1H82A

Structure of polyamine oxidase in complex with guazatine
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h82A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h82A02
2XYOA 2YLXA 1GRBA 1DNCA 2BS2A 3SFDA 4CCQA 2W0HA 2BS3A 3DMEA 3NRNA 3IWAA 3DK8A 3UOYA 2R45A 1H86A 3F8DA 2JKCA 2C7GA 1RP0A 2R4EA 3ATRA 4I58A 2CULA 1F6MA 3VQRA 5JCNA 3CN8A 4YWOA 1VQWA 1CBOA 4RSLA 4B1BA 1FOHA 3GYJA 2BXSA 4EM3A 4LU6A 2XFOA 4XXGA 2C76A 2BK4A 4H2QA 1JRYA 1CJ4A 1JNRA 3M12A 5M0ZA 1GETA 1CHUA 2IIDA 2GR0A 4YTNA 1YQ4A 3JSKA 5J60A 2E1MA 2VQ7A 3UCLA 4U8NA 3AE1A 1E39A 2EQ8A 3AYIA 3NK0X 1S2QA 4AOSA 3KA7A 1LVLA 2C75A 4USQA 1KFYA 3AEBA 4U2LA 3AXBA 3NN0X 3PO7A 3OZ2A 4A9WA 4B64A 4CRTA 3CPJG 4OPLA 1QLBA 4LIIA 3DA1A 2YAUA 1ZK7A 1FCDA 4ZCCA 2BC0A 2R0PA 1NHQA 4GRTA 4JY3A 3DJEA 4FDCB 2Q0KA 2RGOA 3NIXA 1DJQA 2Q7VA 2UZZA 3CPHG 4IVMB 4NEVA 4O5UA 5FMHA 2WETA 4YXDA 2GQWA 5JCMA 5KWFA 3IC9A 4DSGA 2VZ2A 2YG3A 4JDRA 1GRAA 1DOEA 2WOIA 2XLPA 3GRSA 3UKKA 1IUXA 2WDQA 2TMDA 1ZMDA 4A6NB 2FBWA 5FS7A 3UKQA 4P9SA 4HA6A 3B6DA 4U2TA 2FJAA 3L1RA 1YQZA 3QJ4A 3NYFA 1B4VA 2OA1A 3ITJA 4D03A 2RGHA 2C64A 3GYIA 2R0GA 3URHA 2B7SA 2YM1A 5IQ4A 5JCLA 1VG9A 3RP7A 1KF6A 4U8MA 4B66A 2X3NA 1VDCA 4K8DA 4LA1A 2V3BA 2IVEA 4X9NA 1PBCA 2YG7A 1IUVA 4Z44A 4YSYA 5C2TA 3VRBA 4YKFA 5C3JA 2GAGB 1E1LA 3CGDA 4GDPA 1Y56A 3RP6A 5IQ1A 1Q9IA 4GF7A 2X8CA 4BK1A 4OCGA 1LJ1A 1K4QA 4IV9A 1JOAA 3VRDB 3CPIG 5HY5A 3AE4A 3FIMB 3NGCX 4Y4LA 3EANA 4FX9A 1H83A 1GEUA 4H4PA 1CJ2A 2GEWA 1GRHA 1Q1RA 3H4KA 4UDRA 5FS6A 2JB2A 2QA1A 1PBFA 3BI4A 4GUVA 4OPIA 4CY8A 2NPXA 2VRLA 3GWDA 1D7YA 1N4WA 4X4JA 4XWZA 1EL7A 3BNUA 4NZHA 3P1WA 3ABVA 4BURA 3NN6X 4USRA 4DSHA 2H88A 2BK5A 4J33A 3ICTA 4NTDA 5JCIA 3C4NA 2WEUA 2JK6A 2XVHA 4TM3A 2I0ZA 4CNKA 3K7TA 4U2SA 4K5RA 1LQUA 3AYLA 4CBQA 4AP1A 1YY5A 3AEFA 4H4YA 1REOA 3SFEA 2YWLA 4AT0A 2E4GA 2B76A 3RP8A 3DGZA 3ATQA 3AE7A 2EQ7A 2VRMA 5FS9A 1K0LA 4ADWA 2YVFA 3AE2A 4C5OA 2TPRA 2C70A 4Z2UA 2Z5YA 4Y4NA 4A65A 1LTXR 1S3BA 4EQXA 4J31A 4Z2RA 2DKIA 1ELIA 1ZMCA 1BWCA 1Y0PA 3LZWA 4RG4A 1D7LA 5CKUA 4A7AA 2AR8A 3OC4A 1CJCA 3CGCA 3IF9A 3L8KA 4IA6A 3AECA 1B5QA 1GTEA 3COXA 3DJJA 3M0OA 2Z5XA 1OJTA 4APNA 3M13A 1NENA 1N4UA 2GAHB 3NKSA 1K0JA 1NPXA 4IVOB 5KRQA 2F5ZA 4PABA 1GTHA 4BJYA 3UKFA 3ICRA 1K0IA 3GDPA 1S2YA 3AEDA 2OLNA 4UP3A 3FPZA 2APGA 2GQFA 3Q9TA 4I59A 3VR9A 1NAAA 2JBVA 3UOVA 4CY6A 1KSUA 3UTEA 4K7ZA 3DK4A 3EPTA 3NYCA 2FJBA 1F8WA 3R9UA 1GREA 1H7XA 2Q0LA 2JB1A 3UOXA 3D1CA 1GOSA 1S3EA 2BK3A 1PHHA 2GB0A 2WU5A 1FECA 2XFQA 4C3XA 4GR1A 4J36A 3REDA 1DODA 1TDFA 1YKJA 4YSZA 5BVAA 4JNQA 3KU9A 4KPRA 1ZOYA 4AOXA 2YG5A 1D4DA 4J56A 1BGNA 4O5QA 2ACZA 4Z43A 1X31B 1P2HA 2XVJA 1LV0A 5EB4A 2GR3A 1UKVG 3K7MX 4C3YA 2WPFA 2XLUA 1XPQA 1BF3A 4PAAA 2V3AA 2WPCA 4D04A 1PXCA 3AYJA 3AE6A 3UP4A 2GV8A 3G5QA 2X8GA 1FEAA 2XFUA 3UP5A 1RSGA 4BV6A 1EBDA 5BULA 3KKJA 3KD9A 4GDEA 3P4PA 1NDAA 2X8HA 2XVIA 2ZZ0A 4A6NA 3T37A 3CNDA 1EL5A 2XFPA 1LQTA 1AOGA 5TR3A 1D5TA 4OPTA 3I3LA 2BYBA 1GESA 2BC1A 1N4VA 2A8XA 2CDUA 3FG2P 3NK2X 4H4QA 4JQ9A 4TM0A 4U8OA 3RNMA 4E0VA 3VR8A 2RGJA 2A89A 1KSSA 4H50A 4H2PA 2C65A 1GNDA 1PXAA 3AEAA 4TLZA 1EL8A 1OJ9A 3BI2A 1ZP0A 2YG6A 1F3PA 3NYEA 2B9XA 2C3DA 4TLXA 4U8IA 3UKPA 2YLTA 4K22A 4IA5A 4JN9A 4X9MA 1H6VA 3V3NA 4OPCA 3AE5A 3ADAB 5BUKA 1L9EA 3NK1X 2V61A 2XLSA 1DOBA 4CNJA 4EIPA 1TRBA 4B67A 2AQJA 4B63A 2VVMA 1GRTA 5HHFA 4EMWA 2BS4A 2WDRA 1IUWA 4J2WA 3UOZA 3II4A 1OJDA 2FJDA 1FL2A 4Z2TA 2GH5A 1CJ3A 4DNAA 1MXTA 3AE9A 3DK9A 4A99A 2GR1A 2BA9A 2YLSA 1OJAA 3P9UA 3P4QA 3C96A 1Y56B 2PYXA 2WOVA 1PBBA 3ISHA 4H4RA 4NEWA 1DJNA 2GF3A 1L0VA 3P4RA 3QSSA 3QVPA 1TDKA 2YVGA 3AE3A 3BHFA 4ICYA 4OPGA 3AEEA 2HQMA 2PHHA 2WP9A 2YR5A 1IUSA 3Q6JA 4HB9A 1QJDA 2ARDA 1E1KA 1GPEA 2WOWA 4U8KA 3GMCA 3S5WA 1PJ7A 3ZYXA 2R4JA 4YKGA 2WPEA 1H7WA 1IJHA 5KVHA 4YSHA 5CQFA 4M52A 1GXFA 5EB5A 2YM2A 1V59A 2A87A 5ER0A 2V60A 4EIQA 1B37A 1PXBA 1NG4A 4EMIA 4C77A 4EQRA 2BCGG 4H4TA 2XDOA 2YVJA 3NNEA 5KXJA 4REKA 4YTPA 3HZLA 1GALA 2Y6RA 1ONFA 2XVFA 1PS9A 1QO8A 3CNTA 2XVEA 1EL9A 2GMHA 4OVIA 2V6OA 1JEHA 3O0HA 4B69A 1KNRA 2YLRA 5IPYA 2WQYA 1COYA 4Z24A 1L9DA 2EQ6A 3DGHA 3ALMA 3LB8A 5KOXA 3V3OA 3CGEA 1H82A 4WCTA 4K5SA 1PJ6A 2QCUA 1VG0A 4ZN0A 4H4ZA 2YLWA 2CFYA 2DKHA 3AB1A 3EF6A 3IHMA 1PN0A 3NT6A 4U8JA 4OPDA 4RG3A 1NHSA 3ZDNA 5DBJA 5HXIA 4NTEA 3NH3X 5BRTA 4C74A 1JU2A 2VOUA 5J7XA 1JRXA 2WP6A 1E6EA 1LPFA 1NG3A 1CC4A 2XLTA 3FBSA 1CL0A 1BGJA 1MOKA 1TYTA 2BACA 2R0CA 3BNMA 3NG7X 3LJPA 1D4CA 1GT8A 2YQUA 1F8SA 1JNZA 2NVKX 3UTFA 3F8RA 5U63A 2JB3A 4FK1A 4Z25A 3ALJA 3UTHA 1VRQB 1ZDLA 3GMBA 3KVEA 4H4VA 2C72A 2XLRA 1KDGA 1PBEA 5M10A 2XCGA 2B9WA 4J34A 3NHOX 4CCRA 3H8LA 1BKWA 2OLOA 4H4WA 2FJEA 2BXRA 1IUUA 1TDEA 5U25A 3UKLA 1SEZA 1NHRA 2GRTA 4H2RA 1CC6A 3AE8A 3GDNA 2IVDA 2YG4A 3B3RA 2WHDA 4BJZA 1D4EA 3CNSA 1ZOVA 3NTAA 1PDHA 1E1NA 3AD9B 3PS9A 1MO9A 3QSMA 5JCKA 5LV9A 4XWRA 4A5LA 2WESA 3ALLA 3KPFA 2E5VA 3CIRA 5L46A 1CF3A 3NLCA 3S61A 1FEBA 5GRTA 1XANA 2WDVA 1NHPA 2OAMA 2WBAA 3QFBA 1GSNA 3UTGA 1E7PA 4ECHA 4MJWA 2X50A 4DGKA 2QAEA 2Q6UA 4U8PA 4H4XA 3V76A 4A79A 4YT0A 1TDOA 1YQ3A 5HYMA 2J3NA 3CTYA 3G5RA 2GMJA 4FK1C 3SQPA 1TYPA 2XFNA 1O95A 3RHAA 4N9XA 2WU2A 4EM4A 1PJ5A 2WP5A 2ZZCA 1N1PA 1GV4A 3LZXA 3QSEA 3GD4A 3GRTA 3VRAA 1NEKA 2BCPA 3IHGA 2C73A 3E1TA 1GERA 2AAQA 3F8PA 1GRFA 2H89A 2ZZBA 4AT2A 3I6DA 2C67A 1BZLA 4OPUA 2R46A 3H8IA 3LXDA 2YR4A 5FS8A 5U1OA 4BK2A 4YSXA 4TM1A 2Y6QA 4KX6A 1E1MA 1CC2A 1B8SA 1DOCA 3BHKA 4U8LA 3SM8A 2B9YA 2B7RA 3AD7B 3C4AA 3GWFA 2C3CA 1HYUA 3KLJA 4H7UA 5KVIA 1Z6LA 5EOWA 1ZY8A 1O94A 3FMWA 4TM4A 3G5SA 1M64A 4NTCA 3SGLA 4B65A 3PVCA 3CNJA 4J57A 2QA2A 4UDPA 3DJDA 2JAEA 4GCMA 1PBDA 2V5ZA 5KOWA 1W4XA 4EQWA 3UKAA 1Q1WA 1H81A 1M6IA 1GRGA 1JRZA 2OALA 1IUTA 2X99A 3K30A 3LOVA 1ZX9A 4H2NA 4K2XA 1KNPA 2EQ9A 3LADA 5GSNA 3K7QX 3AD8B 3UKHA 3P4SA 1ZKQA 3CNPA 2BABA 1DXLA 4AP3A 4B68A 4H4SA 3GD3A 4Y4MA 2VVLG 1P2EA 1O5WA 3DJGX 2YR6A 5EBKA 3EAOA 3BI5A 3CGBA 3AWIA 4ZCDA 2CVJA 4EMJA 4BK3A 3QVRA 3QFAA 1H84A 4JNAA 2VVLA 1F8RA 2R9ZA 4EQSA 2C66A 2GVCA 3D8XA 4Z26A 1OJCA 2YLZA 4WX1A 4H4UA 2GR2A 2O9ZA 1XDIA 2VQBA 1L9CA 2ZBWA 3NTDA 3ICSA 3WE0A 1XHCA 1TDNA 2WS3A 3GSIA 1RYIA 3DH9A 2RABA 4YTMA 4JY2A 4UDQA 3AEGA
chains in the Genus database with same CATH superfamily
2XYOA 2YLXA 5KMPA 1GRBA 1DNCA 2BS2A 3SFDA 4CCQA 2W0HA 2BS3A 3DMEA 3NRNA 3IWAA 3DK8A 3UOYA 2R45A 1H86A 3F8DA 4G6HA 2JKCA 2C7GA 1RP0A 2R4EA 3ATRA 4I58A 2CULA 1F6MA 3VQRA 5JCNA 3CN8A 4YWOA 1VQWA 1CBOA 4RSLA 4B1BA 1FOHA 3GYJA 5KMSA 2BXSA 4EM3A 4LU6A 2XFOA 4XXGA 2C76A 2BK4A 4H2QA 1JRYA 1CJ4A 1JNRA 3M12A 5M0ZA 1GETA 1CHUA 2IIDA 2GR0A 4YTNA 1YQ4A 3JSKA 5J60A 2E1MA 2VQ7A 3UCLA 4U8NA 3AE1A 1E39A 2EQ8A 3AYIA 3NK0X 1S2QA 4AOSA 3KA7A 1LVLA 3T14A 2C75A 4USQA 1KFYA 3AEBA 4U2LA 3AXBA 3NN0X 3PO7A 3OZ2A 4A9WA 4B64A 4CRTA 3CPJG 4OPLA 1QLBA 4LIIA 3DA1A 2YAUA 1ZK7A 1FCDA 4ZCCA 2BC0A 2R0PA 1NHQA 4GRTA 3SZFA 4JY3A 3DJEA 4FDCB 2Q0KA 2RGOA 3NIXA 1DJQA 2Q7VA 2UZZA 3CPHG 4IVMB 4NEVA 4O5UA 5FMHA 2WETA 4YXDA 2GQWA 5JCMA 5KWFA 3IC9A 4DSGA 2VZ2A 2YG3A 4JDRA 1GRAA 1DOEA 2WOIA 2XLPA 3GRSA 3UKKA 1IUXA 2WDQA 2TMDA 1ZMDA 4A6NB 2FBWA 5FS7A 3UKQA 4P9SA 4HA6A 3B6DA 4U2TA 2FJAA 3L1RA 1YQZA 3QJ4A 3NYFA 3T2YA 1B4VA 2OA1A 3ITJA 4D03A 3T2ZA 2RGHA 2C64A 3GYIA 2R0GA 4G6GA 3URHA 2B7SA 2YM1A 5IQ4A 5JCLA 1VG9A 3RP7A 1KF6A 4U8MA 4B66A 3SZCA 2X3NA 1VDCA 4K8DA 4LA1A 2V3BA 2BRAA 2IVEA 4X9NA 1PBCA 2YG7A 1IUVA 4Z44A 4YSYA 5C2TA 3VRBA 4YKFA 5C3JA 3GYXA 2GAGB 1E1LA 3CGDA 4GDPA 1Y56A 3RP6A 5IQ1A 1Q9IA 4GF7A 2X8CA 4BK1A 4OCGA 1LJ1A 1K4QA 4IV9A 1JOAA 3VRDB 3CPIG 5HY5A 3AE4A 3FIMB 3NGCX 4Y4LA 3EANA 4FX9A 1H83A 1GEUA 4H4PA 1CJ2A 2GEWA 1GRHA 1Q1RA 3H4KA 4UDRA 5FS6A 3SX6A 5KMRA 2JB2A 2QA1A 1PBFA 3BI4A 4GUVA 4OPIA 4CY8A 2NPXA 2VRLA 3GWDA 1D7YA 1N4WA 4X4JA 4XWZA 1EL7A 3BNUA 4NZHA 3P1WA 3ABVA 4BURA 3CMMA 3NN6X 4USRA 4DSHA 2H88A 2BK5A 4J33A 3ICTA 4NTDA 5JCIA 3C4NA 2WEUA 2JK6A 2XVHA 4TM3A 2I0ZA 4CNKA 4II3A 3K7TA 4U2SA 4K5RA 1LQUA 3AYLA 4CBQA 4AP1A 1YY5A 3AEFA 4NNJA 4H4YA 1REOA 3SFEA 2YWLA 4AT0A 2E4GA 2B76A 3RP8A 3DGZA 3ATQA 3AE7A 2EQ7A 2VRMA 5FS9A 1K0LA 4ADWA 2YVFA 3AE2A 4C5OA 2TPRA 2C4CA 2C70A 4Z2UA 2Z5YA 4Y4NA 4A65A 1LTXR 1S3BA 4EQXA 4J31A 4Z2RA 2DKIA 1ELIA 1ZMCA 1BWCA 1Y0PA 3LZWA 3HYWA 4RG4A 1D7LA 5CKUA 4A7AA 2AR8A 3OC4A 1CJCA 3CGCA 4II2A 3IF9A 3L8KA 4IA6A 3AECA 1B5QA 1GTEA 3COXA 3DJJA 3M0OA 2Z5XA 1OJTA 4APNA 3M13A 1NENA 1N4UA 2GAHB 3NKSA 1K0JA 1NPXA 4IVOB 5KRQA 2F5ZA 4PABA 1GTHA 4BJYA 3UKFA 3ICRA 1K0IA 3GDPA 1S2YA 3AEDA 2OLNA 4UP3A 3FPZA 2APGA 2GQFA 3Q9TA 4I59A 3VR9A 1NAAA 2JBVA 3UOVA 4CY6A 1KSUA 3UTEA 4K7ZA 3DK4A 3EPTA 3NYCA 2FJBA 3T0KA 1F8WA 3R9UA 1GREA 1H7XA 2Q0LA 2JB1A 3UOXA 3D1CA 1GOSA 1S3EA 2BK3A 1PHHA 2GB0A 2WU5A 1FECA 2XFQA 4C3XA 4GR1A 4J36A 3REDA 1DODA 1TDFA 1YKJA 4YSZA 5BVAA 4JNQA 3KU9A 4KPRA 1ZOYA 4AOXA 2YG5A 1D4DA 4J56A 1BGNA 4O5QA 2ACZA 4Z43A 1X31B 1P2HA 2XVJA 1LV0A 5EB4A 2GR3A 1UKVG 3K7MX 4C3YA 2WPFA 2XLUA 1XPQA 1BF3A 4PAAA 2V3AA 2WPCA 4D04A 1PXCA 3AYJA 4NWZA 3AE6A 3UP4A 2GV8A 3G5QA 2X8GA 1FEAA 2XFUA 3UP5A 1RSGA 4BV6A 1EBDA 3HYVA 5BULA 3KKJA 3KD9A 4GDEA 3P4PA 1NDAA 2X8HA 2XVIA 2ZZ0A 4A6NA 3T37A 3CNDA 1EL5A 2XFPA 1LQTA 1AOGA 3SY4A 5TR3A 1D5TA 4OPTA 3I3LA 2BYBA 1GESA 2BC1A 1N4VA 2A8XA 2CDUA 3FG2P 3NK2X 4H4QA 4JQ9A 4TM0A 4U8OA 3RNMA 3SYIA 4E0VA 3VR8A 2RGJA 2A89A 1KSSA 4H50A 4H2PA 2C65A 1GNDA 1PXAA 3AEAA 4TLZA 3KPKA 1EL8A 1OJ9A 3BI2A 1ZP0A 2YG6A 1F3PA 3NYEA 2B9XA 2C3DA 4TLXA 4U8IA 3UKPA 2YLTA 4K22A 4IA5A 4JN9A 4X9MA 1H6VA 3V3NA 4OPCA 3AE5A 3ADAB 5BUKA 1L9EA 4G9KA 3NK1X 2V61A 2XLSA 1DOBA 4CNJA 4EIPA 1TRBA 4B67A 5KNLA 2AQJA 4B63A 2VVMA 1GRTA 5HHFA 4EMWA 2BS4A 2WDRA 1IUWA 4J2WA 3UOZA 3II4A 1OJDA 2FJDA 1FL2A 4Z2TA 2GH5A 1CJ3A 4DNAA 1MXTA 3AE9A 3DK9A 4A99A 2GR1A 2BA9A 2YLSA 1OJAA 3P9UA 3P4QA 3C96A 1Y56B 2PYXA 2WOVA 1PBBA 3ISHA 4H4RA 4NEWA 1DJNA 2GF3A 1L0VA 3P4RA 3QSSA 3QVPA 1TDKA 2YVGA 3AE3A 3BHFA 4ICYA 4OPGA 3AEEA 2HQMA 2PHHA 2WP9A 2YR5A 1IUSA 3Q6JA 4HB9A 1QJDA 2ARDA 1E1KA 1GPEA 2WOWA 4U8KA 3GMCA 3S5WA 1PJ7A 3ZYXA 2R4JA 4YKGA 2WPEA 1H7WA 1IJHA 5KVHA 4YSHA 5CQFA 3T2KA 4GAPA 4M52A 1GXFA 5EB5A 2YM2A 1V59A 2A87A 5ER0A 2V60A 4EIQA 1B37A 1PXBA 1NG4A 4EMIA 4C77A 4EQRA 2BCGG 4H4TA 2XDOA 2YVJA 3NNEA 5KXJA 4REKA 4YTPA 3HZLA 1GALA 2Y6RA 1ONFA 2XVFA 1PS9A 5KMQA 1QO8A 3CNTA 2XVEA 1EL9A 2GMHA 4OVIA 2V6OA 1JEHA 3O0HA 4B69A 1KNRA 2YLRA 5IPYA 2WQYA 1COYA 4Z24A 1L9DA 2EQ6A 3DGHA 3ALMA 3LB8A 5KOXA 3V3OA 3CGEA 1H82A 4WCTA 4K5SA 2QCUA 1PJ6A 1VG0A 4ZN0A 4H4ZA 2YLWA 2CFYA 2DKHA 3AB1A 3EF6A 3IHMA 1PN0A 3NT6A 4U8JA 4OPDA 4RG3A 1NHSA 3ZDNA 5DBJA 5HXIA 4NTEA 3NH3X 5BRTA 4C74A 1JU2A 2VOUA 5J7XA 1JRXA 2WP6A 1E6EA 1LPFA 1NG3A 1CC4A 2XLTA 3FBSA 1CL0A 1BGJA 1MOKA 1TYTA 2BACA 2R0CA 3BNMA 3NG7X 4GAVA 3LJPA 1D4CA 1GT8A 2YQUA 1F8SA 1JNZA 2NVKX 3UTFA 3F8RA 5U63A 2JB3A 4FK1A 4Z25A 3ALJA 3UTHA 1VRQB 1ZDLA 3GMBA 3KVEA 4H4VA 2C72A 2XLRA 1KDGA 1PBEA 5M10A 2XCGA 2B9WA 4J34A 3NHOX 4CCRA 3H8LA 1BKWA 3SZWA 2OLOA 4H4WA 2FJEA 2BXRA 1IUUA 1TDEA 5U25A 3UKLA 1SEZA 1NHRA 2GRTA 4H2RA 3T31A 1CC6A 3AE8A 3GDNA 4G74A 2IVDA 2YG4A 3B3RA 2WHDA 4BJZA 1D4EA 3CNSA 1ZOVA 3NTAA 1PDHA 1E1NA 3AD9B 3PS9A 1MO9A 3QSMA 5JCKA 5LV9A 4XWRA 4A5LA 2WESA 3ALLA 3KPFA 2E5VA 3CIRA 5L46A 1CF3A 3NLCA 3S61A 1FEBA 5GRTA 1XANA 2WDVA 1NHPA 2OAMA 2WBAA 3QFBA 1GSNA 3UTGA 1E7PA 4ECHA 4MJWA 2X50A 4DGKA 2QAEA 2Q6UA 4U8PA 4H4XA 3V76A 4A79A 4YT0A 1TDOA 1YQ3A 5HYMA 2J3NA 3CTYA 3G5RA 2GMJA 4FK1C 3SQPA 1TYPA 2XFNA 1O95A 3RHAA 4N9XA 3SXIA 2WU2A 4EM4A 1PJ5A 2WP5A 2ZZCA 4G73A 1N1PA 1GV4A 3LZXA 3QSEA 3GD4A 3GRTA 3VRAA 1NEKA 2BCPA 3IHGA 2C73A 3E1TA 1GERA 2AAQA 3F8PA 1GRFA 2H89A 2ZZBA 4AT2A 3I6DA 2C67A 1BZLA 4OPUA 2R46A 3H8IA 3LXDA 2YR4A 3HYXA 5FS8A 5U1OA 4BK2A 4TM1A 2Y6QA 4KX6A 4YSXA 1E1MA 1CC2A 3SZ0A 1B8SA 1DOCA 3BHKA 4U8LA 3SM8A 2B9YA 2B7RA 3AD7B 3C4AA 3GWFA 2C3CA 1HYUA 3KLJA 4H7UA 5KVIA 1Z6LA 5EOWA 1ZY8A 1O94A 3FMWA 4TM4A 3G5SA 1M64A 4NTCA 3SGLA 4B65A 3PVCA 3CNJA 4J57A 2QA2A 4UDPA 3DJDA 2JAEA 4GCMA 1PBDA 2V5ZA 5KOWA 1W4XA 4EQWA 3UKAA 1Q1WA 1H81A 1M6IA 1GRGA 1JRZA 2OALA 1IUTA 2X99A 3K30A 3LOVA 1ZX9A 4H2NA 4K2XA 1KNPA 2EQ9A 3LADA 5GSNA 3K7QX 3AD8B 3UKHA 3P4SA 1ZKQA 3CNPA 2BABA 1DXLA 4AP3A 4B68A 4H4SA 3GD3A 2BRYA 4Y4MA 2VVLG 1P2EA 1O5WA 3DJGX 2YR6A 5EBKA 3EAOA 3BI5A 3CGBA 3AWIA 4ZCDA 2CVJA 4EMJA 4BK3A 3QVRA 3QFAA 1H84A 4JNAA 2VVLA 1F8RA 2R9ZA 4EQSA 2C66A 2GVCA 3D8XA 4Z26A 1OJCA 2YLZA 4WX1A 4H4UA 2GR2A 2O9ZA 1XDIA 2VQBA 1L9CA 2ZBWA 3NTDA 3ICSA 3WE0A 1XHCA 1TDNA 2WS3A 3GSIA 1RYIA 3DH9A 2RABA 4YTMA 4JY2A 4UDQA 3AEGA
chains in the Genus database with same CATH topology
2XYOA 2YLXA 5KMPA 1GRBA 1DNCA 2BS2A 3SFDA 4CCQA 2W0HA 2BS3A 3DMEA 3NRNA 3IWAA 3DK8A 3UOYA 2R45A 1H86A 3F8DA 4G6HA 2JKCA 2C7GA 1RP0A 2R4EA 3ATRA 4I58A 2CULA 1F6MA 3VQRA 5JCNA 3CN8A 4YWOA 1VQWA 1CBOA 4RSLA 4B1BA 1FOHA 3GYJA 5KMSA 2BXSA 4EM3A 4LU6A 2XFOA 4XXGA 2C76A 2BK4A 4H2QA 1JRYA 1CJ4A 1JNRA 3M12A 5M0ZA 1GETA 1CHUA 2IIDA 2GR0A 4YTNA 1YQ4A 3JSKA 5J60A 2E1MA 2VQ7A 3UCLA 4U8NA 3AE1A 1E39A 2EQ8A 3AYIA 3NK0X 1S2QA 4AOSA 3KA7A 1LVLA 3T14A 2C75A 4USQA 1KFYA 3AEBA 4U2LA 3AXBA 3NN0X 3PO7A 3OZ2A 4A9WA 4B64A 4CRTA 3CPJG 4OPLA 1QLBA 4LIIA 3DA1A 2YAUA 1ZK7A 1FCDA 4ZCCA 2BC0A 2R0PA 1NHQA 4GRTA 3SZFA 4JY3A 3DJEA 4FDCB 2Q0KA 2RGOA 3NIXA 1DJQA 2Q7VA 2UZZA 3CPHG 4IVMB 4NEVA 4O5UA 5FMHA 2WETA 4YXDA 2GQWA 5JCMA 5KWFA 3IC9A 4DSGA 2VZ2A 2YG3A 4JDRA 1GRAA 1DOEA 2WOIA 2XLPA 3GRSA 3UKKA 1IUXA 2WDQA 2TMDA 1ZMDA 4A6NB 2FBWA 5FS7A 3UKQA 4P9SA 4HA6A 3B6DA 4U2TA 2FJAA 3L1RA 1YQZA 3QJ4A 3NYFA 3T2YA 1B4VA 2OA1A 3ITJA 4D03A 3T2ZA 2RGHA 2C64A 3GYIA 2R0GA 4G6GA 3URHA 2B7SA 2YM1A 5IQ4A 5JCLA 1VG9A 3RP7A 1KF6A 4U8MA 4B66A 3SZCA 2X3NA 1VDCA 4K8DA 4LA1A 2V3BA 2BRAA 2IVEA 4X9NA 1PBCA 2YG7A 1IUVA 4Z44A 4YSYA 5C2TA 3VRBA 4YKFA 5C3JA 3GYXA 2GAGB 1E1LA 3CGDA 4GDPA 1Y56A 3RP6A 5IQ1A 1Q9IA 4GF7A 2X8CA 4BK1A 4OCGA 1LJ1A 1K4QA 4IV9A 1JOAA 3VRDB 3CPIG 5HY5A 3AE4A 3FIMB 3NGCX 4Y4LA 3EANA 4FX9A 1H83A 1GEUA 4H4PA 1CJ2A 2GEWA 1GRHA 1Q1RA 3H4KA 4UDRA 5FS6A 3SX6A 5KMRA 2JB2A 2QA1A 1PBFA 3BI4A 4GUVA 4OPIA 4CY8A 2NPXA 2VRLA 3GWDA 1D7YA 1N4WA 4X4JA 4XWZA 1EL7A 3BNUA 4NZHA 3P1WA 3ABVA 4BURA 3CMMA 3NN6X 4USRA 4DSHA 2H88A 2BK5A 4J33A 3ICTA 4NTDA 5JCIA 3C4NA 2WEUA 2JK6A 2XVHA 4TM3A 2I0ZA 4CNKA 4II3A 3K7TA 4U2SA 4K5RA 1LQUA 3AYLA 4CBQA 4AP1A 1YY5A 3AEFA 4NNJA 4H4YA 1REOA 3SFEA 2YWLA 4AT0A 2E4GA 2B76A 3RP8A 3DGZA 3ATQA 3AE7A 2EQ7A 2VRMA 5FS9A 1K0LA 4ADWA 2YVFA 3AE2A 4C5OA 2TPRA 2C4CA 2C70A 4Z2UA 2Z5YA 4Y4NA 4A65A 1LTXR 1S3BA 4EQXA 4J31A 4Z2RA 2DKIA 1ELIA 1ZMCA 1BWCA 1Y0PA 3LZWA 3HYWA 4RG4A 1D7LA 5CKUA 4A7AA 2AR8A 3OC4A 1CJCA 3CGCA 4II2A 3IF9A 3L8KA 4IA6A 3AECA 1B5QA 1GTEA 3COXA 3DJJA 3M0OA 2Z5XA 1OJTA 4APNA 3M13A 1NENA 1N4UA 2GAHB 3NKSA 1K0JA 1NPXA 4IVOB 5KRQA 2F5ZA 4PABA 1GTHA 4BJYA 3UKFA 3ICRA 1K0IA 3GDPA 1S2YA 3AEDA 2OLNA 4UP3A 3FPZA 2APGA 2GQFA 3Q9TA 4I59A 3VR9A 1NAAA 2JBVA 3UOVA 4CY6A 1KSUA 3UTEA 4K7ZA 3DK4A 3EPTA 3NYCA 2FJBA 3T0KA 1F8WA 3R9UA 1GREA 1H7XA 2Q0LA 2JB1A 3UOXA 3D1CA 1GOSA 1S3EA 2BK3A 1PHHA 2GB0A 2WU5A 1FECA 2XFQA 4C3XA 4GR1A 4J36A 3REDA 1DODA 1TDFA 1YKJA 4YSZA 5BVAA 4JNQA 3KU9A 4KPRA 1ZOYA 4AOXA 2YG5A 1D4DA 4J56A 1BGNA 4O5QA 2ACZA 4Z43A 1X31B 1P2HA 2XVJA 1LV0A 5EB4A 2GR3A 1UKVG 3K7MX 4C3YA 2WPFA 2XLUA 1XPQA 1BF3A 4PAAA 2V3AA 2WPCA 4D04A 1PXCA 3AYJA 4NWZA 3AE6A 3UP4A 2GV8A 3G5QA 2X8GA 1FEAA 2XFUA 3UP5A 1RSGA 4BV6A 1EBDA 3HYVA 5BULA 3KKJA 3KD9A 4GDEA 3P4PA 1NDAA 2X8HA 2XVIA 2ZZ0A 4A6NA 3T37A 3CNDA 1EL5A 2XFPA 1LQTA 1AOGA 3SY4A 5TR3A 1D5TA 4OPTA 3I3LA 2BYBA 1GESA 2BC1A 1N4VA 2A8XA 2CDUA 3FG2P 3NK2X 4H4QA 4JQ9A 4TM0A 4U8OA 3RNMA 3SYIA 4E0VA 3VR8A 2RGJA 2A89A 1KSSA 4H50A 4H2PA 2C65A 1GNDA 1PXAA 3AEAA 4TLZA 3KPKA 1EL8A 1OJ9A 3BI2A 1ZP0A 2YG6A 1F3PA 3NYEA 2B9XA 2C3DA 4TLXA 4U8IA 3UKPA 2YLTA 4K22A 4IA5A 4JN9A 4X9MA 1H6VA 3V3NA 4OPCA 3AE5A 3ADAB 5BUKA 1L9EA 4G9KA 3NK1X 2V61A 2XLSA 1DOBA 4CNJA 4EIPA 1TRBA 4B67A 5KNLA 2AQJA 4B63A 2VVMA 1GRTA 5HHFA 4EMWA 2BS4A 2WDRA 1IUWA 4J2WA 3UOZA 3II4A 1OJDA 2FJDA 1FL2A 4Z2TA 2GH5A 1CJ3A 4DNAA 1MXTA 3AE9A 3DK9A 4A99A 2GR1A 2BA9A 2YLSA 1OJAA 3P9UA 3P4QA 3C96A 1Y56B 2PYXA 2WOVA 1PBBA 3ISHA 4H4RA 4NEWA 1DJNA 2GF3A 1L0VA 3P4RA 3QSSA 3QVPA 1TDKA 2YVGA 3AE3A 3BHFA 4ICYA 4OPGA 3AEEA 2HQMA 2PHHA 2WP9A 2YR5A 1IUSA 3Q6JA 4HB9A 1QJDA 2ARDA 1E1KA 1GPEA 2WOWA 4U8KA 3GMCA 3S5WA 1PJ7A 3ZYXA 2R4JA 4YKGA 2WPEA 1H7WA 1IJHA 5KVHA 4YSHA 5CQFA 3T2KA 4GAPA 4M52A 1GXFA 5EB5A 2YM2A 1V59A 2A87A 5ER0A 2V60A 4EIQA 1B37A 1PXBA 1NG4A 4EMIA 4C77A 4EQRA 2BCGG 4H4TA 2XDOA 2YVJA 3NNEA 5KXJA 4REKA 4YTPA 3HZLA 1GALA 2Y6RA 1ONFA 2XVFA 1PS9A 5KMQA 1QO8A 3CNTA 2XVEA 1EL9A 2GMHA 4OVIA 2V6OA 1JEHA 3O0HA 4B69A 1KNRA 2YLRA 5IPYA 2WQYA 1COYA 4Z24A 1L9DA 2EQ6A 3DGHA 3ALMA 3LB8A 5KOXA 3V3OA 3CGEA 1H82A 4WCTA 4K5SA 2QCUA 1PJ6A 1VG0A 4ZN0A 4H4ZA 2YLWA 2CFYA 2DKHA 3AB1A 3EF6A 3IHMA 1PN0A 3NT6A 4U8JA 4OPDA 4RG3A 1NHSA 3ZDNA 5DBJA 5HXIA 4NTEA 3NH3X 5BRTA 4C74A 1JU2A 2VOUA 5J7XA 1JRXA 2WP6A 1E6EA 1LPFA 1NG3A 1CC4A 2XLTA 3FBSA 1CL0A 1BGJA 1MOKA 1TYTA 2BACA 2R0CA 3BNMA 3NG7X 4GAVA 3LJPA 1D4CA 1GT8A 2YQUA 1F8SA 1JNZA 2NVKX 3UTFA 3F8RA 5U63A 2JB3A 4FK1A 4Z25A 3ALJA 3UTHA 1VRQB 1ZDLA 3GMBA 3KVEA 4H4VA 2C72A 2XLRA 1KDGA 1PBEA 5M10A 2XCGA 2B9WA 4J34A 3NHOX 4CCRA 3H8LA 1BKWA 3SZWA 2OLOA 4H4WA 2FJEA 2BXRA 1IUUA 1TDEA 5U25A 3UKLA 1SEZA 1NHRA 2GRTA 4H2RA 3T31A 1CC6A 3AE8A 3GDNA 4G74A 2IVDA 2YG4A 3B3RA 2WHDA 4BJZA 1D4EA 3CNSA 1ZOVA 3NTAA 1PDHA 1E1NA 3AD9B 3PS9A 1MO9A 3QSMA 5JCKA 5LV9A 4XWRA 4A5LA 2WESA 3ALLA 3KPFA 2E5VA 3CIRA 5L46A 1CF3A 3NLCA 3S61A 1FEBA 5GRTA 1XANA 2WDVA 1NHPA 2OAMA 2WBAA 3QFBA 1GSNA 3UTGA 1E7PA 4ECHA 4MJWA 2X50A 4DGKA 2QAEA 2Q6UA 4U8PA 4H4XA 3V76A 4A79A 4YT0A 1TDOA 1YQ3A 5HYMA 2J3NA 3CTYA 3G5RA 2GMJA 4FK1C 3SQPA 1TYPA 2XFNA 1O95A 3RHAA 4N9XA 3SXIA 2WU2A 4EM4A 1PJ5A 2WP5A 2ZZCA 4G73A 1N1PA 1GV4A 3LZXA 3QSEA 3GD4A 3GRTA 3VRAA 1NEKA 2BCPA 3IHGA 2C73A 3E1TA 1GERA 2AAQA 3F8PA 1GRFA 2H89A 2ZZBA 4AT2A 3I6DA 2C67A 1BZLA 4OPUA 2R46A 3H8IA 3LXDA 2YR4A 3HYXA 5FS8A 5U1OA 4BK2A 4TM1A 2Y6QA 4KX6A 4YSXA 1E1MA 1CC2A 3SZ0A 1B8SA 1DOCA 3BHKA 4U8LA 3SM8A 2B9YA 2B7RA 3AD7B 3C4AA 3GWFA 2C3CA 1HYUA 3KLJA 4H7UA 5KVIA 1Z6LA 5EOWA 1ZY8A 1O94A 3FMWA 4TM4A 3G5SA 1M64A 4NTCA 3SGLA 4B65A 3PVCA 3CNJA 4J57A 2QA2A 4UDPA 3DJDA 2JAEA 4GCMA 1PBDA 2V5ZA 5KOWA 1W4XA 4EQWA 3UKAA 1Q1WA 1H81A 1M6IA 1GRGA 1JRZA 2OALA 1IUTA 2X99A 3K30A 3LOVA 1ZX9A 4H2NA 4K2XA 1KNPA 2EQ9A 3LADA 5GSNA 3K7QX 3AD8B 3UKHA 3P4SA 1ZKQA 3CNPA 2BABA 1DXLA 4AP3A 4B68A 4H4SA 3GD3A 2BRYA 4Y4MA 2VVLG 1P2EA 1O5WA 3DJGX 2YR6A 5EBKA 3EAOA 3BI5A 3CGBA 3AWIA 4ZCDA 2CVJA 4EMJA 4BK3A 3QVRA 3QFAA 1H84A 4JNAA 2VVLA 1F8RA 2R9ZA 4EQSA 2C66A 2GVCA 3D8XA 4Z26A 1OJCA 2YLZA 4WX1A 4H4UA 2GR2A 2O9ZA 1XDIA 2VQBA 1L9CA 2ZBWA 3NTDA 3ICSA 3WE0A 1XHCA 1TDNA 2WS3A 3GSIA 1RYIA 3DH9A 2RABA 4YTMA 4JY2A 4UDQA 3AEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYO A;  2YLX A;  1GRB A;  1DNC A;  2BS2 A;  3SFD A;  4CCQ A;  2W0H A;  2BS3 A;  3DME A;  3NRN A;  3IWA A;  3DK8 A;  3UOY A;  2R45 A;  1H86 A;  3F8D A;  2JKC A;  2C7G A;  1RP0 A;  2R4E A;  3ATR A;  4I58 A;  2CUL A;  1F6M A;  3VQR A;  5JCN A;  3CN8 A;  4YWO A;  1VQW A;  1CBO A;  4RSL A;  4B1B A;  1FOH A;  3GYJ A;  2BXS A;  4EM3 A;  4LU6 A;  2XFO A;  4XXG A;  2C76 A;  2BK4 A;  4H2Q A;  1JRY A;  1CJ4 A;  1JNR A;  3M12 A;  5M0Z A;  1GET A;  1CHU A;  2IID A;  2GR0 A;  4YTN A;  1YQ4 A;  3JSK A;  5J60 A;  2E1M A;  2VQ7 A;  3UCL A;  4U8N A;  3AE1 A;  1E39 A;  2EQ8 A;  3AYI A;  3NK0 X;  1S2Q A;  4AOS A;  3KA7 A;  1LVL A;  2C75 A;  4USQ A;  1KFY A;  3AEB A;  4U2L A;  3AXB A;  3NN0 X;  3PO7 A;  3OZ2 A;  4A9W A;  4B64 A;  4CRT A;  3CPJ G;  4OPL A;  1QLB A;  4LII A;  3DA1 A;  2YAU A;  1ZK7 A;  1FCD A;  4ZCC A;  2BC0 A;  2R0P A;  1NHQ A;  4GRT A;  4JY3 A;  3DJE A;  4FDC B;  2Q0K A;  2RGO A;  3NIX A;  1DJQ A;  2Q7V A;  2UZZ A;  3CPH G;  4IVM B;  4NEV A;  4O5U A;  5FMH A;  2WET A;  4YXD A;  2GQW A;  5JCM A;  5KWF A;  3IC9 A;  4DSG A;  2VZ2 A;  2YG3 A;  4JDR A;  1GRA A;  1DOE A;  2WOI A;  2XLP A;  3GRS A;  3UKK A;  1IUX A;  2WDQ A;  2TMD A;  1ZMD A;  4A6N B;  2FBW A;  5FS7 A;  3UKQ A;  4P9S A;  4HA6 A;  3B6D A;  4U2T A;  2FJA A;  3L1R A;  1YQZ A;  3QJ4 A;  3NYF A;  1B4V A;  2OA1 A;  3ITJ A;  4D03 A;  2RGH A;  2C64 A;  3GYI A;  2R0G A;  3URH A;  2B7S A;  2YM1 A;  5IQ4 A;  5JCL A;  1VG9 A;  3RP7 A;  1KF6 A;  4U8M A;  4B66 A;  2X3N A;  1VDC A;  4K8D A;  4LA1 A;  2V3B A;  2IVE A;  4X9N A;  1PBC A;  2YG7 A;  1IUV A;  4Z44 A;  4YSY A;  5C2T A;  3VRB A;  4YKF A;  5C3J A;  2GAG B;  1E1L A;  3CGD A;  4GDP A;  1Y56 A;  3RP6 A;  5IQ1 A;  1Q9I A;  4GF7 A;  2X8C A;  4BK1 A;  4OCG A;  1LJ1 A;  1K4Q A;  4IV9 A;  1JOA A;  3VRD B;  3CPI G;  5HY5 A;  3AE4 A;  3FIM B;  3NGC X;  4Y4L A;  3EAN A;  4FX9 A;  1H83 A;  1GEU A;  4H4P A;  1CJ2 A;  2GEW A;  1GRH A;  1Q1R A;  3H4K A;  4UDR A;  5FS6 A;  2JB2 A;  2QA1 A;  1PBF A;  3BI4 A;  4GUV A;  4OPI A;  4CY8 A;  2NPX A;  2VRL A;  3GWD A;  1D7Y A;  1N4W A;  4X4J A;  4XWZ A;  1EL7 A;  3BNU A;  4NZH A;  3P1W A;  3ABV A;  4BUR A;  3NN6 X;  4USR A;  4DSH A;  2H88 A;  2BK5 A;  4J33 A;  3ICT A;  4NTD A;  5JCI A;  3C4N A;  2WEU A;  2JK6 A;  2XVH A;  4TM3 A;  2I0Z A;  4CNK A;  3K7T A;  4U2S A;  4K5R A;  1LQU A;  3AYL A;  4CBQ A;  4AP1 A;  1YY5 A;  3AEF A;  4H4Y A;  1REO A;  3SFE A;  2YWL A;  4AT0 A;  2E4G A;  2B76 A;  3RP8 A;  3DGZ A;  3ATQ A;  3AE7 A;  2EQ7 A;  2VRM A;  5FS9 A;  1K0L A;  4ADW A;  2YVF A;  3AE2 A;  4C5O A;  2TPR A;  2C70 A;  4Z2U A;  2Z5Y A;  4Y4N A;  4A65 A;  1LTX R;  1S3B A;  4EQX A;  4J31 A;  4Z2R A;  2DKI A;  1ELI A;  1ZMC A;  1BWC A;  1Y0P A;  3LZW A;  4RG4 A;  1D7L A;  5CKU A;  4A7A A;  2AR8 A;  3OC4 A;  1CJC A;  3CGC A;  3IF9 A;  3L8K A;  4IA6 A;  3AEC A;  1B5Q A;  1GTE A;  3COX A;  3DJJ A;  3M0O A;  2Z5X A;  1OJT A;  4APN A;  3M13 A;  1NEN A;  1N4U A;  2GAH B;  3NKS A;  1K0J A;  1NPX A;  4IVO B;  5KRQ A;  2F5Z A;  4PAB A;  1GTH A;  4BJY A;  3UKF A;  3ICR A;  1K0I A;  3GDP A;  1S2Y A;  3AED A;  2OLN A;  4UP3 A;  3FPZ A;  2APG A;  2GQF A;  3Q9T A;  4I59 A;  3VR9 A;  1NAA A;  2JBV A;  3UOV A;  4CY6 A;  1KSU A;  3UTE A;  4K7Z A;  3DK4 A;  3EPT A;  3NYC A;  2FJB A;  1F8W A;  3R9U A;  1GRE A;  1H7X A;  2Q0L A;  2JB1 A;  3UOX A;  3D1C A;  1GOS A;  1S3E A;  2BK3 A;  1PHH A;  2GB0 A;  2WU5 A;  1FEC A;  2XFQ A;  4C3X A;  4GR1 A;  4J36 A;  3RED A;  1DOD A;  1TDF A;  1YKJ A;  4YSZ A;  5BVA A;  4JNQ A;  3KU9 A;  4KPR A;  1ZOY A;  4AOX A;  2YG5 A;  1D4D A;  4J56 A;  1BGN A;  4O5Q A;  2ACZ A;  4Z43 A;  1X31 B;  1P2H A;  2XVJ A;  1LV0 A;  5EB4 A;  2GR3 A;  1UKV G;  3K7M X;  4C3Y A;  2WPF A;  2XLU A;  1XPQ A;  1BF3 A;  4PAA A;  2V3A A;  2WPC A;  4D04 A;  1PXC A;  3AYJ A;  3AE6 A;  3UP4 A;  2GV8 A;  3G5Q A;  2X8G A;  1FEA A;  2XFU A;  3UP5 A;  1RSG A;  4BV6 A;  1EBD A;  5BUL A;  3KKJ A;  3KD9 A;  4GDE A;  3P4P A;  1NDA A;  2X8H A;  2XVI A;  2ZZ0 A;  4A6N A;  3T37 A;  3CND A;  1EL5 A;  2XFP A;  1LQT A;  1AOG A;  5TR3 A;  1D5T A;  4OPT A;  3I3L A;  2BYB A;  1GES A;  2BC1 A;  1N4V A;  2A8X A;  2CDU A;  3FG2 P;  3NK2 X;  4H4Q A;  4JQ9 A;  4TM0 A;  4U8O A;  3RNM A;  4E0V A;  3VR8 A;  2RGJ A;  2A89 A;  1KSS A;  4H50 A;  4H2P A;  2C65 A;  1GND A;  1PXA A;  3AEA A;  4TLZ A;  1EL8 A;  1OJ9 A;  3BI2 A;  1ZP0 A;  2YG6 A;  1F3P A;  3NYE A;  2B9X A;  2C3D A;  4TLX A;  4U8I A;  3UKP A;  2YLT A;  4K22 A;  4IA5 A;  4JN9 A;  4X9M A;  1H6V A;  3V3N A;  4OPC A;  3AE5 A;  3ADA B;  5BUK A;  1L9E A;  3NK1 X;  2V61 A;  2XLS A;  1DOB A;  4CNJ A;  4EIP A;  1TRB A;  4B67 A;  2AQJ A;  4B63 A;  2VVM A;  1GRT A;  5HHF A;  4EMW A;  2BS4 A;  2WDR A;  1IUW A;  4J2W A;  3UOZ A;  3II4 A;  1OJD A;  2FJD A;  1FL2 A;  4Z2T A;  2GH5 A;  1CJ3 A;  4DNA A;  1MXT A;  3AE9 A;  3DK9 A;  4A99 A;  2GR1 A;  2BA9 A;  2YLS A;  1OJA A;  3P9U A;  3P4Q A;  3C96 A;  1Y56 B;  2PYX A;  2WOV A;  1PBB A;  3ISH A;  4H4R A;  4NEW A;  1DJN A;  2GF3 A;  1L0V A;  3P4R A;  3QSS A;  3QVP A;  1TDK A;  2YVG A;  3AE3 A;  3BHF A;  4ICY A;  4OPG A;  3AEE A;  2HQM A;  2PHH A;  2WP9 A;  2YR5 A;  1IUS A;  3Q6J A;  4HB9 A;  1QJD A;  2ARD A;  1E1K A;  1GPE A;  2WOW A;  4U8K A;  3GMC A;  3S5W A;  1PJ7 A;  3ZYX A;  2R4J A;  4YKG A;  2WPE A;  1H7W A;  1IJH A;  5KVH A;  4YSH A;  5CQF A;  4M52 A;  1GXF A;  5EB5 A;  2YM2 A;  1V59 A;  2A87 A;  5ER0 A;  2V60 A;  4EIQ A;  1B37 A;  1PXB A;  1NG4 A;  4EMI A;  4C77 A;  4EQR A;  2BCG G;  4H4T A;  2XDO A;  2YVJ A;  3NNE A;  5KXJ A;  4REK A;  4YTP A;  3HZL A;  1GAL A;  2Y6R A;  1ONF A;  2XVF A;  1PS9 A;  1QO8 A;  3CNT A;  2XVE A;  1EL9 A;  2GMH A;  4OVI A;  2V6O A;  1JEH A;  3O0H A;  4B69 A;  1KNR A;  2YLR A;  5IPY A;  2WQY A;  1COY A;  4Z24 A;  1L9D A;  2EQ6 A;  3DGH A;  3ALM A;  3LB8 A;  5KOX A;  3V3O A;  3CGE A;  1H82 A;  4WCT A;  4K5S A;  1PJ6 A;  2QCU A;  1VG0 A;  4ZN0 A;  4H4Z A;  2YLW A;  2CFY A;  2DKH A;  3AB1 A;  3EF6 A;  3IHM A;  1PN0 A;  3NT6 A;  4U8J A;  4OPD A;  4RG3 A;  1NHS A;  3ZDN A;  5DBJ A;  5HXI A;  4NTE A;  3NH3 X;  5BRT A;  4C74 A;  1JU2 A;  2VOU A;  5J7X A;  1JRX A;  2WP6 A;  1E6E A;  1LPF A;  1NG3 A;  1CC4 A;  2XLT A;  3FBS A;  1CL0 A;  1BGJ A;  1MOK A;  1TYT A;  2BAC A;  2R0C A;  3BNM A;  3NG7 X;  3LJP A;  1D4C A;  1GT8 A;  2YQU A;  1F8S A;  1JNZ A;  2NVK X;  3UTF A;  3F8R A;  5U63 A;  2JB3 A;  4FK1 A;  4Z25 A;  3ALJ A;  3UTH A;  1VRQ B;  1ZDL A;  3GMB A;  3KVE A;  4H4V A;  2C72 A;  2XLR A;  1KDG A;  1PBE A;  5M10 A;  2XCG A;  2B9W A;  4J34 A;  3NHO X;  4CCR A;  3H8L A;  1BKW A;  2OLO A;  4H4W A;  2FJE A;  2BXR A;  1IUU A;  1TDE A;  5U25 A;  3UKL A;  1SEZ A;  1NHR A;  2GRT A;  4H2R A;  1CC6 A;  3AE8 A;  3GDN A;  2IVD A;  2YG4 A;  3B3R A;  2WHD A;  4BJZ A;  1D4E A;  3CNS A;  1ZOV A;  3NTA A;  1PDH A;  1E1N A;  3AD9 B;  3PS9 A;  1MO9 A;  3QSM A;  5JCK A;  5LV9 A;  4XWR A;  4A5L A;  2WES A;  3ALL A;  3KPF A;  2E5V A;  3CIR A;  5L46 A;  1CF3 A;  3NLC A;  3S61 A;  1FEB A;  5GRT A;  1XAN A;  2WDV A;  1NHP A;  2OAM A;  2WBA A;  3QFB A;  1GSN A;  3UTG A;  1E7P A;  4ECH A;  4MJW A;  2X50 A;  4DGK A;  2QAE A;  2Q6U A;  4U8P A;  4H4X A;  3V76 A;  4A79 A;  4YT0 A;  1TDO A;  1YQ3 A;  5HYM A;  2J3N A;  3CTY A;  3G5R A;  2GMJ A;  4FK1 C;  3SQP A;  1TYP A;  2XFN A;  1O95 A;  3RHA A;  4N9X A;  2WU2 A;  4EM4 A;  1PJ5 A;  2WP5 A;  2ZZC A;  1N1P A;  1GV4 A;  3LZX A;  3QSE A;  3GD4 A;  3GRT A;  3VRA A;  1NEK A;  2BCP A;  3IHG A;  2C73 A;  3E1T A;  1GER A;  2AAQ A;  3F8P A;  1GRF A;  2H89 A;  2ZZB A;  4AT2 A;  3I6D A;  2C67 A;  1BZL A;  4OPU A;  2R46 A;  3H8I A;  3LXD A;  2YR4 A;  5FS8 A;  5U1O A;  4BK2 A;  4YSX A;  4TM1 A;  2Y6Q A;  4KX6 A;  1E1M A;  1CC2 A;  1B8S A;  1DOC A;  3BHK A;  4U8L A;  3SM8 A;  2B9Y A;  2B7R A;  3AD7 B;  3C4A A;  3GWF A;  2C3C A;  1HYU A;  3KLJ A;  4H7U A;  5KVI A;  1Z6L A;  5EOW A;  1ZY8 A;  1O94 A;  3FMW A;  4TM4 A;  3G5S A;  1M64 A;  4NTC A;  3SGL A;  4B65 A;  3PVC A;  3CNJ A;  4J57 A;  2QA2 A;  4UDP A;  3DJD A;  2JAE A;  4GCM A;  1PBD A;  2V5Z A;  5KOW A;  1W4X A;  4EQW A;  3UKA A;  1Q1W A;  1H81 A;  1M6I A;  1GRG A;  1JRZ A;  2OAL A;  1IUT A;  2X99 A;  3K30 A;  3LOV A;  1ZX9 A;  4H2N A;  4K2X A;  1KNP A;  2EQ9 A;  3LAD A;  5GSN A;  3K7Q X;  3AD8 B;  3UKH A;  3P4S A;  1ZKQ A;  3CNP A;  2BAB A;  1DXL A;  4AP3 A;  4B68 A;  4H4S A;  3GD3 A;  4Y4M A;  2VVL G;  1P2E A;  1O5W A;  3DJG X;  2YR6 A;  5EBK A;  3EAO A;  3BI5 A;  3CGB A;  3AWI A;  4ZCD A;  2CVJ A;  4EMJ A;  4BK3 A;  3QVR A;  3QFA A;  1H84 A;  4JNA A;  2VVL A;  1F8R A;  2R9Z A;  4EQS A;  2C66 A;  2GVC A;  3D8X A;  4Z26 A;  1OJC A;  2YLZ A;  4WX1 A;  4H4U A;  2GR2 A;  2O9Z A;  1XDI A;  2VQB A;  1L9C A;  2ZBW A;  3NTD A;  3ICS A;  3WE0 A;  1XHC A;  1TDN A;  2WS3 A;  3GSI A;  1RYI A;  3DH9 A;  2RAB A;  4YTM A;  4JY2 A;  4UDQ A;  3AEG A; 
#chains in the Genus database with same CATH topology
 2XYO A;  2YLX A;  5KMP A;  1GRB A;  1DNC A;  2BS2 A;  3SFD A;  4CCQ A;  2W0H A;  2BS3 A;  3DME A;  3NRN A;  3IWA A;  3DK8 A;  3UOY A;  2R45 A;  1H86 A;  3F8D A;  4G6H A;  2JKC A;  2C7G A;  1RP0 A;  2R4E A;  3ATR A;  4I58 A;  2CUL A;  1F6M A;  3VQR A;  5JCN A;  3CN8 A;  4YWO A;  1VQW A;  1CBO A;  4RSL A;  4B1B A;  1FOH A;  3GYJ A;  5KMS A;  2BXS A;  4EM3 A;  4LU6 A;  2XFO A;  4XXG A;  2C76 A;  2BK4 A;  4H2Q A;  1JRY A;  1CJ4 A;  1JNR A;  3M12 A;  5M0Z A;  1GET A;  1CHU A;  2IID A;  2GR0 A;  4YTN A;  1YQ4 A;  3JSK A;  5J60 A;  2E1M A;  2VQ7 A;  3UCL A;  4U8N A;  3AE1 A;  1E39 A;  2EQ8 A;  3AYI A;  3NK0 X;  1S2Q A;  4AOS A;  3KA7 A;  1LVL A;  3T14 A;  2C75 A;  4USQ A;  1KFY A;  3AEB A;  4U2L A;  3AXB A;  3NN0 X;  3PO7 A;  3OZ2 A;  4A9W A;  4B64 A;  4CRT A;  3CPJ G;  4OPL A;  1QLB A;  4LII A;  3DA1 A;  2YAU A;  1ZK7 A;  1FCD A;  4ZCC A;  2BC0 A;  2R0P A;  1NHQ A;  4GRT A;  3SZF A;  4JY3 A;  3DJE A;  4FDC B;  2Q0K A;  2RGO A;  3NIX A;  1DJQ A;  2Q7V A;  2UZZ A;  3CPH G;  4IVM B;  4NEV A;  4O5U A;  5FMH A;  2WET A;  4YXD A;  2GQW A;  5JCM A;  5KWF A;  3IC9 A;  4DSG A;  2VZ2 A;  2YG3 A;  4JDR A;  1GRA A;  1DOE A;  2WOI A;  2XLP A;  3GRS A;  3UKK A;  1IUX A;  2WDQ A;  2TMD A;  1ZMD A;  4A6N B;  2FBW A;  5FS7 A;  3UKQ A;  4P9S A;  4HA6 A;  3B6D A;  4U2T A;  2FJA A;  3L1R A;  1YQZ A;  3QJ4 A;  3NYF A;  3T2Y A;  1B4V A;  2OA1 A;  3ITJ A;  4D03 A;  3T2Z A;  2RGH A;  2C64 A;  3GYI A;  2R0G A;  4G6G A;  3URH A;  2B7S A;  2YM1 A;  5IQ4 A;  5JCL A;  1VG9 A;  3RP7 A;  1KF6 A;  4U8M A;  4B66 A;  3SZC A;  2X3N A;  1VDC A;  4K8D A;  4LA1 A;  2V3B A;  2BRA A;  2IVE A;  4X9N A;  1PBC A;  2YG7 A;  1IUV A;  4Z44 A;  4YSY A;  5C2T A;  3VRB A;  4YKF A;  5C3J A;  3GYX A;  2GAG B;  1E1L A;  3CGD A;  4GDP A;  1Y56 A;  3RP6 A;  5IQ1 A;  1Q9I A;  4GF7 A;  2X8C A;  4BK1 A;  4OCG A;  1LJ1 A;  1K4Q A;  4IV9 A;  1JOA A;  3VRD B;  3CPI G;  5HY5 A;  3AE4 A;  3FIM B;  3NGC X;  4Y4L A;  3EAN A;  4FX9 A;  1H83 A;  1GEU A;  4H4P A;  1CJ2 A;  2GEW A;  1GRH A;  1Q1R A;  3H4K A;  4UDR A;  5FS6 A;  3SX6 A;  5KMR A;  2JB2 A;  2QA1 A;  1PBF A;  3BI4 A;  4GUV A;  4OPI A;  4CY8 A;  2NPX A;  2VRL A;  3GWD A;  1D7Y A;  1N4W A;  4X4J A;  4XWZ A;  1EL7 A;  3BNU A;  4NZH A;  3P1W A;  3ABV A;  4BUR A;  3CMM A;  3NN6 X;  4USR A;  4DSH A;  2H88 A;  2BK5 A;  4J33 A;  3ICT A;  4NTD A;  5JCI A;  3C4N A;  2WEU A;  2JK6 A;  2XVH A;  4TM3 A;  2I0Z A;  4CNK A;  4II3 A;  3K7T A;  4U2S A;  4K5R A;  1LQU A;  3AYL A;  4CBQ A;  4AP1 A;  1YY5 A;  3AEF A;  4NNJ A;  4H4Y A;  1REO A;  3SFE A;  2YWL A;  4AT0 A;  2E4G A;  2B76 A;  3RP8 A;  3DGZ A;  3ATQ A;  3AE7 A;  2EQ7 A;  2VRM A;  5FS9 A;  1K0L A;  4ADW A;  2YVF A;  3AE2 A;  4C5O A;  2TPR A;  2C4C A;  2C70 A;  4Z2U A;  2Z5Y A;  4Y4N A;  4A65 A;  1LTX R;  1S3B A;  4EQX A;  4J31 A;  4Z2R A;  2DKI A;  1ELI A;  1ZMC A;  1BWC A;  1Y0P A;  3LZW A;  3HYW A;  4RG4 A;  1D7L A;  5CKU A;  4A7A A;  2AR8 A;  3OC4 A;  1CJC A;  3CGC A;  4II2 A;  3IF9 A;  3L8K A;  4IA6 A;  3AEC A;  1B5Q A;  1GTE A;  3COX A;  3DJJ A;  3M0O A;  2Z5X A;  1OJT A;  4APN A;  3M13 A;  1NEN A;  1N4U A;  2GAH B;  3NKS A;  1K0J A;  1NPX A;  4IVO B;  5KRQ A;  2F5Z A;  4PAB A;  1GTH A;  4BJY A;  3UKF A;  3ICR A;  1K0I A;  3GDP A;  1S2Y A;  3AED A;  2OLN A;  4UP3 A;  3FPZ A;  2APG A;  2GQF A;  3Q9T A;  4I59 A;  3VR9 A;  1NAA A;  2JBV A;  3UOV A;  4CY6 A;  1KSU A;  3UTE A;  4K7Z A;  3DK4 A;  3EPT A;  3NYC A;  2FJB A;  3T0K A;  1F8W A;  3R9U A;  1GRE A;  1H7X A;  2Q0L A;  2JB1 A;  3UOX A;  3D1C A;  1GOS A;  1S3E A;  2BK3 A;  1PHH A;  2GB0 A;  2WU5 A;  1FEC A;  2XFQ A;  4C3X A;  4GR1 A;  4J36 A;  3RED A;  1DOD A;  1TDF A;  1YKJ A;  4YSZ A;  5BVA A;  4JNQ A;  3KU9 A;  4KPR A;  1ZOY A;  4AOX A;  2YG5 A;  1D4D A;  4J56 A;  1BGN A;  4O5Q A;  2ACZ A;  4Z43 A;  1X31 B;  1P2H A;  2XVJ A;  1LV0 A;  5EB4 A;  2GR3 A;  1UKV G;  3K7M X;  4C3Y A;  2WPF A;  2XLU A;  1XPQ A;  1BF3 A;  4PAA A;  2V3A A;  2WPC A;  4D04 A;  1PXC A;  3AYJ A;  4NWZ A;  3AE6 A;  3UP4 A;  2GV8 A;  3G5Q A;  2X8G A;  1FEA A;  2XFU A;  3UP5 A;  1RSG A;  4BV6 A;  1EBD A;  3HYV A;  5BUL A;  3KKJ A;  3KD9 A;  4GDE A;  3P4P A;  1NDA A;  2X8H A;  2XVI A;  2ZZ0 A;  4A6N A;  3T37 A;  3CND A;  1EL5 A;  2XFP A;  1LQT A;  1AOG A;  3SY4 A;  5TR3 A;  1D5T A;  4OPT A;  3I3L A;  2BYB A;  1GES A;  2BC1 A;  1N4V A;  2A8X A;  2CDU A;  3FG2 P;  3NK2 X;  4H4Q A;  4JQ9 A;  4TM0 A;  4U8O A;  3RNM A;  3SYI A;  4E0V A;  3VR8 A;  2RGJ A;  2A89 A;  1KSS A;  4H50 A;  4H2P A;  2C65 A;  1GND A;  1PXA A;  3AEA A;  4TLZ A;  3KPK A;  1EL8 A;  1OJ9 A;  3BI2 A;  1ZP0 A;  2YG6 A;  1F3P A;  3NYE A;  2B9X A;  2C3D A;  4TLX A;  4U8I A;  3UKP A;  2YLT A;  4K22 A;  4IA5 A;  4JN9 A;  4X9M A;  1H6V A;  3V3N A;  4OPC A;  3AE5 A;  3ADA B;  5BUK A;  1L9E A;  4G9K A;  3NK1 X;  2V61 A;  2XLS A;  1DOB A;  4CNJ A;  4EIP A;  1TRB A;  4B67 A;  5KNL A;  2AQJ A;  4B63 A;  2VVM A;  1GRT A;  5HHF A;  4EMW A;  2BS4 A;  2WDR A;  1IUW A;  4J2W A;  3UOZ A;  3II4 A;  1OJD A;  2FJD A;  1FL2 A;  4Z2T A;  2GH5 A;  1CJ3 A;  4DNA A;  1MXT A;  3AE9 A;  3DK9 A;  4A99 A;  2GR1 A;  2BA9 A;  2YLS A;  1OJA A;  3P9U A;  3P4Q A;  3C96 A;  1Y56 B;  2PYX A;  2WOV A;  1PBB A;  3ISH A;  4H4R A;  4NEW A;  1DJN A;  2GF3 A;  1L0V A;  3P4R A;  3QSS A;  3QVP A;  1TDK A;  2YVG A;  3AE3 A;  3BHF A;  4ICY A;  4OPG A;  3AEE A;  2HQM A;  2PHH A;  2WP9 A;  2YR5 A;  1IUS A;  3Q6J A;  4HB9 A;  1QJD A;  2ARD A;  1E1K A;  1GPE A;  2WOW A;  4U8K A;  3GMC A;  3S5W A;  1PJ7 A;  3ZYX A;  2R4J A;  4YKG A;  2WPE A;  1H7W A;  1IJH A;  5KVH A;  4YSH A;  5CQF A;  3T2K A;  4GAP A;  4M52 A;  1GXF A;  5EB5 A;  2YM2 A;  1V59 A;  2A87 A;  5ER0 A;  2V60 A;  4EIQ A;  1B37 A;  1PXB A;  1NG4 A;  4EMI A;  4C77 A;  4EQR A;  2BCG G;  4H4T A;  2XDO A;  2YVJ A;  3NNE A;  5KXJ A;  4REK A;  4YTP A;  3HZL A;  1GAL A;  2Y6R A;  1ONF A;  2XVF A;  1PS9 A;  5KMQ A;  1QO8 A;  3CNT A;  2XVE A;  1EL9 A;  2GMH A;  4OVI A;  2V6O A;  1JEH A;  3O0H A;  4B69 A;  1KNR A;  2YLR A;  5IPY A;  2WQY A;  1COY A;  4Z24 A;  1L9D A;  2EQ6 A;  3DGH A;  3ALM A;  3LB8 A;  5KOX A;  3V3O A;  3CGE A;  1H82 A;  4WCT A;  4K5S A;  2QCU A;  1PJ6 A;  1VG0 A;  4ZN0 A;  4H4Z A;  2YLW A;  2CFY A;  2DKH A;  3AB1 A;  3EF6 A;  3IHM A;  1PN0 A;  3NT6 A;  4U8J A;  4OPD A;  4RG3 A;  1NHS A;  3ZDN A;  5DBJ A;  5HXI A;  4NTE A;  3NH3 X;  5BRT A;  4C74 A;  1JU2 A;  2VOU A;  5J7X A;  1JRX A;  2WP6 A;  1E6E A;  1LPF A;  1NG3 A;  1CC4 A;  2XLT A;  3FBS A;  1CL0 A;  1BGJ A;  1MOK A;  1TYT A;  2BAC A;  2R0C A;  3BNM A;  3NG7 X;  4GAV A;  3LJP A;  1D4C A;  1GT8 A;  2YQU A;  1F8S A;  1JNZ A;  2NVK X;  3UTF A;  3F8R A;  5U63 A;  2JB3 A;  4FK1 A;  4Z25 A;  3ALJ A;  3UTH A;  1VRQ B;  1ZDL A;  3GMB A;  3KVE A;  4H4V A;  2C72 A;  2XLR A;  1KDG A;  1PBE A;  5M10 A;  2XCG A;  2B9W A;  4J34 A;  3NHO X;  4CCR A;  3H8L A;  1BKW A;  3SZW A;  2OLO A;  4H4W A;  2FJE A;  2BXR A;  1IUU A;  1TDE A;  5U25 A;  3UKL A;  1SEZ A;  1NHR A;  2GRT A;  4H2R A;  3T31 A;  1CC6 A;  3AE8 A;  3GDN A;  4G74 A;  2IVD A;  2YG4 A;  3B3R A;  2WHD A;  4BJZ A;  1D4E A;  3CNS A;  1ZOV A;  3NTA A;  1PDH A;  1E1N A;  3AD9 B;  3PS9 A;  1MO9 A;  3QSM A;  5JCK A;  5LV9 A;  4XWR A;  4A5L A;  2WES A;  3ALL A;  3KPF A;  2E5V A;  3CIR A;  5L46 A;  1CF3 A;  3NLC A;  3S61 A;  1FEB A;  5GRT A;  1XAN A;  2WDV A;  1NHP A;  2OAM A;  2WBA A;  3QFB A;  1GSN A;  3UTG A;  1E7P A;  4ECH A;  4MJW A;  2X50 A;  4DGK A;  2QAE A;  2Q6U A;  4U8P A;  4H4X A;  3V76 A;  4A79 A;  4YT0 A;  1TDO A;  1YQ3 A;  5HYM A;  2J3N A;  3CTY A;  3G5R A;  2GMJ A;  4FK1 C;  3SQP A;  1TYP A;  2XFN A;  1O95 A;  3RHA A;  4N9X A;  3SXI A;  2WU2 A;  4EM4 A;  1PJ5 A;  2WP5 A;  2ZZC A;  4G73 A;  1N1P A;  1GV4 A;  3LZX A;  3QSE A;  3GD4 A;  3GRT A;  3VRA A;  1NEK A;  2BCP A;  3IHG A;  2C73 A;  3E1T A;  1GER A;  2AAQ A;  3F8P A;  1GRF A;  2H89 A;  2ZZB A;  4AT2 A;  3I6D A;  2C67 A;  1BZL A;  4OPU A;  2R46 A;  3H8I A;  3LXD A;  2YR4 A;  3HYX A;  5FS8 A;  5U1O A;  4BK2 A;  4TM1 A;  2Y6Q A;  4KX6 A;  4YSX A;  1E1M A;  1CC2 A;  3SZ0 A;  1B8S A;  1DOC A;  3BHK A;  4U8L A;  3SM8 A;  2B9Y A;  2B7R A;  3AD7 B;  3C4A A;  3GWF A;  2C3C A;  1HYU A;  3KLJ A;  4H7U A;  5KVI A;  1Z6L A;  5EOW A;  1ZY8 A;  1O94 A;  3FMW A;  4TM4 A;  3G5S A;  1M64 A;  4NTC A;  3SGL A;  4B65 A;  3PVC A;  3CNJ A;  4J57 A;  2QA2 A;  4UDP A;  3DJD A;  2JAE A;  4GCM A;  1PBD A;  2V5Z A;  5KOW A;  1W4X A;  4EQW A;  3UKA A;  1Q1W A;  1H81 A;  1M6I A;  1GRG A;  1JRZ A;  2OAL A;  1IUT A;  2X99 A;  3K30 A;  3LOV A;  1ZX9 A;  4H2N A;  4K2X A;  1KNP A;  2EQ9 A;  3LAD A;  5GSN A;  3K7Q X;  3AD8 B;  3UKH A;  3P4S A;  1ZKQ A;  3CNP A;  2BAB A;  1DXL A;  4AP3 A;  4B68 A;  4H4S A;  3GD3 A;  2BRY A;  4Y4M A;  2VVL G;  1P2E A;  1O5W A;  3DJG X;  2YR6 A;  5EBK A;  3EAO A;  3BI5 A;  3CGB A;  3AWI A;  4ZCD A;  2CVJ A;  4EMJ A;  4BK3 A;  3QVR A;  3QFA A;  1H84 A;  4JNA A;  2VVL A;  1F8R A;  2R9Z A;  4EQS A;  2C66 A;  2GVC A;  3D8X A;  4Z26 A;  1OJC A;  2YLZ A;  4WX1 A;  4H4U A;  2GR2 A;  2O9Z A;  1XDI A;  2VQB A;  1L9C A;  2ZBW A;  3NTD A;  3ICS A;  3WE0 A;  1XHC A;  1TDN A;  2WS3 A;  3GSI A;  1RYI A;  3DH9 A;  2RAB A;  4YTM A;  4JY2 A;  4UDQ A;  3AEG A; 
#chains in the Genus database with same CATH homology
 2XYO A;  2YLX A;  5KMP A;  1GRB A;  1DNC A;  2BS2 A;  3SFD A;  4CCQ A;  2W0H A;  2BS3 A;  3DME A;  3NRN A;  3IWA A;  3DK8 A;  3UOY A;  2R45 A;  1H86 A;  3F8D A;  4G6H A;  2JKC A;  2C7G A;  1RP0 A;  2R4E A;  3ATR A;  4I58 A;  2CUL A;  1F6M A;  3VQR A;  5JCN A;  3CN8 A;  4YWO A;  1VQW A;  1CBO A;  4RSL A;  4B1B A;  1FOH A;  3GYJ A;  5KMS A;  2BXS A;  4EM3 A;  4LU6 A;  2XFO A;  4XXG A;  2C76 A;  2BK4 A;  4H2Q A;  1JRY A;  1CJ4 A;  1JNR A;  3M12 A;  5M0Z A;  1GET A;  1CHU A;  2IID A;  2GR0 A;  4YTN A;  1YQ4 A;  3JSK A;  5J60 A;  2E1M A;  2VQ7 A;  3UCL A;  4U8N A;  3AE1 A;  1E39 A;  2EQ8 A;  3AYI A;  3NK0 X;  1S2Q A;  4AOS A;  3KA7 A;  1LVL A;  3T14 A;  2C75 A;  4USQ A;  1KFY A;  3AEB A;  4U2L A;  3AXB A;  3NN0 X;  3PO7 A;  3OZ2 A;  4A9W A;  4B64 A;  4CRT A;  3CPJ G;  4OPL A;  1QLB A;  4LII A;  3DA1 A;  2YAU A;  1ZK7 A;  1FCD A;  4ZCC A;  2BC0 A;  2R0P A;  1NHQ A;  4GRT A;  3SZF A;  4JY3 A;  3DJE A;  4FDC B;  2Q0K A;  2RGO A;  3NIX A;  1DJQ A;  2Q7V A;  2UZZ A;  3CPH G;  4IVM B;  4NEV A;  4O5U A;  5FMH A;  2WET A;  4YXD A;  2GQW A;  5JCM A;  5KWF A;  3IC9 A;  4DSG A;  2VZ2 A;  2YG3 A;  4JDR A;  1GRA A;  1DOE A;  2WOI A;  2XLP A;  3GRS A;  3UKK A;  1IUX A;  2WDQ A;  2TMD A;  1ZMD A;  4A6N B;  2FBW A;  5FS7 A;  3UKQ A;  4P9S A;  4HA6 A;  3B6D A;  4U2T A;  2FJA A;  3L1R A;  1YQZ A;  3QJ4 A;  3NYF A;  3T2Y A;  1B4V A;  2OA1 A;  3ITJ A;  4D03 A;  3T2Z A;  2RGH A;  2C64 A;  3GYI A;  2R0G A;  4G6G A;  3URH A;  2B7S A;  2YM1 A;  5IQ4 A;  5JCL A;  1VG9 A;  3RP7 A;  1KF6 A;  4U8M A;  4B66 A;  3SZC A;  2X3N A;  1VDC A;  4K8D A;  4LA1 A;  2V3B A;  2BRA A;  2IVE A;  4X9N A;  1PBC A;  2YG7 A;  1IUV A;  4Z44 A;  4YSY A;  5C2T A;  3VRB A;  4YKF A;  5C3J A;  3GYX A;  2GAG B;  1E1L A;  3CGD A;  4GDP A;  1Y56 A;  3RP6 A;  5IQ1 A;  1Q9I A;  4GF7 A;  2X8C A;  4BK1 A;  4OCG A;  1LJ1 A;  1K4Q A;  4IV9 A;  1JOA A;  3VRD B;  3CPI G;  5HY5 A;  3AE4 A;  3FIM B;  3NGC X;  4Y4L A;  3EAN A;  4FX9 A;  1H83 A;  1GEU A;  4H4P A;  1CJ2 A;  2GEW A;  1GRH A;  1Q1R A;  3H4K A;  4UDR A;  5FS6 A;  3SX6 A;  5KMR A;  2JB2 A;  2QA1 A;  1PBF A;  3BI4 A;  4GUV A;  4OPI A;  4CY8 A;  2NPX A;  2VRL A;  3GWD A;  1D7Y A;  1N4W A;  4X4J A;  4XWZ A;  1EL7 A;  3BNU A;  4NZH A;  3P1W A;  3ABV A;  4BUR A;  3CMM A;  3NN6 X;  4USR A;  4DSH A;  2H88 A;  2BK5 A;  4J33 A;  3ICT A;  4NTD A;  5JCI A;  3C4N A;  2WEU A;  2JK6 A;  2XVH A;  4TM3 A;  2I0Z A;  4CNK A;  4II3 A;  3K7T A;  4U2S A;  4K5R A;  1LQU A;  3AYL A;  4CBQ A;  4AP1 A;  1YY5 A;  3AEF A;  4NNJ A;  4H4Y A;  1REO A;  3SFE A;  2YWL A;  4AT0 A;  2E4G A;  2B76 A;  3RP8 A;  3DGZ A;  3ATQ A;  3AE7 A;  2EQ7 A;  2VRM A;  5FS9 A;  1K0L A;  4ADW A;  2YVF A;  3AE2 A;  4C5O A;  2TPR A;  2C4C A;  2C70 A;  4Z2U A;  2Z5Y A;  4Y4N A;  4A65 A;  1LTX R;  1S3B A;  4EQX A;  4J31 A;  4Z2R A;  2DKI A;  1ELI A;  1ZMC A;  1BWC A;  1Y0P A;  3LZW A;  3HYW A;  4RG4 A;  1D7L A;  5CKU A;  4A7A A;  2AR8 A;  3OC4 A;  1CJC A;  3CGC A;  4II2 A;  3IF9 A;  3L8K A;  4IA6 A;  3AEC A;  1B5Q A;  1GTE A;  3COX A;  3DJJ A;  3M0O A;  2Z5X A;  1OJT A;  4APN A;  3M13 A;  1NEN A;  1N4U A;  2GAH B;  3NKS A;  1K0J A;  1NPX A;  4IVO B;  5KRQ A;  2F5Z A;  4PAB A;  1GTH A;  4BJY A;  3UKF A;  3ICR A;  1K0I A;  3GDP A;  1S2Y A;  3AED A;  2OLN A;  4UP3 A;  3FPZ A;  2APG A;  2GQF A;  3Q9T A;  4I59 A;  3VR9 A;  1NAA A;  2JBV A;  3UOV A;  4CY6 A;  1KSU A;  3UTE A;  4K7Z A;  3DK4 A;  3EPT A;  3NYC A;  2FJB A;  3T0K A;  1F8W A;  3R9U A;  1GRE A;  1H7X A;  2Q0L A;  2JB1 A;  3UOX A;  3D1C A;  1GOS A;  1S3E A;  2BK3 A;  1PHH A;  2GB0 A;  2WU5 A;  1FEC A;  2XFQ A;  4C3X A;  4GR1 A;  4J36 A;  3RED A;  1DOD A;  1TDF A;  1YKJ A;  4YSZ A;  5BVA A;  4JNQ A;  3KU9 A;  4KPR A;  1ZOY A;  4AOX A;  2YG5 A;  1D4D A;  4J56 A;  1BGN A;  4O5Q A;  2ACZ A;  4Z43 A;  1X31 B;  1P2H A;  2XVJ A;  1LV0 A;  5EB4 A;  2GR3 A;  1UKV G;  3K7M X;  4C3Y A;  2WPF A;  2XLU A;  1XPQ A;  1BF3 A;  4PAA A;  2V3A A;  2WPC A;  4D04 A;  1PXC A;  3AYJ A;  4NWZ A;  3AE6 A;  3UP4 A;  2GV8 A;  3G5Q A;  2X8G A;  1FEA A;  2XFU A;  3UP5 A;  1RSG A;  4BV6 A;  1EBD A;  3HYV A;  5BUL A;  3KKJ A;  3KD9 A;  4GDE A;  3P4P A;  1NDA A;  2X8H A;  2XVI A;  2ZZ0 A;  4A6N A;  3T37 A;  3CND A;  1EL5 A;  2XFP A;  1LQT A;  1AOG A;  3SY4 A;  5TR3 A;  1D5T A;  4OPT A;  3I3L A;  2BYB A;  1GES A;  2BC1 A;  1N4V A;  2A8X A;  2CDU A;  3FG2 P;  3NK2 X;  4H4Q A;  4JQ9 A;  4TM0 A;  4U8O A;  3RNM A;  3SYI A;  4E0V A;  3VR8 A;  2RGJ A;  2A89 A;  1KSS A;  4H50 A;  4H2P A;  2C65 A;  1GND A;  1PXA A;  3AEA A;  4TLZ A;  3KPK A;  1EL8 A;  1OJ9 A;  3BI2 A;  1ZP0 A;  2YG6 A;  1F3P A;  3NYE A;  2B9X A;  2C3D A;  4TLX A;  4U8I A;  3UKP A;  2YLT A;  4K22 A;  4IA5 A;  4JN9 A;  4X9M A;  1H6V A;  3V3N A;  4OPC A;  3AE5 A;  3ADA B;  5BUK A;  1L9E A;  4G9K A;  3NK1 X;  2V61 A;  2XLS A;  1DOB A;  4CNJ A;  4EIP A;  1TRB A;  4B67 A;  5KNL A;  2AQJ A;  4B63 A;  2VVM A;  1GRT A;  5HHF A;  4EMW A;  2BS4 A;  2WDR A;  1IUW A;  4J2W A;  3UOZ A;  3II4 A;  1OJD A;  2FJD A;  1FL2 A;  4Z2T A;  2GH5 A;  1CJ3 A;  4DNA A;  1MXT A;  3AE9 A;  3DK9 A;  4A99 A;  2GR1 A;  2BA9 A;  2YLS A;  1OJA A;  3P9U A;  3P4Q A;  3C96 A;  1Y56 B;  2PYX A;  2WOV A;  1PBB A;  3ISH A;  4H4R A;  4NEW A;  1DJN A;  2GF3 A;  1L0V A;  3P4R A;  3QSS A;  3QVP A;  1TDK A;  2YVG A;  3AE3 A;  3BHF A;  4ICY A;  4OPG A;  3AEE A;  2HQM A;  2PHH A;  2WP9 A;  2YR5 A;  1IUS A;  3Q6J A;  4HB9 A;  1QJD A;  2ARD A;  1E1K A;  1GPE A;  2WOW A;  4U8K A;  3GMC A;  3S5W A;  1PJ7 A;  3ZYX A;  2R4J A;  4YKG A;  2WPE A;  1H7W A;  1IJH A;  5KVH A;  4YSH A;  5CQF A;  3T2K A;  4GAP A;  4M52 A;  1GXF A;  5EB5 A;  2YM2 A;  1V59 A;  2A87 A;  5ER0 A;  2V60 A;  4EIQ A;  1B37 A;  1PXB A;  1NG4 A;  4EMI A;  4C77 A;  4EQR A;  2BCG G;  4H4T A;  2XDO A;  2YVJ A;  3NNE A;  5KXJ A;  4REK A;  4YTP A;  3HZL A;  1GAL A;  2Y6R A;  1ONF A;  2XVF A;  1PS9 A;  5KMQ A;  1QO8 A;  3CNT A;  2XVE A;  1EL9 A;  2GMH A;  4OVI A;  2V6O A;  1JEH A;  3O0H A;  4B69 A;  1KNR A;  2YLR A;  5IPY A;  2WQY A;  1COY A;  4Z24 A;  1L9D A;  2EQ6 A;  3DGH A;  3ALM A;  3LB8 A;  5KOX A;  3V3O A;  3CGE A;  1H82 A;  4WCT A;  4K5S A;  2QCU A;  1PJ6 A;  1VG0 A;  4ZN0 A;  4H4Z A;  2YLW A;  2CFY A;  2DKH A;  3AB1 A;  3EF6 A;  3IHM A;  1PN0 A;  3NT6 A;  4U8J A;  4OPD A;  4RG3 A;  1NHS A;  3ZDN A;  5DBJ A;  5HXI A;  4NTE A;  3NH3 X;  5BRT A;  4C74 A;  1JU2 A;  2VOU A;  5J7X A;  1JRX A;  2WP6 A;  1E6E A;  1LPF A;  1NG3 A;  1CC4 A;  2XLT A;  3FBS A;  1CL0 A;  1BGJ A;  1MOK A;  1TYT A;  2BAC A;  2R0C A;  3BNM A;  3NG7 X;  4GAV A;  3LJP A;  1D4C A;  1GT8 A;  2YQU A;  1F8S A;  1JNZ A;  2NVK X;  3UTF A;  3F8R A;  5U63 A;  2JB3 A;  4FK1 A;  4Z25 A;  3ALJ A;  3UTH A;  1VRQ B;  1ZDL A;  3GMB A;  3KVE A;  4H4V A;  2C72 A;  2XLR A;  1KDG A;  1PBE A;  5M10 A;  2XCG A;  2B9W A;  4J34 A;  3NHO X;  4CCR A;  3H8L A;  1BKW A;  3SZW A;  2OLO A;  4H4W A;  2FJE A;  2BXR A;  1IUU A;  1TDE A;  5U25 A;  3UKL A;  1SEZ A;  1NHR A;  2GRT A;  4H2R A;  3T31 A;  1CC6 A;  3AE8 A;  3GDN A;  4G74 A;  2IVD A;  2YG4 A;  3B3R A;  2WHD A;  4BJZ A;  1D4E A;  3CNS A;  1ZOV A;  3NTA A;  1PDH A;  1E1N A;  3AD9 B;  3PS9 A;  1MO9 A;  3QSM A;  5JCK A;  5LV9 A;  4XWR A;  4A5L A;  2WES A;  3ALL A;  3KPF A;  2E5V A;  3CIR A;  5L46 A;  1CF3 A;  3NLC A;  3S61 A;  1FEB A;  5GRT A;  1XAN A;  2WDV A;  1NHP A;  2OAM A;  2WBA A;  3QFB A;  1GSN A;  3UTG A;  1E7P A;  4ECH A;  4MJW A;  2X50 A;  4DGK A;  2QAE A;  2Q6U A;  4U8P A;  4H4X A;  3V76 A;  4A79 A;  4YT0 A;  1TDO A;  1YQ3 A;  5HYM A;  2J3N A;  3CTY A;  3G5R A;  2GMJ A;  4FK1 C;  3SQP A;  1TYP A;  2XFN A;  1O95 A;  3RHA A;  4N9X A;  3SXI A;  2WU2 A;  4EM4 A;  1PJ5 A;  2WP5 A;  2ZZC A;  4G73 A;  1N1P A;  1GV4 A;  3LZX A;  3QSE A;  3GD4 A;  3GRT A;  3VRA A;  1NEK A;  2BCP A;  3IHG A;  2C73 A;  3E1T A;  1GER A;  2AAQ A;  3F8P A;  1GRF A;  2H89 A;  2ZZB A;  4AT2 A;  3I6D A;  2C67 A;  1BZL A;  4OPU A;  2R46 A;  3H8I A;  3LXD A;  2YR4 A;  3HYX A;  5FS8 A;  5U1O A;  4BK2 A;  4TM1 A;  2Y6Q A;  4KX6 A;  4YSX A;  1E1M A;  1CC2 A;  3SZ0 A;  1B8S A;  1DOC A;  3BHK A;  4U8L A;  3SM8 A;  2B9Y A;  2B7R A;  3AD7 B;  3C4A A;  3GWF A;  2C3C A;  1HYU A;  3KLJ A;  4H7U A;  5KVI A;  1Z6L A;  5EOW A;  1ZY8 A;  1O94 A;  3FMW A;  4TM4 A;  3G5S A;  1M64 A;  4NTC A;  3SGL A;  4B65 A;  3PVC A;  3CNJ A;  4J57 A;  2QA2 A;  4UDP A;  3DJD A;  2JAE A;  4GCM A;  1PBD A;  2V5Z A;  5KOW A;  1W4X A;  4EQW A;  3UKA A;  1Q1W A;  1H81 A;  1M6I A;  1GRG A;  1JRZ A;  2OAL A;  1IUT A;  2X99 A;  3K30 A;  3LOV A;  1ZX9 A;  4H2N A;  4K2X A;  1KNP A;  2EQ9 A;  3LAD A;  5GSN A;  3K7Q X;  3AD8 B;  3UKH A;  3P4S A;  1ZKQ A;  3CNP A;  2BAB A;  1DXL A;  4AP3 A;  4B68 A;  4H4S A;  3GD3 A;  2BRY A;  4Y4M A;  2VVL G;  1P2E A;  1O5W A;  3DJG X;  2YR6 A;  5EBK A;  3EAO A;  3BI5 A;  3CGB A;  3AWI A;  4ZCD A;  2CVJ A;  4EMJ A;  4BK3 A;  3QVR A;  3QFA A;  1H84 A;  4JNA A;  2VVL A;  1F8R A;  2R9Z A;  4EQS A;  2C66 A;  2GVC A;  3D8X A;  4Z26 A;  1OJC A;  2YLZ A;  4WX1 A;  4H4U A;  2GR2 A;  2O9Z A;  1XDI A;  2VQB A;  1L9C A;  2ZBW A;  3NTD A;  3ICS A;  3WE0 A;  1XHC A;  1TDN A;  2WS3 A;  3GSI A;  1RYI A;  3DH9 A;  2RAB A;  4YTM A;  4JY2 A;  4UDQ A;  3AEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...