3NK2X

Complex of 6-hydroxy-l-nicotine oxidase with dopamine
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 142
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk2X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk2X02
5L46A 1PXCA 4ICYA 3B6DA 3CNTA 4H4RA 4AP1A 1D7YA 1W4XA 3H8IA 3NK1X 4C3XA 5ER0A 5HYMA 2VRMA 1E1LA 3AE5A 1KSSA 4J56A 4CCQA 2EQ7A 1EL7A 2V61A 2WOWA 3NGCX 3KPFA 4YTPA 2BC1A 1KFYA 1UKVG 3C4NA 1YKJA 3BHKA 4H4VA 2R0GA 2BS2A 3FG2P 3CTYA 2APGA 3FBSA 4J36A 5BVAA 1JRYA 2BXSA 1PN0A 1CBOA 2VQBA 5IPYA 3CGDA 4H4WA 3AE8A 5LV9A 1PJ6A 1O5WA 3NYCA 2Z5YA 1PBCA 2R0CA 1E1KA 2JB1A 3AEEA 2VOUA 1QJDA 2R4JA 3AEGA 4TLZA 1Z6LA 1TDOA 1KF6A 4Z2TA 1BWCA 1KNRA 3UOVA 3CGCA 2WPEA 3KU9A 4O5UA 2YLWA 3DJDA 2YG6A 4OCGA 5IQ4A 2CDUA 4U8OA 1LJ1A 3NLCA 3URHA 4H4SA 3BI2A 3KVEA 4GCMA 4OPUA 5DBJA 5TR3A 2EQ8A 3RNMA 1B8SA 2WPCA 3ICRA 2C64A 1KSUA 3AE2A 3GYIA 4J34A 4GF7A 4K5SA 1K0LA 1CJ3A 3AE3A 4B67A 1NEKA 1L0VA 2W0HA 5KOXA 3ISHA 5IQ1A 1F3PA 2C75A 1CC4A 1TDNA 1TRBA 3GSIA 2OAMA 1FEBA 1K4QA 5KWFA 4J31A 1JNZA 4YWOA 4H2QA 3EPTA 1ZX9A 2VZ2A 1OJTA 2FBWA 4FX9A 3SFDA 4Y4MA 4OPGA 2ZZBA 3DK9A 3GWFA 3AE7A 3NTAA 1NHPA 4H4XA 4TM4A 5EB4A 1PJ5A 4EQSA 3NH3X 1PBFA 3AECA 4H50A 4TLXA 1MO9A 1P2HA 4CBQA 1OJAA 1B4VA 1EL5A 2V3BA 1FECA 1JU2A 1ZMDA 2OLNA 1EBDA 4LIIA 1CL0A 3M0OA 3G5QA 3LZXA 2JBVA 3IWAA 3NYEA 2RABA 3NIXA 2I0ZA 3DMEA 1EL8A 3UKQA 2VRLA 3SQPA 1CHUA 3SGLA 5KOWA 1NPXA 2WDVA 2C67A 3FPZA 1H81A 3PS9A 4U2TA 2Q0LA 1H6VA 1CJ2A 2GAHB 4IV9A 3UOYA 3AYIA 2HQMA 1PBDA 1LTXR 2XFQA 3F8RA 3AYJA 3NTDA 4M52A 4CNKA 1JRXA 4BK2A 1NENA 1E6EA 3CPIG 5EOWA 4YTNA 1M6IA 1NHSA 2O9ZA 2A8XA 2GMHA 1E1NA 3AD7B 3NYFA 5JCMA 3NN6X 3BI5A 4AT2A 2C3CA 5J60A 3HZLA 2BABA 4JDRA 1DNCA 3NK2X 4H4UA 4H7UA 3SM8A 1BGNA 1YQ3A 1ELIA 2YG3A 2V5ZA 3GWDA 1B5QA 1DJNA 3OZ2A 1GPEA 1GSNA 1PBBA 1P2EA 3DGZA 1TYTA 4U8NA 4EMJA 5JCIA 3ITJA 1KDGA 4OPCA 4IA5A 3CGBA 2BS4A 5EBKA 1GETA 1GESA 2R4EA 3L1RA 3BHFA 4IVMB 3DJJA 1GERA 4EM3A 4H4TA 2OLOA 1ZMCA 2VVLG 4EMIA 3AEFA 4K8DA 1GREA 2WDQA 4I59A 4NTCA 2R46A 3NRNA 4OPIA 2XCGA 4J57A 3AEDA 1Y0PA 1RP0A 2X3NA 2XYOA 1COYA 2WS3A 3AWIA 2XFNA 1E1MA 2R0PA 2YG4A 2ZZCA 1F8SA 2AR8A 3FIMB 2XVHA 4HB9A 3SFEA 1CC6A 1GTHA 1PXAA 1F6MA 4JNAA 4A6NB 4A79A 2H89A 2QA1A 4GDPA 3P9UA 2JB2A 4EMWA 2BCPA 5FMHA 5M0ZA 2OA1A 4LA1A 1RYIA 2Y6QA 4D04A 1BGJA 2GV8A 4JN9A 4K7ZA 4U2LA 5M10A 1LPFA 2XVIA 3GMCA 1AOGA 2B9WA 3QSEA 4X9NA 1O95A 3ZDNA 2AAQA 2GR0A 4ECHA 5FS8A 4BK1A 4LU6A 1NHRA 2XDOA 5C3JA 4APNA 4E0VA 1DXLA 4JY3A 2GVCA 2B7SA 4Z24A 2JB3A 3ALMA 3DGHA 2B7RA 2XFPA 1D5TA 2C3DA 4NEVA 5U25A 1EL9A 2GB0A 2TMDA 2BCGG 4GR1A 4ZN0A 1NG4A 2JK6A 1ZKQA 3CIRA 5HHFA 1N4WA 3VRAA 3GDNA 1NG3A 2A87A 3ALLA 3KA7A 1L9EA 1VG9A 4Y4LA 3DA1A 1VRQB 2YWLA 1TDEA 2VVMA 2NVKX 2CVJA 4JNQA 2WU2A 4RSLA 1L9CA 1LVLA 3GD3A 5JCNA 4TM1A 2WETA 1D4DA 3IHMA 1KNPA 3QSMA 2X8CA 1F8WA 3BNMA 4EQXA 3S5WA 2XFUA 1FEAA 3GYJA 2NPXA 4XXGA 4U8JA 4USQA 3M13A 4CNJA 3CNJA 4OPDA 3NN0X 3Q9TA 1VQWA 3I3LA 4YKGA 3ATQA 1TYPA 4U8PA 1BKWA 2YVFA 1S2YA 2R9ZA 2YQUA 3DK8A 3ICTA 3KLJA 2WP5A 2X99A 4EM4A 2WDRA 2YLXA 1PHHA 3H4KA 3QFBA 1Q1RA 1JNRA 5J7XA 3H8LA 4TM3A 1JEHA 3IC9A 2GR2A 3UTEA 2GR3A 3GRTA 4YT0A 1CF3A 3NHOX 1H84A 1RSGA 2Q6UA 1CJ4A 2WOVA 1S3EA 3DJGX 1GRFA 1NDAA 3EAOA 4K5RA 5BUKA 2BACA 2WBAA 2GR1A 3VQRA 1Q1WA 3GMBA 2RGJA 5U63A 2B9YA 2XLSA 2FJDA 4GUVA 4H4PA 4JY2A 4CRTA 1MOKA 1ZK7A 3CNDA 3PVCA 2X50A 3NG7X 2YR5A 2ZBWA 3Q6JA 1XANA 1GRGA 1PBEA 2Z5XA 3D1CA 3NK0X 2Q0KA 4H2RA 2WHDA 3FMWA 1LQTA 4H2PA 4KX6A 4OVIA 4BV6A 1IUWA 1DOBA 3LADA 3P4QA 3P1WA 1PJ7A 4NEWA 5KXJA 1V59A 4A5LA 1DOEA 2C66A 4Z2RA 3I6DA 4C3YA 2C73A 2WP9A 1HYUA 1GNDA 4BURA 5U1OA 4J33A 4YSHA 2V3AA 2UZZA 3KKJA 2VVLA 3UKAA 1VG0A 1ZP0A 3T37A 1S3BA 1E7PA 2YM1A 1FOHA 4HA6A 1X31B 3QJ4A 2E4GA 2ARDA 2BK4A 1H7WA 3LZWA 4J2WA 1IUTA 1Y56A 1CC2A 1GEUA 3AEBA 3DH9A 2QCUA 4UDRA 4USRA 5FS9A 3R9UA 1DODA 1E39A 1H86A 4C5OA 1ZOVA 1N1PA 4B1BA 3RP6A 2BC0A 3G5SA 2B76A 1GALA 2GAGB 4A6NA 2GQFA 1ZY8A 4UP3A 2BK3A 4P9SA 3JSKA 4Z26A 2WOIA 4WX1A 1BF3A 2BYBA 3V76A 1BZLA 2FJEA 4RG3A 4H2NA 4YXDA 2EQ6A 4Z43A 3P4SA 3LOVA 1FL2A 4EQRA 1H82A 4DSGA 3IHGA 5KVIA 3RP8A 2YLSA 2R45A 1IJHA 3UP5A 1ONFA 2F5ZA 3RP7A 3K7QX 1QLBA 4B69A 4EIPA 2BK5A 4AOSA 1XPQA 4OPLA 1FCDA 2B9XA 2JKCA 4TM0A 2XFOA 3L8KA 3ABVA 3V3OA 3PO7A 2YAUA 3BI4A 3II4A 4CY8A 2QAEA 4BK3A 1CJCA 1PS9A 4XWZA 4AOXA 2YR4A 4GRTA 4RG4A 3COXA 4ZCDA 3S61A 1NAAA 2DKIA 4X9MA 3KD9A 2BS3A 2RGHA 3AD8B 1REOA 2V60A 4IA6A 4YTMA 4DGKA 3RHAA 5CQFA 1GOSA 4C77A 1F8RA 3ICSA 2C72A 3NT6A 4U8IA 3VR8A 2E5VA 1H7XA 3UOXA 3NKSA 3OC4A 3AB1A 3VRDB 3UP4A 2XLPA 4ZCCA 4A65A 3CNPA 3UTHA 4CCRA 1XHCA 2QA2A 5FS6A 1JRZA 4FK1A 2WU5A 4U8KA 3V3NA 4DSHA 2GH5A 3IF9A 4CY6A 2ACZA 2RGOA 4A9WA 4OPTA 1GXFA 2C65A 3AYLA 4YSYA 4FDCB 5BRTA 4DNAA 4K2XA 3CPJG 3UKPA 2GQWA 5HXIA 2YM2A 3EANA 2GRTA 4C74A 1K0IA 1H83A 3AD9B 1N4VA 2A89A 5GSNA 3CNSA 1Q9IA 2YLZA 2WQYA 2DKHA 1D4EA 2WESA 2YVGA 4NTDA 1B37A 1GRTA 3DJEA 2C7GA 2XLUA 4B64A 2XLRA 4B63A 1YQZA 2EQ9A 2VQ7A 1IUVA 2J3NA 4AT0A 5JCKA 1GV4A 1DOCA 1TDFA 1K0JA 2ZZ0A 3B3RA 3AE6A 3CPHG 3BNUA 3D8XA 1GRBA 4X4JA 3AE1A 3LXDA 2WEUA 4KPRA 2GMJA 4D03A 5KRQA 4PABA 1GT8A 2X8GA 4N9XA 3VRBA 2PHHA 3O0HA 2YG5A 4EIQA 1IUXA 1NHQA 4B66A 2PYXA 3K7TA 2E1MA 1S2QA 3ATRA 2OALA 1OJCA 4REKA 3QVRA 2CULA 3REDA 1N4UA 3LJPA 4Z25A 2YVJA 3UKHA 4PAAA 1D7LA 2GF3A 2BXRA 1PDHA 4EQWA 5KVHA 1MXTA 1D4CA 1GRHA 2XVJA 4JQ9A 2XVFA 4O5QA 4Y4NA 2Q7VA 3QFAA 4U8MA 5CKUA 5EB5A 4Z44A 3LB8A 4YSXA 2YLRA 5HY5A 3AEAA 2XLTA 3ADAB 3F8PA 4XWRA 1TDKA 4B68A 1ZOYA 5C2TA 2YG7A 2C76A 3P4PA 1GRAA 3CGEA 3AE9A 4IVOB 3E1TA 3VR9A 3WE0A 3ALJA 3UOZA 1OJ9A 1YY5A 4FK1C 1IUSA 4U8LA 3C96A 2C70A 2IVEA 3AE4A 3GRSA 4GDEA 4YSZA 3UKFA 1LQUA 2WP6A 1IUUA 4UDPA 2IVDA 4UDQA 1VDCA 3CN8A 3UTGA 3P4RA 2TPRA 2YLTA 2CFYA 4A99A 1GTEA 1QO8A 4YKFA 4K22A 3DK4A 1O94A 2Y6RA 4NZHA 1LV0A 3ZYXA 1PXBA 4H4YA 3GD4A 3AXBA 2XVEA 3K7MX 3NNEA 3UCLA 4Z2UA 1YQ4A 5FS7A 4B65A 3G5RA 2X8HA 4ADWA 2FJAA 4MJWA 2FJBA 1DJQA 4H4ZA 4WCTA 5JCLA 3UTFA 4U2SA 3M12A 3QSSA 2BA9A 2V6OA 1M64A 1XDIA 2YR6A 4H4QA 2WPFA 4I58A 3UKKA 4BJYA 3K30A 3GDPA 3C4AA 2H88A 3F8DA 2AQJA 4NTEA 3UKLA 3EF6A 1OJDA 1SEZA 4BJZA 2IIDA 4AP3A 2GEWA 5BULA 5GRTA 1ZDLA 4A7AA 3QVPA 1JOAA 2JAEA 1L9DA 1Y56B
chains in the Genus database with same CATH superfamily
5L46A 1PXCA 4ICYA 3B6DA 3CNTA 4H4RA 4AP1A 1D7YA 1W4XA 3H8IA 3NK1X 4C3XA 5ER0A 5HYMA 2VRMA 1E1LA 3AE5A 1KSSA 4J56A 4CCQA 2EQ7A 1EL7A 2V61A 2WOWA 3NGCX 3KPFA 3T14A 2BC1A 1KFYA 1UKVG 3C4NA 4YTPA 1YKJA 3BHKA 4H4VA 2R0GA 3HYWA 2BS2A 3FG2P 3CTYA 2APGA 3FBSA 4J36A 5BVAA 1JRYA 2BXSA 1PN0A 1CBOA 2VQBA 3T2YA 3CGDA 4H4WA 5IPYA 3AE8A 5LV9A 1PJ6A 1O5WA 3NYCA 2Z5YA 1PBCA 2R0CA 1E1KA 2JB1A 3AEEA 2VOUA 1QJDA 2R4JA 3AEGA 4TLZA 1Z6LA 1TDOA 1KF6A 4Z2TA 1BWCA 1KNRA 3UOVA 3CGCA 2WPEA 3KU9A 4O5UA 2YLWA 3DJDA 2YG6A 4OCGA 3SZWA 4G74A 5IQ4A 2CDUA 4U8OA 1LJ1A 3NLCA 3URHA 4H4SA 3BI2A 3KVEA 4GCMA 4OPUA 5DBJA 5TR3A 2EQ8A 3RNMA 1B8SA 2WPCA 3ICRA 2C64A 1KSUA 3AE2A 3GYIA 4J34A 4GF7A 4K5SA 1K0LA 1CJ3A 3AE3A 4B67A 1NEKA 1L0VA 2W0HA 5KOXA 3ISHA 5IQ1A 1F3PA 2C75A 1CC4A 1TDNA 1TRBA 3GSIA 2OAMA 1FEBA 1K4QA 5KWFA 4J31A 1JNZA 4YWOA 4H2QA 3EPTA 1ZX9A 2VZ2A 1OJTA 2FBWA 4FX9A 3SFDA 4Y4MA 4OPGA 2ZZBA 3DK9A 3GWFA 3AE7A 3NTAA 1NHPA 4H4XA 4TM4A 5EB4A 1PJ5A 4EQSA 3NH3X 1PBFA 3AECA 4H50A 4TLXA 2BRYA 1MO9A 1P2HA 4CBQA 1OJAA 1B4VA 1EL5A 2V3BA 1FECA 1JU2A 1ZMDA 2OLNA 1EBDA 4LIIA 1CL0A 3M0OA 3G5QA 3LZXA 2JBVA 3IWAA 3NYEA 2RABA 3NIXA 2I0ZA 3DMEA 1EL8A 3UKQA 2VRLA 3SQPA 1CHUA 3SGLA 5KOWA 1NPXA 2WDVA 2C67A 3FPZA 1H81A 3PS9A 4U2TA 2Q0LA 5KMSA 1H6VA 1CJ2A 2GAHB 4IV9A 3UOYA 3AYIA 2HQMA 1PBDA 1LTXR 2XFQA 3F8RA 3AYJA 3NTDA 4M52A 4CNKA 5KNLA 1JRXA 4BK2A 1NENA 1E6EA 3CPIG 5EOWA 4YTNA 1M6IA 1NHSA 2O9ZA 2A8XA 2GMHA 1E1NA 3AD7B 3NYFA 5JCMA 4NNJA 3NN6X 3BI5A 4AT2A 2C3CA 5J60A 3HZLA 2BABA 4JDRA 1DNCA 3NK2X 4H4UA 4H7UA 3SM8A 1BGNA 1YQ3A 1ELIA 2YG3A 2V5ZA 3GWDA 1B5QA 1DJNA 3OZ2A 1GPEA 1GSNA 1PBBA 1P2EA 3DGZA 1TYTA 4U8NA 3T2KA 4EMJA 5JCIA 3ITJA 1KDGA 4OPCA 4IA5A 3CGBA 2BS4A 5EBKA 1GETA 1GESA 2R4EA 3L1RA 3BHFA 4IVMB 3DJJA 1GERA 3SZ0A 4H4TA 4EM3A 2OLOA 1ZMCA 2VVLG 4EMIA 3AEFA 4K8DA 1GREA 2WDQA 4I59A 4NTCA 2R46A 3NRNA 4OPIA 2XCGA 4J57A 3AEDA 1Y0PA 1RP0A 2X3NA 2XYOA 1COYA 2WS3A 3AWIA 2XFNA 1E1MA 2R0PA 2YG4A 2ZZCA 1F8SA 2AR8A 3FIMB 2XVHA 4HB9A 3SFEA 3SZFA 5KMPA 1CC6A 1GTHA 1PXAA 4G73A 1F6MA 4JNAA 4A6NB 4A79A 2H89A 2QA1A 4GDPA 3P9UA 2JB2A 4EMWA 2BCPA 5FMHA 5M0ZA 2OA1A 4LA1A 1RYIA 2Y6QA 4D04A 1BGJA 2GV8A 4JN9A 4K7ZA 4U2LA 3T31A 1LPFA 5M10A 2XVIA 3GMCA 1AOGA 2B9WA 3QSEA 4X9NA 1O95A 3ZDNA 2AAQA 2GR0A 3SZCA 4ECHA 5FS8A 4BK1A 4LU6A 1NHRA 2XDOA 5C3JA 4APNA 4E0VA 1DXLA 4JY3A 2GVCA 2B7SA 4Z24A 2JB3A 3ALMA 3DGHA 2B7RA 2XFPA 1D5TA 2C3DA 4NEVA 5U25A 1EL9A 2GB0A 2TMDA 2BCGG 4GR1A 4ZN0A 1NG4A 2JK6A 1ZKQA 3CIRA 5HHFA 1N4WA 3VRAA 3GDNA 1NG3A 2A87A 3ALLA 3KA7A 1L9EA 1VG9A 4Y4LA 3DA1A 1VRQB 2YWLA 1TDEA 2VVMA 2NVKX 2CVJA 4JNQA 4GAVA 2WU2A 4RSLA 1L9CA 1LVLA 3GD3A 5JCNA 4TM1A 2WETA 1D4DA 3IHMA 1KNPA 3QSMA 2X8CA 1F8WA 3BNMA 3T2ZA 3S5WA 4EQXA 2XFUA 1FEAA 3GYJA 2NPXA 4XXGA 4U8JA 4G6HA 4USQA 3M13A 4CNJA 3CNJA 4OPDA 3NN0X 3Q9TA 1VQWA 3I3LA 4YKGA 3ATQA 1TYPA 4U8PA 1BKWA 2YVFA 1S2YA 2R9ZA 2YQUA 3DK8A 3ICTA 3KLJA 2WP5A 2X99A 4EM4A 2WDRA 2YLXA 1PHHA 3H4KA 3QFBA 1Q1RA 1JNRA 5J7XA 3H8LA 4TM3A 1JEHA 3IC9A 2GR2A 3UTEA 2GR3A 3GRTA 4YT0A 1CF3A 3NHOX 1H84A 1RSGA 2Q6UA 1CJ4A 2WOVA 1S3EA 2BRAA 3DJGX 3HYVA 1GRFA 1NDAA 3EAOA 4K5RA 5BUKA 4GAPA 2BACA 2WBAA 2GR1A 3VQRA 1Q1WA 3GMBA 2RGJA 5U63A 2B9YA 2XLSA 2FJDA 4GUVA 4H4PA 4JY2A 4CRTA 1MOKA 1ZK7A 3CNDA 3PVCA 2X50A 3NG7X 2YR5A 2ZBWA 3Q6JA 1XANA 1GRGA 4NWZA 1PBEA 2Z5XA 3D1CA 3NK0X 2Q0KA 4H2RA 2WHDA 3CMMA 3FMWA 1LQTA 4H2PA 4KX6A 4OVIA 4BV6A 1IUWA 1DOBA 3LADA 3P4QA 4G6GA 3P1WA 1PJ7A 4NEWA 5KXJA 1V59A 4A5LA 1DOEA 2C66A 4Z2RA 3I6DA 4C3YA 2C73A 2WP9A 1HYUA 1GNDA 4BURA 5U1OA 4J33A 4YSHA 2V3AA 2UZZA 3KKJA 2VVLA 3UKAA 1VG0A 1ZP0A 3T37A 1S3BA 1E7PA 3SY4A 2YM1A 1FOHA 4HA6A 1X31B 3QJ4A 2E4GA 2ARDA 2BK4A 1H7WA 3LZWA 4J2WA 1IUTA 1Y56A 1CC2A 1GEUA 3AEBA 3DH9A 2QCUA 4UDRA 4USRA 5FS9A 3R9UA 1DODA 1E39A 1H86A 4C5OA 1ZOVA 1N1PA 4B1BA 3RP6A 2BC0A 3G5SA 2B76A 1GALA 2GAGB 4A6NA 2GQFA 1ZY8A 4UP3A 2BK3A 4P9SA 3JSKA 4Z26A 2WOIA 4WX1A 1BF3A 2BYBA 3V76A 4G9KA 1BZLA 2FJEA 4RG3A 4H2NA 4YXDA 2EQ6A 3KPKA 4Z43A 3P4SA 3LOVA 1FL2A 4EQRA 1H82A 4DSGA 3IHGA 5KVIA 3RP8A 2YLSA 2R45A 1IJHA 3UP5A 1ONFA 2F5ZA 3RP7A 3K7QX 1QLBA 4B69A 4EIPA 2BK5A 4AOSA 1XPQA 4OPLA 1FCDA 2B9XA 2JKCA 4TM0A 2XFOA 3L8KA 3ABVA 3V3OA 3PO7A 2YAUA 3BI4A 3II4A 4CY8A 2QAEA 4BK3A 1CJCA 1PS9A 4XWZA 4AOXA 2YR4A 4GRTA 4RG4A 3COXA 4ZCDA 3S61A 1NAAA 2DKIA 4X9MA 3KD9A 2BS3A 2RGHA 3AD8B 1REOA 2V60A 4IA6A 4YTMA 4DGKA 3RHAA 5CQFA 3HYXA 1GOSA 4C77A 1F8RA 3ICSA 2C72A 3NT6A 4U8IA 3VR8A 2E5VA 1H7XA 3SYIA 3UOXA 3NKSA 3OC4A 3AB1A 3VRDB 3UP4A 2XLPA 4ZCCA 4A65A 3CNPA 3UTHA 4CCRA 1XHCA 2QA2A 5FS6A 1JRZA 4FK1A 2WU5A 4U8KA 3V3NA 4DSHA 2GH5A 3IF9A 4CY6A 2ACZA 2RGOA 4A9WA 4OPTA 1GXFA 2C65A 3AYLA 4YSYA 4FDCB 5BRTA 5KMQA 4DNAA 4K2XA 3CPJG 3UKPA 2GQWA 5HXIA 2YM2A 3EANA 2GRTA 4C74A 1K0IA 1H83A 3AD9B 1N4VA 2A89A 5GSNA 3CNSA 1Q9IA 2YLZA 2WQYA 2DKHA 1D4EA 2WESA 2YVGA 4NTDA 1B37A 1GRTA 3DJEA 2C7GA 2XLUA 4B64A 2XLRA 4B63A 1YQZA 2EQ9A 2VQ7A 1IUVA 2J3NA 4AT0A 5JCKA 1GV4A 1DOCA 1TDFA 1K0JA 2ZZ0A 3B3RA 3AE6A 3CPHG 3BNUA 3D8XA 1GRBA 4X4JA 3AE1A 3T0KA 3LXDA 2WEUA 4KPRA 2GMJA 4D03A 5KRQA 4PABA 1GT8A 2X8GA 4N9XA 3VRBA 2PHHA 3O0HA 2YG5A 4EIQA 1IUXA 1NHQA 4B66A 2PYXA 3K7TA 2E1MA 1S2QA 3ATRA 2OALA 1OJCA 5KMRA 4REKA 3QVRA 2CULA 3REDA 1N4UA 3LJPA 4Z25A 2YVJA 3UKHA 4PAAA 1D7LA 2GF3A 2BXRA 1PDHA 4EQWA 5KVHA 1MXTA 1D4CA 1GRHA 2XVJA 4JQ9A 2XVFA 4O5QA 4Y4NA 2Q7VA 3QFAA 4U8MA 5CKUA 5EB5A 4Z44A 3LB8A 4YSXA 2YLRA 5HY5A 3AEAA 2XLTA 3ADAB 3F8PA 4II2A 4XWRA 4II3A 1TDKA 4B68A 1ZOYA 5C2TA 2YG7A 2C76A 3P4PA 1GRAA 3CGEA 3AE9A 4IVOB 3E1TA 3VR9A 3WE0A 3ALJA 3GYXA 3UOZA 1OJ9A 1YY5A 4FK1C 1IUSA 4U8LA 3C96A 2C70A 2IVEA 3AE4A 3GRSA 4GDEA 4YSZA 3UKFA 1LQUA 2C4CA 1IUUA 2WP6A 4UDPA 2IVDA 4UDQA 1VDCA 3CN8A 3UTGA 3P4RA 2TPRA 2YLTA 2CFYA 4A99A 1GTEA 1QO8A 4YKFA 4K22A 3DK4A 1O94A 2Y6RA 4NZHA 1LV0A 3ZYXA 1PXBA 4H4YA 3GD4A 3AXBA 2XVEA 3K7MX 3NNEA 3UCLA 4Z2UA 1YQ4A 5FS7A 4B65A 3G5RA 2X8HA 4ADWA 2FJAA 4MJWA 2FJBA 1DJQA 4H4ZA 4WCTA 5JCLA 3UTFA 4U2SA 3M12A 3QSSA 2BA9A 2V6OA 1M64A 1XDIA 2YR6A 4H4QA 2WPFA 4I58A 3UKKA 4BJYA 3K30A 3SX6A 3GDPA 3C4AA 2H88A 3F8DA 2AQJA 4NTEA 3UKLA 3EF6A 1OJDA 1SEZA 4BJZA 2IIDA 4AP3A 2GEWA 5BULA 3SXIA 5GRTA 1ZDLA 4A7AA 3QVPA 1JOAA 2JAEA 1L9DA 1Y56B
chains in the Genus database with same CATH topology
5L46A 1PXCA 4ICYA 3B6DA 3CNTA 4H4RA 4AP1A 1D7YA 1W4XA 3H8IA 3NK1X 4C3XA 5ER0A 5HYMA 2VRMA 1E1LA 3AE5A 1KSSA 4J56A 4CCQA 2EQ7A 1EL7A 2V61A 2WOWA 3NGCX 3KPFA 3T14A 2BC1A 1KFYA 1UKVG 3C4NA 4YTPA 1YKJA 3BHKA 4H4VA 2R0GA 3HYWA 2BS2A 3FG2P 3CTYA 2APGA 3FBSA 4J36A 5BVAA 1JRYA 2BXSA 1PN0A 1CBOA 2VQBA 3T2YA 3CGDA 4H4WA 5IPYA 3AE8A 5LV9A 1PJ6A 1O5WA 3NYCA 2Z5YA 1PBCA 2R0CA 1E1KA 2JB1A 3AEEA 2VOUA 1QJDA 2R4JA 3AEGA 4TLZA 1Z6LA 1TDOA 1KF6A 4Z2TA 1BWCA 1KNRA 3UOVA 3CGCA 2WPEA 3KU9A 4O5UA 2YLWA 3DJDA 2YG6A 4OCGA 3SZWA 4G74A 5IQ4A 2CDUA 4U8OA 1LJ1A 3NLCA 3URHA 4H4SA 3BI2A 3KVEA 4GCMA 4OPUA 5DBJA 5TR3A 2EQ8A 3RNMA 1B8SA 2WPCA 3ICRA 2C64A 1KSUA 3AE2A 3GYIA 4J34A 4GF7A 4K5SA 1K0LA 1CJ3A 3AE3A 4B67A 1NEKA 1L0VA 2W0HA 5KOXA 3ISHA 5IQ1A 1F3PA 2C75A 1CC4A 1TDNA 1TRBA 3GSIA 2OAMA 1FEBA 1K4QA 5KWFA 4J31A 1JNZA 4YWOA 4H2QA 3EPTA 1ZX9A 2VZ2A 1OJTA 2FBWA 4FX9A 3SFDA 4Y4MA 4OPGA 2ZZBA 3DK9A 3GWFA 3AE7A 3NTAA 1NHPA 4H4XA 4TM4A 5EB4A 1PJ5A 4EQSA 3NH3X 1PBFA 3AECA 4H50A 4TLXA 2BRYA 1MO9A 1P2HA 4CBQA 1OJAA 1B4VA 1EL5A 2V3BA 1FECA 1JU2A 1ZMDA 2OLNA 1EBDA 4LIIA 1CL0A 3M0OA 3G5QA 3LZXA 2JBVA 3IWAA 3NYEA 2RABA 3NIXA 2I0ZA 3DMEA 1EL8A 3UKQA 2VRLA 3SQPA 1CHUA 3SGLA 5KOWA 1NPXA 2WDVA 2C67A 3FPZA 1H81A 3PS9A 4U2TA 2Q0LA 5KMSA 1H6VA 1CJ2A 2GAHB 4IV9A 3UOYA 3AYIA 2HQMA 1PBDA 1LTXR 2XFQA 3F8RA 3AYJA 3NTDA 4M52A 4CNKA 5KNLA 1JRXA 4BK2A 1NENA 1E6EA 3CPIG 5EOWA 4YTNA 1M6IA 1NHSA 2O9ZA 2A8XA 2GMHA 1E1NA 3AD7B 3NYFA 5JCMA 4NNJA 3NN6X 3BI5A 4AT2A 2C3CA 5J60A 3HZLA 2BABA 4JDRA 1DNCA 3NK2X 4H4UA 4H7UA 3SM8A 1BGNA 1YQ3A 1ELIA 2YG3A 2V5ZA 3GWDA 1B5QA 1DJNA 3OZ2A 1GPEA 1GSNA 1PBBA 1P2EA 3DGZA 1TYTA 4U8NA 3T2KA 4EMJA 5JCIA 3ITJA 1KDGA 4OPCA 4IA5A 3CGBA 2BS4A 5EBKA 1GETA 1GESA 2R4EA 3L1RA 3BHFA 4IVMB 3DJJA 1GERA 3SZ0A 4H4TA 4EM3A 2OLOA 1ZMCA 2VVLG 4EMIA 3AEFA 4K8DA 1GREA 2WDQA 4I59A 4NTCA 2R46A 3NRNA 4OPIA 2XCGA 4J57A 3AEDA 1Y0PA 1RP0A 2X3NA 2XYOA 1COYA 2WS3A 3AWIA 2XFNA 1E1MA 2R0PA 2YG4A 2ZZCA 1F8SA 2AR8A 3FIMB 2XVHA 4HB9A 3SFEA 3SZFA 5KMPA 1CC6A 1GTHA 1PXAA 4G73A 1F6MA 4JNAA 4A6NB 4A79A 2H89A 2QA1A 4GDPA 3P9UA 2JB2A 4EMWA 2BCPA 5FMHA 5M0ZA 2OA1A 4LA1A 1RYIA 2Y6QA 4D04A 1BGJA 2GV8A 4JN9A 4K7ZA 4U2LA 3T31A 1LPFA 5M10A 2XVIA 3GMCA 1AOGA 2B9WA 3QSEA 4X9NA 1O95A 3ZDNA 2AAQA 2GR0A 3SZCA 4ECHA 5FS8A 4BK1A 4LU6A 1NHRA 2XDOA 5C3JA 4APNA 4E0VA 1DXLA 4JY3A 2GVCA 2B7SA 4Z24A 2JB3A 3ALMA 3DGHA 2B7RA 2XFPA 1D5TA 2C3DA 4NEVA 5U25A 1EL9A 2GB0A 2TMDA 2BCGG 4GR1A 4ZN0A 1NG4A 2JK6A 1ZKQA 3CIRA 5HHFA 1N4WA 3VRAA 3GDNA 1NG3A 2A87A 3ALLA 3KA7A 1L9EA 1VG9A 4Y4LA 3DA1A 1VRQB 2YWLA 1TDEA 2VVMA 2NVKX 2CVJA 4JNQA 4GAVA 2WU2A 4RSLA 1L9CA 1LVLA 3GD3A 5JCNA 4TM1A 2WETA 1D4DA 3IHMA 1KNPA 3QSMA 2X8CA 1F8WA 3BNMA 3T2ZA 3S5WA 4EQXA 2XFUA 1FEAA 3GYJA 2NPXA 4XXGA 4U8JA 4G6HA 4USQA 3M13A 4CNJA 3CNJA 4OPDA 3NN0X 3Q9TA 1VQWA 3I3LA 4YKGA 3ATQA 1TYPA 4U8PA 1BKWA 2YVFA 1S2YA 2R9ZA 2YQUA 3DK8A 3ICTA 3KLJA 2WP5A 2X99A 4EM4A 2WDRA 2YLXA 1PHHA 3H4KA 3QFBA 1Q1RA 1JNRA 5J7XA 3H8LA 4TM3A 1JEHA 3IC9A 2GR2A 3UTEA 2GR3A 3GRTA 4YT0A 1CF3A 3NHOX 1H84A 1RSGA 2Q6UA 1CJ4A 2WOVA 1S3EA 2BRAA 3DJGX 3HYVA 1GRFA 1NDAA 3EAOA 4K5RA 5BUKA 4GAPA 2BACA 2WBAA 2GR1A 3VQRA 1Q1WA 3GMBA 2RGJA 5U63A 2B9YA 2XLSA 2FJDA 4GUVA 4H4PA 4JY2A 4CRTA 1MOKA 1ZK7A 3CNDA 3PVCA 2X50A 3NG7X 2YR5A 2ZBWA 3Q6JA 1XANA 1GRGA 4NWZA 1PBEA 2Z5XA 3D1CA 3NK0X 2Q0KA 4H2RA 2WHDA 3CMMA 3FMWA 1LQTA 4H2PA 4KX6A 4OVIA 4BV6A 1IUWA 1DOBA 3LADA 3P4QA 4G6GA 3P1WA 1PJ7A 4NEWA 5KXJA 1V59A 4A5LA 1DOEA 2C66A 4Z2RA 3I6DA 4C3YA 2C73A 2WP9A 1HYUA 1GNDA 4BURA 5U1OA 4J33A 4YSHA 2V3AA 2UZZA 3KKJA 2VVLA 3UKAA 1VG0A 1ZP0A 3T37A 1S3BA 1E7PA 3SY4A 2YM1A 1FOHA 4HA6A 1X31B 3QJ4A 2E4GA 2ARDA 2BK4A 1H7WA 3LZWA 4J2WA 1IUTA 1Y56A 1CC2A 1GEUA 3AEBA 3DH9A 2QCUA 4UDRA 4USRA 5FS9A 3R9UA 1DODA 1E39A 1H86A 4C5OA 1ZOVA 1N1PA 4B1BA 3RP6A 2BC0A 3G5SA 2B76A 1GALA 2GAGB 4A6NA 2GQFA 1ZY8A 4UP3A 2BK3A 4P9SA 3JSKA 4Z26A 2WOIA 4WX1A 1BF3A 2BYBA 3V76A 4G9KA 1BZLA 2FJEA 4RG3A 4H2NA 4YXDA 2EQ6A 3KPKA 4Z43A 3P4SA 3LOVA 1FL2A 4EQRA 1H82A 4DSGA 3IHGA 5KVIA 3RP8A 2YLSA 2R45A 1IJHA 3UP5A 1ONFA 2F5ZA 3RP7A 3K7QX 1QLBA 4B69A 4EIPA 2BK5A 4AOSA 1XPQA 4OPLA 1FCDA 2B9XA 2JKCA 4TM0A 2XFOA 3L8KA 3ABVA 3V3OA 3PO7A 2YAUA 3BI4A 3II4A 4CY8A 2QAEA 4BK3A 1CJCA 1PS9A 4XWZA 4AOXA 2YR4A 4GRTA 4RG4A 3COXA 4ZCDA 3S61A 1NAAA 2DKIA 4X9MA 3KD9A 2BS3A 2RGHA 3AD8B 1REOA 2V60A 4IA6A 4YTMA 4DGKA 3RHAA 5CQFA 3HYXA 1GOSA 4C77A 1F8RA 3ICSA 2C72A 3NT6A 4U8IA 3VR8A 2E5VA 1H7XA 3SYIA 3UOXA 3NKSA 3OC4A 3AB1A 3VRDB 3UP4A 2XLPA 4ZCCA 4A65A 3CNPA 3UTHA 4CCRA 1XHCA 2QA2A 5FS6A 1JRZA 4FK1A 2WU5A 4U8KA 3V3NA 4DSHA 2GH5A 3IF9A 4CY6A 2ACZA 2RGOA 4A9WA 4OPTA 1GXFA 2C65A 3AYLA 4YSYA 4FDCB 5BRTA 5KMQA 4DNAA 4K2XA 3CPJG 3UKPA 2GQWA 5HXIA 2YM2A 3EANA 2GRTA 4C74A 1K0IA 1H83A 3AD9B 1N4VA 2A89A 5GSNA 3CNSA 1Q9IA 2YLZA 2WQYA 2DKHA 1D4EA 2WESA 2YVGA 4NTDA 1B37A 1GRTA 3DJEA 2C7GA 2XLUA 4B64A 2XLRA 4B63A 1YQZA 2EQ9A 2VQ7A 1IUVA 2J3NA 4AT0A 5JCKA 1GV4A 1DOCA 1TDFA 1K0JA 2ZZ0A 3B3RA 3AE6A 3CPHG 3BNUA 3D8XA 1GRBA 4X4JA 3AE1A 3T0KA 3LXDA 2WEUA 4KPRA 2GMJA 4D03A 5KRQA 4PABA 1GT8A 2X8GA 4N9XA 3VRBA 2PHHA 3O0HA 2YG5A 4EIQA 1IUXA 1NHQA 4B66A 2PYXA 3K7TA 2E1MA 1S2QA 3ATRA 2OALA 1OJCA 5KMRA 4REKA 3QVRA 2CULA 3REDA 1N4UA 3LJPA 4Z25A 2YVJA 3UKHA 4PAAA 1D7LA 2GF3A 2BXRA 1PDHA 4EQWA 5KVHA 1MXTA 1D4CA 1GRHA 2XVJA 4JQ9A 2XVFA 4O5QA 4Y4NA 2Q7VA 3QFAA 4U8MA 5CKUA 5EB5A 4Z44A 3LB8A 4YSXA 2YLRA 5HY5A 3AEAA 2XLTA 3ADAB 3F8PA 4II2A 4XWRA 4II3A 1TDKA 4B68A 1ZOYA 5C2TA 2YG7A 2C76A 3P4PA 1GRAA 3CGEA 3AE9A 4IVOB 3E1TA 3VR9A 3WE0A 3ALJA 3GYXA 3UOZA 1OJ9A 1YY5A 4FK1C 1IUSA 4U8LA 3C96A 2C70A 2IVEA 3AE4A 3GRSA 4GDEA 4YSZA 3UKFA 1LQUA 2C4CA 1IUUA 2WP6A 4UDPA 2IVDA 4UDQA 1VDCA 3CN8A 3UTGA 3P4RA 2TPRA 2YLTA 2CFYA 4A99A 1GTEA 1QO8A 4YKFA 4K22A 3DK4A 1O94A 2Y6RA 4NZHA 1LV0A 3ZYXA 1PXBA 4H4YA 3GD4A 3AXBA 2XVEA 3K7MX 3NNEA 3UCLA 4Z2UA 1YQ4A 5FS7A 4B65A 3G5RA 2X8HA 4ADWA 2FJAA 4MJWA 2FJBA 1DJQA 4H4ZA 4WCTA 5JCLA 3UTFA 4U2SA 3M12A 3QSSA 2BA9A 2V6OA 1M64A 1XDIA 2YR6A 4H4QA 2WPFA 4I58A 3UKKA 4BJYA 3K30A 3SX6A 3GDPA 3C4AA 2H88A 3F8DA 2AQJA 4NTEA 3UKLA 3EF6A 1OJDA 1SEZA 4BJZA 2IIDA 4AP3A 2GEWA 5BULA 3SXIA 5GRTA 1ZDLA 4A7AA 3QVPA 1JOAA 2JAEA 1L9DA 1Y56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L46 A;  1PXC A;  4ICY A;  3B6D A;  3CNT A;  4H4R A;  4AP1 A;  1D7Y A;  1W4X A;  3H8I A;  3NK1 X;  4C3X A;  5ER0 A;  5HYM A;  2VRM A;  1E1L A;  3AE5 A;  1KSS A;  4J56 A;  4CCQ A;  2EQ7 A;  1EL7 A;  2V61 A;  2WOW A;  3NGC X;  3KPF A;  4YTP A;  2BC1 A;  1KFY A;  1UKV G;  3C4N A;  1YKJ A;  3BHK A;  4H4V A;  2R0G A;  2BS2 A;  3FG2 P;  3CTY A;  2APG A;  3FBS A;  4J36 A;  5BVA A;  1JRY A;  2BXS A;  1PN0 A;  1CBO A;  2VQB A;  5IPY A;  3CGD A;  4H4W A;  3AE8 A;  5LV9 A;  1PJ6 A;  1O5W A;  3NYC A;  2Z5Y A;  1PBC A;  2R0C A;  1E1K A;  2JB1 A;  3AEE A;  2VOU A;  1QJD A;  2R4J A;  3AEG A;  4TLZ A;  1Z6L A;  1TDO A;  1KF6 A;  4Z2T A;  1BWC A;  1KNR A;  3UOV A;  3CGC A;  2WPE A;  3KU9 A;  4O5U A;  2YLW A;  3DJD A;  2YG6 A;  4OCG A;  5IQ4 A;  2CDU A;  4U8O A;  1LJ1 A;  3NLC A;  3URH A;  4H4S A;  3BI2 A;  3KVE A;  4GCM A;  4OPU A;  5DBJ A;  5TR3 A;  2EQ8 A;  3RNM A;  1B8S A;  2WPC A;  3ICR A;  2C64 A;  1KSU A;  3AE2 A;  3GYI A;  4J34 A;  4GF7 A;  4K5S A;  1K0L A;  1CJ3 A;  3AE3 A;  4B67 A;  1NEK A;  1L0V A;  2W0H A;  5KOX A;  3ISH A;  5IQ1 A;  1F3P A;  2C75 A;  1CC4 A;  1TDN A;  1TRB A;  3GSI A;  2OAM A;  1FEB A;  1K4Q A;  5KWF A;  4J31 A;  1JNZ A;  4YWO A;  4H2Q A;  3EPT A;  1ZX9 A;  2VZ2 A;  1OJT A;  2FBW A;  4FX9 A;  3SFD A;  4Y4M A;  4OPG A;  2ZZB A;  3DK9 A;  3GWF A;  3AE7 A;  3NTA A;  1NHP A;  4H4X A;  4TM4 A;  5EB4 A;  1PJ5 A;  4EQS A;  3NH3 X;  1PBF A;  3AEC A;  4H50 A;  4TLX A;  1MO9 A;  1P2H A;  4CBQ A;  1OJA A;  1B4V A;  1EL5 A;  2V3B A;  1FEC A;  1JU2 A;  1ZMD A;  2OLN A;  1EBD A;  4LII A;  1CL0 A;  3M0O A;  3G5Q A;  3LZX A;  2JBV A;  3IWA A;  3NYE A;  2RAB A;  3NIX A;  2I0Z A;  3DME A;  1EL8 A;  3UKQ A;  2VRL A;  3SQP A;  1CHU A;  3SGL A;  5KOW A;  1NPX A;  2WDV A;  2C67 A;  3FPZ A;  1H81 A;  3PS9 A;  4U2T A;  2Q0L A;  1H6V A;  1CJ2 A;  2GAH B;  4IV9 A;  3UOY A;  3AYI A;  2HQM A;  1PBD A;  1LTX R;  2XFQ A;  3F8R A;  3AYJ A;  3NTD A;  4M52 A;  4CNK A;  1JRX A;  4BK2 A;  1NEN A;  1E6E A;  3CPI G;  5EOW A;  4YTN A;  1M6I A;  1NHS A;  2O9Z A;  2A8X A;  2GMH A;  1E1N A;  3AD7 B;  3NYF A;  5JCM A;  3NN6 X;  3BI5 A;  4AT2 A;  2C3C A;  5J60 A;  3HZL A;  2BAB A;  4JDR A;  1DNC A;  3NK2 X;  4H4U A;  4H7U A;  3SM8 A;  1BGN A;  1YQ3 A;  1ELI A;  2YG3 A;  2V5Z A;  3GWD A;  1B5Q A;  1DJN A;  3OZ2 A;  1GPE A;  1GSN A;  1PBB A;  1P2E A;  3DGZ A;  1TYT A;  4U8N A;  4EMJ A;  5JCI A;  3ITJ A;  1KDG A;  4OPC A;  4IA5 A;  3CGB A;  2BS4 A;  5EBK A;  1GET A;  1GES A;  2R4E A;  3L1R A;  3BHF A;  4IVM B;  3DJJ A;  1GER A;  4EM3 A;  4H4T A;  2OLO A;  1ZMC A;  2VVL G;  4EMI A;  3AEF A;  4K8D A;  1GRE A;  2WDQ A;  4I59 A;  4NTC A;  2R46 A;  3NRN A;  4OPI A;  2XCG A;  4J57 A;  3AED A;  1Y0P A;  1RP0 A;  2X3N A;  2XYO A;  1COY A;  2WS3 A;  3AWI A;  2XFN A;  1E1M A;  2R0P A;  2YG4 A;  2ZZC A;  1F8S A;  2AR8 A;  3FIM B;  2XVH A;  4HB9 A;  3SFE A;  1CC6 A;  1GTH A;  1PXA A;  1F6M A;  4JNA A;  4A6N B;  4A79 A;  2H89 A;  2QA1 A;  4GDP A;  3P9U A;  2JB2 A;  4EMW A;  2BCP A;  5FMH A;  5M0Z A;  2OA1 A;  4LA1 A;  1RYI A;  2Y6Q A;  4D04 A;  1BGJ A;  2GV8 A;  4JN9 A;  4K7Z A;  4U2L A;  5M10 A;  1LPF A;  2XVI A;  3GMC A;  1AOG A;  2B9W A;  3QSE A;  4X9N A;  1O95 A;  3ZDN A;  2AAQ A;  2GR0 A;  4ECH A;  5FS8 A;  4BK1 A;  4LU6 A;  1NHR A;  2XDO A;  5C3J A;  4APN A;  4E0V A;  1DXL A;  4JY3 A;  2GVC A;  2B7S A;  4Z24 A;  2JB3 A;  3ALM A;  3DGH A;  2B7R A;  2XFP A;  1D5T A;  2C3D A;  4NEV A;  5U25 A;  1EL9 A;  2GB0 A;  2TMD A;  2BCG G;  4GR1 A;  4ZN0 A;  1NG4 A;  2JK6 A;  1ZKQ A;  3CIR A;  5HHF A;  1N4W A;  3VRA A;  3GDN A;  1NG3 A;  2A87 A;  3ALL A;  3KA7 A;  1L9E A;  1VG9 A;  4Y4L A;  3DA1 A;  1VRQ B;  2YWL A;  1TDE A;  2VVM A;  2NVK X;  2CVJ A;  4JNQ A;  2WU2 A;  4RSL A;  1L9C A;  1LVL A;  3GD3 A;  5JCN A;  4TM1 A;  2WET A;  1D4D A;  3IHM A;  1KNP A;  3QSM A;  2X8C A;  1F8W A;  3BNM A;  4EQX A;  3S5W A;  2XFU A;  1FEA A;  3GYJ A;  2NPX A;  4XXG A;  4U8J A;  4USQ A;  3M13 A;  4CNJ A;  3CNJ A;  4OPD A;  3NN0 X;  3Q9T A;  1VQW A;  3I3L A;  4YKG A;  3ATQ A;  1TYP A;  4U8P A;  1BKW A;  2YVF A;  1S2Y A;  2R9Z A;  2YQU A;  3DK8 A;  3ICT A;  3KLJ A;  2WP5 A;  2X99 A;  4EM4 A;  2WDR A;  2YLX A;  1PHH A;  3H4K A;  3QFB A;  1Q1R A;  1JNR A;  5J7X A;  3H8L A;  4TM3 A;  1JEH A;  3IC9 A;  2GR2 A;  3UTE A;  2GR3 A;  3GRT A;  4YT0 A;  1CF3 A;  3NHO X;  1H84 A;  1RSG A;  2Q6U A;  1CJ4 A;  2WOV A;  1S3E A;  3DJG X;  1GRF A;  1NDA A;  3EAO A;  4K5R A;  5BUK A;  2BAC A;  2WBA A;  2GR1 A;  3VQR A;  1Q1W A;  3GMB A;  2RGJ A;  5U63 A;  2B9Y A;  2XLS A;  2FJD A;  4GUV A;  4H4P A;  4JY2 A;  4CRT A;  1MOK A;  1ZK7 A;  3CND A;  3PVC A;  2X50 A;  3NG7 X;  2YR5 A;  2ZBW A;  3Q6J A;  1XAN A;  1GRG A;  1PBE A;  2Z5X A;  3D1C A;  3NK0 X;  2Q0K A;  4H2R A;  2WHD A;  3FMW A;  1LQT A;  4H2P A;  4KX6 A;  4OVI A;  4BV6 A;  1IUW A;  1DOB A;  3LAD A;  3P4Q A;  3P1W A;  1PJ7 A;  4NEW A;  5KXJ A;  1V59 A;  4A5L A;  1DOE A;  2C66 A;  4Z2R A;  3I6D A;  4C3Y A;  2C73 A;  2WP9 A;  1HYU A;  1GND A;  4BUR A;  5U1O A;  4J33 A;  4YSH A;  2V3A A;  2UZZ A;  3KKJ A;  2VVL A;  3UKA A;  1VG0 A;  1ZP0 A;  3T37 A;  1S3B A;  1E7P A;  2YM1 A;  1FOH A;  4HA6 A;  1X31 B;  3QJ4 A;  2E4G A;  2ARD A;  2BK4 A;  1H7W A;  3LZW A;  4J2W A;  1IUT A;  1Y56 A;  1CC2 A;  1GEU A;  3AEB A;  3DH9 A;  2QCU A;  4UDR A;  4USR A;  5FS9 A;  3R9U A;  1DOD A;  1E39 A;  1H86 A;  4C5O A;  1ZOV A;  1N1P A;  4B1B A;  3RP6 A;  2BC0 A;  3G5S A;  2B76 A;  1GAL A;  2GAG B;  4A6N A;  2GQF A;  1ZY8 A;  4UP3 A;  2BK3 A;  4P9S A;  3JSK A;  4Z26 A;  2WOI A;  4WX1 A;  1BF3 A;  2BYB A;  3V76 A;  1BZL A;  2FJE A;  4RG3 A;  4H2N A;  4YXD A;  2EQ6 A;  4Z43 A;  3P4S A;  3LOV A;  1FL2 A;  4EQR A;  1H82 A;  4DSG A;  3IHG A;  5KVI A;  3RP8 A;  2YLS A;  2R45 A;  1IJH A;  3UP5 A;  1ONF A;  2F5Z A;  3RP7 A;  3K7Q X;  1QLB A;  4B69 A;  4EIP A;  2BK5 A;  4AOS A;  1XPQ A;  4OPL A;  1FCD A;  2B9X A;  2JKC A;  4TM0 A;  2XFO A;  3L8K A;  3ABV A;  3V3O A;  3PO7 A;  2YAU A;  3BI4 A;  3II4 A;  4CY8 A;  2QAE A;  4BK3 A;  1CJC A;  1PS9 A;  4XWZ A;  4AOX A;  2YR4 A;  4GRT A;  4RG4 A;  3COX A;  4ZCD A;  3S61 A;  1NAA A;  2DKI A;  4X9M A;  3KD9 A;  2BS3 A;  2RGH A;  3AD8 B;  1REO A;  2V60 A;  4IA6 A;  4YTM A;  4DGK A;  3RHA A;  5CQF A;  1GOS A;  4C77 A;  1F8R A;  3ICS A;  2C72 A;  3NT6 A;  4U8I A;  3VR8 A;  2E5V A;  1H7X A;  3UOX A;  3NKS A;  3OC4 A;  3AB1 A;  3VRD B;  3UP4 A;  2XLP A;  4ZCC A;  4A65 A;  3CNP A;  3UTH A;  4CCR A;  1XHC A;  2QA2 A;  5FS6 A;  1JRZ A;  4FK1 A;  2WU5 A;  4U8K A;  3V3N A;  4DSH A;  2GH5 A;  3IF9 A;  4CY6 A;  2ACZ A;  2RGO A;  4A9W A;  4OPT A;  1GXF A;  2C65 A;  3AYL A;  4YSY A;  4FDC B;  5BRT A;  4DNA A;  4K2X A;  3CPJ G;  3UKP A;  2GQW A;  5HXI A;  2YM2 A;  3EAN A;  2GRT A;  4C74 A;  1K0I A;  1H83 A;  3AD9 B;  1N4V A;  2A89 A;  5GSN A;  3CNS A;  1Q9I A;  2YLZ A;  2WQY A;  2DKH A;  1D4E A;  2WES A;  2YVG A;  4NTD A;  1B37 A;  1GRT A;  3DJE A;  2C7G A;  2XLU A;  4B64 A;  2XLR A;  4B63 A;  1YQZ A;  2EQ9 A;  2VQ7 A;  1IUV A;  2J3N A;  4AT0 A;  5JCK A;  1GV4 A;  1DOC A;  1TDF A;  1K0J A;  2ZZ0 A;  3B3R A;  3AE6 A;  3CPH G;  3BNU A;  3D8X A;  1GRB A;  4X4J A;  3AE1 A;  3LXD A;  2WEU A;  4KPR A;  2GMJ A;  4D03 A;  5KRQ A;  4PAB A;  1GT8 A;  2X8G A;  4N9X A;  3VRB A;  2PHH A;  3O0H A;  2YG5 A;  4EIQ A;  1IUX A;  1NHQ A;  4B66 A;  2PYX A;  3K7T A;  2E1M A;  1S2Q A;  3ATR A;  2OAL A;  1OJC A;  4REK A;  3QVR A;  2CUL A;  3RED A;  1N4U A;  3LJP A;  4Z25 A;  2YVJ A;  3UKH A;  4PAA A;  1D7L A;  2GF3 A;  2BXR A;  1PDH A;  4EQW A;  5KVH A;  1MXT A;  1D4C A;  1GRH A;  2XVJ A;  4JQ9 A;  2XVF A;  4O5Q A;  4Y4N A;  2Q7V A;  3QFA A;  4U8M A;  5CKU A;  5EB5 A;  4Z44 A;  3LB8 A;  4YSX A;  2YLR A;  5HY5 A;  3AEA A;  2XLT A;  3ADA B;  3F8P A;  4XWR A;  1TDK A;  4B68 A;  1ZOY A;  5C2T A;  2YG7 A;  2C76 A;  3P4P A;  1GRA A;  3CGE A;  3AE9 A;  4IVO B;  3E1T A;  3VR9 A;  3WE0 A;  3ALJ A;  3UOZ A;  1OJ9 A;  1YY5 A;  4FK1 C;  1IUS A;  4U8L A;  3C96 A;  2C70 A;  2IVE A;  3AE4 A;  3GRS A;  4GDE A;  4YSZ A;  3UKF A;  1LQU A;  2WP6 A;  1IUU A;  4UDP A;  2IVD A;  4UDQ A;  1VDC A;  3CN8 A;  3UTG A;  3P4R A;  2TPR A;  2YLT A;  2CFY A;  4A99 A;  1GTE A;  1QO8 A;  4YKF A;  4K22 A;  3DK4 A;  1O94 A;  2Y6R A;  4NZH A;  1LV0 A;  3ZYX A;  1PXB A;  4H4Y A;  3GD4 A;  3AXB A;  2XVE A;  3K7M X;  3NNE A;  3UCL A;  4Z2U A;  1YQ4 A;  5FS7 A;  4B65 A;  3G5R A;  2X8H A;  4ADW A;  2FJA A;  4MJW A;  2FJB A;  1DJQ A;  4H4Z A;  4WCT A;  5JCL A;  3UTF A;  4U2S A;  3M12 A;  3QSS A;  2BA9 A;  2V6O A;  1M64 A;  1XDI A;  2YR6 A;  4H4Q A;  2WPF A;  4I58 A;  3UKK A;  4BJY A;  3K30 A;  3GDP A;  3C4A A;  2H88 A;  3F8D A;  2AQJ A;  4NTE A;  3UKL A;  3EF6 A;  1OJD A;  1SEZ A;  4BJZ A;  2IID A;  4AP3 A;  2GEW A;  5BUL A;  5GRT A;  1ZDL A;  4A7A A;  3QVP A;  1JOA A;  2JAE A;  1L9D A;  1Y56 B; 
#chains in the Genus database with same CATH topology
 5L46 A;  1PXC A;  4ICY A;  3B6D A;  3CNT A;  4H4R A;  4AP1 A;  1D7Y A;  1W4X A;  3H8I A;  3NK1 X;  4C3X A;  5ER0 A;  5HYM A;  2VRM A;  1E1L A;  3AE5 A;  1KSS A;  4J56 A;  4CCQ A;  2EQ7 A;  1EL7 A;  2V61 A;  2WOW A;  3NGC X;  3KPF A;  3T14 A;  2BC1 A;  1KFY A;  1UKV G;  3C4N A;  4YTP A;  1YKJ A;  3BHK A;  4H4V A;  2R0G A;  3HYW A;  2BS2 A;  3FG2 P;  3CTY A;  2APG A;  3FBS A;  4J36 A;  5BVA A;  1JRY A;  2BXS A;  1PN0 A;  1CBO A;  2VQB A;  3T2Y A;  3CGD A;  4H4W A;  5IPY A;  3AE8 A;  5LV9 A;  1PJ6 A;  1O5W A;  3NYC A;  2Z5Y A;  1PBC A;  2R0C A;  1E1K A;  2JB1 A;  3AEE A;  2VOU A;  1QJD A;  2R4J A;  3AEG A;  4TLZ A;  1Z6L A;  1TDO A;  1KF6 A;  4Z2T A;  1BWC A;  1KNR A;  3UOV A;  3CGC A;  2WPE A;  3KU9 A;  4O5U A;  2YLW A;  3DJD A;  2YG6 A;  4OCG A;  3SZW A;  4G74 A;  5IQ4 A;  2CDU A;  4U8O A;  1LJ1 A;  3NLC A;  3URH A;  4H4S A;  3BI2 A;  3KVE A;  4GCM A;  4OPU A;  5DBJ A;  5TR3 A;  2EQ8 A;  3RNM A;  1B8S A;  2WPC A;  3ICR A;  2C64 A;  1KSU A;  3AE2 A;  3GYI A;  4J34 A;  4GF7 A;  4K5S A;  1K0L A;  1CJ3 A;  3AE3 A;  4B67 A;  1NEK A;  1L0V A;  2W0H A;  5KOX A;  3ISH A;  5IQ1 A;  1F3P A;  2C75 A;  1CC4 A;  1TDN A;  1TRB A;  3GSI A;  2OAM A;  1FEB A;  1K4Q A;  5KWF A;  4J31 A;  1JNZ A;  4YWO A;  4H2Q A;  3EPT A;  1ZX9 A;  2VZ2 A;  1OJT A;  2FBW A;  4FX9 A;  3SFD A;  4Y4M A;  4OPG A;  2ZZB A;  3DK9 A;  3GWF A;  3AE7 A;  3NTA A;  1NHP A;  4H4X A;  4TM4 A;  5EB4 A;  1PJ5 A;  4EQS A;  3NH3 X;  1PBF A;  3AEC A;  4H50 A;  4TLX A;  2BRY A;  1MO9 A;  1P2H A;  4CBQ A;  1OJA A;  1B4V A;  1EL5 A;  2V3B A;  1FEC A;  1JU2 A;  1ZMD A;  2OLN A;  1EBD A;  4LII A;  1CL0 A;  3M0O A;  3G5Q A;  3LZX A;  2JBV A;  3IWA A;  3NYE A;  2RAB A;  3NIX A;  2I0Z A;  3DME A;  1EL8 A;  3UKQ A;  2VRL A;  3SQP A;  1CHU A;  3SGL A;  5KOW A;  1NPX A;  2WDV A;  2C67 A;  3FPZ A;  1H81 A;  3PS9 A;  4U2T A;  2Q0L A;  5KMS A;  1H6V A;  1CJ2 A;  2GAH B;  4IV9 A;  3UOY A;  3AYI A;  2HQM A;  1PBD A;  1LTX R;  2XFQ A;  3F8R A;  3AYJ A;  3NTD A;  4M52 A;  4CNK A;  5KNL A;  1JRX A;  4BK2 A;  1NEN A;  1E6E A;  3CPI G;  5EOW A;  4YTN A;  1M6I A;  1NHS A;  2O9Z A;  2A8X A;  2GMH A;  1E1N A;  3AD7 B;  3NYF A;  5JCM A;  4NNJ A;  3NN6 X;  3BI5 A;  4AT2 A;  2C3C A;  5J60 A;  3HZL A;  2BAB A;  4JDR A;  1DNC A;  3NK2 X;  4H4U A;  4H7U A;  3SM8 A;  1BGN A;  1YQ3 A;  1ELI A;  2YG3 A;  2V5Z A;  3GWD A;  1B5Q A;  1DJN A;  3OZ2 A;  1GPE A;  1GSN A;  1PBB A;  1P2E A;  3DGZ A;  1TYT A;  4U8N A;  3T2K A;  4EMJ A;  5JCI A;  3ITJ A;  1KDG A;  4OPC A;  4IA5 A;  3CGB A;  2BS4 A;  5EBK A;  1GET A;  1GES A;  2R4E A;  3L1R A;  3BHF A;  4IVM B;  3DJJ A;  1GER A;  3SZ0 A;  4H4T A;  4EM3 A;  2OLO A;  1ZMC A;  2VVL G;  4EMI A;  3AEF A;  4K8D A;  1GRE A;  2WDQ A;  4I59 A;  4NTC A;  2R46 A;  3NRN A;  4OPI A;  2XCG A;  4J57 A;  3AED A;  1Y0P A;  1RP0 A;  2X3N A;  2XYO A;  1COY A;  2WS3 A;  3AWI A;  2XFN A;  1E1M A;  2R0P A;  2YG4 A;  2ZZC A;  1F8S A;  2AR8 A;  3FIM B;  2XVH A;  4HB9 A;  3SFE A;  3SZF A;  5KMP A;  1CC6 A;  1GTH A;  1PXA A;  4G73 A;  1F6M A;  4JNA A;  4A6N B;  4A79 A;  2H89 A;  2QA1 A;  4GDP A;  3P9U A;  2JB2 A;  4EMW A;  2BCP A;  5FMH A;  5M0Z A;  2OA1 A;  4LA1 A;  1RYI A;  2Y6Q A;  4D04 A;  1BGJ A;  2GV8 A;  4JN9 A;  4K7Z A;  4U2L A;  3T31 A;  1LPF A;  5M10 A;  2XVI A;  3GMC A;  1AOG A;  2B9W A;  3QSE A;  4X9N A;  1O95 A;  3ZDN A;  2AAQ A;  2GR0 A;  3SZC A;  4ECH A;  5FS8 A;  4BK1 A;  4LU6 A;  1NHR A;  2XDO A;  5C3J A;  4APN A;  4E0V A;  1DXL A;  4JY3 A;  2GVC A;  2B7S A;  4Z24 A;  2JB3 A;  3ALM A;  3DGH A;  2B7R A;  2XFP A;  1D5T A;  2C3D A;  4NEV A;  5U25 A;  1EL9 A;  2GB0 A;  2TMD A;  2BCG G;  4GR1 A;  4ZN0 A;  1NG4 A;  2JK6 A;  1ZKQ A;  3CIR A;  5HHF A;  1N4W A;  3VRA A;  3GDN A;  1NG3 A;  2A87 A;  3ALL A;  3KA7 A;  1L9E A;  1VG9 A;  4Y4L A;  3DA1 A;  1VRQ B;  2YWL A;  1TDE A;  2VVM A;  2NVK X;  2CVJ A;  4JNQ A;  4GAV A;  2WU2 A;  4RSL A;  1L9C A;  1LVL A;  3GD3 A;  5JCN A;  4TM1 A;  2WET A;  1D4D A;  3IHM A;  1KNP A;  3QSM A;  2X8C A;  1F8W A;  3BNM A;  3T2Z A;  3S5W A;  4EQX A;  2XFU A;  1FEA A;  3GYJ A;  2NPX A;  4XXG A;  4U8J A;  4G6H A;  4USQ A;  3M13 A;  4CNJ A;  3CNJ A;  4OPD A;  3NN0 X;  3Q9T A;  1VQW A;  3I3L A;  4YKG A;  3ATQ A;  1TYP A;  4U8P A;  1BKW A;  2YVF A;  1S2Y A;  2R9Z A;  2YQU A;  3DK8 A;  3ICT A;  3KLJ A;  2WP5 A;  2X99 A;  4EM4 A;  2WDR A;  2YLX A;  1PHH A;  3H4K A;  3QFB A;  1Q1R A;  1JNR A;  5J7X A;  3H8L A;  4TM3 A;  1JEH A;  3IC9 A;  2GR2 A;  3UTE A;  2GR3 A;  3GRT A;  4YT0 A;  1CF3 A;  3NHO X;  1H84 A;  1RSG A;  2Q6U A;  1CJ4 A;  2WOV A;  1S3E A;  2BRA A;  3DJG X;  3HYV A;  1GRF A;  1NDA A;  3EAO A;  4K5R A;  5BUK A;  4GAP A;  2BAC A;  2WBA A;  2GR1 A;  3VQR A;  1Q1W A;  3GMB A;  2RGJ A;  5U63 A;  2B9Y A;  2XLS A;  2FJD A;  4GUV A;  4H4P A;  4JY2 A;  4CRT A;  1MOK A;  1ZK7 A;  3CND A;  3PVC A;  2X50 A;  3NG7 X;  2YR5 A;  2ZBW A;  3Q6J A;  1XAN A;  1GRG A;  4NWZ A;  1PBE A;  2Z5X A;  3D1C A;  3NK0 X;  2Q0K A;  4H2R A;  2WHD A;  3CMM A;  3FMW A;  1LQT A;  4H2P A;  4KX6 A;  4OVI A;  4BV6 A;  1IUW A;  1DOB A;  3LAD A;  3P4Q A;  4G6G A;  3P1W A;  1PJ7 A;  4NEW A;  5KXJ A;  1V59 A;  4A5L A;  1DOE A;  2C66 A;  4Z2R A;  3I6D A;  4C3Y A;  2C73 A;  2WP9 A;  1HYU A;  1GND A;  4BUR A;  5U1O A;  4J33 A;  4YSH A;  2V3A A;  2UZZ A;  3KKJ A;  2VVL A;  3UKA A;  1VG0 A;  1ZP0 A;  3T37 A;  1S3B A;  1E7P A;  3SY4 A;  2YM1 A;  1FOH A;  4HA6 A;  1X31 B;  3QJ4 A;  2E4G A;  2ARD A;  2BK4 A;  1H7W A;  3LZW A;  4J2W A;  1IUT A;  1Y56 A;  1CC2 A;  1GEU A;  3AEB A;  3DH9 A;  2QCU A;  4UDR A;  4USR A;  5FS9 A;  3R9U A;  1DOD A;  1E39 A;  1H86 A;  4C5O A;  1ZOV A;  1N1P A;  4B1B A;  3RP6 A;  2BC0 A;  3G5S A;  2B76 A;  1GAL A;  2GAG B;  4A6N A;  2GQF A;  1ZY8 A;  4UP3 A;  2BK3 A;  4P9S A;  3JSK A;  4Z26 A;  2WOI A;  4WX1 A;  1BF3 A;  2BYB A;  3V76 A;  4G9K A;  1BZL A;  2FJE A;  4RG3 A;  4H2N A;  4YXD A;  2EQ6 A;  3KPK A;  4Z43 A;  3P4S A;  3LOV A;  1FL2 A;  4EQR A;  1H82 A;  4DSG A;  3IHG A;  5KVI A;  3RP8 A;  2YLS A;  2R45 A;  1IJH A;  3UP5 A;  1ONF A;  2F5Z A;  3RP7 A;  3K7Q X;  1QLB A;  4B69 A;  4EIP A;  2BK5 A;  4AOS A;  1XPQ A;  4OPL A;  1FCD A;  2B9X A;  2JKC A;  4TM0 A;  2XFO A;  3L8K A;  3ABV A;  3V3O A;  3PO7 A;  2YAU A;  3BI4 A;  3II4 A;  4CY8 A;  2QAE A;  4BK3 A;  1CJC A;  1PS9 A;  4XWZ A;  4AOX A;  2YR4 A;  4GRT A;  4RG4 A;  3COX A;  4ZCD A;  3S61 A;  1NAA A;  2DKI A;  4X9M A;  3KD9 A;  2BS3 A;  2RGH A;  3AD8 B;  1REO A;  2V60 A;  4IA6 A;  4YTM A;  4DGK A;  3RHA A;  5CQF A;  3HYX A;  1GOS A;  4C77 A;  1F8R A;  3ICS A;  2C72 A;  3NT6 A;  4U8I A;  3VR8 A;  2E5V A;  1H7X A;  3SYI A;  3UOX A;  3NKS A;  3OC4 A;  3AB1 A;  3VRD B;  3UP4 A;  2XLP A;  4ZCC A;  4A65 A;  3CNP A;  3UTH A;  4CCR A;  1XHC A;  2QA2 A;  5FS6 A;  1JRZ A;  4FK1 A;  2WU5 A;  4U8K A;  3V3N A;  4DSH A;  2GH5 A;  3IF9 A;  4CY6 A;  2ACZ A;  2RGO A;  4A9W A;  4OPT A;  1GXF A;  2C65 A;  3AYL A;  4YSY A;  4FDC B;  5BRT A;  5KMQ A;  4DNA A;  4K2X A;  3CPJ G;  3UKP A;  2GQW A;  5HXI A;  2YM2 A;  3EAN A;  2GRT A;  4C74 A;  1K0I A;  1H83 A;  3AD9 B;  1N4V A;  2A89 A;  5GSN A;  3CNS A;  1Q9I A;  2YLZ A;  2WQY A;  2DKH A;  1D4E A;  2WES A;  2YVG A;  4NTD A;  1B37 A;  1GRT A;  3DJE A;  2C7G A;  2XLU A;  4B64 A;  2XLR A;  4B63 A;  1YQZ A;  2EQ9 A;  2VQ7 A;  1IUV A;  2J3N A;  4AT0 A;  5JCK A;  1GV4 A;  1DOC A;  1TDF A;  1K0J A;  2ZZ0 A;  3B3R A;  3AE6 A;  3CPH G;  3BNU A;  3D8X A;  1GRB A;  4X4J A;  3AE1 A;  3T0K A;  3LXD A;  2WEU A;  4KPR A;  2GMJ A;  4D03 A;  5KRQ A;  4PAB A;  1GT8 A;  2X8G A;  4N9X A;  3VRB A;  2PHH A;  3O0H A;  2YG5 A;  4EIQ A;  1IUX A;  1NHQ A;  4B66 A;  2PYX A;  3K7T A;  2E1M A;  1S2Q A;  3ATR A;  2OAL A;  1OJC A;  5KMR A;  4REK A;  3QVR A;  2CUL A;  3RED A;  1N4U A;  3LJP A;  4Z25 A;  2YVJ A;  3UKH A;  4PAA A;  1D7L A;  2GF3 A;  2BXR A;  1PDH A;  4EQW A;  5KVH A;  1MXT A;  1D4C A;  1GRH A;  2XVJ A;  4JQ9 A;  2XVF A;  4O5Q A;  4Y4N A;  2Q7V A;  3QFA A;  4U8M A;  5CKU A;  5EB5 A;  4Z44 A;  3LB8 A;  4YSX A;  2YLR A;  5HY5 A;  3AEA A;  2XLT A;  3ADA B;  3F8P A;  4II2 A;  4XWR A;  4II3 A;  1TDK A;  4B68 A;  1ZOY A;  5C2T A;  2YG7 A;  2C76 A;  3P4P A;  1GRA A;  3CGE A;  3AE9 A;  4IVO B;  3E1T A;  3VR9 A;  3WE0 A;  3ALJ A;  3GYX A;  3UOZ A;  1OJ9 A;  1YY5 A;  4FK1 C;  1IUS A;  4U8L A;  3C96 A;  2C70 A;  2IVE A;  3AE4 A;  3GRS A;  4GDE A;  4YSZ A;  3UKF A;  1LQU A;  2C4C A;  1IUU A;  2WP6 A;  4UDP A;  2IVD A;  4UDQ A;  1VDC A;  3CN8 A;  3UTG A;  3P4R A;  2TPR A;  2YLT A;  2CFY A;  4A99 A;  1GTE A;  1QO8 A;  4YKF A;  4K22 A;  3DK4 A;  1O94 A;  2Y6R A;  4NZH A;  1LV0 A;  3ZYX A;  1PXB A;  4H4Y A;  3GD4 A;  3AXB A;  2XVE A;  3K7M X;  3NNE A;  3UCL A;  4Z2U A;  1YQ4 A;  5FS7 A;  4B65 A;  3G5R A;  2X8H A;  4ADW A;  2FJA A;  4MJW A;  2FJB A;  1DJQ A;  4H4Z A;  4WCT A;  5JCL A;  3UTF A;  4U2S A;  3M12 A;  3QSS A;  2BA9 A;  2V6O A;  1M64 A;  1XDI A;  2YR6 A;  4H4Q A;  2WPF A;  4I58 A;  3UKK A;  4BJY A;  3K30 A;  3SX6 A;  3GDP A;  3C4A A;  2H88 A;  3F8D A;  2AQJ A;  4NTE A;  3UKL A;  3EF6 A;  1OJD A;  1SEZ A;  4BJZ A;  2IID A;  4AP3 A;  2GEW A;  5BUL A;  3SXI A;  5GRT A;  1ZDL A;  4A7A A;  3QVP A;  1JOA A;  2JAE A;  1L9D A;  1Y56 B; 
#chains in the Genus database with same CATH homology
 5L46 A;  1PXC A;  4ICY A;  3B6D A;  3CNT A;  4H4R A;  4AP1 A;  1D7Y A;  1W4X A;  3H8I A;  3NK1 X;  4C3X A;  5ER0 A;  5HYM A;  2VRM A;  1E1L A;  3AE5 A;  1KSS A;  4J56 A;  4CCQ A;  2EQ7 A;  1EL7 A;  2V61 A;  2WOW A;  3NGC X;  3KPF A;  3T14 A;  2BC1 A;  1KFY A;  1UKV G;  3C4N A;  4YTP A;  1YKJ A;  3BHK A;  4H4V A;  2R0G A;  3HYW A;  2BS2 A;  3FG2 P;  3CTY A;  2APG A;  3FBS A;  4J36 A;  5BVA A;  1JRY A;  2BXS A;  1PN0 A;  1CBO A;  2VQB A;  3T2Y A;  3CGD A;  4H4W A;  5IPY A;  3AE8 A;  5LV9 A;  1PJ6 A;  1O5W A;  3NYC A;  2Z5Y A;  1PBC A;  2R0C A;  1E1K A;  2JB1 A;  3AEE A;  2VOU A;  1QJD A;  2R4J A;  3AEG A;  4TLZ A;  1Z6L A;  1TDO A;  1KF6 A;  4Z2T A;  1BWC A;  1KNR A;  3UOV A;  3CGC A;  2WPE A;  3KU9 A;  4O5U A;  2YLW A;  3DJD A;  2YG6 A;  4OCG A;  3SZW A;  4G74 A;  5IQ4 A;  2CDU A;  4U8O A;  1LJ1 A;  3NLC A;  3URH A;  4H4S A;  3BI2 A;  3KVE A;  4GCM A;  4OPU A;  5DBJ A;  5TR3 A;  2EQ8 A;  3RNM A;  1B8S A;  2WPC A;  3ICR A;  2C64 A;  1KSU A;  3AE2 A;  3GYI A;  4J34 A;  4GF7 A;  4K5S A;  1K0L A;  1CJ3 A;  3AE3 A;  4B67 A;  1NEK A;  1L0V A;  2W0H A;  5KOX A;  3ISH A;  5IQ1 A;  1F3P A;  2C75 A;  1CC4 A;  1TDN A;  1TRB A;  3GSI A;  2OAM A;  1FEB A;  1K4Q A;  5KWF A;  4J31 A;  1JNZ A;  4YWO A;  4H2Q A;  3EPT A;  1ZX9 A;  2VZ2 A;  1OJT A;  2FBW A;  4FX9 A;  3SFD A;  4Y4M A;  4OPG A;  2ZZB A;  3DK9 A;  3GWF A;  3AE7 A;  3NTA A;  1NHP A;  4H4X A;  4TM4 A;  5EB4 A;  1PJ5 A;  4EQS A;  3NH3 X;  1PBF A;  3AEC A;  4H50 A;  4TLX A;  2BRY A;  1MO9 A;  1P2H A;  4CBQ A;  1OJA A;  1B4V A;  1EL5 A;  2V3B A;  1FEC A;  1JU2 A;  1ZMD A;  2OLN A;  1EBD A;  4LII A;  1CL0 A;  3M0O A;  3G5Q A;  3LZX A;  2JBV A;  3IWA A;  3NYE A;  2RAB A;  3NIX A;  2I0Z A;  3DME A;  1EL8 A;  3UKQ A;  2VRL A;  3SQP A;  1CHU A;  3SGL A;  5KOW A;  1NPX A;  2WDV A;  2C67 A;  3FPZ A;  1H81 A;  3PS9 A;  4U2T A;  2Q0L A;  5KMS A;  1H6V A;  1CJ2 A;  2GAH B;  4IV9 A;  3UOY A;  3AYI A;  2HQM A;  1PBD A;  1LTX R;  2XFQ A;  3F8R A;  3AYJ A;  3NTD A;  4M52 A;  4CNK A;  5KNL A;  1JRX A;  4BK2 A;  1NEN A;  1E6E A;  3CPI G;  5EOW A;  4YTN A;  1M6I A;  1NHS A;  2O9Z A;  2A8X A;  2GMH A;  1E1N A;  3AD7 B;  3NYF A;  5JCM A;  4NNJ A;  3NN6 X;  3BI5 A;  4AT2 A;  2C3C A;  5J60 A;  3HZL A;  2BAB A;  4JDR A;  1DNC A;  3NK2 X;  4H4U A;  4H7U A;  3SM8 A;  1BGN A;  1YQ3 A;  1ELI A;  2YG3 A;  2V5Z A;  3GWD A;  1B5Q A;  1DJN A;  3OZ2 A;  1GPE A;  1GSN A;  1PBB A;  1P2E A;  3DGZ A;  1TYT A;  4U8N A;  3T2K A;  4EMJ A;  5JCI A;  3ITJ A;  1KDG A;  4OPC A;  4IA5 A;  3CGB A;  2BS4 A;  5EBK A;  1GET A;  1GES A;  2R4E A;  3L1R A;  3BHF A;  4IVM B;  3DJJ A;  1GER A;  3SZ0 A;  4H4T A;  4EM3 A;  2OLO A;  1ZMC A;  2VVL G;  4EMI A;  3AEF A;  4K8D A;  1GRE A;  2WDQ A;  4I59 A;  4NTC A;  2R46 A;  3NRN A;  4OPI A;  2XCG A;  4J57 A;  3AED A;  1Y0P A;  1RP0 A;  2X3N A;  2XYO A;  1COY A;  2WS3 A;  3AWI A;  2XFN A;  1E1M A;  2R0P A;  2YG4 A;  2ZZC A;  1F8S A;  2AR8 A;  3FIM B;  2XVH A;  4HB9 A;  3SFE A;  3SZF A;  5KMP A;  1CC6 A;  1GTH A;  1PXA A;  4G73 A;  1F6M A;  4JNA A;  4A6N B;  4A79 A;  2H89 A;  2QA1 A;  4GDP A;  3P9U A;  2JB2 A;  4EMW A;  2BCP A;  5FMH A;  5M0Z A;  2OA1 A;  4LA1 A;  1RYI A;  2Y6Q A;  4D04 A;  1BGJ A;  2GV8 A;  4JN9 A;  4K7Z A;  4U2L A;  3T31 A;  1LPF A;  5M10 A;  2XVI A;  3GMC A;  1AOG A;  2B9W A;  3QSE A;  4X9N A;  1O95 A;  3ZDN A;  2AAQ A;  2GR0 A;  3SZC A;  4ECH A;  5FS8 A;  4BK1 A;  4LU6 A;  1NHR A;  2XDO A;  5C3J A;  4APN A;  4E0V A;  1DXL A;  4JY3 A;  2GVC A;  2B7S A;  4Z24 A;  2JB3 A;  3ALM A;  3DGH A;  2B7R A;  2XFP A;  1D5T A;  2C3D A;  4NEV A;  5U25 A;  1EL9 A;  2GB0 A;  2TMD A;  2BCG G;  4GR1 A;  4ZN0 A;  1NG4 A;  2JK6 A;  1ZKQ A;  3CIR A;  5HHF A;  1N4W A;  3VRA A;  3GDN A;  1NG3 A;  2A87 A;  3ALL A;  3KA7 A;  1L9E A;  1VG9 A;  4Y4L A;  3DA1 A;  1VRQ B;  2YWL A;  1TDE A;  2VVM A;  2NVK X;  2CVJ A;  4JNQ A;  4GAV A;  2WU2 A;  4RSL A;  1L9C A;  1LVL A;  3GD3 A;  5JCN A;  4TM1 A;  2WET A;  1D4D A;  3IHM A;  1KNP A;  3QSM A;  2X8C A;  1F8W A;  3BNM A;  3T2Z A;  3S5W A;  4EQX A;  2XFU A;  1FEA A;  3GYJ A;  2NPX A;  4XXG A;  4U8J A;  4G6H A;  4USQ A;  3M13 A;  4CNJ A;  3CNJ A;  4OPD A;  3NN0 X;  3Q9T A;  1VQW A;  3I3L A;  4YKG A;  3ATQ A;  1TYP A;  4U8P A;  1BKW A;  2YVF A;  1S2Y A;  2R9Z A;  2YQU A;  3DK8 A;  3ICT A;  3KLJ A;  2WP5 A;  2X99 A;  4EM4 A;  2WDR A;  2YLX A;  1PHH A;  3H4K A;  3QFB A;  1Q1R A;  1JNR A;  5J7X A;  3H8L A;  4TM3 A;  1JEH A;  3IC9 A;  2GR2 A;  3UTE A;  2GR3 A;  3GRT A;  4YT0 A;  1CF3 A;  3NHO X;  1H84 A;  1RSG A;  2Q6U A;  1CJ4 A;  2WOV A;  1S3E A;  2BRA A;  3DJG X;  3HYV A;  1GRF A;  1NDA A;  3EAO A;  4K5R A;  5BUK A;  4GAP A;  2BAC A;  2WBA A;  2GR1 A;  3VQR A;  1Q1W A;  3GMB A;  2RGJ A;  5U63 A;  2B9Y A;  2XLS A;  2FJD A;  4GUV A;  4H4P A;  4JY2 A;  4CRT A;  1MOK A;  1ZK7 A;  3CND A;  3PVC A;  2X50 A;  3NG7 X;  2YR5 A;  2ZBW A;  3Q6J A;  1XAN A;  1GRG A;  4NWZ A;  1PBE A;  2Z5X A;  3D1C A;  3NK0 X;  2Q0K A;  4H2R A;  2WHD A;  3CMM A;  3FMW A;  1LQT A;  4H2P A;  4KX6 A;  4OVI A;  4BV6 A;  1IUW A;  1DOB A;  3LAD A;  3P4Q A;  4G6G A;  3P1W A;  1PJ7 A;  4NEW A;  5KXJ A;  1V59 A;  4A5L A;  1DOE A;  2C66 A;  4Z2R A;  3I6D A;  4C3Y A;  2C73 A;  2WP9 A;  1HYU A;  1GND A;  4BUR A;  5U1O A;  4J33 A;  4YSH A;  2V3A A;  2UZZ A;  3KKJ A;  2VVL A;  3UKA A;  1VG0 A;  1ZP0 A;  3T37 A;  1S3B A;  1E7P A;  3SY4 A;  2YM1 A;  1FOH A;  4HA6 A;  1X31 B;  3QJ4 A;  2E4G A;  2ARD A;  2BK4 A;  1H7W A;  3LZW A;  4J2W A;  1IUT A;  1Y56 A;  1CC2 A;  1GEU A;  3AEB A;  3DH9 A;  2QCU A;  4UDR A;  4USR A;  5FS9 A;  3R9U A;  1DOD A;  1E39 A;  1H86 A;  4C5O A;  1ZOV A;  1N1P A;  4B1B A;  3RP6 A;  2BC0 A;  3G5S A;  2B76 A;  1GAL A;  2GAG B;  4A6N A;  2GQF A;  1ZY8 A;  4UP3 A;  2BK3 A;  4P9S A;  3JSK A;  4Z26 A;  2WOI A;  4WX1 A;  1BF3 A;  2BYB A;  3V76 A;  4G9K A;  1BZL A;  2FJE A;  4RG3 A;  4H2N A;  4YXD A;  2EQ6 A;  3KPK A;  4Z43 A;  3P4S A;  3LOV A;  1FL2 A;  4EQR A;  1H82 A;  4DSG A;  3IHG A;  5KVI A;  3RP8 A;  2YLS A;  2R45 A;  1IJH A;  3UP5 A;  1ONF A;  2F5Z A;  3RP7 A;  3K7Q X;  1QLB A;  4B69 A;  4EIP A;  2BK5 A;  4AOS A;  1XPQ A;  4OPL A;  1FCD A;  2B9X A;  2JKC A;  4TM0 A;  2XFO A;  3L8K A;  3ABV A;  3V3O A;  3PO7 A;  2YAU A;  3BI4 A;  3II4 A;  4CY8 A;  2QAE A;  4BK3 A;  1CJC A;  1PS9 A;  4XWZ A;  4AOX A;  2YR4 A;  4GRT A;  4RG4 A;  3COX A;  4ZCD A;  3S61 A;  1NAA A;  2DKI A;  4X9M A;  3KD9 A;  2BS3 A;  2RGH A;  3AD8 B;  1REO A;  2V60 A;  4IA6 A;  4YTM A;  4DGK A;  3RHA A;  5CQF A;  3HYX A;  1GOS A;  4C77 A;  1F8R A;  3ICS A;  2C72 A;  3NT6 A;  4U8I A;  3VR8 A;  2E5V A;  1H7X A;  3SYI A;  3UOX A;  3NKS A;  3OC4 A;  3AB1 A;  3VRD B;  3UP4 A;  2XLP A;  4ZCC A;  4A65 A;  3CNP A;  3UTH A;  4CCR A;  1XHC A;  2QA2 A;  5FS6 A;  1JRZ A;  4FK1 A;  2WU5 A;  4U8K A;  3V3N A;  4DSH A;  2GH5 A;  3IF9 A;  4CY6 A;  2ACZ A;  2RGO A;  4A9W A;  4OPT A;  1GXF A;  2C65 A;  3AYL A;  4YSY A;  4FDC B;  5BRT A;  5KMQ A;  4DNA A;  4K2X A;  3CPJ G;  3UKP A;  2GQW A;  5HXI A;  2YM2 A;  3EAN A;  2GRT A;  4C74 A;  1K0I A;  1H83 A;  3AD9 B;  1N4V A;  2A89 A;  5GSN A;  3CNS A;  1Q9I A;  2YLZ A;  2WQY A;  2DKH A;  1D4E A;  2WES A;  2YVG A;  4NTD A;  1B37 A;  1GRT A;  3DJE A;  2C7G A;  2XLU A;  4B64 A;  2XLR A;  4B63 A;  1YQZ A;  2EQ9 A;  2VQ7 A;  1IUV A;  2J3N A;  4AT0 A;  5JCK A;  1GV4 A;  1DOC A;  1TDF A;  1K0J A;  2ZZ0 A;  3B3R A;  3AE6 A;  3CPH G;  3BNU A;  3D8X A;  1GRB A;  4X4J A;  3AE1 A;  3T0K A;  3LXD A;  2WEU A;  4KPR A;  2GMJ A;  4D03 A;  5KRQ A;  4PAB A;  1GT8 A;  2X8G A;  4N9X A;  3VRB A;  2PHH A;  3O0H A;  2YG5 A;  4EIQ A;  1IUX A;  1NHQ A;  4B66 A;  2PYX A;  3K7T A;  2E1M A;  1S2Q A;  3ATR A;  2OAL A;  1OJC A;  5KMR A;  4REK A;  3QVR A;  2CUL A;  3RED A;  1N4U A;  3LJP A;  4Z25 A;  2YVJ A;  3UKH A;  4PAA A;  1D7L A;  2GF3 A;  2BXR A;  1PDH A;  4EQW A;  5KVH A;  1MXT A;  1D4C A;  1GRH A;  2XVJ A;  4JQ9 A;  2XVF A;  4O5Q A;  4Y4N A;  2Q7V A;  3QFA A;  4U8M A;  5CKU A;  5EB5 A;  4Z44 A;  3LB8 A;  4YSX A;  2YLR A;  5HY5 A;  3AEA A;  2XLT A;  3ADA B;  3F8P A;  4II2 A;  4XWR A;  4II3 A;  1TDK A;  4B68 A;  1ZOY A;  5C2T A;  2YG7 A;  2C76 A;  3P4P A;  1GRA A;  3CGE A;  3AE9 A;  4IVO B;  3E1T A;  3VR9 A;  3WE0 A;  3ALJ A;  3GYX A;  3UOZ A;  1OJ9 A;  1YY5 A;  4FK1 C;  1IUS A;  4U8L A;  3C96 A;  2C70 A;  2IVE A;  3AE4 A;  3GRS A;  4GDE A;  4YSZ A;  3UKF A;  1LQU A;  2C4C A;  1IUU A;  2WP6 A;  4UDP A;  2IVD A;  4UDQ A;  1VDC A;  3CN8 A;  3UTG A;  3P4R A;  2TPR A;  2YLT A;  2CFY A;  4A99 A;  1GTE A;  1QO8 A;  4YKF A;  4K22 A;  3DK4 A;  1O94 A;  2Y6R A;  4NZH A;  1LV0 A;  3ZYX A;  1PXB A;  4H4Y A;  3GD4 A;  3AXB A;  2XVE A;  3K7M X;  3NNE A;  3UCL A;  4Z2U A;  1YQ4 A;  5FS7 A;  4B65 A;  3G5R A;  2X8H A;  4ADW A;  2FJA A;  4MJW A;  2FJB A;  1DJQ A;  4H4Z A;  4WCT A;  5JCL A;  3UTF A;  4U2S A;  3M12 A;  3QSS A;  2BA9 A;  2V6O A;  1M64 A;  1XDI A;  2YR6 A;  4H4Q A;  2WPF A;  4I58 A;  3UKK A;  4BJY A;  3K30 A;  3SX6 A;  3GDP A;  3C4A A;  2H88 A;  3F8D A;  2AQJ A;  4NTE A;  3UKL A;  3EF6 A;  1OJD A;  1SEZ A;  4BJZ A;  2IID A;  4AP3 A;  2GEW A;  5BUL A;  3SXI A;  5GRT A;  1ZDL A;  4A7A A;  3QVP A;  1JOA A;  2JAE A;  1L9D A;  1Y56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...