3NK2X

Complex of 6-hydroxy-l-nicotine oxidase with dopamine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 142
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk2X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk2X02
4B66A 3BHKA 1B5QA 3K7MX 2GH5A 3AD9B 3BHFA 3ALMA 3UCLA 4LIIA 3ATRA 3Q6JA 1FL2A 3KA7A 1MO9A 3ITJA 2JBVA 2DKHA 3DJGX 1BGJA 4GUVA 3UKPA 3GYJA 1Z6LA 4C77A 3QSEA 4AP3A 5BULA 2OLNA 1OJ9A 1ZP0A 3D1CA 2C7GA 4A6NA 2CVJA 2JAEA 4K5SA 3UKAA 2V6OA 4X4JA 4U8OA 2R0CA 3SFDA 1F8SA 1NHSA 4H4UA 3Q9TA 2JB3A 4JN9A 3F8PA 4WX1A 1ZOYA 4OVIA 3AB1A 4U2LA 1K4QA 1PHHA 4M52A 3LJPA 3ICRA 2X3NA 1GTEA 2BACA 2PHHA 3GD4A 4OPUA 3T37A 3UP5A 3PO7A 4YKFA 1PXAA 3UP4A 2R9ZA 3UKKA 1UKVG 2QA1A 4J2WA 4Y4NA 2GEWA 4CY6A 1S3EA 1YKJA 4B63A 3UKFA 1JRYA 3K30A 4U2TA 1GXFA 5ER0A 2C64A 3RNMA 2VVMA 4H4PA 3IWAA 3VRAA 4Z26A 1E1KA 2A89A 2ZZCA 4GR1A 2GF3A 2RGOA 1S2YA 1DOEA 1B8SA 5U25A 3KKJA 1GRFA 1OJCA 1FCDA 5U63A 2OA1A 5KRQA 5CQFA 3E1TA 5C3JA 4A6NB 1JNRA 4A9WA 1NENA 4EIPA 3F8RA 1VG0A 3ZDNA 4J36A 5J60A 5KVIA 4YKGA 3EPTA 4JQ9A 3AD8B 4A99A 4YWOA 3CNSA 2XLRA 4GCMA 5KOWA 3RP7A 4RG3A 4TM1A 1KSUA 2YWLA 3CGCA 1GOSA 3GMBA 2Y6RA 2XLUA 2BK4A 2XLSA 2PYXA 2BC0A 4K7ZA 2WDVA 4EQWA 3CPHG 5L46A 4Y4MA 2ARDA 2B9WA 1IUVA 5JCKA 1K0IA 3P1WA 1KF6A 4A5LA 4YTPA 4NEVA 1B4VA 3GD3A 4OPGA 1DXLA 4J56A 4LA1A 3AE2A 2WDQA 3F8DA 1QLBA 1K0LA 4B69A 2ZBWA 2BXRA 4YSYA 3BI4A 4DSGA 2V3AA 4A65A 3V76A 3IF9A 1JU2A 1E39A 3ADAB 2E1MA 1F3PA 2YLRA 4KPRA 4D03A 1TYTA 4NEWA 1DJQA 1D4EA 4U8LA 1KNRA 3KU9A 1E7PA 2HQMA 2VQ7A 5JCIA 2CDUA 4D04A 4UDPA 3C96A 1F8WA 1FOHA 2XYOA 2VRLA 4EM3A 1K0JA 2NVKX 4H4ZA 4ZCDA 3P4PA 2R4EA 1NG3A 3NK0X 3AE9A 4TM0A 4J31A 3BI5A 4KX6A 4ZCCA 4GDEA 1FEBA 3L1RA 5HY5A 1GRBA 4UDRA 1D5TA 4EQRA 3C4NA 1TYPA 4H7UA 3RP8A 2V61A 4AOXA 1ZX9A 3AD7B 4OPDA 3CNTA 2VVLA 1H86A 4B64A 1PJ5A 4H4QA 1ZKQA 3DK9A 2EQ8A 2GVCA 1XDIA 1TDFA 4YSXA 3FG2P 2YVFA 2XVEA 1REOA 2APGA 2FJDA 5KOXA 1Q1RA 4EM4A 2XDOA 2BS4A 1NHQA 3NNEA 1CHUA 2B7RA 1N1PA 3AECA 3BNMA 3COXA 1YQ3A 2B9YA 1GSNA 2X8GA 2RABA 3JSKA 5HHFA 4U8JA 1XHCA 4UP3A 4H4SA 1PXBA 5FS7A 4CBQA 3VR8A 2BYBA 4H4YA 5CKUA 3IHGA 4DNAA 5BUKA 3DJDA 4A7AA 3AXBA 4JNAA 2XVIA 1ZY8A 2ZZBA 2R0PA 4Z2RA 2IIDA 2O9ZA 4OPTA 3CNJA 4TLZA 1H6VA 1N4WA 3UKLA 1QJDA 1NAAA 3I6DA 4CCQA 3UOZA 4OPIA 2XVJA 1D4DA 4RSLA 3QJ4A 3UOVA 2XFOA 4OPLA 1EL9A 3LZXA 2VRMA 2YM2A 1EL7A 4IA6A 2OLOA 2EQ6A 1IUWA 2BK3A 3CGBA 3NHOX 2C67A 3AYIA 5M0ZA 1F6MA 2Q6UA 1IUTA 4NTCA 1CC4A 1GNDA 4ZN0A 4O5QA 2BCGG 1H83A 2WOWA 2YAUA 2GAHB 2YR4A 3NN0X 3CPIG 2YQUA 4IA5A 5JCLA 2WU5A 3GRSA 2I0ZA 2JB1A 3IC9A 3ICSA 4U8PA 2FJEA 2YLZA 1L0VA 4BURA 3CGDA 5EOWA 2V3BA 3ISHA 3BNUA 4B1BA 1H7WA 1LQTA 2GQWA 3FIMB 1PBCA 4EQXA 1RP0A 1PBDA 3EANA 1L9CA 3CGEA 3CN8A 4H4TA 1TDOA 4H4VA 3K7TA 1GESA 3LB8A 3ABVA 1COYA 4REKA 2GV8A 4U8IA 1PN0A 2ACZA 4H2NA 2WPEA 2E5VA 2TPRA 2WP6A 4WCTA 1E6EA 4APNA 4EQSA 2R46A 5J7XA 3NGCX 3SFEA 3AEAA 5HYMA 2JKCA 2BK5A 2WPFA 3URHA 4PAAA 1CC2A 3M13A 3EAOA 1RYIA 1QO8A 2QAEA 2Q0LA 4JY3A 3DGHA 1DODA 4C5OA 4J34A 3GSIA 3NT6A 4DGKA 3CNPA 4FK1A 1LTXR 1O94A 3AYLA 4H2QA 3AE5A 2IVDA 2TMDA 1O95A 1VRQB 2JK6A 1ZMCA 3RP6A 4EMIA 1IUSA 5EB4A 2V5ZA 1GRTA 3GDPA 3VRBA 4B65A 2XFQA 1M6IA 2A8XA 3P4RA 3H8IA 1B37A 2WOVA 4AP1A 1FEAA 4EMJA 2OALA 1DNCA 4AT0A 4XWRA 4C74A 2WESA 2H88A 3PS9A 3UTFA 4AT2A 1E1MA 2CULA 3FPZA 4OCGA 3NK1X 4N9XA 4Z24A 4DSHA 4Z43A 1SEZA 4RG4A 5FMHA 3UTEA 1NEKA 4HB9A 4J33A 1KNPA 3FMWA 1NDAA 2GR1A 2YG4A 1JNZA 2FJBA 3S61A 4YT0A 4HA6A 3AE7A 3RHAA 4YTNA 3FBSA 3IHMA 2XFUA 1GEUA 2X99A 4I58A 1EL8A 2YG6A 1LVLA 1PBEA 4ECHA 5IPYA 4H4XA 5BVAA 1GRGA 5GSNA 1EL5A 3SM8A 1ZK7A 1NPXA 5M10A 3UOYA 4BV6A 2XVFA 2BABA 3NYCA 4CCRA 2IVEA 1X31B 2E4GA 3AEFA 1YQ4A 2J3NA 3NYFA 5HXIA 1CBOA 2BS3A 1IUUA 1DJNA 2R4JA 1PJ7A 3QVRA 5KVHA 1PBBA 1VQWA 1CC6A 1YQZA 3DJEA 3LZWA 1D7LA 2X8CA 2WDRA 1BZLA 2A87A 3GRTA 1EBDA 4IVMB 4TM4A 2Q7VA 1KFYA 5U1OA 1JEHA 3LXDA 1PBFA 2YLSA 2EQ7A 4X9MA 4Y4LA 3SGLA 3DK4A 2C70A 1OJTA 5IQ4A 3DK8A 1JRXA 4AOSA 3B3RA 4MJWA 3GDNA 3VQRA 4USQA 1ZDLA 5IQ1A 2QA2A 1Y56A 1XPQA 2UZZA 2GMHA 4PABA 1TDKA 1GETA 4TLXA 2C3DA 1P2EA 2V60A 2RGHA 1AOGA 1GRHA 2R45A 1H84A 4JDRA 2YR5A 1GREA 3P4SA 4GF7A 4H2PA 3P9UA 3AE6A 1GRAA 4K5RA 4Z44A 2FJAA 2YLTA 4BK2A 3NIXA 3AE8A 1PDHA 2WU2A 5BRTA 5C2TA 2BC1A 3GWDA 4Z25A 3AE4A 1KSSA 2WPCA 3I3LA 4H4WA 4CRTA 2H89A 1ELIA 4H50A 1GV4A 1TRBA 2BS2A 2YLXA 4TM3A 2JB2A 5FS8A 2YG5A 4Z2TA 1M64A 1DOCA 5KWFA 2C75A 1NHRA 1E1NA 4BK3A 4C3YA 1IUXA 3NTDA 2WP5A 4I59A 3R9UA 4Z2UA 1Y56B 3REDA 1ZOVA 2QCUA 4GDPA 2YVJA 4JY2A 3NTAA 2Z5YA 3AEBA 4E0VA 3ZYXA 4YSHA 2XFNA 4A79A 4FX9A 3AEGA 3EF6A 4LU6A 2XCGA 5LV9A 2BA9A 2B76A 2GRTA 2XVHA 2ZZ0A 1H7XA 4EMWA 2B7SA 3CTYA 3QSSA 1MXTA 3QFBA 4EIQA 3KVEA 4X9NA 5KXJA 5JCMA 4BK1A 1Q9IA 4NZHA 4ICYA 3VR9A 3WE0A 1BGNA 4YSZA 2XFPA 3H4KA 5DBJA 5GRTA 1H81A 1CL0A 3ALLA 1XANA 4U8NA 3GWFA 2RGJA 3AYJA 2CFYA 1NG4A 3QSMA 1N4UA 4P9SA 3AEDA 2Y6QA 2GR0A 4CNJA 1N4VA 5TR3A 4O5UA 2VOUA 4YXDA 3O0HA 2VVLG 3LADA 4JNQA 4K2XA 3S5WA 4CY8A 2GMJA 3G5QA 3M12A 3QFAA 4CNKA 5FS9A 1P2HA 3OZ2A 4BJZA 3P4QA 2VQBA 2XLPA 4FK1C 5JCNA 2C76A 3DJJA 2GR3A 1LV0A 1LPFA 1VG9A 2DKIA 3UTGA 2C3CA 1Q1WA 3NN6X 1OJAA 2Q0KA 2GB0A 1GERA 1H82A 3UOXA 3ALJA 3G5SA 2WS3A 4XWZA 2WEUA 1D7YA 1LQUA 3BI2A 4U8KA 3CNDA 1BF3A 3NLCA 1CJ3A 2YG7A 2C72A 2GQFA 4H4RA 2AAQA 4K22A 3NRNA 3V3OA 4USRA 2WETA 3UKHA 3NKSA 1BWCA 1D4CA 3C4AA 2B9XA 4C3XA 1IJHA 1TDNA 2C65A 3DGZA 3G5RA 4YTMA 1JRZA 3ATQA 3KPFA 4OPCA 3KLJA 4NTEA 3UTHA 5FS6A 2NPXA 1GALA 2VZ2A 2YVGA 3KD9A 3D8XA 1RSGA 1ONFA 2WQYA 3NYEA 3B6DA 3ICTA 4U2SA 5EB5A 3GYIA 3CPJG 3SQPA 4IVOB 2OAMA 4ADWA 3PVCA 4BJYA 3DA1A 2AR8A 4U8MA 3V3NA 2WHDA 2FBWA 1LJ1A 1NHPA 3AEEA 3HZLA 3NG7X 1YY5A 1GPEA 3DMEA 4FDCB 1MOKA 3GMCA 3OC4A 4XXGA 2WP9A 4IV9A 1BKWA 1GTHA 2WOIA 1Y0PA 3II4A 1PJ6A 1GT8A 2BXSA 1CJ4A 1E1LA 1PXCA 4K8DA 2GAGB 2C73A 5EBKA 2F5ZA 1FECA 4H2RA 2XLTA 3NH3X 1F8RA 2YM1A 2C66A 4J57A 2Z5XA 1PS9A 1CF3A 1KDGA 2X8HA 3M0OA 4GRTA 2EQ9A 3LOVA 1CJ2A 1DOBA 2AQJA 3AE3A 1JOAA 2W0HA 1TDEA 1CJCA 1VDCA 2YR6A 1HYUA 3AWIA 1S3BA 2YLWA 1V59A 3VRDB 3K7QX 1L9EA 4B68A 3L8KA 2BCPA 1O5WA 2GR2A 4B67A 1L9DA 1OJDA 1S2QA 1ZMDA 2YG3A 3AE1A 3H8LA 3NK2X 2WBAA 2R0GA 1W4XA 4NTDA 3UKQA 3QVPA 3DH9A 4UDQA 2X50A 3CIRA
chains in the Genus database with same CATH superfamily
4B66A 3BHKA 1B5QA 3K7MX 5KNLA 2GH5A 3AD9B 3BHFA 3ALMA 3UCLA 4LIIA 3ATRA 3Q6JA 1FL2A 3KA7A 3T2KA 1MO9A 3ITJA 2JBVA 2DKHA 3DJGX 1BGJA 4GUVA 3UKPA 3GYJA 1Z6LA 4C77A 3QSEA 4AP3A 5BULA 2OLNA 1OJ9A 1ZP0A 3D1CA 2C7GA 4NNJA 4A6NA 2CVJA 2JAEA 4K5SA 3UKAA 2V6OA 4X4JA 4U8OA 2R0CA 3SFDA 1F8SA 1NHSA 4H4UA 3Q9TA 2JB3A 4JN9A 3F8PA 4WX1A 1ZOYA 4OVIA 3AB1A 4U2LA 1K4QA 1PHHA 4M52A 3LJPA 3ICRA 2X3NA 1GTEA 2BACA 2PHHA 3GD4A 4OPUA 3T37A 3UP5A 3PO7A 4YKFA 1PXAA 3UP4A 2R9ZA 3UKKA 1UKVG 2QA1A 4J2WA 4Y4NA 2GEWA 4CY6A 1S3EA 1YKJA 3SZWA 4B63A 3UKFA 1JRYA 3K30A 4U2TA 1GXFA 5ER0A 2C64A 3RNMA 2VVMA 4H4PA 3IWAA 3VRAA 4Z26A 3T31A 1E1KA 2A89A 2ZZCA 4GR1A 2GF3A 2RGOA 1S2YA 1DOEA 1B8SA 5U25A 3KKJA 1GRFA 1OJCA 1FCDA 5U63A 2OA1A 5KRQA 5CQFA 3E1TA 5C3JA 4A6NB 1JNRA 4GAVA 4A9WA 1NENA 4EIPA 3F8RA 1VG0A 3ZDNA 4J36A 5J60A 5KVIA 4YKGA 3EPTA 4JQ9A 3AD8B 4A99A 4YWOA 3CNSA 2XLRA 4GCMA 5KOWA 3RP7A 4RG3A 4TM1A 1KSUA 2YWLA 3CGCA 1GOSA 3GMBA 2Y6RA 2XLUA 2BK4A 2XLSA 2PYXA 2C4CA 2BC0A 4K7ZA 2WDVA 3GYXA 3CPHG 4EQWA 5L46A 4Y4MA 2ARDA 2B9WA 1IUVA 5JCKA 3CMMA 1K0IA 3P1WA 1KF6A 4A5LA 4YTPA 4NEVA 1B4VA 3GD3A 4OPGA 1DXLA 4J56A 4LA1A 3AE2A 2WDQA 3F8DA 1QLBA 1K0LA 4B69A 2ZBWA 2BXRA 3T14A 4YSYA 3BI4A 4DSGA 2V3AA 4A65A 3V76A 3IF9A 1JU2A 1E39A 3ADAB 2E1MA 1F3PA 2YLRA 4KPRA 4D03A 1TYTA 4NEWA 1DJQA 1D4EA 4U8LA 1KNRA 3KU9A 1E7PA 2HQMA 2VQ7A 5JCIA 2CDUA 4D04A 3SYIA 4UDPA 3C96A 1F8WA 1FOHA 2XYOA 2VRLA 4EM3A 1K0JA 2NVKX 4H4ZA 4ZCDA 3P4PA 2R4EA 1NG3A 3NK0X 3AE9A 4TM0A 4J31A 3BI5A 4KX6A 4ZCCA 4GDEA 1FEBA 3L1RA 5HY5A 1GRBA 4UDRA 1D5TA 4EQRA 3C4NA 1TYPA 4H7UA 3RP8A 2V61A 4AOXA 1ZX9A 3AD7B 4OPDA 3CNTA 2VVLA 1H86A 4B64A 1PJ5A 4H4QA 1ZKQA 3DK9A 2EQ8A 2GVCA 5KMSA 1XDIA 1TDFA 4YSXA 3FG2P 2YVFA 2XVEA 1REOA 2APGA 2FJDA 5KOXA 1Q1RA 4EM4A 2XDOA 2BS4A 1NHQA 3NNEA 1CHUA 2B7RA 1N1PA 3AECA 3BNMA 3COXA 1YQ3A 2B9YA 1GSNA 2X8GA 2RABA 3JSKA 5HHFA 4U8JA 1XHCA 4UP3A 4H4SA 1PXBA 5FS7A 4CBQA 3VR8A 2BYBA 4H4YA 5CKUA 3IHGA 4DNAA 5BUKA 3DJDA 4A7AA 3AXBA 4JNAA 2XVIA 1ZY8A 2ZZBA 2R0PA 5KMPA 4Z2RA 2IIDA 2O9ZA 4OPTA 3CNJA 4TLZA 1H6VA 3SZCA 1N4WA 3UKLA 1QJDA 1NAAA 3I6DA 4G6HA 4CCQA 3UOZA 4OPIA 2XVJA 1D4DA 4RSLA 3QJ4A 3UOVA 2XFOA 4OPLA 1EL9A 3LZXA 2VRMA 2YM2A 1EL7A 4IA6A 2OLOA 2EQ6A 1IUWA 2BK3A 3CGBA 3NHOX 2C67A 3AYIA 5M0ZA 1F6MA 2Q6UA 1IUTA 4NTCA 1CC4A 1GNDA 5KMRA 4ZN0A 4O5QA 2BCGG 1H83A 2WOWA 2YAUA 2GAHB 2YR4A 3NN0X 3CPIG 2YQUA 4IA5A 5JCLA 2WU5A 3GRSA 2I0ZA 2JB1A 3IC9A 3ICSA 4U8PA 2FJEA 2YLZA 1L0VA 4BURA 3CGDA 5EOWA 2V3BA 3ISHA 3BNUA 4B1BA 1H7WA 1LQTA 2GQWA 3FIMB 1PBCA 4EQXA 1RP0A 1PBDA 3EANA 1L9CA 3CGEA 3CN8A 4H4TA 3T2ZA 4II2A 1TDOA 4H4VA 3K7TA 1GESA 3LB8A 3ABVA 1COYA 4REKA 2GV8A 4U8IA 1PN0A 2ACZA 4H2NA 2WPEA 2E5VA 3T2YA 2TPRA 2WP6A 4WCTA 1E6EA 4APNA 4EQSA 2R46A 5J7XA 3NGCX 3SFEA 3AEAA 5HYMA 2JKCA 2BK5A 2WPFA 3URHA 4PAAA 1CC2A 3M13A 3EAOA 1RYIA 1QO8A 2QAEA 2Q0LA 4JY3A 3DGHA 1DODA 4C5OA 4J34A 3GSIA 3NT6A 4DGKA 3CNPA 4FK1A 1LTXR 1O94A 3AYLA 4H2QA 3AE5A 2IVDA 3SX6A 2TMDA 1O95A 1VRQB 2JK6A 1ZMCA 3RP6A 4EMIA 1IUSA 5EB4A 2V5ZA 1GRTA 3GDPA 3VRBA 4B65A 2XFQA 3HYVA 1M6IA 2A8XA 3P4RA 3H8IA 1B37A 2WOVA 4AP1A 1FEAA 4EMJA 2OALA 1DNCA 4II3A 4AT0A 4XWRA 4C74A 2WESA 2H88A 3PS9A 3UTFA 4AT2A 1E1MA 2CULA 3FPZA 4OCGA 3NK1X 4N9XA 4Z24A 4DSHA 4Z43A 4G9KA 1SEZA 4RG4A 5FMHA 3UTEA 1NEKA 4HB9A 4J33A 1KNPA 3FMWA 1NDAA 2GR1A 2YG4A 1JNZA 2FJBA 3S61A 4YT0A 4HA6A 3AE7A 3RHAA 4YTNA 3FBSA 3IHMA 2XFUA 1GEUA 2X99A 4I58A 1EL8A 2YG6A 1LVLA 1PBEA 4ECHA 5IPYA 4H4XA 5BVAA 1GRGA 5GSNA 1EL5A 3SM8A 1ZK7A 1NPXA 5M10A 3UOYA 4BV6A 2XVFA 2BABA 3NYCA 4CCRA 2IVEA 1X31B 2E4GA 3AEFA 1YQ4A 2J3NA 3NYFA 5HXIA 1CBOA 2BS3A 1IUUA 1DJNA 2R4JA 1PJ7A 3QVRA 5KVHA 1PBBA 1VQWA 1CC6A 1YQZA 3DJEA 3LZWA 1D7LA 2X8CA 2WDRA 1BZLA 2A87A 3GRTA 1EBDA 4IVMB 4TM4A 2Q7VA 1KFYA 5U1OA 1JEHA 3LXDA 1PBFA 2YLSA 2EQ7A 4X9MA 4Y4LA 3SGLA 3DK4A 2C70A 1OJTA 5IQ4A 3DK8A 1JRXA 4AOSA 3B3RA 4MJWA 3GDNA 3VQRA 4USQA 1ZDLA 5IQ1A 2QA2A 1Y56A 1XPQA 2UZZA 2GMHA 4PABA 1TDKA 1GETA 4TLXA 2C3DA 1P2EA 2V60A 2RGHA 1AOGA 1GRHA 2R45A 1H84A 4JDRA 2YR5A 1GREA 3P4SA 4GF7A 4H2PA 3P9UA 3AE6A 1GRAA 4K5RA 4Z44A 2FJAA 2YLTA 4BK2A 3NIXA 3AE8A 1PDHA 2WU2A 5BRTA 5C2TA 2BC1A 3GWDA 4Z25A 3AE4A 1KSSA 2WPCA 3I3LA 4G6GA 4H4WA 2H89A 4CRTA 1ELIA 4H50A 1GV4A 1TRBA 2BS2A 2YLXA 4TM3A 2JB2A 3KPKA 5FS8A 2YG5A 4Z2TA 1M64A 1DOCA 5KWFA 2C75A 1NHRA 1E1NA 4BK3A 4C3YA 1IUXA 3NTDA 2WP5A 4I59A 3R9UA 4Z2UA 1Y56B 3REDA 1ZOVA 2QCUA 3HYXA 2YVJA 4GDPA 4JY2A 3NTAA 2Z5YA 3AEBA 4E0VA 3ZYXA 4YSHA 5KMQA 2XFNA 4A79A 4FX9A 3AEGA 3EF6A 4LU6A 2XCGA 5LV9A 2BA9A 2B76A 2GRTA 2XVHA 2ZZ0A 1H7XA 4EMWA 2B7SA 3CTYA 3QSSA 1MXTA 3QFBA 4EIQA 3KVEA 4X9NA 5KXJA 5JCMA 4BK1A 1Q9IA 4NZHA 4GAPA 4ICYA 3VR9A 3WE0A 1BGNA 4YSZA 2XFPA 3H4KA 5DBJA 5GRTA 1H81A 1CL0A 3ALLA 1XANA 4U8NA 3GWFA 2BRAA 2RGJA 3AYJA 2CFYA 1NG4A 3QSMA 1N4UA 4P9SA 3AEDA 2Y6QA 2GR0A 4CNJA 1N4VA 5TR3A 4O5UA 2VOUA 4YXDA 3O0HA 2VVLG 3LADA 4JNQA 4K2XA 4G74A 3S5WA 4CY8A 2GMJA 3G5QA 3M12A 3QFAA 4G73A 5FS9A 4CNKA 1P2HA 3OZ2A 4BJZA 3P4QA 2VQBA 2XLPA 4FK1C 5JCNA 2C76A 3DJJA 2GR3A 1LV0A 1LPFA 1VG9A 2DKIA 3UTGA 2C3CA 1Q1WA 3NN6X 1OJAA 2Q0KA 2GB0A 1GERA 1H82A 3UOXA 3ALJA 3G5SA 2WS3A 4XWZA 2WEUA 1D7YA 1LQUA 3BI2A 3HYWA 4U8KA 4NWZA 3CNDA 1BF3A 3NLCA 1CJ3A 2YG7A 2C72A 2GQFA 4H4RA 2AAQA 4K22A 3NRNA 3V3OA 4USRA 2WETA 3UKHA 3NKSA 1BWCA 1D4CA 3C4AA 2B9XA 4C3XA 1IJHA 1TDNA 2C65A 3DGZA 3G5RA 4YTMA 1JRZA 3ATQA 3KPFA 4OPCA 3KLJA 4NTEA 3UTHA 3SXIA 5FS6A 2NPXA 1GALA 2VZ2A 2YVGA 3KD9A 3D8XA 1RSGA 1ONFA 2WQYA 3NYEA 3B6DA 3ICTA 4U2SA 5EB5A 3GYIA 3CPJG 3SQPA 4IVOB 2OAMA 4ADWA 3PVCA 4BJYA 3DA1A 2AR8A 4U8MA 3V3NA 2WHDA 2FBWA 1LJ1A 1NHPA 3AEEA 3HZLA 3NG7X 1YY5A 1GPEA 3DMEA 4FDCB 1MOKA 3GMCA 3OC4A 4XXGA 2WP9A 4IV9A 1BKWA 1GTHA 2WOIA 1Y0PA 3II4A 3SZ0A 1PJ6A 1GT8A 2BXSA 1CJ4A 1E1LA 1PXCA 3SY4A 3T0KA 4K8DA 2GAGB 2C73A 5EBKA 2F5ZA 1FECA 4H2RA 2BRYA 2XLTA 3NH3X 1F8RA 2YM1A 2C66A 4J57A 2Z5XA 1PS9A 1CF3A 1KDGA 2X8HA 3M0OA 4GRTA 2EQ9A 3LOVA 1CJ2A 1DOBA 2AQJA 3AE3A 1JOAA 2W0HA 1TDEA 1CJCA 1VDCA 2YR6A 1HYUA 3AWIA 1S3BA 2YLWA 1V59A 3VRDB 3K7QX 1L9EA 4B68A 3L8KA 2BCPA 1O5WA 2GR2A 4B67A 1L9DA 1OJDA 1S2QA 1ZMDA 2YG3A 3AE1A 3H8LA 3NK2X 2WBAA 2R0GA 1W4XA 4NTDA 3UKQA 3QVPA 3DH9A 4UDQA 3SZFA 2X50A 3CIRA
chains in the Genus database with same CATH topology
4B66A 3BHKA 1B5QA 3K7MX 5KNLA 2GH5A 3AD9B 3BHFA 3ALMA 3UCLA 4LIIA 3ATRA 3Q6JA 1FL2A 3KA7A 3T2KA 1MO9A 3ITJA 2JBVA 2DKHA 3DJGX 1BGJA 4GUVA 3UKPA 3GYJA 1Z6LA 4C77A 3QSEA 4AP3A 5BULA 2OLNA 1OJ9A 1ZP0A 3D1CA 2C7GA 4NNJA 4A6NA 2CVJA 2JAEA 4K5SA 3UKAA 2V6OA 4X4JA 4U8OA 2R0CA 3SFDA 1F8SA 1NHSA 4H4UA 3Q9TA 2JB3A 4JN9A 3F8PA 4WX1A 1ZOYA 4OVIA 3AB1A 4U2LA 1K4QA 1PHHA 4M52A 3LJPA 3ICRA 2X3NA 1GTEA 2BACA 2PHHA 3GD4A 4OPUA 3T37A 3UP5A 3PO7A 4YKFA 1PXAA 3UP4A 2R9ZA 3UKKA 1UKVG 2QA1A 4J2WA 4Y4NA 2GEWA 4CY6A 1S3EA 1YKJA 3SZWA 4B63A 3UKFA 1JRYA 3K30A 4U2TA 1GXFA 5ER0A 2C64A 3RNMA 2VVMA 4H4PA 3IWAA 3VRAA 4Z26A 3T31A 1E1KA 2A89A 2ZZCA 4GR1A 2GF3A 2RGOA 1S2YA 1DOEA 1B8SA 5U25A 3KKJA 1GRFA 1OJCA 1FCDA 5U63A 2OA1A 5KRQA 5CQFA 3E1TA 5C3JA 4A6NB 1JNRA 4GAVA 4A9WA 1NENA 4EIPA 3F8RA 1VG0A 3ZDNA 4J36A 5J60A 5KVIA 4YKGA 3EPTA 4JQ9A 3AD8B 4A99A 4YWOA 3CNSA 2XLRA 4GCMA 5KOWA 3RP7A 4RG3A 4TM1A 1KSUA 2YWLA 3CGCA 1GOSA 3GMBA 2Y6RA 2XLUA 2BK4A 2XLSA 2PYXA 2C4CA 2BC0A 4K7ZA 2WDVA 3GYXA 3CPHG 4EQWA 5L46A 4Y4MA 2ARDA 2B9WA 1IUVA 5JCKA 3CMMA 1K0IA 3P1WA 1KF6A 4A5LA 4YTPA 4NEVA 1B4VA 3GD3A 4OPGA 1DXLA 4J56A 4LA1A 3AE2A 2WDQA 3F8DA 1QLBA 1K0LA 4B69A 2ZBWA 2BXRA 3T14A 4YSYA 3BI4A 4DSGA 2V3AA 4A65A 3V76A 3IF9A 1JU2A 1E39A 3ADAB 2E1MA 1F3PA 2YLRA 4KPRA 4D03A 1TYTA 4NEWA 1DJQA 1D4EA 4U8LA 1KNRA 3KU9A 1E7PA 2HQMA 2VQ7A 5JCIA 2CDUA 4D04A 3SYIA 4UDPA 3C96A 1F8WA 1FOHA 2XYOA 2VRLA 4EM3A 1K0JA 2NVKX 4H4ZA 4ZCDA 3P4PA 2R4EA 1NG3A 3NK0X 3AE9A 4TM0A 4J31A 3BI5A 4KX6A 4ZCCA 4GDEA 1FEBA 3L1RA 5HY5A 1GRBA 4UDRA 1D5TA 4EQRA 3C4NA 1TYPA 4H7UA 3RP8A 2V61A 4AOXA 1ZX9A 3AD7B 4OPDA 3CNTA 2VVLA 1H86A 4B64A 1PJ5A 4H4QA 1ZKQA 3DK9A 2EQ8A 2GVCA 5KMSA 1XDIA 1TDFA 4YSXA 3FG2P 2YVFA 2XVEA 1REOA 2APGA 2FJDA 5KOXA 1Q1RA 4EM4A 2XDOA 2BS4A 1NHQA 3NNEA 1CHUA 2B7RA 1N1PA 3AECA 3BNMA 3COXA 1YQ3A 2B9YA 1GSNA 2X8GA 2RABA 3JSKA 5HHFA 4U8JA 1XHCA 4UP3A 4H4SA 1PXBA 5FS7A 4CBQA 3VR8A 2BYBA 4H4YA 5CKUA 3IHGA 4DNAA 5BUKA 3DJDA 4A7AA 3AXBA 4JNAA 2XVIA 1ZY8A 2ZZBA 2R0PA 5KMPA 4Z2RA 2IIDA 2O9ZA 4OPTA 3CNJA 4TLZA 1H6VA 3SZCA 1N4WA 3UKLA 1QJDA 1NAAA 3I6DA 4G6HA 4CCQA 3UOZA 4OPIA 2XVJA 1D4DA 4RSLA 3QJ4A 3UOVA 2XFOA 4OPLA 1EL9A 3LZXA 2VRMA 2YM2A 1EL7A 4IA6A 2OLOA 2EQ6A 1IUWA 2BK3A 3CGBA 3NHOX 2C67A 3AYIA 5M0ZA 1F6MA 2Q6UA 1IUTA 4NTCA 1CC4A 1GNDA 5KMRA 4ZN0A 4O5QA 2BCGG 1H83A 2WOWA 2YAUA 2GAHB 2YR4A 3NN0X 3CPIG 2YQUA 4IA5A 5JCLA 2WU5A 3GRSA 2I0ZA 2JB1A 3IC9A 3ICSA 4U8PA 2FJEA 2YLZA 1L0VA 4BURA 3CGDA 5EOWA 2V3BA 3ISHA 3BNUA 4B1BA 1H7WA 1LQTA 2GQWA 3FIMB 1PBCA 4EQXA 1RP0A 1PBDA 3EANA 1L9CA 3CGEA 3CN8A 4H4TA 3T2ZA 4II2A 1TDOA 4H4VA 3K7TA 1GESA 3LB8A 3ABVA 1COYA 4REKA 2GV8A 4U8IA 1PN0A 2ACZA 4H2NA 2WPEA 2E5VA 3T2YA 2TPRA 2WP6A 4WCTA 1E6EA 4APNA 4EQSA 2R46A 5J7XA 3NGCX 3SFEA 3AEAA 5HYMA 2JKCA 2BK5A 2WPFA 3URHA 4PAAA 1CC2A 3M13A 3EAOA 1RYIA 1QO8A 2QAEA 2Q0LA 4JY3A 3DGHA 1DODA 4C5OA 4J34A 3GSIA 3NT6A 4DGKA 3CNPA 4FK1A 1LTXR 1O94A 3AYLA 4H2QA 3AE5A 2IVDA 3SX6A 2TMDA 1O95A 1VRQB 2JK6A 1ZMCA 3RP6A 4EMIA 1IUSA 5EB4A 2V5ZA 1GRTA 3GDPA 3VRBA 4B65A 2XFQA 3HYVA 1M6IA 2A8XA 3P4RA 3H8IA 1B37A 2WOVA 4AP1A 1FEAA 4EMJA 2OALA 1DNCA 4II3A 4AT0A 4XWRA 4C74A 2WESA 2H88A 3PS9A 3UTFA 4AT2A 1E1MA 2CULA 3FPZA 4OCGA 3NK1X 4N9XA 4Z24A 4DSHA 4Z43A 4G9KA 1SEZA 4RG4A 5FMHA 3UTEA 1NEKA 4HB9A 4J33A 1KNPA 3FMWA 1NDAA 2GR1A 2YG4A 1JNZA 2FJBA 3S61A 4YT0A 4HA6A 3AE7A 3RHAA 4YTNA 3FBSA 3IHMA 2XFUA 1GEUA 2X99A 4I58A 1EL8A 2YG6A 1LVLA 1PBEA 4ECHA 5IPYA 4H4XA 5BVAA 1GRGA 5GSNA 1EL5A 3SM8A 1ZK7A 1NPXA 5M10A 3UOYA 4BV6A 2XVFA 2BABA 3NYCA 4CCRA 2IVEA 1X31B 2E4GA 3AEFA 1YQ4A 2J3NA 3NYFA 5HXIA 1CBOA 2BS3A 1IUUA 1DJNA 2R4JA 1PJ7A 3QVRA 5KVHA 1PBBA 1VQWA 1CC6A 1YQZA 3DJEA 3LZWA 1D7LA 2X8CA 2WDRA 1BZLA 2A87A 3GRTA 1EBDA 4IVMB 4TM4A 2Q7VA 1KFYA 5U1OA 1JEHA 3LXDA 1PBFA 2YLSA 2EQ7A 4X9MA 4Y4LA 3SGLA 3DK4A 2C70A 1OJTA 5IQ4A 3DK8A 1JRXA 4AOSA 3B3RA 4MJWA 3GDNA 3VQRA 4USQA 1ZDLA 5IQ1A 2QA2A 1Y56A 1XPQA 2UZZA 2GMHA 4PABA 1TDKA 1GETA 4TLXA 2C3DA 1P2EA 2V60A 2RGHA 1AOGA 1GRHA 2R45A 1H84A 4JDRA 2YR5A 1GREA 3P4SA 4GF7A 4H2PA 3P9UA 3AE6A 1GRAA 4K5RA 4Z44A 2FJAA 2YLTA 4BK2A 3NIXA 3AE8A 1PDHA 2WU2A 5BRTA 5C2TA 2BC1A 3GWDA 4Z25A 3AE4A 1KSSA 2WPCA 3I3LA 4G6GA 4H4WA 2H89A 4CRTA 1ELIA 4H50A 1GV4A 1TRBA 2BS2A 2YLXA 4TM3A 2JB2A 3KPKA 5FS8A 2YG5A 4Z2TA 1M64A 1DOCA 5KWFA 2C75A 1NHRA 1E1NA 4BK3A 4C3YA 1IUXA 3NTDA 2WP5A 4I59A 3R9UA 4Z2UA 1Y56B 3REDA 1ZOVA 2QCUA 3HYXA 2YVJA 4GDPA 4JY2A 3NTAA 2Z5YA 3AEBA 4E0VA 3ZYXA 4YSHA 5KMQA 2XFNA 4A79A 4FX9A 3AEGA 3EF6A 4LU6A 2XCGA 5LV9A 2BA9A 2B76A 2GRTA 2XVHA 2ZZ0A 1H7XA 4EMWA 2B7SA 3CTYA 3QSSA 1MXTA 3QFBA 4EIQA 3KVEA 4X9NA 5KXJA 5JCMA 4BK1A 1Q9IA 4NZHA 4GAPA 4ICYA 3VR9A 3WE0A 1BGNA 4YSZA 2XFPA 3H4KA 5DBJA 5GRTA 1H81A 1CL0A 3ALLA 1XANA 4U8NA 3GWFA 2BRAA 2RGJA 3AYJA 2CFYA 1NG4A 3QSMA 1N4UA 4P9SA 3AEDA 2Y6QA 2GR0A 4CNJA 1N4VA 5TR3A 4O5UA 2VOUA 4YXDA 3O0HA 2VVLG 3LADA 4JNQA 4K2XA 4G74A 3S5WA 4CY8A 2GMJA 3G5QA 3M12A 3QFAA 4G73A 5FS9A 4CNKA 1P2HA 3OZ2A 4BJZA 3P4QA 2VQBA 2XLPA 4FK1C 5JCNA 2C76A 3DJJA 2GR3A 1LV0A 1LPFA 1VG9A 2DKIA 3UTGA 2C3CA 1Q1WA 3NN6X 1OJAA 2Q0KA 2GB0A 1GERA 1H82A 3UOXA 3ALJA 3G5SA 2WS3A 4XWZA 2WEUA 1D7YA 1LQUA 3BI2A 3HYWA 4U8KA 4NWZA 3CNDA 1BF3A 3NLCA 1CJ3A 2YG7A 2C72A 2GQFA 4H4RA 2AAQA 4K22A 3NRNA 3V3OA 4USRA 2WETA 3UKHA 3NKSA 1BWCA 1D4CA 3C4AA 2B9XA 4C3XA 1IJHA 1TDNA 2C65A 3DGZA 3G5RA 4YTMA 1JRZA 3ATQA 3KPFA 4OPCA 3KLJA 4NTEA 3UTHA 3SXIA 5FS6A 2NPXA 1GALA 2VZ2A 2YVGA 3KD9A 3D8XA 1RSGA 1ONFA 2WQYA 3NYEA 3B6DA 3ICTA 4U2SA 5EB5A 3GYIA 3CPJG 3SQPA 4IVOB 2OAMA 4ADWA 3PVCA 4BJYA 3DA1A 2AR8A 4U8MA 3V3NA 2WHDA 2FBWA 1LJ1A 1NHPA 3AEEA 3HZLA 3NG7X 1YY5A 1GPEA 3DMEA 4FDCB 1MOKA 3GMCA 3OC4A 4XXGA 2WP9A 4IV9A 1BKWA 1GTHA 2WOIA 1Y0PA 3II4A 3SZ0A 1PJ6A 1GT8A 2BXSA 1CJ4A 1E1LA 1PXCA 3SY4A 3T0KA 4K8DA 2GAGB 2C73A 5EBKA 2F5ZA 1FECA 4H2RA 2BRYA 2XLTA 3NH3X 1F8RA 2YM1A 2C66A 4J57A 2Z5XA 1PS9A 1CF3A 1KDGA 2X8HA 3M0OA 4GRTA 2EQ9A 3LOVA 1CJ2A 1DOBA 2AQJA 3AE3A 1JOAA 2W0HA 1TDEA 1CJCA 1VDCA 2YR6A 1HYUA 3AWIA 1S3BA 2YLWA 1V59A 3VRDB 3K7QX 1L9EA 4B68A 3L8KA 2BCPA 1O5WA 2GR2A 4B67A 1L9DA 1OJDA 1S2QA 1ZMDA 2YG3A 3AE1A 3H8LA 3NK2X 2WBAA 2R0GA 1W4XA 4NTDA 3UKQA 3QVPA 3DH9A 4UDQA 3SZFA 2X50A 3CIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B66 A;  3BHK A;  1B5Q A;  3K7M X;  2GH5 A;  3AD9 B;  3BHF A;  3ALM A;  3UCL A;  4LII A;  3ATR A;  3Q6J A;  1FL2 A;  3KA7 A;  1MO9 A;  3ITJ A;  2JBV A;  2DKH A;  3DJG X;  1BGJ A;  4GUV A;  3UKP A;  3GYJ A;  1Z6L A;  4C77 A;  3QSE A;  4AP3 A;  5BUL A;  2OLN A;  1OJ9 A;  1ZP0 A;  3D1C A;  2C7G A;  4A6N A;  2CVJ A;  2JAE A;  4K5S A;  3UKA A;  2V6O A;  4X4J A;  4U8O A;  2R0C A;  3SFD A;  1F8S A;  1NHS A;  4H4U A;  3Q9T A;  2JB3 A;  4JN9 A;  3F8P A;  4WX1 A;  1ZOY A;  4OVI A;  3AB1 A;  4U2L A;  1K4Q A;  1PHH A;  4M52 A;  3LJP A;  3ICR A;  2X3N A;  1GTE A;  2BAC A;  2PHH A;  3GD4 A;  4OPU A;  3T37 A;  3UP5 A;  3PO7 A;  4YKF A;  1PXA A;  3UP4 A;  2R9Z A;  3UKK A;  1UKV G;  2QA1 A;  4J2W A;  4Y4N A;  2GEW A;  4CY6 A;  1S3E A;  1YKJ A;  4B63 A;  3UKF A;  1JRY A;  3K30 A;  4U2T A;  1GXF A;  5ER0 A;  2C64 A;  3RNM A;  2VVM A;  4H4P A;  3IWA A;  3VRA A;  4Z26 A;  1E1K A;  2A89 A;  2ZZC A;  4GR1 A;  2GF3 A;  2RGO A;  1S2Y A;  1DOE A;  1B8S A;  5U25 A;  3KKJ A;  1GRF A;  1OJC A;  1FCD A;  5U63 A;  2OA1 A;  5KRQ A;  5CQF A;  3E1T A;  5C3J A;  4A6N B;  1JNR A;  4A9W A;  1NEN A;  4EIP A;  3F8R A;  1VG0 A;  3ZDN A;  4J36 A;  5J60 A;  5KVI A;  4YKG A;  3EPT A;  4JQ9 A;  3AD8 B;  4A99 A;  4YWO A;  3CNS A;  2XLR A;  4GCM A;  5KOW A;  3RP7 A;  4RG3 A;  4TM1 A;  1KSU A;  2YWL A;  3CGC A;  1GOS A;  3GMB A;  2Y6R A;  2XLU A;  2BK4 A;  2XLS A;  2PYX A;  2BC0 A;  4K7Z A;  2WDV A;  4EQW A;  3CPH G;  5L46 A;  4Y4M A;  2ARD A;  2B9W A;  1IUV A;  5JCK A;  1K0I A;  3P1W A;  1KF6 A;  4A5L A;  4YTP A;  4NEV A;  1B4V A;  3GD3 A;  4OPG A;  1DXL A;  4J56 A;  4LA1 A;  3AE2 A;  2WDQ A;  3F8D A;  1QLB A;  1K0L A;  4B69 A;  2ZBW A;  2BXR A;  4YSY A;  3BI4 A;  4DSG A;  2V3A A;  4A65 A;  3V76 A;  3IF9 A;  1JU2 A;  1E39 A;  3ADA B;  2E1M A;  1F3P A;  2YLR A;  4KPR A;  4D03 A;  1TYT A;  4NEW A;  1DJQ A;  1D4E A;  4U8L A;  1KNR A;  3KU9 A;  1E7P A;  2HQM A;  2VQ7 A;  5JCI A;  2CDU A;  4D04 A;  4UDP A;  3C96 A;  1F8W A;  1FOH A;  2XYO A;  2VRL A;  4EM3 A;  1K0J A;  2NVK X;  4H4Z A;  4ZCD A;  3P4P A;  2R4E A;  1NG3 A;  3NK0 X;  3AE9 A;  4TM0 A;  4J31 A;  3BI5 A;  4KX6 A;  4ZCC A;  4GDE A;  1FEB A;  3L1R A;  5HY5 A;  1GRB A;  4UDR A;  1D5T A;  4EQR A;  3C4N A;  1TYP A;  4H7U A;  3RP8 A;  2V61 A;  4AOX A;  1ZX9 A;  3AD7 B;  4OPD A;  3CNT A;  2VVL A;  1H86 A;  4B64 A;  1PJ5 A;  4H4Q A;  1ZKQ A;  3DK9 A;  2EQ8 A;  2GVC A;  1XDI A;  1TDF A;  4YSX A;  3FG2 P;  2YVF A;  2XVE A;  1REO A;  2APG A;  2FJD A;  5KOX A;  1Q1R A;  4EM4 A;  2XDO A;  2BS4 A;  1NHQ A;  3NNE A;  1CHU A;  2B7R A;  1N1P A;  3AEC A;  3BNM A;  3COX A;  1YQ3 A;  2B9Y A;  1GSN A;  2X8G A;  2RAB A;  3JSK A;  5HHF A;  4U8J A;  1XHC A;  4UP3 A;  4H4S A;  1PXB A;  5FS7 A;  4CBQ A;  3VR8 A;  2BYB A;  4H4Y A;  5CKU A;  3IHG A;  4DNA A;  5BUK A;  3DJD A;  4A7A A;  3AXB A;  4JNA A;  2XVI A;  1ZY8 A;  2ZZB A;  2R0P A;  4Z2R A;  2IID A;  2O9Z A;  4OPT A;  3CNJ A;  4TLZ A;  1H6V A;  1N4W A;  3UKL A;  1QJD A;  1NAA A;  3I6D A;  4CCQ A;  3UOZ A;  4OPI A;  2XVJ A;  1D4D A;  4RSL A;  3QJ4 A;  3UOV A;  2XFO A;  4OPL A;  1EL9 A;  3LZX A;  2VRM A;  2YM2 A;  1EL7 A;  4IA6 A;  2OLO A;  2EQ6 A;  1IUW A;  2BK3 A;  3CGB A;  3NHO X;  2C67 A;  3AYI A;  5M0Z A;  1F6M A;  2Q6U A;  1IUT A;  4NTC A;  1CC4 A;  1GND A;  4ZN0 A;  4O5Q A;  2BCG G;  1H83 A;  2WOW A;  2YAU A;  2GAH B;  2YR4 A;  3NN0 X;  3CPI G;  2YQU A;  4IA5 A;  5JCL A;  2WU5 A;  3GRS A;  2I0Z A;  2JB1 A;  3IC9 A;  3ICS A;  4U8P A;  2FJE A;  2YLZ A;  1L0V A;  4BUR A;  3CGD A;  5EOW A;  2V3B A;  3ISH A;  3BNU A;  4B1B A;  1H7W A;  1LQT A;  2GQW A;  3FIM B;  1PBC A;  4EQX A;  1RP0 A;  1PBD A;  3EAN A;  1L9C A;  3CGE A;  3CN8 A;  4H4T A;  1TDO A;  4H4V A;  3K7T A;  1GES A;  3LB8 A;  3ABV A;  1COY A;  4REK A;  2GV8 A;  4U8I A;  1PN0 A;  2ACZ A;  4H2N A;  2WPE A;  2E5V A;  2TPR A;  2WP6 A;  4WCT A;  1E6E A;  4APN A;  4EQS A;  2R46 A;  5J7X A;  3NGC X;  3SFE A;  3AEA A;  5HYM A;  2JKC A;  2BK5 A;  2WPF A;  3URH A;  4PAA A;  1CC2 A;  3M13 A;  3EAO A;  1RYI A;  1QO8 A;  2QAE A;  2Q0L A;  4JY3 A;  3DGH A;  1DOD A;  4C5O A;  4J34 A;  3GSI A;  3NT6 A;  4DGK A;  3CNP A;  4FK1 A;  1LTX R;  1O94 A;  3AYL A;  4H2Q A;  3AE5 A;  2IVD A;  2TMD A;  1O95 A;  1VRQ B;  2JK6 A;  1ZMC A;  3RP6 A;  4EMI A;  1IUS A;  5EB4 A;  2V5Z A;  1GRT A;  3GDP A;  3VRB A;  4B65 A;  2XFQ A;  1M6I A;  2A8X A;  3P4R A;  3H8I A;  1B37 A;  2WOV A;  4AP1 A;  1FEA A;  4EMJ A;  2OAL A;  1DNC A;  4AT0 A;  4XWR A;  4C74 A;  2WES A;  2H88 A;  3PS9 A;  3UTF A;  4AT2 A;  1E1M A;  2CUL A;  3FPZ A;  4OCG A;  3NK1 X;  4N9X A;  4Z24 A;  4DSH A;  4Z43 A;  1SEZ A;  4RG4 A;  5FMH A;  3UTE A;  1NEK A;  4HB9 A;  4J33 A;  1KNP A;  3FMW A;  1NDA A;  2GR1 A;  2YG4 A;  1JNZ A;  2FJB A;  3S61 A;  4YT0 A;  4HA6 A;  3AE7 A;  3RHA A;  4YTN A;  3FBS A;  3IHM A;  2XFU A;  1GEU A;  2X99 A;  4I58 A;  1EL8 A;  2YG6 A;  1LVL A;  1PBE A;  4ECH A;  5IPY A;  4H4X A;  5BVA A;  1GRG A;  5GSN A;  1EL5 A;  3SM8 A;  1ZK7 A;  1NPX A;  5M10 A;  3UOY A;  4BV6 A;  2XVF A;  2BAB A;  3NYC A;  4CCR A;  2IVE A;  1X31 B;  2E4G A;  3AEF A;  1YQ4 A;  2J3N A;  3NYF A;  5HXI A;  1CBO A;  2BS3 A;  1IUU A;  1DJN A;  2R4J A;  1PJ7 A;  3QVR A;  5KVH A;  1PBB A;  1VQW A;  1CC6 A;  1YQZ A;  3DJE A;  3LZW A;  1D7L A;  2X8C A;  2WDR A;  1BZL A;  2A87 A;  3GRT A;  1EBD A;  4IVM B;  4TM4 A;  2Q7V A;  1KFY A;  5U1O A;  1JEH A;  3LXD A;  1PBF A;  2YLS A;  2EQ7 A;  4X9M A;  4Y4L A;  3SGL A;  3DK4 A;  2C70 A;  1OJT A;  5IQ4 A;  3DK8 A;  1JRX A;  4AOS A;  3B3R A;  4MJW A;  3GDN A;  3VQR A;  4USQ A;  1ZDL A;  5IQ1 A;  2QA2 A;  1Y56 A;  1XPQ A;  2UZZ A;  2GMH A;  4PAB A;  1TDK A;  1GET A;  4TLX A;  2C3D A;  1P2E A;  2V60 A;  2RGH A;  1AOG A;  1GRH A;  2R45 A;  1H84 A;  4JDR A;  2YR5 A;  1GRE A;  3P4S A;  4GF7 A;  4H2P A;  3P9U A;  3AE6 A;  1GRA A;  4K5R A;  4Z44 A;  2FJA A;  2YLT A;  4BK2 A;  3NIX A;  3AE8 A;  1PDH A;  2WU2 A;  5BRT A;  5C2T A;  2BC1 A;  3GWD A;  4Z25 A;  3AE4 A;  1KSS A;  2WPC A;  3I3L A;  4H4W A;  4CRT A;  2H89 A;  1ELI A;  4H50 A;  1GV4 A;  1TRB A;  2BS2 A;  2YLX A;  4TM3 A;  2JB2 A;  5FS8 A;  2YG5 A;  4Z2T A;  1M64 A;  1DOC A;  5KWF A;  2C75 A;  1NHR A;  1E1N A;  4BK3 A;  4C3Y A;  1IUX A;  3NTD A;  2WP5 A;  4I59 A;  3R9U A;  4Z2U A;  1Y56 B;  3RED A;  1ZOV A;  2QCU A;  4GDP A;  2YVJ A;  4JY2 A;  3NTA A;  2Z5Y A;  3AEB A;  4E0V A;  3ZYX A;  4YSH A;  2XFN A;  4A79 A;  4FX9 A;  3AEG A;  3EF6 A;  4LU6 A;  2XCG A;  5LV9 A;  2BA9 A;  2B76 A;  2GRT A;  2XVH A;  2ZZ0 A;  1H7X A;  4EMW A;  2B7S A;  3CTY A;  3QSS A;  1MXT A;  3QFB A;  4EIQ A;  3KVE A;  4X9N A;  5KXJ A;  5JCM A;  4BK1 A;  1Q9I A;  4NZH A;  4ICY A;  3VR9 A;  3WE0 A;  1BGN A;  4YSZ A;  2XFP A;  3H4K A;  5DBJ A;  5GRT A;  1H81 A;  1CL0 A;  3ALL A;  1XAN A;  4U8N A;  3GWF A;  2RGJ A;  3AYJ A;  2CFY A;  1NG4 A;  3QSM A;  1N4U A;  4P9S A;  3AED A;  2Y6Q A;  2GR0 A;  4CNJ A;  1N4V A;  5TR3 A;  4O5U A;  2VOU A;  4YXD A;  3O0H A;  2VVL G;  3LAD A;  4JNQ A;  4K2X A;  3S5W A;  4CY8 A;  2GMJ A;  3G5Q A;  3M12 A;  3QFA A;  4CNK A;  5FS9 A;  1P2H A;  3OZ2 A;  4BJZ A;  3P4Q A;  2VQB A;  2XLP A;  4FK1 C;  5JCN A;  2C76 A;  3DJJ A;  2GR3 A;  1LV0 A;  1LPF A;  1VG9 A;  2DKI A;  3UTG A;  2C3C A;  1Q1W A;  3NN6 X;  1OJA A;  2Q0K A;  2GB0 A;  1GER A;  1H82 A;  3UOX A;  3ALJ A;  3G5S A;  2WS3 A;  4XWZ A;  2WEU A;  1D7Y A;  1LQU A;  3BI2 A;  4U8K A;  3CND A;  1BF3 A;  3NLC A;  1CJ3 A;  2YG7 A;  2C72 A;  2GQF A;  4H4R A;  2AAQ A;  4K22 A;  3NRN A;  3V3O A;  4USR A;  2WET A;  3UKH A;  3NKS A;  1BWC A;  1D4C A;  3C4A A;  2B9X A;  4C3X A;  1IJH A;  1TDN A;  2C65 A;  3DGZ A;  3G5R A;  4YTM A;  1JRZ A;  3ATQ A;  3KPF A;  4OPC A;  3KLJ A;  4NTE A;  3UTH A;  5FS6 A;  2NPX A;  1GAL A;  2VZ2 A;  2YVG A;  3KD9 A;  3D8X A;  1RSG A;  1ONF A;  2WQY A;  3NYE A;  3B6D A;  3ICT A;  4U2S A;  5EB5 A;  3GYI A;  3CPJ G;  3SQP A;  4IVO B;  2OAM A;  4ADW A;  3PVC A;  4BJY A;  3DA1 A;  2AR8 A;  4U8M A;  3V3N A;  2WHD A;  2FBW A;  1LJ1 A;  1NHP A;  3AEE A;  3HZL A;  3NG7 X;  1YY5 A;  1GPE A;  3DME A;  4FDC B;  1MOK A;  3GMC A;  3OC4 A;  4XXG A;  2WP9 A;  4IV9 A;  1BKW A;  1GTH A;  2WOI A;  1Y0P A;  3II4 A;  1PJ6 A;  1GT8 A;  2BXS A;  1CJ4 A;  1E1L A;  1PXC A;  4K8D A;  2GAG B;  2C73 A;  5EBK A;  2F5Z A;  1FEC A;  4H2R A;  2XLT A;  3NH3 X;  1F8R A;  2YM1 A;  2C66 A;  4J57 A;  2Z5X A;  1PS9 A;  1CF3 A;  1KDG A;  2X8H A;  3M0O A;  4GRT A;  2EQ9 A;  3LOV A;  1CJ2 A;  1DOB A;  2AQJ A;  3AE3 A;  1JOA A;  2W0H A;  1TDE A;  1CJC A;  1VDC A;  2YR6 A;  1HYU A;  3AWI A;  1S3B A;  2YLW A;  1V59 A;  3VRD B;  3K7Q X;  1L9E A;  4B68 A;  3L8K A;  2BCP A;  1O5W A;  2GR2 A;  4B67 A;  1L9D A;  1OJD A;  1S2Q A;  1ZMD A;  2YG3 A;  3AE1 A;  3H8L A;  3NK2 X;  2WBA A;  2R0G A;  1W4X A;  4NTD A;  3UKQ A;  3QVP A;  3DH9 A;  4UDQ A;  2X50 A;  3CIR A; 
#chains in the Genus database with same CATH topology
 4B66 A;  3BHK A;  1B5Q A;  3K7M X;  5KNL A;  2GH5 A;  3AD9 B;  3BHF A;  3ALM A;  3UCL A;  4LII A;  3ATR A;  3Q6J A;  1FL2 A;  3KA7 A;  3T2K A;  1MO9 A;  3ITJ A;  2JBV A;  2DKH A;  3DJG X;  1BGJ A;  4GUV A;  3UKP A;  3GYJ A;  1Z6L A;  4C77 A;  3QSE A;  4AP3 A;  5BUL A;  2OLN A;  1OJ9 A;  1ZP0 A;  3D1C A;  2C7G A;  4NNJ A;  4A6N A;  2CVJ A;  2JAE A;  4K5S A;  3UKA A;  2V6O A;  4X4J A;  4U8O A;  2R0C A;  3SFD A;  1F8S A;  1NHS A;  4H4U A;  3Q9T A;  2JB3 A;  4JN9 A;  3F8P A;  4WX1 A;  1ZOY A;  4OVI A;  3AB1 A;  4U2L A;  1K4Q A;  1PHH A;  4M52 A;  3LJP A;  3ICR A;  2X3N A;  1GTE A;  2BAC A;  2PHH A;  3GD4 A;  4OPU A;  3T37 A;  3UP5 A;  3PO7 A;  4YKF A;  1PXA A;  3UP4 A;  2R9Z A;  3UKK A;  1UKV G;  2QA1 A;  4J2W A;  4Y4N A;  2GEW A;  4CY6 A;  1S3E A;  1YKJ A;  3SZW A;  4B63 A;  3UKF A;  1JRY A;  3K30 A;  4U2T A;  1GXF A;  5ER0 A;  2C64 A;  3RNM A;  2VVM A;  4H4P A;  3IWA A;  3VRA A;  4Z26 A;  3T31 A;  1E1K A;  2A89 A;  2ZZC A;  4GR1 A;  2GF3 A;  2RGO A;  1S2Y A;  1DOE A;  1B8S A;  5U25 A;  3KKJ A;  1GRF A;  1OJC A;  1FCD A;  5U63 A;  2OA1 A;  5KRQ A;  5CQF A;  3E1T A;  5C3J A;  4A6N B;  1JNR A;  4GAV A;  4A9W A;  1NEN A;  4EIP A;  3F8R A;  1VG0 A;  3ZDN A;  4J36 A;  5J60 A;  5KVI A;  4YKG A;  3EPT A;  4JQ9 A;  3AD8 B;  4A99 A;  4YWO A;  3CNS A;  2XLR A;  4GCM A;  5KOW A;  3RP7 A;  4RG3 A;  4TM1 A;  1KSU A;  2YWL A;  3CGC A;  1GOS A;  3GMB A;  2Y6R A;  2XLU A;  2BK4 A;  2XLS A;  2PYX A;  2C4C A;  2BC0 A;  4K7Z A;  2WDV A;  3GYX A;  3CPH G;  4EQW A;  5L46 A;  4Y4M A;  2ARD A;  2B9W A;  1IUV A;  5JCK A;  3CMM A;  1K0I A;  3P1W A;  1KF6 A;  4A5L A;  4YTP A;  4NEV A;  1B4V A;  3GD3 A;  4OPG A;  1DXL A;  4J56 A;  4LA1 A;  3AE2 A;  2WDQ A;  3F8D A;  1QLB A;  1K0L A;  4B69 A;  2ZBW A;  2BXR A;  3T14 A;  4YSY A;  3BI4 A;  4DSG A;  2V3A A;  4A65 A;  3V76 A;  3IF9 A;  1JU2 A;  1E39 A;  3ADA B;  2E1M A;  1F3P A;  2YLR A;  4KPR A;  4D03 A;  1TYT A;  4NEW A;  1DJQ A;  1D4E A;  4U8L A;  1KNR A;  3KU9 A;  1E7P A;  2HQM A;  2VQ7 A;  5JCI A;  2CDU A;  4D04 A;  3SYI A;  4UDP A;  3C96 A;  1F8W A;  1FOH A;  2XYO A;  2VRL A;  4EM3 A;  1K0J A;  2NVK X;  4H4Z A;  4ZCD A;  3P4P A;  2R4E A;  1NG3 A;  3NK0 X;  3AE9 A;  4TM0 A;  4J31 A;  3BI5 A;  4KX6 A;  4ZCC A;  4GDE A;  1FEB A;  3L1R A;  5HY5 A;  1GRB A;  4UDR A;  1D5T A;  4EQR A;  3C4N A;  1TYP A;  4H7U A;  3RP8 A;  2V61 A;  4AOX A;  1ZX9 A;  3AD7 B;  4OPD A;  3CNT A;  2VVL A;  1H86 A;  4B64 A;  1PJ5 A;  4H4Q A;  1ZKQ A;  3DK9 A;  2EQ8 A;  2GVC A;  5KMS A;  1XDI A;  1TDF A;  4YSX A;  3FG2 P;  2YVF A;  2XVE A;  1REO A;  2APG A;  2FJD A;  5KOX A;  1Q1R A;  4EM4 A;  2XDO A;  2BS4 A;  1NHQ A;  3NNE A;  1CHU A;  2B7R A;  1N1P A;  3AEC A;  3BNM A;  3COX A;  1YQ3 A;  2B9Y A;  1GSN A;  2X8G A;  2RAB A;  3JSK A;  5HHF A;  4U8J A;  1XHC A;  4UP3 A;  4H4S A;  1PXB A;  5FS7 A;  4CBQ A;  3VR8 A;  2BYB A;  4H4Y A;  5CKU A;  3IHG A;  4DNA A;  5BUK A;  3DJD A;  4A7A A;  3AXB A;  4JNA A;  2XVI A;  1ZY8 A;  2ZZB A;  2R0P A;  5KMP A;  4Z2R A;  2IID A;  2O9Z A;  4OPT A;  3CNJ A;  4TLZ A;  1H6V A;  3SZC A;  1N4W A;  3UKL A;  1QJD A;  1NAA A;  3I6D A;  4G6H A;  4CCQ A;  3UOZ A;  4OPI A;  2XVJ A;  1D4D A;  4RSL A;  3QJ4 A;  3UOV A;  2XFO A;  4OPL A;  1EL9 A;  3LZX A;  2VRM A;  2YM2 A;  1EL7 A;  4IA6 A;  2OLO A;  2EQ6 A;  1IUW A;  2BK3 A;  3CGB A;  3NHO X;  2C67 A;  3AYI A;  5M0Z A;  1F6M A;  2Q6U A;  1IUT A;  4NTC A;  1CC4 A;  1GND A;  5KMR A;  4ZN0 A;  4O5Q A;  2BCG G;  1H83 A;  2WOW A;  2YAU A;  2GAH B;  2YR4 A;  3NN0 X;  3CPI G;  2YQU A;  4IA5 A;  5JCL A;  2WU5 A;  3GRS A;  2I0Z A;  2JB1 A;  3IC9 A;  3ICS A;  4U8P A;  2FJE A;  2YLZ A;  1L0V A;  4BUR A;  3CGD A;  5EOW A;  2V3B A;  3ISH A;  3BNU A;  4B1B A;  1H7W A;  1LQT A;  2GQW A;  3FIM B;  1PBC A;  4EQX A;  1RP0 A;  1PBD A;  3EAN A;  1L9C A;  3CGE A;  3CN8 A;  4H4T A;  3T2Z A;  4II2 A;  1TDO A;  4H4V A;  3K7T A;  1GES A;  3LB8 A;  3ABV A;  1COY A;  4REK A;  2GV8 A;  4U8I A;  1PN0 A;  2ACZ A;  4H2N A;  2WPE A;  2E5V A;  3T2Y A;  2TPR A;  2WP6 A;  4WCT A;  1E6E A;  4APN A;  4EQS A;  2R46 A;  5J7X A;  3NGC X;  3SFE A;  3AEA A;  5HYM A;  2JKC A;  2BK5 A;  2WPF A;  3URH A;  4PAA A;  1CC2 A;  3M13 A;  3EAO A;  1RYI A;  1QO8 A;  2QAE A;  2Q0L A;  4JY3 A;  3DGH A;  1DOD A;  4C5O A;  4J34 A;  3GSI A;  3NT6 A;  4DGK A;  3CNP A;  4FK1 A;  1LTX R;  1O94 A;  3AYL A;  4H2Q A;  3AE5 A;  2IVD A;  3SX6 A;  2TMD A;  1O95 A;  1VRQ B;  2JK6 A;  1ZMC A;  3RP6 A;  4EMI A;  1IUS A;  5EB4 A;  2V5Z A;  1GRT A;  3GDP A;  3VRB A;  4B65 A;  2XFQ A;  3HYV A;  1M6I A;  2A8X A;  3P4R A;  3H8I A;  1B37 A;  2WOV A;  4AP1 A;  1FEA A;  4EMJ A;  2OAL A;  1DNC A;  4II3 A;  4AT0 A;  4XWR A;  4C74 A;  2WES A;  2H88 A;  3PS9 A;  3UTF A;  4AT2 A;  1E1M A;  2CUL A;  3FPZ A;  4OCG A;  3NK1 X;  4N9X A;  4Z24 A;  4DSH A;  4Z43 A;  4G9K A;  1SEZ A;  4RG4 A;  5FMH A;  3UTE A;  1NEK A;  4HB9 A;  4J33 A;  1KNP A;  3FMW A;  1NDA A;  2GR1 A;  2YG4 A;  1JNZ A;  2FJB A;  3S61 A;  4YT0 A;  4HA6 A;  3AE7 A;  3RHA A;  4YTN A;  3FBS A;  3IHM A;  2XFU A;  1GEU A;  2X99 A;  4I58 A;  1EL8 A;  2YG6 A;  1LVL A;  1PBE A;  4ECH A;  5IPY A;  4H4X A;  5BVA A;  1GRG A;  5GSN A;  1EL5 A;  3SM8 A;  1ZK7 A;  1NPX A;  5M10 A;  3UOY A;  4BV6 A;  2XVF A;  2BAB A;  3NYC A;  4CCR A;  2IVE A;  1X31 B;  2E4G A;  3AEF A;  1YQ4 A;  2J3N A;  3NYF A;  5HXI A;  1CBO A;  2BS3 A;  1IUU A;  1DJN A;  2R4J A;  1PJ7 A;  3QVR A;  5KVH A;  1PBB A;  1VQW A;  1CC6 A;  1YQZ A;  3DJE A;  3LZW A;  1D7L A;  2X8C A;  2WDR A;  1BZL A;  2A87 A;  3GRT A;  1EBD A;  4IVM B;  4TM4 A;  2Q7V A;  1KFY A;  5U1O A;  1JEH A;  3LXD A;  1PBF A;  2YLS A;  2EQ7 A;  4X9M A;  4Y4L A;  3SGL A;  3DK4 A;  2C70 A;  1OJT A;  5IQ4 A;  3DK8 A;  1JRX A;  4AOS A;  3B3R A;  4MJW A;  3GDN A;  3VQR A;  4USQ A;  1ZDL A;  5IQ1 A;  2QA2 A;  1Y56 A;  1XPQ A;  2UZZ A;  2GMH A;  4PAB A;  1TDK A;  1GET A;  4TLX A;  2C3D A;  1P2E A;  2V60 A;  2RGH A;  1AOG A;  1GRH A;  2R45 A;  1H84 A;  4JDR A;  2YR5 A;  1GRE A;  3P4S A;  4GF7 A;  4H2P A;  3P9U A;  3AE6 A;  1GRA A;  4K5R A;  4Z44 A;  2FJA A;  2YLT A;  4BK2 A;  3NIX A;  3AE8 A;  1PDH A;  2WU2 A;  5BRT A;  5C2T A;  2BC1 A;  3GWD A;  4Z25 A;  3AE4 A;  1KSS A;  2WPC A;  3I3L A;  4G6G A;  4H4W A;  2H89 A;  4CRT A;  1ELI A;  4H50 A;  1GV4 A;  1TRB A;  2BS2 A;  2YLX A;  4TM3 A;  2JB2 A;  3KPK A;  5FS8 A;  2YG5 A;  4Z2T A;  1M64 A;  1DOC A;  5KWF A;  2C75 A;  1NHR A;  1E1N A;  4BK3 A;  4C3Y A;  1IUX A;  3NTD A;  2WP5 A;  4I59 A;  3R9U A;  4Z2U A;  1Y56 B;  3RED A;  1ZOV A;  2QCU A;  3HYX A;  2YVJ A;  4GDP A;  4JY2 A;  3NTA A;  2Z5Y A;  3AEB A;  4E0V A;  3ZYX A;  4YSH A;  5KMQ A;  2XFN A;  4A79 A;  4FX9 A;  3AEG A;  3EF6 A;  4LU6 A;  2XCG A;  5LV9 A;  2BA9 A;  2B76 A;  2GRT A;  2XVH A;  2ZZ0 A;  1H7X A;  4EMW A;  2B7S A;  3CTY A;  3QSS A;  1MXT A;  3QFB A;  4EIQ A;  3KVE A;  4X9N A;  5KXJ A;  5JCM A;  4BK1 A;  1Q9I A;  4NZH A;  4GAP A;  4ICY A;  3VR9 A;  3WE0 A;  1BGN A;  4YSZ A;  2XFP A;  3H4K A;  5DBJ A;  5GRT A;  1H81 A;  1CL0 A;  3ALL A;  1XAN A;  4U8N A;  3GWF A;  2BRA A;  2RGJ A;  3AYJ A;  2CFY A;  1NG4 A;  3QSM A;  1N4U A;  4P9S A;  3AED A;  2Y6Q A;  2GR0 A;  4CNJ A;  1N4V A;  5TR3 A;  4O5U A;  2VOU A;  4YXD A;  3O0H A;  2VVL G;  3LAD A;  4JNQ A;  4K2X A;  4G74 A;  3S5W A;  4CY8 A;  2GMJ A;  3G5Q A;  3M12 A;  3QFA A;  4G73 A;  5FS9 A;  4CNK A;  1P2H A;  3OZ2 A;  4BJZ A;  3P4Q A;  2VQB A;  2XLP A;  4FK1 C;  5JCN A;  2C76 A;  3DJJ A;  2GR3 A;  1LV0 A;  1LPF A;  1VG9 A;  2DKI A;  3UTG A;  2C3C A;  1Q1W A;  3NN6 X;  1OJA A;  2Q0K A;  2GB0 A;  1GER A;  1H82 A;  3UOX A;  3ALJ A;  3G5S A;  2WS3 A;  4XWZ A;  2WEU A;  1D7Y A;  1LQU A;  3BI2 A;  3HYW A;  4U8K A;  4NWZ A;  3CND A;  1BF3 A;  3NLC A;  1CJ3 A;  2YG7 A;  2C72 A;  2GQF A;  4H4R A;  2AAQ A;  4K22 A;  3NRN A;  3V3O A;  4USR A;  2WET A;  3UKH A;  3NKS A;  1BWC A;  1D4C A;  3C4A A;  2B9X A;  4C3X A;  1IJH A;  1TDN A;  2C65 A;  3DGZ A;  3G5R A;  4YTM A;  1JRZ A;  3ATQ A;  3KPF A;  4OPC A;  3KLJ A;  4NTE A;  3UTH A;  3SXI A;  5FS6 A;  2NPX A;  1GAL A;  2VZ2 A;  2YVG A;  3KD9 A;  3D8X A;  1RSG A;  1ONF A;  2WQY A;  3NYE A;  3B6D A;  3ICT A;  4U2S A;  5EB5 A;  3GYI A;  3CPJ G;  3SQP A;  4IVO B;  2OAM A;  4ADW A;  3PVC A;  4BJY A;  3DA1 A;  2AR8 A;  4U8M A;  3V3N A;  2WHD A;  2FBW A;  1LJ1 A;  1NHP A;  3AEE A;  3HZL A;  3NG7 X;  1YY5 A;  1GPE A;  3DME A;  4FDC B;  1MOK A;  3GMC A;  3OC4 A;  4XXG A;  2WP9 A;  4IV9 A;  1BKW A;  1GTH A;  2WOI A;  1Y0P A;  3II4 A;  3SZ0 A;  1PJ6 A;  1GT8 A;  2BXS A;  1CJ4 A;  1E1L A;  1PXC A;  3SY4 A;  3T0K A;  4K8D A;  2GAG B;  2C73 A;  5EBK A;  2F5Z A;  1FEC A;  4H2R A;  2BRY A;  2XLT A;  3NH3 X;  1F8R A;  2YM1 A;  2C66 A;  4J57 A;  2Z5X A;  1PS9 A;  1CF3 A;  1KDG A;  2X8H A;  3M0O A;  4GRT A;  2EQ9 A;  3LOV A;  1CJ2 A;  1DOB A;  2AQJ A;  3AE3 A;  1JOA A;  2W0H A;  1TDE A;  1CJC A;  1VDC A;  2YR6 A;  1HYU A;  3AWI A;  1S3B A;  2YLW A;  1V59 A;  3VRD B;  3K7Q X;  1L9E A;  4B68 A;  3L8K A;  2BCP A;  1O5W A;  2GR2 A;  4B67 A;  1L9D A;  1OJD A;  1S2Q A;  1ZMD A;  2YG3 A;  3AE1 A;  3H8L A;  3NK2 X;  2WBA A;  2R0G A;  1W4X A;  4NTD A;  3UKQ A;  3QVP A;  3DH9 A;  4UDQ A;  3SZF A;  2X50 A;  3CIR A; 
#chains in the Genus database with same CATH homology
 4B66 A;  3BHK A;  1B5Q A;  3K7M X;  5KNL A;  2GH5 A;  3AD9 B;  3BHF A;  3ALM A;  3UCL A;  4LII A;  3ATR A;  3Q6J A;  1FL2 A;  3KA7 A;  3T2K A;  1MO9 A;  3ITJ A;  2JBV A;  2DKH A;  3DJG X;  1BGJ A;  4GUV A;  3UKP A;  3GYJ A;  1Z6L A;  4C77 A;  3QSE A;  4AP3 A;  5BUL A;  2OLN A;  1OJ9 A;  1ZP0 A;  3D1C A;  2C7G A;  4NNJ A;  4A6N A;  2CVJ A;  2JAE A;  4K5S A;  3UKA A;  2V6O A;  4X4J A;  4U8O A;  2R0C A;  3SFD A;  1F8S A;  1NHS A;  4H4U A;  3Q9T A;  2JB3 A;  4JN9 A;  3F8P A;  4WX1 A;  1ZOY A;  4OVI A;  3AB1 A;  4U2L A;  1K4Q A;  1PHH A;  4M52 A;  3LJP A;  3ICR A;  2X3N A;  1GTE A;  2BAC A;  2PHH A;  3GD4 A;  4OPU A;  3T37 A;  3UP5 A;  3PO7 A;  4YKF A;  1PXA A;  3UP4 A;  2R9Z A;  3UKK A;  1UKV G;  2QA1 A;  4J2W A;  4Y4N A;  2GEW A;  4CY6 A;  1S3E A;  1YKJ A;  3SZW A;  4B63 A;  3UKF A;  1JRY A;  3K30 A;  4U2T A;  1GXF A;  5ER0 A;  2C64 A;  3RNM A;  2VVM A;  4H4P A;  3IWA A;  3VRA A;  4Z26 A;  3T31 A;  1E1K A;  2A89 A;  2ZZC A;  4GR1 A;  2GF3 A;  2RGO A;  1S2Y A;  1DOE A;  1B8S A;  5U25 A;  3KKJ A;  1GRF A;  1OJC A;  1FCD A;  5U63 A;  2OA1 A;  5KRQ A;  5CQF A;  3E1T A;  5C3J A;  4A6N B;  1JNR A;  4GAV A;  4A9W A;  1NEN A;  4EIP A;  3F8R A;  1VG0 A;  3ZDN A;  4J36 A;  5J60 A;  5KVI A;  4YKG A;  3EPT A;  4JQ9 A;  3AD8 B;  4A99 A;  4YWO A;  3CNS A;  2XLR A;  4GCM A;  5KOW A;  3RP7 A;  4RG3 A;  4TM1 A;  1KSU A;  2YWL A;  3CGC A;  1GOS A;  3GMB A;  2Y6R A;  2XLU A;  2BK4 A;  2XLS A;  2PYX A;  2C4C A;  2BC0 A;  4K7Z A;  2WDV A;  3GYX A;  3CPH G;  4EQW A;  5L46 A;  4Y4M A;  2ARD A;  2B9W A;  1IUV A;  5JCK A;  3CMM A;  1K0I A;  3P1W A;  1KF6 A;  4A5L A;  4YTP A;  4NEV A;  1B4V A;  3GD3 A;  4OPG A;  1DXL A;  4J56 A;  4LA1 A;  3AE2 A;  2WDQ A;  3F8D A;  1QLB A;  1K0L A;  4B69 A;  2ZBW A;  2BXR A;  3T14 A;  4YSY A;  3BI4 A;  4DSG A;  2V3A A;  4A65 A;  3V76 A;  3IF9 A;  1JU2 A;  1E39 A;  3ADA B;  2E1M A;  1F3P A;  2YLR A;  4KPR A;  4D03 A;  1TYT A;  4NEW A;  1DJQ A;  1D4E A;  4U8L A;  1KNR A;  3KU9 A;  1E7P A;  2HQM A;  2VQ7 A;  5JCI A;  2CDU A;  4D04 A;  3SYI A;  4UDP A;  3C96 A;  1F8W A;  1FOH A;  2XYO A;  2VRL A;  4EM3 A;  1K0J A;  2NVK X;  4H4Z A;  4ZCD A;  3P4P A;  2R4E A;  1NG3 A;  3NK0 X;  3AE9 A;  4TM0 A;  4J31 A;  3BI5 A;  4KX6 A;  4ZCC A;  4GDE A;  1FEB A;  3L1R A;  5HY5 A;  1GRB A;  4UDR A;  1D5T A;  4EQR A;  3C4N A;  1TYP A;  4H7U A;  3RP8 A;  2V61 A;  4AOX A;  1ZX9 A;  3AD7 B;  4OPD A;  3CNT A;  2VVL A;  1H86 A;  4B64 A;  1PJ5 A;  4H4Q A;  1ZKQ A;  3DK9 A;  2EQ8 A;  2GVC A;  5KMS A;  1XDI A;  1TDF A;  4YSX A;  3FG2 P;  2YVF A;  2XVE A;  1REO A;  2APG A;  2FJD A;  5KOX A;  1Q1R A;  4EM4 A;  2XDO A;  2BS4 A;  1NHQ A;  3NNE A;  1CHU A;  2B7R A;  1N1P A;  3AEC A;  3BNM A;  3COX A;  1YQ3 A;  2B9Y A;  1GSN A;  2X8G A;  2RAB A;  3JSK A;  5HHF A;  4U8J A;  1XHC A;  4UP3 A;  4H4S A;  1PXB A;  5FS7 A;  4CBQ A;  3VR8 A;  2BYB A;  4H4Y A;  5CKU A;  3IHG A;  4DNA A;  5BUK A;  3DJD A;  4A7A A;  3AXB A;  4JNA A;  2XVI A;  1ZY8 A;  2ZZB A;  2R0P A;  5KMP A;  4Z2R A;  2IID A;  2O9Z A;  4OPT A;  3CNJ A;  4TLZ A;  1H6V A;  3SZC A;  1N4W A;  3UKL A;  1QJD A;  1NAA A;  3I6D A;  4G6H A;  4CCQ A;  3UOZ A;  4OPI A;  2XVJ A;  1D4D A;  4RSL A;  3QJ4 A;  3UOV A;  2XFO A;  4OPL A;  1EL9 A;  3LZX A;  2VRM A;  2YM2 A;  1EL7 A;  4IA6 A;  2OLO A;  2EQ6 A;  1IUW A;  2BK3 A;  3CGB A;  3NHO X;  2C67 A;  3AYI A;  5M0Z A;  1F6M A;  2Q6U A;  1IUT A;  4NTC A;  1CC4 A;  1GND A;  5KMR A;  4ZN0 A;  4O5Q A;  2BCG G;  1H83 A;  2WOW A;  2YAU A;  2GAH B;  2YR4 A;  3NN0 X;  3CPI G;  2YQU A;  4IA5 A;  5JCL A;  2WU5 A;  3GRS A;  2I0Z A;  2JB1 A;  3IC9 A;  3ICS A;  4U8P A;  2FJE A;  2YLZ A;  1L0V A;  4BUR A;  3CGD A;  5EOW A;  2V3B A;  3ISH A;  3BNU A;  4B1B A;  1H7W A;  1LQT A;  2GQW A;  3FIM B;  1PBC A;  4EQX A;  1RP0 A;  1PBD A;  3EAN A;  1L9C A;  3CGE A;  3CN8 A;  4H4T A;  3T2Z A;  4II2 A;  1TDO A;  4H4V A;  3K7T A;  1GES A;  3LB8 A;  3ABV A;  1COY A;  4REK A;  2GV8 A;  4U8I A;  1PN0 A;  2ACZ A;  4H2N A;  2WPE A;  2E5V A;  3T2Y A;  2TPR A;  2WP6 A;  4WCT A;  1E6E A;  4APN A;  4EQS A;  2R46 A;  5J7X A;  3NGC X;  3SFE A;  3AEA A;  5HYM A;  2JKC A;  2BK5 A;  2WPF A;  3URH A;  4PAA A;  1CC2 A;  3M13 A;  3EAO A;  1RYI A;  1QO8 A;  2QAE A;  2Q0L A;  4JY3 A;  3DGH A;  1DOD A;  4C5O A;  4J34 A;  3GSI A;  3NT6 A;  4DGK A;  3CNP A;  4FK1 A;  1LTX R;  1O94 A;  3AYL A;  4H2Q A;  3AE5 A;  2IVD A;  3SX6 A;  2TMD A;  1O95 A;  1VRQ B;  2JK6 A;  1ZMC A;  3RP6 A;  4EMI A;  1IUS A;  5EB4 A;  2V5Z A;  1GRT A;  3GDP A;  3VRB A;  4B65 A;  2XFQ A;  3HYV A;  1M6I A;  2A8X A;  3P4R A;  3H8I A;  1B37 A;  2WOV A;  4AP1 A;  1FEA A;  4EMJ A;  2OAL A;  1DNC A;  4II3 A;  4AT0 A;  4XWR A;  4C74 A;  2WES A;  2H88 A;  3PS9 A;  3UTF A;  4AT2 A;  1E1M A;  2CUL A;  3FPZ A;  4OCG A;  3NK1 X;  4N9X A;  4Z24 A;  4DSH A;  4Z43 A;  4G9K A;  1SEZ A;  4RG4 A;  5FMH A;  3UTE A;  1NEK A;  4HB9 A;  4J33 A;  1KNP A;  3FMW A;  1NDA A;  2GR1 A;  2YG4 A;  1JNZ A;  2FJB A;  3S61 A;  4YT0 A;  4HA6 A;  3AE7 A;  3RHA A;  4YTN A;  3FBS A;  3IHM A;  2XFU A;  1GEU A;  2X99 A;  4I58 A;  1EL8 A;  2YG6 A;  1LVL A;  1PBE A;  4ECH A;  5IPY A;  4H4X A;  5BVA A;  1GRG A;  5GSN A;  1EL5 A;  3SM8 A;  1ZK7 A;  1NPX A;  5M10 A;  3UOY A;  4BV6 A;  2XVF A;  2BAB A;  3NYC A;  4CCR A;  2IVE A;  1X31 B;  2E4G A;  3AEF A;  1YQ4 A;  2J3N A;  3NYF A;  5HXI A;  1CBO A;  2BS3 A;  1IUU A;  1DJN A;  2R4J A;  1PJ7 A;  3QVR A;  5KVH A;  1PBB A;  1VQW A;  1CC6 A;  1YQZ A;  3DJE A;  3LZW A;  1D7L A;  2X8C A;  2WDR A;  1BZL A;  2A87 A;  3GRT A;  1EBD A;  4IVM B;  4TM4 A;  2Q7V A;  1KFY A;  5U1O A;  1JEH A;  3LXD A;  1PBF A;  2YLS A;  2EQ7 A;  4X9M A;  4Y4L A;  3SGL A;  3DK4 A;  2C70 A;  1OJT A;  5IQ4 A;  3DK8 A;  1JRX A;  4AOS A;  3B3R A;  4MJW A;  3GDN A;  3VQR A;  4USQ A;  1ZDL A;  5IQ1 A;  2QA2 A;  1Y56 A;  1XPQ A;  2UZZ A;  2GMH A;  4PAB A;  1TDK A;  1GET A;  4TLX A;  2C3D A;  1P2E A;  2V60 A;  2RGH A;  1AOG A;  1GRH A;  2R45 A;  1H84 A;  4JDR A;  2YR5 A;  1GRE A;  3P4S A;  4GF7 A;  4H2P A;  3P9U A;  3AE6 A;  1GRA A;  4K5R A;  4Z44 A;  2FJA A;  2YLT A;  4BK2 A;  3NIX A;  3AE8 A;  1PDH A;  2WU2 A;  5BRT A;  5C2T A;  2BC1 A;  3GWD A;  4Z25 A;  3AE4 A;  1KSS A;  2WPC A;  3I3L A;  4G6G A;  4H4W A;  2H89 A;  4CRT A;  1ELI A;  4H50 A;  1GV4 A;  1TRB A;  2BS2 A;  2YLX A;  4TM3 A;  2JB2 A;  3KPK A;  5FS8 A;  2YG5 A;  4Z2T A;  1M64 A;  1DOC A;  5KWF A;  2C75 A;  1NHR A;  1E1N A;  4BK3 A;  4C3Y A;  1IUX A;  3NTD A;  2WP5 A;  4I59 A;  3R9U A;  4Z2U A;  1Y56 B;  3RED A;  1ZOV A;  2QCU A;  3HYX A;  2YVJ A;  4GDP A;  4JY2 A;  3NTA A;  2Z5Y A;  3AEB A;  4E0V A;  3ZYX A;  4YSH A;  5KMQ A;  2XFN A;  4A79 A;  4FX9 A;  3AEG A;  3EF6 A;  4LU6 A;  2XCG A;  5LV9 A;  2BA9 A;  2B76 A;  2GRT A;  2XVH A;  2ZZ0 A;  1H7X A;  4EMW A;  2B7S A;  3CTY A;  3QSS A;  1MXT A;  3QFB A;  4EIQ A;  3KVE A;  4X9N A;  5KXJ A;  5JCM A;  4BK1 A;  1Q9I A;  4NZH A;  4GAP A;  4ICY A;  3VR9 A;  3WE0 A;  1BGN A;  4YSZ A;  2XFP A;  3H4K A;  5DBJ A;  5GRT A;  1H81 A;  1CL0 A;  3ALL A;  1XAN A;  4U8N A;  3GWF A;  2BRA A;  2RGJ A;  3AYJ A;  2CFY A;  1NG4 A;  3QSM A;  1N4U A;  4P9S A;  3AED A;  2Y6Q A;  2GR0 A;  4CNJ A;  1N4V A;  5TR3 A;  4O5U A;  2VOU A;  4YXD A;  3O0H A;  2VVL G;  3LAD A;  4JNQ A;  4K2X A;  4G74 A;  3S5W A;  4CY8 A;  2GMJ A;  3G5Q A;  3M12 A;  3QFA A;  4G73 A;  5FS9 A;  4CNK A;  1P2H A;  3OZ2 A;  4BJZ A;  3P4Q A;  2VQB A;  2XLP A;  4FK1 C;  5JCN A;  2C76 A;  3DJJ A;  2GR3 A;  1LV0 A;  1LPF A;  1VG9 A;  2DKI A;  3UTG A;  2C3C A;  1Q1W A;  3NN6 X;  1OJA A;  2Q0K A;  2GB0 A;  1GER A;  1H82 A;  3UOX A;  3ALJ A;  3G5S A;  2WS3 A;  4XWZ A;  2WEU A;  1D7Y A;  1LQU A;  3BI2 A;  3HYW A;  4U8K A;  4NWZ A;  3CND A;  1BF3 A;  3NLC A;  1CJ3 A;  2YG7 A;  2C72 A;  2GQF A;  4H4R A;  2AAQ A;  4K22 A;  3NRN A;  3V3O A;  4USR A;  2WET A;  3UKH A;  3NKS A;  1BWC A;  1D4C A;  3C4A A;  2B9X A;  4C3X A;  1IJH A;  1TDN A;  2C65 A;  3DGZ A;  3G5R A;  4YTM A;  1JRZ A;  3ATQ A;  3KPF A;  4OPC A;  3KLJ A;  4NTE A;  3UTH A;  3SXI A;  5FS6 A;  2NPX A;  1GAL A;  2VZ2 A;  2YVG A;  3KD9 A;  3D8X A;  1RSG A;  1ONF A;  2WQY A;  3NYE A;  3B6D A;  3ICT A;  4U2S A;  5EB5 A;  3GYI A;  3CPJ G;  3SQP A;  4IVO B;  2OAM A;  4ADW A;  3PVC A;  4BJY A;  3DA1 A;  2AR8 A;  4U8M A;  3V3N A;  2WHD A;  2FBW A;  1LJ1 A;  1NHP A;  3AEE A;  3HZL A;  3NG7 X;  1YY5 A;  1GPE A;  3DME A;  4FDC B;  1MOK A;  3GMC A;  3OC4 A;  4XXG A;  2WP9 A;  4IV9 A;  1BKW A;  1GTH A;  2WOI A;  1Y0P A;  3II4 A;  3SZ0 A;  1PJ6 A;  1GT8 A;  2BXS A;  1CJ4 A;  1E1L A;  1PXC A;  3SY4 A;  3T0K A;  4K8D A;  2GAG B;  2C73 A;  5EBK A;  2F5Z A;  1FEC A;  4H2R A;  2BRY A;  2XLT A;  3NH3 X;  1F8R A;  2YM1 A;  2C66 A;  4J57 A;  2Z5X A;  1PS9 A;  1CF3 A;  1KDG A;  2X8H A;  3M0O A;  4GRT A;  2EQ9 A;  3LOV A;  1CJ2 A;  1DOB A;  2AQJ A;  3AE3 A;  1JOA A;  2W0H A;  1TDE A;  1CJC A;  1VDC A;  2YR6 A;  1HYU A;  3AWI A;  1S3B A;  2YLW A;  1V59 A;  3VRD B;  3K7Q X;  1L9E A;  4B68 A;  3L8K A;  2BCP A;  1O5W A;  2GR2 A;  4B67 A;  1L9D A;  1OJD A;  1S2Q A;  1ZMD A;  2YG3 A;  3AE1 A;  3H8L A;  3NK2 X;  2WBA A;  2R0G A;  1W4X A;  4NTD A;  3UKQ A;  3QVP A;  3DH9 A;  4UDQ A;  3SZF A;  2X50 A;  3CIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...