1H82A

Structure of polyamine oxidase in complex with guazatine
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h82A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h82A02
2V5ZA 1JU2A 2XDOA 2X8CA 4C3YA 1EL7A 3IWAA 2XLPA 3S5WA 4AOSA 4IA5A 1H7XA 1LJ1A 1ZOVA 1GT8A 2XFNA 3DJJA 4FK1A 3CN8A 4D03A 3AYIA 1ZMCA 1NHPA 3V3OA 3DK4A 4H4WA 4USQA 4CCQA 4U8KA 2YG3A 1F3PA 2B7SA 1BGNA 1GERA 1M6IA 1ZK7A 2YR5A 4H4UA 4I58A 1OJTA 5BVAA 3LOVA 1GRFA 1GETA 4DGKA 1GPEA 3AEDA 2Z5YA 3UTEA 1GSNA 5BUKA 3ATQA 4H4XA 2C66A 2JAEA 2YR6A 2YM1A 1ONFA 3RP6A 1KSSA 2BCPA 3UKFA 3I3LA 4DSGA 5HHFA 1E6EA 2GF3A 2FJAA 1H82A 1LTXR 3COXA 3AE1A 1O5WA 3DGHA 3REDA 1DJNA 1PBCA 3H8LA 2ZZCA 3AD8B 2A8XA 4JNQA 4J56A 2B7RA 4EQSA 1NG4A 3FG2P 1H81A 1VG0A 4TLZA 4CY8A 4H4ZA 1F8WA 4JQ9A 3HZLA 3D8XA 3L1RA 3O0HA 4BK2A 2RABA 2XFUA 1DOCA 1S2YA 2GR2A 2PHHA 2WP9A 3CGEA 3M12A 5FS9A 4X9MA 1CL0A 2Y6QA 3SFEA 2R46A 3UOXA 4A65A 3M13A 3KU9A 3GD3A 4U8NA 2XVHA 4GR1A 3VRBA 3BHFA 2C67A 4CBQA 1IUVA 3P4SA 5KVIA 3F8PA 3R9UA 2XVEA 2GMJA 1K0IA 2OA1A 3I6DA 4UP3A 5JCMA 1CC4A 3GSIA 1OJDA 3DMEA 1H86A 1EL8A 2BYBA 1LQUA 2WHDA 3C96A 3NT6A 4HA6A 4AT0A 1CBOA 4B63A 4NTCA 1YQ4A 2WBAA 3UKAA 1GTEA 4K22A 2EQ9A 2BXRA 4J33A 4U8PA 1H7WA 5C2TA 2WPFA 3NYEA 1NDAA 1FOHA 3FMWA 4Z44A 2XLRA 2OLNA 1PJ5A 2QAEA 5ER0A 4EQRA 4U2LA 2W0HA 2R4EA 3CGCA 3WE0A 4JY2A 4P9SA 2C3CA 5FS8A 2CVJA 4YTPA 3AD9B 2WPEA 1K0JA 2A87A 1Q9IA 2C64A 4LU6A 2DKIA 2GQFA 3DK9A 4ZCDA 2OLOA 2C70A 1CC2A 3GYJA 3KPFA 3T37A 3KD9A 1BGJA 1COYA 1E1NA 1TDEA 2VVLA 3LJPA 3FIMB 1L9DA 3ZYXA 2YLWA 3F8DA 3VQRA 4CNJA 3H8IA 2VOUA 4AP3A 4RG4A 1KFYA 5U63A 3ABVA 2V60A 2O9ZA 4H4TA 4LIIA 1OJCA 1GRAA 3PS9A 5U25A 3AEFA 2J3NA 3AE6A 3SFDA 3P9UA 3K7QX 3VRAA 5LV9A 1GOSA 2JB2A 3NG7X 2VQ7A 3K7TA 3K30A 3AEGA 2WDQA 1DNCA 4Y4LA 3UTHA 4MJWA 4YSYA 3NIXA 1ELIA 2YLZA 4GDPA 5CKUA 1GRHA 1K4QA 1RSGA 3AEEA 3LB8A 3NN6X 3P1WA 4ICYA 1S3EA 3BNUA 4C77A 3QFAA 1GREA 1QLBA 1GEUA 5EB5A 1NHSA 2QCUA 1VDCA 3QSSA 4B68A 4N9XA 1XDIA 2JKCA 1KNPA 2Q6UA 1L9EA 3BNMA 4YSZA 1IUSA 1E1KA 2YR4A 3UOYA 3KA7A 4U8IA 3UKKA 2QA2A 1LQTA 2YAUA 4YTNA 3GD4A 3Q6JA 2XLSA 4CY6A 4U8JA 3QSEA 4U8OA 1PXBA 2WOVA 4TM0A 3KKJA 2YLXA 5J7XA 1DXLA 3G5RA 4AT2A 4YTMA 2XFPA 4GF7A 3UKLA 5KVHA 1ZDLA 1FL2A 1JRXA 1NAAA 2JB1A 5DBJA 1TDNA 1Y0PA 2WEUA 1GRTA 1GESA 1KNRA 2WU5A 1GRGA 3G5QA 2B9YA 3CNDA 5FMHA 4K7ZA 4H4RA 1NHQA 2ZZ0A 2XVJA 3AE4A 5GRTA 1DOEA 5TR3A 2CFYA 3B3RA 4K5RA 1BWCA 2GV8A 3ATRA 1L9CA 4OPCA 2BC1A 3VRDB 4CNKA 4JDRA 2VVMA 2IIDA 4J34A 4EQWA 1S3BA 4O5UA 1BZLA 2XYOA 2R0GA 5JCNA 4J36A 3FBSA 1EL5A 4B1BA 2GVCA 4REKA 5FS7A 1DOBA 2H89A 4BV6A 2WU2A 2VZ2A 3GWDA 3L8KA 2ZBWA 4J2WA 2YLRA 3SM8A 3CPJG 2WESA 1K0LA 1NG3A 2V3BA 1JOAA 4NTDA 1GV4A 4A79A 4NTEA 1BF3A 3NRNA 4U8LA 2YVFA 3JSKA 3AYLA 4EMIA 2X8GA 1YKJA 2XLUA 2ACZA 4YSHA 4A99A 2WDVA 2BC0A 2EQ6A 2YVGA 1XHCA 3NYCA 5M10A 1M64A 2V3AA 2XVIA 2WOIA 3AE9A 2XLTA 4Z26A 2BS3A 1NPXA 2X50A 3BI2A 3E1TA 3UTGA 5HYMA 4AOXA 1MXTA 3GRSA 4U2TA 4DSHA 2AAQA 1TRBA 2TMDA 1CC6A 3NLCA 4K8DA 3K7MX 4Z24A 4IVMB 3EAOA 3NK0X 1JEHA 4HB9A 1E1LA 2GB0A 4IV9A 3UP4A 5CQFA 1W4XA 1QJDA 1RYIA 3KLJA 1GRBA 2E5VA 4OPIA 2Q7VA 2YG5A 2YVJA 4IVOB 3QFBA 4USRA 1TDOA 4ZN0A 2VRLA 3NNEA 2YG4A 4H4PA 4RG3A 4TM1A 4FX9A 1MO9A 2BA9A 1JNZA 1Q1RA 3SQPA 2YM2A 1E7PA 5BRTA 1N4WA 5GSNA 4H4SA 1GTHA 2ARDA 4FK1C 1D7LA 2YG7A 2X3NA 4OPLA 1OJ9A 1PJ6A 3C4NA 2YWLA 3CNPA 1NEKA 2BS4A 1MOKA 4C5OA 1EL9A 2FJDA 3AEBA 5EBKA 3ICSA 2WP5A 4KX6A 3UOVA 3NK1X 3UKHA 4B66A 3RNMA 2OALA 1Q1WA 2BABA 5IPYA 2CDUA 1EBDA 1O95A 4ZCCA 2BK3A 3SGLA 4K5SA 2R0PA 3UP5A 1PBEA 1Z6LA 1OJAA 1HYUA 3NYFA 1TDFA 1ZMDA 1TDKA 3LZXA 4BK3A 1IUTA 3IHMA 4Z2UA 3BI4A 3QVPA 1F8RA 3CNJA 3P4PA 4NEVA 4YXDA 3RHAA 2Q0KA 3EPTA 3BHKA 3DJGX 3H4KA 3Q9TA 1NHRA 3DGZA 3GDNA 1PS9A 1UKVG 3ISHA 2IVDA 3NGCX 3LADA 2YQUA 3UOZA 1VG9A 1B4VA 2GAHB 3CIRA 3DJDA 2NVKX 4A9WA 1D5TA 4YWOA 1GNDA 4YKFA 4EIPA 3UCLA 1PDHA 3LZWA 1TYPA 4WCTA 2GR0A 1D4DA 4H4QA 4PAAA 2B9XA 2X99A 2ZZBA 4EQXA 4YKGA 3GMBA 3P4RA 4YSXA 2WPCA 1FEAA 1B37A 2XVFA 2V61A 1IUUA 3EF6A 3IF9A 4GRTA 1VQWA 1D4EA 3PO7A 1ZP0A 2BXSA 4ECHA 4TM4A 4Y4MA 3V3NA 2GAGB 4EMJA 3AE2A 2QA1A 3NTAA 4H7UA 3DJEA 5EOWA 4H4VA 5BULA 3RP8A 3F8RA 1PXAA 2NPXA 2CULA 2WOWA 4H4YA 4K2XA 4EM3A 4H2PA 3AWIA 2GR1A 2BK4A 2OAMA 2Z5XA 3GDPA 1F8SA 1FCDA 2IVEA 4UDRA 2GEWA 3FPZA 5FS6A 2C76A 3NKSA 4H2QA 2WQYA 3QJ4A 1V59A 2YLTA 4UDPA 3NTDA 5M0ZA 1TYTA 3DK8A 2AR8A 4XXGA 2FJEA 5JCKA 4JN9A 4J57A 1L0VA 4OCGA 4IA6A 2FBWA 3QSMA 3UKPA 4U2SA 4KPRA 1ZOYA 3AD7B 2UZZA 1H84A 4OPTA 3CTYA 2C65A 3KVEA 1H83A 4TLXA 2C72A 2XCGA 4UDQA 1DODA 3GYIA 2RGJA 3G5SA 3ALMA 1AOGA 2YLSA 1NENA 5C3JA 3ICTA 3ICRA 3GWFA 3M0OA 3NHOX 3QVRA 2GR3A 4M52A 1IUXA 1PBBA 3UTFA 1E39A 4C74A 1FECA 1N4UA 1GALA 1QO8A 2WDRA 3AB1A 3CPIG 3GMCA 2F5ZA 4OPUA 1P2EA 1CJ2A 4XWRA 3ZDNA 4JY3A 2GH5A 4NEWA 1KDGA 1GXFA 2X8HA 4GCMA 1YQZA 4ADWA 1N4VA 4B65A 3D1CA 1LVLA 2B9WA 2BS2A 2Y6RA 2E1MA 3EANA 1DJQA 2PYXA 5IQ1A 3RP7A 5JCIA 5KOWA 3CPHG 1KF6A 2XFQA 3NN0X 4CCRA 1XANA 4GUVA 4Y4NA 4Z2TA 4E0VA 3II4A 4JNAA 4OVIA 4BJYA 5IQ4A 3BI5A 2JB3A 1IJHA 1P2HA 4X9NA 4YT0A 1CJCA 1S2QA 3C4AA 4A7AA 3LXDA 4B67A 3PVCA 4BURA 1ZY8A 3S61A 2FJBA 4EMWA 4APNA 2Q0LA 2JBVA 1FEBA 4TM3A 1CHUA 3IC9A 1F6MA 1SEZA 2WS3A 5KRQA 2WETA 2BCGG 1X31B 3AE3A 1D4CA 3GRTA 1Y56B 5HXIA 2WP6A 5EB4A 4RSLA 1Y56A 1N1PA 2AQJA 3ALLA 1KSUA 2V6OA 1XPQA 1PXCA 2C7GA 3CGBA 4LA1A 2R4JA 2RGOA 2APGA 3AXBA 3CNSA 1PBFA 2GMHA 3V76A 2R0CA 2GQWA 2HQMA 4OPGA 4XWZA 4U8MA 3AECA 3AE5A 4GDEA 4O5QA 3AYJA 2C73A 2JK6A 3OC4A 3AEAA 4D04A 3AE7A 3B6DA 4NZHA 5KXJA 3URHA 4Z25A 3P4QA 1B8SA 1B5QA 4CRTA 5KWFA 1D7YA 1JRZA 1LPFA 4I59A 4Z2RA 4J31A 2H88A 4H2RA 1E1MA 2XFOA 4WX1A 2BK5A 2C75A 4PABA 3CGDA 1YY5A 3OZ2A 4H2NA 1O94A 2I0ZA 2R45A 1YQ3A 2C3DA 2R9ZA 3ADAB 4B69A 4EIQA 3NK2X 1CJ4A 4BK1A 1PN0A 1JNRA 1BKWA 2EQ7A 4C3XA 1VRQB 3VR9A 2DKHA 1JRYA 1LV0A 2B76A 1ZKQA 1IUWA 4X4JA 3NH3X 3AE8A 4AP1A 4A6NB 5J60A 3VR8A 1CF3A 5KOXA 5JCLA 1REOA 4FDCB 1RP0A 4DNAA 2RGHA 4A6NA 4B64A 3DH9A 3UKQA 1ZX9A 3DA1A 4EM4A 1PBDA 2TPRA 2GRTA 2VQBA 3ALJA 1CJ3A 4BJZA 5L46A 1PHHA 3IHGA 5HY5A 2A89A 5U1OA 1H6VA 2BACA 4OPDA 4A5LA 3ITJA 2E4GA 3CNTA 2VVLG 2YG6A 2EQ8A 1PJ7A 4Z43A 4H50A 2VRMA
chains in the Genus database with same CATH superfamily
2V5ZA 1JU2A 2XDOA 2X8CA 4C3YA 1EL7A 3IWAA 2XLPA 3S5WA 4AOSA 4IA5A 1H7XA 1LJ1A 1ZOVA 1GT8A 2XFNA 3DJJA 4FK1A 3CN8A 4D03A 3AYIA 1ZMCA 1NHPA 3V3OA 3DK4A 4H4WA 4USQA 4CCQA 4G6GA 4U8KA 2YG3A 1F3PA 2B7SA 1BGNA 1GERA 1M6IA 1ZK7A 2YR5A 3SYIA 3T31A 4H4UA 4I58A 1OJTA 5BVAA 3LOVA 1GRFA 5KMRA 1GETA 4DGKA 1GPEA 3AEDA 2Z5YA 3UTEA 1GSNA 5BUKA 3ATQA 4H4XA 2C66A 2JAEA 2BRYA 2YR6A 2YM1A 3T0KA 1ONFA 3RP6A 1KSSA 2BCPA 3UKFA 3I3LA 4DSGA 5HHFA 1E6EA 2GF3A 2FJAA 1H82A 1LTXR 3COXA 3AE1A 1O5WA 3DGHA 3REDA 1DJNA 1PBCA 3H8LA 2ZZCA 3AD8B 2A8XA 4JNQA 4J56A 2B7RA 4EQSA 1NG4A 3FG2P 1H81A 1VG0A 4TLZA 4CY8A 4H4ZA 1F8WA 4JQ9A 3HZLA 3D8XA 3L1RA 3O0HA 3CMMA 4BK2A 2RABA 2XFUA 1DOCA 1S2YA 2GR2A 2PHHA 2WP9A 3CGEA 3M12A 5FS9A 4X9MA 1CL0A 2Y6QA 3SFEA 2R46A 3UOXA 4A65A 3M13A 3KU9A 3GD3A 4U8NA 2XVHA 4GR1A 3VRBA 3BHFA 2C67A 4CBQA 1IUVA 3T14A 3P4SA 5KVIA 2BRAA 3F8PA 2XVEA 3R9UA 2GMJA 1K0IA 2OA1A 3I6DA 4UP3A 5JCMA 1CC4A 3GSIA 1OJDA 3DMEA 1H86A 1EL8A 2BYBA 1LQUA 2WHDA 3C96A 3NT6A 4HA6A 4AT0A 1CBOA 4B63A 4NTCA 1YQ4A 2WBAA 3UKAA 1GTEA 4K22A 2EQ9A 2BXRA 4J33A 4U8PA 1H7WA 5C2TA 2WPFA 3NYEA 1NDAA 1FOHA 3FMWA 4Z44A 2XLRA 2OLNA 1PJ5A 2QAEA 4C5OA 5ER0A 4EQRA 4U2LA 2W0HA 2R4EA 3CGCA 3WE0A 4JY2A 4P9SA 2C3CA 3HYWA 5FS8A 2CVJA 4YTPA 3AD9B 2WPEA 1K0JA 2A87A 1Q9IA 2C64A 4LU6A 2DKIA 2GQFA 3DK9A 4ZCDA 3SX6A 2OLOA 2C70A 1CC2A 3GYJA 3KPFA 3T37A 3KD9A 1BGJA 1COYA 1E1NA 1TDEA 2VVLA 3LJPA 3FIMB 1L9DA 3ZYXA 2YLWA 3F8DA 3VQRA 4CNJA 3H8IA 2VOUA 3SY4A 4RG4A 4AP3A 1KFYA 5U63A 3ABVA 2V60A 2O9ZA 4H4TA 4LIIA 1OJCA 1GRAA 3PS9A 5U25A 3AEFA 2J3NA 3AE6A 3SFDA 3P9UA 3K7QX 3VRAA 5LV9A 1GOSA 2JB2A 3NG7X 2VQ7A 3K7TA 3K30A 3AEGA 2WDQA 1DNCA 4Y4LA 3T2KA 3UTHA 4MJWA 4YSYA 3NIXA 1ELIA 2YLZA 4GDPA 5CKUA 1GRHA 1K4QA 1RSGA 3AEEA 3LB8A 3NN6X 3P1WA 4ICYA 1S3EA 3BNUA 4C77A 3QFAA 1GREA 1QLBA 1GEUA 5EB5A 1NHSA 2QCUA 1VDCA 3QSSA 4B68A 4N9XA 1XDIA 2JKCA 1KNPA 2Q6UA 1L9EA 3BNMA 4YSZA 1IUSA 1E1KA 2YR4A 3UOYA 3KA7A 4U8IA 3UKKA 2QA2A 1LQTA 2YAUA 4YTNA 3GD4A 3Q6JA 2XLSA 4CY6A 4U8JA 3QSEA 4U8OA 1PXBA 2WOVA 4TM0A 3KKJA 2YLXA 5J7XA 1DXLA 3G5RA 4AT2A 4YTMA 2XFPA 4GF7A 3UKLA 5KVHA 1ZDLA 1FL2A 1JRXA 1NAAA 2JB1A 5DBJA 1TDNA 1Y0PA 2WEUA 3SZ0A 1GRTA 1GESA 1KNRA 2WU5A 1GRGA 3G5QA 2B9YA 3CNDA 5FMHA 4K7ZA 4H4RA 3T2YA 1NHQA 2ZZ0A 2XVJA 3AE4A 5GRTA 1DOEA 5TR3A 2CFYA 3B3RA 4K5RA 1BWCA 2GV8A 3ATRA 1L9CA 4OPCA 4NNJA 2BC1A 3VRDB 4CNKA 4JDRA 2VVMA 2IIDA 4J34A 4EQWA 1S3BA 4O5UA 1BZLA 2XYOA 2R0GA 5JCNA 4J36A 3FBSA 1EL5A 4B1BA 2GVCA 4REKA 5FS7A 1DOBA 2H89A 4BV6A 2WU2A 2VZ2A 3GWDA 3L8KA 2ZBWA 4J2WA 2YLRA 3SM8A 3CPJG 2WESA 1K0LA 1NG3A 2V3BA 1JOAA 4NTDA 1GV4A 4A79A 4NTEA 1BF3A 3NRNA 4U8LA 3SXIA 2YVFA 3JSKA 3AYLA 4EMIA 2X8GA 1YKJA 2XLUA 2ACZA 4YSHA 4A99A 2WDVA 2BC0A 2EQ6A 2YVGA 1XHCA 3NYCA 5M10A 4G74A 1M64A 2V3AA 2XVIA 2WOIA 3AE9A 2XLTA 4Z26A 2BS3A 1NPXA 2X50A 3BI2A 3E1TA 3UTGA 5HYMA 4AOXA 1MXTA 4II3A 3GRSA 4U2TA 4DSHA 2AAQA 1TRBA 2TMDA 1CC6A 3NLCA 4K8DA 3K7MX 4Z24A 4IVMB 4GAPA 3EAOA 5KMSA 3NK0X 1JEHA 4HB9A 1E1LA 2GB0A 4IV9A 4NWZA 3UP4A 5CQFA 1W4XA 1QJDA 3SZFA 1RYIA 3KLJA 1GRBA 2E5VA 4OPIA 2Q7VA 2YG5A 2YVJA 4IVOB 3QFBA 4USRA 1TDOA 4ZN0A 2VRLA 3NNEA 2YG4A 4H4PA 4RG3A 4TM1A 4FX9A 1MO9A 2BA9A 1JNZA 1Q1RA 3SQPA 2YM2A 1E7PA 5BRTA 1N4WA 5GSNA 4H4SA 1GTHA 2ARDA 4FK1C 1D7LA 3SZWA 2YG7A 2X3NA 4OPLA 1OJ9A 1PJ6A 3C4NA 2YWLA 3CNPA 1NEKA 2BS4A 1MOKA 3GYXA 1EL9A 2FJDA 3AEBA 5EBKA 3ICSA 2WP5A 4KX6A 3UOVA 3NK1X 3UKHA 4B66A 3RNMA 2OALA 1Q1WA 2BABA 5IPYA 2CDUA 1EBDA 1O95A 4ZCCA 2BK3A 3SGLA 4K5SA 2R0PA 3UP5A 1PBEA 1Z6LA 1OJAA 1HYUA 3NYFA 1TDFA 1ZMDA 1TDKA 3LZXA 4G6HA 4BK3A 1IUTA 3IHMA 4Z2UA 3BI4A 3QVPA 1F8RA 3CNJA 3P4PA 4NEVA 4YXDA 3RHAA 2Q0KA 3EPTA 3BHKA 3DJGX 3H4KA 3Q9TA 1NHRA 3DGZA 3GDNA 1PS9A 1UKVG 3ISHA 2IVDA 3NGCX 3LADA 2YQUA 3UOZA 1VG9A 1B4VA 2GAHB 3CIRA 3DJDA 2NVKX 4A9WA 1D5TA 4YWOA 1GNDA 4YKFA 4EIPA 3UCLA 1PDHA 3LZWA 1TYPA 4WCTA 2GR0A 1D4DA 4H4QA 4PAAA 2B9XA 2X99A 2ZZBA 4EQXA 4YKGA 3GMBA 3P4RA 4YSXA 2WPCA 1FEAA 1B37A 2XVFA 2V61A 1IUUA 3EF6A 3IF9A 4GRTA 1VQWA 1D4EA 3PO7A 1ZP0A 2BXSA 4ECHA 4TM4A 4Y4MA 3V3NA 2GAGB 4EMJA 3AE2A 2QA1A 3NTAA 4H7UA 3DJEA 5EOWA 4H4VA 5BULA 3RP8A 3F8RA 1PXAA 2NPXA 2CULA 2WOWA 4GAVA 4H4YA 4K2XA 4EM3A 4H2PA 3AWIA 2GR1A 2BK4A 2OAMA 2Z5XA 3GDPA 1F8SA 1FCDA 2IVEA 5KMPA 4UDRA 2GEWA 3FPZA 5FS6A 2C76A 3NKSA 4H2QA 2WQYA 3QJ4A 1V59A 2YLTA 4UDPA 3NTDA 5M0ZA 1TYTA 3DK8A 2AR8A 4XXGA 2FJEA 5JCKA 4JN9A 4J57A 1L0VA 4OCGA 4IA6A 2FBWA 3QSMA 3UKPA 4U2SA 4KPRA 1ZOYA 3AD7B 3HYXA 3T2ZA 2UZZA 1H84A 4OPTA 3CTYA 2C65A 3KVEA 1H83A 4TLXA 2C72A 2XCGA 4UDQA 1DODA 3GYIA 2RGJA 3G5SA 3ALMA 1AOGA 2YLSA 1NENA 5C3JA 3ICTA 3ICRA 3GWFA 3M0OA 3NHOX 3QVRA 2GR3A 4M52A 1IUXA 1PBBA 3UTFA 1E39A 4C74A 1FECA 1N4UA 1GALA 1QO8A 2WDRA 3AB1A 3CPIG 3GMCA 2F5ZA 4OPUA 1P2EA 1CJ2A 4XWRA 3ZDNA 4JY3A 2GH5A 4NEWA 1KDGA 1GXFA 2X8HA 4GCMA 1YQZA 4ADWA 1N4VA 4B65A 3D1CA 1LVLA 2B9WA 2BS2A 2Y6RA 2E1MA 3EANA 1DJQA 2PYXA 5IQ1A 3RP7A 5JCIA 5KOWA 3CPHG 1KF6A 2XFQA 3NN0X 4CCRA 1XANA 4GUVA 4Y4NA 4Z2TA 4E0VA 3II4A 4JNAA 4OVIA 4BJYA 5IQ4A 3BI5A 2JB3A 1IJHA 1P2HA 4X9NA 4G9KA 4YT0A 1CJCA 1S2QA 3C4AA 4G73A 4A7AA 3LXDA 4B67A 3PVCA 4BURA 1ZY8A 3S61A 2FJBA 4EMWA 4APNA 2Q0LA 5KMQA 2JBVA 1FEBA 4TM3A 1CHUA 3IC9A 1F6MA 1SEZA 2WS3A 5KRQA 2WETA 2BCGG 1X31B 3AE3A 1D4CA 3GRTA 1Y56B 5HXIA 2WP6A 5EB4A 4RSLA 1Y56A 1N1PA 2AQJA 3ALLA 5KNLA 1KSUA 2V6OA 1XPQA 1PXCA 2C7GA 3CGBA 4LA1A 2R4JA 2RGOA 2APGA 3AXBA 3CNSA 1PBFA 2GMHA 3V76A 2R0CA 2GQWA 2HQMA 4OPGA 4XWZA 2C4CA 4U8MA 3AECA 3AE5A 4GDEA 4O5QA 3SZCA 3AYJA 2C73A 2JK6A 3OC4A 3AEAA 4D04A 3AE7A 3B6DA 4NZHA 5KXJA 3URHA 4Z25A 3P4QA 1B8SA 1B5QA 4CRTA 5KWFA 1D7YA 1JRZA 1LPFA 4I59A 4Z2RA 4J31A 2H88A 3HYVA 1E1MA 4H2RA 2XFOA 4WX1A 2BK5A 3KPKA 2C75A 4PABA 3CGDA 1YY5A 3OZ2A 4H2NA 1O94A 2I0ZA 2R45A 1YQ3A 2C3DA 2R9ZA 3ADAB 4B69A 4EIQA 3NK2X 1CJ4A 4BK1A 1PN0A 1JNRA 1BKWA 2EQ7A 4C3XA 1VRQB 3VR9A 2DKHA 1JRYA 1LV0A 2B76A 4II2A 1ZKQA 1IUWA 4X4JA 3NH3X 3AE8A 4AP1A 4A6NB 5J60A 3VR8A 1CF3A 5KOXA 5JCLA 1REOA 4FDCB 1RP0A 4DNAA 2RGHA 4A6NA 4B64A 3DH9A 3UKQA 1ZX9A 3DA1A 4EM4A 1PBDA 2TPRA 2GRTA 2VQBA 3ALJA 1CJ3A 4BJZA 5L46A 1PHHA 3IHGA 5HY5A 2A89A 5U1OA 1H6VA 2BACA 4OPDA 4A5LA 3ITJA 2E4GA 3CNTA 2VVLG 2YG6A 2EQ8A 1PJ7A 4Z43A 4H50A 2VRMA
chains in the Genus database with same CATH topology
2V5ZA 1JU2A 2XDOA 2X8CA 4C3YA 1EL7A 3IWAA 2XLPA 3S5WA 4AOSA 4IA5A 1H7XA 1LJ1A 1ZOVA 1GT8A 2XFNA 3DJJA 4FK1A 3CN8A 4D03A 3AYIA 1ZMCA 1NHPA 3V3OA 3DK4A 4H4WA 4USQA 4CCQA 4G6GA 4U8KA 2YG3A 1F3PA 2B7SA 1BGNA 1GERA 1M6IA 1ZK7A 2YR5A 3SYIA 3T31A 4H4UA 4I58A 1OJTA 5BVAA 3LOVA 1GRFA 5KMRA 1GETA 4DGKA 1GPEA 3AEDA 2Z5YA 3UTEA 1GSNA 5BUKA 3ATQA 4H4XA 2C66A 2JAEA 2BRYA 2YR6A 2YM1A 3T0KA 1ONFA 3RP6A 1KSSA 2BCPA 3UKFA 3I3LA 4DSGA 5HHFA 1E6EA 2GF3A 2FJAA 1H82A 1LTXR 3COXA 3AE1A 1O5WA 3DGHA 3REDA 1DJNA 1PBCA 3H8LA 2ZZCA 3AD8B 2A8XA 4JNQA 4J56A 2B7RA 4EQSA 1NG4A 3FG2P 1H81A 1VG0A 4TLZA 4CY8A 4H4ZA 1F8WA 4JQ9A 3HZLA 3D8XA 3L1RA 3O0HA 3CMMA 4BK2A 2RABA 2XFUA 1DOCA 1S2YA 2GR2A 2PHHA 2WP9A 3CGEA 3M12A 5FS9A 4X9MA 1CL0A 2Y6QA 3SFEA 2R46A 3UOXA 4A65A 3M13A 3KU9A 3GD3A 4U8NA 2XVHA 4GR1A 3VRBA 3BHFA 2C67A 4CBQA 1IUVA 3T14A 3P4SA 5KVIA 2BRAA 3F8PA 2XVEA 3R9UA 2GMJA 1K0IA 2OA1A 3I6DA 4UP3A 5JCMA 1CC4A 3GSIA 1OJDA 3DMEA 1H86A 1EL8A 2BYBA 1LQUA 2WHDA 3C96A 3NT6A 4HA6A 4AT0A 1CBOA 4B63A 4NTCA 1YQ4A 2WBAA 3UKAA 1GTEA 4K22A 2EQ9A 2BXRA 4J33A 4U8PA 1H7WA 5C2TA 2WPFA 3NYEA 1NDAA 1FOHA 3FMWA 4Z44A 2XLRA 2OLNA 1PJ5A 2QAEA 4C5OA 5ER0A 4EQRA 4U2LA 2W0HA 2R4EA 3CGCA 3WE0A 4JY2A 4P9SA 2C3CA 3HYWA 5FS8A 2CVJA 4YTPA 3AD9B 2WPEA 1K0JA 2A87A 1Q9IA 2C64A 4LU6A 2DKIA 2GQFA 3DK9A 4ZCDA 3SX6A 2OLOA 2C70A 1CC2A 3GYJA 3KPFA 3T37A 3KD9A 1BGJA 1COYA 1E1NA 1TDEA 2VVLA 3LJPA 3FIMB 1L9DA 3ZYXA 2YLWA 3F8DA 3VQRA 4CNJA 3H8IA 2VOUA 3SY4A 4RG4A 4AP3A 1KFYA 5U63A 3ABVA 2V60A 2O9ZA 4H4TA 4LIIA 1OJCA 1GRAA 3PS9A 5U25A 3AEFA 2J3NA 3AE6A 3SFDA 3P9UA 3K7QX 3VRAA 5LV9A 1GOSA 2JB2A 3NG7X 2VQ7A 3K7TA 3K30A 3AEGA 2WDQA 1DNCA 4Y4LA 3T2KA 3UTHA 4MJWA 4YSYA 3NIXA 1ELIA 2YLZA 4GDPA 5CKUA 1GRHA 1K4QA 1RSGA 3AEEA 3LB8A 3NN6X 3P1WA 4ICYA 1S3EA 3BNUA 4C77A 3QFAA 1GREA 1QLBA 1GEUA 5EB5A 1NHSA 2QCUA 1VDCA 3QSSA 4B68A 4N9XA 1XDIA 2JKCA 1KNPA 2Q6UA 1L9EA 3BNMA 4YSZA 1IUSA 1E1KA 2YR4A 3UOYA 3KA7A 4U8IA 3UKKA 2QA2A 1LQTA 2YAUA 4YTNA 3GD4A 3Q6JA 2XLSA 4CY6A 4U8JA 3QSEA 4U8OA 1PXBA 2WOVA 4TM0A 3KKJA 2YLXA 5J7XA 1DXLA 3G5RA 4AT2A 4YTMA 2XFPA 4GF7A 3UKLA 5KVHA 1ZDLA 1FL2A 1JRXA 1NAAA 2JB1A 5DBJA 1TDNA 1Y0PA 2WEUA 3SZ0A 1GRTA 1GESA 1KNRA 2WU5A 1GRGA 3G5QA 2B9YA 3CNDA 5FMHA 4K7ZA 4H4RA 3T2YA 1NHQA 2ZZ0A 2XVJA 3AE4A 5GRTA 1DOEA 5TR3A 2CFYA 3B3RA 4K5RA 1BWCA 2GV8A 3ATRA 1L9CA 4OPCA 4NNJA 2BC1A 3VRDB 4CNKA 4JDRA 2VVMA 2IIDA 4J34A 4EQWA 1S3BA 4O5UA 1BZLA 2XYOA 2R0GA 5JCNA 4J36A 3FBSA 1EL5A 4B1BA 2GVCA 4REKA 5FS7A 1DOBA 2H89A 4BV6A 2WU2A 2VZ2A 3GWDA 3L8KA 2ZBWA 4J2WA 2YLRA 3SM8A 3CPJG 2WESA 1K0LA 1NG3A 2V3BA 1JOAA 4NTDA 1GV4A 4A79A 4NTEA 1BF3A 3NRNA 4U8LA 3SXIA 2YVFA 3JSKA 3AYLA 4EMIA 2X8GA 1YKJA 2XLUA 2ACZA 4YSHA 4A99A 2WDVA 2BC0A 2EQ6A 2YVGA 1XHCA 3NYCA 5M10A 4G74A 1M64A 2V3AA 2XVIA 2WOIA 3AE9A 2XLTA 4Z26A 2BS3A 1NPXA 2X50A 3BI2A 3E1TA 3UTGA 5HYMA 4AOXA 1MXTA 4II3A 3GRSA 4U2TA 4DSHA 2AAQA 1TRBA 2TMDA 1CC6A 3NLCA 4K8DA 3K7MX 4Z24A 4IVMB 4GAPA 3EAOA 5KMSA 3NK0X 1JEHA 4HB9A 1E1LA 2GB0A 4IV9A 4NWZA 3UP4A 5CQFA 1W4XA 1QJDA 3SZFA 1RYIA 3KLJA 1GRBA 2E5VA 4OPIA 2Q7VA 2YG5A 2YVJA 4IVOB 3QFBA 4USRA 1TDOA 4ZN0A 2VRLA 3NNEA 2YG4A 4H4PA 4RG3A 4TM1A 4FX9A 1MO9A 2BA9A 1JNZA 1Q1RA 3SQPA 2YM2A 1E7PA 5BRTA 1N4WA 5GSNA 4H4SA 1GTHA 2ARDA 4FK1C 1D7LA 3SZWA 2YG7A 2X3NA 4OPLA 1OJ9A 1PJ6A 3C4NA 2YWLA 3CNPA 1NEKA 2BS4A 1MOKA 3GYXA 1EL9A 2FJDA 3AEBA 5EBKA 3ICSA 2WP5A 4KX6A 3UOVA 3NK1X 3UKHA 4B66A 3RNMA 2OALA 1Q1WA 2BABA 5IPYA 2CDUA 1EBDA 1O95A 4ZCCA 2BK3A 3SGLA 4K5SA 2R0PA 3UP5A 1PBEA 1Z6LA 1OJAA 1HYUA 3NYFA 1TDFA 1ZMDA 1TDKA 3LZXA 4G6HA 4BK3A 1IUTA 3IHMA 4Z2UA 3BI4A 3QVPA 1F8RA 3CNJA 3P4PA 4NEVA 4YXDA 3RHAA 2Q0KA 3EPTA 3BHKA 3DJGX 3H4KA 3Q9TA 1NHRA 3DGZA 3GDNA 1PS9A 1UKVG 3ISHA 2IVDA 3NGCX 3LADA 2YQUA 3UOZA 1VG9A 1B4VA 2GAHB 3CIRA 3DJDA 2NVKX 4A9WA 1D5TA 4YWOA 1GNDA 4YKFA 4EIPA 3UCLA 1PDHA 3LZWA 1TYPA 4WCTA 2GR0A 1D4DA 4H4QA 4PAAA 2B9XA 2X99A 2ZZBA 4EQXA 4YKGA 3GMBA 3P4RA 4YSXA 2WPCA 1FEAA 1B37A 2XVFA 2V61A 1IUUA 3EF6A 3IF9A 4GRTA 1VQWA 1D4EA 3PO7A 1ZP0A 2BXSA 4ECHA 4TM4A 4Y4MA 3V3NA 2GAGB 4EMJA 3AE2A 2QA1A 3NTAA 4H7UA 3DJEA 5EOWA 4H4VA 5BULA 3RP8A 3F8RA 1PXAA 2NPXA 2CULA 2WOWA 4GAVA 4H4YA 4K2XA 4EM3A 4H2PA 3AWIA 2GR1A 2BK4A 2OAMA 2Z5XA 3GDPA 1F8SA 1FCDA 2IVEA 5KMPA 4UDRA 2GEWA 3FPZA 5FS6A 2C76A 3NKSA 4H2QA 2WQYA 3QJ4A 1V59A 2YLTA 4UDPA 3NTDA 5M0ZA 1TYTA 3DK8A 2AR8A 4XXGA 2FJEA 5JCKA 4JN9A 4J57A 1L0VA 4OCGA 4IA6A 2FBWA 3QSMA 3UKPA 4U2SA 4KPRA 1ZOYA 3AD7B 3HYXA 3T2ZA 2UZZA 1H84A 4OPTA 3CTYA 2C65A 3KVEA 1H83A 4TLXA 2C72A 2XCGA 4UDQA 1DODA 3GYIA 2RGJA 3G5SA 3ALMA 1AOGA 2YLSA 1NENA 5C3JA 3ICTA 3ICRA 3GWFA 3M0OA 3NHOX 3QVRA 2GR3A 4M52A 1IUXA 1PBBA 3UTFA 1E39A 4C74A 1FECA 1N4UA 1GALA 1QO8A 2WDRA 3AB1A 3CPIG 3GMCA 2F5ZA 4OPUA 1P2EA 1CJ2A 4XWRA 3ZDNA 4JY3A 2GH5A 4NEWA 1KDGA 1GXFA 2X8HA 4GCMA 1YQZA 4ADWA 1N4VA 4B65A 3D1CA 1LVLA 2B9WA 2BS2A 2Y6RA 2E1MA 3EANA 1DJQA 2PYXA 5IQ1A 3RP7A 5JCIA 5KOWA 3CPHG 1KF6A 2XFQA 3NN0X 4CCRA 1XANA 4GUVA 4Y4NA 4Z2TA 4E0VA 3II4A 4JNAA 4OVIA 4BJYA 5IQ4A 3BI5A 2JB3A 1IJHA 1P2HA 4X9NA 4G9KA 4YT0A 1CJCA 1S2QA 3C4AA 4G73A 4A7AA 3LXDA 4B67A 3PVCA 4BURA 1ZY8A 3S61A 2FJBA 4EMWA 4APNA 2Q0LA 5KMQA 2JBVA 1FEBA 4TM3A 1CHUA 3IC9A 1F6MA 1SEZA 2WS3A 5KRQA 2WETA 2BCGG 1X31B 3AE3A 1D4CA 3GRTA 1Y56B 5HXIA 2WP6A 5EB4A 4RSLA 1Y56A 1N1PA 2AQJA 3ALLA 5KNLA 1KSUA 2V6OA 1XPQA 1PXCA 2C7GA 3CGBA 4LA1A 2R4JA 2RGOA 2APGA 3AXBA 3CNSA 1PBFA 2GMHA 3V76A 2R0CA 2GQWA 2HQMA 4OPGA 4XWZA 2C4CA 4U8MA 3AECA 3AE5A 4GDEA 4O5QA 3SZCA 3AYJA 2C73A 2JK6A 3OC4A 3AEAA 4D04A 3AE7A 3B6DA 4NZHA 5KXJA 3URHA 4Z25A 3P4QA 1B8SA 1B5QA 4CRTA 5KWFA 1D7YA 1JRZA 1LPFA 4I59A 4Z2RA 4J31A 2H88A 3HYVA 1E1MA 4H2RA 2XFOA 4WX1A 2BK5A 3KPKA 2C75A 4PABA 3CGDA 1YY5A 3OZ2A 4H2NA 1O94A 2I0ZA 2R45A 1YQ3A 2C3DA 2R9ZA 3ADAB 4B69A 4EIQA 3NK2X 1CJ4A 4BK1A 1PN0A 1JNRA 1BKWA 2EQ7A 4C3XA 1VRQB 3VR9A 2DKHA 1JRYA 1LV0A 2B76A 4II2A 1ZKQA 1IUWA 4X4JA 3NH3X 3AE8A 4AP1A 4A6NB 5J60A 3VR8A 1CF3A 5KOXA 5JCLA 1REOA 4FDCB 1RP0A 4DNAA 2RGHA 4A6NA 4B64A 3DH9A 3UKQA 1ZX9A 3DA1A 4EM4A 1PBDA 2TPRA 2GRTA 2VQBA 3ALJA 1CJ3A 4BJZA 5L46A 1PHHA 3IHGA 5HY5A 2A89A 5U1OA 1H6VA 2BACA 4OPDA 4A5LA 3ITJA 2E4GA 3CNTA 2VVLG 2YG6A 2EQ8A 1PJ7A 4Z43A 4H50A 2VRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5Z A;  1JU2 A;  2XDO A;  2X8C A;  4C3Y A;  1EL7 A;  3IWA A;  2XLP A;  3S5W A;  4AOS A;  4IA5 A;  1H7X A;  1LJ1 A;  1ZOV A;  1GT8 A;  2XFN A;  3DJJ A;  4FK1 A;  3CN8 A;  4D03 A;  3AYI A;  1ZMC A;  1NHP A;  3V3O A;  3DK4 A;  4H4W A;  4USQ A;  4CCQ A;  4U8K A;  2YG3 A;  1F3P A;  2B7S A;  1BGN A;  1GER A;  1M6I A;  1ZK7 A;  2YR5 A;  4H4U A;  4I58 A;  1OJT A;  5BVA A;  3LOV A;  1GRF A;  1GET A;  4DGK A;  1GPE A;  3AED A;  2Z5Y A;  3UTE A;  1GSN A;  5BUK A;  3ATQ A;  4H4X A;  2C66 A;  2JAE A;  2YR6 A;  2YM1 A;  1ONF A;  3RP6 A;  1KSS A;  2BCP A;  3UKF A;  3I3L A;  4DSG A;  5HHF A;  1E6E A;  2GF3 A;  2FJA A;  1H82 A;  1LTX R;  3COX A;  3AE1 A;  1O5W A;  3DGH A;  3RED A;  1DJN A;  1PBC A;  3H8L A;  2ZZC A;  3AD8 B;  2A8X A;  4JNQ A;  4J56 A;  2B7R A;  4EQS A;  1NG4 A;  3FG2 P;  1H81 A;  1VG0 A;  4TLZ A;  4CY8 A;  4H4Z A;  1F8W A;  4JQ9 A;  3HZL A;  3D8X A;  3L1R A;  3O0H A;  4BK2 A;  2RAB A;  2XFU A;  1DOC A;  1S2Y A;  2GR2 A;  2PHH A;  2WP9 A;  3CGE A;  3M12 A;  5FS9 A;  4X9M A;  1CL0 A;  2Y6Q A;  3SFE A;  2R46 A;  3UOX A;  4A65 A;  3M13 A;  3KU9 A;  3GD3 A;  4U8N A;  2XVH A;  4GR1 A;  3VRB A;  3BHF A;  2C67 A;  4CBQ A;  1IUV A;  3P4S A;  5KVI A;  3F8P A;  3R9U A;  2XVE A;  2GMJ A;  1K0I A;  2OA1 A;  3I6D A;  4UP3 A;  5JCM A;  1CC4 A;  3GSI A;  1OJD A;  3DME A;  1H86 A;  1EL8 A;  2BYB A;  1LQU A;  2WHD A;  3C96 A;  3NT6 A;  4HA6 A;  4AT0 A;  1CBO A;  4B63 A;  4NTC A;  1YQ4 A;  2WBA A;  3UKA A;  1GTE A;  4K22 A;  2EQ9 A;  2BXR A;  4J33 A;  4U8P A;  1H7W A;  5C2T A;  2WPF A;  3NYE A;  1NDA A;  1FOH A;  3FMW A;  4Z44 A;  2XLR A;  2OLN A;  1PJ5 A;  2QAE A;  5ER0 A;  4EQR A;  4U2L A;  2W0H A;  2R4E A;  3CGC A;  3WE0 A;  4JY2 A;  4P9S A;  2C3C A;  5FS8 A;  2CVJ A;  4YTP A;  3AD9 B;  2WPE A;  1K0J A;  2A87 A;  1Q9I A;  2C64 A;  4LU6 A;  2DKI A;  2GQF A;  3DK9 A;  4ZCD A;  2OLO A;  2C70 A;  1CC2 A;  3GYJ A;  3KPF A;  3T37 A;  3KD9 A;  1BGJ A;  1COY A;  1E1N A;  1TDE A;  2VVL A;  3LJP A;  3FIM B;  1L9D A;  3ZYX A;  2YLW A;  3F8D A;  3VQR A;  4CNJ A;  3H8I A;  2VOU A;  4AP3 A;  4RG4 A;  1KFY A;  5U63 A;  3ABV A;  2V60 A;  2O9Z A;  4H4T A;  4LII A;  1OJC A;  1GRA A;  3PS9 A;  5U25 A;  3AEF A;  2J3N A;  3AE6 A;  3SFD A;  3P9U A;  3K7Q X;  3VRA A;  5LV9 A;  1GOS A;  2JB2 A;  3NG7 X;  2VQ7 A;  3K7T A;  3K30 A;  3AEG A;  2WDQ A;  1DNC A;  4Y4L A;  3UTH A;  4MJW A;  4YSY A;  3NIX A;  1ELI A;  2YLZ A;  4GDP A;  5CKU A;  1GRH A;  1K4Q A;  1RSG A;  3AEE A;  3LB8 A;  3NN6 X;  3P1W A;  4ICY A;  1S3E A;  3BNU A;  4C77 A;  3QFA A;  1GRE A;  1QLB A;  1GEU A;  5EB5 A;  1NHS A;  2QCU A;  1VDC A;  3QSS A;  4B68 A;  4N9X A;  1XDI A;  2JKC A;  1KNP A;  2Q6U A;  1L9E A;  3BNM A;  4YSZ A;  1IUS A;  1E1K A;  2YR4 A;  3UOY A;  3KA7 A;  4U8I A;  3UKK A;  2QA2 A;  1LQT A;  2YAU A;  4YTN A;  3GD4 A;  3Q6J A;  2XLS A;  4CY6 A;  4U8J A;  3QSE A;  4U8O A;  1PXB A;  2WOV A;  4TM0 A;  3KKJ A;  2YLX A;  5J7X A;  1DXL A;  3G5R A;  4AT2 A;  4YTM A;  2XFP A;  4GF7 A;  3UKL A;  5KVH A;  1ZDL A;  1FL2 A;  1JRX A;  1NAA A;  2JB1 A;  5DBJ A;  1TDN A;  1Y0P A;  2WEU A;  1GRT A;  1GES A;  1KNR A;  2WU5 A;  1GRG A;  3G5Q A;  2B9Y A;  3CND A;  5FMH A;  4K7Z A;  4H4R A;  1NHQ A;  2ZZ0 A;  2XVJ A;  3AE4 A;  5GRT A;  1DOE A;  5TR3 A;  2CFY A;  3B3R A;  4K5R A;  1BWC A;  2GV8 A;  3ATR A;  1L9C A;  4OPC A;  2BC1 A;  3VRD B;  4CNK A;  4JDR A;  2VVM A;  2IID A;  4J34 A;  4EQW A;  1S3B A;  4O5U A;  1BZL A;  2XYO A;  2R0G A;  5JCN A;  4J36 A;  3FBS A;  1EL5 A;  4B1B A;  2GVC A;  4REK A;  5FS7 A;  1DOB A;  2H89 A;  4BV6 A;  2WU2 A;  2VZ2 A;  3GWD A;  3L8K A;  2ZBW A;  4J2W A;  2YLR A;  3SM8 A;  3CPJ G;  2WES A;  1K0L A;  1NG3 A;  2V3B A;  1JOA A;  4NTD A;  1GV4 A;  4A79 A;  4NTE A;  1BF3 A;  3NRN A;  4U8L A;  2YVF A;  3JSK A;  3AYL A;  4EMI A;  2X8G A;  1YKJ A;  2XLU A;  2ACZ A;  4YSH A;  4A99 A;  2WDV A;  2BC0 A;  2EQ6 A;  2YVG A;  1XHC A;  3NYC A;  5M10 A;  1M64 A;  2V3A A;  2XVI A;  2WOI A;  3AE9 A;  2XLT A;  4Z26 A;  2BS3 A;  1NPX A;  2X50 A;  3BI2 A;  3E1T A;  3UTG A;  5HYM A;  4AOX A;  1MXT A;  3GRS A;  4U2T A;  4DSH A;  2AAQ A;  1TRB A;  2TMD A;  1CC6 A;  3NLC A;  4K8D A;  3K7M X;  4Z24 A;  4IVM B;  3EAO A;  3NK0 X;  1JEH A;  4HB9 A;  1E1L A;  2GB0 A;  4IV9 A;  3UP4 A;  5CQF A;  1W4X A;  1QJD A;  1RYI A;  3KLJ A;  1GRB A;  2E5V A;  4OPI A;  2Q7V A;  2YG5 A;  2YVJ A;  4IVO B;  3QFB A;  4USR A;  1TDO A;  4ZN0 A;  2VRL A;  3NNE A;  2YG4 A;  4H4P A;  4RG3 A;  4TM1 A;  4FX9 A;  1MO9 A;  2BA9 A;  1JNZ A;  1Q1R A;  3SQP A;  2YM2 A;  1E7P A;  5BRT A;  1N4W A;  5GSN A;  4H4S A;  1GTH A;  2ARD A;  4FK1 C;  1D7L A;  2YG7 A;  2X3N A;  4OPL A;  1OJ9 A;  1PJ6 A;  3C4N A;  2YWL A;  3CNP A;  1NEK A;  2BS4 A;  1MOK A;  4C5O A;  1EL9 A;  2FJD A;  3AEB A;  5EBK A;  3ICS A;  2WP5 A;  4KX6 A;  3UOV A;  3NK1 X;  3UKH A;  4B66 A;  3RNM A;  2OAL A;  1Q1W A;  2BAB A;  5IPY A;  2CDU A;  1EBD A;  1O95 A;  4ZCC A;  2BK3 A;  3SGL A;  4K5S A;  2R0P A;  3UP5 A;  1PBE A;  1Z6L A;  1OJA A;  1HYU A;  3NYF A;  1TDF A;  1ZMD A;  1TDK A;  3LZX A;  4BK3 A;  1IUT A;  3IHM A;  4Z2U A;  3BI4 A;  3QVP A;  1F8R A;  3CNJ A;  3P4P A;  4NEV A;  4YXD A;  3RHA A;  2Q0K A;  3EPT A;  3BHK A;  3DJG X;  3H4K A;  3Q9T A;  1NHR A;  3DGZ A;  3GDN A;  1PS9 A;  1UKV G;  3ISH A;  2IVD A;  3NGC X;  3LAD A;  2YQU A;  3UOZ A;  1VG9 A;  1B4V A;  2GAH B;  3CIR A;  3DJD A;  2NVK X;  4A9W A;  1D5T A;  4YWO A;  1GND A;  4YKF A;  4EIP A;  3UCL A;  1PDH A;  3LZW A;  1TYP A;  4WCT A;  2GR0 A;  1D4D A;  4H4Q A;  4PAA A;  2B9X A;  2X99 A;  2ZZB A;  4EQX A;  4YKG A;  3GMB A;  3P4R A;  4YSX A;  2WPC A;  1FEA A;  1B37 A;  2XVF A;  2V61 A;  1IUU A;  3EF6 A;  3IF9 A;  4GRT A;  1VQW A;  1D4E A;  3PO7 A;  1ZP0 A;  2BXS A;  4ECH A;  4TM4 A;  4Y4M A;  3V3N A;  2GAG B;  4EMJ A;  3AE2 A;  2QA1 A;  3NTA A;  4H7U A;  3DJE A;  5EOW A;  4H4V A;  5BUL A;  3RP8 A;  3F8R A;  1PXA A;  2NPX A;  2CUL A;  2WOW A;  4H4Y A;  4K2X A;  4EM3 A;  4H2P A;  3AWI A;  2GR1 A;  2BK4 A;  2OAM A;  2Z5X A;  3GDP A;  1F8S A;  1FCD A;  2IVE A;  4UDR A;  2GEW A;  3FPZ A;  5FS6 A;  2C76 A;  3NKS A;  4H2Q A;  2WQY A;  3QJ4 A;  1V59 A;  2YLT A;  4UDP A;  3NTD A;  5M0Z A;  1TYT A;  3DK8 A;  2AR8 A;  4XXG A;  2FJE A;  5JCK A;  4JN9 A;  4J57 A;  1L0V A;  4OCG A;  4IA6 A;  2FBW A;  3QSM A;  3UKP A;  4U2S A;  4KPR A;  1ZOY A;  3AD7 B;  2UZZ A;  1H84 A;  4OPT A;  3CTY A;  2C65 A;  3KVE A;  1H83 A;  4TLX A;  2C72 A;  2XCG A;  4UDQ A;  1DOD A;  3GYI A;  2RGJ A;  3G5S A;  3ALM A;  1AOG A;  2YLS A;  1NEN A;  5C3J A;  3ICT A;  3ICR A;  3GWF A;  3M0O A;  3NHO X;  3QVR A;  2GR3 A;  4M52 A;  1IUX A;  1PBB A;  3UTF A;  1E39 A;  4C74 A;  1FEC A;  1N4U A;  1GAL A;  1QO8 A;  2WDR A;  3AB1 A;  3CPI G;  3GMC A;  2F5Z A;  4OPU A;  1P2E A;  1CJ2 A;  4XWR A;  3ZDN A;  4JY3 A;  2GH5 A;  4NEW A;  1KDG A;  1GXF A;  2X8H A;  4GCM A;  1YQZ A;  4ADW A;  1N4V A;  4B65 A;  3D1C A;  1LVL A;  2B9W A;  2BS2 A;  2Y6R A;  2E1M A;  3EAN A;  1DJQ A;  2PYX A;  5IQ1 A;  3RP7 A;  5JCI A;  5KOW A;  3CPH G;  1KF6 A;  2XFQ A;  3NN0 X;  4CCR A;  1XAN A;  4GUV A;  4Y4N A;  4Z2T A;  4E0V A;  3II4 A;  4JNA A;  4OVI A;  4BJY A;  5IQ4 A;  3BI5 A;  2JB3 A;  1IJH A;  1P2H A;  4X9N A;  4YT0 A;  1CJC A;  1S2Q A;  3C4A A;  4A7A A;  3LXD A;  4B67 A;  3PVC A;  4BUR A;  1ZY8 A;  3S61 A;  2FJB A;  4EMW A;  4APN A;  2Q0L A;  2JBV A;  1FEB A;  4TM3 A;  1CHU A;  3IC9 A;  1F6M A;  1SEZ A;  2WS3 A;  5KRQ A;  2WET A;  2BCG G;  1X31 B;  3AE3 A;  1D4C A;  3GRT A;  1Y56 B;  5HXI A;  2WP6 A;  5EB4 A;  4RSL A;  1Y56 A;  1N1P A;  2AQJ A;  3ALL A;  1KSU A;  2V6O A;  1XPQ A;  1PXC A;  2C7G A;  3CGB A;  4LA1 A;  2R4J A;  2RGO A;  2APG A;  3AXB A;  3CNS A;  1PBF A;  2GMH A;  3V76 A;  2R0C A;  2GQW A;  2HQM A;  4OPG A;  4XWZ A;  4U8M A;  3AEC A;  3AE5 A;  4GDE A;  4O5Q A;  3AYJ A;  2C73 A;  2JK6 A;  3OC4 A;  3AEA A;  4D04 A;  3AE7 A;  3B6D A;  4NZH A;  5KXJ A;  3URH A;  4Z25 A;  3P4Q A;  1B8S A;  1B5Q A;  4CRT A;  5KWF A;  1D7Y A;  1JRZ A;  1LPF A;  4I59 A;  4Z2R A;  4J31 A;  2H88 A;  4H2R A;  1E1M A;  2XFO A;  4WX1 A;  2BK5 A;  2C75 A;  4PAB A;  3CGD A;  1YY5 A;  3OZ2 A;  4H2N A;  1O94 A;  2I0Z A;  2R45 A;  1YQ3 A;  2C3D A;  2R9Z A;  3ADA B;  4B69 A;  4EIQ A;  3NK2 X;  1CJ4 A;  4BK1 A;  1PN0 A;  1JNR A;  1BKW A;  2EQ7 A;  4C3X A;  1VRQ B;  3VR9 A;  2DKH A;  1JRY A;  1LV0 A;  2B76 A;  1ZKQ A;  1IUW A;  4X4J A;  3NH3 X;  3AE8 A;  4AP1 A;  4A6N B;  5J60 A;  3VR8 A;  1CF3 A;  5KOX A;  5JCL A;  1REO A;  4FDC B;  1RP0 A;  4DNA A;  2RGH A;  4A6N A;  4B64 A;  3DH9 A;  3UKQ A;  1ZX9 A;  3DA1 A;  4EM4 A;  1PBD A;  2TPR A;  2GRT A;  2VQB A;  3ALJ A;  1CJ3 A;  4BJZ A;  5L46 A;  1PHH A;  3IHG A;  5HY5 A;  2A89 A;  5U1O A;  1H6V A;  2BAC A;  4OPD A;  4A5L A;  3ITJ A;  2E4G A;  3CNT A;  2VVL G;  2YG6 A;  2EQ8 A;  1PJ7 A;  4Z43 A;  4H50 A;  2VRM A; 
#chains in the Genus database with same CATH topology
 2V5Z A;  1JU2 A;  2XDO A;  2X8C A;  4C3Y A;  1EL7 A;  3IWA A;  2XLP A;  3S5W A;  4AOS A;  4IA5 A;  1H7X A;  1LJ1 A;  1ZOV A;  1GT8 A;  2XFN A;  3DJJ A;  4FK1 A;  3CN8 A;  4D03 A;  3AYI A;  1ZMC A;  1NHP A;  3V3O A;  3DK4 A;  4H4W A;  4USQ A;  4CCQ A;  4G6G A;  4U8K A;  2YG3 A;  1F3P A;  2B7S A;  1BGN A;  1GER A;  1M6I A;  1ZK7 A;  2YR5 A;  3SYI A;  3T31 A;  4H4U A;  4I58 A;  1OJT A;  5BVA A;  3LOV A;  1GRF A;  5KMR A;  1GET A;  4DGK A;  1GPE A;  3AED A;  2Z5Y A;  3UTE A;  1GSN A;  5BUK A;  3ATQ A;  4H4X A;  2C66 A;  2JAE A;  2BRY A;  2YR6 A;  2YM1 A;  3T0K A;  1ONF A;  3RP6 A;  1KSS A;  2BCP A;  3UKF A;  3I3L A;  4DSG A;  5HHF A;  1E6E A;  2GF3 A;  2FJA A;  1H82 A;  1LTX R;  3COX A;  3AE1 A;  1O5W A;  3DGH A;  3RED A;  1DJN A;  1PBC A;  3H8L A;  2ZZC A;  3AD8 B;  2A8X A;  4JNQ A;  4J56 A;  2B7R A;  4EQS A;  1NG4 A;  3FG2 P;  1H81 A;  1VG0 A;  4TLZ A;  4CY8 A;  4H4Z A;  1F8W A;  4JQ9 A;  3HZL A;  3D8X A;  3L1R A;  3O0H A;  3CMM A;  4BK2 A;  2RAB A;  2XFU A;  1DOC A;  1S2Y A;  2GR2 A;  2PHH A;  2WP9 A;  3CGE A;  3M12 A;  5FS9 A;  4X9M A;  1CL0 A;  2Y6Q A;  3SFE A;  2R46 A;  3UOX A;  4A65 A;  3M13 A;  3KU9 A;  3GD3 A;  4U8N A;  2XVH A;  4GR1 A;  3VRB A;  3BHF A;  2C67 A;  4CBQ A;  1IUV A;  3T14 A;  3P4S A;  5KVI A;  2BRA A;  3F8P A;  2XVE A;  3R9U A;  2GMJ A;  1K0I A;  2OA1 A;  3I6D A;  4UP3 A;  5JCM A;  1CC4 A;  3GSI A;  1OJD A;  3DME A;  1H86 A;  1EL8 A;  2BYB A;  1LQU A;  2WHD A;  3C96 A;  3NT6 A;  4HA6 A;  4AT0 A;  1CBO A;  4B63 A;  4NTC A;  1YQ4 A;  2WBA A;  3UKA A;  1GTE A;  4K22 A;  2EQ9 A;  2BXR A;  4J33 A;  4U8P A;  1H7W A;  5C2T A;  2WPF A;  3NYE A;  1NDA A;  1FOH A;  3FMW A;  4Z44 A;  2XLR A;  2OLN A;  1PJ5 A;  2QAE A;  4C5O A;  5ER0 A;  4EQR A;  4U2L A;  2W0H A;  2R4E A;  3CGC A;  3WE0 A;  4JY2 A;  4P9S A;  2C3C A;  3HYW A;  5FS8 A;  2CVJ A;  4YTP A;  3AD9 B;  2WPE A;  1K0J A;  2A87 A;  1Q9I A;  2C64 A;  4LU6 A;  2DKI A;  2GQF A;  3DK9 A;  4ZCD A;  3SX6 A;  2OLO A;  2C70 A;  1CC2 A;  3GYJ A;  3KPF A;  3T37 A;  3KD9 A;  1BGJ A;  1COY A;  1E1N A;  1TDE A;  2VVL A;  3LJP A;  3FIM B;  1L9D A;  3ZYX A;  2YLW A;  3F8D A;  3VQR A;  4CNJ A;  3H8I A;  2VOU A;  3SY4 A;  4RG4 A;  4AP3 A;  1KFY A;  5U63 A;  3ABV A;  2V60 A;  2O9Z A;  4H4T A;  4LII A;  1OJC A;  1GRA A;  3PS9 A;  5U25 A;  3AEF A;  2J3N A;  3AE6 A;  3SFD A;  3P9U A;  3K7Q X;  3VRA A;  5LV9 A;  1GOS A;  2JB2 A;  3NG7 X;  2VQ7 A;  3K7T A;  3K30 A;  3AEG A;  2WDQ A;  1DNC A;  4Y4L A;  3T2K A;  3UTH A;  4MJW A;  4YSY A;  3NIX A;  1ELI A;  2YLZ A;  4GDP A;  5CKU A;  1GRH A;  1K4Q A;  1RSG A;  3AEE A;  3LB8 A;  3NN6 X;  3P1W A;  4ICY A;  1S3E A;  3BNU A;  4C77 A;  3QFA A;  1GRE A;  1QLB A;  1GEU A;  5EB5 A;  1NHS A;  2QCU A;  1VDC A;  3QSS A;  4B68 A;  4N9X A;  1XDI A;  2JKC A;  1KNP A;  2Q6U A;  1L9E A;  3BNM A;  4YSZ A;  1IUS A;  1E1K A;  2YR4 A;  3UOY A;  3KA7 A;  4U8I A;  3UKK A;  2QA2 A;  1LQT A;  2YAU A;  4YTN A;  3GD4 A;  3Q6J A;  2XLS A;  4CY6 A;  4U8J A;  3QSE A;  4U8O A;  1PXB A;  2WOV A;  4TM0 A;  3KKJ A;  2YLX A;  5J7X A;  1DXL A;  3G5R A;  4AT2 A;  4YTM A;  2XFP A;  4GF7 A;  3UKL A;  5KVH A;  1ZDL A;  1FL2 A;  1JRX A;  1NAA A;  2JB1 A;  5DBJ A;  1TDN A;  1Y0P A;  2WEU A;  3SZ0 A;  1GRT A;  1GES A;  1KNR A;  2WU5 A;  1GRG A;  3G5Q A;  2B9Y A;  3CND A;  5FMH A;  4K7Z A;  4H4R A;  3T2Y A;  1NHQ A;  2ZZ0 A;  2XVJ A;  3AE4 A;  5GRT A;  1DOE A;  5TR3 A;  2CFY A;  3B3R A;  4K5R A;  1BWC A;  2GV8 A;  3ATR A;  1L9C A;  4OPC A;  4NNJ A;  2BC1 A;  3VRD B;  4CNK A;  4JDR A;  2VVM A;  2IID A;  4J34 A;  4EQW A;  1S3B A;  4O5U A;  1BZL A;  2XYO A;  2R0G A;  5JCN A;  4J36 A;  3FBS A;  1EL5 A;  4B1B A;  2GVC A;  4REK A;  5FS7 A;  1DOB A;  2H89 A;  4BV6 A;  2WU2 A;  2VZ2 A;  3GWD A;  3L8K A;  2ZBW A;  4J2W A;  2YLR A;  3SM8 A;  3CPJ G;  2WES A;  1K0L A;  1NG3 A;  2V3B A;  1JOA A;  4NTD A;  1GV4 A;  4A79 A;  4NTE A;  1BF3 A;  3NRN A;  4U8L A;  3SXI A;  2YVF A;  3JSK A;  3AYL A;  4EMI A;  2X8G A;  1YKJ A;  2XLU A;  2ACZ A;  4YSH A;  4A99 A;  2WDV A;  2BC0 A;  2EQ6 A;  2YVG A;  1XHC A;  3NYC A;  5M10 A;  4G74 A;  1M64 A;  2V3A A;  2XVI A;  2WOI A;  3AE9 A;  2XLT A;  4Z26 A;  2BS3 A;  1NPX A;  2X50 A;  3BI2 A;  3E1T A;  3UTG A;  5HYM A;  4AOX A;  1MXT A;  4II3 A;  3GRS A;  4U2T A;  4DSH A;  2AAQ A;  1TRB A;  2TMD A;  1CC6 A;  3NLC A;  4K8D A;  3K7M X;  4Z24 A;  4IVM B;  4GAP A;  3EAO A;  5KMS A;  3NK0 X;  1JEH A;  4HB9 A;  1E1L A;  2GB0 A;  4IV9 A;  4NWZ A;  3UP4 A;  5CQF A;  1W4X A;  1QJD A;  3SZF A;  1RYI A;  3KLJ A;  1GRB A;  2E5V A;  4OPI A;  2Q7V A;  2YG5 A;  2YVJ A;  4IVO B;  3QFB A;  4USR A;  1TDO A;  4ZN0 A;  2VRL A;  3NNE A;  2YG4 A;  4H4P A;  4RG3 A;  4TM1 A;  4FX9 A;  1MO9 A;  2BA9 A;  1JNZ A;  1Q1R A;  3SQP A;  2YM2 A;  1E7P A;  5BRT A;  1N4W A;  5GSN A;  4H4S A;  1GTH A;  2ARD A;  4FK1 C;  1D7L A;  3SZW A;  2YG7 A;  2X3N A;  4OPL A;  1OJ9 A;  1PJ6 A;  3C4N A;  2YWL A;  3CNP A;  1NEK A;  2BS4 A;  1MOK A;  3GYX A;  1EL9 A;  2FJD A;  3AEB A;  5EBK A;  3ICS A;  2WP5 A;  4KX6 A;  3UOV A;  3NK1 X;  3UKH A;  4B66 A;  3RNM A;  2OAL A;  1Q1W A;  2BAB A;  5IPY A;  2CDU A;  1EBD A;  1O95 A;  4ZCC A;  2BK3 A;  3SGL A;  4K5S A;  2R0P A;  3UP5 A;  1PBE A;  1Z6L A;  1OJA A;  1HYU A;  3NYF A;  1TDF A;  1ZMD A;  1TDK A;  3LZX A;  4G6H A;  4BK3 A;  1IUT A;  3IHM A;  4Z2U A;  3BI4 A;  3QVP A;  1F8R A;  3CNJ A;  3P4P A;  4NEV A;  4YXD A;  3RHA A;  2Q0K A;  3EPT A;  3BHK A;  3DJG X;  3H4K A;  3Q9T A;  1NHR A;  3DGZ A;  3GDN A;  1PS9 A;  1UKV G;  3ISH A;  2IVD A;  3NGC X;  3LAD A;  2YQU A;  3UOZ A;  1VG9 A;  1B4V A;  2GAH B;  3CIR A;  3DJD A;  2NVK X;  4A9W A;  1D5T A;  4YWO A;  1GND A;  4YKF A;  4EIP A;  3UCL A;  1PDH A;  3LZW A;  1TYP A;  4WCT A;  2GR0 A;  1D4D A;  4H4Q A;  4PAA A;  2B9X A;  2X99 A;  2ZZB A;  4EQX A;  4YKG A;  3GMB A;  3P4R A;  4YSX A;  2WPC A;  1FEA A;  1B37 A;  2XVF A;  2V61 A;  1IUU A;  3EF6 A;  3IF9 A;  4GRT A;  1VQW A;  1D4E A;  3PO7 A;  1ZP0 A;  2BXS A;  4ECH A;  4TM4 A;  4Y4M A;  3V3N A;  2GAG B;  4EMJ A;  3AE2 A;  2QA1 A;  3NTA A;  4H7U A;  3DJE A;  5EOW A;  4H4V A;  5BUL A;  3RP8 A;  3F8R A;  1PXA A;  2NPX A;  2CUL A;  2WOW A;  4GAV A;  4H4Y A;  4K2X A;  4EM3 A;  4H2P A;  3AWI A;  2GR1 A;  2BK4 A;  2OAM A;  2Z5X A;  3GDP A;  1F8S A;  1FCD A;  2IVE A;  5KMP A;  4UDR A;  2GEW A;  3FPZ A;  5FS6 A;  2C76 A;  3NKS A;  4H2Q A;  2WQY A;  3QJ4 A;  1V59 A;  2YLT A;  4UDP A;  3NTD A;  5M0Z A;  1TYT A;  3DK8 A;  2AR8 A;  4XXG A;  2FJE A;  5JCK A;  4JN9 A;  4J57 A;  1L0V A;  4OCG A;  4IA6 A;  2FBW A;  3QSM A;  3UKP A;  4U2S A;  4KPR A;  1ZOY A;  3AD7 B;  3HYX A;  3T2Z A;  2UZZ A;  1H84 A;  4OPT A;  3CTY A;  2C65 A;  3KVE A;  1H83 A;  4TLX A;  2C72 A;  2XCG A;  4UDQ A;  1DOD A;  3GYI A;  2RGJ A;  3G5S A;  3ALM A;  1AOG A;  2YLS A;  1NEN A;  5C3J A;  3ICT A;  3ICR A;  3GWF A;  3M0O A;  3NHO X;  3QVR A;  2GR3 A;  4M52 A;  1IUX A;  1PBB A;  3UTF A;  1E39 A;  4C74 A;  1FEC A;  1N4U A;  1GAL A;  1QO8 A;  2WDR A;  3AB1 A;  3CPI G;  3GMC A;  2F5Z A;  4OPU A;  1P2E A;  1CJ2 A;  4XWR A;  3ZDN A;  4JY3 A;  2GH5 A;  4NEW A;  1KDG A;  1GXF A;  2X8H A;  4GCM A;  1YQZ A;  4ADW A;  1N4V A;  4B65 A;  3D1C A;  1LVL A;  2B9W A;  2BS2 A;  2Y6R A;  2E1M A;  3EAN A;  1DJQ A;  2PYX A;  5IQ1 A;  3RP7 A;  5JCI A;  5KOW A;  3CPH G;  1KF6 A;  2XFQ A;  3NN0 X;  4CCR A;  1XAN A;  4GUV A;  4Y4N A;  4Z2T A;  4E0V A;  3II4 A;  4JNA A;  4OVI A;  4BJY A;  5IQ4 A;  3BI5 A;  2JB3 A;  1IJH A;  1P2H A;  4X9N A;  4G9K A;  4YT0 A;  1CJC A;  1S2Q A;  3C4A A;  4G73 A;  4A7A A;  3LXD A;  4B67 A;  3PVC A;  4BUR A;  1ZY8 A;  3S61 A;  2FJB A;  4EMW A;  4APN A;  2Q0L A;  5KMQ A;  2JBV A;  1FEB A;  4TM3 A;  1CHU A;  3IC9 A;  1F6M A;  1SEZ A;  2WS3 A;  5KRQ A;  2WET A;  2BCG G;  1X31 B;  3AE3 A;  1D4C A;  3GRT A;  1Y56 B;  5HXI A;  2WP6 A;  5EB4 A;  4RSL A;  1Y56 A;  1N1P A;  2AQJ A;  3ALL A;  5KNL A;  1KSU A;  2V6O A;  1XPQ A;  1PXC A;  2C7G A;  3CGB A;  4LA1 A;  2R4J A;  2RGO A;  2APG A;  3AXB A;  3CNS A;  1PBF A;  2GMH A;  3V76 A;  2R0C A;  2GQW A;  2HQM A;  4OPG A;  4XWZ A;  2C4C A;  4U8M A;  3AEC A;  3AE5 A;  4GDE A;  4O5Q A;  3SZC A;  3AYJ A;  2C73 A;  2JK6 A;  3OC4 A;  3AEA A;  4D04 A;  3AE7 A;  3B6D A;  4NZH A;  5KXJ A;  3URH A;  4Z25 A;  3P4Q A;  1B8S A;  1B5Q A;  4CRT A;  5KWF A;  1D7Y A;  1JRZ A;  1LPF A;  4I59 A;  4Z2R A;  4J31 A;  2H88 A;  3HYV A;  1E1M A;  4H2R A;  2XFO A;  4WX1 A;  2BK5 A;  3KPK A;  2C75 A;  4PAB A;  3CGD A;  1YY5 A;  3OZ2 A;  4H2N A;  1O94 A;  2I0Z A;  2R45 A;  1YQ3 A;  2C3D A;  2R9Z A;  3ADA B;  4B69 A;  4EIQ A;  3NK2 X;  1CJ4 A;  4BK1 A;  1PN0 A;  1JNR A;  1BKW A;  2EQ7 A;  4C3X A;  1VRQ B;  3VR9 A;  2DKH A;  1JRY A;  1LV0 A;  2B76 A;  4II2 A;  1ZKQ A;  1IUW A;  4X4J A;  3NH3 X;  3AE8 A;  4AP1 A;  4A6N B;  5J60 A;  3VR8 A;  1CF3 A;  5KOX A;  5JCL A;  1REO A;  4FDC B;  1RP0 A;  4DNA A;  2RGH A;  4A6N A;  4B64 A;  3DH9 A;  3UKQ A;  1ZX9 A;  3DA1 A;  4EM4 A;  1PBD A;  2TPR A;  2GRT A;  2VQB A;  3ALJ A;  1CJ3 A;  4BJZ A;  5L46 A;  1PHH A;  3IHG A;  5HY5 A;  2A89 A;  5U1O A;  1H6V A;  2BAC A;  4OPD A;  4A5L A;  3ITJ A;  2E4G A;  3CNT A;  2VVL G;  2YG6 A;  2EQ8 A;  1PJ7 A;  4Z43 A;  4H50 A;  2VRM A; 
#chains in the Genus database with same CATH homology
 2V5Z A;  1JU2 A;  2XDO A;  2X8C A;  4C3Y A;  1EL7 A;  3IWA A;  2XLP A;  3S5W A;  4AOS A;  4IA5 A;  1H7X A;  1LJ1 A;  1ZOV A;  1GT8 A;  2XFN A;  3DJJ A;  4FK1 A;  3CN8 A;  4D03 A;  3AYI A;  1ZMC A;  1NHP A;  3V3O A;  3DK4 A;  4H4W A;  4USQ A;  4CCQ A;  4G6G A;  4U8K A;  2YG3 A;  1F3P A;  2B7S A;  1BGN A;  1GER A;  1M6I A;  1ZK7 A;  2YR5 A;  3SYI A;  3T31 A;  4H4U A;  4I58 A;  1OJT A;  5BVA A;  3LOV A;  1GRF A;  5KMR A;  1GET A;  4DGK A;  1GPE A;  3AED A;  2Z5Y A;  3UTE A;  1GSN A;  5BUK A;  3ATQ A;  4H4X A;  2C66 A;  2JAE A;  2BRY A;  2YR6 A;  2YM1 A;  3T0K A;  1ONF A;  3RP6 A;  1KSS A;  2BCP A;  3UKF A;  3I3L A;  4DSG A;  5HHF A;  1E6E A;  2GF3 A;  2FJA A;  1H82 A;  1LTX R;  3COX A;  3AE1 A;  1O5W A;  3DGH A;  3RED A;  1DJN A;  1PBC A;  3H8L A;  2ZZC A;  3AD8 B;  2A8X A;  4JNQ A;  4J56 A;  2B7R A;  4EQS A;  1NG4 A;  3FG2 P;  1H81 A;  1VG0 A;  4TLZ A;  4CY8 A;  4H4Z A;  1F8W A;  4JQ9 A;  3HZL A;  3D8X A;  3L1R A;  3O0H A;  3CMM A;  4BK2 A;  2RAB A;  2XFU A;  1DOC A;  1S2Y A;  2GR2 A;  2PHH A;  2WP9 A;  3CGE A;  3M12 A;  5FS9 A;  4X9M A;  1CL0 A;  2Y6Q A;  3SFE A;  2R46 A;  3UOX A;  4A65 A;  3M13 A;  3KU9 A;  3GD3 A;  4U8N A;  2XVH A;  4GR1 A;  3VRB A;  3BHF A;  2C67 A;  4CBQ A;  1IUV A;  3T14 A;  3P4S A;  5KVI A;  2BRA A;  3F8P A;  2XVE A;  3R9U A;  2GMJ A;  1K0I A;  2OA1 A;  3I6D A;  4UP3 A;  5JCM A;  1CC4 A;  3GSI A;  1OJD A;  3DME A;  1H86 A;  1EL8 A;  2BYB A;  1LQU A;  2WHD A;  3C96 A;  3NT6 A;  4HA6 A;  4AT0 A;  1CBO A;  4B63 A;  4NTC A;  1YQ4 A;  2WBA A;  3UKA A;  1GTE A;  4K22 A;  2EQ9 A;  2BXR A;  4J33 A;  4U8P A;  1H7W A;  5C2T A;  2WPF A;  3NYE A;  1NDA A;  1FOH A;  3FMW A;  4Z44 A;  2XLR A;  2OLN A;  1PJ5 A;  2QAE A;  4C5O A;  5ER0 A;  4EQR A;  4U2L A;  2W0H A;  2R4E A;  3CGC A;  3WE0 A;  4JY2 A;  4P9S A;  2C3C A;  3HYW A;  5FS8 A;  2CVJ A;  4YTP A;  3AD9 B;  2WPE A;  1K0J A;  2A87 A;  1Q9I A;  2C64 A;  4LU6 A;  2DKI A;  2GQF A;  3DK9 A;  4ZCD A;  3SX6 A;  2OLO A;  2C70 A;  1CC2 A;  3GYJ A;  3KPF A;  3T37 A;  3KD9 A;  1BGJ A;  1COY A;  1E1N A;  1TDE A;  2VVL A;  3LJP A;  3FIM B;  1L9D A;  3ZYX A;  2YLW A;  3F8D A;  3VQR A;  4CNJ A;  3H8I A;  2VOU A;  3SY4 A;  4RG4 A;  4AP3 A;  1KFY A;  5U63 A;  3ABV A;  2V60 A;  2O9Z A;  4H4T A;  4LII A;  1OJC A;  1GRA A;  3PS9 A;  5U25 A;  3AEF A;  2J3N A;  3AE6 A;  3SFD A;  3P9U A;  3K7Q X;  3VRA A;  5LV9 A;  1GOS A;  2JB2 A;  3NG7 X;  2VQ7 A;  3K7T A;  3K30 A;  3AEG A;  2WDQ A;  1DNC A;  4Y4L A;  3T2K A;  3UTH A;  4MJW A;  4YSY A;  3NIX A;  1ELI A;  2YLZ A;  4GDP A;  5CKU A;  1GRH A;  1K4Q A;  1RSG A;  3AEE A;  3LB8 A;  3NN6 X;  3P1W A;  4ICY A;  1S3E A;  3BNU A;  4C77 A;  3QFA A;  1GRE A;  1QLB A;  1GEU A;  5EB5 A;  1NHS A;  2QCU A;  1VDC A;  3QSS A;  4B68 A;  4N9X A;  1XDI A;  2JKC A;  1KNP A;  2Q6U A;  1L9E A;  3BNM A;  4YSZ A;  1IUS A;  1E1K A;  2YR4 A;  3UOY A;  3KA7 A;  4U8I A;  3UKK A;  2QA2 A;  1LQT A;  2YAU A;  4YTN A;  3GD4 A;  3Q6J A;  2XLS A;  4CY6 A;  4U8J A;  3QSE A;  4U8O A;  1PXB A;  2WOV A;  4TM0 A;  3KKJ A;  2YLX A;  5J7X A;  1DXL A;  3G5R A;  4AT2 A;  4YTM A;  2XFP A;  4GF7 A;  3UKL A;  5KVH A;  1ZDL A;  1FL2 A;  1JRX A;  1NAA A;  2JB1 A;  5DBJ A;  1TDN A;  1Y0P A;  2WEU A;  3SZ0 A;  1GRT A;  1GES A;  1KNR A;  2WU5 A;  1GRG A;  3G5Q A;  2B9Y A;  3CND A;  5FMH A;  4K7Z A;  4H4R A;  3T2Y A;  1NHQ A;  2ZZ0 A;  2XVJ A;  3AE4 A;  5GRT A;  1DOE A;  5TR3 A;  2CFY A;  3B3R A;  4K5R A;  1BWC A;  2GV8 A;  3ATR A;  1L9C A;  4OPC A;  4NNJ A;  2BC1 A;  3VRD B;  4CNK A;  4JDR A;  2VVM A;  2IID A;  4J34 A;  4EQW A;  1S3B A;  4O5U A;  1BZL A;  2XYO A;  2R0G A;  5JCN A;  4J36 A;  3FBS A;  1EL5 A;  4B1B A;  2GVC A;  4REK A;  5FS7 A;  1DOB A;  2H89 A;  4BV6 A;  2WU2 A;  2VZ2 A;  3GWD A;  3L8K A;  2ZBW A;  4J2W A;  2YLR A;  3SM8 A;  3CPJ G;  2WES A;  1K0L A;  1NG3 A;  2V3B A;  1JOA A;  4NTD A;  1GV4 A;  4A79 A;  4NTE A;  1BF3 A;  3NRN A;  4U8L A;  3SXI A;  2YVF A;  3JSK A;  3AYL A;  4EMI A;  2X8G A;  1YKJ A;  2XLU A;  2ACZ A;  4YSH A;  4A99 A;  2WDV A;  2BC0 A;  2EQ6 A;  2YVG A;  1XHC A;  3NYC A;  5M10 A;  4G74 A;  1M64 A;  2V3A A;  2XVI A;  2WOI A;  3AE9 A;  2XLT A;  4Z26 A;  2BS3 A;  1NPX A;  2X50 A;  3BI2 A;  3E1T A;  3UTG A;  5HYM A;  4AOX A;  1MXT A;  4II3 A;  3GRS A;  4U2T A;  4DSH A;  2AAQ A;  1TRB A;  2TMD A;  1CC6 A;  3NLC A;  4K8D A;  3K7M X;  4Z24 A;  4IVM B;  4GAP A;  3EAO A;  5KMS A;  3NK0 X;  1JEH A;  4HB9 A;  1E1L A;  2GB0 A;  4IV9 A;  4NWZ A;  3UP4 A;  5CQF A;  1W4X A;  1QJD A;  3SZF A;  1RYI A;  3KLJ A;  1GRB A;  2E5V A;  4OPI A;  2Q7V A;  2YG5 A;  2YVJ A;  4IVO B;  3QFB A;  4USR A;  1TDO A;  4ZN0 A;  2VRL A;  3NNE A;  2YG4 A;  4H4P A;  4RG3 A;  4TM1 A;  4FX9 A;  1MO9 A;  2BA9 A;  1JNZ A;  1Q1R A;  3SQP A;  2YM2 A;  1E7P A;  5BRT A;  1N4W A;  5GSN A;  4H4S A;  1GTH A;  2ARD A;  4FK1 C;  1D7L A;  3SZW A;  2YG7 A;  2X3N A;  4OPL A;  1OJ9 A;  1PJ6 A;  3C4N A;  2YWL A;  3CNP A;  1NEK A;  2BS4 A;  1MOK A;  3GYX A;  1EL9 A;  2FJD A;  3AEB A;  5EBK A;  3ICS A;  2WP5 A;  4KX6 A;  3UOV A;  3NK1 X;  3UKH A;  4B66 A;  3RNM A;  2OAL A;  1Q1W A;  2BAB A;  5IPY A;  2CDU A;  1EBD A;  1O95 A;  4ZCC A;  2BK3 A;  3SGL A;  4K5S A;  2R0P A;  3UP5 A;  1PBE A;  1Z6L A;  1OJA A;  1HYU A;  3NYF A;  1TDF A;  1ZMD A;  1TDK A;  3LZX A;  4G6H A;  4BK3 A;  1IUT A;  3IHM A;  4Z2U A;  3BI4 A;  3QVP A;  1F8R A;  3CNJ A;  3P4P A;  4NEV A;  4YXD A;  3RHA A;  2Q0K A;  3EPT A;  3BHK A;  3DJG X;  3H4K A;  3Q9T A;  1NHR A;  3DGZ A;  3GDN A;  1PS9 A;  1UKV G;  3ISH A;  2IVD A;  3NGC X;  3LAD A;  2YQU A;  3UOZ A;  1VG9 A;  1B4V A;  2GAH B;  3CIR A;  3DJD A;  2NVK X;  4A9W A;  1D5T A;  4YWO A;  1GND A;  4YKF A;  4EIP A;  3UCL A;  1PDH A;  3LZW A;  1TYP A;  4WCT A;  2GR0 A;  1D4D A;  4H4Q A;  4PAA A;  2B9X A;  2X99 A;  2ZZB A;  4EQX A;  4YKG A;  3GMB A;  3P4R A;  4YSX A;  2WPC A;  1FEA A;  1B37 A;  2XVF A;  2V61 A;  1IUU A;  3EF6 A;  3IF9 A;  4GRT A;  1VQW A;  1D4E A;  3PO7 A;  1ZP0 A;  2BXS A;  4ECH A;  4TM4 A;  4Y4M A;  3V3N A;  2GAG B;  4EMJ A;  3AE2 A;  2QA1 A;  3NTA A;  4H7U A;  3DJE A;  5EOW A;  4H4V A;  5BUL A;  3RP8 A;  3F8R A;  1PXA A;  2NPX A;  2CUL A;  2WOW A;  4GAV A;  4H4Y A;  4K2X A;  4EM3 A;  4H2P A;  3AWI A;  2GR1 A;  2BK4 A;  2OAM A;  2Z5X A;  3GDP A;  1F8S A;  1FCD A;  2IVE A;  5KMP A;  4UDR A;  2GEW A;  3FPZ A;  5FS6 A;  2C76 A;  3NKS A;  4H2Q A;  2WQY A;  3QJ4 A;  1V59 A;  2YLT A;  4UDP A;  3NTD A;  5M0Z A;  1TYT A;  3DK8 A;  2AR8 A;  4XXG A;  2FJE A;  5JCK A;  4JN9 A;  4J57 A;  1L0V A;  4OCG A;  4IA6 A;  2FBW A;  3QSM A;  3UKP A;  4U2S A;  4KPR A;  1ZOY A;  3AD7 B;  3HYX A;  3T2Z A;  2UZZ A;  1H84 A;  4OPT A;  3CTY A;  2C65 A;  3KVE A;  1H83 A;  4TLX A;  2C72 A;  2XCG A;  4UDQ A;  1DOD A;  3GYI A;  2RGJ A;  3G5S A;  3ALM A;  1AOG A;  2YLS A;  1NEN A;  5C3J A;  3ICT A;  3ICR A;  3GWF A;  3M0O A;  3NHO X;  3QVR A;  2GR3 A;  4M52 A;  1IUX A;  1PBB A;  3UTF A;  1E39 A;  4C74 A;  1FEC A;  1N4U A;  1GAL A;  1QO8 A;  2WDR A;  3AB1 A;  3CPI G;  3GMC A;  2F5Z A;  4OPU A;  1P2E A;  1CJ2 A;  4XWR A;  3ZDN A;  4JY3 A;  2GH5 A;  4NEW A;  1KDG A;  1GXF A;  2X8H A;  4GCM A;  1YQZ A;  4ADW A;  1N4V A;  4B65 A;  3D1C A;  1LVL A;  2B9W A;  2BS2 A;  2Y6R A;  2E1M A;  3EAN A;  1DJQ A;  2PYX A;  5IQ1 A;  3RP7 A;  5JCI A;  5KOW A;  3CPH G;  1KF6 A;  2XFQ A;  3NN0 X;  4CCR A;  1XAN A;  4GUV A;  4Y4N A;  4Z2T A;  4E0V A;  3II4 A;  4JNA A;  4OVI A;  4BJY A;  5IQ4 A;  3BI5 A;  2JB3 A;  1IJH A;  1P2H A;  4X9N A;  4G9K A;  4YT0 A;  1CJC A;  1S2Q A;  3C4A A;  4G73 A;  4A7A A;  3LXD A;  4B67 A;  3PVC A;  4BUR A;  1ZY8 A;  3S61 A;  2FJB A;  4EMW A;  4APN A;  2Q0L A;  5KMQ A;  2JBV A;  1FEB A;  4TM3 A;  1CHU A;  3IC9 A;  1F6M A;  1SEZ A;  2WS3 A;  5KRQ A;  2WET A;  2BCG G;  1X31 B;  3AE3 A;  1D4C A;  3GRT A;  1Y56 B;  5HXI A;  2WP6 A;  5EB4 A;  4RSL A;  1Y56 A;  1N1P A;  2AQJ A;  3ALL A;  5KNL A;  1KSU A;  2V6O A;  1XPQ A;  1PXC A;  2C7G A;  3CGB A;  4LA1 A;  2R4J A;  2RGO A;  2APG A;  3AXB A;  3CNS A;  1PBF A;  2GMH A;  3V76 A;  2R0C A;  2GQW A;  2HQM A;  4OPG A;  4XWZ A;  2C4C A;  4U8M A;  3AEC A;  3AE5 A;  4GDE A;  4O5Q A;  3SZC A;  3AYJ A;  2C73 A;  2JK6 A;  3OC4 A;  3AEA A;  4D04 A;  3AE7 A;  3B6D A;  4NZH A;  5KXJ A;  3URH A;  4Z25 A;  3P4Q A;  1B8S A;  1B5Q A;  4CRT A;  5KWF A;  1D7Y A;  1JRZ A;  1LPF A;  4I59 A;  4Z2R A;  4J31 A;  2H88 A;  3HYV A;  1E1M A;  4H2R A;  2XFO A;  4WX1 A;  2BK5 A;  3KPK A;  2C75 A;  4PAB A;  3CGD A;  1YY5 A;  3OZ2 A;  4H2N A;  1O94 A;  2I0Z A;  2R45 A;  1YQ3 A;  2C3D A;  2R9Z A;  3ADA B;  4B69 A;  4EIQ A;  3NK2 X;  1CJ4 A;  4BK1 A;  1PN0 A;  1JNR A;  1BKW A;  2EQ7 A;  4C3X A;  1VRQ B;  3VR9 A;  2DKH A;  1JRY A;  1LV0 A;  2B76 A;  4II2 A;  1ZKQ A;  1IUW A;  4X4J A;  3NH3 X;  3AE8 A;  4AP1 A;  4A6N B;  5J60 A;  3VR8 A;  1CF3 A;  5KOX A;  5JCL A;  1REO A;  4FDC B;  1RP0 A;  4DNA A;  2RGH A;  4A6N A;  4B64 A;  3DH9 A;  3UKQ A;  1ZX9 A;  3DA1 A;  4EM4 A;  1PBD A;  2TPR A;  2GRT A;  2VQB A;  3ALJ A;  1CJ3 A;  4BJZ A;  5L46 A;  1PHH A;  3IHG A;  5HY5 A;  2A89 A;  5U1O A;  1H6V A;  2BAC A;  4OPD A;  4A5L A;  3ITJ A;  2E4G A;  3CNT A;  2VVL G;  2YG6 A;  2EQ8 A;  1PJ7 A;  4Z43 A;  4H50 A;  2VRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...