1H82A

Structure of polyamine oxidase in complex with guazatine
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h82A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h82A02
3EANA 1DJQA 5U63A 1PBBA 3O0HA 4B64A 3RP6A 5C2TA 2AR8A 1NHSA 4EQSA 3UTFA 1GRHA 2XVFA 3AXBA 2V3BA 3LZWA 3SQPA 5BVAA 3FPZA 1JNZA 1OJ9A 1VQWA 2R4JA 4OPUA 5GRTA 4B67A 4UDRA 1BGNA 4XWZA 1K0JA 3AYJA 4M52A 4TLXA 2QCUA 1L0VA 4PABA 1PJ7A 2AAQA 2GF3A 3SFEA 4YSZA 1F6MA 4U2LA 3GMCA 4PAAA 1W4XA 4U2SA 4U8IA 4Y4NA 4WX1A 1KF6A 2VVLG 4U8LA 1FEBA 4RSLA 4C3YA 3QFAA 1B4VA 2WDQA 1NHQA 5IQ1A 5HXIA 5JCNA 4JY3A 3OC4A 2YM1A 1LVLA 1UKVG 2YVGA 2TMDA 4FX9A 4RG4A 4YSYA 2XLTA 2GR1A 2C76A 2Y6QA 2VRLA 4X9NA 1TYPA 2OAMA 3F8DA 2GAHB 4APNA 1E6EA 3D1CA 3DJEA 4U8JA 1FOHA 1YQ4A 3GSIA 2YLSA 2I0ZA 3K30A 3EPTA 4IA5A 4ECHA 3WE0A 4B65A 4YTPA 2C3DA 2YR6A 4JNQA 3M0OA 4OPDA 3AEDA 2A8XA 3AECA 1CHUA 3ATQA 1D4DA 4Z2UA 3IWAA 4H50A 1IJHA 3UP4A 1Q1RA 1FECA 1S2YA 2EQ8A 2WP5A 4AT2A 2WP9A 4A65A 2X3NA 3UP5A 1H84A 3KLJA 5BRTA 1GERA 2B76A 1PXCA 4Z25A 2OA1A 2YVJA 1GXFA 3FBSA 1CBOA 2B9YA 3REDA 2X50A 1CC2A 2GR3A 1N4UA 2DKHA 3S5WA 3AD8B 2ZZCA 1V59A 1NAAA 5FMHA 2YM2A 4DGKA 2EQ9A 1GESA 1N4VA 1NHPA 4B66A 2Q0LA 4H2RA 4C74A 4Z26A 2YG6A 3BI4A 1PS9A 4YKGA 2GQWA 2WU2A 5C3JA 1CJ4A 3AEEA 1O95A 3CNDA 3PO7A 5EBKA 2JKCA 1DODA 1F8SA 1GALA 3P1WA 2YR5A 3URHA 4ICYA 4CNJA 3NYEA 4ZCCA 4BK2A 2C72A 1ZOVA 4J57A 2GV8A 2WQYA 4P9SA 1DNCA 1QJDA 2E4GA 3IF9A 1CL0A 2X8GA 2XFOA 3BNMA 3CTYA 3CIRA 1YY5A 2J3NA 1JRYA 2C64A 4H4UA 3QSSA 2BYBA 1H86A 3ALJA 3NK0X 1GSNA 1RP0A 2YR4A 5CKUA 3UTHA 4GF7A 3GMBA 3DA1A 2WPFA 3BNUA 4NTEA 3S61A 3RP8A 3NG7X 4K7ZA 4H4RA 5HHFA 4C5OA 1KSUA 1DXLA 1F3PA 1JNRA 1SEZA 1VDCA 3QSEA 5ER0A 2OLOA 4H4VA 3GYIA 3NLCA 4HB9A 1D7YA 4BK3A 2WPEA 1XHCA 3AEGA 1DOEA 3ALMA 3CGCA 3I6DA 3KKJA 4A99A 5KWFA 1EL8A 2WETA 4AT0A 3F8PA 2XVEA 1GPEA 4J56A 2QA2A 3AB1A 5JCKA 3P4QA 3AD7B 3NGCX 1TDEA 1Y56A 3PS9A 1N1PA 1GT8A 3UKAA 1QLBA 4OPCA 2YWLA 4EIPA 1NPXA 3EF6A 3ZDNA 1IUXA 3I3LA 2WBAA 3CGBA 2R0CA 1HYUA 3IHMA 1CC6A 1RSGA 3Q6JA 3UOXA 1E1LA 4U8KA 4N9XA 1IUTA 3PVCA 4GUVA 4H4XA 1E1KA 1GTHA 2EQ6A 3QFBA 4O5QA 3KD9A 3UCLA 1GREA 1D7LA 3BI2A 3LZXA 5KVIA 1TDKA 5BULA 2BCPA 2GRTA 3P4PA 2Q7VA 1Q1WA 1LPFA 1E7PA 1GRFA 2BS4A 3AE3A 4AP3A 2BACA 3M13A 4H4SA 5IPYA 2V3AA 3DGZA 1GETA 3KU9A 1H7XA 3UKFA 1FL2A 2X99A 4A7AA 3B3RA 4CNKA 4FDCB 1S3EA 3SFDA 4JQ9A 2Q6UA 5GSNA 4K5RA 4IV9A 2XVJA 4TLZA 1KNPA 2A89A 1GTEA 1Y56B 1YKJA 3VR9A 1PDHA 2Z5XA 1H82A 4NTCA 4OPIA 1JRXA 3DJGX 2B9XA 5LV9A 3LADA 3P9UA 2WP6A 3CNSA 1CJ2A 2FJBA 1ZMCA 2WOVA 3P4SA 3C4AA 4CBQA 3QVRA 1O5WA 5KXJA 1H7WA 1PBDA 2C66A 4IVMB 4H4ZA 1LTXR 1OJAA 3LB8A 1GRBA 4TM0A 1F8RA 1JOAA 3L8KA 5KRQA 1FCDA 3CGDA 1OJDA 2WU5A 1GOSA 2YLZA 3AEBA 1BGJA 5DBJA 4O5UA 1LQTA 2E5VA 4DSGA 1NENA 1M64A 4C3XA 2R0PA 1AOGA 2Z5YA 3GRSA 4B68A 3BHKA 1P2EA 4TM1A 4YTMA 3CNPA 3GDPA 3NRNA 4J31A 1PHHA 1E1NA 3B6DA 3H8IA 1IUWA 3E1TA 1PJ6A 3P4RA 4OPLA 3UTEA 2ARDA 3F8RA 2WDVA 3UTGA 3UKQA 4EIQA 3LOVA 4Y4MA 4ZN0A 4K5SA 3V3NA 1P2HA 3UKHA 4EMIA 4GDEA 4CY6A 5U25A 1DOBA 3Q9TA 1TRBA 4NEVA 2XFQA 2DKIA 2EQ7A 3M12A 3K7TA 2V60A 2H88A 4H2NA 2X8HA 3ALLA 4LIIA 2VOUA 1ELIA 3H4KA 4Y4LA 1L9CA 2A87A 5HYMA 4X4JA 5M0ZA 2XLUA 2V6OA 1L9DA 4BK1A 4IA6A 3HZLA 4K8DA 4NEWA 2XVHA 2BS3A 4OPTA 5EB4A 1YQ3A 4B69A 4OPGA 2BK3A 2WOIA 4H7UA 3ISHA 4U8MA 2JBVA 4XWRA 3KPFA 3NK2X 1KFYA 4JY2A 2VVLA 4A79A 3CGEA 2UZZA 2YG7A 1B8SA 3GWDA 4OVIA 2FJDA 3COXA 2GAGB 5BUKA 1FEAA 4UDQA 2OALA 2WOWA 2GR2A 3UKKA 3VRDB 3VR8A 2NPXA 4J36A 2WESA 1VRQB 4K22A 3UKPA 1OJTA 3H8LA 1D4CA 4Z43A 1CF3A 2QAEA 4BJZA 3LJPA 2WHDA 2AQJA 3NN0X 2PYXA 4YTNA 2B9WA 2FJEA 5TR3A 4TM4A 1E1MA 1LJ1A 2YLTA 4NZHA 4YKFA 1CJ3A 3EAOA 2GEWA 2YLXA 2RGOA 4U8PA 2CVJA 4KPRA 2YG3A 3G5QA 1JU2A 4H4QA 1XANA 1E39A 3GYJA 1Q9IA 2XFPA 3DK4A 4RG3A 3QVPA 2XFNA 1NEKA 3ICTA 4C77A 3NN6X 2C75A 1PBFA 3AYLA 1EL7A 3ADAB 2WEUA 3CNJA 3AEAA 5J60A 3C4NA 4GR1A 2H89A 4REKA 1B5QA 2IIDA 3AEFA 1ZKQA 3L1RA 4YWOA 1H81A 2BC1A 2Y6RA 4I58A 2BS2A 1ZK7A 1ZMDA 4HA6A 3RNMA 5FS7A 3NH3X 5IQ4A 4B1BA 1EL9A 4B63A 4NTDA 4Z24A 4CCQA 2BK4A 1KSSA 4FK1C 3NTDA 4JNAA 4I59A 2C7GA 3CNTA 2C67A 2V61A 4H4TA 4IVOB 2XLSA 3UKLA 3UOVA 4EM3A 1PJ5A 1F8WA 4USQA 3ZYXA 3NKSA 2PHHA 3T37A 3IHGA 2IVDA 3AE1A 4AOXA 3GDNA 3QSMA 5JCMA 1CC4A 5JCIA 3KA7A 5CQFA 2ZZBA 4YSXA 2TPRA 2APGA 3AE2A 1BKWA 1YQZA 3BHFA 4EQWA 1BZLA 3AE5A 2IVEA 2GVCA 2VRMA 2FJAA 4H2QA 4BJYA 3AE9A 2E1MA 1BWCA 2JB1A 1Y0PA 2OLNA 2Q0KA 1GRAA 1TDNA 4GCMA 2ACZA 4ZCDA 1L9EA 2NVKX 1TDOA 3IC9A 3AD9B 1H83A 4H2PA 1GEUA 2YQUA 3FG2P 4A6NA 5EB5A 2CULA 4EM4A 1PBCA 1DJNA 1LQUA 2GMHA 1GV4A 3C96A 3CN8A 3CPIG 1X31B 3SGLA 1JEHA 1K4QA 2B7SA 3II4A 4BURA 4XXGA 5L46A 3UOYA 4YSHA 3VRAA 1GRTA 4USRA 2WDRA 3NYCA 3FMWA 1MXTA 2YVFA 4YXDA 2R9ZA 3OZ2A 4OCGA 3LXDA 1K0LA 1REOA 4AOSA 4A5LA 3NTAA 5KOXA 3NT6A 3NHOX 4GDPA 1K0IA 4H4PA 1XPQA 3R9UA 4D03A 3DGHA 1B37A 2VVMA 3KVEA 4U8NA 3DH9A 1COYA 2ZZ0A 1O94A 4DSHA 3VRBA 4BV6A 3NYFA 1NDAA 4LA1A 4A6NB 2XLPA 4ADWA 2CFYA 2GR0A 3JSKA 1MOKA 4WCTA 1NG3A 4Z44A 3V3OA 2JB3A 2W0HA 4JDRA 3G5RA 1PN0A 4U2TA 2FBWA 5KVHA 1PXBA 1JRZA 3NK1X 3RP7A 1DOCA 5HY5A 5JCLA 5M10A 2C70A 2XLRA 1ZP0A 4U8OA 1TYTA 4EMJA 2BXSA 2VQBA 1EL5A 2GQFA 3BI5A 3V76A 4Z2TA 2GB0A 4H4WA 2XCGA 2RGHA 1D5TA 3K7MX 3AE6A 4JN9A 4Z2RA 3AE8A 3GRTA 5KOWA 1TDFA 3AYIA 3ITJA 1XDIA 2WS3A 1Z6LA 3AE7A 2JK6A 3DJJA 5J7XA 2C3CA 1BF3A 3DJDA 2YG5A 1VG0A 2XDOA 4GRTA 3ICSA 4CRTA 4EQXA 1S2QA 1LV0A 2O9ZA 4AP1A 2R46A 3DMEA 4K2XA 4TM3A 4X9MA 1QO8A 5FS9A 4CCRA 1MO9A 1PBEA 1IUUA 3SM8A 4E0VA 2XFUA 3FIMB 3VQRA 4EQRA 2YLRA 2X8CA 1KDGA 2CDUA 2BC0A 1EBDA 3GD3A 2VZ2A 3GD4A 1OJCA 2BCGG 2YLWA 3G5SA 5FS8A 5EOWA 2B7RA 3ABVA 3NIXA 4LU6A 1N4WA 3AE4A 2F5ZA 1KNRA 1NG4A 4EMWA 2C73A 2R4EA 2VQ7A 3QJ4A 2GMJA 3CPJG 2JAEA 4H4YA 4MJWA 1ZDLA 4DNAA 3RHAA 1ONFA 3GWFA 3ICRA 3UOZA 1M6IA 1ZOYA 2BA9A 2BABA 2QA1A 2RABA 5FS6A 2WPCA 3CPHG 2V5ZA 1CJCA 2YAUA 1IUVA 2ZBWA 4UDPA 2BK5A 1VG9A 1IUSA 2XVIA 4J33A 1ZY8A 1NHRA 2YG4A 4YT0A 4J2WA 2HQMA 2R0GA 2XYOA 4A9WA 4UP3A 1GRGA 1H6VA 1RYIA 2JB2A 3ATRA 3AWIA 1GNDA 1PXAA 1ZX9A 1D4EA 3D8XA 3DK9A 2RGJA 3DK8A 4CY8A 2BXRA 2GH5A 2R45A 3K7QX 4D04A 4FK1A 3NNEA 2C65A 4J34A 5U1OA 1S3BA 4KX6A
chains in the Genus database with same CATH superfamily
3EANA 1DJQA 5U63A 1PBBA 3O0HA 4B64A 3RP6A 5C2TA 2AR8A 1NHSA 4EQSA 3UTFA 1GRHA 2XVFA 3AXBA 2V3BA 3LZWA 3SQPA 5BVAA 3FPZA 1JNZA 1OJ9A 1VQWA 2R4JA 4OPUA 5GRTA 4B67A 4UDRA 1BGNA 4XWZA 1K0JA 3AYJA 4M52A 4TLXA 2QCUA 1L0VA 4PABA 1PJ7A 2AAQA 2GF3A 3SFEA 4YSZA 1F6MA 4U2LA 3GMCA 4PAAA 1W4XA 4U2SA 4U8IA 4Y4NA 4WX1A 1KF6A 2VVLG 4U8LA 1FEBA 4RSLA 4C3YA 3QFAA 1B4VA 2WDQA 1NHQA 5IQ1A 5HXIA 5JCNA 4JY3A 3OC4A 2YM1A 1LVLA 1UKVG 2YVGA 4II3A 2TMDA 4FX9A 4RG4A 4YSYA 2XLTA 2GR1A 2C76A 2Y6QA 4NNJA 2VRLA 4X9NA 1TYPA 2OAMA 3F8DA 2GAHB 4APNA 1E6EA 3D1CA 3DJEA 4U8JA 1FOHA 1YQ4A 3GSIA 3SXIA 2YLSA 2I0ZA 3K30A 3EPTA 4IA5A 4ECHA 3WE0A 4B65A 4YTPA 2C3DA 2YR6A 4JNQA 3M0OA 4OPDA 3AEDA 2A8XA 3AECA 1CHUA 3ATQA 1D4DA 3T2ZA 3IWAA 4H50A 4Z2UA 1IJHA 3UP4A 1Q1RA 1FECA 1S2YA 2EQ8A 2WP5A 4AT2A 2WP9A 4A65A 2X3NA 3UP5A 1H84A 3KLJA 5BRTA 1GERA 2B76A 1PXCA 4Z25A 2OA1A 3HYVA 2YVJA 1GXFA 3FBSA 1CBOA 2B9YA 4GAPA 3REDA 2X50A 1CC2A 2GR3A 1N4UA 2DKHA 3S5WA 3AD8B 2ZZCA 1V59A 1NAAA 5FMHA 2YM2A 4DGKA 2EQ9A 1GESA 1N4VA 1NHPA 4B66A 2Q0LA 4H2RA 4C74A 4Z26A 2YG6A 3BI4A 1PS9A 4YKGA 2GQWA 2WU2A 5C3JA 2BRYA 1CJ4A 3AEEA 1O95A 3CNDA 3PO7A 5EBKA 2JKCA 1DODA 1F8SA 1GALA 3P1WA 2YR5A 3URHA 4ICYA 4CNJA 3T0KA 3NYEA 4ZCCA 4BK2A 2C72A 1ZOVA 4J57A 2GV8A 2WQYA 4P9SA 1DNCA 1QJDA 2E4GA 3IF9A 1CL0A 2X8GA 2XFOA 3BNMA 3CTYA 3CIRA 1YY5A 2J3NA 1JRYA 2C64A 4H4UA 3QSSA 2BYBA 1H86A 3ALJA 3NK0X 1GSNA 1RP0A 2YR4A 5CKUA 3UTHA 4GF7A 3GMBA 3DA1A 2WPFA 3BNUA 4NTEA 3S61A 3RP8A 3NG7X 4K7ZA 4H4RA 5HHFA 4C5OA 3T14A 1KSUA 3HYWA 1DXLA 1F3PA 1JNRA 1SEZA 1VDCA 3QSEA 5ER0A 2OLOA 4H4VA 3GYIA 3NLCA 4HB9A 1D7YA 4BK3A 2WPEA 1XHCA 3AEGA 1DOEA 3ALMA 3CGCA 3I6DA 3KKJA 4A99A 5KWFA 1EL8A 2WETA 4AT0A 3F8PA 2XVEA 1GPEA 4J56A 2QA2A 3AB1A 5JCKA 3P4QA 3AD7B 3NGCX 1TDEA 1Y56A 3PS9A 1N1PA 1GT8A 3UKAA 1QLBA 4OPCA 2YWLA 4EIPA 1NPXA 3EF6A 3ZDNA 1IUXA 3I3LA 2WBAA 3CGBA 2R0CA 1HYUA 3IHMA 1CC6A 1RSGA 3Q6JA 3UOXA 1E1LA 3SZFA 4U8KA 4N9XA 1IUTA 3PVCA 3SZWA 4GUVA 4H4XA 1E1KA 1GTHA 2EQ6A 3QFBA 4O5QA 3KD9A 3UCLA 1GREA 1D7LA 3BI2A 3LZXA 5KVIA 1TDKA 5BULA 2BCPA 2GRTA 3P4PA 2Q7VA 1Q1WA 1LPFA 1E7PA 1GRFA 2BS4A 3AE3A 4AP3A 2BACA 3M13A 4H4SA 5IPYA 2V3AA 3DGZA 1GETA 3KU9A 1H7XA 3UKFA 1FL2A 2X99A 4A7AA 3B3RA 4CNKA 4FDCB 1S3EA 3SFDA 4JQ9A 5KMSA 2Q6UA 5GSNA 4K5RA 4IV9A 2XVJA 4TLZA 1KNPA 2A89A 1GTEA 1Y56B 1YKJA 3VR9A 1PDHA 2Z5XA 1H82A 4NTCA 4OPIA 1JRXA 3DJGX 2B9XA 5LV9A 3LADA 3P9UA 2WP6A 3CNSA 1CJ2A 2FJBA 1ZMCA 2WOVA 3P4SA 3C4AA 4CBQA 3QVRA 1O5WA 5KXJA 1H7WA 1PBDA 2C66A 4IVMB 4H4ZA 1LTXR 1OJAA 3LB8A 1GRBA 4TM0A 1F8RA 1JOAA 3L8KA 5KRQA 1FCDA 3CGDA 1OJDA 2WU5A 1GOSA 2YLZA 3AEBA 1BGJA 5DBJA 4O5UA 1LQTA 2E5VA 4DSGA 1NENA 1M64A 4C3XA 2R0PA 1AOGA 2Z5YA 3GRSA 4B68A 3BHKA 1P2EA 4TM1A 4YTMA 3CNPA 3GDPA 3NRNA 4J31A 1PHHA 1E1NA 3B6DA 3H8IA 1IUWA 3E1TA 1PJ6A 3P4RA 4OPLA 4G74A 3UTEA 2ARDA 3F8RA 2WDVA 3UTGA 3UKQA 4EIQA 3LOVA 4Y4MA 4ZN0A 4K5SA 3V3NA 1P2HA 3UKHA 4EMIA 4GDEA 4CY6A 5U25A 1DOBA 3Q9TA 3SX6A 1TRBA 4NEVA 2XFQA 2DKIA 2EQ7A 3M12A 3K7TA 2V60A 3T2YA 2H88A 4H2NA 2X8HA 3ALLA 4LIIA 2VOUA 1ELIA 3H4KA 4Y4LA 1L9CA 2A87A 5HYMA 4X4JA 5M0ZA 2XLUA 2V6OA 1L9DA 4BK1A 4IA6A 5KNLA 3HZLA 4K8DA 4NEWA 2XVHA 2BS3A 4OPTA 5EB4A 1YQ3A 4B69A 4OPGA 2BK3A 2WOIA 4H7UA 3ISHA 4U8MA 2JBVA 4XWRA 3KPFA 3NK2X 1KFYA 4JY2A 2VVLA 3T31A 4A79A 3CGEA 2UZZA 2YG7A 1B8SA 3GWDA 4OVIA 2FJDA 3COXA 2GAGB 5BUKA 1FEAA 4UDQA 2OALA 2WOWA 2GR2A 3UKKA 3VRDB 3VR8A 2NPXA 4J36A 2WESA 1VRQB 4K22A 3UKPA 1OJTA 3H8LA 1D4CA 4Z43A 1CF3A 2QAEA 4BJZA 3LJPA 2WHDA 2AQJA 3NN0X 2PYXA 4YTNA 2B9WA 2FJEA 5TR3A 4TM4A 1E1MA 1LJ1A 3SYIA 2YLTA 4NZHA 4YKFA 3GYXA 1CJ3A 3EAOA 2GEWA 3SY4A 2YLXA 2RGOA 4U8PA 2CVJA 4KPRA 2YG3A 3G5QA 1JU2A 4H4QA 1XANA 1E39A 3GYJA 1Q9IA 2XFPA 3DK4A 4RG3A 3QVPA 2XFNA 1NEKA 3ICTA 4C77A 3NN6X 2C75A 1PBFA 3AYLA 1EL7A 3ADAB 2WEUA 3CNJA 3AEAA 5J60A 3C4NA 4GR1A 2H89A 4REKA 1B5QA 2IIDA 3AEFA 1ZKQA 3L1RA 4YWOA 1H81A 2BC1A 2Y6RA 4I58A 2BS2A 1ZK7A 1ZMDA 4HA6A 3RNMA 5FS7A 3NH3X 5IQ4A 4B1BA 1EL9A 4B63A 4NTDA 4Z24A 2C4CA 5KMRA 4CCQA 2BK4A 1KSSA 4FK1C 3NTDA 4JNAA 4I59A 3T2KA 2C7GA 3CNTA 2C67A 2V61A 4H4TA 4G9KA 2XLSA 4IVOB 3UKLA 3UOVA 4EM3A 1PJ5A 1F8WA 4USQA 3ZYXA 3NKSA 3KPKA 2PHHA 3T37A 3IHGA 2IVDA 3AE1A 4II2A 3GDNA 4AOXA 3QSMA 5JCMA 1CC4A 4G6HA 5JCIA 3KA7A 5CQFA 2ZZBA 4YSXA 2TPRA 2APGA 3AE2A 1BKWA 1YQZA 3BHFA 4EQWA 1BZLA 3AE5A 2IVEA 2GVCA 2VRMA 2FJAA 4H2QA 4BJYA 3AE9A 2E1MA 1BWCA 2JB1A 1Y0PA 2OLNA 2Q0KA 1GRAA 1TDNA 4GCMA 2ACZA 4ZCDA 1L9EA 2NVKX 1TDOA 3IC9A 3SZ0A 3AD9B 1H83A 4H2PA 1GEUA 2YQUA 3FG2P 3SZCA 4A6NA 5EB5A 2CULA 4EM4A 1PBCA 1DJNA 1LQUA 2GMHA 1GV4A 3C96A 3CN8A 3CPIG 1X31B 3SGLA 1JEHA 1K4QA 2B7SA 3II4A 4BURA 4XXGA 5L46A 3UOYA 4YSHA 3VRAA 1GRTA 4USRA 2WDRA 3NYCA 3FMWA 1MXTA 2YVFA 4YXDA 2R9ZA 3OZ2A 4OCGA 3LXDA 1K0LA 1REOA 2BRAA 4AOSA 4A5LA 3NTAA 3HYXA 5KOXA 3NT6A 3NHOX 4GDPA 1K0IA 4H4PA 1XPQA 3R9UA 4D03A 3DGHA 1B37A 2VVMA 3KVEA 4U8NA 4GAVA 3DH9A 1COYA 2ZZ0A 1O94A 4DSHA 3VRBA 4BV6A 3NYFA 1NDAA 4LA1A 4A6NB 2XLPA 4ADWA 2CFYA 2GR0A 3JSKA 1MOKA 4WCTA 1NG3A 4G6GA 4Z44A 3V3OA 2JB3A 2W0HA 4JDRA 3G5RA 1PN0A 4U2TA 2FBWA 5KVHA 1PXBA 1JRZA 3NK1X 3RP7A 1DOCA 5HY5A 5JCLA 5M10A 2C70A 2XLRA 1ZP0A 4U8OA 1TYTA 4EMJA 2BXSA 2VQBA 1EL5A 2GQFA 3BI5A 3V76A 4Z2TA 2GB0A 4H4WA 2XCGA 2RGHA 1D5TA 3K7MX 3AE6A 4JN9A 4Z2RA 3AE8A 3GRTA 5KOWA 1TDFA 3AYIA 3ITJA 1XDIA 2WS3A 1Z6LA 3AE7A 2JK6A 3DJJA 5J7XA 2C3CA 1BF3A 3DJDA 2YG5A 1VG0A 2XDOA 4GRTA 3ICSA 4CRTA 4EQXA 3CMMA 1S2QA 4G73A 1LV0A 2O9ZA 4AP1A 2R46A 3DMEA 4K2XA 4TM3A 4X9MA 1QO8A 5FS9A 4CCRA 1MO9A 1PBEA 1IUUA 3SM8A 4E0VA 2XFUA 3FIMB 3VQRA 4EQRA 2YLRA 2X8CA 1KDGA 2CDUA 2BC0A 1EBDA 3GD3A 2VZ2A 3GD4A 5KMQA 1OJCA 2BCGG 2YLWA 3G5SA 5FS8A 5EOWA 2B7RA 3ABVA 3NIXA 4LU6A 1N4WA 3AE4A 4NWZA 2F5ZA 1KNRA 1NG4A 4EMWA 2C73A 2R4EA 2VQ7A 3QJ4A 2GMJA 3CPJG 2JAEA 4H4YA 4MJWA 1ZDLA 4DNAA 3RHAA 1ONFA 3GWFA 3ICRA 3UOZA 1M6IA 1ZOYA 2BA9A 2BABA 2QA1A 2RABA 5FS6A 2WPCA 3CPHG 2V5ZA 1CJCA 2YAUA 1IUVA 2ZBWA 4UDPA 2BK5A 1VG9A 1IUSA 2XVIA 4J33A 1ZY8A 1NHRA 2YG4A 4YT0A 4J2WA 2HQMA 2R0GA 2XYOA 4A9WA 4UP3A 1GRGA 1H6VA 1RYIA 2JB2A 3ATRA 3AWIA 1GNDA 1PXAA 1ZX9A 1D4EA 3D8XA 3DK9A 5KMPA 2RGJA 3DK8A 4CY8A 2BXRA 2GH5A 2R45A 3K7QX 4D04A 4FK1A 3NNEA 2C65A 4J34A 5U1OA 1S3BA 4KX6A
chains in the Genus database with same CATH topology
3EANA 1DJQA 5U63A 1PBBA 3O0HA 4B64A 3RP6A 5C2TA 2AR8A 1NHSA 4EQSA 3UTFA 1GRHA 2XVFA 3AXBA 2V3BA 3LZWA 3SQPA 5BVAA 3FPZA 1JNZA 1OJ9A 1VQWA 2R4JA 4OPUA 5GRTA 4B67A 4UDRA 1BGNA 4XWZA 1K0JA 3AYJA 4M52A 4TLXA 2QCUA 1L0VA 4PABA 1PJ7A 2AAQA 2GF3A 3SFEA 4YSZA 1F6MA 4U2LA 3GMCA 4PAAA 1W4XA 4U2SA 4U8IA 4Y4NA 4WX1A 1KF6A 2VVLG 4U8LA 1FEBA 4RSLA 4C3YA 3QFAA 1B4VA 2WDQA 1NHQA 5IQ1A 5HXIA 5JCNA 4JY3A 3OC4A 2YM1A 1LVLA 1UKVG 2YVGA 4II3A 2TMDA 4FX9A 4RG4A 4YSYA 2XLTA 2GR1A 2C76A 2Y6QA 4NNJA 2VRLA 4X9NA 1TYPA 2OAMA 3F8DA 2GAHB 4APNA 1E6EA 3D1CA 3DJEA 4U8JA 1FOHA 1YQ4A 3GSIA 3SXIA 2YLSA 2I0ZA 3K30A 3EPTA 4IA5A 4ECHA 3WE0A 4B65A 4YTPA 2C3DA 2YR6A 4JNQA 3M0OA 4OPDA 3AEDA 2A8XA 3AECA 1CHUA 3ATQA 1D4DA 3T2ZA 3IWAA 4H50A 4Z2UA 1IJHA 3UP4A 1Q1RA 1FECA 1S2YA 2EQ8A 2WP5A 4AT2A 2WP9A 4A65A 2X3NA 3UP5A 1H84A 3KLJA 5BRTA 1GERA 2B76A 1PXCA 4Z25A 2OA1A 3HYVA 2YVJA 1GXFA 3FBSA 1CBOA 2B9YA 4GAPA 3REDA 2X50A 1CC2A 2GR3A 1N4UA 2DKHA 3S5WA 3AD8B 2ZZCA 1V59A 1NAAA 5FMHA 2YM2A 4DGKA 2EQ9A 1GESA 1N4VA 1NHPA 4B66A 2Q0LA 4H2RA 4C74A 4Z26A 2YG6A 3BI4A 1PS9A 4YKGA 2GQWA 2WU2A 5C3JA 2BRYA 1CJ4A 3AEEA 1O95A 3CNDA 3PO7A 5EBKA 2JKCA 1DODA 1F8SA 1GALA 3P1WA 2YR5A 3URHA 4ICYA 4CNJA 3T0KA 3NYEA 4ZCCA 4BK2A 2C72A 1ZOVA 4J57A 2GV8A 2WQYA 4P9SA 1DNCA 1QJDA 2E4GA 3IF9A 1CL0A 2X8GA 2XFOA 3BNMA 3CTYA 3CIRA 1YY5A 2J3NA 1JRYA 2C64A 4H4UA 3QSSA 2BYBA 1H86A 3ALJA 3NK0X 1GSNA 1RP0A 2YR4A 5CKUA 3UTHA 4GF7A 3GMBA 3DA1A 2WPFA 3BNUA 4NTEA 3S61A 3RP8A 3NG7X 4K7ZA 4H4RA 5HHFA 4C5OA 3T14A 1KSUA 3HYWA 1DXLA 1F3PA 1JNRA 1SEZA 1VDCA 3QSEA 5ER0A 2OLOA 4H4VA 3GYIA 3NLCA 4HB9A 1D7YA 4BK3A 2WPEA 1XHCA 3AEGA 1DOEA 3ALMA 3CGCA 3I6DA 3KKJA 4A99A 5KWFA 1EL8A 2WETA 4AT0A 3F8PA 2XVEA 1GPEA 4J56A 2QA2A 3AB1A 5JCKA 3P4QA 3AD7B 3NGCX 1TDEA 1Y56A 3PS9A 1N1PA 1GT8A 3UKAA 1QLBA 4OPCA 2YWLA 4EIPA 1NPXA 3EF6A 3ZDNA 1IUXA 3I3LA 2WBAA 3CGBA 2R0CA 1HYUA 3IHMA 1CC6A 1RSGA 3Q6JA 3UOXA 1E1LA 3SZFA 4U8KA 4N9XA 1IUTA 3PVCA 3SZWA 4GUVA 4H4XA 1E1KA 1GTHA 2EQ6A 3QFBA 4O5QA 3KD9A 3UCLA 1GREA 1D7LA 3BI2A 3LZXA 5KVIA 1TDKA 5BULA 2BCPA 2GRTA 3P4PA 2Q7VA 1Q1WA 1LPFA 1E7PA 1GRFA 2BS4A 3AE3A 4AP3A 2BACA 3M13A 4H4SA 5IPYA 2V3AA 3DGZA 1GETA 3KU9A 1H7XA 3UKFA 1FL2A 2X99A 4A7AA 3B3RA 4CNKA 4FDCB 1S3EA 3SFDA 4JQ9A 5KMSA 2Q6UA 5GSNA 4K5RA 4IV9A 2XVJA 4TLZA 1KNPA 2A89A 1GTEA 1Y56B 1YKJA 3VR9A 1PDHA 2Z5XA 1H82A 4NTCA 4OPIA 1JRXA 3DJGX 2B9XA 5LV9A 3LADA 3P9UA 2WP6A 3CNSA 1CJ2A 2FJBA 1ZMCA 2WOVA 3P4SA 3C4AA 4CBQA 3QVRA 1O5WA 5KXJA 1H7WA 1PBDA 2C66A 4IVMB 4H4ZA 1LTXR 1OJAA 3LB8A 1GRBA 4TM0A 1F8RA 1JOAA 3L8KA 5KRQA 1FCDA 3CGDA 1OJDA 2WU5A 1GOSA 2YLZA 3AEBA 1BGJA 5DBJA 4O5UA 1LQTA 2E5VA 4DSGA 1NENA 1M64A 4C3XA 2R0PA 1AOGA 2Z5YA 3GRSA 4B68A 3BHKA 1P2EA 4TM1A 4YTMA 3CNPA 3GDPA 3NRNA 4J31A 1PHHA 1E1NA 3B6DA 3H8IA 1IUWA 3E1TA 1PJ6A 3P4RA 4OPLA 4G74A 3UTEA 2ARDA 3F8RA 2WDVA 3UTGA 3UKQA 4EIQA 3LOVA 4Y4MA 4ZN0A 4K5SA 3V3NA 1P2HA 3UKHA 4EMIA 4GDEA 4CY6A 5U25A 1DOBA 3Q9TA 3SX6A 1TRBA 4NEVA 2XFQA 2DKIA 2EQ7A 3M12A 3K7TA 2V60A 3T2YA 2H88A 4H2NA 2X8HA 3ALLA 4LIIA 2VOUA 1ELIA 3H4KA 4Y4LA 1L9CA 2A87A 5HYMA 4X4JA 5M0ZA 2XLUA 2V6OA 1L9DA 4BK1A 4IA6A 5KNLA 3HZLA 4K8DA 4NEWA 2XVHA 2BS3A 4OPTA 5EB4A 1YQ3A 4B69A 4OPGA 2BK3A 2WOIA 4H7UA 3ISHA 4U8MA 2JBVA 4XWRA 3KPFA 3NK2X 1KFYA 4JY2A 2VVLA 3T31A 4A79A 3CGEA 2UZZA 2YG7A 1B8SA 3GWDA 4OVIA 2FJDA 3COXA 2GAGB 5BUKA 1FEAA 4UDQA 2OALA 2WOWA 2GR2A 3UKKA 3VRDB 3VR8A 2NPXA 4J36A 2WESA 1VRQB 4K22A 3UKPA 1OJTA 3H8LA 1D4CA 4Z43A 1CF3A 2QAEA 4BJZA 3LJPA 2WHDA 2AQJA 3NN0X 2PYXA 4YTNA 2B9WA 2FJEA 5TR3A 4TM4A 1E1MA 1LJ1A 3SYIA 2YLTA 4NZHA 4YKFA 3GYXA 1CJ3A 3EAOA 2GEWA 3SY4A 2YLXA 2RGOA 4U8PA 2CVJA 4KPRA 2YG3A 3G5QA 1JU2A 4H4QA 1XANA 1E39A 3GYJA 1Q9IA 2XFPA 3DK4A 4RG3A 3QVPA 2XFNA 1NEKA 3ICTA 4C77A 3NN6X 2C75A 1PBFA 3AYLA 1EL7A 3ADAB 2WEUA 3CNJA 3AEAA 5J60A 3C4NA 4GR1A 2H89A 4REKA 1B5QA 2IIDA 3AEFA 1ZKQA 3L1RA 4YWOA 1H81A 2BC1A 2Y6RA 4I58A 2BS2A 1ZK7A 1ZMDA 4HA6A 3RNMA 5FS7A 3NH3X 5IQ4A 4B1BA 1EL9A 4B63A 4NTDA 4Z24A 2C4CA 5KMRA 4CCQA 2BK4A 1KSSA 4FK1C 3NTDA 4JNAA 4I59A 3T2KA 2C7GA 3CNTA 2C67A 2V61A 4H4TA 4G9KA 2XLSA 4IVOB 3UKLA 3UOVA 4EM3A 1PJ5A 1F8WA 4USQA 3ZYXA 3NKSA 3KPKA 2PHHA 3T37A 3IHGA 2IVDA 3AE1A 4II2A 3GDNA 4AOXA 3QSMA 5JCMA 1CC4A 4G6HA 5JCIA 3KA7A 5CQFA 2ZZBA 4YSXA 2TPRA 2APGA 3AE2A 1BKWA 1YQZA 3BHFA 4EQWA 1BZLA 3AE5A 2IVEA 2GVCA 2VRMA 2FJAA 4H2QA 4BJYA 3AE9A 2E1MA 1BWCA 2JB1A 1Y0PA 2OLNA 2Q0KA 1GRAA 1TDNA 4GCMA 2ACZA 4ZCDA 1L9EA 2NVKX 1TDOA 3IC9A 3SZ0A 3AD9B 1H83A 4H2PA 1GEUA 2YQUA 3FG2P 3SZCA 4A6NA 5EB5A 2CULA 4EM4A 1PBCA 1DJNA 1LQUA 2GMHA 1GV4A 3C96A 3CN8A 3CPIG 1X31B 3SGLA 1JEHA 1K4QA 2B7SA 3II4A 4BURA 4XXGA 5L46A 3UOYA 4YSHA 3VRAA 1GRTA 4USRA 2WDRA 3NYCA 3FMWA 1MXTA 2YVFA 4YXDA 2R9ZA 3OZ2A 4OCGA 3LXDA 1K0LA 1REOA 2BRAA 4AOSA 4A5LA 3NTAA 3HYXA 5KOXA 3NT6A 3NHOX 4GDPA 1K0IA 4H4PA 1XPQA 3R9UA 4D03A 3DGHA 1B37A 2VVMA 3KVEA 4U8NA 4GAVA 3DH9A 1COYA 2ZZ0A 1O94A 4DSHA 3VRBA 4BV6A 3NYFA 1NDAA 4LA1A 4A6NB 2XLPA 4ADWA 2CFYA 2GR0A 3JSKA 1MOKA 4WCTA 1NG3A 4G6GA 4Z44A 3V3OA 2JB3A 2W0HA 4JDRA 3G5RA 1PN0A 4U2TA 2FBWA 5KVHA 1PXBA 1JRZA 3NK1X 3RP7A 1DOCA 5HY5A 5JCLA 5M10A 2C70A 2XLRA 1ZP0A 4U8OA 1TYTA 4EMJA 2BXSA 2VQBA 1EL5A 2GQFA 3BI5A 3V76A 4Z2TA 2GB0A 4H4WA 2XCGA 2RGHA 1D5TA 3K7MX 3AE6A 4JN9A 4Z2RA 3AE8A 3GRTA 5KOWA 1TDFA 3AYIA 3ITJA 1XDIA 2WS3A 1Z6LA 3AE7A 2JK6A 3DJJA 5J7XA 2C3CA 1BF3A 3DJDA 2YG5A 1VG0A 2XDOA 4GRTA 3ICSA 4CRTA 4EQXA 3CMMA 1S2QA 4G73A 1LV0A 2O9ZA 4AP1A 2R46A 3DMEA 4K2XA 4TM3A 4X9MA 1QO8A 5FS9A 4CCRA 1MO9A 1PBEA 1IUUA 3SM8A 4E0VA 2XFUA 3FIMB 3VQRA 4EQRA 2YLRA 2X8CA 1KDGA 2CDUA 2BC0A 1EBDA 3GD3A 2VZ2A 3GD4A 5KMQA 1OJCA 2BCGG 2YLWA 3G5SA 5FS8A 5EOWA 2B7RA 3ABVA 3NIXA 4LU6A 1N4WA 3AE4A 4NWZA 2F5ZA 1KNRA 1NG4A 4EMWA 2C73A 2R4EA 2VQ7A 3QJ4A 2GMJA 3CPJG 2JAEA 4H4YA 4MJWA 1ZDLA 4DNAA 3RHAA 1ONFA 3GWFA 3ICRA 3UOZA 1M6IA 1ZOYA 2BA9A 2BABA 2QA1A 2RABA 5FS6A 2WPCA 3CPHG 2V5ZA 1CJCA 2YAUA 1IUVA 2ZBWA 4UDPA 2BK5A 1VG9A 1IUSA 2XVIA 4J33A 1ZY8A 1NHRA 2YG4A 4YT0A 4J2WA 2HQMA 2R0GA 2XYOA 4A9WA 4UP3A 1GRGA 1H6VA 1RYIA 2JB2A 3ATRA 3AWIA 1GNDA 1PXAA 1ZX9A 1D4EA 3D8XA 3DK9A 5KMPA 2RGJA 3DK8A 4CY8A 2BXRA 2GH5A 2R45A 3K7QX 4D04A 4FK1A 3NNEA 2C65A 4J34A 5U1OA 1S3BA 4KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAN A;  1DJQ A;  5U63 A;  1PBB A;  3O0H A;  4B64 A;  3RP6 A;  5C2T A;  2AR8 A;  1NHS A;  4EQS A;  3UTF A;  1GRH A;  2XVF A;  3AXB A;  2V3B A;  3LZW A;  3SQP A;  5BVA A;  3FPZ A;  1JNZ A;  1OJ9 A;  1VQW A;  2R4J A;  4OPU A;  5GRT A;  4B67 A;  4UDR A;  1BGN A;  4XWZ A;  1K0J A;  3AYJ A;  4M52 A;  4TLX A;  2QCU A;  1L0V A;  4PAB A;  1PJ7 A;  2AAQ A;  2GF3 A;  3SFE A;  4YSZ A;  1F6M A;  4U2L A;  3GMC A;  4PAA A;  1W4X A;  4U2S A;  4U8I A;  4Y4N A;  4WX1 A;  1KF6 A;  2VVL G;  4U8L A;  1FEB A;  4RSL A;  4C3Y A;  3QFA A;  1B4V A;  2WDQ A;  1NHQ A;  5IQ1 A;  5HXI A;  5JCN A;  4JY3 A;  3OC4 A;  2YM1 A;  1LVL A;  1UKV G;  2YVG A;  2TMD A;  4FX9 A;  4RG4 A;  4YSY A;  2XLT A;  2GR1 A;  2C76 A;  2Y6Q A;  2VRL A;  4X9N A;  1TYP A;  2OAM A;  3F8D A;  2GAH B;  4APN A;  1E6E A;  3D1C A;  3DJE A;  4U8J A;  1FOH A;  1YQ4 A;  3GSI A;  2YLS A;  2I0Z A;  3K30 A;  3EPT A;  4IA5 A;  4ECH A;  3WE0 A;  4B65 A;  4YTP A;  2C3D A;  2YR6 A;  4JNQ A;  3M0O A;  4OPD A;  3AED A;  2A8X A;  3AEC A;  1CHU A;  3ATQ A;  1D4D A;  4Z2U A;  3IWA A;  4H50 A;  1IJH A;  3UP4 A;  1Q1R A;  1FEC A;  1S2Y A;  2EQ8 A;  2WP5 A;  4AT2 A;  2WP9 A;  4A65 A;  2X3N A;  3UP5 A;  1H84 A;  3KLJ A;  5BRT A;  1GER A;  2B76 A;  1PXC A;  4Z25 A;  2OA1 A;  2YVJ A;  1GXF A;  3FBS A;  1CBO A;  2B9Y A;  3RED A;  2X50 A;  1CC2 A;  2GR3 A;  1N4U A;  2DKH A;  3S5W A;  3AD8 B;  2ZZC A;  1V59 A;  1NAA A;  5FMH A;  2YM2 A;  4DGK A;  2EQ9 A;  1GES A;  1N4V A;  1NHP A;  4B66 A;  2Q0L A;  4H2R A;  4C74 A;  4Z26 A;  2YG6 A;  3BI4 A;  1PS9 A;  4YKG A;  2GQW A;  2WU2 A;  5C3J A;  1CJ4 A;  3AEE A;  1O95 A;  3CND A;  3PO7 A;  5EBK A;  2JKC A;  1DOD A;  1F8S A;  1GAL A;  3P1W A;  2YR5 A;  3URH A;  4ICY A;  4CNJ A;  3NYE A;  4ZCC A;  4BK2 A;  2C72 A;  1ZOV A;  4J57 A;  2GV8 A;  2WQY A;  4P9S A;  1DNC A;  1QJD A;  2E4G A;  3IF9 A;  1CL0 A;  2X8G A;  2XFO A;  3BNM A;  3CTY A;  3CIR A;  1YY5 A;  2J3N A;  1JRY A;  2C64 A;  4H4U A;  3QSS A;  2BYB A;  1H86 A;  3ALJ A;  3NK0 X;  1GSN A;  1RP0 A;  2YR4 A;  5CKU A;  3UTH A;  4GF7 A;  3GMB A;  3DA1 A;  2WPF A;  3BNU A;  4NTE A;  3S61 A;  3RP8 A;  3NG7 X;  4K7Z A;  4H4R A;  5HHF A;  4C5O A;  1KSU A;  1DXL A;  1F3P A;  1JNR A;  1SEZ A;  1VDC A;  3QSE A;  5ER0 A;  2OLO A;  4H4V A;  3GYI A;  3NLC A;  4HB9 A;  1D7Y A;  4BK3 A;  2WPE A;  1XHC A;  3AEG A;  1DOE A;  3ALM A;  3CGC A;  3I6D A;  3KKJ A;  4A99 A;  5KWF A;  1EL8 A;  2WET A;  4AT0 A;  3F8P A;  2XVE A;  1GPE A;  4J56 A;  2QA2 A;  3AB1 A;  5JCK A;  3P4Q A;  3AD7 B;  3NGC X;  1TDE A;  1Y56 A;  3PS9 A;  1N1P A;  1GT8 A;  3UKA A;  1QLB A;  4OPC A;  2YWL A;  4EIP A;  1NPX A;  3EF6 A;  3ZDN A;  1IUX A;  3I3L A;  2WBA A;  3CGB A;  2R0C A;  1HYU A;  3IHM A;  1CC6 A;  1RSG A;  3Q6J A;  3UOX A;  1E1L A;  4U8K A;  4N9X A;  1IUT A;  3PVC A;  4GUV A;  4H4X A;  1E1K A;  1GTH A;  2EQ6 A;  3QFB A;  4O5Q A;  3KD9 A;  3UCL A;  1GRE A;  1D7L A;  3BI2 A;  3LZX A;  5KVI A;  1TDK A;  5BUL A;  2BCP A;  2GRT A;  3P4P A;  2Q7V A;  1Q1W A;  1LPF A;  1E7P A;  1GRF A;  2BS4 A;  3AE3 A;  4AP3 A;  2BAC A;  3M13 A;  4H4S A;  5IPY A;  2V3A A;  3DGZ A;  1GET A;  3KU9 A;  1H7X A;  3UKF A;  1FL2 A;  2X99 A;  4A7A A;  3B3R A;  4CNK A;  4FDC B;  1S3E A;  3SFD A;  4JQ9 A;  2Q6U A;  5GSN A;  4K5R A;  4IV9 A;  2XVJ A;  4TLZ A;  1KNP A;  2A89 A;  1GTE A;  1Y56 B;  1YKJ A;  3VR9 A;  1PDH A;  2Z5X A;  1H82 A;  4NTC A;  4OPI A;  1JRX A;  3DJG X;  2B9X A;  5LV9 A;  3LAD A;  3P9U A;  2WP6 A;  3CNS A;  1CJ2 A;  2FJB A;  1ZMC A;  2WOV A;  3P4S A;  3C4A A;  4CBQ A;  3QVR A;  1O5W A;  5KXJ A;  1H7W A;  1PBD A;  2C66 A;  4IVM B;  4H4Z A;  1LTX R;  1OJA A;  3LB8 A;  1GRB A;  4TM0 A;  1F8R A;  1JOA A;  3L8K A;  5KRQ A;  1FCD A;  3CGD A;  1OJD A;  2WU5 A;  1GOS A;  2YLZ A;  3AEB A;  1BGJ A;  5DBJ A;  4O5U A;  1LQT A;  2E5V A;  4DSG A;  1NEN A;  1M64 A;  4C3X A;  2R0P A;  1AOG A;  2Z5Y A;  3GRS A;  4B68 A;  3BHK A;  1P2E A;  4TM1 A;  4YTM A;  3CNP A;  3GDP A;  3NRN A;  4J31 A;  1PHH A;  1E1N A;  3B6D A;  3H8I A;  1IUW A;  3E1T A;  1PJ6 A;  3P4R A;  4OPL A;  3UTE A;  2ARD A;  3F8R A;  2WDV A;  3UTG A;  3UKQ A;  4EIQ A;  3LOV A;  4Y4M A;  4ZN0 A;  4K5S A;  3V3N A;  1P2H A;  3UKH A;  4EMI A;  4GDE A;  4CY6 A;  5U25 A;  1DOB A;  3Q9T A;  1TRB A;  4NEV A;  2XFQ A;  2DKI A;  2EQ7 A;  3M12 A;  3K7T A;  2V60 A;  2H88 A;  4H2N A;  2X8H A;  3ALL A;  4LII A;  2VOU A;  1ELI A;  3H4K A;  4Y4L A;  1L9C A;  2A87 A;  5HYM A;  4X4J A;  5M0Z A;  2XLU A;  2V6O A;  1L9D A;  4BK1 A;  4IA6 A;  3HZL A;  4K8D A;  4NEW A;  2XVH A;  2BS3 A;  4OPT A;  5EB4 A;  1YQ3 A;  4B69 A;  4OPG A;  2BK3 A;  2WOI A;  4H7U A;  3ISH A;  4U8M A;  2JBV A;  4XWR A;  3KPF A;  3NK2 X;  1KFY A;  4JY2 A;  2VVL A;  4A79 A;  3CGE A;  2UZZ A;  2YG7 A;  1B8S A;  3GWD A;  4OVI A;  2FJD A;  3COX A;  2GAG B;  5BUK A;  1FEA A;  4UDQ A;  2OAL A;  2WOW A;  2GR2 A;  3UKK A;  3VRD B;  3VR8 A;  2NPX A;  4J36 A;  2WES A;  1VRQ B;  4K22 A;  3UKP A;  1OJT A;  3H8L A;  1D4C A;  4Z43 A;  1CF3 A;  2QAE A;  4BJZ A;  3LJP A;  2WHD A;  2AQJ A;  3NN0 X;  2PYX A;  4YTN A;  2B9W A;  2FJE A;  5TR3 A;  4TM4 A;  1E1M A;  1LJ1 A;  2YLT A;  4NZH A;  4YKF A;  1CJ3 A;  3EAO A;  2GEW A;  2YLX A;  2RGO A;  4U8P A;  2CVJ A;  4KPR A;  2YG3 A;  3G5Q A;  1JU2 A;  4H4Q A;  1XAN A;  1E39 A;  3GYJ A;  1Q9I A;  2XFP A;  3DK4 A;  4RG3 A;  3QVP A;  2XFN A;  1NEK A;  3ICT A;  4C77 A;  3NN6 X;  2C75 A;  1PBF A;  3AYL A;  1EL7 A;  3ADA B;  2WEU A;  3CNJ A;  3AEA A;  5J60 A;  3C4N A;  4GR1 A;  2H89 A;  4REK A;  1B5Q A;  2IID A;  3AEF A;  1ZKQ A;  3L1R A;  4YWO A;  1H81 A;  2BC1 A;  2Y6R A;  4I58 A;  2BS2 A;  1ZK7 A;  1ZMD A;  4HA6 A;  3RNM A;  5FS7 A;  3NH3 X;  5IQ4 A;  4B1B A;  1EL9 A;  4B63 A;  4NTD A;  4Z24 A;  4CCQ A;  2BK4 A;  1KSS A;  4FK1 C;  3NTD A;  4JNA A;  4I59 A;  2C7G A;  3CNT A;  2C67 A;  2V61 A;  4H4T A;  4IVO B;  2XLS A;  3UKL A;  3UOV A;  4EM3 A;  1PJ5 A;  1F8W A;  4USQ A;  3ZYX A;  3NKS A;  2PHH A;  3T37 A;  3IHG A;  2IVD A;  3AE1 A;  4AOX A;  3GDN A;  3QSM A;  5JCM A;  1CC4 A;  5JCI A;  3KA7 A;  5CQF A;  2ZZB A;  4YSX A;  2TPR A;  2APG A;  3AE2 A;  1BKW A;  1YQZ A;  3BHF A;  4EQW A;  1BZL A;  3AE5 A;  2IVE A;  2GVC A;  2VRM A;  2FJA A;  4H2Q A;  4BJY A;  3AE9 A;  2E1M A;  1BWC A;  2JB1 A;  1Y0P A;  2OLN A;  2Q0K A;  1GRA A;  1TDN A;  4GCM A;  2ACZ A;  4ZCD A;  1L9E A;  2NVK X;  1TDO A;  3IC9 A;  3AD9 B;  1H83 A;  4H2P A;  1GEU A;  2YQU A;  3FG2 P;  4A6N A;  5EB5 A;  2CUL A;  4EM4 A;  1PBC A;  1DJN A;  1LQU A;  2GMH A;  1GV4 A;  3C96 A;  3CN8 A;  3CPI G;  1X31 B;  3SGL A;  1JEH A;  1K4Q A;  2B7S A;  3II4 A;  4BUR A;  4XXG A;  5L46 A;  3UOY A;  4YSH A;  3VRA A;  1GRT A;  4USR A;  2WDR A;  3NYC A;  3FMW A;  1MXT A;  2YVF A;  4YXD A;  2R9Z A;  3OZ2 A;  4OCG A;  3LXD A;  1K0L A;  1REO A;  4AOS A;  4A5L A;  3NTA A;  5KOX A;  3NT6 A;  3NHO X;  4GDP A;  1K0I A;  4H4P A;  1XPQ A;  3R9U A;  4D03 A;  3DGH A;  1B37 A;  2VVM A;  3KVE A;  4U8N A;  3DH9 A;  1COY A;  2ZZ0 A;  1O94 A;  4DSH A;  3VRB A;  4BV6 A;  3NYF A;  1NDA A;  4LA1 A;  4A6N B;  2XLP A;  4ADW A;  2CFY A;  2GR0 A;  3JSK A;  1MOK A;  4WCT A;  1NG3 A;  4Z44 A;  3V3O A;  2JB3 A;  2W0H A;  4JDR A;  3G5R A;  1PN0 A;  4U2T A;  2FBW A;  5KVH A;  1PXB A;  1JRZ A;  3NK1 X;  3RP7 A;  1DOC A;  5HY5 A;  5JCL A;  5M10 A;  2C70 A;  2XLR A;  1ZP0 A;  4U8O A;  1TYT A;  4EMJ A;  2BXS A;  2VQB A;  1EL5 A;  2GQF A;  3BI5 A;  3V76 A;  4Z2T A;  2GB0 A;  4H4W A;  2XCG A;  2RGH A;  1D5T A;  3K7M X;  3AE6 A;  4JN9 A;  4Z2R A;  3AE8 A;  3GRT A;  5KOW A;  1TDF A;  3AYI A;  3ITJ A;  1XDI A;  2WS3 A;  1Z6L A;  3AE7 A;  2JK6 A;  3DJJ A;  5J7X A;  2C3C A;  1BF3 A;  3DJD A;  2YG5 A;  1VG0 A;  2XDO A;  4GRT A;  3ICS A;  4CRT A;  4EQX A;  1S2Q A;  1LV0 A;  2O9Z A;  4AP1 A;  2R46 A;  3DME A;  4K2X A;  4TM3 A;  4X9M A;  1QO8 A;  5FS9 A;  4CCR A;  1MO9 A;  1PBE A;  1IUU A;  3SM8 A;  4E0V A;  2XFU A;  3FIM B;  3VQR A;  4EQR A;  2YLR A;  2X8C A;  1KDG A;  2CDU A;  2BC0 A;  1EBD A;  3GD3 A;  2VZ2 A;  3GD4 A;  1OJC A;  2BCG G;  2YLW A;  3G5S A;  5FS8 A;  5EOW A;  2B7R A;  3ABV A;  3NIX A;  4LU6 A;  1N4W A;  3AE4 A;  2F5Z A;  1KNR A;  1NG4 A;  4EMW A;  2C73 A;  2R4E A;  2VQ7 A;  3QJ4 A;  2GMJ A;  3CPJ G;  2JAE A;  4H4Y A;  4MJW A;  1ZDL A;  4DNA A;  3RHA A;  1ONF A;  3GWF A;  3ICR A;  3UOZ A;  1M6I A;  1ZOY A;  2BA9 A;  2BAB A;  2QA1 A;  2RAB A;  5FS6 A;  2WPC A;  3CPH G;  2V5Z A;  1CJC A;  2YAU A;  1IUV A;  2ZBW A;  4UDP A;  2BK5 A;  1VG9 A;  1IUS A;  2XVI A;  4J33 A;  1ZY8 A;  1NHR A;  2YG4 A;  4YT0 A;  4J2W A;  2HQM A;  2R0G A;  2XYO A;  4A9W A;  4UP3 A;  1GRG A;  1H6V A;  1RYI A;  2JB2 A;  3ATR A;  3AWI A;  1GND A;  1PXA A;  1ZX9 A;  1D4E A;  3D8X A;  3DK9 A;  2RGJ A;  3DK8 A;  4CY8 A;  2BXR A;  2GH5 A;  2R45 A;  3K7Q X;  4D04 A;  4FK1 A;  3NNE A;  2C65 A;  4J34 A;  5U1O A;  1S3B A;  4KX6 A; 
#chains in the Genus database with same CATH topology
 3EAN A;  1DJQ A;  5U63 A;  1PBB A;  3O0H A;  4B64 A;  3RP6 A;  5C2T A;  2AR8 A;  1NHS A;  4EQS A;  3UTF A;  1GRH A;  2XVF A;  3AXB A;  2V3B A;  3LZW A;  3SQP A;  5BVA A;  3FPZ A;  1JNZ A;  1OJ9 A;  1VQW A;  2R4J A;  4OPU A;  5GRT A;  4B67 A;  4UDR A;  1BGN A;  4XWZ A;  1K0J A;  3AYJ A;  4M52 A;  4TLX A;  2QCU A;  1L0V A;  4PAB A;  1PJ7 A;  2AAQ A;  2GF3 A;  3SFE A;  4YSZ A;  1F6M A;  4U2L A;  3GMC A;  4PAA A;  1W4X A;  4U2S A;  4U8I A;  4Y4N A;  4WX1 A;  1KF6 A;  2VVL G;  4U8L A;  1FEB A;  4RSL A;  4C3Y A;  3QFA A;  1B4V A;  2WDQ A;  1NHQ A;  5IQ1 A;  5HXI A;  5JCN A;  4JY3 A;  3OC4 A;  2YM1 A;  1LVL A;  1UKV G;  2YVG A;  4II3 A;  2TMD A;  4FX9 A;  4RG4 A;  4YSY A;  2XLT A;  2GR1 A;  2C76 A;  2Y6Q A;  4NNJ A;  2VRL A;  4X9N A;  1TYP A;  2OAM A;  3F8D A;  2GAH B;  4APN A;  1E6E A;  3D1C A;  3DJE A;  4U8J A;  1FOH A;  1YQ4 A;  3GSI A;  3SXI A;  2YLS A;  2I0Z A;  3K30 A;  3EPT A;  4IA5 A;  4ECH A;  3WE0 A;  4B65 A;  4YTP A;  2C3D A;  2YR6 A;  4JNQ A;  3M0O A;  4OPD A;  3AED A;  2A8X A;  3AEC A;  1CHU A;  3ATQ A;  1D4D A;  3T2Z A;  3IWA A;  4H50 A;  4Z2U A;  1IJH A;  3UP4 A;  1Q1R A;  1FEC A;  1S2Y A;  2EQ8 A;  2WP5 A;  4AT2 A;  2WP9 A;  4A65 A;  2X3N A;  3UP5 A;  1H84 A;  3KLJ A;  5BRT A;  1GER A;  2B76 A;  1PXC A;  4Z25 A;  2OA1 A;  3HYV A;  2YVJ A;  1GXF A;  3FBS A;  1CBO A;  2B9Y A;  4GAP A;  3RED A;  2X50 A;  1CC2 A;  2GR3 A;  1N4U A;  2DKH A;  3S5W A;  3AD8 B;  2ZZC A;  1V59 A;  1NAA A;  5FMH A;  2YM2 A;  4DGK A;  2EQ9 A;  1GES A;  1N4V A;  1NHP A;  4B66 A;  2Q0L A;  4H2R A;  4C74 A;  4Z26 A;  2YG6 A;  3BI4 A;  1PS9 A;  4YKG A;  2GQW A;  2WU2 A;  5C3J A;  2BRY A;  1CJ4 A;  3AEE A;  1O95 A;  3CND A;  3PO7 A;  5EBK A;  2JKC A;  1DOD A;  1F8S A;  1GAL A;  3P1W A;  2YR5 A;  3URH A;  4ICY A;  4CNJ A;  3T0K A;  3NYE A;  4ZCC A;  4BK2 A;  2C72 A;  1ZOV A;  4J57 A;  2GV8 A;  2WQY A;  4P9S A;  1DNC A;  1QJD A;  2E4G A;  3IF9 A;  1CL0 A;  2X8G A;  2XFO A;  3BNM A;  3CTY A;  3CIR A;  1YY5 A;  2J3N A;  1JRY A;  2C64 A;  4H4U A;  3QSS A;  2BYB A;  1H86 A;  3ALJ A;  3NK0 X;  1GSN A;  1RP0 A;  2YR4 A;  5CKU A;  3UTH A;  4GF7 A;  3GMB A;  3DA1 A;  2WPF A;  3BNU A;  4NTE A;  3S61 A;  3RP8 A;  3NG7 X;  4K7Z A;  4H4R A;  5HHF A;  4C5O A;  3T14 A;  1KSU A;  3HYW A;  1DXL A;  1F3P A;  1JNR A;  1SEZ A;  1VDC A;  3QSE A;  5ER0 A;  2OLO A;  4H4V A;  3GYI A;  3NLC A;  4HB9 A;  1D7Y A;  4BK3 A;  2WPE A;  1XHC A;  3AEG A;  1DOE A;  3ALM A;  3CGC A;  3I6D A;  3KKJ A;  4A99 A;  5KWF A;  1EL8 A;  2WET A;  4AT0 A;  3F8P A;  2XVE A;  1GPE A;  4J56 A;  2QA2 A;  3AB1 A;  5JCK A;  3P4Q A;  3AD7 B;  3NGC X;  1TDE A;  1Y56 A;  3PS9 A;  1N1P A;  1GT8 A;  3UKA A;  1QLB A;  4OPC A;  2YWL A;  4EIP A;  1NPX A;  3EF6 A;  3ZDN A;  1IUX A;  3I3L A;  2WBA A;  3CGB A;  2R0C A;  1HYU A;  3IHM A;  1CC6 A;  1RSG A;  3Q6J A;  3UOX A;  1E1L A;  3SZF A;  4U8K A;  4N9X A;  1IUT A;  3PVC A;  3SZW A;  4GUV A;  4H4X A;  1E1K A;  1GTH A;  2EQ6 A;  3QFB A;  4O5Q A;  3KD9 A;  3UCL A;  1GRE A;  1D7L A;  3BI2 A;  3LZX A;  5KVI A;  1TDK A;  5BUL A;  2BCP A;  2GRT A;  3P4P A;  2Q7V A;  1Q1W A;  1LPF A;  1E7P A;  1GRF A;  2BS4 A;  3AE3 A;  4AP3 A;  2BAC A;  3M13 A;  4H4S A;  5IPY A;  2V3A A;  3DGZ A;  1GET A;  3KU9 A;  1H7X A;  3UKF A;  1FL2 A;  2X99 A;  4A7A A;  3B3R A;  4CNK A;  4FDC B;  1S3E A;  3SFD A;  4JQ9 A;  5KMS A;  2Q6U A;  5GSN A;  4K5R A;  4IV9 A;  2XVJ A;  4TLZ A;  1KNP A;  2A89 A;  1GTE A;  1Y56 B;  1YKJ A;  3VR9 A;  1PDH A;  2Z5X A;  1H82 A;  4NTC A;  4OPI A;  1JRX A;  3DJG X;  2B9X A;  5LV9 A;  3LAD A;  3P9U A;  2WP6 A;  3CNS A;  1CJ2 A;  2FJB A;  1ZMC A;  2WOV A;  3P4S A;  3C4A A;  4CBQ A;  3QVR A;  1O5W A;  5KXJ A;  1H7W A;  1PBD A;  2C66 A;  4IVM B;  4H4Z A;  1LTX R;  1OJA A;  3LB8 A;  1GRB A;  4TM0 A;  1F8R A;  1JOA A;  3L8K A;  5KRQ A;  1FCD A;  3CGD A;  1OJD A;  2WU5 A;  1GOS A;  2YLZ A;  3AEB A;  1BGJ A;  5DBJ A;  4O5U A;  1LQT A;  2E5V A;  4DSG A;  1NEN A;  1M64 A;  4C3X A;  2R0P A;  1AOG A;  2Z5Y A;  3GRS A;  4B68 A;  3BHK A;  1P2E A;  4TM1 A;  4YTM A;  3CNP A;  3GDP A;  3NRN A;  4J31 A;  1PHH A;  1E1N A;  3B6D A;  3H8I A;  1IUW A;  3E1T A;  1PJ6 A;  3P4R A;  4OPL A;  4G74 A;  3UTE A;  2ARD A;  3F8R A;  2WDV A;  3UTG A;  3UKQ A;  4EIQ A;  3LOV A;  4Y4M A;  4ZN0 A;  4K5S A;  3V3N A;  1P2H A;  3UKH A;  4EMI A;  4GDE A;  4CY6 A;  5U25 A;  1DOB A;  3Q9T A;  3SX6 A;  1TRB A;  4NEV A;  2XFQ A;  2DKI A;  2EQ7 A;  3M12 A;  3K7T A;  2V60 A;  3T2Y A;  2H88 A;  4H2N A;  2X8H A;  3ALL A;  4LII A;  2VOU A;  1ELI A;  3H4K A;  4Y4L A;  1L9C A;  2A87 A;  5HYM A;  4X4J A;  5M0Z A;  2XLU A;  2V6O A;  1L9D A;  4BK1 A;  4IA6 A;  5KNL A;  3HZL A;  4K8D A;  4NEW A;  2XVH A;  2BS3 A;  4OPT A;  5EB4 A;  1YQ3 A;  4B69 A;  4OPG A;  2BK3 A;  2WOI A;  4H7U A;  3ISH A;  4U8M A;  2JBV A;  4XWR A;  3KPF A;  3NK2 X;  1KFY A;  4JY2 A;  2VVL A;  3T31 A;  4A79 A;  3CGE A;  2UZZ A;  2YG7 A;  1B8S A;  3GWD A;  4OVI A;  2FJD A;  3COX A;  2GAG B;  5BUK A;  1FEA A;  4UDQ A;  2OAL A;  2WOW A;  2GR2 A;  3UKK A;  3VRD B;  3VR8 A;  2NPX A;  4J36 A;  2WES A;  1VRQ B;  4K22 A;  3UKP A;  1OJT A;  3H8L A;  1D4C A;  4Z43 A;  1CF3 A;  2QAE A;  4BJZ A;  3LJP A;  2WHD A;  2AQJ A;  3NN0 X;  2PYX A;  4YTN A;  2B9W A;  2FJE A;  5TR3 A;  4TM4 A;  1E1M A;  1LJ1 A;  3SYI A;  2YLT A;  4NZH A;  4YKF A;  3GYX A;  1CJ3 A;  3EAO A;  2GEW A;  3SY4 A;  2YLX A;  2RGO A;  4U8P A;  2CVJ A;  4KPR A;  2YG3 A;  3G5Q A;  1JU2 A;  4H4Q A;  1XAN A;  1E39 A;  3GYJ A;  1Q9I A;  2XFP A;  3DK4 A;  4RG3 A;  3QVP A;  2XFN A;  1NEK A;  3ICT A;  4C77 A;  3NN6 X;  2C75 A;  1PBF A;  3AYL A;  1EL7 A;  3ADA B;  2WEU A;  3CNJ A;  3AEA A;  5J60 A;  3C4N A;  4GR1 A;  2H89 A;  4REK A;  1B5Q A;  2IID A;  3AEF A;  1ZKQ A;  3L1R A;  4YWO A;  1H81 A;  2BC1 A;  2Y6R A;  4I58 A;  2BS2 A;  1ZK7 A;  1ZMD A;  4HA6 A;  3RNM A;  5FS7 A;  3NH3 X;  5IQ4 A;  4B1B A;  1EL9 A;  4B63 A;  4NTD A;  4Z24 A;  2C4C A;  5KMR A;  4CCQ A;  2BK4 A;  1KSS A;  4FK1 C;  3NTD A;  4JNA A;  4I59 A;  3T2K A;  2C7G A;  3CNT A;  2C67 A;  2V61 A;  4H4T A;  4G9K A;  2XLS A;  4IVO B;  3UKL A;  3UOV A;  4EM3 A;  1PJ5 A;  1F8W A;  4USQ A;  3ZYX A;  3NKS A;  3KPK A;  2PHH A;  3T37 A;  3IHG A;  2IVD A;  3AE1 A;  4II2 A;  3GDN A;  4AOX A;  3QSM A;  5JCM A;  1CC4 A;  4G6H A;  5JCI A;  3KA7 A;  5CQF A;  2ZZB A;  4YSX A;  2TPR A;  2APG A;  3AE2 A;  1BKW A;  1YQZ A;  3BHF A;  4EQW A;  1BZL A;  3AE5 A;  2IVE A;  2GVC A;  2VRM A;  2FJA A;  4H2Q A;  4BJY A;  3AE9 A;  2E1M A;  1BWC A;  2JB1 A;  1Y0P A;  2OLN A;  2Q0K A;  1GRA A;  1TDN A;  4GCM A;  2ACZ A;  4ZCD A;  1L9E A;  2NVK X;  1TDO A;  3IC9 A;  3SZ0 A;  3AD9 B;  1H83 A;  4H2P A;  1GEU A;  2YQU A;  3FG2 P;  3SZC A;  4A6N A;  5EB5 A;  2CUL A;  4EM4 A;  1PBC A;  1DJN A;  1LQU A;  2GMH A;  1GV4 A;  3C96 A;  3CN8 A;  3CPI G;  1X31 B;  3SGL A;  1JEH A;  1K4Q A;  2B7S A;  3II4 A;  4BUR A;  4XXG A;  5L46 A;  3UOY A;  4YSH A;  3VRA A;  1GRT A;  4USR A;  2WDR A;  3NYC A;  3FMW A;  1MXT A;  2YVF A;  4YXD A;  2R9Z A;  3OZ2 A;  4OCG A;  3LXD A;  1K0L A;  1REO A;  2BRA A;  4AOS A;  4A5L A;  3NTA A;  3HYX A;  5KOX A;  3NT6 A;  3NHO X;  4GDP A;  1K0I A;  4H4P A;  1XPQ A;  3R9U A;  4D03 A;  3DGH A;  1B37 A;  2VVM A;  3KVE A;  4U8N A;  4GAV A;  3DH9 A;  1COY A;  2ZZ0 A;  1O94 A;  4DSH A;  3VRB A;  4BV6 A;  3NYF A;  1NDA A;  4LA1 A;  4A6N B;  2XLP A;  4ADW A;  2CFY A;  2GR0 A;  3JSK A;  1MOK A;  4WCT A;  1NG3 A;  4G6G A;  4Z44 A;  3V3O A;  2JB3 A;  2W0H A;  4JDR A;  3G5R A;  1PN0 A;  4U2T A;  2FBW A;  5KVH A;  1PXB A;  1JRZ A;  3NK1 X;  3RP7 A;  1DOC A;  5HY5 A;  5JCL A;  5M10 A;  2C70 A;  2XLR A;  1ZP0 A;  4U8O A;  1TYT A;  4EMJ A;  2BXS A;  2VQB A;  1EL5 A;  2GQF A;  3BI5 A;  3V76 A;  4Z2T A;  2GB0 A;  4H4W A;  2XCG A;  2RGH A;  1D5T A;  3K7M X;  3AE6 A;  4JN9 A;  4Z2R A;  3AE8 A;  3GRT A;  5KOW A;  1TDF A;  3AYI A;  3ITJ A;  1XDI A;  2WS3 A;  1Z6L A;  3AE7 A;  2JK6 A;  3DJJ A;  5J7X A;  2C3C A;  1BF3 A;  3DJD A;  2YG5 A;  1VG0 A;  2XDO A;  4GRT A;  3ICS A;  4CRT A;  4EQX A;  3CMM A;  1S2Q A;  4G73 A;  1LV0 A;  2O9Z A;  4AP1 A;  2R46 A;  3DME A;  4K2X A;  4TM3 A;  4X9M A;  1QO8 A;  5FS9 A;  4CCR A;  1MO9 A;  1PBE A;  1IUU A;  3SM8 A;  4E0V A;  2XFU A;  3FIM B;  3VQR A;  4EQR A;  2YLR A;  2X8C A;  1KDG A;  2CDU A;  2BC0 A;  1EBD A;  3GD3 A;  2VZ2 A;  3GD4 A;  5KMQ A;  1OJC A;  2BCG G;  2YLW A;  3G5S A;  5FS8 A;  5EOW A;  2B7R A;  3ABV A;  3NIX A;  4LU6 A;  1N4W A;  3AE4 A;  4NWZ A;  2F5Z A;  1KNR A;  1NG4 A;  4EMW A;  2C73 A;  2R4E A;  2VQ7 A;  3QJ4 A;  2GMJ A;  3CPJ G;  2JAE A;  4H4Y A;  4MJW A;  1ZDL A;  4DNA A;  3RHA A;  1ONF A;  3GWF A;  3ICR A;  3UOZ A;  1M6I A;  1ZOY A;  2BA9 A;  2BAB A;  2QA1 A;  2RAB A;  5FS6 A;  2WPC A;  3CPH G;  2V5Z A;  1CJC A;  2YAU A;  1IUV A;  2ZBW A;  4UDP A;  2BK5 A;  1VG9 A;  1IUS A;  2XVI A;  4J33 A;  1ZY8 A;  1NHR A;  2YG4 A;  4YT0 A;  4J2W A;  2HQM A;  2R0G A;  2XYO A;  4A9W A;  4UP3 A;  1GRG A;  1H6V A;  1RYI A;  2JB2 A;  3ATR A;  3AWI A;  1GND A;  1PXA A;  1ZX9 A;  1D4E A;  3D8X A;  3DK9 A;  5KMP A;  2RGJ A;  3DK8 A;  4CY8 A;  2BXR A;  2GH5 A;  2R45 A;  3K7Q X;  4D04 A;  4FK1 A;  3NNE A;  2C65 A;  4J34 A;  5U1O A;  1S3B A;  4KX6 A; 
#chains in the Genus database with same CATH homology
 3EAN A;  1DJQ A;  5U63 A;  1PBB A;  3O0H A;  4B64 A;  3RP6 A;  5C2T A;  2AR8 A;  1NHS A;  4EQS A;  3UTF A;  1GRH A;  2XVF A;  3AXB A;  2V3B A;  3LZW A;  3SQP A;  5BVA A;  3FPZ A;  1JNZ A;  1OJ9 A;  1VQW A;  2R4J A;  4OPU A;  5GRT A;  4B67 A;  4UDR A;  1BGN A;  4XWZ A;  1K0J A;  3AYJ A;  4M52 A;  4TLX A;  2QCU A;  1L0V A;  4PAB A;  1PJ7 A;  2AAQ A;  2GF3 A;  3SFE A;  4YSZ A;  1F6M A;  4U2L A;  3GMC A;  4PAA A;  1W4X A;  4U2S A;  4U8I A;  4Y4N A;  4WX1 A;  1KF6 A;  2VVL G;  4U8L A;  1FEB A;  4RSL A;  4C3Y A;  3QFA A;  1B4V A;  2WDQ A;  1NHQ A;  5IQ1 A;  5HXI A;  5JCN A;  4JY3 A;  3OC4 A;  2YM1 A;  1LVL A;  1UKV G;  2YVG A;  4II3 A;  2TMD A;  4FX9 A;  4RG4 A;  4YSY A;  2XLT A;  2GR1 A;  2C76 A;  2Y6Q A;  4NNJ A;  2VRL A;  4X9N A;  1TYP A;  2OAM A;  3F8D A;  2GAH B;  4APN A;  1E6E A;  3D1C A;  3DJE A;  4U8J A;  1FOH A;  1YQ4 A;  3GSI A;  3SXI A;  2YLS A;  2I0Z A;  3K30 A;  3EPT A;  4IA5 A;  4ECH A;  3WE0 A;  4B65 A;  4YTP A;  2C3D A;  2YR6 A;  4JNQ A;  3M0O A;  4OPD A;  3AED A;  2A8X A;  3AEC A;  1CHU A;  3ATQ A;  1D4D A;  3T2Z A;  3IWA A;  4H50 A;  4Z2U A;  1IJH A;  3UP4 A;  1Q1R A;  1FEC A;  1S2Y A;  2EQ8 A;  2WP5 A;  4AT2 A;  2WP9 A;  4A65 A;  2X3N A;  3UP5 A;  1H84 A;  3KLJ A;  5BRT A;  1GER A;  2B76 A;  1PXC A;  4Z25 A;  2OA1 A;  3HYV A;  2YVJ A;  1GXF A;  3FBS A;  1CBO A;  2B9Y A;  4GAP A;  3RED A;  2X50 A;  1CC2 A;  2GR3 A;  1N4U A;  2DKH A;  3S5W A;  3AD8 B;  2ZZC A;  1V59 A;  1NAA A;  5FMH A;  2YM2 A;  4DGK A;  2EQ9 A;  1GES A;  1N4V A;  1NHP A;  4B66 A;  2Q0L A;  4H2R A;  4C74 A;  4Z26 A;  2YG6 A;  3BI4 A;  1PS9 A;  4YKG A;  2GQW A;  2WU2 A;  5C3J A;  2BRY A;  1CJ4 A;  3AEE A;  1O95 A;  3CND A;  3PO7 A;  5EBK A;  2JKC A;  1DOD A;  1F8S A;  1GAL A;  3P1W A;  2YR5 A;  3URH A;  4ICY A;  4CNJ A;  3T0K A;  3NYE A;  4ZCC A;  4BK2 A;  2C72 A;  1ZOV A;  4J57 A;  2GV8 A;  2WQY A;  4P9S A;  1DNC A;  1QJD A;  2E4G A;  3IF9 A;  1CL0 A;  2X8G A;  2XFO A;  3BNM A;  3CTY A;  3CIR A;  1YY5 A;  2J3N A;  1JRY A;  2C64 A;  4H4U A;  3QSS A;  2BYB A;  1H86 A;  3ALJ A;  3NK0 X;  1GSN A;  1RP0 A;  2YR4 A;  5CKU A;  3UTH A;  4GF7 A;  3GMB A;  3DA1 A;  2WPF A;  3BNU A;  4NTE A;  3S61 A;  3RP8 A;  3NG7 X;  4K7Z A;  4H4R A;  5HHF A;  4C5O A;  3T14 A;  1KSU A;  3HYW A;  1DXL A;  1F3P A;  1JNR A;  1SEZ A;  1VDC A;  3QSE A;  5ER0 A;  2OLO A;  4H4V A;  3GYI A;  3NLC A;  4HB9 A;  1D7Y A;  4BK3 A;  2WPE A;  1XHC A;  3AEG A;  1DOE A;  3ALM A;  3CGC A;  3I6D A;  3KKJ A;  4A99 A;  5KWF A;  1EL8 A;  2WET A;  4AT0 A;  3F8P A;  2XVE A;  1GPE A;  4J56 A;  2QA2 A;  3AB1 A;  5JCK A;  3P4Q A;  3AD7 B;  3NGC X;  1TDE A;  1Y56 A;  3PS9 A;  1N1P A;  1GT8 A;  3UKA A;  1QLB A;  4OPC A;  2YWL A;  4EIP A;  1NPX A;  3EF6 A;  3ZDN A;  1IUX A;  3I3L A;  2WBA A;  3CGB A;  2R0C A;  1HYU A;  3IHM A;  1CC6 A;  1RSG A;  3Q6J A;  3UOX A;  1E1L A;  3SZF A;  4U8K A;  4N9X A;  1IUT A;  3PVC A;  3SZW A;  4GUV A;  4H4X A;  1E1K A;  1GTH A;  2EQ6 A;  3QFB A;  4O5Q A;  3KD9 A;  3UCL A;  1GRE A;  1D7L A;  3BI2 A;  3LZX A;  5KVI A;  1TDK A;  5BUL A;  2BCP A;  2GRT A;  3P4P A;  2Q7V A;  1Q1W A;  1LPF A;  1E7P A;  1GRF A;  2BS4 A;  3AE3 A;  4AP3 A;  2BAC A;  3M13 A;  4H4S A;  5IPY A;  2V3A A;  3DGZ A;  1GET A;  3KU9 A;  1H7X A;  3UKF A;  1FL2 A;  2X99 A;  4A7A A;  3B3R A;  4CNK A;  4FDC B;  1S3E A;  3SFD A;  4JQ9 A;  5KMS A;  2Q6U A;  5GSN A;  4K5R A;  4IV9 A;  2XVJ A;  4TLZ A;  1KNP A;  2A89 A;  1GTE A;  1Y56 B;  1YKJ A;  3VR9 A;  1PDH A;  2Z5X A;  1H82 A;  4NTC A;  4OPI A;  1JRX A;  3DJG X;  2B9X A;  5LV9 A;  3LAD A;  3P9U A;  2WP6 A;  3CNS A;  1CJ2 A;  2FJB A;  1ZMC A;  2WOV A;  3P4S A;  3C4A A;  4CBQ A;  3QVR A;  1O5W A;  5KXJ A;  1H7W A;  1PBD A;  2C66 A;  4IVM B;  4H4Z A;  1LTX R;  1OJA A;  3LB8 A;  1GRB A;  4TM0 A;  1F8R A;  1JOA A;  3L8K A;  5KRQ A;  1FCD A;  3CGD A;  1OJD A;  2WU5 A;  1GOS A;  2YLZ A;  3AEB A;  1BGJ A;  5DBJ A;  4O5U A;  1LQT A;  2E5V A;  4DSG A;  1NEN A;  1M64 A;  4C3X A;  2R0P A;  1AOG A;  2Z5Y A;  3GRS A;  4B68 A;  3BHK A;  1P2E A;  4TM1 A;  4YTM A;  3CNP A;  3GDP A;  3NRN A;  4J31 A;  1PHH A;  1E1N A;  3B6D A;  3H8I A;  1IUW A;  3E1T A;  1PJ6 A;  3P4R A;  4OPL A;  4G74 A;  3UTE A;  2ARD A;  3F8R A;  2WDV A;  3UTG A;  3UKQ A;  4EIQ A;  3LOV A;  4Y4M A;  4ZN0 A;  4K5S A;  3V3N A;  1P2H A;  3UKH A;  4EMI A;  4GDE A;  4CY6 A;  5U25 A;  1DOB A;  3Q9T A;  3SX6 A;  1TRB A;  4NEV A;  2XFQ A;  2DKI A;  2EQ7 A;  3M12 A;  3K7T A;  2V60 A;  3T2Y A;  2H88 A;  4H2N A;  2X8H A;  3ALL A;  4LII A;  2VOU A;  1ELI A;  3H4K A;  4Y4L A;  1L9C A;  2A87 A;  5HYM A;  4X4J A;  5M0Z A;  2XLU A;  2V6O A;  1L9D A;  4BK1 A;  4IA6 A;  5KNL A;  3HZL A;  4K8D A;  4NEW A;  2XVH A;  2BS3 A;  4OPT A;  5EB4 A;  1YQ3 A;  4B69 A;  4OPG A;  2BK3 A;  2WOI A;  4H7U A;  3ISH A;  4U8M A;  2JBV A;  4XWR A;  3KPF A;  3NK2 X;  1KFY A;  4JY2 A;  2VVL A;  3T31 A;  4A79 A;  3CGE A;  2UZZ A;  2YG7 A;  1B8S A;  3GWD A;  4OVI A;  2FJD A;  3COX A;  2GAG B;  5BUK A;  1FEA A;  4UDQ A;  2OAL A;  2WOW A;  2GR2 A;  3UKK A;  3VRD B;  3VR8 A;  2NPX A;  4J36 A;  2WES A;  1VRQ B;  4K22 A;  3UKP A;  1OJT A;  3H8L A;  1D4C A;  4Z43 A;  1CF3 A;  2QAE A;  4BJZ A;  3LJP A;  2WHD A;  2AQJ A;  3NN0 X;  2PYX A;  4YTN A;  2B9W A;  2FJE A;  5TR3 A;  4TM4 A;  1E1M A;  1LJ1 A;  3SYI A;  2YLT A;  4NZH A;  4YKF A;  3GYX A;  1CJ3 A;  3EAO A;  2GEW A;  3SY4 A;  2YLX A;  2RGO A;  4U8P A;  2CVJ A;  4KPR A;  2YG3 A;  3G5Q A;  1JU2 A;  4H4Q A;  1XAN A;  1E39 A;  3GYJ A;  1Q9I A;  2XFP A;  3DK4 A;  4RG3 A;  3QVP A;  2XFN A;  1NEK A;  3ICT A;  4C77 A;  3NN6 X;  2C75 A;  1PBF A;  3AYL A;  1EL7 A;  3ADA B;  2WEU A;  3CNJ A;  3AEA A;  5J60 A;  3C4N A;  4GR1 A;  2H89 A;  4REK A;  1B5Q A;  2IID A;  3AEF A;  1ZKQ A;  3L1R A;  4YWO A;  1H81 A;  2BC1 A;  2Y6R A;  4I58 A;  2BS2 A;  1ZK7 A;  1ZMD A;  4HA6 A;  3RNM A;  5FS7 A;  3NH3 X;  5IQ4 A;  4B1B A;  1EL9 A;  4B63 A;  4NTD A;  4Z24 A;  2C4C A;  5KMR A;  4CCQ A;  2BK4 A;  1KSS A;  4FK1 C;  3NTD A;  4JNA A;  4I59 A;  3T2K A;  2C7G A;  3CNT A;  2C67 A;  2V61 A;  4H4T A;  4G9K A;  2XLS A;  4IVO B;  3UKL A;  3UOV A;  4EM3 A;  1PJ5 A;  1F8W A;  4USQ A;  3ZYX A;  3NKS A;  3KPK A;  2PHH A;  3T37 A;  3IHG A;  2IVD A;  3AE1 A;  4II2 A;  3GDN A;  4AOX A;  3QSM A;  5JCM A;  1CC4 A;  4G6H A;  5JCI A;  3KA7 A;  5CQF A;  2ZZB A;  4YSX A;  2TPR A;  2APG A;  3AE2 A;  1BKW A;  1YQZ A;  3BHF A;  4EQW A;  1BZL A;  3AE5 A;  2IVE A;  2GVC A;  2VRM A;  2FJA A;  4H2Q A;  4BJY A;  3AE9 A;  2E1M A;  1BWC A;  2JB1 A;  1Y0P A;  2OLN A;  2Q0K A;  1GRA A;  1TDN A;  4GCM A;  2ACZ A;  4ZCD A;  1L9E A;  2NVK X;  1TDO A;  3IC9 A;  3SZ0 A;  3AD9 B;  1H83 A;  4H2P A;  1GEU A;  2YQU A;  3FG2 P;  3SZC A;  4A6N A;  5EB5 A;  2CUL A;  4EM4 A;  1PBC A;  1DJN A;  1LQU A;  2GMH A;  1GV4 A;  3C96 A;  3CN8 A;  3CPI G;  1X31 B;  3SGL A;  1JEH A;  1K4Q A;  2B7S A;  3II4 A;  4BUR A;  4XXG A;  5L46 A;  3UOY A;  4YSH A;  3VRA A;  1GRT A;  4USR A;  2WDR A;  3NYC A;  3FMW A;  1MXT A;  2YVF A;  4YXD A;  2R9Z A;  3OZ2 A;  4OCG A;  3LXD A;  1K0L A;  1REO A;  2BRA A;  4AOS A;  4A5L A;  3NTA A;  3HYX A;  5KOX A;  3NT6 A;  3NHO X;  4GDP A;  1K0I A;  4H4P A;  1XPQ A;  3R9U A;  4D03 A;  3DGH A;  1B37 A;  2VVM A;  3KVE A;  4U8N A;  4GAV A;  3DH9 A;  1COY A;  2ZZ0 A;  1O94 A;  4DSH A;  3VRB A;  4BV6 A;  3NYF A;  1NDA A;  4LA1 A;  4A6N B;  2XLP A;  4ADW A;  2CFY A;  2GR0 A;  3JSK A;  1MOK A;  4WCT A;  1NG3 A;  4G6G A;  4Z44 A;  3V3O A;  2JB3 A;  2W0H A;  4JDR A;  3G5R A;  1PN0 A;  4U2T A;  2FBW A;  5KVH A;  1PXB A;  1JRZ A;  3NK1 X;  3RP7 A;  1DOC A;  5HY5 A;  5JCL A;  5M10 A;  2C70 A;  2XLR A;  1ZP0 A;  4U8O A;  1TYT A;  4EMJ A;  2BXS A;  2VQB A;  1EL5 A;  2GQF A;  3BI5 A;  3V76 A;  4Z2T A;  2GB0 A;  4H4W A;  2XCG A;  2RGH A;  1D5T A;  3K7M X;  3AE6 A;  4JN9 A;  4Z2R A;  3AE8 A;  3GRT A;  5KOW A;  1TDF A;  3AYI A;  3ITJ A;  1XDI A;  2WS3 A;  1Z6L A;  3AE7 A;  2JK6 A;  3DJJ A;  5J7X A;  2C3C A;  1BF3 A;  3DJD A;  2YG5 A;  1VG0 A;  2XDO A;  4GRT A;  3ICS A;  4CRT A;  4EQX A;  3CMM A;  1S2Q A;  4G73 A;  1LV0 A;  2O9Z A;  4AP1 A;  2R46 A;  3DME A;  4K2X A;  4TM3 A;  4X9M A;  1QO8 A;  5FS9 A;  4CCR A;  1MO9 A;  1PBE A;  1IUU A;  3SM8 A;  4E0V A;  2XFU A;  3FIM B;  3VQR A;  4EQR A;  2YLR A;  2X8C A;  1KDG A;  2CDU A;  2BC0 A;  1EBD A;  3GD3 A;  2VZ2 A;  3GD4 A;  5KMQ A;  1OJC A;  2BCG G;  2YLW A;  3G5S A;  5FS8 A;  5EOW A;  2B7R A;  3ABV A;  3NIX A;  4LU6 A;  1N4W A;  3AE4 A;  4NWZ A;  2F5Z A;  1KNR A;  1NG4 A;  4EMW A;  2C73 A;  2R4E A;  2VQ7 A;  3QJ4 A;  2GMJ A;  3CPJ G;  2JAE A;  4H4Y A;  4MJW A;  1ZDL A;  4DNA A;  3RHA A;  1ONF A;  3GWF A;  3ICR A;  3UOZ A;  1M6I A;  1ZOY A;  2BA9 A;  2BAB A;  2QA1 A;  2RAB A;  5FS6 A;  2WPC A;  3CPH G;  2V5Z A;  1CJC A;  2YAU A;  1IUV A;  2ZBW A;  4UDP A;  2BK5 A;  1VG9 A;  1IUS A;  2XVI A;  4J33 A;  1ZY8 A;  1NHR A;  2YG4 A;  4YT0 A;  4J2W A;  2HQM A;  2R0G A;  2XYO A;  4A9W A;  4UP3 A;  1GRG A;  1H6V A;  1RYI A;  2JB2 A;  3ATR A;  3AWI A;  1GND A;  1PXA A;  1ZX9 A;  1D4E A;  3D8X A;  3DK9 A;  5KMP A;  2RGJ A;  3DK8 A;  4CY8 A;  2BXR A;  2GH5 A;  2R45 A;  3K7Q X;  4D04 A;  4FK1 A;  3NNE A;  2C65 A;  4J34 A;  5U1O A;  1S3B A;  4KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...