3NK2X

Complex of 6-hydroxy-l-nicotine oxidase with dopamine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 142
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk2X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk2X02
1VRQB 1O94A 4EM4A 2VRLA 3D1CA 3CNDA 4FDCB 4AT0A 4BJZA 4UDQA 1L0VA 1H81A 3CPJG 2XVFA 3C4AA 1CHUA 4A7AA 3GYJA 2I0ZA 2WP5A 4XXGA 5FS6A 3V3NA 5JCLA 1GSNA 1TDEA 2VZ2A 4FK1C 2WESA 2BABA 4J36A 4O5UA 4H4QA 2BA9A 4U2LA 1TDNA 2XFQA 3AE9A 2CDUA 4GR1A 1XPQA 3LB8A 3GWDA 1IUXA 3NLCA 1F8WA 1M6IA 3F8RA 5FS9A 3CNPA 4IV9A 4B64A 3P4PA 1PBDA 4J33A 5C2TA 4K7ZA 4JN9A 1E39A 4MJWA 4U2TA 1NENA 4A9WA 1O5WA 2EQ9A 4TM0A 1RP0A 2Q6UA 4B65A 4YKGA 3AD9B 3RNMA 2BC0A 2WP6A 4EMIA 4JNAA 4K22A 4B1BA 4D04A 1IUTA 1GT8A 1ZMDA 2R0CA 1O95A 1EBDA 2BXRA 4DGKA 1H84A 3GDNA 3ALJA 4KX6A 2C66A 4U8KA 2BK4A 3NKSA 3UOZA 4U8JA 1ZDLA 4K2XA 1E1KA 4YT0A 1D7YA 2XLSA 2BK5A 1PXCA 3K7QX 1H7WA 3NRNA 5EBKA 3UTEA 1JNZA 4H4XA 2RGOA 3DK8A 1GRAA 3UKLA 2OALA 3PS9A 4Z2UA 3H8LA 3H4KA 2YWLA 3DJJA 1H83A 1LV0A 3UP4A 2QAEA 4EQRA 2NVKX 4U8IA 2BYBA 3KU9A 5FS8A 5HYMA 1ZOVA 3AE2A 3QVPA 2E1MA 3UKFA 2GF3A 1B8SA 2R0PA 4IA6A 2XCGA 1KF6A 2WP9A 5FS7A 2VVLG 2GEWA 4PABA 2W0HA 4NTCA 3UKQA 4Y4NA 3NNEA 4EQSA 3QSMA 1X31B 2ZBWA 4YSHA 2WDVA 4TM3A 1ZKQA 2JKCA 4LA1A 2BXSA 2PYXA 3CTYA 4U8PA 1N4WA 1CF3A 1KDGA 3CNTA 1IUVA 1JRYA 1D7LA 2DKHA 4EM3A 1BKWA 1D4DA 2BK3A 3GD3A 2YG6A 2B7RA 4BURA 3SQPA 3FIMB 5HHFA 3UP5A 1DJQA 2H89A 2YLXA 4B68A 1ZY8A 1JNRA 4J31A 4JY3A 1CC4A 4U2SA 3RP8A 5IQ4A 2Z5YA 4CY8A 3EF6A 1K0JA 1Q1WA 2XDOA 5EB5A 3UTFA 3REDA 1E1MA 3BHFA 2BS4A 1KSUA 1PBEA 2B7SA 4M52A 1TDKA 2B9YA 2EQ6A 1E6EA 2WQYA 2YR5A 3FPZA 4H4YA 1DJNA 2V5ZA 3NN0X 5DBJA 1ONFA 2QA2A 1XANA 3AD7B 3AE4A 1GRGA 5KXJA 1IUUA 4JNQA 3GYIA 4APNA 4Y4MA 1UKVG 4O5QA 5ER0A 3Q9TA 3ZYXA 3ABVA 3DGZA 2V60A 3IC9A 2WDRA 2V3BA 1F8SA 1N4VA 3AYJA 1N1PA 1GREA 3VRBA 2XVJA 1Z6LA 3M0OA 4XWZA 1ZK7A 1OJ9A 1GRTA 2AR8A 2X8CA 2C65A 4OPIA 4ZCDA 4AT2A 4NEWA 3KLJA 2XFPA 4FX9A 1GRBA 1NEKA 2WOVA 3ZDNA 4H7UA 1JRZA 2ARDA 5GSNA 2VRMA 3VR9A 3V76A 4Z2TA 1E1NA 1EL8A 1KSSA 4TM4A 1PJ7A 3ALMA 4YTNA 3V3OA 3AECA 2XFNA 5L46A 1GETA 1QO8A 4USQA 4REKA 1L9EA 5U25A 4AOSA 2XFOA 4EQWA 2YLSA 3LZXA 4OPCA 1OJDA 1TDOA 3NK2X 2B76A 3DJEA 4JDRA 1NAAA 1CC2A 3G5SA 1NG4A 1PXBA 1TRBA 2YR6A 5M0ZA 2GQFA 2VQ7A 1DNCA 2XYOA 3II4A 2F5ZA 2XVHA 3K7MX 4IVMB 1ZMCA 1F8RA 2CULA 3LADA 4A5LA 4BK2A 1PHHA 1VG0A 2IIDA 2Q0LA 3FMWA 2E5VA 4Z44A 3ICRA 2RABA 1TYTA 4OPTA 2YG3A 4K8DA 2CVJA 4B66A 4U8OA 4YSYA 2GAGB 3QFBA 4N9XA 4H4ZA 5KOXA 1GRHA 4XWRA 4H4SA 3LOVA 1K0IA 1YY5A 1NHRA 3RP7A 2YLRA 2VOUA 3IHMA 1GV4A 4NTDA 1FOHA 5FMHA 1GERA 1TDFA 1KFYA 3DH9A 4J34A 1Q9IA 2BS2A 2V61A 3AE1A 1D4EA 2RGJA 3M12A 5CQFA 5TR3A 2X8GA 2APGA 2IVEA 2YG5A 3BHKA 5HY5A 3S61A 3H8IA 4H2RA 1PDHA 4OPLA 1MXTA 2ZZBA 3BI4A 2Y6RA 2YVFA 4H2NA 1B4VA 1NPXA 2EQ7A 4H2PA 4DSGA 1H86A 3AYLA 4A6NB 2R45A 1S3BA 3GDPA 4NEVA 2C70A 4GDPA 4B69A 3PVCA 4Z26A 4CBQA 1M64A 3AWIA 4HA6A 2FBWA 2YR4A 3F8PA 2ACZA 1KNPA 2EQ8A 2WOWA 4GF7A 3AB1A 3AE6A 4K5RA 5U1OA 1CC6A 4B63A 4GRTA 5EB4A 1QLBA 5HXIA 3AEBA 3QVRA 2R4JA 3ATQA 1PJ6A 2C64A 2J3NA 1OJCA 1VDCA 4GCMA 5CKUA 1DOBA 5IQ1A 1FCDA 2AAQA 4DNAA 2WEUA 2C3CA 5M10A 2JBVA 2YM2A 3G5RA 4J56A 1GALA 2X8HA 3ATRA 3LXDA 4I59A 2XLRA 2GRTA 2A87A 3D8XA 3S5WA 4CY6A 3R9UA 2X3NA 4WCTA 1PJ5A 3PO7A 1YQZA 1Y0PA 1PBBA 3ITJA 1YQ4A 2V6OA 1GEUA 1JRXA 1AOGA 1B37A 4AP3A 1P2HA 4H4TA 2R46A 3KVEA 3VRAA 2GQWA 5JCNA 1K4QA 4EMWA 3P9UA 4H4VA 3DGHA 4C3XA 3O0HA 5JCIA 2GMHA 3K7TA 3AE7A 1E1LA 3UOYA 2C72A 3CNSA 3KD9A 2YM1A 3SM8A 4YSXA 2XVEA 4H4PA 4C77A 2YG4A 2YVJA 3OC4A 4DSHA 1PS9A 1SEZA 4WX1A 1YQ3A 4FK1A 4YXDA 1EL7A 4UDPA 1OJAA 4YKFA 3VQRA 4NZHA 1Q1RA 2ZZ0A 2TPRA 3GD4A 3UOVA 2OAMA 1H6VA 3JSKA 3NG7X 4UDRA 2Z5XA 3URHA 5C3JA 1GTHA 2GVCA 1DOEA 3P4RA 3ISHA 1DXLA 3DA1A 4TM1A 1N4UA 5GRTA 3UTHA 4OPUA 3IHGA 2XLPA 3AEEA 1FEAA 1L9DA 1NHQA 3NGCX 3NTDA 2NPXA 4JY2A 1OJTA 1CJCA 1RSGA 3GMCA 2UZZA 2BCPA 2XLUA 1ELIA 3DJDA 4C74A 4YSZA 5J7XA 2RGHA 5KRQA 2GR0A 1GTEA 1LQUA 5BVAA 3QFAA 2O9ZA 5LV9A 3EPTA 2VVLA 1GRFA 4ICYA 4BV6A 2YLTA 4U8LA 3CGCA 2WBAA 4NTEA 1P2EA 1ZP0A 2YLZA 3KPFA 2FJDA 3AEFA 3QSEA 3VRDB 4EIPA 3NIXA 1F3PA 3I3LA 2OLNA 4RG3A 1HYUA 3AE3A 2TMDA 4OVIA 3RHAA 1GESA 5KVIA 3SFEA 5KWFA 2JB3A 2CFYA 3GWFA 2E4GA 1NHPA 1W4XA 1LVLA 3NK1X 1NDAA 1Y56A 2WHDA 3NK0X 3BNUA 4AOXA 1MOKA 2GR3A 2JB1A 3Q6JA 2A8XA 1DOCA 2WPCA 2GR1A 5U63A 2Q7VA 3P4SA 3T37A 4ADWA 3M13A 1PBFA 2FJAA 1BF3A 4Y4LA 2Q0KA 3AEGA 3SFDA 4BK3A 1COYA 2YVGA 3AEDA 3CIRA 5J60A 5JCKA 4A99A 2WU2A 1S2QA 3GSIA 4C3YA 4YWOA 3CN8A 3FG2P 4CNJA 4P9SA 1REOA 3KKJA 3OZ2A 1CJ4A 4Z2RA 2WETA 3UTGA 3UOXA 3ICTA 4CNKA 3BI2A 3IF9A 1L9CA 4CCQA 2QCUA 2GH5A 3NTAA 4K5SA 4U8NA 4X9NA 2XLTA 3AYIA 4CCRA 2B9WA 5IPYA 1JU2A 3L8KA 5JCMA 1GNDA 2HQMA 2X99A 3CPIG 3EANA 2H88A 4H50A 1CJ2A 2VVMA 3NH3X 1RYIA 1ZX9A 4J57A 3CPHG 3EAOA 2YAUA 4YTPA 1PXAA 2C67A 4GDEA 1CL0A 2WDQA 3GRSA 1IJHA 3AXBA 3GMBA 3QSSA 4B67A 2OLOA 1JOAA 4BK1A 2JB2A 4EQXA 4HB9A 2GMJA 2R0GA 4AP1A 1V59A 1D5TA 3UKPA 3NN6X 2VQBA 1B5QA 4OPDA 1XDIA 3B3RA 2C3DA 3I6DA 3AE5A 4H4RA 5BUKA 3G5QA 4A6NA 2A89A 1FECA 4YTMA 1IUSA 2GAHB 4C5OA 3C4NA 1D4CA 4EIQA 3ADAB 3F8DA 3P1WA 4TLXA 3C96A 2WPEA 4H2QA 3COXA 4KPRA 4A65A 2OA1A 5KOWA 3NYEA 4CRTA 2YG7A 1CBOA 1XHCA 2JAEA 2C7GA 4RSLA 4X4JA 3AE8A 3DMEA 2BCGG 1DODA 3K30A 1PBCA 4X9MA 4PAAA 4BJYA 1GOSA 1KNRA 3UCLA 3UKKA 1CJ3A 4LIIA 3GRTA 1H7XA 1LJ1A 5BRTA 2FJBA 1TYPA 4ZN0A 5EOWA 4IVOB 1GPEA 3KA7A 1F6MA 1GXFA 4Z24A 4E0VA 1LPFA 1FL2A 1YKJA 1NG3A 4OPGA 1ZOYA 3LZWA 3RP6A 2DKIA 3DK9A 5BULA 2WU5A 1BGJA 2GR2A 2YLWA 3LJPA 3UKHA 2C76A 3NHOX 4I58A 3FBSA 1S2YA 2C73A 1LQTA 2FJEA 2ZZCA 3BNMA 2Y6QA 3SGLA 3UKAA 1K0LA 4LU6A 4UP3A 2YQUA 3B6DA 3DJGX 4ECHA 4J2WA 2V3AA 2WS3A 2WOIA 1MO9A 2XVIA 1QJDA 3NYFA 2BACA 4U8MA 4TLZA 2BS3A 4IA5A 1S3EA 3WE0A 2C75A 3NT6A 1PN0A 3AEAA 1BWCA 3E1TA 1EL9A 3CGDA 3HZLA 3NYCA 2XFUA 2QA1A 1VG9A 1JEHA 2X50A 4GUVA 3L1RA 4Z43A 2GB0A 4USRA 4RG4A 3ALLA 2B9XA 4H4WA 4ZCCA 1LTXR 1BGNA 4A79A 5KVHA 3DK4A 3CNJA 1IUWA 1FEBA 3CGEA 2GV8A 1Y56B 3CGBA 3AD8B 4OCGA 2AQJA 3ICSA 1BZLA 4JQ9A 2JK6A 2IVDA 3BI5A 4D03A 1VQWA 1NHSA 2WPFA 3VR8A 3QJ4A 2BC1A 3IWAA 1E7PA 1EL5A 4EMJA 4H4UA 2PHHA 3P4QA 1H82A 2R9ZA 4Z25A 2R4EA
chains in the Genus database with same CATH superfamily
1VRQB 1O94A 4EM4A 2VRLA 3D1CA 3CNDA 4FDCB 4AT0A 4BJZA 4UDQA 1L0VA 1H81A 3CPJG 2XVFA 3C4AA 1CHUA 4A7AA 3GYJA 2I0ZA 2WP5A 4XXGA 5FS6A 3V3NA 5JCLA 1GSNA 1TDEA 2VZ2A 4FK1C 2WESA 2BABA 4J36A 4O5UA 4H4QA 2BA9A 4U2LA 1TDNA 2XFQA 3AE9A 2CDUA 4GR1A 1XPQA 3LB8A 3GWDA 1IUXA 3NLCA 1F8WA 1M6IA 3F8RA 5FS9A 3CNPA 4IV9A 4B64A 3P4PA 1PBDA 4J33A 5C2TA 4K7ZA 4JN9A 1E39A 4MJWA 4U2TA 3SXIA 1NENA 4A9WA 1O5WA 2EQ9A 4TM0A 1RP0A 2Q6UA 4B65A 4YKGA 3AD9B 3RNMA 2BC0A 2WP6A 4EMIA 4JNAA 4K22A 4B1BA 4D04A 2C4CA 1IUTA 1GT8A 1ZMDA 2R0CA 1O95A 1EBDA 2BXRA 4DGKA 1H84A 3GDNA 3ALJA 4KX6A 2C66A 4U8KA 2BK4A 3NKSA 3UOZA 4U8JA 1ZDLA 4K2XA 1E1KA 4YT0A 1D7YA 2XLSA 2BK5A 1PXCA 3K7QX 1H7WA 3NRNA 5EBKA 3UTEA 1JNZA 4H4XA 4II3A 2RGOA 3DK8A 1GRAA 3UKLA 2OALA 3PS9A 4Z2UA 3H8LA 3H4KA 2YWLA 3DJJA 1H83A 1LV0A 3UP4A 2QAEA 4EQRA 2NVKX 4U8IA 2BYBA 3KU9A 5FS8A 5HYMA 1ZOVA 3AE2A 3QVPA 2E1MA 3UKFA 2GF3A 1B8SA 2R0PA 4IA6A 2XCGA 1KF6A 2WP9A 5FS7A 2VVLG 2GEWA 4PABA 2W0HA 4NTCA 3UKQA 4Y4NA 3NNEA 4EQSA 3QSMA 1X31B 2ZBWA 4YSHA 2WDVA 4TM3A 1ZKQA 2JKCA 4LA1A 2BXSA 2PYXA 3CTYA 4U8PA 1N4WA 1CF3A 1KDGA 3CNTA 1IUVA 3T14A 1JRYA 1D7LA 2DKHA 4EM3A 1BKWA 1D4DA 2BK3A 3GD3A 4G73A 2YG6A 2B7RA 4BURA 3SQPA 3FIMB 5HHFA 3UP5A 1DJQA 2H89A 2YLXA 4B68A 1ZY8A 1JNRA 4J31A 4JY3A 1CC4A 4U2SA 3RP8A 5IQ4A 2Z5YA 4CY8A 3EF6A 1K0JA 1Q1WA 2XDOA 5EB5A 3UTFA 3REDA 1E1MA 3BHFA 2BS4A 1KSUA 1PBEA 2B7SA 4M52A 1TDKA 2B9YA 2EQ6A 1E6EA 2WQYA 2YR5A 3FPZA 4GAVA 4H4YA 1DJNA 2V5ZA 3NN0X 5DBJA 1ONFA 2QA2A 1XANA 3AD7B 3AE4A 1GRGA 5KXJA 3T0KA 1IUUA 4JNQA 3GYIA 4APNA 4Y4MA 1UKVG 4O5QA 5ER0A 3Q9TA 3ZYXA 3ABVA 3DGZA 2V60A 3IC9A 2WDRA 2V3BA 1F8SA 1N4VA 3AYJA 1N1PA 1GREA 3VRBA 2XVJA 1Z6LA 3M0OA 4XWZA 1ZK7A 1OJ9A 3SZCA 1GRTA 2AR8A 2X8CA 2C65A 4OPIA 4ZCDA 4AT2A 4NEWA 3KLJA 2XFPA 4FX9A 1GRBA 1NEKA 2WOVA 3ZDNA 4H7UA 1JRZA 2ARDA 5GSNA 2VRMA 3VR9A 3V76A 4Z2TA 1E1NA 1EL8A 1KSSA 3SX6A 3T2KA 4TM4A 1PJ7A 3ALMA 4YTNA 3V3OA 3AECA 2XFNA 5L46A 1GETA 1QO8A 3HYWA 4USQA 4REKA 1L9EA 5U25A 4AOSA 2XFOA 4EQWA 2YLSA 3LZXA 4OPCA 1OJDA 1TDOA 3HYVA 3NK2X 2B76A 3DJEA 4JDRA 1NAAA 1CC2A 3T2ZA 3G5SA 1NG4A 1PXBA 1TRBA 2YR6A 5M0ZA 2GQFA 2VQ7A 1DNCA 2XYOA 3II4A 2F5ZA 2XVHA 3K7MX 4IVMB 1ZMCA 1F8RA 2CULA 3LADA 4A5LA 3SYIA 1PHHA 4BK2A 1VG0A 2IIDA 2Q0LA 3FMWA 2E5VA 4Z44A 3ICRA 2RABA 1TYTA 4OPTA 2YG3A 4K8DA 2CVJA 4B66A 4U8OA 4YSYA 2GAGB 3QFBA 4N9XA 4H4ZA 5KOXA 4G74A 1GRHA 4XWRA 4H4SA 3LOVA 1K0IA 1YY5A 1NHRA 3RP7A 2YLRA 2VOUA 3IHMA 1GV4A 4NTDA 1FOHA 4G9KA 5FMHA 1GERA 1TDFA 1KFYA 3DH9A 4J34A 1Q9IA 2BS2A 2V61A 3AE1A 1D4EA 2RGJA 3M12A 5CQFA 5TR3A 2X8GA 2APGA 2IVEA 2YG5A 3BHKA 5HY5A 3S61A 3H8IA 4H2RA 1PDHA 4OPLA 1MXTA 2ZZBA 3KPKA 3BI4A 2Y6RA 2YVFA 4H2NA 1B4VA 1NPXA 2EQ7A 4H2PA 4DSGA 1H86A 3AYLA 4A6NB 2R45A 1S3BA 3GDPA 4NEVA 2C70A 5KMRA 4GDPA 4B69A 3PVCA 4Z26A 4CBQA 1M64A 3AWIA 4HA6A 2FBWA 2YR4A 3F8PA 3SY4A 2ACZA 1KNPA 2EQ8A 2WOWA 4GF7A 3AB1A 3AE6A 4K5RA 5U1OA 1CC6A 4B63A 4GRTA 5EB4A 1QLBA 5HXIA 3AEBA 3QVRA 2R4JA 3ATQA 1PJ6A 2C64A 2J3NA 1OJCA 1VDCA 4GCMA 5CKUA 1DOBA 5IQ1A 1FCDA 2AAQA 4DNAA 2WEUA 2C3CA 5M10A 2JBVA 2YM2A 3G5RA 4J56A 1GALA 2X8HA 3ATRA 3LXDA 4I59A 2XLRA 2GRTA 2A87A 5KNLA 3D8XA 3S5WA 4CY6A 3R9UA 2BRYA 4GAPA 2X3NA 4WCTA 1PJ5A 3HYXA 3PO7A 1YQZA 1Y0PA 1PBBA 3ITJA 1YQ4A 2V6OA 1GEUA 1JRXA 1AOGA 1B37A 4AP3A 1P2HA 4H4TA 2R46A 3KVEA 3VRAA 2GQWA 5JCNA 4NWZA 1K4QA 4EMWA 3P9UA 4H4VA 3DGHA 4C3XA 3O0HA 5JCIA 2GMHA 3K7TA 3AE7A 1E1LA 3UOYA 2C72A 3CNSA 3GYXA 3KD9A 2YM1A 3SM8A 4YSXA 2XVEA 4H4PA 4C77A 2YG4A 2YVJA 3OC4A 4DSHA 1PS9A 1SEZA 4WX1A 1YQ3A 4FK1A 4YXDA 1EL7A 4UDPA 1OJAA 4YKFA 3VQRA 4NZHA 1Q1RA 2ZZ0A 2TPRA 3GD4A 3SZ0A 2OAMA 1H6VA 3JSKA 3NG7X 4UDRA 3UOVA 2Z5XA 3URHA 5C3JA 1GTHA 2GVCA 1DOEA 3P4RA 3ISHA 1DXLA 3DA1A 4TM1A 1N4UA 5GRTA 3UTHA 4OPUA 3IHGA 2XLPA 3AEEA 1FEAA 1L9DA 1NHQA 3NGCX 3NTDA 2NPXA 4JY2A 1OJTA 1CJCA 1RSGA 3GMCA 2UZZA 2BCPA 2XLUA 1ELIA 3DJDA 4C74A 4YSZA 5J7XA 2RGHA 5KRQA 2GR0A 1GTEA 1LQUA 5BVAA 3QFAA 2O9ZA 5LV9A 3EPTA 2VVLA 1GRFA 4ICYA 4BV6A 2YLTA 4U8LA 3CGCA 2WBAA 4NTEA 1P2EA 1ZP0A 2YLZA 3KPFA 2FJDA 3AEFA 3QSEA 3T2YA 3VRDB 4EIPA 4II2A 3NIXA 1F3PA 3I3LA 2OLNA 4RG3A 1HYUA 3AE3A 2TMDA 4OVIA 3RHAA 1GESA 5KVIA 3SFEA 5KWFA 2JB3A 2CFYA 3GWFA 2E4GA 1NHPA 1W4XA 1LVLA 3NK1X 1NDAA 1Y56A 2WHDA 3NK0X 3BNUA 4AOXA 1MOKA 2GR3A 2JB1A 3Q6JA 2A8XA 1DOCA 2WPCA 2GR1A 5U63A 2Q7VA 3P4SA 3T37A 4ADWA 3M13A 1PBFA 2FJAA 1BF3A 4Y4LA 2Q0KA 3AEGA 3SFDA 4BK3A 1COYA 2YVGA 3AEDA 3CIRA 5J60A 5JCKA 4A99A 2WU2A 1S2QA 3GSIA 4C3YA 4YWOA 3CN8A 3FG2P 4CNJA 4P9SA 1REOA 3KKJA 3OZ2A 1CJ4A 4Z2RA 2WETA 3UTGA 3UOXA 3ICTA 4CNKA 3BI2A 3IF9A 1L9CA 4CCQA 2QCUA 3SZWA 2GH5A 3NTAA 4K5SA 4U8NA 4NNJA 4X9NA 2XLTA 3AYIA 4CCRA 2B9WA 5IPYA 1JU2A 3L8KA 5JCMA 1GNDA 2HQMA 2X99A 3CPIG 3EANA 2H88A 4H50A 1CJ2A 2VVMA 3NH3X 1RYIA 1ZX9A 4J57A 3CPHG 3EAOA 2YAUA 4YTPA 1PXAA 2C67A 4GDEA 1CL0A 2WDQA 3GRSA 1IJHA 3AXBA 3GMBA 3QSSA 5KMQA 4B67A 2OLOA 1JOAA 4BK1A 2JB2A 4EQXA 4HB9A 2GMJA 2R0GA 4AP1A 1V59A 1D5TA 3UKPA 3NN6X 2VQBA 1B5QA 4OPDA 1XDIA 3B3RA 2C3DA 3I6DA 3AE5A 4H4RA 5BUKA 3G5QA 4A6NA 2A89A 1FECA 4G6HA 4YTMA 1IUSA 2GAHB 4C5OA 3C4NA 1D4CA 4EIQA 3ADAB 3F8DA 3P1WA 4TLXA 3C96A 2WPEA 4H2QA 3COXA 4KPRA 3CMMA 2OA1A 4A65A 3NYEA 5KOWA 4CRTA 2YG7A 1CBOA 1XHCA 2JAEA 2C7GA 4RSLA 4X4JA 3AE8A 3DMEA 2BCGG 1DODA 3K30A 3T31A 1PBCA 4X9MA 4PAAA 4BJYA 1GOSA 1KNRA 3UCLA 3UKKA 1CJ3A 4LIIA 3GRTA 1H7XA 1LJ1A 5BRTA 2FJBA 1TYPA 4ZN0A 5EOWA 4IVOB 1GPEA 3KA7A 1F6MA 1GXFA 4Z24A 4E0VA 1LPFA 1FL2A 1YKJA 1NG3A 4OPGA 1ZOYA 3LZWA 3RP6A 2DKIA 3DK9A 5BULA 2WU5A 1BGJA 2GR2A 2YLWA 3LJPA 3UKHA 2C76A 3NHOX 4I58A 3FBSA 1S2YA 2C73A 1LQTA 2FJEA 2ZZCA 3BNMA 2Y6QA 3SZFA 3SGLA 3UKAA 1K0LA 4LU6A 4UP3A 2YQUA 3B6DA 3DJGX 4ECHA 4J2WA 2V3AA 2WS3A 2WOIA 1MO9A 2XVIA 1QJDA 3NYFA 2BACA 4U8MA 4TLZA 2BS3A 4IA5A 1S3EA 3WE0A 2C75A 3NT6A 1PN0A 3AEAA 1BWCA 3E1TA 1EL9A 3CGDA 3HZLA 3NYCA 4G6GA 2XFUA 2QA1A 1VG9A 1JEHA 2X50A 4GUVA 3L1RA 4Z43A 2GB0A 4USRA 4RG4A 3ALLA 2B9XA 4H4WA 4ZCCA 1LTXR 1BGNA 4A79A 5KMSA 5KVHA 3DK4A 3CNJA 1IUWA 1FEBA 3CGEA 2GV8A 1Y56B 3CGBA 3AD8B 4OCGA 5KMPA 2AQJA 3ICSA 1BZLA 4JQ9A 2JK6A 2IVDA 3BI5A 4D03A 1VQWA 1NHSA 2WPFA 3VR8A 3QJ4A 2BC1A 3IWAA 1E7PA 1EL5A 2BRAA 4EMJA 4H4UA 2PHHA 3P4QA 1H82A 2R9ZA 4Z25A 2R4EA
chains in the Genus database with same CATH topology
1VRQB 1O94A 4EM4A 2VRLA 3D1CA 3CNDA 4FDCB 4AT0A 4BJZA 4UDQA 1L0VA 1H81A 3CPJG 2XVFA 3C4AA 1CHUA 4A7AA 3GYJA 2I0ZA 2WP5A 4XXGA 5FS6A 3V3NA 5JCLA 1GSNA 1TDEA 2VZ2A 4FK1C 2WESA 2BABA 4J36A 4O5UA 4H4QA 2BA9A 4U2LA 1TDNA 2XFQA 3AE9A 2CDUA 4GR1A 1XPQA 3LB8A 3GWDA 1IUXA 3NLCA 1F8WA 1M6IA 3F8RA 5FS9A 3CNPA 4IV9A 4B64A 3P4PA 1PBDA 4J33A 5C2TA 4K7ZA 4JN9A 1E39A 4MJWA 4U2TA 3SXIA 1NENA 4A9WA 1O5WA 2EQ9A 4TM0A 1RP0A 2Q6UA 4B65A 4YKGA 3AD9B 3RNMA 2BC0A 2WP6A 4EMIA 4JNAA 4K22A 4B1BA 4D04A 2C4CA 1IUTA 1GT8A 1ZMDA 2R0CA 1O95A 1EBDA 2BXRA 4DGKA 1H84A 3GDNA 3ALJA 4KX6A 2C66A 4U8KA 2BK4A 3NKSA 3UOZA 4U8JA 1ZDLA 4K2XA 1E1KA 4YT0A 1D7YA 2XLSA 2BK5A 1PXCA 3K7QX 1H7WA 3NRNA 5EBKA 3UTEA 1JNZA 4H4XA 4II3A 2RGOA 3DK8A 1GRAA 3UKLA 2OALA 3PS9A 4Z2UA 3H8LA 3H4KA 2YWLA 3DJJA 1H83A 1LV0A 3UP4A 2QAEA 4EQRA 2NVKX 4U8IA 2BYBA 3KU9A 5FS8A 5HYMA 1ZOVA 3AE2A 3QVPA 2E1MA 3UKFA 2GF3A 1B8SA 2R0PA 4IA6A 2XCGA 1KF6A 2WP9A 5FS7A 2VVLG 2GEWA 4PABA 2W0HA 4NTCA 3UKQA 4Y4NA 3NNEA 4EQSA 3QSMA 1X31B 2ZBWA 4YSHA 2WDVA 4TM3A 1ZKQA 2JKCA 4LA1A 2BXSA 2PYXA 3CTYA 4U8PA 1N4WA 1CF3A 1KDGA 3CNTA 1IUVA 3T14A 1JRYA 1D7LA 2DKHA 4EM3A 1BKWA 1D4DA 2BK3A 3GD3A 4G73A 2YG6A 2B7RA 4BURA 3SQPA 3FIMB 5HHFA 3UP5A 1DJQA 2H89A 2YLXA 4B68A 1ZY8A 1JNRA 4J31A 4JY3A 1CC4A 4U2SA 3RP8A 5IQ4A 2Z5YA 4CY8A 3EF6A 1K0JA 1Q1WA 2XDOA 5EB5A 3UTFA 3REDA 1E1MA 3BHFA 2BS4A 1KSUA 1PBEA 2B7SA 4M52A 1TDKA 2B9YA 2EQ6A 1E6EA 2WQYA 2YR5A 3FPZA 4GAVA 4H4YA 1DJNA 2V5ZA 3NN0X 5DBJA 1ONFA 2QA2A 1XANA 3AD7B 3AE4A 1GRGA 5KXJA 3T0KA 1IUUA 4JNQA 3GYIA 4APNA 4Y4MA 1UKVG 4O5QA 5ER0A 3Q9TA 3ZYXA 3ABVA 3DGZA 2V60A 3IC9A 2WDRA 2V3BA 1F8SA 1N4VA 3AYJA 1N1PA 1GREA 3VRBA 2XVJA 1Z6LA 3M0OA 4XWZA 1ZK7A 1OJ9A 3SZCA 1GRTA 2AR8A 2X8CA 2C65A 4OPIA 4ZCDA 4AT2A 4NEWA 3KLJA 2XFPA 4FX9A 1GRBA 1NEKA 2WOVA 3ZDNA 4H7UA 1JRZA 2ARDA 5GSNA 2VRMA 3VR9A 3V76A 4Z2TA 1E1NA 1EL8A 1KSSA 3SX6A 3T2KA 4TM4A 1PJ7A 3ALMA 4YTNA 3V3OA 3AECA 2XFNA 5L46A 1GETA 1QO8A 3HYWA 4USQA 4REKA 1L9EA 5U25A 4AOSA 2XFOA 4EQWA 2YLSA 3LZXA 4OPCA 1OJDA 1TDOA 3HYVA 3NK2X 2B76A 3DJEA 4JDRA 1NAAA 1CC2A 3T2ZA 3G5SA 1NG4A 1PXBA 1TRBA 2YR6A 5M0ZA 2GQFA 2VQ7A 1DNCA 2XYOA 3II4A 2F5ZA 2XVHA 3K7MX 4IVMB 1ZMCA 1F8RA 2CULA 3LADA 4A5LA 3SYIA 1PHHA 4BK2A 1VG0A 2IIDA 2Q0LA 3FMWA 2E5VA 4Z44A 3ICRA 2RABA 1TYTA 4OPTA 2YG3A 4K8DA 2CVJA 4B66A 4U8OA 4YSYA 2GAGB 3QFBA 4N9XA 4H4ZA 5KOXA 4G74A 1GRHA 4XWRA 4H4SA 3LOVA 1K0IA 1YY5A 1NHRA 3RP7A 2YLRA 2VOUA 3IHMA 1GV4A 4NTDA 1FOHA 4G9KA 5FMHA 1GERA 1TDFA 1KFYA 3DH9A 4J34A 1Q9IA 2BS2A 2V61A 3AE1A 1D4EA 2RGJA 3M12A 5CQFA 5TR3A 2X8GA 2APGA 2IVEA 2YG5A 3BHKA 5HY5A 3S61A 3H8IA 4H2RA 1PDHA 4OPLA 1MXTA 2ZZBA 3KPKA 3BI4A 2Y6RA 2YVFA 4H2NA 1B4VA 1NPXA 2EQ7A 4H2PA 4DSGA 1H86A 3AYLA 4A6NB 2R45A 1S3BA 3GDPA 4NEVA 2C70A 5KMRA 4GDPA 4B69A 3PVCA 4Z26A 4CBQA 1M64A 3AWIA 4HA6A 2FBWA 2YR4A 3F8PA 3SY4A 2ACZA 1KNPA 2EQ8A 2WOWA 4GF7A 3AB1A 3AE6A 4K5RA 5U1OA 1CC6A 4B63A 4GRTA 5EB4A 1QLBA 5HXIA 3AEBA 3QVRA 2R4JA 3ATQA 1PJ6A 2C64A 2J3NA 1OJCA 1VDCA 4GCMA 5CKUA 1DOBA 5IQ1A 1FCDA 2AAQA 4DNAA 2WEUA 2C3CA 5M10A 2JBVA 2YM2A 3G5RA 4J56A 1GALA 2X8HA 3ATRA 3LXDA 4I59A 2XLRA 2GRTA 2A87A 5KNLA 3D8XA 3S5WA 4CY6A 3R9UA 2BRYA 4GAPA 2X3NA 4WCTA 1PJ5A 3HYXA 3PO7A 1YQZA 1Y0PA 1PBBA 3ITJA 1YQ4A 2V6OA 1GEUA 1JRXA 1AOGA 1B37A 4AP3A 1P2HA 4H4TA 2R46A 3KVEA 3VRAA 2GQWA 5JCNA 4NWZA 1K4QA 4EMWA 3P9UA 4H4VA 3DGHA 4C3XA 3O0HA 5JCIA 2GMHA 3K7TA 3AE7A 1E1LA 3UOYA 2C72A 3CNSA 3GYXA 3KD9A 2YM1A 3SM8A 4YSXA 2XVEA 4H4PA 4C77A 2YG4A 2YVJA 3OC4A 4DSHA 1PS9A 1SEZA 4WX1A 1YQ3A 4FK1A 4YXDA 1EL7A 4UDPA 1OJAA 4YKFA 3VQRA 4NZHA 1Q1RA 2ZZ0A 2TPRA 3GD4A 3SZ0A 2OAMA 1H6VA 3JSKA 3NG7X 4UDRA 3UOVA 2Z5XA 3URHA 5C3JA 1GTHA 2GVCA 1DOEA 3P4RA 3ISHA 1DXLA 3DA1A 4TM1A 1N4UA 5GRTA 3UTHA 4OPUA 3IHGA 2XLPA 3AEEA 1FEAA 1L9DA 1NHQA 3NGCX 3NTDA 2NPXA 4JY2A 1OJTA 1CJCA 1RSGA 3GMCA 2UZZA 2BCPA 2XLUA 1ELIA 3DJDA 4C74A 4YSZA 5J7XA 2RGHA 5KRQA 2GR0A 1GTEA 1LQUA 5BVAA 3QFAA 2O9ZA 5LV9A 3EPTA 2VVLA 1GRFA 4ICYA 4BV6A 2YLTA 4U8LA 3CGCA 2WBAA 4NTEA 1P2EA 1ZP0A 2YLZA 3KPFA 2FJDA 3AEFA 3QSEA 3T2YA 3VRDB 4EIPA 4II2A 3NIXA 1F3PA 3I3LA 2OLNA 4RG3A 1HYUA 3AE3A 2TMDA 4OVIA 3RHAA 1GESA 5KVIA 3SFEA 5KWFA 2JB3A 2CFYA 3GWFA 2E4GA 1NHPA 1W4XA 1LVLA 3NK1X 1NDAA 1Y56A 2WHDA 3NK0X 3BNUA 4AOXA 1MOKA 2GR3A 2JB1A 3Q6JA 2A8XA 1DOCA 2WPCA 2GR1A 5U63A 2Q7VA 3P4SA 3T37A 4ADWA 3M13A 1PBFA 2FJAA 1BF3A 4Y4LA 2Q0KA 3AEGA 3SFDA 4BK3A 1COYA 2YVGA 3AEDA 3CIRA 5J60A 5JCKA 4A99A 2WU2A 1S2QA 3GSIA 4C3YA 4YWOA 3CN8A 3FG2P 4CNJA 4P9SA 1REOA 3KKJA 3OZ2A 1CJ4A 4Z2RA 2WETA 3UTGA 3UOXA 3ICTA 4CNKA 3BI2A 3IF9A 1L9CA 4CCQA 2QCUA 3SZWA 2GH5A 3NTAA 4K5SA 4U8NA 4NNJA 4X9NA 2XLTA 3AYIA 4CCRA 2B9WA 5IPYA 1JU2A 3L8KA 5JCMA 1GNDA 2HQMA 2X99A 3CPIG 3EANA 2H88A 4H50A 1CJ2A 2VVMA 3NH3X 1RYIA 1ZX9A 4J57A 3CPHG 3EAOA 2YAUA 4YTPA 1PXAA 2C67A 4GDEA 1CL0A 2WDQA 3GRSA 1IJHA 3AXBA 3GMBA 3QSSA 5KMQA 4B67A 2OLOA 1JOAA 4BK1A 2JB2A 4EQXA 4HB9A 2GMJA 2R0GA 4AP1A 1V59A 1D5TA 3UKPA 3NN6X 2VQBA 1B5QA 4OPDA 1XDIA 3B3RA 2C3DA 3I6DA 3AE5A 4H4RA 5BUKA 3G5QA 4A6NA 2A89A 1FECA 4G6HA 4YTMA 1IUSA 2GAHB 4C5OA 3C4NA 1D4CA 4EIQA 3ADAB 3F8DA 3P1WA 4TLXA 3C96A 2WPEA 4H2QA 3COXA 4KPRA 3CMMA 2OA1A 4A65A 3NYEA 5KOWA 4CRTA 2YG7A 1CBOA 1XHCA 2JAEA 2C7GA 4RSLA 4X4JA 3AE8A 3DMEA 2BCGG 1DODA 3K30A 3T31A 1PBCA 4X9MA 4PAAA 4BJYA 1GOSA 1KNRA 3UCLA 3UKKA 1CJ3A 4LIIA 3GRTA 1H7XA 1LJ1A 5BRTA 2FJBA 1TYPA 4ZN0A 5EOWA 4IVOB 1GPEA 3KA7A 1F6MA 1GXFA 4Z24A 4E0VA 1LPFA 1FL2A 1YKJA 1NG3A 4OPGA 1ZOYA 3LZWA 3RP6A 2DKIA 3DK9A 5BULA 2WU5A 1BGJA 2GR2A 2YLWA 3LJPA 3UKHA 2C76A 3NHOX 4I58A 3FBSA 1S2YA 2C73A 1LQTA 2FJEA 2ZZCA 3BNMA 2Y6QA 3SZFA 3SGLA 3UKAA 1K0LA 4LU6A 4UP3A 2YQUA 3B6DA 3DJGX 4ECHA 4J2WA 2V3AA 2WS3A 2WOIA 1MO9A 2XVIA 1QJDA 3NYFA 2BACA 4U8MA 4TLZA 2BS3A 4IA5A 1S3EA 3WE0A 2C75A 3NT6A 1PN0A 3AEAA 1BWCA 3E1TA 1EL9A 3CGDA 3HZLA 3NYCA 4G6GA 2XFUA 2QA1A 1VG9A 1JEHA 2X50A 4GUVA 3L1RA 4Z43A 2GB0A 4USRA 4RG4A 3ALLA 2B9XA 4H4WA 4ZCCA 1LTXR 1BGNA 4A79A 5KMSA 5KVHA 3DK4A 3CNJA 1IUWA 1FEBA 3CGEA 2GV8A 1Y56B 3CGBA 3AD8B 4OCGA 5KMPA 2AQJA 3ICSA 1BZLA 4JQ9A 2JK6A 2IVDA 3BI5A 4D03A 1VQWA 1NHSA 2WPFA 3VR8A 3QJ4A 2BC1A 3IWAA 1E7PA 1EL5A 2BRAA 4EMJA 4H4UA 2PHHA 3P4QA 1H82A 2R9ZA 4Z25A 2R4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VRQ B;  1O94 A;  4EM4 A;  2VRL A;  3D1C A;  3CND A;  4FDC B;  4AT0 A;  4BJZ A;  4UDQ A;  1L0V A;  1H81 A;  3CPJ G;  2XVF A;  3C4A A;  1CHU A;  4A7A A;  3GYJ A;  2I0Z A;  2WP5 A;  4XXG A;  5FS6 A;  3V3N A;  5JCL A;  1GSN A;  1TDE A;  2VZ2 A;  4FK1 C;  2WES A;  2BAB A;  4J36 A;  4O5U A;  4H4Q A;  2BA9 A;  4U2L A;  1TDN A;  2XFQ A;  3AE9 A;  2CDU A;  4GR1 A;  1XPQ A;  3LB8 A;  3GWD A;  1IUX A;  3NLC A;  1F8W A;  1M6I A;  3F8R A;  5FS9 A;  3CNP A;  4IV9 A;  4B64 A;  3P4P A;  1PBD A;  4J33 A;  5C2T A;  4K7Z A;  4JN9 A;  1E39 A;  4MJW A;  4U2T A;  1NEN A;  4A9W A;  1O5W A;  2EQ9 A;  4TM0 A;  1RP0 A;  2Q6U A;  4B65 A;  4YKG A;  3AD9 B;  3RNM A;  2BC0 A;  2WP6 A;  4EMI A;  4JNA A;  4K22 A;  4B1B A;  4D04 A;  1IUT A;  1GT8 A;  1ZMD A;  2R0C A;  1O95 A;  1EBD A;  2BXR A;  4DGK A;  1H84 A;  3GDN A;  3ALJ A;  4KX6 A;  2C66 A;  4U8K A;  2BK4 A;  3NKS A;  3UOZ A;  4U8J A;  1ZDL A;  4K2X A;  1E1K A;  4YT0 A;  1D7Y A;  2XLS A;  2BK5 A;  1PXC A;  3K7Q X;  1H7W A;  3NRN A;  5EBK A;  3UTE A;  1JNZ A;  4H4X A;  2RGO A;  3DK8 A;  1GRA A;  3UKL A;  2OAL A;  3PS9 A;  4Z2U A;  3H8L A;  3H4K A;  2YWL A;  3DJJ A;  1H83 A;  1LV0 A;  3UP4 A;  2QAE A;  4EQR A;  2NVK X;  4U8I A;  2BYB A;  3KU9 A;  5FS8 A;  5HYM A;  1ZOV A;  3AE2 A;  3QVP A;  2E1M A;  3UKF A;  2GF3 A;  1B8S A;  2R0P A;  4IA6 A;  2XCG A;  1KF6 A;  2WP9 A;  5FS7 A;  2VVL G;  2GEW A;  4PAB A;  2W0H A;  4NTC A;  3UKQ A;  4Y4N A;  3NNE A;  4EQS A;  3QSM A;  1X31 B;  2ZBW A;  4YSH A;  2WDV A;  4TM3 A;  1ZKQ A;  2JKC A;  4LA1 A;  2BXS A;  2PYX A;  3CTY A;  4U8P A;  1N4W A;  1CF3 A;  1KDG A;  3CNT A;  1IUV A;  1JRY A;  1D7L A;  2DKH A;  4EM3 A;  1BKW A;  1D4D A;  2BK3 A;  3GD3 A;  2YG6 A;  2B7R A;  4BUR A;  3SQP A;  3FIM B;  5HHF A;  3UP5 A;  1DJQ A;  2H89 A;  2YLX A;  4B68 A;  1ZY8 A;  1JNR A;  4J31 A;  4JY3 A;  1CC4 A;  4U2S A;  3RP8 A;  5IQ4 A;  2Z5Y A;  4CY8 A;  3EF6 A;  1K0J A;  1Q1W A;  2XDO A;  5EB5 A;  3UTF A;  3RED A;  1E1M A;  3BHF A;  2BS4 A;  1KSU A;  1PBE A;  2B7S A;  4M52 A;  1TDK A;  2B9Y A;  2EQ6 A;  1E6E A;  2WQY A;  2YR5 A;  3FPZ A;  4H4Y A;  1DJN A;  2V5Z A;  3NN0 X;  5DBJ A;  1ONF A;  2QA2 A;  1XAN A;  3AD7 B;  3AE4 A;  1GRG A;  5KXJ A;  1IUU A;  4JNQ A;  3GYI A;  4APN A;  4Y4M A;  1UKV G;  4O5Q A;  5ER0 A;  3Q9T A;  3ZYX A;  3ABV A;  3DGZ A;  2V60 A;  3IC9 A;  2WDR A;  2V3B A;  1F8S A;  1N4V A;  3AYJ A;  1N1P A;  1GRE A;  3VRB A;  2XVJ A;  1Z6L A;  3M0O A;  4XWZ A;  1ZK7 A;  1OJ9 A;  1GRT A;  2AR8 A;  2X8C A;  2C65 A;  4OPI A;  4ZCD A;  4AT2 A;  4NEW A;  3KLJ A;  2XFP A;  4FX9 A;  1GRB A;  1NEK A;  2WOV A;  3ZDN A;  4H7U A;  1JRZ A;  2ARD A;  5GSN A;  2VRM A;  3VR9 A;  3V76 A;  4Z2T A;  1E1N A;  1EL8 A;  1KSS A;  4TM4 A;  1PJ7 A;  3ALM A;  4YTN A;  3V3O A;  3AEC A;  2XFN A;  5L46 A;  1GET A;  1QO8 A;  4USQ A;  4REK A;  1L9E A;  5U25 A;  4AOS A;  2XFO A;  4EQW A;  2YLS A;  3LZX A;  4OPC A;  1OJD A;  1TDO A;  3NK2 X;  2B76 A;  3DJE A;  4JDR A;  1NAA A;  1CC2 A;  3G5S A;  1NG4 A;  1PXB A;  1TRB A;  2YR6 A;  5M0Z A;  2GQF A;  2VQ7 A;  1DNC A;  2XYO A;  3II4 A;  2F5Z A;  2XVH A;  3K7M X;  4IVM B;  1ZMC A;  1F8R A;  2CUL A;  3LAD A;  4A5L A;  4BK2 A;  1PHH A;  1VG0 A;  2IID A;  2Q0L A;  3FMW A;  2E5V A;  4Z44 A;  3ICR A;  2RAB A;  1TYT A;  4OPT A;  2YG3 A;  4K8D A;  2CVJ A;  4B66 A;  4U8O A;  4YSY A;  2GAG B;  3QFB A;  4N9X A;  4H4Z A;  5KOX A;  1GRH A;  4XWR A;  4H4S A;  3LOV A;  1K0I A;  1YY5 A;  1NHR A;  3RP7 A;  2YLR A;  2VOU A;  3IHM A;  1GV4 A;  4NTD A;  1FOH A;  5FMH A;  1GER A;  1TDF A;  1KFY A;  3DH9 A;  4J34 A;  1Q9I A;  2BS2 A;  2V61 A;  3AE1 A;  1D4E A;  2RGJ A;  3M12 A;  5CQF A;  5TR3 A;  2X8G A;  2APG A;  2IVE A;  2YG5 A;  3BHK A;  5HY5 A;  3S61 A;  3H8I A;  4H2R A;  1PDH A;  4OPL A;  1MXT A;  2ZZB A;  3BI4 A;  2Y6R A;  2YVF A;  4H2N A;  1B4V A;  1NPX A;  2EQ7 A;  4H2P A;  4DSG A;  1H86 A;  3AYL A;  4A6N B;  2R45 A;  1S3B A;  3GDP A;  4NEV A;  2C70 A;  4GDP A;  4B69 A;  3PVC A;  4Z26 A;  4CBQ A;  1M64 A;  3AWI A;  4HA6 A;  2FBW A;  2YR4 A;  3F8P A;  2ACZ A;  1KNP A;  2EQ8 A;  2WOW A;  4GF7 A;  3AB1 A;  3AE6 A;  4K5R A;  5U1O A;  1CC6 A;  4B63 A;  4GRT A;  5EB4 A;  1QLB A;  5HXI A;  3AEB A;  3QVR A;  2R4J A;  3ATQ A;  1PJ6 A;  2C64 A;  2J3N A;  1OJC A;  1VDC A;  4GCM A;  5CKU A;  1DOB A;  5IQ1 A;  1FCD A;  2AAQ A;  4DNA A;  2WEU A;  2C3C A;  5M10 A;  2JBV A;  2YM2 A;  3G5R A;  4J56 A;  1GAL A;  2X8H A;  3ATR A;  3LXD A;  4I59 A;  2XLR A;  2GRT A;  2A87 A;  3D8X A;  3S5W A;  4CY6 A;  3R9U A;  2X3N A;  4WCT A;  1PJ5 A;  3PO7 A;  1YQZ A;  1Y0P A;  1PBB A;  3ITJ A;  1YQ4 A;  2V6O A;  1GEU A;  1JRX A;  1AOG A;  1B37 A;  4AP3 A;  1P2H A;  4H4T A;  2R46 A;  3KVE A;  3VRA A;  2GQW A;  5JCN A;  1K4Q A;  4EMW A;  3P9U A;  4H4V A;  3DGH A;  4C3X A;  3O0H A;  5JCI A;  2GMH A;  3K7T A;  3AE7 A;  1E1L A;  3UOY A;  2C72 A;  3CNS A;  3KD9 A;  2YM1 A;  3SM8 A;  4YSX A;  2XVE A;  4H4P A;  4C77 A;  2YG4 A;  2YVJ A;  3OC4 A;  4DSH A;  1PS9 A;  1SEZ A;  4WX1 A;  1YQ3 A;  4FK1 A;  4YXD A;  1EL7 A;  4UDP A;  1OJA A;  4YKF A;  3VQR A;  4NZH A;  1Q1R A;  2ZZ0 A;  2TPR A;  3GD4 A;  3UOV A;  2OAM A;  1H6V A;  3JSK A;  3NG7 X;  4UDR A;  2Z5X A;  3URH A;  5C3J A;  1GTH A;  2GVC A;  1DOE A;  3P4R A;  3ISH A;  1DXL A;  3DA1 A;  4TM1 A;  1N4U A;  5GRT A;  3UTH A;  4OPU A;  3IHG A;  2XLP A;  3AEE A;  1FEA A;  1L9D A;  1NHQ A;  3NGC X;  3NTD A;  2NPX A;  4JY2 A;  1OJT A;  1CJC A;  1RSG A;  3GMC A;  2UZZ A;  2BCP A;  2XLU A;  1ELI A;  3DJD A;  4C74 A;  4YSZ A;  5J7X A;  2RGH A;  5KRQ A;  2GR0 A;  1GTE A;  1LQU A;  5BVA A;  3QFA A;  2O9Z A;  5LV9 A;  3EPT A;  2VVL A;  1GRF A;  4ICY A;  4BV6 A;  2YLT A;  4U8L A;  3CGC A;  2WBA A;  4NTE A;  1P2E A;  1ZP0 A;  2YLZ A;  3KPF A;  2FJD A;  3AEF A;  3QSE A;  3VRD B;  4EIP A;  3NIX A;  1F3P A;  3I3L A;  2OLN A;  4RG3 A;  1HYU A;  3AE3 A;  2TMD A;  4OVI A;  3RHA A;  1GES A;  5KVI A;  3SFE A;  5KWF A;  2JB3 A;  2CFY A;  3GWF A;  2E4G A;  1NHP A;  1W4X A;  1LVL A;  3NK1 X;  1NDA A;  1Y56 A;  2WHD A;  3NK0 X;  3BNU A;  4AOX A;  1MOK A;  2GR3 A;  2JB1 A;  3Q6J A;  2A8X A;  1DOC A;  2WPC A;  2GR1 A;  5U63 A;  2Q7V A;  3P4S A;  3T37 A;  4ADW A;  3M13 A;  1PBF A;  2FJA A;  1BF3 A;  4Y4L A;  2Q0K A;  3AEG A;  3SFD A;  4BK3 A;  1COY A;  2YVG A;  3AED A;  3CIR A;  5J60 A;  5JCK A;  4A99 A;  2WU2 A;  1S2Q A;  3GSI A;  4C3Y A;  4YWO A;  3CN8 A;  3FG2 P;  4CNJ A;  4P9S A;  1REO A;  3KKJ A;  3OZ2 A;  1CJ4 A;  4Z2R A;  2WET A;  3UTG A;  3UOX A;  3ICT A;  4CNK A;  3BI2 A;  3IF9 A;  1L9C A;  4CCQ A;  2QCU A;  2GH5 A;  3NTA A;  4K5S A;  4U8N A;  4X9N A;  2XLT A;  3AYI A;  4CCR A;  2B9W A;  5IPY A;  1JU2 A;  3L8K A;  5JCM A;  1GND A;  2HQM A;  2X99 A;  3CPI G;  3EAN A;  2H88 A;  4H50 A;  1CJ2 A;  2VVM A;  3NH3 X;  1RYI A;  1ZX9 A;  4J57 A;  3CPH G;  3EAO A;  2YAU A;  4YTP A;  1PXA A;  2C67 A;  4GDE A;  1CL0 A;  2WDQ A;  3GRS A;  1IJH A;  3AXB A;  3GMB A;  3QSS A;  4B67 A;  2OLO A;  1JOA A;  4BK1 A;  2JB2 A;  4EQX A;  4HB9 A;  2GMJ A;  2R0G A;  4AP1 A;  1V59 A;  1D5T A;  3UKP A;  3NN6 X;  2VQB A;  1B5Q A;  4OPD A;  1XDI A;  3B3R A;  2C3D A;  3I6D A;  3AE5 A;  4H4R A;  5BUK A;  3G5Q A;  4A6N A;  2A89 A;  1FEC A;  4YTM A;  1IUS A;  2GAH B;  4C5O A;  3C4N A;  1D4C A;  4EIQ A;  3ADA B;  3F8D A;  3P1W A;  4TLX A;  3C96 A;  2WPE A;  4H2Q A;  3COX A;  4KPR A;  4A65 A;  2OA1 A;  5KOW A;  3NYE A;  4CRT A;  2YG7 A;  1CBO A;  1XHC A;  2JAE A;  2C7G A;  4RSL A;  4X4J A;  3AE8 A;  3DME A;  2BCG G;  1DOD A;  3K30 A;  1PBC A;  4X9M A;  4PAA A;  4BJY A;  1GOS A;  1KNR A;  3UCL A;  3UKK A;  1CJ3 A;  4LII A;  3GRT A;  1H7X A;  1LJ1 A;  5BRT A;  2FJB A;  1TYP A;  4ZN0 A;  5EOW A;  4IVO B;  1GPE A;  3KA7 A;  1F6M A;  1GXF A;  4Z24 A;  4E0V A;  1LPF A;  1FL2 A;  1YKJ A;  1NG3 A;  4OPG A;  1ZOY A;  3LZW A;  3RP6 A;  2DKI A;  3DK9 A;  5BUL A;  2WU5 A;  1BGJ A;  2GR2 A;  2YLW A;  3LJP A;  3UKH A;  2C76 A;  3NHO X;  4I58 A;  3FBS A;  1S2Y A;  2C73 A;  1LQT A;  2FJE A;  2ZZC A;  3BNM A;  2Y6Q A;  3SGL A;  3UKA A;  1K0L A;  4LU6 A;  4UP3 A;  2YQU A;  3B6D A;  3DJG X;  4ECH A;  4J2W A;  2V3A A;  2WS3 A;  2WOI A;  1MO9 A;  2XVI A;  1QJD A;  3NYF A;  2BAC A;  4U8M A;  4TLZ A;  2BS3 A;  4IA5 A;  1S3E A;  3WE0 A;  2C75 A;  3NT6 A;  1PN0 A;  3AEA A;  1BWC A;  3E1T A;  1EL9 A;  3CGD A;  3HZL A;  3NYC A;  2XFU A;  2QA1 A;  1VG9 A;  1JEH A;  2X50 A;  4GUV A;  3L1R A;  4Z43 A;  2GB0 A;  4USR A;  4RG4 A;  3ALL A;  2B9X A;  4H4W A;  4ZCC A;  1LTX R;  1BGN A;  4A79 A;  5KVH A;  3DK4 A;  3CNJ A;  1IUW A;  1FEB A;  3CGE A;  2GV8 A;  1Y56 B;  3CGB A;  3AD8 B;  4OCG A;  2AQJ A;  3ICS A;  1BZL A;  4JQ9 A;  2JK6 A;  2IVD A;  3BI5 A;  4D03 A;  1VQW A;  1NHS A;  2WPF A;  3VR8 A;  3QJ4 A;  2BC1 A;  3IWA A;  1E7P A;  1EL5 A;  4EMJ A;  4H4U A;  2PHH A;  3P4Q A;  1H82 A;  2R9Z A;  4Z25 A;  2R4E A; 
#chains in the Genus database with same CATH topology
 1VRQ B;  1O94 A;  4EM4 A;  2VRL A;  3D1C A;  3CND A;  4FDC B;  4AT0 A;  4BJZ A;  4UDQ A;  1L0V A;  1H81 A;  3CPJ G;  2XVF A;  3C4A A;  1CHU A;  4A7A A;  3GYJ A;  2I0Z A;  2WP5 A;  4XXG A;  5FS6 A;  3V3N A;  5JCL A;  1GSN A;  1TDE A;  2VZ2 A;  4FK1 C;  2WES A;  2BAB A;  4J36 A;  4O5U A;  4H4Q A;  2BA9 A;  4U2L A;  1TDN A;  2XFQ A;  3AE9 A;  2CDU A;  4GR1 A;  1XPQ A;  3LB8 A;  3GWD A;  1IUX A;  3NLC A;  1F8W A;  1M6I A;  3F8R A;  5FS9 A;  3CNP A;  4IV9 A;  4B64 A;  3P4P A;  1PBD A;  4J33 A;  5C2T A;  4K7Z A;  4JN9 A;  1E39 A;  4MJW A;  4U2T A;  3SXI A;  1NEN A;  4A9W A;  1O5W A;  2EQ9 A;  4TM0 A;  1RP0 A;  2Q6U A;  4B65 A;  4YKG A;  3AD9 B;  3RNM A;  2BC0 A;  2WP6 A;  4EMI A;  4JNA A;  4K22 A;  4B1B A;  4D04 A;  2C4C A;  1IUT A;  1GT8 A;  1ZMD A;  2R0C A;  1O95 A;  1EBD A;  2BXR A;  4DGK A;  1H84 A;  3GDN A;  3ALJ A;  4KX6 A;  2C66 A;  4U8K A;  2BK4 A;  3NKS A;  3UOZ A;  4U8J A;  1ZDL A;  4K2X A;  1E1K A;  4YT0 A;  1D7Y A;  2XLS A;  2BK5 A;  1PXC A;  3K7Q X;  1H7W A;  3NRN A;  5EBK A;  3UTE A;  1JNZ A;  4H4X A;  4II3 A;  2RGO A;  3DK8 A;  1GRA A;  3UKL A;  2OAL A;  3PS9 A;  4Z2U A;  3H8L A;  3H4K A;  2YWL A;  3DJJ A;  1H83 A;  1LV0 A;  3UP4 A;  2QAE A;  4EQR A;  2NVK X;  4U8I A;  2BYB A;  3KU9 A;  5FS8 A;  5HYM A;  1ZOV A;  3AE2 A;  3QVP A;  2E1M A;  3UKF A;  2GF3 A;  1B8S A;  2R0P A;  4IA6 A;  2XCG A;  1KF6 A;  2WP9 A;  5FS7 A;  2VVL G;  2GEW A;  4PAB A;  2W0H A;  4NTC A;  3UKQ A;  4Y4N A;  3NNE A;  4EQS A;  3QSM A;  1X31 B;  2ZBW A;  4YSH A;  2WDV A;  4TM3 A;  1ZKQ A;  2JKC A;  4LA1 A;  2BXS A;  2PYX A;  3CTY A;  4U8P A;  1N4W A;  1CF3 A;  1KDG A;  3CNT A;  1IUV A;  3T14 A;  1JRY A;  1D7L A;  2DKH A;  4EM3 A;  1BKW A;  1D4D A;  2BK3 A;  3GD3 A;  4G73 A;  2YG6 A;  2B7R A;  4BUR A;  3SQP A;  3FIM B;  5HHF A;  3UP5 A;  1DJQ A;  2H89 A;  2YLX A;  4B68 A;  1ZY8 A;  1JNR A;  4J31 A;  4JY3 A;  1CC4 A;  4U2S A;  3RP8 A;  5IQ4 A;  2Z5Y A;  4CY8 A;  3EF6 A;  1K0J A;  1Q1W A;  2XDO A;  5EB5 A;  3UTF A;  3RED A;  1E1M A;  3BHF A;  2BS4 A;  1KSU A;  1PBE A;  2B7S A;  4M52 A;  1TDK A;  2B9Y A;  2EQ6 A;  1E6E A;  2WQY A;  2YR5 A;  3FPZ A;  4GAV A;  4H4Y A;  1DJN A;  2V5Z A;  3NN0 X;  5DBJ A;  1ONF A;  2QA2 A;  1XAN A;  3AD7 B;  3AE4 A;  1GRG A;  5KXJ A;  3T0K A;  1IUU A;  4JNQ A;  3GYI A;  4APN A;  4Y4M A;  1UKV G;  4O5Q A;  5ER0 A;  3Q9T A;  3ZYX A;  3ABV A;  3DGZ A;  2V60 A;  3IC9 A;  2WDR A;  2V3B A;  1F8S A;  1N4V A;  3AYJ A;  1N1P A;  1GRE A;  3VRB A;  2XVJ A;  1Z6L A;  3M0O A;  4XWZ A;  1ZK7 A;  1OJ9 A;  3SZC A;  1GRT A;  2AR8 A;  2X8C A;  2C65 A;  4OPI A;  4ZCD A;  4AT2 A;  4NEW A;  3KLJ A;  2XFP A;  4FX9 A;  1GRB A;  1NEK A;  2WOV A;  3ZDN A;  4H7U A;  1JRZ A;  2ARD A;  5GSN A;  2VRM A;  3VR9 A;  3V76 A;  4Z2T A;  1E1N A;  1EL8 A;  1KSS A;  3SX6 A;  3T2K A;  4TM4 A;  1PJ7 A;  3ALM A;  4YTN A;  3V3O A;  3AEC A;  2XFN A;  5L46 A;  1GET A;  1QO8 A;  3HYW A;  4USQ A;  4REK A;  1L9E A;  5U25 A;  4AOS A;  2XFO A;  4EQW A;  2YLS A;  3LZX A;  4OPC A;  1OJD A;  1TDO A;  3HYV A;  3NK2 X;  2B76 A;  3DJE A;  4JDR A;  1NAA A;  1CC2 A;  3T2Z A;  3G5S A;  1NG4 A;  1PXB A;  1TRB A;  2YR6 A;  5M0Z A;  2GQF A;  2VQ7 A;  1DNC A;  2XYO A;  3II4 A;  2F5Z A;  2XVH A;  3K7M X;  4IVM B;  1ZMC A;  1F8R A;  2CUL A;  3LAD A;  4A5L A;  3SYI A;  1PHH A;  4BK2 A;  1VG0 A;  2IID A;  2Q0L A;  3FMW A;  2E5V A;  4Z44 A;  3ICR A;  2RAB A;  1TYT A;  4OPT A;  2YG3 A;  4K8D A;  2CVJ A;  4B66 A;  4U8O A;  4YSY A;  2GAG B;  3QFB A;  4N9X A;  4H4Z A;  5KOX A;  4G74 A;  1GRH A;  4XWR A;  4H4S A;  3LOV A;  1K0I A;  1YY5 A;  1NHR A;  3RP7 A;  2YLR A;  2VOU A;  3IHM A;  1GV4 A;  4NTD A;  1FOH A;  4G9K A;  5FMH A;  1GER A;  1TDF A;  1KFY A;  3DH9 A;  4J34 A;  1Q9I A;  2BS2 A;  2V61 A;  3AE1 A;  1D4E A;  2RGJ A;  3M12 A;  5CQF A;  5TR3 A;  2X8G A;  2APG A;  2IVE A;  2YG5 A;  3BHK A;  5HY5 A;  3S61 A;  3H8I A;  4H2R A;  1PDH A;  4OPL A;  1MXT A;  2ZZB A;  3KPK A;  3BI4 A;  2Y6R A;  2YVF A;  4H2N A;  1B4V A;  1NPX A;  2EQ7 A;  4H2P A;  4DSG A;  1H86 A;  3AYL A;  4A6N B;  2R45 A;  1S3B A;  3GDP A;  4NEV A;  2C70 A;  5KMR A;  4GDP A;  4B69 A;  3PVC A;  4Z26 A;  4CBQ A;  1M64 A;  3AWI A;  4HA6 A;  2FBW A;  2YR4 A;  3F8P A;  3SY4 A;  2ACZ A;  1KNP A;  2EQ8 A;  2WOW A;  4GF7 A;  3AB1 A;  3AE6 A;  4K5R A;  5U1O A;  1CC6 A;  4B63 A;  4GRT A;  5EB4 A;  1QLB A;  5HXI A;  3AEB A;  3QVR A;  2R4J A;  3ATQ A;  1PJ6 A;  2C64 A;  2J3N A;  1OJC A;  1VDC A;  4GCM A;  5CKU A;  1DOB A;  5IQ1 A;  1FCD A;  2AAQ A;  4DNA A;  2WEU A;  2C3C A;  5M10 A;  2JBV A;  2YM2 A;  3G5R A;  4J56 A;  1GAL A;  2X8H A;  3ATR A;  3LXD A;  4I59 A;  2XLR A;  2GRT A;  2A87 A;  5KNL A;  3D8X A;  3S5W A;  4CY6 A;  3R9U A;  2BRY A;  4GAP A;  2X3N A;  4WCT A;  1PJ5 A;  3HYX A;  3PO7 A;  1YQZ A;  1Y0P A;  1PBB A;  3ITJ A;  1YQ4 A;  2V6O A;  1GEU A;  1JRX A;  1AOG A;  1B37 A;  4AP3 A;  1P2H A;  4H4T A;  2R46 A;  3KVE A;  3VRA A;  2GQW A;  5JCN A;  4NWZ A;  1K4Q A;  4EMW A;  3P9U A;  4H4V A;  3DGH A;  4C3X A;  3O0H A;  5JCI A;  2GMH A;  3K7T A;  3AE7 A;  1E1L A;  3UOY A;  2C72 A;  3CNS A;  3GYX A;  3KD9 A;  2YM1 A;  3SM8 A;  4YSX A;  2XVE A;  4H4P A;  4C77 A;  2YG4 A;  2YVJ A;  3OC4 A;  4DSH A;  1PS9 A;  1SEZ A;  4WX1 A;  1YQ3 A;  4FK1 A;  4YXD A;  1EL7 A;  4UDP A;  1OJA A;  4YKF A;  3VQR A;  4NZH A;  1Q1R A;  2ZZ0 A;  2TPR A;  3GD4 A;  3SZ0 A;  2OAM A;  1H6V A;  3JSK A;  3NG7 X;  4UDR A;  3UOV A;  2Z5X A;  3URH A;  5C3J A;  1GTH A;  2GVC A;  1DOE A;  3P4R A;  3ISH A;  1DXL A;  3DA1 A;  4TM1 A;  1N4U A;  5GRT A;  3UTH A;  4OPU A;  3IHG A;  2XLP A;  3AEE A;  1FEA A;  1L9D A;  1NHQ A;  3NGC X;  3NTD A;  2NPX A;  4JY2 A;  1OJT A;  1CJC A;  1RSG A;  3GMC A;  2UZZ A;  2BCP A;  2XLU A;  1ELI A;  3DJD A;  4C74 A;  4YSZ A;  5J7X A;  2RGH A;  5KRQ A;  2GR0 A;  1GTE A;  1LQU A;  5BVA A;  3QFA A;  2O9Z A;  5LV9 A;  3EPT A;  2VVL A;  1GRF A;  4ICY A;  4BV6 A;  2YLT A;  4U8L A;  3CGC A;  2WBA A;  4NTE A;  1P2E A;  1ZP0 A;  2YLZ A;  3KPF A;  2FJD A;  3AEF A;  3QSE A;  3T2Y A;  3VRD B;  4EIP A;  4II2 A;  3NIX A;  1F3P A;  3I3L A;  2OLN A;  4RG3 A;  1HYU A;  3AE3 A;  2TMD A;  4OVI A;  3RHA A;  1GES A;  5KVI A;  3SFE A;  5KWF A;  2JB3 A;  2CFY A;  3GWF A;  2E4G A;  1NHP A;  1W4X A;  1LVL A;  3NK1 X;  1NDA A;  1Y56 A;  2WHD A;  3NK0 X;  3BNU A;  4AOX A;  1MOK A;  2GR3 A;  2JB1 A;  3Q6J A;  2A8X A;  1DOC A;  2WPC A;  2GR1 A;  5U63 A;  2Q7V A;  3P4S A;  3T37 A;  4ADW A;  3M13 A;  1PBF A;  2FJA A;  1BF3 A;  4Y4L A;  2Q0K A;  3AEG A;  3SFD A;  4BK3 A;  1COY A;  2YVG A;  3AED A;  3CIR A;  5J60 A;  5JCK A;  4A99 A;  2WU2 A;  1S2Q A;  3GSI A;  4C3Y A;  4YWO A;  3CN8 A;  3FG2 P;  4CNJ A;  4P9S A;  1REO A;  3KKJ A;  3OZ2 A;  1CJ4 A;  4Z2R A;  2WET A;  3UTG A;  3UOX A;  3ICT A;  4CNK A;  3BI2 A;  3IF9 A;  1L9C A;  4CCQ A;  2QCU A;  3SZW A;  2GH5 A;  3NTA A;  4K5S A;  4U8N A;  4NNJ A;  4X9N A;  2XLT A;  3AYI A;  4CCR A;  2B9W A;  5IPY A;  1JU2 A;  3L8K A;  5JCM A;  1GND A;  2HQM A;  2X99 A;  3CPI G;  3EAN A;  2H88 A;  4H50 A;  1CJ2 A;  2VVM A;  3NH3 X;  1RYI A;  1ZX9 A;  4J57 A;  3CPH G;  3EAO A;  2YAU A;  4YTP A;  1PXA A;  2C67 A;  4GDE A;  1CL0 A;  2WDQ A;  3GRS A;  1IJH A;  3AXB A;  3GMB A;  3QSS A;  5KMQ A;  4B67 A;  2OLO A;  1JOA A;  4BK1 A;  2JB2 A;  4EQX A;  4HB9 A;  2GMJ A;  2R0G A;  4AP1 A;  1V59 A;  1D5T A;  3UKP A;  3NN6 X;  2VQB A;  1B5Q A;  4OPD A;  1XDI A;  3B3R A;  2C3D A;  3I6D A;  3AE5 A;  4H4R A;  5BUK A;  3G5Q A;  4A6N A;  2A89 A;  1FEC A;  4G6H A;  4YTM A;  1IUS A;  2GAH B;  4C5O A;  3C4N A;  1D4C A;  4EIQ A;  3ADA B;  3F8D A;  3P1W A;  4TLX A;  3C96 A;  2WPE A;  4H2Q A;  3COX A;  4KPR A;  3CMM A;  2OA1 A;  4A65 A;  3NYE A;  5KOW A;  4CRT A;  2YG7 A;  1CBO A;  1XHC A;  2JAE A;  2C7G A;  4RSL A;  4X4J A;  3AE8 A;  3DME A;  2BCG G;  1DOD A;  3K30 A;  3T31 A;  1PBC A;  4X9M A;  4PAA A;  4BJY A;  1GOS A;  1KNR A;  3UCL A;  3UKK A;  1CJ3 A;  4LII A;  3GRT A;  1H7X A;  1LJ1 A;  5BRT A;  2FJB A;  1TYP A;  4ZN0 A;  5EOW A;  4IVO B;  1GPE A;  3KA7 A;  1F6M A;  1GXF A;  4Z24 A;  4E0V A;  1LPF A;  1FL2 A;  1YKJ A;  1NG3 A;  4OPG A;  1ZOY A;  3LZW A;  3RP6 A;  2DKI A;  3DK9 A;  5BUL A;  2WU5 A;  1BGJ A;  2GR2 A;  2YLW A;  3LJP A;  3UKH A;  2C76 A;  3NHO X;  4I58 A;  3FBS A;  1S2Y A;  2C73 A;  1LQT A;  2FJE A;  2ZZC A;  3BNM A;  2Y6Q A;  3SZF A;  3SGL A;  3UKA A;  1K0L A;  4LU6 A;  4UP3 A;  2YQU A;  3B6D A;  3DJG X;  4ECH A;  4J2W A;  2V3A A;  2WS3 A;  2WOI A;  1MO9 A;  2XVI A;  1QJD A;  3NYF A;  2BAC A;  4U8M A;  4TLZ A;  2BS3 A;  4IA5 A;  1S3E A;  3WE0 A;  2C75 A;  3NT6 A;  1PN0 A;  3AEA A;  1BWC A;  3E1T A;  1EL9 A;  3CGD A;  3HZL A;  3NYC A;  4G6G A;  2XFU A;  2QA1 A;  1VG9 A;  1JEH A;  2X50 A;  4GUV A;  3L1R A;  4Z43 A;  2GB0 A;  4USR A;  4RG4 A;  3ALL A;  2B9X A;  4H4W A;  4ZCC A;  1LTX R;  1BGN A;  4A79 A;  5KMS A;  5KVH A;  3DK4 A;  3CNJ A;  1IUW A;  1FEB A;  3CGE A;  2GV8 A;  1Y56 B;  3CGB A;  3AD8 B;  4OCG A;  5KMP A;  2AQJ A;  3ICS A;  1BZL A;  4JQ9 A;  2JK6 A;  2IVD A;  3BI5 A;  4D03 A;  1VQW A;  1NHS A;  2WPF A;  3VR8 A;  3QJ4 A;  2BC1 A;  3IWA A;  1E7P A;  1EL5 A;  2BRA A;  4EMJ A;  4H4U A;  2PHH A;  3P4Q A;  1H82 A;  2R9Z A;  4Z25 A;  2R4E A; 
#chains in the Genus database with same CATH homology
 1VRQ B;  1O94 A;  4EM4 A;  2VRL A;  3D1C A;  3CND A;  4FDC B;  4AT0 A;  4BJZ A;  4UDQ A;  1L0V A;  1H81 A;  3CPJ G;  2XVF A;  3C4A A;  1CHU A;  4A7A A;  3GYJ A;  2I0Z A;  2WP5 A;  4XXG A;  5FS6 A;  3V3N A;  5JCL A;  1GSN A;  1TDE A;  2VZ2 A;  4FK1 C;  2WES A;  2BAB A;  4J36 A;  4O5U A;  4H4Q A;  2BA9 A;  4U2L A;  1TDN A;  2XFQ A;  3AE9 A;  2CDU A;  4GR1 A;  1XPQ A;  3LB8 A;  3GWD A;  1IUX A;  3NLC A;  1F8W A;  1M6I A;  3F8R A;  5FS9 A;  3CNP A;  4IV9 A;  4B64 A;  3P4P A;  1PBD A;  4J33 A;  5C2T A;  4K7Z A;  4JN9 A;  1E39 A;  4MJW A;  4U2T A;  3SXI A;  1NEN A;  4A9W A;  1O5W A;  2EQ9 A;  4TM0 A;  1RP0 A;  2Q6U A;  4B65 A;  4YKG A;  3AD9 B;  3RNM A;  2BC0 A;  2WP6 A;  4EMI A;  4JNA A;  4K22 A;  4B1B A;  4D04 A;  2C4C A;  1IUT A;  1GT8 A;  1ZMD A;  2R0C A;  1O95 A;  1EBD A;  2BXR A;  4DGK A;  1H84 A;  3GDN A;  3ALJ A;  4KX6 A;  2C66 A;  4U8K A;  2BK4 A;  3NKS A;  3UOZ A;  4U8J A;  1ZDL A;  4K2X A;  1E1K A;  4YT0 A;  1D7Y A;  2XLS A;  2BK5 A;  1PXC A;  3K7Q X;  1H7W A;  3NRN A;  5EBK A;  3UTE A;  1JNZ A;  4H4X A;  4II3 A;  2RGO A;  3DK8 A;  1GRA A;  3UKL A;  2OAL A;  3PS9 A;  4Z2U A;  3H8L A;  3H4K A;  2YWL A;  3DJJ A;  1H83 A;  1LV0 A;  3UP4 A;  2QAE A;  4EQR A;  2NVK X;  4U8I A;  2BYB A;  3KU9 A;  5FS8 A;  5HYM A;  1ZOV A;  3AE2 A;  3QVP A;  2E1M A;  3UKF A;  2GF3 A;  1B8S A;  2R0P A;  4IA6 A;  2XCG A;  1KF6 A;  2WP9 A;  5FS7 A;  2VVL G;  2GEW A;  4PAB A;  2W0H A;  4NTC A;  3UKQ A;  4Y4N A;  3NNE A;  4EQS A;  3QSM A;  1X31 B;  2ZBW A;  4YSH A;  2WDV A;  4TM3 A;  1ZKQ A;  2JKC A;  4LA1 A;  2BXS A;  2PYX A;  3CTY A;  4U8P A;  1N4W A;  1CF3 A;  1KDG A;  3CNT A;  1IUV A;  3T14 A;  1JRY A;  1D7L A;  2DKH A;  4EM3 A;  1BKW A;  1D4D A;  2BK3 A;  3GD3 A;  4G73 A;  2YG6 A;  2B7R A;  4BUR A;  3SQP A;  3FIM B;  5HHF A;  3UP5 A;  1DJQ A;  2H89 A;  2YLX A;  4B68 A;  1ZY8 A;  1JNR A;  4J31 A;  4JY3 A;  1CC4 A;  4U2S A;  3RP8 A;  5IQ4 A;  2Z5Y A;  4CY8 A;  3EF6 A;  1K0J A;  1Q1W A;  2XDO A;  5EB5 A;  3UTF A;  3RED A;  1E1M A;  3BHF A;  2BS4 A;  1KSU A;  1PBE A;  2B7S A;  4M52 A;  1TDK A;  2B9Y A;  2EQ6 A;  1E6E A;  2WQY A;  2YR5 A;  3FPZ A;  4GAV A;  4H4Y A;  1DJN A;  2V5Z A;  3NN0 X;  5DBJ A;  1ONF A;  2QA2 A;  1XAN A;  3AD7 B;  3AE4 A;  1GRG A;  5KXJ A;  3T0K A;  1IUU A;  4JNQ A;  3GYI A;  4APN A;  4Y4M A;  1UKV G;  4O5Q A;  5ER0 A;  3Q9T A;  3ZYX A;  3ABV A;  3DGZ A;  2V60 A;  3IC9 A;  2WDR A;  2V3B A;  1F8S A;  1N4V A;  3AYJ A;  1N1P A;  1GRE A;  3VRB A;  2XVJ A;  1Z6L A;  3M0O A;  4XWZ A;  1ZK7 A;  1OJ9 A;  3SZC A;  1GRT A;  2AR8 A;  2X8C A;  2C65 A;  4OPI A;  4ZCD A;  4AT2 A;  4NEW A;  3KLJ A;  2XFP A;  4FX9 A;  1GRB A;  1NEK A;  2WOV A;  3ZDN A;  4H7U A;  1JRZ A;  2ARD A;  5GSN A;  2VRM A;  3VR9 A;  3V76 A;  4Z2T A;  1E1N A;  1EL8 A;  1KSS A;  3SX6 A;  3T2K A;  4TM4 A;  1PJ7 A;  3ALM A;  4YTN A;  3V3O A;  3AEC A;  2XFN A;  5L46 A;  1GET A;  1QO8 A;  3HYW A;  4USQ A;  4REK A;  1L9E A;  5U25 A;  4AOS A;  2XFO A;  4EQW A;  2YLS A;  3LZX A;  4OPC A;  1OJD A;  1TDO A;  3HYV A;  3NK2 X;  2B76 A;  3DJE A;  4JDR A;  1NAA A;  1CC2 A;  3T2Z A;  3G5S A;  1NG4 A;  1PXB A;  1TRB A;  2YR6 A;  5M0Z A;  2GQF A;  2VQ7 A;  1DNC A;  2XYO A;  3II4 A;  2F5Z A;  2XVH A;  3K7M X;  4IVM B;  1ZMC A;  1F8R A;  2CUL A;  3LAD A;  4A5L A;  3SYI A;  1PHH A;  4BK2 A;  1VG0 A;  2IID A;  2Q0L A;  3FMW A;  2E5V A;  4Z44 A;  3ICR A;  2RAB A;  1TYT A;  4OPT A;  2YG3 A;  4K8D A;  2CVJ A;  4B66 A;  4U8O A;  4YSY A;  2GAG B;  3QFB A;  4N9X A;  4H4Z A;  5KOX A;  4G74 A;  1GRH A;  4XWR A;  4H4S A;  3LOV A;  1K0I A;  1YY5 A;  1NHR A;  3RP7 A;  2YLR A;  2VOU A;  3IHM A;  1GV4 A;  4NTD A;  1FOH A;  4G9K A;  5FMH A;  1GER A;  1TDF A;  1KFY A;  3DH9 A;  4J34 A;  1Q9I A;  2BS2 A;  2V61 A;  3AE1 A;  1D4E A;  2RGJ A;  3M12 A;  5CQF A;  5TR3 A;  2X8G A;  2APG A;  2IVE A;  2YG5 A;  3BHK A;  5HY5 A;  3S61 A;  3H8I A;  4H2R A;  1PDH A;  4OPL A;  1MXT A;  2ZZB A;  3KPK A;  3BI4 A;  2Y6R A;  2YVF A;  4H2N A;  1B4V A;  1NPX A;  2EQ7 A;  4H2P A;  4DSG A;  1H86 A;  3AYL A;  4A6N B;  2R45 A;  1S3B A;  3GDP A;  4NEV A;  2C70 A;  5KMR A;  4GDP A;  4B69 A;  3PVC A;  4Z26 A;  4CBQ A;  1M64 A;  3AWI A;  4HA6 A;  2FBW A;  2YR4 A;  3F8P A;  3SY4 A;  2ACZ A;  1KNP A;  2EQ8 A;  2WOW A;  4GF7 A;  3AB1 A;  3AE6 A;  4K5R A;  5U1O A;  1CC6 A;  4B63 A;  4GRT A;  5EB4 A;  1QLB A;  5HXI A;  3AEB A;  3QVR A;  2R4J A;  3ATQ A;  1PJ6 A;  2C64 A;  2J3N A;  1OJC A;  1VDC A;  4GCM A;  5CKU A;  1DOB A;  5IQ1 A;  1FCD A;  2AAQ A;  4DNA A;  2WEU A;  2C3C A;  5M10 A;  2JBV A;  2YM2 A;  3G5R A;  4J56 A;  1GAL A;  2X8H A;  3ATR A;  3LXD A;  4I59 A;  2XLR A;  2GRT A;  2A87 A;  5KNL A;  3D8X A;  3S5W A;  4CY6 A;  3R9U A;  2BRY A;  4GAP A;  2X3N A;  4WCT A;  1PJ5 A;  3HYX A;  3PO7 A;  1YQZ A;  1Y0P A;  1PBB A;  3ITJ A;  1YQ4 A;  2V6O A;  1GEU A;  1JRX A;  1AOG A;  1B37 A;  4AP3 A;  1P2H A;  4H4T A;  2R46 A;  3KVE A;  3VRA A;  2GQW A;  5JCN A;  4NWZ A;  1K4Q A;  4EMW A;  3P9U A;  4H4V A;  3DGH A;  4C3X A;  3O0H A;  5JCI A;  2GMH A;  3K7T A;  3AE7 A;  1E1L A;  3UOY A;  2C72 A;  3CNS A;  3GYX A;  3KD9 A;  2YM1 A;  3SM8 A;  4YSX A;  2XVE A;  4H4P A;  4C77 A;  2YG4 A;  2YVJ A;  3OC4 A;  4DSH A;  1PS9 A;  1SEZ A;  4WX1 A;  1YQ3 A;  4FK1 A;  4YXD A;  1EL7 A;  4UDP A;  1OJA A;  4YKF A;  3VQR A;  4NZH A;  1Q1R A;  2ZZ0 A;  2TPR A;  3GD4 A;  3SZ0 A;  2OAM A;  1H6V A;  3JSK A;  3NG7 X;  4UDR A;  3UOV A;  2Z5X A;  3URH A;  5C3J A;  1GTH A;  2GVC A;  1DOE A;  3P4R A;  3ISH A;  1DXL A;  3DA1 A;  4TM1 A;  1N4U A;  5GRT A;  3UTH A;  4OPU A;  3IHG A;  2XLP A;  3AEE A;  1FEA A;  1L9D A;  1NHQ A;  3NGC X;  3NTD A;  2NPX A;  4JY2 A;  1OJT A;  1CJC A;  1RSG A;  3GMC A;  2UZZ A;  2BCP A;  2XLU A;  1ELI A;  3DJD A;  4C74 A;  4YSZ A;  5J7X A;  2RGH A;  5KRQ A;  2GR0 A;  1GTE A;  1LQU A;  5BVA A;  3QFA A;  2O9Z A;  5LV9 A;  3EPT A;  2VVL A;  1GRF A;  4ICY A;  4BV6 A;  2YLT A;  4U8L A;  3CGC A;  2WBA A;  4NTE A;  1P2E A;  1ZP0 A;  2YLZ A;  3KPF A;  2FJD A;  3AEF A;  3QSE A;  3T2Y A;  3VRD B;  4EIP A;  4II2 A;  3NIX A;  1F3P A;  3I3L A;  2OLN A;  4RG3 A;  1HYU A;  3AE3 A;  2TMD A;  4OVI A;  3RHA A;  1GES A;  5KVI A;  3SFE A;  5KWF A;  2JB3 A;  2CFY A;  3GWF A;  2E4G A;  1NHP A;  1W4X A;  1LVL A;  3NK1 X;  1NDA A;  1Y56 A;  2WHD A;  3NK0 X;  3BNU A;  4AOX A;  1MOK A;  2GR3 A;  2JB1 A;  3Q6J A;  2A8X A;  1DOC A;  2WPC A;  2GR1 A;  5U63 A;  2Q7V A;  3P4S A;  3T37 A;  4ADW A;  3M13 A;  1PBF A;  2FJA A;  1BF3 A;  4Y4L A;  2Q0K A;  3AEG A;  3SFD A;  4BK3 A;  1COY A;  2YVG A;  3AED A;  3CIR A;  5J60 A;  5JCK A;  4A99 A;  2WU2 A;  1S2Q A;  3GSI A;  4C3Y A;  4YWO A;  3CN8 A;  3FG2 P;  4CNJ A;  4P9S A;  1REO A;  3KKJ A;  3OZ2 A;  1CJ4 A;  4Z2R A;  2WET A;  3UTG A;  3UOX A;  3ICT A;  4CNK A;  3BI2 A;  3IF9 A;  1L9C A;  4CCQ A;  2QCU A;  3SZW A;  2GH5 A;  3NTA A;  4K5S A;  4U8N A;  4NNJ A;  4X9N A;  2XLT A;  3AYI A;  4CCR A;  2B9W A;  5IPY A;  1JU2 A;  3L8K A;  5JCM A;  1GND A;  2HQM A;  2X99 A;  3CPI G;  3EAN A;  2H88 A;  4H50 A;  1CJ2 A;  2VVM A;  3NH3 X;  1RYI A;  1ZX9 A;  4J57 A;  3CPH G;  3EAO A;  2YAU A;  4YTP A;  1PXA A;  2C67 A;  4GDE A;  1CL0 A;  2WDQ A;  3GRS A;  1IJH A;  3AXB A;  3GMB A;  3QSS A;  5KMQ A;  4B67 A;  2OLO A;  1JOA A;  4BK1 A;  2JB2 A;  4EQX A;  4HB9 A;  2GMJ A;  2R0G A;  4AP1 A;  1V59 A;  1D5T A;  3UKP A;  3NN6 X;  2VQB A;  1B5Q A;  4OPD A;  1XDI A;  3B3R A;  2C3D A;  3I6D A;  3AE5 A;  4H4R A;  5BUK A;  3G5Q A;  4A6N A;  2A89 A;  1FEC A;  4G6H A;  4YTM A;  1IUS A;  2GAH B;  4C5O A;  3C4N A;  1D4C A;  4EIQ A;  3ADA B;  3F8D A;  3P1W A;  4TLX A;  3C96 A;  2WPE A;  4H2Q A;  3COX A;  4KPR A;  3CMM A;  2OA1 A;  4A65 A;  3NYE A;  5KOW A;  4CRT A;  2YG7 A;  1CBO A;  1XHC A;  2JAE A;  2C7G A;  4RSL A;  4X4J A;  3AE8 A;  3DME A;  2BCG G;  1DOD A;  3K30 A;  3T31 A;  1PBC A;  4X9M A;  4PAA A;  4BJY A;  1GOS A;  1KNR A;  3UCL A;  3UKK A;  1CJ3 A;  4LII A;  3GRT A;  1H7X A;  1LJ1 A;  5BRT A;  2FJB A;  1TYP A;  4ZN0 A;  5EOW A;  4IVO B;  1GPE A;  3KA7 A;  1F6M A;  1GXF A;  4Z24 A;  4E0V A;  1LPF A;  1FL2 A;  1YKJ A;  1NG3 A;  4OPG A;  1ZOY A;  3LZW A;  3RP6 A;  2DKI A;  3DK9 A;  5BUL A;  2WU5 A;  1BGJ A;  2GR2 A;  2YLW A;  3LJP A;  3UKH A;  2C76 A;  3NHO X;  4I58 A;  3FBS A;  1S2Y A;  2C73 A;  1LQT A;  2FJE A;  2ZZC A;  3BNM A;  2Y6Q A;  3SZF A;  3SGL A;  3UKA A;  1K0L A;  4LU6 A;  4UP3 A;  2YQU A;  3B6D A;  3DJG X;  4ECH A;  4J2W A;  2V3A A;  2WS3 A;  2WOI A;  1MO9 A;  2XVI A;  1QJD A;  3NYF A;  2BAC A;  4U8M A;  4TLZ A;  2BS3 A;  4IA5 A;  1S3E A;  3WE0 A;  2C75 A;  3NT6 A;  1PN0 A;  3AEA A;  1BWC A;  3E1T A;  1EL9 A;  3CGD A;  3HZL A;  3NYC A;  4G6G A;  2XFU A;  2QA1 A;  1VG9 A;  1JEH A;  2X50 A;  4GUV A;  3L1R A;  4Z43 A;  2GB0 A;  4USR A;  4RG4 A;  3ALL A;  2B9X A;  4H4W A;  4ZCC A;  1LTX R;  1BGN A;  4A79 A;  5KMS A;  5KVH A;  3DK4 A;  3CNJ A;  1IUW A;  1FEB A;  3CGE A;  2GV8 A;  1Y56 B;  3CGB A;  3AD8 B;  4OCG A;  5KMP A;  2AQJ A;  3ICS A;  1BZL A;  4JQ9 A;  2JK6 A;  2IVD A;  3BI5 A;  4D03 A;  1VQW A;  1NHS A;  2WPF A;  3VR8 A;  3QJ4 A;  2BC1 A;  3IWA A;  1E7P A;  1EL5 A;  2BRA A;  4EMJ A;  4H4U A;  2PHH A;  3P4Q A;  1H82 A;  2R9Z A;  4Z25 A;  2R4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...