3NK2X

Complex of 6-hydroxy-l-nicotine oxidase with dopamine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 142
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk2X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk2X02
2Z5XA 2X8CA 3LOVA 5EB5A 4DSGA 3ATRA 5C3JA 1OJDA 2WOIA 4K5RA 4M52A 3SQPA 1ZDLA 2IVEA 1PBBA 2QCUA 3AYLA 2ZZ0A 4NTDA 3UCLA 2GVCA 4YWOA 3VRAA 1B8SA 3G5SA 3O0HA 3I3LA 2CVJA 2WETA 5BVAA 3QSSA 1S2QA 3AEFA 1ZY8A 3AE4A 4J34A 2R4JA 4H4QA 2XVIA 1LPFA 4IV9A 2DKHA 4BK3A 4FK1A 2C3CA 3CGDA 5EB4A 3LB8A 4BURA 3WE0A 3VRBA 4YKGA 1P2HA 2GAGB 3BI5A 3DJEA 3ITJA 4A5LA 4YTNA 2YLTA 2BC1A 2Q7VA 3DJJA 3NN0X 1UKVG 3P4QA 4XXGA 2E4GA 2R46A 2YWLA 5FS6A 2GF3A 1SEZA 1CHUA 2C7GA 2B7SA 3B6DA 4K8DA 1PXAA 4TM1A 3AE2A 2C65A 2H89A 4Y4NA 5FS9A 1RYIA 1BKWA 3ALJA 1XPQA 2WESA 3DJDA 3CPHG 1GEUA 3M0OA 4A99A 4YTPA 1PBEA 3LXDA 2GMJA 3KVEA 4YSZA 2YG7A 2JAEA 3GD4A 3LZXA 1TRBA 1PS9A 2YM1A 3ATQA 4EMWA 3NK0X 2C70A 2PHHA 4UP3A 3DMEA 2QA1A 3GYIA 2FJEA 1K0JA 1QJDA 5J60A 1CJCA 3IC9A 4ZN0A 1Y56A 1HYUA 2V61A 3DK4A 4B69A 1LTXR 2EQ7A 2AR8A 3NK2X 4FDCB 4Z2RA 2V60A 1NENA 4I58A 1F3PA 1M64A 1BF3A 4DGKA 1VRQB 1ZOVA 3F8DA 3NT6A 4H2PA 2R0GA 4Z25A 3AECA 1XDIA 1XHCA 2YLXA 1D7YA 1O5WA 3AE3A 2EQ6A 3CPJG 3CNTA 2YG4A 5TR3A 4J56A 4UDQA 3KLJA 1QLBA 1EBDA 3S5WA 1M6IA 3GWFA 3FBSA 4KX6A 4OPLA 2C67A 3RP6A 3VRDB 2R0CA 1H86A 3NYCA 4JNAA 1GETA 2YG6A 2A8XA 3CIRA 3K30A 4B1BA 2XLTA 5BRTA 2BK3A 1ZOYA 4H2QA 4ADWA 2A87A 4NZHA 4UDPA 2XLUA 1KSSA 4EQWA 4LA1A 1B4VA 4GCMA 1YQ3A 3UTHA 1H7XA 1LQTA 4GUVA 4ECHA 3BNUA 4TLZA 2YAUA 4FX9A 2V5ZA 4JQ9A 2UZZA 1CJ4A 1TDNA 1N4VA 3UKPA 2BC0A 4N9XA 3NH3X 4YKFA 2PYXA 3QSEA 1IUSA 4X9MA 3GRSA 3AEDA 3GMBA 1Q9IA 5GSNA 1E1KA 3CNJA 3UKQA 1GNDA 1RSGA 1PBCA 3BI2A 5KOXA 2O9ZA 1YKJA 4TM4A 3CGBA 2GEWA 5U25A 4YT0A 2BA9A 5U63A 2VVLA 2WP6A 3QVRA 2R0PA 4H4ZA 2VZ2A 2GR2A 3E1TA 2FJDA 1YY5A 2XLPA 2XCGA 3G5RA 4U8NA 1ZMDA 2OLNA 4JY3A 5IPYA 4A6NB 1KFYA 3VR9A 2FJBA 3P1WA 4CBQA 3EF6A 3CNSA 4WX1A 1MO9A 1K0LA 1NHSA 3ALMA 4A6NA 4GF7A 4RG4A 3QSMA 1E1MA 2OAMA 2YR6A 3AWIA 4H4TA 4OPGA 2WHDA 1E1LA 3NTAA 1GRBA 2E5VA 2QA2A 2OALA 4OPCA 3C4NA 4U8PA 1L9DA 3OC4A 1PJ5A 3RHAA 1XANA 2CFYA 3URHA 3AXBA 4DNAA 1E7PA 1KNRA 2VQBA 3K7QX 1AOGA 1GREA 1E6EA 5BUKA 2GH5A 2XFOA 4BK2A 1O95A 4H4PA 4K2XA 2Q0LA 4EM4A 3AE1A 2AQJA 2BK5A 1DOCA 1OJAA 2YVJA 3EAOA 4C77A 1DODA 2X99A 4D03A 1IUVA 3ALLA 2XVEA 1K4QA 4FK1C 5M0ZA 4B68A 2GRTA 5JCMA 5IQ1A 1CL0A 5KWFA 1PJ6A 4U8KA 3DK9A 3KPFA 3AEGA 4XWRA 2WS3A 4EM3A 2XVJA 3NIXA 4U2TA 4ZCCA 3AE7A 3IWAA 4ICYA 2HQMA 3P4SA 1NEKA 2XFUA 3ZYXA 4NTEA 1W4XA 4OVIA 3UP5A 1X31B 4RSLA 1GRGA 2YG3A 2XFPA 2X50A 2BYBA 4JDRA 4B67A 3NLCA 4A79A 3DGHA 1F6MA 3UKHA 4B65A 4DSHA 1TDEA 4OPUA 2C3DA 1F8SA 3VR8A 2IIDA 4IVOB 3K7TA 3CNPA 1GTEA 2V3AA 5KRQA 1GALA 1FCDA 2ZZCA 2C73A 2BCPA 3GYJA 1S3BA 3DA1A 4EIQA 2RABA 1B5QA 2GQWA 5KVHA 2GR1A 2XDOA 1L9EA 3GDPA 3IF9A 4H4YA 3NRNA 5FS7A 4EQSA 4Z44A 2B9WA 1GESA 1N4WA 3BI4A 3NG7X 4YSXA 3QFBA 3CNDA 4PAAA 2BS4A 5J7XA 2VRLA 1H83A 1ONFA 4H4WA 2J3NA 1KSUA 3QJ4A 1IJHA 2BK4A 2GAHB 4BV6A 2C66A 2WDVA 1GOSA 5KOWA 1H7WA 4XWZA 3UKAA 3BHFA 2WEUA 5L46A 2YLWA 2BXRA 4H4XA 1DJQA 1GERA 1LJ1A 2R45A 2H88A 4IA6A 1MOKA 2C75A 1ZX9A 3P9UA 2JB1A 4ZCDA 4H4RA 2JKCA 3DH9A 3UOXA 3R9UA 4A65A 4AOSA 5JCKA 1QO8A 2WBAA 1K0IA 4H2NA 2WPFA 1L0VA 2B9XA 3ABVA 4EMJA 4JY2A 4OCGA 3NKSA 3AE5A 3Q9TA 1EL5A 3F8RA 4OPTA 1B37A 1IUXA 4J57A 3AE6A 4J36A 1JRXA 4CNKA 2OA1A 1JRZA 1RP0A 4AP1A 5GRTA 1Y0PA 2B7RA 1V59A 2XFQA 3C4AA 4H4VA 5ER0A 1EL8A 2R9ZA 1EL9A 1P2EA 3DK8A 5HXIA 5JCIA 4CNJA 1H6VA 1DNCA 4H4SA 3REDA 1FEAA 2R4EA 1FL2A 2YLSA 3C96A 4H4UA 1GPEA 3NK1X 3LJPA 1F8WA 2WOWA 1KF6A 1Y56B 1ZKQA 3F8PA 4EMIA 3DGZA 4LU6A 3L8KA 3PO7A 1NG3A 2YM2A 4TLXA 1H84A 2XFNA 3D1CA 3UTEA 3NYEA 3V76A 4EQXA 4O5QA 2VVLG 1D4CA 2EQ8A 1VG0A 4Z24A 2Q0KA 2YLZA 3T37A 1NG4A 3PS9A 2VOUA 2NPXA 1NHRA 5M10A 1FEBA 4C3XA 4TM3A 5U1OA 1D5TA 3CN8A 2GR0A 1PBFA 2VQ7A 3CTYA 4A7AA 3GRTA 1DXLA 2Z5YA 1TYTA 5DBJA 2DKIA 1JRYA 2OLOA 2JK6A 1IUTA 3Q6JA 4Z43A 1Q1WA 4K7ZA 1VG9A 4JN9A 2RGOA 5LV9A 3SM8A 3ZDNA 4K5SA 4JNQA 1NDAA 2YVGA 3G5QA 3FG2P 4I59A 4CCRA 1D4EA 2WDRA 3UTGA 3H8LA 3HZLA 1IUUA 2GV8A 1YQ4A 2JB3A 2CULA 2V3BA 3RP7A 3AEEA 3VQRA 3UKFA 5HYMA 4U8LA 3B3RA 5FS8A 4E0VA 1TYPA 2RGJA 3IHMA 5JCLA 1L9CA 5KVIA 2C64A 4NTCA 1GRAA 4OPIA 1FECA 2AAQA 3CGEA 3NTDA 4H50A 1OJCA 1D4DA 1F8RA 4REKA 1GV4A 2YR5A 1CBOA 4AT2A 1S2YA 1CF3A 4GRTA 2A89A 1LQUA 1S3EA 4YTMA 2WPEA 3UOZA 3AEAA 4USQA 1DJNA 2X3NA 1DOEA 1DOBA 3D8XA 2CDUA 2WP5A 4Y4MA 4APNA 4UDRA 4GDEA 4OPDA 1JOAA 4H2RA 5JCNA 4AOXA 3AD9B 4KPRA 4X9NA 4WCTA 1CC6A 5IQ4A 4HA6A 4GDPA 4U2SA 2BS3A 3AD8B 1ZK7A 1OJTA 1E1NA 1GRTA 3V3NA 2B76A 2Y6RA 4C3YA 3NN6X 1PXBA 1LVLA 2ARDA 2BCGG 2XVHA 2XVFA 3AB1A 3KU9A 3RP8A 2YLRA 2WP9A 1VQWA 3NYFA 3P4RA 4U8IA 3DJGX 1BWCA 4A9WA 2WU2A 2APGA 4B66A 3H4KA 1YQZA 2IVDA 2XYOA 1BGJA 2WOVA 1IUWA 3UP4A 2E1MA 1EL7A 1VDCA 3LZWA 1FOHA 3CPIG 2VVMA 4Y4LA 1ZP0A 3KA7A 4NEWA 4Z26A 1JEHA 5CQFA 4LIIA 4YSYA 3KKJA 2YR4A 3AYJA 3ISHA 2VRMA 2NVKX 1REOA 1NPXA 1LV0A 1GTHA 3BNMA 2X8HA 3UOYA 4YSHA 2FBWA 2GB0A 2ZZBA 1CJ3A 2FJAA 3QFAA 4MJWA 2TMDA 4H7UA 4U2LA 4CCQA 5C2TA 2YVFA 4CY8A 2B9YA 4O5UA 3I6DA 3BHKA 2YQUA 3EPTA 1TDOA 4C5OA 3QVPA 1Z6LA 4EQRA 2XLRA 1N4UA 1OJ9A 3FPZA 4J2WA 3ICRA 1BZLA 3II4A 1NAAA 2ACZA 3CGCA 3FIMB 1GSNA 4HB9A 1CJ2A 2X8GA 2F5ZA 1E39A 2XLSA 3H8IA 2JBVA 1CC4A 1KNPA 1PBDA 1PDHA 3AE8A 4U8MA 1CC2A 1H82A 5BULA 1GRHA 1PJ7A 5FMHA 1PN0A 3UKLA 4BJZA 2C72A 4Z2UA 3SFEA 4BJYA 3M13A 3UOVA 4CY6A 2GQFA 3ICTA 2Q6UA 4AT0A 3COXA 2BS2A 3GSIA 2EQ9A 4D04A 3NGCX 3NNEA 3L1RA 1NHQA 4GR1A 2QAEA 1TDKA 3AEBA 2W0HA 3OZ2A 1ZMCA 4J31A 5HY5A 1D7LA 4IA5A 4K22A 1BGNA 2V6OA 4U8OA 3GD3A 2TPRA 3S61A 1COYA 1TDFA 3EANA 3UTFA 3K7MX 3PVCA 3AD7B 3ICSA 4P9SA 4B63A 4RG3A 4BK1A 5CKUA 5EOWA 2Y6QA 3IHGA 1PHHA 4J33A 3RNMA 3ADAB 3GMCA 3KD9A 1GT8A 1JU2A 4Z2TA 2ZBWA 3JSKA 2WDQA 5HHFA 1JNZA 1H81A 1N1PA 2BACA 3LADA 2YG5A 4U8JA 4USRA 5EBKA 1PXCA 2GR3A 4X4JA 4CRTA 1ELIA 2WPCA 4YXDA 2WQYA 2RGHA 2JB2A 2I0ZA 3UKKA 3M12A 4PABA 1Q1RA 4TM0A 1GRFA 4B64A 4NEVA 1KDGA 3GWDA 1GXFA 4EIPA 4AP3A 1JNRA 2GMHA 1MXTA 3AYIA 3FMWA 3GDNA 4IVMB 3SFDA 2C76A 2BABA 4C74A 3AE9A 1O94A 2WU5A 3NHOX 3SGLA 1NHPA 3P4PA 3V3OA 5KXJA 2BXSA
chains in the Genus database with same CATH superfamily
2Z5XA 2X8CA 3GYXA 3LOVA 5EB5A 3ATRA 4DSGA 5C3JA 1OJDA 2WOIA 4K5RA 4M52A 3SQPA 1ZDLA 2IVEA 1PBBA 2QCUA 3AYLA 2ZZ0A 4NTDA 3UCLA 2GVCA 4YWOA 3VRAA 1B8SA 3G5SA 3O0HA 3I3LA 2CVJA 2WETA 3SZWA 5BVAA 4G9KA 3QSSA 1S2QA 3AEFA 1ZY8A 3AE4A 4J34A 2R4JA 4H4QA 2XVIA 1LPFA 4IV9A 2DKHA 4BK3A 4FK1A 2C3CA 3SYIA 3CGDA 5EB4A 3LB8A 4BURA 3WE0A 3VRBA 4YKGA 1P2HA 2GAGB 3BI5A 3DJEA 3ITJA 4A5LA 4YTNA 2YLTA 2BC1A 2Q7VA 3DJJA 3CMMA 3NN0X 1UKVG 3P4QA 4XXGA 2E4GA 2R46A 2YWLA 5FS6A 2GF3A 1SEZA 1CHUA 2C7GA 2B7SA 3B6DA 4K8DA 1PXAA 4TM1A 3AE2A 2C65A 2H89A 4Y4NA 5FS9A 1RYIA 1BKWA 3ALJA 1XPQA 2WESA 3DJDA 3CPHG 1GEUA 3M0OA 4A99A 4YTPA 1PBEA 3LXDA 2GMJA 3KVEA 4YSZA 2YG7A 2JAEA 3GD4A 3LZXA 1TRBA 1PS9A 2YM1A 3ATQA 4EMWA 3NK0X 2C70A 2PHHA 4UP3A 3DMEA 2QA1A 3GYIA 2FJEA 1K0JA 1QJDA 5J60A 1CJCA 3IC9A 4ZN0A 1Y56A 1HYUA 2V61A 3DK4A 4B69A 5KMSA 1LTXR 2EQ7A 2AR8A 3NK2X 4FDCB 4Z2RA 2V60A 1NENA 4I58A 1F3PA 1M64A 1BF3A 4DGKA 1VRQB 1ZOVA 3F8DA 3NT6A 4H2PA 2R0GA 4Z25A 3AECA 1XDIA 1XHCA 2YLXA 1D7YA 1O5WA 3AE3A 2EQ6A 3CPJG 3CNTA 2YG4A 5TR3A 4J56A 4UDQA 3KLJA 4GAVA 5KMQA 1QLBA 1EBDA 3S5WA 1M6IA 3GWFA 3FBSA 4KX6A 4OPLA 2C67A 3RP6A 3VRDB 2R0CA 1H86A 3NYCA 4JNAA 1GETA 2YG6A 2A8XA 3CIRA 3K30A 4B1BA 2XLTA 5BRTA 2BK3A 1ZOYA 4H2QA 4ADWA 2A87A 4NZHA 3SZCA 4UDPA 2XLUA 1KSSA 4EQWA 4LA1A 1B4VA 4GCMA 1YQ3A 3UTHA 1H7XA 1LQTA 4GUVA 4ECHA 3BNUA 4TLZA 2YAUA 4FX9A 2V5ZA 4JQ9A 2UZZA 1CJ4A 1TDNA 1N4VA 3UKPA 2BC0A 4N9XA 3NH3X 4YKFA 2PYXA 3QSEA 1IUSA 4X9MA 3GRSA 3AEDA 3GMBA 1Q9IA 5GSNA 1E1KA 3CNJA 3UKQA 1GNDA 1RSGA 1PBCA 3BI2A 5KOXA 2O9ZA 1YKJA 4TM4A 3CGBA 2GEWA 5U25A 4YT0A 2BA9A 5U63A 2VVLA 2WP6A 3QVRA 2R0PA 4H4ZA 3HYXA 2VZ2A 2GR2A 3E1TA 2FJDA 1YY5A 2XLPA 2XCGA 3G5RA 4U8NA 1ZMDA 2OLNA 4JY3A 5IPYA 4A6NB 1KFYA 4GAPA 2FJBA 3VR9A 3P1WA 4CBQA 3EF6A 3CNSA 4WX1A 1MO9A 1K0LA 1NHSA 3ALMA 4A6NA 4GF7A 4RG4A 3QSMA 1E1MA 2OAMA 2YR6A 3AWIA 4H4TA 4OPGA 2WHDA 1E1LA 3NTAA 1GRBA 2E5VA 2QA2A 2OALA 4OPCA 3C4NA 4U8PA 1L9DA 3OC4A 1PJ5A 3RHAA 1XANA 2CFYA 3URHA 3AXBA 4DNAA 1E7PA 1KNRA 2VQBA 3K7QX 1AOGA 1GREA 1E6EA 5BUKA 5KMPA 2GH5A 2XFOA 4BK2A 1O95A 4H4PA 4K2XA 2Q0LA 4EM4A 3AE1A 2AQJA 2BK5A 1DOCA 1OJAA 2YVJA 3EAOA 4C77A 1DODA 2X99A 4D03A 1IUVA 3ALLA 2XVEA 1K4QA 4FK1C 5M0ZA 4B68A 2GRTA 5JCMA 5IQ1A 1CL0A 5KWFA 1PJ6A 4U8KA 3DK9A 3KPFA 3AEGA 4XWRA 2WS3A 4EM3A 2XVJA 3NIXA 4NNJA 4U2TA 4ZCCA 3AE7A 3IWAA 4ICYA 2HQMA 3P4SA 1NEKA 2XFUA 3ZYXA 4NTEA 1W4XA 4OVIA 3UP5A 1X31B 4RSLA 1GRGA 2YG3A 2XFPA 2X50A 2BYBA 4JDRA 4B67A 3NLCA 4A79A 3DGHA 1F6MA 3UKHA 4B65A 4DSHA 1TDEA 4OPUA 2C3DA 1F8SA 3VR8A 2IIDA 4IVOB 3K7TA 3CNPA 1GTEA 2V3AA 5KRQA 1GALA 1FCDA 2ZZCA 2C73A 2BCPA 3GYJA 1S3BA 3DA1A 4EIQA 2RABA 1B5QA 2GQWA 5KVHA 2GR1A 2XDOA 1L9EA 3GDPA 3IF9A 4H4YA 3NRNA 5FS7A 4EQSA 4Z44A 2B9WA 1GESA 1N4WA 3BI4A 2C4CA 3NG7X 3SZFA 4YSXA 3QFBA 3CNDA 4PAAA 2BS4A 5J7XA 2VRLA 1H83A 4G74A 1ONFA 4H4WA 3HYWA 2J3NA 1KSUA 3QJ4A 1IJHA 2BK4A 2GAHB 4BV6A 2C66A 3SXIA 2WDVA 1GOSA 5KOWA 1H7WA 4G6GA 4XWZA 3BHFA 2WEUA 3UKAA 2YLWA 5L46A 2BXRA 4H4XA 1DJQA 1GERA 1LJ1A 2R45A 2H88A 4IA6A 1MOKA 5KNLA 2C75A 1ZX9A 3P9UA 2JB1A 3SX6A 4ZCDA 4H4RA 2JKCA 3DH9A 3UOXA 3R9UA 4A65A 4AOSA 5JCKA 1QO8A 2WBAA 1K0IA 4H2NA 2WPFA 1L0VA 2B9XA 3ABVA 4EMJA 4JY2A 4OCGA 3NKSA 3AE5A 3Q9TA 1EL5A 3F8RA 4OPTA 4NWZA 1B37A 1IUXA 4J57A 3AE6A 5KMRA 4J36A 1JRXA 4CNKA 2OA1A 1JRZA 1RP0A 4AP1A 5GRTA 1Y0PA 2B7RA 1V59A 2XFQA 3C4AA 4H4VA 5ER0A 1EL8A 2R9ZA 1EL9A 1P2EA 3DK8A 5HXIA 5JCIA 4CNJA 1H6VA 1DNCA 4H4SA 3REDA 1FEAA 2R4EA 1FL2A 2YLSA 3C96A 4H4UA 1GPEA 3NK1X 3LJPA 1F8WA 2WOWA 1KF6A 1Y56B 1ZKQA 3F8PA 4EMIA 3DGZA 4LU6A 3L8KA 3PO7A 1NG3A 2YM2A 4TLXA 1H84A 2XFNA 3D1CA 3SZ0A 3NYEA 3UTEA 3V76A 3T2KA 4EQXA 4O5QA 2VVLG 1D4CA 2EQ8A 1VG0A 4Z24A 2Q0KA 2YLZA 3T37A 1NG4A 3PS9A 2VOUA 2NPXA 1NHRA 5M10A 1FEBA 4C3XA 4TM3A 5U1OA 1D5TA 3CN8A 2GR0A 1PBFA 2VQ7A 3CTYA 4A7AA 3GRTA 1DXLA 2Z5YA 1TYTA 5DBJA 2DKIA 1JRYA 2OLOA 2JK6A 4II3A 1IUTA 3Q6JA 4Z43A 1Q1WA 4K7ZA 1VG9A 4JN9A 2RGOA 5LV9A 3SM8A 3ZDNA 4K5SA 4JNQA 1NDAA 2YVGA 3G5QA 3FG2P 4I59A 4CCRA 1D4EA 2WDRA 3T0KA 3KPKA 3H8LA 3UTGA 3HZLA 1IUUA 2GV8A 1YQ4A 2JB3A 2CULA 2V3BA 3RP7A 3AEEA 3VQRA 3UKFA 5HYMA 4U8LA 2BRYA 3B3RA 5FS8A 1TYPA 2RGJA 4E0VA 3IHMA 5JCLA 1L9CA 5KVIA 2C64A 4NTCA 1GRAA 4OPIA 1FECA 2AAQA 3CGEA 3NTDA 3T14A 4H50A 1OJCA 1D4DA 1F8RA 4REKA 1GV4A 2YR5A 1CBOA 4AT2A 1S2YA 1CF3A 4GRTA 2A89A 1LQUA 1S3EA 4YTMA 2WPEA 3UOZA 3AEAA 4USQA 1DJNA 2X3NA 1DOEA 1DOBA 3D8XA 2CDUA 2WP5A 4Y4MA 4APNA 4UDRA 4GDEA 4OPDA 1JOAA 4H2RA 5JCNA 4AOXA 3AD9B 4KPRA 4X9NA 4WCTA 1CC6A 5IQ4A 4HA6A 4GDPA 4U2SA 2BS3A 3AD8B 4G73A 1ZK7A 1OJTA 1E1NA 1GRTA 3V3NA 2B76A 2Y6RA 4C3YA 3NN6X 1PXBA 1LVLA 2ARDA 2BCGG 2XVHA 2XVFA 3AB1A 3KU9A 3RP8A 2YLRA 2WP9A 1VQWA 2BRAA 3NYFA 3P4RA 4U8IA 3DJGX 1BWCA 4A9WA 2WU2A 2APGA 4B66A 3H4KA 1YQZA 2IVDA 2XYOA 1BGJA 2WOVA 1IUWA 3UP4A 2E1MA 1EL7A 1VDCA 3LZWA 3SY4A 1FOHA 3CPIG 2VVMA 4Y4LA 1ZP0A 3KA7A 4NEWA 4Z26A 1JEHA 5CQFA 4LIIA 4YSYA 3KKJA 2YR4A 3AYJA 3ISHA 2VRMA 2NVKX 1REOA 1NPXA 1LV0A 1GTHA 3BNMA 2X8HA 3T31A 3UOYA 4YSHA 2FBWA 2GB0A 2ZZBA 1CJ3A 2FJAA 3QFAA 4MJWA 2TMDA 4H7UA 4U2LA 4CCQA 5C2TA 2YVFA 4CY8A 2B9YA 4O5UA 3I6DA 3BHKA 2YQUA 3EPTA 1TDOA 3T2YA 4C5OA 3QVPA 1Z6LA 4EQRA 2XLRA 1N4UA 1OJ9A 3FPZA 4J2WA 3ICRA 1BZLA 3II4A 1NAAA 2ACZA 3HYVA 3CGCA 3FIMB 1GSNA 4HB9A 1CJ2A 2X8GA 2F5ZA 1E39A 2XLSA 3H8IA 2JBVA 1CC4A 1KNPA 1PBDA 1PDHA 3AE8A 4U8MA 1CC2A 1H82A 5BULA 1GRHA 1PJ7A 5FMHA 1PN0A 3UKLA 4BJZA 2C72A 4Z2UA 3SFEA 4BJYA 3M13A 3UOVA 4CY6A 2GQFA 3ICTA 2Q6UA 4AT0A 3COXA 2BS2A 3GSIA 2EQ9A 4D04A 3NGCX 3NNEA 3L1RA 1NHQA 4GR1A 2QAEA 1TDKA 3AEBA 2W0HA 3OZ2A 1ZMCA 4J31A 4II2A 1D7LA 5HY5A 4IA5A 4K22A 1BGNA 2V6OA 4U8OA 3GD3A 2TPRA 3S61A 1COYA 1TDFA 3EANA 3UTFA 3K7MX 3PVCA 3AD7B 3ICSA 4P9SA 3T2ZA 4B63A 4RG3A 4BK1A 5CKUA 5EOWA 2Y6QA 3IHGA 1PHHA 4J33A 3RNMA 3ADAB 3GMCA 3KD9A 1GT8A 1JU2A 4Z2TA 2ZBWA 3JSKA 2WDQA 5HHFA 1JNZA 1H81A 1N1PA 2BACA 3LADA 2YG5A 4U8JA 4USRA 5EBKA 1PXCA 2GR3A 4X4JA 4CRTA 1ELIA 2WPCA 4YXDA 2WQYA 2RGHA 2JB2A 2I0ZA 3UKKA 3M12A 4G6HA 4PABA 1Q1RA 4TM0A 1GRFA 4B64A 4NEVA 1KDGA 3GWDA 1GXFA 4EIPA 4AP3A 1JNRA 2GMHA 1MXTA 3AYIA 3FMWA 3GDNA 4IVMB 3SFDA 2C76A 2BABA 4C74A 3AE9A 1O94A 2WU5A 3NHOX 3SGLA 1NHPA 3P4PA 3V3OA 5KXJA 2BXSA
chains in the Genus database with same CATH topology
2Z5XA 2X8CA 3GYXA 3LOVA 5EB5A 3ATRA 4DSGA 5C3JA 1OJDA 2WOIA 4K5RA 4M52A 3SQPA 1ZDLA 2IVEA 1PBBA 2QCUA 3AYLA 2ZZ0A 4NTDA 3UCLA 2GVCA 4YWOA 3VRAA 1B8SA 3G5SA 3O0HA 3I3LA 2CVJA 2WETA 3SZWA 5BVAA 4G9KA 3QSSA 1S2QA 3AEFA 1ZY8A 3AE4A 4J34A 2R4JA 4H4QA 2XVIA 1LPFA 4IV9A 2DKHA 4BK3A 4FK1A 2C3CA 3SYIA 3CGDA 5EB4A 3LB8A 4BURA 3WE0A 3VRBA 4YKGA 1P2HA 2GAGB 3BI5A 3DJEA 3ITJA 4A5LA 4YTNA 2YLTA 2BC1A 2Q7VA 3DJJA 3CMMA 3NN0X 1UKVG 3P4QA 4XXGA 2E4GA 2R46A 2YWLA 5FS6A 2GF3A 1SEZA 1CHUA 2C7GA 2B7SA 3B6DA 4K8DA 1PXAA 4TM1A 3AE2A 2C65A 2H89A 4Y4NA 5FS9A 1RYIA 1BKWA 3ALJA 1XPQA 2WESA 3DJDA 3CPHG 1GEUA 3M0OA 4A99A 4YTPA 1PBEA 3LXDA 2GMJA 3KVEA 4YSZA 2YG7A 2JAEA 3GD4A 3LZXA 1TRBA 1PS9A 2YM1A 3ATQA 4EMWA 3NK0X 2C70A 2PHHA 4UP3A 3DMEA 2QA1A 3GYIA 2FJEA 1K0JA 1QJDA 5J60A 1CJCA 3IC9A 4ZN0A 1Y56A 1HYUA 2V61A 3DK4A 4B69A 5KMSA 1LTXR 2EQ7A 2AR8A 3NK2X 4FDCB 4Z2RA 2V60A 1NENA 4I58A 1F3PA 1M64A 1BF3A 4DGKA 1VRQB 1ZOVA 3F8DA 3NT6A 4H2PA 2R0GA 4Z25A 3AECA 1XDIA 1XHCA 2YLXA 1D7YA 1O5WA 3AE3A 2EQ6A 3CPJG 3CNTA 2YG4A 5TR3A 4J56A 4UDQA 3KLJA 4GAVA 5KMQA 1QLBA 1EBDA 3S5WA 1M6IA 3GWFA 3FBSA 4KX6A 4OPLA 2C67A 3RP6A 3VRDB 2R0CA 1H86A 3NYCA 4JNAA 1GETA 2YG6A 2A8XA 3CIRA 3K30A 4B1BA 2XLTA 5BRTA 2BK3A 1ZOYA 4H2QA 4ADWA 2A87A 4NZHA 3SZCA 4UDPA 2XLUA 1KSSA 4EQWA 4LA1A 1B4VA 4GCMA 1YQ3A 3UTHA 1H7XA 1LQTA 4GUVA 4ECHA 3BNUA 4TLZA 2YAUA 4FX9A 2V5ZA 4JQ9A 2UZZA 1CJ4A 1TDNA 1N4VA 3UKPA 2BC0A 4N9XA 3NH3X 4YKFA 2PYXA 3QSEA 1IUSA 4X9MA 3GRSA 3AEDA 3GMBA 1Q9IA 5GSNA 1E1KA 3CNJA 3UKQA 1GNDA 1RSGA 1PBCA 3BI2A 5KOXA 2O9ZA 1YKJA 4TM4A 3CGBA 2GEWA 5U25A 4YT0A 2BA9A 5U63A 2VVLA 2WP6A 3QVRA 2R0PA 4H4ZA 3HYXA 2VZ2A 2GR2A 3E1TA 2FJDA 1YY5A 2XLPA 2XCGA 3G5RA 4U8NA 1ZMDA 2OLNA 4JY3A 5IPYA 4A6NB 1KFYA 4GAPA 2FJBA 3VR9A 3P1WA 4CBQA 3EF6A 3CNSA 4WX1A 1MO9A 1K0LA 1NHSA 3ALMA 4A6NA 4GF7A 4RG4A 3QSMA 1E1MA 2OAMA 2YR6A 3AWIA 4H4TA 4OPGA 2WHDA 1E1LA 3NTAA 1GRBA 2E5VA 2QA2A 2OALA 4OPCA 3C4NA 4U8PA 1L9DA 3OC4A 1PJ5A 3RHAA 1XANA 2CFYA 3URHA 3AXBA 4DNAA 1E7PA 1KNRA 2VQBA 3K7QX 1AOGA 1GREA 1E6EA 5BUKA 5KMPA 2GH5A 2XFOA 4BK2A 1O95A 4H4PA 4K2XA 2Q0LA 4EM4A 3AE1A 2AQJA 2BK5A 1DOCA 1OJAA 2YVJA 3EAOA 4C77A 1DODA 2X99A 4D03A 1IUVA 3ALLA 2XVEA 1K4QA 4FK1C 5M0ZA 4B68A 2GRTA 5JCMA 5IQ1A 1CL0A 5KWFA 1PJ6A 4U8KA 3DK9A 3KPFA 3AEGA 4XWRA 2WS3A 4EM3A 2XVJA 3NIXA 4NNJA 4U2TA 4ZCCA 3AE7A 3IWAA 4ICYA 2HQMA 3P4SA 1NEKA 2XFUA 3ZYXA 4NTEA 1W4XA 4OVIA 3UP5A 1X31B 4RSLA 1GRGA 2YG3A 2XFPA 2X50A 2BYBA 4JDRA 4B67A 3NLCA 4A79A 3DGHA 1F6MA 3UKHA 4B65A 4DSHA 1TDEA 4OPUA 2C3DA 1F8SA 3VR8A 2IIDA 4IVOB 3K7TA 3CNPA 1GTEA 2V3AA 5KRQA 1GALA 1FCDA 2ZZCA 2C73A 2BCPA 3GYJA 1S3BA 3DA1A 4EIQA 2RABA 1B5QA 2GQWA 5KVHA 2GR1A 2XDOA 1L9EA 3GDPA 3IF9A 4H4YA 3NRNA 5FS7A 4EQSA 4Z44A 2B9WA 1GESA 1N4WA 3BI4A 2C4CA 3NG7X 3SZFA 4YSXA 3QFBA 3CNDA 4PAAA 2BS4A 5J7XA 2VRLA 1H83A 4G74A 1ONFA 4H4WA 3HYWA 2J3NA 1KSUA 3QJ4A 1IJHA 2BK4A 2GAHB 4BV6A 2C66A 3SXIA 2WDVA 1GOSA 5KOWA 1H7WA 4G6GA 4XWZA 3BHFA 2WEUA 3UKAA 2YLWA 5L46A 2BXRA 4H4XA 1DJQA 1GERA 1LJ1A 2R45A 2H88A 4IA6A 1MOKA 5KNLA 2C75A 1ZX9A 3P9UA 2JB1A 3SX6A 4ZCDA 4H4RA 2JKCA 3DH9A 3UOXA 3R9UA 4A65A 4AOSA 5JCKA 1QO8A 2WBAA 1K0IA 4H2NA 2WPFA 1L0VA 2B9XA 3ABVA 4EMJA 4JY2A 4OCGA 3NKSA 3AE5A 3Q9TA 1EL5A 3F8RA 4OPTA 4NWZA 1B37A 1IUXA 4J57A 3AE6A 5KMRA 4J36A 1JRXA 4CNKA 2OA1A 1JRZA 1RP0A 4AP1A 5GRTA 1Y0PA 2B7RA 1V59A 2XFQA 3C4AA 4H4VA 5ER0A 1EL8A 2R9ZA 1EL9A 1P2EA 3DK8A 5HXIA 5JCIA 4CNJA 1H6VA 1DNCA 4H4SA 3REDA 1FEAA 2R4EA 1FL2A 2YLSA 3C96A 4H4UA 1GPEA 3NK1X 3LJPA 1F8WA 2WOWA 1KF6A 1Y56B 1ZKQA 3F8PA 4EMIA 3DGZA 4LU6A 3L8KA 3PO7A 1NG3A 2YM2A 4TLXA 1H84A 2XFNA 3D1CA 3SZ0A 3NYEA 3UTEA 3V76A 3T2KA 4EQXA 4O5QA 2VVLG 1D4CA 2EQ8A 1VG0A 4Z24A 2Q0KA 2YLZA 3T37A 1NG4A 3PS9A 2VOUA 2NPXA 1NHRA 5M10A 1FEBA 4C3XA 4TM3A 5U1OA 1D5TA 3CN8A 2GR0A 1PBFA 2VQ7A 3CTYA 4A7AA 3GRTA 1DXLA 2Z5YA 1TYTA 5DBJA 2DKIA 1JRYA 2OLOA 2JK6A 4II3A 1IUTA 3Q6JA 4Z43A 1Q1WA 4K7ZA 1VG9A 4JN9A 2RGOA 5LV9A 3SM8A 3ZDNA 4K5SA 4JNQA 1NDAA 2YVGA 3G5QA 3FG2P 4I59A 4CCRA 1D4EA 2WDRA 3T0KA 3KPKA 3H8LA 3UTGA 3HZLA 1IUUA 2GV8A 1YQ4A 2JB3A 2CULA 2V3BA 3RP7A 3AEEA 3VQRA 3UKFA 5HYMA 4U8LA 2BRYA 3B3RA 5FS8A 1TYPA 2RGJA 4E0VA 3IHMA 5JCLA 1L9CA 5KVIA 2C64A 4NTCA 1GRAA 4OPIA 1FECA 2AAQA 3CGEA 3NTDA 3T14A 4H50A 1OJCA 1D4DA 1F8RA 4REKA 1GV4A 2YR5A 1CBOA 4AT2A 1S2YA 1CF3A 4GRTA 2A89A 1LQUA 1S3EA 4YTMA 2WPEA 3UOZA 3AEAA 4USQA 1DJNA 2X3NA 1DOEA 1DOBA 3D8XA 2CDUA 2WP5A 4Y4MA 4APNA 4UDRA 4GDEA 4OPDA 1JOAA 4H2RA 5JCNA 4AOXA 3AD9B 4KPRA 4X9NA 4WCTA 1CC6A 5IQ4A 4HA6A 4GDPA 4U2SA 2BS3A 3AD8B 4G73A 1ZK7A 1OJTA 1E1NA 1GRTA 3V3NA 2B76A 2Y6RA 4C3YA 3NN6X 1PXBA 1LVLA 2ARDA 2BCGG 2XVHA 2XVFA 3AB1A 3KU9A 3RP8A 2YLRA 2WP9A 1VQWA 2BRAA 3NYFA 3P4RA 4U8IA 3DJGX 1BWCA 4A9WA 2WU2A 2APGA 4B66A 3H4KA 1YQZA 2IVDA 2XYOA 1BGJA 2WOVA 1IUWA 3UP4A 2E1MA 1EL7A 1VDCA 3LZWA 3SY4A 1FOHA 3CPIG 2VVMA 4Y4LA 1ZP0A 3KA7A 4NEWA 4Z26A 1JEHA 5CQFA 4LIIA 4YSYA 3KKJA 2YR4A 3AYJA 3ISHA 2VRMA 2NVKX 1REOA 1NPXA 1LV0A 1GTHA 3BNMA 2X8HA 3T31A 3UOYA 4YSHA 2FBWA 2GB0A 2ZZBA 1CJ3A 2FJAA 3QFAA 4MJWA 2TMDA 4H7UA 4U2LA 4CCQA 5C2TA 2YVFA 4CY8A 2B9YA 4O5UA 3I6DA 3BHKA 2YQUA 3EPTA 1TDOA 3T2YA 4C5OA 3QVPA 1Z6LA 4EQRA 2XLRA 1N4UA 1OJ9A 3FPZA 4J2WA 3ICRA 1BZLA 3II4A 1NAAA 2ACZA 3HYVA 3CGCA 3FIMB 1GSNA 4HB9A 1CJ2A 2X8GA 2F5ZA 1E39A 2XLSA 3H8IA 2JBVA 1CC4A 1KNPA 1PBDA 1PDHA 3AE8A 4U8MA 1CC2A 1H82A 5BULA 1GRHA 1PJ7A 5FMHA 1PN0A 3UKLA 4BJZA 2C72A 4Z2UA 3SFEA 4BJYA 3M13A 3UOVA 4CY6A 2GQFA 3ICTA 2Q6UA 4AT0A 3COXA 2BS2A 3GSIA 2EQ9A 4D04A 3NGCX 3NNEA 3L1RA 1NHQA 4GR1A 2QAEA 1TDKA 3AEBA 2W0HA 3OZ2A 1ZMCA 4J31A 4II2A 1D7LA 5HY5A 4IA5A 4K22A 1BGNA 2V6OA 4U8OA 3GD3A 2TPRA 3S61A 1COYA 1TDFA 3EANA 3UTFA 3K7MX 3PVCA 3AD7B 3ICSA 4P9SA 3T2ZA 4B63A 4RG3A 4BK1A 5CKUA 5EOWA 2Y6QA 3IHGA 1PHHA 4J33A 3RNMA 3ADAB 3GMCA 3KD9A 1GT8A 1JU2A 4Z2TA 2ZBWA 3JSKA 2WDQA 5HHFA 1JNZA 1H81A 1N1PA 2BACA 3LADA 2YG5A 4U8JA 4USRA 5EBKA 1PXCA 2GR3A 4X4JA 4CRTA 1ELIA 2WPCA 4YXDA 2WQYA 2RGHA 2JB2A 2I0ZA 3UKKA 3M12A 4G6HA 4PABA 1Q1RA 4TM0A 1GRFA 4B64A 4NEVA 1KDGA 3GWDA 1GXFA 4EIPA 4AP3A 1JNRA 2GMHA 1MXTA 3AYIA 3FMWA 3GDNA 4IVMB 3SFDA 2C76A 2BABA 4C74A 3AE9A 1O94A 2WU5A 3NHOX 3SGLA 1NHPA 3P4PA 3V3OA 5KXJA 2BXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5X A;  2X8C A;  3LOV A;  5EB5 A;  4DSG A;  3ATR A;  5C3J A;  1OJD A;  2WOI A;  4K5R A;  4M52 A;  3SQP A;  1ZDL A;  2IVE A;  1PBB A;  2QCU A;  3AYL A;  2ZZ0 A;  4NTD A;  3UCL A;  2GVC A;  4YWO A;  3VRA A;  1B8S A;  3G5S A;  3O0H A;  3I3L A;  2CVJ A;  2WET A;  5BVA A;  3QSS A;  1S2Q A;  3AEF A;  1ZY8 A;  3AE4 A;  4J34 A;  2R4J A;  4H4Q A;  2XVI A;  1LPF A;  4IV9 A;  2DKH A;  4BK3 A;  4FK1 A;  2C3C A;  3CGD A;  5EB4 A;  3LB8 A;  4BUR A;  3WE0 A;  3VRB A;  4YKG A;  1P2H A;  2GAG B;  3BI5 A;  3DJE A;  3ITJ A;  4A5L A;  4YTN A;  2YLT A;  2BC1 A;  2Q7V A;  3DJJ A;  3NN0 X;  1UKV G;  3P4Q A;  4XXG A;  2E4G A;  2R46 A;  2YWL A;  5FS6 A;  2GF3 A;  1SEZ A;  1CHU A;  2C7G A;  2B7S A;  3B6D A;  4K8D A;  1PXA A;  4TM1 A;  3AE2 A;  2C65 A;  2H89 A;  4Y4N A;  5FS9 A;  1RYI A;  1BKW A;  3ALJ A;  1XPQ A;  2WES A;  3DJD A;  3CPH G;  1GEU A;  3M0O A;  4A99 A;  4YTP A;  1PBE A;  3LXD A;  2GMJ A;  3KVE A;  4YSZ A;  2YG7 A;  2JAE A;  3GD4 A;  3LZX A;  1TRB A;  1PS9 A;  2YM1 A;  3ATQ A;  4EMW A;  3NK0 X;  2C70 A;  2PHH A;  4UP3 A;  3DME A;  2QA1 A;  3GYI A;  2FJE A;  1K0J A;  1QJD A;  5J60 A;  1CJC A;  3IC9 A;  4ZN0 A;  1Y56 A;  1HYU A;  2V61 A;  3DK4 A;  4B69 A;  1LTX R;  2EQ7 A;  2AR8 A;  3NK2 X;  4FDC B;  4Z2R A;  2V60 A;  1NEN A;  4I58 A;  1F3P A;  1M64 A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  3F8D A;  3NT6 A;  4H2P A;  2R0G A;  4Z25 A;  3AEC A;  1XDI A;  1XHC A;  2YLX A;  1D7Y A;  1O5W A;  3AE3 A;  2EQ6 A;  3CPJ G;  3CNT A;  2YG4 A;  5TR3 A;  4J56 A;  4UDQ A;  3KLJ A;  1QLB A;  1EBD A;  3S5W A;  1M6I A;  3GWF A;  3FBS A;  4KX6 A;  4OPL A;  2C67 A;  3RP6 A;  3VRD B;  2R0C A;  1H86 A;  3NYC A;  4JNA A;  1GET A;  2YG6 A;  2A8X A;  3CIR A;  3K30 A;  4B1B A;  2XLT A;  5BRT A;  2BK3 A;  1ZOY A;  4H2Q A;  4ADW A;  2A87 A;  4NZH A;  4UDP A;  2XLU A;  1KSS A;  4EQW A;  4LA1 A;  1B4V A;  4GCM A;  1YQ3 A;  3UTH A;  1H7X A;  1LQT A;  4GUV A;  4ECH A;  3BNU A;  4TLZ A;  2YAU A;  4FX9 A;  2V5Z A;  4JQ9 A;  2UZZ A;  1CJ4 A;  1TDN A;  1N4V A;  3UKP A;  2BC0 A;  4N9X A;  3NH3 X;  4YKF A;  2PYX A;  3QSE A;  1IUS A;  4X9M A;  3GRS A;  3AED A;  3GMB A;  1Q9I A;  5GSN A;  1E1K A;  3CNJ A;  3UKQ A;  1GND A;  1RSG A;  1PBC A;  3BI2 A;  5KOX A;  2O9Z A;  1YKJ A;  4TM4 A;  3CGB A;  2GEW A;  5U25 A;  4YT0 A;  2BA9 A;  5U63 A;  2VVL A;  2WP6 A;  3QVR A;  2R0P A;  4H4Z A;  2VZ2 A;  2GR2 A;  3E1T A;  2FJD A;  1YY5 A;  2XLP A;  2XCG A;  3G5R A;  4U8N A;  1ZMD A;  2OLN A;  4JY3 A;  5IPY A;  4A6N B;  1KFY A;  3VR9 A;  2FJB A;  3P1W A;  4CBQ A;  3EF6 A;  3CNS A;  4WX1 A;  1MO9 A;  1K0L A;  1NHS A;  3ALM A;  4A6N A;  4GF7 A;  4RG4 A;  3QSM A;  1E1M A;  2OAM A;  2YR6 A;  3AWI A;  4H4T A;  4OPG A;  2WHD A;  1E1L A;  3NTA A;  1GRB A;  2E5V A;  2QA2 A;  2OAL A;  4OPC A;  3C4N A;  4U8P A;  1L9D A;  3OC4 A;  1PJ5 A;  3RHA A;  1XAN A;  2CFY A;  3URH A;  3AXB A;  4DNA A;  1E7P A;  1KNR A;  2VQB A;  3K7Q X;  1AOG A;  1GRE A;  1E6E A;  5BUK A;  2GH5 A;  2XFO A;  4BK2 A;  1O95 A;  4H4P A;  4K2X A;  2Q0L A;  4EM4 A;  3AE1 A;  2AQJ A;  2BK5 A;  1DOC A;  1OJA A;  2YVJ A;  3EAO A;  4C77 A;  1DOD A;  2X99 A;  4D03 A;  1IUV A;  3ALL A;  2XVE A;  1K4Q A;  4FK1 C;  5M0Z A;  4B68 A;  2GRT A;  5JCM A;  5IQ1 A;  1CL0 A;  5KWF A;  1PJ6 A;  4U8K A;  3DK9 A;  3KPF A;  3AEG A;  4XWR A;  2WS3 A;  4EM3 A;  2XVJ A;  3NIX A;  4U2T A;  4ZCC A;  3AE7 A;  3IWA A;  4ICY A;  2HQM A;  3P4S A;  1NEK A;  2XFU A;  3ZYX A;  4NTE A;  1W4X A;  4OVI A;  3UP5 A;  1X31 B;  4RSL A;  1GRG A;  2YG3 A;  2XFP A;  2X50 A;  2BYB A;  4JDR A;  4B67 A;  3NLC A;  4A79 A;  3DGH A;  1F6M A;  3UKH A;  4B65 A;  4DSH A;  1TDE A;  4OPU A;  2C3D A;  1F8S A;  3VR8 A;  2IID A;  4IVO B;  3K7T A;  3CNP A;  1GTE A;  2V3A A;  5KRQ A;  1GAL A;  1FCD A;  2ZZC A;  2C73 A;  2BCP A;  3GYJ A;  1S3B A;  3DA1 A;  4EIQ A;  2RAB A;  1B5Q A;  2GQW A;  5KVH A;  2GR1 A;  2XDO A;  1L9E A;  3GDP A;  3IF9 A;  4H4Y A;  3NRN A;  5FS7 A;  4EQS A;  4Z44 A;  2B9W A;  1GES A;  1N4W A;  3BI4 A;  3NG7 X;  4YSX A;  3QFB A;  3CND A;  4PAA A;  2BS4 A;  5J7X A;  2VRL A;  1H83 A;  1ONF A;  4H4W A;  2J3N A;  1KSU A;  3QJ4 A;  1IJH A;  2BK4 A;  2GAH B;  4BV6 A;  2C66 A;  2WDV A;  1GOS A;  5KOW A;  1H7W A;  4XWZ A;  3UKA A;  3BHF A;  2WEU A;  5L46 A;  2YLW A;  2BXR A;  4H4X A;  1DJQ A;  1GER A;  1LJ1 A;  2R45 A;  2H88 A;  4IA6 A;  1MOK A;  2C75 A;  1ZX9 A;  3P9U A;  2JB1 A;  4ZCD A;  4H4R A;  2JKC A;  3DH9 A;  3UOX A;  3R9U A;  4A65 A;  4AOS A;  5JCK A;  1QO8 A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1L0V A;  2B9X A;  3ABV A;  4EMJ A;  4JY2 A;  4OCG A;  3NKS A;  3AE5 A;  3Q9T A;  1EL5 A;  3F8R A;  4OPT A;  1B37 A;  1IUX A;  4J57 A;  3AE6 A;  4J36 A;  1JRX A;  4CNK A;  2OA1 A;  1JRZ A;  1RP0 A;  4AP1 A;  5GRT A;  1Y0P A;  2B7R A;  1V59 A;  2XFQ A;  3C4A A;  4H4V A;  5ER0 A;  1EL8 A;  2R9Z A;  1EL9 A;  1P2E A;  3DK8 A;  5HXI A;  5JCI A;  4CNJ A;  1H6V A;  1DNC A;  4H4S A;  3RED A;  1FEA A;  2R4E A;  1FL2 A;  2YLS A;  3C96 A;  4H4U A;  1GPE A;  3NK1 X;  3LJP A;  1F8W A;  2WOW A;  1KF6 A;  1Y56 B;  1ZKQ A;  3F8P A;  4EMI A;  3DGZ A;  4LU6 A;  3L8K A;  3PO7 A;  1NG3 A;  2YM2 A;  4TLX A;  1H84 A;  2XFN A;  3D1C A;  3UTE A;  3NYE A;  3V76 A;  4EQX A;  4O5Q A;  2VVL G;  1D4C A;  2EQ8 A;  1VG0 A;  4Z24 A;  2Q0K A;  2YLZ A;  3T37 A;  1NG4 A;  3PS9 A;  2VOU A;  2NPX A;  1NHR A;  5M10 A;  1FEB A;  4C3X A;  4TM3 A;  5U1O A;  1D5T A;  3CN8 A;  2GR0 A;  1PBF A;  2VQ7 A;  3CTY A;  4A7A A;  3GRT A;  1DXL A;  2Z5Y A;  1TYT A;  5DBJ A;  2DKI A;  1JRY A;  2OLO A;  2JK6 A;  1IUT A;  3Q6J A;  4Z43 A;  1Q1W A;  4K7Z A;  1VG9 A;  4JN9 A;  2RGO A;  5LV9 A;  3SM8 A;  3ZDN A;  4K5S A;  4JNQ A;  1NDA A;  2YVG A;  3G5Q A;  3FG2 P;  4I59 A;  4CCR A;  1D4E A;  2WDR A;  3UTG A;  3H8L A;  3HZL A;  1IUU A;  2GV8 A;  1YQ4 A;  2JB3 A;  2CUL A;  2V3B A;  3RP7 A;  3AEE A;  3VQR A;  3UKF A;  5HYM A;  4U8L A;  3B3R A;  5FS8 A;  4E0V A;  1TYP A;  2RGJ A;  3IHM A;  5JCL A;  1L9C A;  5KVI A;  2C64 A;  4NTC A;  1GRA A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3NTD A;  4H50 A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  1GV4 A;  2YR5 A;  1CBO A;  4AT2 A;  1S2Y A;  1CF3 A;  4GRT A;  2A89 A;  1LQU A;  1S3E A;  4YTM A;  2WPE A;  3UOZ A;  3AEA A;  4USQ A;  1DJN A;  2X3N A;  1DOE A;  1DOB A;  3D8X A;  2CDU A;  2WP5 A;  4Y4M A;  4APN A;  4UDR A;  4GDE A;  4OPD A;  1JOA A;  4H2R A;  5JCN A;  4AOX A;  3AD9 B;  4KPR A;  4X9N A;  4WCT A;  1CC6 A;  5IQ4 A;  4HA6 A;  4GDP A;  4U2S A;  2BS3 A;  3AD8 B;  1ZK7 A;  1OJT A;  1E1N A;  1GRT A;  3V3N A;  2B76 A;  2Y6R A;  4C3Y A;  3NN6 X;  1PXB A;  1LVL A;  2ARD A;  2BCG G;  2XVH A;  2XVF A;  3AB1 A;  3KU9 A;  3RP8 A;  2YLR A;  2WP9 A;  1VQW A;  3NYF A;  3P4R A;  4U8I A;  3DJG X;  1BWC A;  4A9W A;  2WU2 A;  2APG A;  4B66 A;  3H4K A;  1YQZ A;  2IVD A;  2XYO A;  1BGJ A;  2WOV A;  1IUW A;  3UP4 A;  2E1M A;  1EL7 A;  1VDC A;  3LZW A;  1FOH A;  3CPI G;  2VVM A;  4Y4L A;  1ZP0 A;  3KA7 A;  4NEW A;  4Z26 A;  1JEH A;  5CQF A;  4LII A;  4YSY A;  3KKJ A;  2YR4 A;  3AYJ A;  3ISH A;  2VRM A;  2NVK X;  1REO A;  1NPX A;  1LV0 A;  1GTH A;  3BNM A;  2X8H A;  3UOY A;  4YSH A;  2FBW A;  2GB0 A;  2ZZB A;  1CJ3 A;  2FJA A;  3QFA A;  4MJW A;  2TMD A;  4H7U A;  4U2L A;  4CCQ A;  5C2T A;  2YVF A;  4CY8 A;  2B9Y A;  4O5U A;  3I6D A;  3BHK A;  2YQU A;  3EPT A;  1TDO A;  4C5O A;  3QVP A;  1Z6L A;  4EQR A;  2XLR A;  1N4U A;  1OJ9 A;  3FPZ A;  4J2W A;  3ICR A;  1BZL A;  3II4 A;  1NAA A;  2ACZ A;  3CGC A;  3FIM B;  1GSN A;  4HB9 A;  1CJ2 A;  2X8G A;  2F5Z A;  1E39 A;  2XLS A;  3H8I A;  2JBV A;  1CC4 A;  1KNP A;  1PBD A;  1PDH A;  3AE8 A;  4U8M A;  1CC2 A;  1H82 A;  5BUL A;  1GRH A;  1PJ7 A;  5FMH A;  1PN0 A;  3UKL A;  4BJZ A;  2C72 A;  4Z2U A;  3SFE A;  4BJY A;  3M13 A;  3UOV A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  4AT0 A;  3COX A;  2BS2 A;  3GSI A;  2EQ9 A;  4D04 A;  3NGC X;  3NNE A;  3L1R A;  1NHQ A;  4GR1 A;  2QAE A;  1TDK A;  3AEB A;  2W0H A;  3OZ2 A;  1ZMC A;  4J31 A;  5HY5 A;  1D7L A;  4IA5 A;  4K22 A;  1BGN A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  3S61 A;  1COY A;  1TDF A;  3EAN A;  3UTF A;  3K7M X;  3PVC A;  3AD7 B;  3ICS A;  4P9S A;  4B63 A;  4RG3 A;  4BK1 A;  5CKU A;  5EOW A;  2Y6Q A;  3IHG A;  1PHH A;  4J33 A;  3RNM A;  3ADA B;  3GMC A;  3KD9 A;  1GT8 A;  1JU2 A;  4Z2T A;  2ZBW A;  3JSK A;  2WDQ A;  5HHF A;  1JNZ A;  1H81 A;  1N1P A;  2BAC A;  3LAD A;  2YG5 A;  4U8J A;  4USR A;  5EBK A;  1PXC A;  2GR3 A;  4X4J A;  4CRT A;  1ELI A;  2WPC A;  4YXD A;  2WQY A;  2RGH A;  2JB2 A;  2I0Z A;  3UKK A;  3M12 A;  4PAB A;  1Q1R A;  4TM0 A;  1GRF A;  4B64 A;  4NEV A;  1KDG A;  3GWD A;  1GXF A;  4EIP A;  4AP3 A;  1JNR A;  2GMH A;  1MXT A;  3AYI A;  3FMW A;  3GDN A;  4IVM B;  3SFD A;  2C76 A;  2BAB A;  4C74 A;  3AE9 A;  1O94 A;  2WU5 A;  3NHO X;  3SGL A;  1NHP A;  3P4P A;  3V3O A;  5KXJ A;  2BXS A; 
#chains in the Genus database with same CATH topology
 2Z5X A;  2X8C A;  3GYX A;  3LOV A;  5EB5 A;  3ATR A;  4DSG A;  5C3J A;  1OJD A;  2WOI A;  4K5R A;  4M52 A;  3SQP A;  1ZDL A;  2IVE A;  1PBB A;  2QCU A;  3AYL A;  2ZZ0 A;  4NTD A;  3UCL A;  2GVC A;  4YWO A;  3VRA A;  1B8S A;  3G5S A;  3O0H A;  3I3L A;  2CVJ A;  2WET A;  3SZW A;  5BVA A;  4G9K A;  3QSS A;  1S2Q A;  3AEF A;  1ZY8 A;  3AE4 A;  4J34 A;  2R4J A;  4H4Q A;  2XVI A;  1LPF A;  4IV9 A;  2DKH A;  4BK3 A;  4FK1 A;  2C3C A;  3SYI A;  3CGD A;  5EB4 A;  3LB8 A;  4BUR A;  3WE0 A;  3VRB A;  4YKG A;  1P2H A;  2GAG B;  3BI5 A;  3DJE A;  3ITJ A;  4A5L A;  4YTN A;  2YLT A;  2BC1 A;  2Q7V A;  3DJJ A;  3CMM A;  3NN0 X;  1UKV G;  3P4Q A;  4XXG A;  2E4G A;  2R46 A;  2YWL A;  5FS6 A;  2GF3 A;  1SEZ A;  1CHU A;  2C7G A;  2B7S A;  3B6D A;  4K8D A;  1PXA A;  4TM1 A;  3AE2 A;  2C65 A;  2H89 A;  4Y4N A;  5FS9 A;  1RYI A;  1BKW A;  3ALJ A;  1XPQ A;  2WES A;  3DJD A;  3CPH G;  1GEU A;  3M0O A;  4A99 A;  4YTP A;  1PBE A;  3LXD A;  2GMJ A;  3KVE A;  4YSZ A;  2YG7 A;  2JAE A;  3GD4 A;  3LZX A;  1TRB A;  1PS9 A;  2YM1 A;  3ATQ A;  4EMW A;  3NK0 X;  2C70 A;  2PHH A;  4UP3 A;  3DME A;  2QA1 A;  3GYI A;  2FJE A;  1K0J A;  1QJD A;  5J60 A;  1CJC A;  3IC9 A;  4ZN0 A;  1Y56 A;  1HYU A;  2V61 A;  3DK4 A;  4B69 A;  5KMS A;  1LTX R;  2EQ7 A;  2AR8 A;  3NK2 X;  4FDC B;  4Z2R A;  2V60 A;  1NEN A;  4I58 A;  1F3P A;  1M64 A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  3F8D A;  3NT6 A;  4H2P A;  2R0G A;  4Z25 A;  3AEC A;  1XDI A;  1XHC A;  2YLX A;  1D7Y A;  1O5W A;  3AE3 A;  2EQ6 A;  3CPJ G;  3CNT A;  2YG4 A;  5TR3 A;  4J56 A;  4UDQ A;  3KLJ A;  4GAV A;  5KMQ A;  1QLB A;  1EBD A;  3S5W A;  1M6I A;  3GWF A;  3FBS A;  4KX6 A;  4OPL A;  2C67 A;  3RP6 A;  3VRD B;  2R0C A;  1H86 A;  3NYC A;  4JNA A;  1GET A;  2YG6 A;  2A8X A;  3CIR A;  3K30 A;  4B1B A;  2XLT A;  5BRT A;  2BK3 A;  1ZOY A;  4H2Q A;  4ADW A;  2A87 A;  4NZH A;  3SZC A;  4UDP A;  2XLU A;  1KSS A;  4EQW A;  4LA1 A;  1B4V A;  4GCM A;  1YQ3 A;  3UTH A;  1H7X A;  1LQT A;  4GUV A;  4ECH A;  3BNU A;  4TLZ A;  2YAU A;  4FX9 A;  2V5Z A;  4JQ9 A;  2UZZ A;  1CJ4 A;  1TDN A;  1N4V A;  3UKP A;  2BC0 A;  4N9X A;  3NH3 X;  4YKF A;  2PYX A;  3QSE A;  1IUS A;  4X9M A;  3GRS A;  3AED A;  3GMB A;  1Q9I A;  5GSN A;  1E1K A;  3CNJ A;  3UKQ A;  1GND A;  1RSG A;  1PBC A;  3BI2 A;  5KOX A;  2O9Z A;  1YKJ A;  4TM4 A;  3CGB A;  2GEW A;  5U25 A;  4YT0 A;  2BA9 A;  5U63 A;  2VVL A;  2WP6 A;  3QVR A;  2R0P A;  4H4Z A;  3HYX A;  2VZ2 A;  2GR2 A;  3E1T A;  2FJD A;  1YY5 A;  2XLP A;  2XCG A;  3G5R A;  4U8N A;  1ZMD A;  2OLN A;  4JY3 A;  5IPY A;  4A6N B;  1KFY A;  4GAP A;  2FJB A;  3VR9 A;  3P1W A;  4CBQ A;  3EF6 A;  3CNS A;  4WX1 A;  1MO9 A;  1K0L A;  1NHS A;  3ALM A;  4A6N A;  4GF7 A;  4RG4 A;  3QSM A;  1E1M A;  2OAM A;  2YR6 A;  3AWI A;  4H4T A;  4OPG A;  2WHD A;  1E1L A;  3NTA A;  1GRB A;  2E5V A;  2QA2 A;  2OAL A;  4OPC A;  3C4N A;  4U8P A;  1L9D A;  3OC4 A;  1PJ5 A;  3RHA A;  1XAN A;  2CFY A;  3URH A;  3AXB A;  4DNA A;  1E7P A;  1KNR A;  2VQB A;  3K7Q X;  1AOG A;  1GRE A;  1E6E A;  5BUK A;  5KMP A;  2GH5 A;  2XFO A;  4BK2 A;  1O95 A;  4H4P A;  4K2X A;  2Q0L A;  4EM4 A;  3AE1 A;  2AQJ A;  2BK5 A;  1DOC A;  1OJA A;  2YVJ A;  3EAO A;  4C77 A;  1DOD A;  2X99 A;  4D03 A;  1IUV A;  3ALL A;  2XVE A;  1K4Q A;  4FK1 C;  5M0Z A;  4B68 A;  2GRT A;  5JCM A;  5IQ1 A;  1CL0 A;  5KWF A;  1PJ6 A;  4U8K A;  3DK9 A;  3KPF A;  3AEG A;  4XWR A;  2WS3 A;  4EM3 A;  2XVJ A;  3NIX A;  4NNJ A;  4U2T A;  4ZCC A;  3AE7 A;  3IWA A;  4ICY A;  2HQM A;  3P4S A;  1NEK A;  2XFU A;  3ZYX A;  4NTE A;  1W4X A;  4OVI A;  3UP5 A;  1X31 B;  4RSL A;  1GRG A;  2YG3 A;  2XFP A;  2X50 A;  2BYB A;  4JDR A;  4B67 A;  3NLC A;  4A79 A;  3DGH A;  1F6M A;  3UKH A;  4B65 A;  4DSH A;  1TDE A;  4OPU A;  2C3D A;  1F8S A;  3VR8 A;  2IID A;  4IVO B;  3K7T A;  3CNP A;  1GTE A;  2V3A A;  5KRQ A;  1GAL A;  1FCD A;  2ZZC A;  2C73 A;  2BCP A;  3GYJ A;  1S3B A;  3DA1 A;  4EIQ A;  2RAB A;  1B5Q A;  2GQW A;  5KVH A;  2GR1 A;  2XDO A;  1L9E A;  3GDP A;  3IF9 A;  4H4Y A;  3NRN A;  5FS7 A;  4EQS A;  4Z44 A;  2B9W A;  1GES A;  1N4W A;  3BI4 A;  2C4C A;  3NG7 X;  3SZF A;  4YSX A;  3QFB A;  3CND A;  4PAA A;  2BS4 A;  5J7X A;  2VRL A;  1H83 A;  4G74 A;  1ONF A;  4H4W A;  3HYW A;  2J3N A;  1KSU A;  3QJ4 A;  1IJH A;  2BK4 A;  2GAH B;  4BV6 A;  2C66 A;  3SXI A;  2WDV A;  1GOS A;  5KOW A;  1H7W A;  4G6G A;  4XWZ A;  3BHF A;  2WEU A;  3UKA A;  2YLW A;  5L46 A;  2BXR A;  4H4X A;  1DJQ A;  1GER A;  1LJ1 A;  2R45 A;  2H88 A;  4IA6 A;  1MOK A;  5KNL A;  2C75 A;  1ZX9 A;  3P9U A;  2JB1 A;  3SX6 A;  4ZCD A;  4H4R A;  2JKC A;  3DH9 A;  3UOX A;  3R9U A;  4A65 A;  4AOS A;  5JCK A;  1QO8 A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1L0V A;  2B9X A;  3ABV A;  4EMJ A;  4JY2 A;  4OCG A;  3NKS A;  3AE5 A;  3Q9T A;  1EL5 A;  3F8R A;  4OPT A;  4NWZ A;  1B37 A;  1IUX A;  4J57 A;  3AE6 A;  5KMR A;  4J36 A;  1JRX A;  4CNK A;  2OA1 A;  1JRZ A;  1RP0 A;  4AP1 A;  5GRT A;  1Y0P A;  2B7R A;  1V59 A;  2XFQ A;  3C4A A;  4H4V A;  5ER0 A;  1EL8 A;  2R9Z A;  1EL9 A;  1P2E A;  3DK8 A;  5HXI A;  5JCI A;  4CNJ A;  1H6V A;  1DNC A;  4H4S A;  3RED A;  1FEA A;  2R4E A;  1FL2 A;  2YLS A;  3C96 A;  4H4U A;  1GPE A;  3NK1 X;  3LJP A;  1F8W A;  2WOW A;  1KF6 A;  1Y56 B;  1ZKQ A;  3F8P A;  4EMI A;  3DGZ A;  4LU6 A;  3L8K A;  3PO7 A;  1NG3 A;  2YM2 A;  4TLX A;  1H84 A;  2XFN A;  3D1C A;  3SZ0 A;  3NYE A;  3UTE A;  3V76 A;  3T2K A;  4EQX A;  4O5Q A;  2VVL G;  1D4C A;  2EQ8 A;  1VG0 A;  4Z24 A;  2Q0K A;  2YLZ A;  3T37 A;  1NG4 A;  3PS9 A;  2VOU A;  2NPX A;  1NHR A;  5M10 A;  1FEB A;  4C3X A;  4TM3 A;  5U1O A;  1D5T A;  3CN8 A;  2GR0 A;  1PBF A;  2VQ7 A;  3CTY A;  4A7A A;  3GRT A;  1DXL A;  2Z5Y A;  1TYT A;  5DBJ A;  2DKI A;  1JRY A;  2OLO A;  2JK6 A;  4II3 A;  1IUT A;  3Q6J A;  4Z43 A;  1Q1W A;  4K7Z A;  1VG9 A;  4JN9 A;  2RGO A;  5LV9 A;  3SM8 A;  3ZDN A;  4K5S A;  4JNQ A;  1NDA A;  2YVG A;  3G5Q A;  3FG2 P;  4I59 A;  4CCR A;  1D4E A;  2WDR A;  3T0K A;  3KPK A;  3H8L A;  3UTG A;  3HZL A;  1IUU A;  2GV8 A;  1YQ4 A;  2JB3 A;  2CUL A;  2V3B A;  3RP7 A;  3AEE A;  3VQR A;  3UKF A;  5HYM A;  4U8L A;  2BRY A;  3B3R A;  5FS8 A;  1TYP A;  2RGJ A;  4E0V A;  3IHM A;  5JCL A;  1L9C A;  5KVI A;  2C64 A;  4NTC A;  1GRA A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3NTD A;  3T14 A;  4H50 A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  1GV4 A;  2YR5 A;  1CBO A;  4AT2 A;  1S2Y A;  1CF3 A;  4GRT A;  2A89 A;  1LQU A;  1S3E A;  4YTM A;  2WPE A;  3UOZ A;  3AEA A;  4USQ A;  1DJN A;  2X3N A;  1DOE A;  1DOB A;  3D8X A;  2CDU A;  2WP5 A;  4Y4M A;  4APN A;  4UDR A;  4GDE A;  4OPD A;  1JOA A;  4H2R A;  5JCN A;  4AOX A;  3AD9 B;  4KPR A;  4X9N A;  4WCT A;  1CC6 A;  5IQ4 A;  4HA6 A;  4GDP A;  4U2S A;  2BS3 A;  3AD8 B;  4G73 A;  1ZK7 A;  1OJT A;  1E1N A;  1GRT A;  3V3N A;  2B76 A;  2Y6R A;  4C3Y A;  3NN6 X;  1PXB A;  1LVL A;  2ARD A;  2BCG G;  2XVH A;  2XVF A;  3AB1 A;  3KU9 A;  3RP8 A;  2YLR A;  2WP9 A;  1VQW A;  2BRA A;  3NYF A;  3P4R A;  4U8I A;  3DJG X;  1BWC A;  4A9W A;  2WU2 A;  2APG A;  4B66 A;  3H4K A;  1YQZ A;  2IVD A;  2XYO A;  1BGJ A;  2WOV A;  1IUW A;  3UP4 A;  2E1M A;  1EL7 A;  1VDC A;  3LZW A;  3SY4 A;  1FOH A;  3CPI G;  2VVM A;  4Y4L A;  1ZP0 A;  3KA7 A;  4NEW A;  4Z26 A;  1JEH A;  5CQF A;  4LII A;  4YSY A;  3KKJ A;  2YR4 A;  3AYJ A;  3ISH A;  2VRM A;  2NVK X;  1REO A;  1NPX A;  1LV0 A;  1GTH A;  3BNM A;  2X8H A;  3T31 A;  3UOY A;  4YSH A;  2FBW A;  2GB0 A;  2ZZB A;  1CJ3 A;  2FJA A;  3QFA A;  4MJW A;  2TMD A;  4H7U A;  4U2L A;  4CCQ A;  5C2T A;  2YVF A;  4CY8 A;  2B9Y A;  4O5U A;  3I6D A;  3BHK A;  2YQU A;  3EPT A;  1TDO A;  3T2Y A;  4C5O A;  3QVP A;  1Z6L A;  4EQR A;  2XLR A;  1N4U A;  1OJ9 A;  3FPZ A;  4J2W A;  3ICR A;  1BZL A;  3II4 A;  1NAA A;  2ACZ A;  3HYV A;  3CGC A;  3FIM B;  1GSN A;  4HB9 A;  1CJ2 A;  2X8G A;  2F5Z A;  1E39 A;  2XLS A;  3H8I A;  2JBV A;  1CC4 A;  1KNP A;  1PBD A;  1PDH A;  3AE8 A;  4U8M A;  1CC2 A;  1H82 A;  5BUL A;  1GRH A;  1PJ7 A;  5FMH A;  1PN0 A;  3UKL A;  4BJZ A;  2C72 A;  4Z2U A;  3SFE A;  4BJY A;  3M13 A;  3UOV A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  4AT0 A;  3COX A;  2BS2 A;  3GSI A;  2EQ9 A;  4D04 A;  3NGC X;  3NNE A;  3L1R A;  1NHQ A;  4GR1 A;  2QAE A;  1TDK A;  3AEB A;  2W0H A;  3OZ2 A;  1ZMC A;  4J31 A;  4II2 A;  1D7L A;  5HY5 A;  4IA5 A;  4K22 A;  1BGN A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  3S61 A;  1COY A;  1TDF A;  3EAN A;  3UTF A;  3K7M X;  3PVC A;  3AD7 B;  3ICS A;  4P9S A;  3T2Z A;  4B63 A;  4RG3 A;  4BK1 A;  5CKU A;  5EOW A;  2Y6Q A;  3IHG A;  1PHH A;  4J33 A;  3RNM A;  3ADA B;  3GMC A;  3KD9 A;  1GT8 A;  1JU2 A;  4Z2T A;  2ZBW A;  3JSK A;  2WDQ A;  5HHF A;  1JNZ A;  1H81 A;  1N1P A;  2BAC A;  3LAD A;  2YG5 A;  4U8J A;  4USR A;  5EBK A;  1PXC A;  2GR3 A;  4X4J A;  4CRT A;  1ELI A;  2WPC A;  4YXD A;  2WQY A;  2RGH A;  2JB2 A;  2I0Z A;  3UKK A;  3M12 A;  4G6H A;  4PAB A;  1Q1R A;  4TM0 A;  1GRF A;  4B64 A;  4NEV A;  1KDG A;  3GWD A;  1GXF A;  4EIP A;  4AP3 A;  1JNR A;  2GMH A;  1MXT A;  3AYI A;  3FMW A;  3GDN A;  4IVM B;  3SFD A;  2C76 A;  2BAB A;  4C74 A;  3AE9 A;  1O94 A;  2WU5 A;  3NHO X;  3SGL A;  1NHP A;  3P4P A;  3V3O A;  5KXJ A;  2BXS A; 
#chains in the Genus database with same CATH homology
 2Z5X A;  2X8C A;  3GYX A;  3LOV A;  5EB5 A;  3ATR A;  4DSG A;  5C3J A;  1OJD A;  2WOI A;  4K5R A;  4M52 A;  3SQP A;  1ZDL A;  2IVE A;  1PBB A;  2QCU A;  3AYL A;  2ZZ0 A;  4NTD A;  3UCL A;  2GVC A;  4YWO A;  3VRA A;  1B8S A;  3G5S A;  3O0H A;  3I3L A;  2CVJ A;  2WET A;  3SZW A;  5BVA A;  4G9K A;  3QSS A;  1S2Q A;  3AEF A;  1ZY8 A;  3AE4 A;  4J34 A;  2R4J A;  4H4Q A;  2XVI A;  1LPF A;  4IV9 A;  2DKH A;  4BK3 A;  4FK1 A;  2C3C A;  3SYI A;  3CGD A;  5EB4 A;  3LB8 A;  4BUR A;  3WE0 A;  3VRB A;  4YKG A;  1P2H A;  2GAG B;  3BI5 A;  3DJE A;  3ITJ A;  4A5L A;  4YTN A;  2YLT A;  2BC1 A;  2Q7V A;  3DJJ A;  3CMM A;  3NN0 X;  1UKV G;  3P4Q A;  4XXG A;  2E4G A;  2R46 A;  2YWL A;  5FS6 A;  2GF3 A;  1SEZ A;  1CHU A;  2C7G A;  2B7S A;  3B6D A;  4K8D A;  1PXA A;  4TM1 A;  3AE2 A;  2C65 A;  2H89 A;  4Y4N A;  5FS9 A;  1RYI A;  1BKW A;  3ALJ A;  1XPQ A;  2WES A;  3DJD A;  3CPH G;  1GEU A;  3M0O A;  4A99 A;  4YTP A;  1PBE A;  3LXD A;  2GMJ A;  3KVE A;  4YSZ A;  2YG7 A;  2JAE A;  3GD4 A;  3LZX A;  1TRB A;  1PS9 A;  2YM1 A;  3ATQ A;  4EMW A;  3NK0 X;  2C70 A;  2PHH A;  4UP3 A;  3DME A;  2QA1 A;  3GYI A;  2FJE A;  1K0J A;  1QJD A;  5J60 A;  1CJC A;  3IC9 A;  4ZN0 A;  1Y56 A;  1HYU A;  2V61 A;  3DK4 A;  4B69 A;  5KMS A;  1LTX R;  2EQ7 A;  2AR8 A;  3NK2 X;  4FDC B;  4Z2R A;  2V60 A;  1NEN A;  4I58 A;  1F3P A;  1M64 A;  1BF3 A;  4DGK A;  1VRQ B;  1ZOV A;  3F8D A;  3NT6 A;  4H2P A;  2R0G A;  4Z25 A;  3AEC A;  1XDI A;  1XHC A;  2YLX A;  1D7Y A;  1O5W A;  3AE3 A;  2EQ6 A;  3CPJ G;  3CNT A;  2YG4 A;  5TR3 A;  4J56 A;  4UDQ A;  3KLJ A;  4GAV A;  5KMQ A;  1QLB A;  1EBD A;  3S5W A;  1M6I A;  3GWF A;  3FBS A;  4KX6 A;  4OPL A;  2C67 A;  3RP6 A;  3VRD B;  2R0C A;  1H86 A;  3NYC A;  4JNA A;  1GET A;  2YG6 A;  2A8X A;  3CIR A;  3K30 A;  4B1B A;  2XLT A;  5BRT A;  2BK3 A;  1ZOY A;  4H2Q A;  4ADW A;  2A87 A;  4NZH A;  3SZC A;  4UDP A;  2XLU A;  1KSS A;  4EQW A;  4LA1 A;  1B4V A;  4GCM A;  1YQ3 A;  3UTH A;  1H7X A;  1LQT A;  4GUV A;  4ECH A;  3BNU A;  4TLZ A;  2YAU A;  4FX9 A;  2V5Z A;  4JQ9 A;  2UZZ A;  1CJ4 A;  1TDN A;  1N4V A;  3UKP A;  2BC0 A;  4N9X A;  3NH3 X;  4YKF A;  2PYX A;  3QSE A;  1IUS A;  4X9M A;  3GRS A;  3AED A;  3GMB A;  1Q9I A;  5GSN A;  1E1K A;  3CNJ A;  3UKQ A;  1GND A;  1RSG A;  1PBC A;  3BI2 A;  5KOX A;  2O9Z A;  1YKJ A;  4TM4 A;  3CGB A;  2GEW A;  5U25 A;  4YT0 A;  2BA9 A;  5U63 A;  2VVL A;  2WP6 A;  3QVR A;  2R0P A;  4H4Z A;  3HYX A;  2VZ2 A;  2GR2 A;  3E1T A;  2FJD A;  1YY5 A;  2XLP A;  2XCG A;  3G5R A;  4U8N A;  1ZMD A;  2OLN A;  4JY3 A;  5IPY A;  4A6N B;  1KFY A;  4GAP A;  2FJB A;  3VR9 A;  3P1W A;  4CBQ A;  3EF6 A;  3CNS A;  4WX1 A;  1MO9 A;  1K0L A;  1NHS A;  3ALM A;  4A6N A;  4GF7 A;  4RG4 A;  3QSM A;  1E1M A;  2OAM A;  2YR6 A;  3AWI A;  4H4T A;  4OPG A;  2WHD A;  1E1L A;  3NTA A;  1GRB A;  2E5V A;  2QA2 A;  2OAL A;  4OPC A;  3C4N A;  4U8P A;  1L9D A;  3OC4 A;  1PJ5 A;  3RHA A;  1XAN A;  2CFY A;  3URH A;  3AXB A;  4DNA A;  1E7P A;  1KNR A;  2VQB A;  3K7Q X;  1AOG A;  1GRE A;  1E6E A;  5BUK A;  5KMP A;  2GH5 A;  2XFO A;  4BK2 A;  1O95 A;  4H4P A;  4K2X A;  2Q0L A;  4EM4 A;  3AE1 A;  2AQJ A;  2BK5 A;  1DOC A;  1OJA A;  2YVJ A;  3EAO A;  4C77 A;  1DOD A;  2X99 A;  4D03 A;  1IUV A;  3ALL A;  2XVE A;  1K4Q A;  4FK1 C;  5M0Z A;  4B68 A;  2GRT A;  5JCM A;  5IQ1 A;  1CL0 A;  5KWF A;  1PJ6 A;  4U8K A;  3DK9 A;  3KPF A;  3AEG A;  4XWR A;  2WS3 A;  4EM3 A;  2XVJ A;  3NIX A;  4NNJ A;  4U2T A;  4ZCC A;  3AE7 A;  3IWA A;  4ICY A;  2HQM A;  3P4S A;  1NEK A;  2XFU A;  3ZYX A;  4NTE A;  1W4X A;  4OVI A;  3UP5 A;  1X31 B;  4RSL A;  1GRG A;  2YG3 A;  2XFP A;  2X50 A;  2BYB A;  4JDR A;  4B67 A;  3NLC A;  4A79 A;  3DGH A;  1F6M A;  3UKH A;  4B65 A;  4DSH A;  1TDE A;  4OPU A;  2C3D A;  1F8S A;  3VR8 A;  2IID A;  4IVO B;  3K7T A;  3CNP A;  1GTE A;  2V3A A;  5KRQ A;  1GAL A;  1FCD A;  2ZZC A;  2C73 A;  2BCP A;  3GYJ A;  1S3B A;  3DA1 A;  4EIQ A;  2RAB A;  1B5Q A;  2GQW A;  5KVH A;  2GR1 A;  2XDO A;  1L9E A;  3GDP A;  3IF9 A;  4H4Y A;  3NRN A;  5FS7 A;  4EQS A;  4Z44 A;  2B9W A;  1GES A;  1N4W A;  3BI4 A;  2C4C A;  3NG7 X;  3SZF A;  4YSX A;  3QFB A;  3CND A;  4PAA A;  2BS4 A;  5J7X A;  2VRL A;  1H83 A;  4G74 A;  1ONF A;  4H4W A;  3HYW A;  2J3N A;  1KSU A;  3QJ4 A;  1IJH A;  2BK4 A;  2GAH B;  4BV6 A;  2C66 A;  3SXI A;  2WDV A;  1GOS A;  5KOW A;  1H7W A;  4G6G A;  4XWZ A;  3BHF A;  2WEU A;  3UKA A;  2YLW A;  5L46 A;  2BXR A;  4H4X A;  1DJQ A;  1GER A;  1LJ1 A;  2R45 A;  2H88 A;  4IA6 A;  1MOK A;  5KNL A;  2C75 A;  1ZX9 A;  3P9U A;  2JB1 A;  3SX6 A;  4ZCD A;  4H4R A;  2JKC A;  3DH9 A;  3UOX A;  3R9U A;  4A65 A;  4AOS A;  5JCK A;  1QO8 A;  2WBA A;  1K0I A;  4H2N A;  2WPF A;  1L0V A;  2B9X A;  3ABV A;  4EMJ A;  4JY2 A;  4OCG A;  3NKS A;  3AE5 A;  3Q9T A;  1EL5 A;  3F8R A;  4OPT A;  4NWZ A;  1B37 A;  1IUX A;  4J57 A;  3AE6 A;  5KMR A;  4J36 A;  1JRX A;  4CNK A;  2OA1 A;  1JRZ A;  1RP0 A;  4AP1 A;  5GRT A;  1Y0P A;  2B7R A;  1V59 A;  2XFQ A;  3C4A A;  4H4V A;  5ER0 A;  1EL8 A;  2R9Z A;  1EL9 A;  1P2E A;  3DK8 A;  5HXI A;  5JCI A;  4CNJ A;  1H6V A;  1DNC A;  4H4S A;  3RED A;  1FEA A;  2R4E A;  1FL2 A;  2YLS A;  3C96 A;  4H4U A;  1GPE A;  3NK1 X;  3LJP A;  1F8W A;  2WOW A;  1KF6 A;  1Y56 B;  1ZKQ A;  3F8P A;  4EMI A;  3DGZ A;  4LU6 A;  3L8K A;  3PO7 A;  1NG3 A;  2YM2 A;  4TLX A;  1H84 A;  2XFN A;  3D1C A;  3SZ0 A;  3NYE A;  3UTE A;  3V76 A;  3T2K A;  4EQX A;  4O5Q A;  2VVL G;  1D4C A;  2EQ8 A;  1VG0 A;  4Z24 A;  2Q0K A;  2YLZ A;  3T37 A;  1NG4 A;  3PS9 A;  2VOU A;  2NPX A;  1NHR A;  5M10 A;  1FEB A;  4C3X A;  4TM3 A;  5U1O A;  1D5T A;  3CN8 A;  2GR0 A;  1PBF A;  2VQ7 A;  3CTY A;  4A7A A;  3GRT A;  1DXL A;  2Z5Y A;  1TYT A;  5DBJ A;  2DKI A;  1JRY A;  2OLO A;  2JK6 A;  4II3 A;  1IUT A;  3Q6J A;  4Z43 A;  1Q1W A;  4K7Z A;  1VG9 A;  4JN9 A;  2RGO A;  5LV9 A;  3SM8 A;  3ZDN A;  4K5S A;  4JNQ A;  1NDA A;  2YVG A;  3G5Q A;  3FG2 P;  4I59 A;  4CCR A;  1D4E A;  2WDR A;  3T0K A;  3KPK A;  3H8L A;  3UTG A;  3HZL A;  1IUU A;  2GV8 A;  1YQ4 A;  2JB3 A;  2CUL A;  2V3B A;  3RP7 A;  3AEE A;  3VQR A;  3UKF A;  5HYM A;  4U8L A;  2BRY A;  3B3R A;  5FS8 A;  1TYP A;  2RGJ A;  4E0V A;  3IHM A;  5JCL A;  1L9C A;  5KVI A;  2C64 A;  4NTC A;  1GRA A;  4OPI A;  1FEC A;  2AAQ A;  3CGE A;  3NTD A;  3T14 A;  4H50 A;  1OJC A;  1D4D A;  1F8R A;  4REK A;  1GV4 A;  2YR5 A;  1CBO A;  4AT2 A;  1S2Y A;  1CF3 A;  4GRT A;  2A89 A;  1LQU A;  1S3E A;  4YTM A;  2WPE A;  3UOZ A;  3AEA A;  4USQ A;  1DJN A;  2X3N A;  1DOE A;  1DOB A;  3D8X A;  2CDU A;  2WP5 A;  4Y4M A;  4APN A;  4UDR A;  4GDE A;  4OPD A;  1JOA A;  4H2R A;  5JCN A;  4AOX A;  3AD9 B;  4KPR A;  4X9N A;  4WCT A;  1CC6 A;  5IQ4 A;  4HA6 A;  4GDP A;  4U2S A;  2BS3 A;  3AD8 B;  4G73 A;  1ZK7 A;  1OJT A;  1E1N A;  1GRT A;  3V3N A;  2B76 A;  2Y6R A;  4C3Y A;  3NN6 X;  1PXB A;  1LVL A;  2ARD A;  2BCG G;  2XVH A;  2XVF A;  3AB1 A;  3KU9 A;  3RP8 A;  2YLR A;  2WP9 A;  1VQW A;  2BRA A;  3NYF A;  3P4R A;  4U8I A;  3DJG X;  1BWC A;  4A9W A;  2WU2 A;  2APG A;  4B66 A;  3H4K A;  1YQZ A;  2IVD A;  2XYO A;  1BGJ A;  2WOV A;  1IUW A;  3UP4 A;  2E1M A;  1EL7 A;  1VDC A;  3LZW A;  3SY4 A;  1FOH A;  3CPI G;  2VVM A;  4Y4L A;  1ZP0 A;  3KA7 A;  4NEW A;  4Z26 A;  1JEH A;  5CQF A;  4LII A;  4YSY A;  3KKJ A;  2YR4 A;  3AYJ A;  3ISH A;  2VRM A;  2NVK X;  1REO A;  1NPX A;  1LV0 A;  1GTH A;  3BNM A;  2X8H A;  3T31 A;  3UOY A;  4YSH A;  2FBW A;  2GB0 A;  2ZZB A;  1CJ3 A;  2FJA A;  3QFA A;  4MJW A;  2TMD A;  4H7U A;  4U2L A;  4CCQ A;  5C2T A;  2YVF A;  4CY8 A;  2B9Y A;  4O5U A;  3I6D A;  3BHK A;  2YQU A;  3EPT A;  1TDO A;  3T2Y A;  4C5O A;  3QVP A;  1Z6L A;  4EQR A;  2XLR A;  1N4U A;  1OJ9 A;  3FPZ A;  4J2W A;  3ICR A;  1BZL A;  3II4 A;  1NAA A;  2ACZ A;  3HYV A;  3CGC A;  3FIM B;  1GSN A;  4HB9 A;  1CJ2 A;  2X8G A;  2F5Z A;  1E39 A;  2XLS A;  3H8I A;  2JBV A;  1CC4 A;  1KNP A;  1PBD A;  1PDH A;  3AE8 A;  4U8M A;  1CC2 A;  1H82 A;  5BUL A;  1GRH A;  1PJ7 A;  5FMH A;  1PN0 A;  3UKL A;  4BJZ A;  2C72 A;  4Z2U A;  3SFE A;  4BJY A;  3M13 A;  3UOV A;  4CY6 A;  2GQF A;  3ICT A;  2Q6U A;  4AT0 A;  3COX A;  2BS2 A;  3GSI A;  2EQ9 A;  4D04 A;  3NGC X;  3NNE A;  3L1R A;  1NHQ A;  4GR1 A;  2QAE A;  1TDK A;  3AEB A;  2W0H A;  3OZ2 A;  1ZMC A;  4J31 A;  4II2 A;  1D7L A;  5HY5 A;  4IA5 A;  4K22 A;  1BGN A;  2V6O A;  4U8O A;  3GD3 A;  2TPR A;  3S61 A;  1COY A;  1TDF A;  3EAN A;  3UTF A;  3K7M X;  3PVC A;  3AD7 B;  3ICS A;  4P9S A;  3T2Z A;  4B63 A;  4RG3 A;  4BK1 A;  5CKU A;  5EOW A;  2Y6Q A;  3IHG A;  1PHH A;  4J33 A;  3RNM A;  3ADA B;  3GMC A;  3KD9 A;  1GT8 A;  1JU2 A;  4Z2T A;  2ZBW A;  3JSK A;  2WDQ A;  5HHF A;  1JNZ A;  1H81 A;  1N1P A;  2BAC A;  3LAD A;  2YG5 A;  4U8J A;  4USR A;  5EBK A;  1PXC A;  2GR3 A;  4X4J A;  4CRT A;  1ELI A;  2WPC A;  4YXD A;  2WQY A;  2RGH A;  2JB2 A;  2I0Z A;  3UKK A;  3M12 A;  4G6H A;  4PAB A;  1Q1R A;  4TM0 A;  1GRF A;  4B64 A;  4NEV A;  1KDG A;  3GWD A;  1GXF A;  4EIP A;  4AP3 A;  1JNR A;  2GMH A;  1MXT A;  3AYI A;  3FMW A;  3GDN A;  4IVM B;  3SFD A;  2C76 A;  2BAB A;  4C74 A;  3AE9 A;  1O94 A;  2WU5 A;  3NHO X;  3SGL A;  1NHP A;  3P4P A;  3V3O A;  5KXJ A;  2BXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...