4FK1A

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
299
Chain Sequence
b'YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVMKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thioredoxin reductase
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 92
structure length 299
sequence length 299
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A02
5M10A 1V59A 3M12A 2JKCA 2OAMA 4USQA 2VOUA 5JCLA 3FMWA 5IQ4A 2Q0LA 1KF6A 2PHHA 2PYXA 3K7TA 4OPGA 4RG3A 3L1RA 2DKIA 3ABVA 4EM3A 1E6EA 1K0JA 3AEBA 4YSZA 3ICTA 4PABA 3CIRA 2XFPA 3UKLA 4Y4MA 1LTXR 4WCTA 1VG9A 2GRTA 3DJGX 2NVKX 4NEVA 5BVAA 3ICRA 1ZMDA 5BUKA 3AXBA 3ATQA 3COXA 1D5TA 3GSIA 4KPRA 2F5ZA 3PO7A 2BXRA 4EQRA 1ZOVA 3ICSA 1CC6A 4U8IA 1P2HA 3UOYA 3DA1A 3V76A 1GESA 2C7GA 3AD7B 2IVEA 4X4JA 1BZLA 1RSGA 3NGCX 3P4RA 2E4GA 2VVMA 1GXFA 1DXLA 2WU2A 3ADAB 3NYFA 4K22A 3UKQA 4J57A 1GREA 2RGOA 3D1CA 3AE9A 2XLRA 4D03A 1X31B 2Z5YA 1GRFA 2OLOA 4CBQA 1H6VA 1EL5A 1GOSA 4B63A 2GR2A 3FPZA 4I58A 4JN9A 5ER0A 1D4DA 3VR8A 1VDCA 5J7XA 5U1OA 5JCMA 2R4JA 4EQSA 2C70A 2YLSA 4M52A 2C73A 2RGHA 2E5VA 4FDCB 4I59A 4A79A 1NENA 1OJTA 1Q1WA 4AT2A 2R0PA 4O5QA 1NDAA 1S2YA 2X8HA 2GR3A 2VQ7A 2WDQA 3IHMA 1FOHA 1GEUA 2BXSA 1DOEA 1CL0A 3IC9A 3ITJA 1YQ3A 4D04A 1PBCA 1L9EA 5C3JA 3NTDA 1QJDA 2WETA 2NPXA 3F8RA 2ZBWA 3AE2A 4DSGA 3UKAA 1NAAA 1GT8A 4AOXA 3E1TA 1S2QA 3K7MX 3GMBA 1GV4A 1ZKQA 1E39A 1IUUA 2FJAA 3V3NA 4B67A 4B69A 3NNEA 4NZHA 4OCGA 1VG0A 2YG7A 3NIXA 1ONFA 3BI2A 3V3OA 2IIDA 2Q0KA 1ZY8A 4H4RA 4FK1C 3AYIA 4AT0A 1VRQB 1M64A 3S5WA 1CBOA 3GWFA 2WBAA 1NG3A 4YTMA 3SQPA 4YSYA 4JDRA 3BI5A 2Y6RA 3LZWA 4NTCA 3F8DA 3RP7A 3ZDNA 2XLPA 2OLNA 3BNMA 3LOVA 4A9WA 1HYUA 3QVRA 4YXDA 2ARDA 3FIMB 2XYOA 2C64A 2C67A 2X50A 5HXIA 1DNCA 2XFQA 1H83A 1LV0A 2XVHA 3G5SA 2V6OA 4Z43A 1PXAA 1S3BA 2GMHA 4GRTA 2YVJA 4OPLA 2V3BA 3DGZA 3O0HA 2GR0A 4Z2UA 2R0GA 5FS8A 4BJYA 2YLXA 1EL9A 1LVLA 1GPEA 1TDEA 2GF3A 2X3NA 1CJ2A 3CPIG 3KPFA 4GCMA 1FEBA 1TDKA 2YR4A 5J60A 4AOSA 4Z26A 4U2SA 5FMHA 3FBSA 2C72A 3VRDB 4UP3A 2YG3A 3KLJA 2YAUA 2A87A 4TLZA 3AEGA 3SGLA 3RP6A 1E1MA 1CJCA 1GTHA 1E1KA 1YY5A 4IA5A 3P9UA 3CGBA 3LZXA 3VQRA 1FL2A 1KSUA 1REOA 2B76A 1IUWA 1MXTA 3QSMA 4GDPA 3ZYXA 4GUVA 1FCDA 3UKFA 1BGNA 3AYJA 5GRTA 1NPXA 1PDHA 2C75A 3GDPA 4YWOA 1H81A 5L46A 1OJAA 1CC4A 2A89A 3NKSA 4ZN0A 3AE7A 4C3YA 4K2XA 1D7YA 1ZMCA 4A5LA 2TMDA 2XLSA 2C76A 1DJQA 4HA6A 2ZZCA 4ADWA 3LB8A 2BK3A 1UKVG 1PHHA 1D4EA 2X8CA 3AE3A 5FS7A 3LJPA 3CPHG 1IUXA 1XPQA 2AQJA 2A8XA 3OC4A 4U2LA 2C65A 3NH3X 2VVLG 2WP9A 2YLRA 2WPCA 1QLBA 1JEHA 1P2EA 1PJ6A 2UZZA 3D8XA 1KSSA 1OJ9A 3SM8A 2WOIA 3HZLA 1GRHA 2X99A 3CGCA 3NYEA 1D7LA 2QA1A 3AYLA 4FK1A 4E0VA 1KNPA 2Q6UA 2GV8A 3VR9A 2YVFA 2YR5A 4BK3A 4J56A 4TM3A 3F8PA 4JQ9A 2J3NA 4XWRA 4YTNA 2GVCA 4B64A 2BCGG 3AB1A 1GTEA 4U8PA 4FX9A 2XVEA 3DK4A 4B66A 4UDPA 3QFBA 1JRYA 4H4QA 2YWLA 3M0OA 2YQUA 3GMCA 4NEWA 1TRBA 3GD3A 4DGKA 2HQMA 4TLXA 5EOWA 3UP4A 1ZOYA 1O94A 1TDNA 1GRTA 3C4AA 3R9UA 3NK2X 1B8SA 4GF7A 1RYIA 2WESA 5IQ1A 4MJWA 2R45A 5U63A 3PVCA 3P4QA 2C3DA 1MOKA 2BACA 4X9MA 4X9NA 2BA9A 2WU5A 3REDA 1F3PA 5FS9A 2Y6QA 3AD9B 4P9SA 2YG5A 3GRTA 1DJNA 3UOXA 5JCKA 5KXJA 4RSLA 4K5SA 2XFOA 2BYBA 3QSEA 3IWAA 4H50A 4ICYA 1GRGA 4K8DA 4H4TA 4H7UA 4Z25A 3GWDA 4EQXA 3QJ4A 5JCIA 1VQWA 2FJDA 2H88A 2VRMA 3AWIA 1PBDA 3DMEA 4AP3A 3S61A 1DODA 2WP6A 1TYTA 4J2WA 4TM4A 5EB4A 1Z6LA 2XFUA 4JNAA 2OA1A 4NTDA 2IVDA 1PN0A 1JNRA 3NN0X 1PJ5A 5FS6A 1Y56B 1COYA 2WDRA 4BV6A 2APGA 3AE6A 3AEFA 2JAEA 3AE1A 3PS9A 1E1LA 1PS9A 4H4UA 1QO8A 4AP1A 1CHUA 1LJ1A 4YSXA 3EF6A 3DK9A 1JRXA 3WE0A 2QAEA 4ECHA 1JNZA 1H82A 3M13A 4C5OA 3BI4A 3UKPA 1DOCA 3QSSA 4UDQA 5C2TA 1GALA 2CDUA 4REKA 1K4QA 4DNAA 3CTYA 1N4VA 2YR6A 1E7PA 1BKWA 3NN6X 3GRSA 2VVLA 3I6DA 5HYMA 4BK1A 4PAAA 1RP0A 2WPFA 3I3LA 1JU2A 2WOWA 2EQ9A 1MO9A 5JCNA 1Q1RA 3NTAA 4H2QA 4H4VA 3AE4A 1K0IA 4U8JA 1O5WA 5DBJA 4EIPA 3RHAA 2BK5A 4GDEA 4U8KA 3UKKA 4U8NA 1ZDLA 1TYPA 3K7QX 1FECA 3UP5A 1IUVA 1LQUA 2WQYA 4H4ZA 2CULA 2JK6A 1GERA 3FG2P 4YTPA 3NRNA 1XHCA 2BCPA 3UTEA 4A65A 1NHQA 2XCGA 3BHFA 3AE8A 4OPUA 3GYIA 4BJZA 4H4YA 1K0LA 4C77A 1F8RA 4CRTA 3EANA 4EIQA 3CNJA 3CPJG 2QA2A 2C3CA 2JB1A 3G5RA 4A6NA 4O5UA 2YLTA 5IPYA 4K5RA 4EM4A 5KOXA 4CCRA 3KKJA 5KOWA 3GDNA 4EMIA 1NHSA 2R46A 4OPTA 4J34A 5U25A 3CNDA 4H2PA 4ZCDA 3DGHA 4CY6A 4DSHA 1O95A 2XFNA 5BRTA 3DJJA 2BC1A 4J31A 3AEAA 3CNPA 4Z2TA 1JOAA 1XANA 1XDIA 2Z5XA 3NHOX 2VZ2A 4OPCA 4OVIA 3JSKA 1CC2A 2WP5A 1FEAA 1SEZA 3AECA 3B6DA 3P4SA 1IUTA 3II4A 5TR3A 2EQ6A 2GH5A 3CNSA 2R0CA 2GQWA 3RNMA 1PJ7A 4OPIA 3KVEA 2OALA 1NHRA 4HB9A 4EMWA 4C3XA 4YKFA 2FBWA 2V5ZA 1OJDA 4LIIA 5GSNA 3KD9A 3IF9A 4USRA 2XVIA 3Q6JA 4H4PA 1H86A 4B68A 1Y0PA 2YLZA 4CNJA 3ALLA 1KDGA 1EL8A 1PXBA 1YKJA 3UTFA 4CY8A 1LPFA 4C74A 4A99A 1GNDA 3UTHA 1ZX9A 4EQWA 2EQ7A 2WEUA 4K7ZA 1KFYA 2YG6A 2ZZ0A 5EB5A 1PBBA 4U8MA 4U8LA 2BC0A 3P4PA 4U8OA 3KU9A 3H8IA 4BK2A 2O9ZA 2EQ8A 2BABA 4RG4A 2AAQA 3NG7X 2V61A 2XDOA 2XLTA 4H2RA 4LU6A 2X8GA 3EPTA 2GEWA 1N4UA 3ATRA 4IA6A 4J36A 1Q9IA 1B5QA 2XVFA 4EMJA 1LQTA 4H4WA 1OJCA 4KX6A 1ZP0A 5EBKA 3QFAA 4U2TA 4CNKA 2YM2A 3CGDA 4J33A 4TM0A 3NK0X 2C66A 2JBVA 2WHDA 3LXDA 2R9ZA 4WX1A 5CQFA 1F6MA 2XVJA 3VRBA 2B9WA 4A7AA 1B4VA 1H84A 3C4NA 5BULA 4OPDA 2BK4A 3AE5A 4Z44A 1GRBA 2B7RA 1BWCA 2QCUA 3OZ2A 3NK1X 4JNQA 3UTGA 4N9XA 1KNRA 1TDOA 3DK8A 1Y56A 3GD4A 3H8LA 3QVPA 5KVIA 4APNA 1EBDA 1IUSA 3BHKA 1L0VA 2WOVA 4UDRA 2GAGB 2CFYA 3DH9A 4GR1A 4YT0A 4H2NA 4H4SA 2V3AA 3AD8B 1PXCA 2XLUA 2ACZA 2CVJA 3ALJA 2RGJA 1B37A 1PBFA 2WDVA 2WPEA 2GMJA 1GRAA 2ZZBA 2FJEA 3AEEA 3EAOA 4H4XA 5KVHA 3IHGA 4Y4NA 3RP8A 4IV9A 4YSHA 2R4EA 1GETA 1JRZA 3UKHA 4Y4LA 1YQZA 2FJBA 3LADA 1M6IA 3CNTA 2YVGA 2GB0A 4IVOB 1EL7A 1CF3A 1F8WA 2GAHB 3B3RA 3UOZA 1PBEA 4ZCCA 2GR1A 2I0ZA 2JB3A 5HY5A 1TDFA 3K30A 2VRLA 2YLWA 1NG4A 3C96A 3ISHA 3H4KA 4IVMB 2BS2A 2B9YA 1BGJA 1W4XA 2YG4A 3BNUA 2Q7VA 5KRQA 1GSNA 1H7XA 3CGEA 4XWZA 2AR8A 3DJEA 1N4WA 2E1MA 4NTEA 2YM1A 4B1BA 1L9DA 2VQBA 1CJ4A 3P1WA 1IJHA 1YQ4A 3NLCA 1S3EA 4CCQA 3G5QA 3NT6A 5LV9A 2B9XA 2B7SA 4Z2RA 1E1NA 1BF3A 2WS3A 3UOVA 1DOBA 3NYCA 3CN8A 2H89A 4XXGA 1CJ3A 4YKGA 1ZK7A 4JY3A 2DKHA 1NEKA 3GYJA 3SFDA 4B65A 4TM1A 3SFEA 2GQFA 3AEDA 2W0HA 3T37A 4BURA 5KWFA 2JB2A 2V60A 3DJDA 1L9CA 5HHFA 3VRAA 3ALMA 4Z24A 2BS4A 2BS3A 1F8SA 1D4CA 1N1PA 4JY2A 3UCLA 1H7WA 4LA1A 3Q9TA 4A6NB 3L8KA 1ELIA 2RABA 5M0ZA 5CKUA 1AOGA 2TPRA 3URHA 3KA7A 1NHPA
chains in the Genus database with same CATH superfamily
5M10A 1V59A 3M12A 2JKCA 2OAMA 4USQA 2VOUA 5JCLA 3FMWA 5IQ4A 2Q0LA 1KF6A 2PHHA 2PYXA 3K7TA 4OPGA 4RG3A 3L1RA 2DKIA 3ABVA 3SYIA 4EM3A 1E6EA 1K0JA 3AEBA 4YSZA 3ICTA 4PABA 3CIRA 2XFPA 3UKLA 5KMQA 4Y4MA 1LTXR 4WCTA 1VG9A 4NWZA 2GRTA 3DJGX 2NVKX 4NEVA 5BVAA 3ICRA 1ZMDA 5BUKA 3AXBA 3ATQA 3COXA 4NNJA 1D5TA 3GSIA 4KPRA 2C4CA 2F5ZA 3PO7A 2BXRA 4EQRA 1ZOVA 3ICSA 1CC6A 4U8IA 1P2HA 3UOYA 3DA1A 3V76A 1GESA 2C7GA 3AD7B 2IVEA 4X4JA 1BZLA 1RSGA 3NGCX 3P4RA 2E4GA 2VVMA 1GXFA 1DXLA 2WU2A 3ADAB 3NYFA 4K22A 3UKQA 4II2A 4J57A 1GREA 2RGOA 3D1CA 3AE9A 2XLRA 4D03A 1X31B 2Z5YA 1GRFA 2OLOA 4CBQA 1H6VA 1EL5A 1GOSA 4B63A 2GR2A 3FPZA 4I58A 4JN9A 5ER0A 1D4DA 3VR8A 1VDCA 5J7XA 5U1OA 5JCMA 2R4JA 4EQSA 2C70A 2YLSA 4GAVA 4M52A 2C73A 2RGHA 2E5VA 4FDCB 4I59A 4A79A 1NENA 1OJTA 1Q1WA 4AT2A 2R0PA 4O5QA 1NDAA 1S2YA 2X8HA 2GR3A 2VQ7A 2WDQA 3IHMA 1FOHA 1GEUA 2BXSA 1DOEA 1CL0A 3IC9A 3SZCA 3ITJA 1YQ3A 4D04A 1PBCA 1L9EA 5C3JA 3NTDA 1QJDA 2WETA 2NPXA 3F8RA 2ZBWA 3AE2A 3SZFA 3T2YA 4DSGA 3UKAA 1NAAA 3SXIA 1GT8A 4AOXA 3E1TA 1S2QA 3K7MX 4G74A 3GMBA 1GV4A 1ZKQA 1E39A 1IUUA 2FJAA 3V3NA 4B67A 4B69A 3NNEA 4NZHA 4OCGA 1VG0A 2YG7A 3NIXA 1ONFA 3BI2A 3V3OA 2IIDA 2Q0KA 1ZY8A 4H4RA 4FK1C 3AYIA 4AT0A 1VRQB 3HYXA 1M64A 3S5WA 1CBOA 3GWFA 2WBAA 1NG3A 4YTMA 3SQPA 2BRYA 4YSYA 4JDRA 3BI5A 2Y6RA 3LZWA 4NTCA 3F8DA 3RP7A 3ZDNA 2XLPA 2OLNA 3BNMA 3LOVA 4A9WA 1HYUA 3QVRA 4YXDA 2ARDA 3FIMB 2XYOA 2C64A 2C67A 2X50A 5KMPA 5HXIA 1DNCA 2XFQA 1H83A 1LV0A 2XVHA 3G5SA 2V6OA 4Z43A 1PXAA 1S3BA 2GMHA 4GRTA 2YVJA 4OPLA 2V3BA 3DGZA 3O0HA 2GR0A 4Z2UA 2R0GA 5FS8A 4BJYA 2YLXA 1EL9A 1LVLA 1GPEA 1TDEA 2GF3A 2X3NA 1CJ2A 3CPIG 3KPFA 4GCMA 1FEBA 1TDKA 2YR4A 5J60A 4AOSA 4Z26A 4U2SA 5FMHA 3FBSA 3T31A 2C72A 3VRDB 4UP3A 2YG3A 3KLJA 2YAUA 2A87A 4TLZA 3AEGA 3SGLA 3RP6A 3SZ0A 1E1MA 1CJCA 1GTHA 1E1KA 1YY5A 4IA5A 3P9UA 3CGBA 3LZXA 3VQRA 1FL2A 1KSUA 1REOA 2B76A 1IUWA 1MXTA 3QSMA 4GDPA 3ZYXA 4GUVA 1FCDA 3UKFA 1BGNA 3AYJA 5GRTA 1NPXA 1PDHA 2C75A 3GDPA 4YWOA 1H81A 5L46A 1OJAA 1CC4A 2A89A 3NKSA 4ZN0A 3AE7A 4C3YA 4K2XA 2BRAA 1D7YA 1ZMCA 4A5LA 2TMDA 2XLSA 2C76A 3SY4A 1DJQA 4HA6A 2ZZCA 4ADWA 3LB8A 2BK3A 1UKVG 1PHHA 1D4EA 2X8CA 3AE3A 3HYVA 5FS7A 3LJPA 3CPHG 1IUXA 1XPQA 2AQJA 2A8XA 3OC4A 4U2LA 2C65A 3NH3X 2VVLG 2WP9A 2YLRA 2WPCA 1QLBA 1JEHA 1P2EA 1PJ6A 2UZZA 3D8XA 1KSSA 1OJ9A 3SM8A 2WOIA 3HZLA 1GRHA 2X99A 3CGCA 3NYEA 1D7LA 2QA1A 3AYLA 4FK1A 4E0VA 1KNPA 2Q6UA 2GV8A 3VR9A 2YVFA 2YR5A 4BK3A 4J56A 4TM3A 3F8PA 4JQ9A 2J3NA 4XWRA 4YTNA 2GVCA 4B64A 2BCGG 3AB1A 1GTEA 4U8PA 4FX9A 2XVEA 3DK4A 4G6HA 4B66A 4UDPA 3QFBA 1JRYA 4H4QA 2YWLA 3M0OA 2YQUA 3GMCA 4NEWA 1TRBA 3GD3A 4DGKA 2HQMA 3KPKA 4TLXA 5EOWA 3UP4A 1ZOYA 1O94A 1TDNA 1GRTA 3C4AA 3R9UA 3NK2X 1B8SA 4GF7A 1RYIA 2WESA 5IQ1A 4MJWA 2R45A 5U63A 3PVCA 3P4QA 2C3DA 1MOKA 2BACA 4X9MA 4X9NA 2BA9A 2WU5A 3REDA 1F3PA 5FS9A 2Y6QA 3AD9B 4P9SA 2YG5A 3GRTA 1DJNA 3UOXA 5JCKA 5KXJA 4RSLA 4K5SA 2XFOA 2BYBA 3QSEA 3IWAA 4H50A 4ICYA 1GRGA 4K8DA 4H4TA 4H7UA 4Z25A 3GWDA 4EQXA 3QJ4A 5KNLA 5JCIA 1VQWA 2FJDA 2H88A 2VRMA 3AWIA 1PBDA 3DMEA 4AP3A 3S61A 1DODA 4G6GA 3CMMA 2WP6A 1TYTA 4J2WA 4TM4A 5EB4A 1Z6LA 2XFUA 4JNAA 2OA1A 4NTDA 2IVDA 1PN0A 1JNRA 3NN0X 1PJ5A 5FS6A 1Y56B 1COYA 2WDRA 4BV6A 2APGA 3AE6A 3AEFA 2JAEA 3AE1A 3PS9A 1E1LA 1PS9A 4H4UA 1QO8A 4AP1A 1CHUA 1LJ1A 4YSXA 3EF6A 3DK9A 1JRXA 3WE0A 2QAEA 4ECHA 3T2ZA 1JNZA 1H82A 3M13A 4C5OA 3BI4A 3UKPA 1DOCA 3QSSA 4UDQA 5C2TA 1GALA 2CDUA 4REKA 1K4QA 4DNAA 3CTYA 1N4VA 2YR6A 1E7PA 1BKWA 3HYWA 3NN6X 3GRSA 2VVLA 3T2KA 3I6DA 5HYMA 4BK1A 4G9KA 4PAAA 1RP0A 2WPFA 3I3LA 1JU2A 2WOWA 2EQ9A 1MO9A 5JCNA 1Q1RA 3NTAA 4H2QA 4H4VA 3AE4A 1K0IA 4U8JA 1O5WA 5DBJA 4EIPA 3RHAA 2BK5A 4GDEA 4U8KA 3UKKA 4U8NA 1ZDLA 3T14A 1TYPA 3K7QX 1FECA 3UP5A 1IUVA 1LQUA 2WQYA 4H4ZA 2CULA 2JK6A 1GERA 3FG2P 4YTPA 3NRNA 1XHCA 2BCPA 3UTEA 4A65A 1NHQA 2XCGA 3BHFA 3AE8A 4OPUA 3GYIA 4BJZA 4H4YA 1K0LA 4C77A 1F8RA 4CRTA 3EANA 4EIQA 3CNJA 3CPJG 2QA2A 2C3CA 2JB1A 3G5RA 3GYXA 4A6NA 4O5UA 2YLTA 5IPYA 4K5RA 4EM4A 5KOXA 4CCRA 3KKJA 5KOWA 3GDNA 4EMIA 1NHSA 2R46A 4OPTA 4J34A 5U25A 3CNDA 4H2PA 4ZCDA 3DGHA 4CY6A 4DSHA 1O95A 2XFNA 5BRTA 3DJJA 2BC1A 4J31A 3AEAA 3CNPA 4Z2TA 1JOAA 1XANA 1XDIA 2Z5XA 3NHOX 2VZ2A 4OPCA 4OVIA 3JSKA 1CC2A 2WP5A 1FEAA 1SEZA 3AECA 3B6DA 3P4SA 1IUTA 3II4A 5TR3A 2EQ6A 2GH5A 3CNSA 2R0CA 2GQWA 3RNMA 1PJ7A 4OPIA 5KMRA 3SZWA 3KVEA 2OALA 1NHRA 4HB9A 5KMSA 4EMWA 4C3XA 4YKFA 2FBWA 2V5ZA 1OJDA 4LIIA 5GSNA 3KD9A 3IF9A 4USRA 2XVIA 3Q6JA 4H4PA 1H86A 4B68A 1Y0PA 2YLZA 4CNJA 3ALLA 1KDGA 1EL8A 1PXBA 1YKJA 3UTFA 4CY8A 1LPFA 4C74A 4A99A 1GNDA 4G73A 1ZX9A 3UTHA 2EQ7A 2WEUA 4EQWA 4K7ZA 1KFYA 2YG6A 2ZZ0A 5EB5A 1PBBA 4U8MA 4U8LA 3T0KA 2BC0A 3P4PA 4U8OA 3KU9A 3H8IA 4II3A 4BK2A 2O9ZA 2EQ8A 2BABA 4RG4A 2AAQA 3NG7X 2V61A 2XDOA 2XLTA 4H2RA 4LU6A 2X8GA 3EPTA 2GEWA 1N4UA 3ATRA 4IA6A 3SX6A 4J36A 1Q9IA 1B5QA 2XVFA 4EMJA 1LQTA 4H4WA 1OJCA 4KX6A 1ZP0A 5EBKA 3QFAA 4U2TA 4CNKA 2YM2A 3CGDA 4J33A 4TM0A 3NK0X 2C66A 2JBVA 2WHDA 3LXDA 2R9ZA 4WX1A 5CQFA 1F6MA 2XVJA 3VRBA 2B9WA 4A7AA 1B4VA 1H84A 3C4NA 5BULA 4OPDA 2BK4A 3AE5A 4Z44A 1GRBA 2B7RA 1BWCA 2QCUA 3OZ2A 3NK1X 4JNQA 3UTGA 4N9XA 1KNRA 1TDOA 3DK8A 1Y56A 3GD4A 3H8LA 3QVPA 5KVIA 4APNA 1EBDA 1IUSA 3BHKA 1L0VA 2WOVA 4UDRA 2GAGB 2CFYA 3DH9A 4GR1A 4YT0A 4H2NA 4H4SA 2V3AA 3AD8B 1PXCA 2XLUA 2ACZA 2CVJA 3ALJA 2RGJA 1B37A 1PBFA 2WDVA 2WPEA 2GMJA 1GRAA 2ZZBA 2FJEA 3AEEA 3EAOA 4H4XA 5KVHA 3IHGA 4Y4NA 3RP8A 4IV9A 4YSHA 2R4EA 1GETA 1JRZA 3UKHA 4Y4LA 1YQZA 2FJBA 3LADA 1M6IA 3CNTA 2YVGA 2GB0A 4IVOB 1EL7A 1CF3A 1F8WA 2GAHB 3B3RA 3UOZA 1PBEA 4ZCCA 2GR1A 2I0ZA 2JB3A 5HY5A 1TDFA 3K30A 2VRLA 2YLWA 1NG4A 3C96A 3ISHA 3H4KA 4IVMB 2BS2A 2B9YA 1BGJA 1W4XA 2YG4A 3BNUA 2Q7VA 5KRQA 1GSNA 1H7XA 3CGEA 4XWZA 2AR8A 3DJEA 1N4WA 2E1MA 4NTEA 2YM1A 4B1BA 1L9DA 2VQBA 1CJ4A 3P1WA 1IJHA 1YQ4A 3NLCA 1S3EA 4CCQA 3G5QA 3NT6A 5LV9A 2B9XA 2B7SA 4Z2RA 1E1NA 1BF3A 2WS3A 3UOVA 1DOBA 3NYCA 3CN8A 2H89A 4XXGA 1CJ3A 4YKGA 1ZK7A 4JY3A 2DKHA 1NEKA 3GYJA 3SFDA 4B65A 4TM1A 3SFEA 2GQFA 4GAPA 3AEDA 2W0HA 3T37A 4BURA 5KWFA 2JB2A 2V60A 3DJDA 1L9CA 5HHFA 3VRAA 3ALMA 4Z24A 2BS4A 2BS3A 1F8SA 1D4CA 1N1PA 4JY2A 3UCLA 1H7WA 4LA1A 3Q9TA 4A6NB 3L8KA 1ELIA 2RABA 5M0ZA 5CKUA 1AOGA 2TPRA 3URHA 3KA7A 1NHPA
chains in the Genus database with same CATH topology
5M10A 1V59A 3M12A 2JKCA 2OAMA 4USQA 2VOUA 5JCLA 3FMWA 5IQ4A 2Q0LA 1KF6A 2PHHA 2PYXA 3K7TA 4OPGA 4RG3A 3L1RA 2DKIA 3ABVA 3SYIA 4EM3A 1E6EA 1K0JA 3AEBA 4YSZA 3ICTA 4PABA 3CIRA 2XFPA 3UKLA 5KMQA 4Y4MA 1LTXR 4WCTA 1VG9A 4NWZA 2GRTA 3DJGX 2NVKX 4NEVA 5BVAA 3ICRA 1ZMDA 5BUKA 3AXBA 3ATQA 3COXA 4NNJA 1D5TA 3GSIA 4KPRA 2C4CA 2F5ZA 3PO7A 2BXRA 4EQRA 1ZOVA 3ICSA 1CC6A 4U8IA 1P2HA 3UOYA 3DA1A 3V76A 1GESA 2C7GA 3AD7B 2IVEA 4X4JA 1BZLA 1RSGA 3NGCX 3P4RA 2E4GA 2VVMA 1GXFA 1DXLA 2WU2A 3ADAB 3NYFA 4K22A 3UKQA 4II2A 4J57A 1GREA 2RGOA 3D1CA 3AE9A 2XLRA 4D03A 1X31B 2Z5YA 1GRFA 2OLOA 4CBQA 1H6VA 1EL5A 1GOSA 4B63A 2GR2A 3FPZA 4I58A 4JN9A 5ER0A 1D4DA 3VR8A 1VDCA 5J7XA 5U1OA 5JCMA 2R4JA 4EQSA 2C70A 2YLSA 4GAVA 4M52A 2C73A 2RGHA 2E5VA 4FDCB 4I59A 4A79A 1NENA 1OJTA 1Q1WA 4AT2A 2R0PA 4O5QA 1NDAA 1S2YA 2X8HA 2GR3A 2VQ7A 2WDQA 3IHMA 1FOHA 1GEUA 2BXSA 1DOEA 1CL0A 3IC9A 3SZCA 3ITJA 1YQ3A 4D04A 1PBCA 1L9EA 5C3JA 3NTDA 1QJDA 2WETA 2NPXA 3F8RA 2ZBWA 3AE2A 3SZFA 3T2YA 4DSGA 3UKAA 1NAAA 3SXIA 1GT8A 4AOXA 3E1TA 1S2QA 3K7MX 4G74A 3GMBA 1GV4A 1ZKQA 1E39A 1IUUA 2FJAA 3V3NA 4B67A 4B69A 3NNEA 4NZHA 4OCGA 1VG0A 2YG7A 3NIXA 1ONFA 3BI2A 3V3OA 2IIDA 2Q0KA 1ZY8A 4H4RA 4FK1C 3AYIA 4AT0A 1VRQB 3HYXA 1M64A 3S5WA 1CBOA 3GWFA 2WBAA 1NG3A 4YTMA 3SQPA 2BRYA 4YSYA 4JDRA 3BI5A 2Y6RA 3LZWA 4NTCA 3F8DA 3RP7A 3ZDNA 2XLPA 2OLNA 3BNMA 3LOVA 4A9WA 1HYUA 3QVRA 4YXDA 2ARDA 3FIMB 2XYOA 2C64A 2C67A 2X50A 5KMPA 5HXIA 1DNCA 2XFQA 1H83A 1LV0A 2XVHA 3G5SA 2V6OA 4Z43A 1PXAA 1S3BA 2GMHA 4GRTA 2YVJA 4OPLA 2V3BA 3DGZA 3O0HA 2GR0A 4Z2UA 2R0GA 5FS8A 4BJYA 2YLXA 1EL9A 1LVLA 1GPEA 1TDEA 2GF3A 2X3NA 1CJ2A 3CPIG 3KPFA 4GCMA 1FEBA 1TDKA 2YR4A 5J60A 4AOSA 4Z26A 4U2SA 5FMHA 3FBSA 3T31A 2C72A 3VRDB 4UP3A 2YG3A 3KLJA 2YAUA 2A87A 4TLZA 3AEGA 3SGLA 3RP6A 3SZ0A 1E1MA 1CJCA 1GTHA 1E1KA 1YY5A 4IA5A 3P9UA 3CGBA 3LZXA 3VQRA 1FL2A 1KSUA 1REOA 2B76A 1IUWA 1MXTA 3QSMA 4GDPA 3ZYXA 4GUVA 1FCDA 3UKFA 1BGNA 3AYJA 5GRTA 1NPXA 1PDHA 2C75A 3GDPA 4YWOA 1H81A 5L46A 1OJAA 1CC4A 2A89A 3NKSA 4ZN0A 3AE7A 4C3YA 4K2XA 2BRAA 1D7YA 1ZMCA 4A5LA 2TMDA 2XLSA 2C76A 3SY4A 1DJQA 4HA6A 2ZZCA 4ADWA 3LB8A 2BK3A 1UKVG 1PHHA 1D4EA 2X8CA 3AE3A 3HYVA 5FS7A 3LJPA 3CPHG 1IUXA 1XPQA 2AQJA 2A8XA 3OC4A 4U2LA 2C65A 3NH3X 2VVLG 2WP9A 2YLRA 2WPCA 1QLBA 1JEHA 1P2EA 1PJ6A 2UZZA 3D8XA 1KSSA 1OJ9A 3SM8A 2WOIA 3HZLA 1GRHA 2X99A 3CGCA 3NYEA 1D7LA 2QA1A 3AYLA 4FK1A 4E0VA 1KNPA 2Q6UA 2GV8A 3VR9A 2YVFA 2YR5A 4BK3A 4J56A 4TM3A 3F8PA 4JQ9A 2J3NA 4XWRA 4YTNA 2GVCA 4B64A 2BCGG 3AB1A 1GTEA 4U8PA 4FX9A 2XVEA 3DK4A 4G6HA 4B66A 4UDPA 3QFBA 1JRYA 4H4QA 2YWLA 3M0OA 2YQUA 3GMCA 4NEWA 1TRBA 3GD3A 4DGKA 2HQMA 3KPKA 4TLXA 5EOWA 3UP4A 1ZOYA 1O94A 1TDNA 1GRTA 3C4AA 3R9UA 3NK2X 1B8SA 4GF7A 1RYIA 2WESA 5IQ1A 4MJWA 2R45A 5U63A 3PVCA 3P4QA 2C3DA 1MOKA 2BACA 4X9MA 4X9NA 2BA9A 2WU5A 3REDA 1F3PA 5FS9A 2Y6QA 3AD9B 4P9SA 2YG5A 3GRTA 1DJNA 3UOXA 5JCKA 5KXJA 4RSLA 4K5SA 2XFOA 2BYBA 3QSEA 3IWAA 4H50A 4ICYA 1GRGA 4K8DA 4H4TA 4H7UA 4Z25A 3GWDA 4EQXA 3QJ4A 5KNLA 5JCIA 1VQWA 2FJDA 2H88A 2VRMA 3AWIA 1PBDA 3DMEA 4AP3A 3S61A 1DODA 4G6GA 3CMMA 2WP6A 1TYTA 4J2WA 4TM4A 5EB4A 1Z6LA 2XFUA 4JNAA 2OA1A 4NTDA 2IVDA 1PN0A 1JNRA 3NN0X 1PJ5A 5FS6A 1Y56B 1COYA 2WDRA 4BV6A 2APGA 3AE6A 3AEFA 2JAEA 3AE1A 3PS9A 1E1LA 1PS9A 4H4UA 1QO8A 4AP1A 1CHUA 1LJ1A 4YSXA 3EF6A 3DK9A 1JRXA 3WE0A 2QAEA 4ECHA 3T2ZA 1JNZA 1H82A 3M13A 4C5OA 3BI4A 3UKPA 1DOCA 3QSSA 4UDQA 5C2TA 1GALA 2CDUA 4REKA 1K4QA 4DNAA 3CTYA 1N4VA 2YR6A 1E7PA 1BKWA 3HYWA 3NN6X 3GRSA 2VVLA 3T2KA 3I6DA 5HYMA 4BK1A 4G9KA 4PAAA 1RP0A 2WPFA 3I3LA 1JU2A 2WOWA 2EQ9A 1MO9A 5JCNA 1Q1RA 3NTAA 4H2QA 4H4VA 3AE4A 1K0IA 4U8JA 1O5WA 5DBJA 4EIPA 3RHAA 2BK5A 4GDEA 4U8KA 3UKKA 4U8NA 1ZDLA 3T14A 1TYPA 3K7QX 1FECA 3UP5A 1IUVA 1LQUA 2WQYA 4H4ZA 2CULA 2JK6A 1GERA 3FG2P 4YTPA 3NRNA 1XHCA 2BCPA 3UTEA 4A65A 1NHQA 2XCGA 3BHFA 3AE8A 4OPUA 3GYIA 4BJZA 4H4YA 1K0LA 4C77A 1F8RA 4CRTA 3EANA 4EIQA 3CNJA 3CPJG 2QA2A 2C3CA 2JB1A 3G5RA 3GYXA 4A6NA 4O5UA 2YLTA 5IPYA 4K5RA 4EM4A 5KOXA 4CCRA 3KKJA 5KOWA 3GDNA 4EMIA 1NHSA 2R46A 4OPTA 4J34A 5U25A 3CNDA 4H2PA 4ZCDA 3DGHA 4CY6A 4DSHA 1O95A 2XFNA 5BRTA 3DJJA 2BC1A 4J31A 3AEAA 3CNPA 4Z2TA 1JOAA 1XANA 1XDIA 2Z5XA 3NHOX 2VZ2A 4OPCA 4OVIA 3JSKA 1CC2A 2WP5A 1FEAA 1SEZA 3AECA 3B6DA 3P4SA 1IUTA 3II4A 5TR3A 2EQ6A 2GH5A 3CNSA 2R0CA 2GQWA 3RNMA 1PJ7A 4OPIA 5KMRA 3SZWA 3KVEA 2OALA 1NHRA 4HB9A 5KMSA 4EMWA 4C3XA 4YKFA 2FBWA 2V5ZA 1OJDA 4LIIA 5GSNA 3KD9A 3IF9A 4USRA 2XVIA 3Q6JA 4H4PA 1H86A 4B68A 1Y0PA 2YLZA 4CNJA 3ALLA 1KDGA 1EL8A 1PXBA 1YKJA 3UTFA 4CY8A 1LPFA 4C74A 4A99A 1GNDA 4G73A 1ZX9A 3UTHA 2EQ7A 2WEUA 4EQWA 4K7ZA 1KFYA 2YG6A 2ZZ0A 5EB5A 1PBBA 4U8MA 4U8LA 3T0KA 2BC0A 3P4PA 4U8OA 3KU9A 3H8IA 4II3A 4BK2A 2O9ZA 2EQ8A 2BABA 4RG4A 2AAQA 3NG7X 2V61A 2XDOA 2XLTA 4H2RA 4LU6A 2X8GA 3EPTA 2GEWA 1N4UA 3ATRA 4IA6A 3SX6A 4J36A 1Q9IA 1B5QA 2XVFA 4EMJA 1LQTA 4H4WA 1OJCA 4KX6A 1ZP0A 5EBKA 3QFAA 4U2TA 4CNKA 2YM2A 3CGDA 4J33A 4TM0A 3NK0X 2C66A 2JBVA 2WHDA 3LXDA 2R9ZA 4WX1A 5CQFA 1F6MA 2XVJA 3VRBA 2B9WA 4A7AA 1B4VA 1H84A 3C4NA 5BULA 4OPDA 2BK4A 3AE5A 4Z44A 1GRBA 2B7RA 1BWCA 2QCUA 3OZ2A 3NK1X 4JNQA 3UTGA 4N9XA 1KNRA 1TDOA 3DK8A 1Y56A 3GD4A 3H8LA 3QVPA 5KVIA 4APNA 1EBDA 1IUSA 3BHKA 1L0VA 2WOVA 4UDRA 2GAGB 2CFYA 3DH9A 4GR1A 4YT0A 4H2NA 4H4SA 2V3AA 3AD8B 1PXCA 2XLUA 2ACZA 2CVJA 3ALJA 2RGJA 1B37A 1PBFA 2WDVA 2WPEA 2GMJA 1GRAA 2ZZBA 2FJEA 3AEEA 3EAOA 4H4XA 5KVHA 3IHGA 4Y4NA 3RP8A 4IV9A 4YSHA 2R4EA 1GETA 1JRZA 3UKHA 4Y4LA 1YQZA 2FJBA 3LADA 1M6IA 3CNTA 2YVGA 2GB0A 4IVOB 1EL7A 1CF3A 1F8WA 2GAHB 3B3RA 3UOZA 1PBEA 4ZCCA 2GR1A 2I0ZA 2JB3A 5HY5A 1TDFA 3K30A 2VRLA 2YLWA 1NG4A 3C96A 3ISHA 3H4KA 4IVMB 2BS2A 2B9YA 1BGJA 1W4XA 2YG4A 3BNUA 2Q7VA 5KRQA 1GSNA 1H7XA 3CGEA 4XWZA 2AR8A 3DJEA 1N4WA 2E1MA 4NTEA 2YM1A 4B1BA 1L9DA 2VQBA 1CJ4A 3P1WA 1IJHA 1YQ4A 3NLCA 1S3EA 4CCQA 3G5QA 3NT6A 5LV9A 2B9XA 2B7SA 4Z2RA 1E1NA 1BF3A 2WS3A 3UOVA 1DOBA 3NYCA 3CN8A 2H89A 4XXGA 1CJ3A 4YKGA 1ZK7A 4JY3A 2DKHA 1NEKA 3GYJA 3SFDA 4B65A 4TM1A 3SFEA 2GQFA 4GAPA 3AEDA 2W0HA 3T37A 4BURA 5KWFA 2JB2A 2V60A 3DJDA 1L9CA 5HHFA 3VRAA 3ALMA 4Z24A 2BS4A 2BS3A 1F8SA 1D4CA 1N1PA 4JY2A 3UCLA 1H7WA 4LA1A 3Q9TA 4A6NB 3L8KA 1ELIA 2RABA 5M0ZA 5CKUA 1AOGA 2TPRA 3URHA 3KA7A 1NHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M10 A;  1V59 A;  3M12 A;  2JKC A;  2OAM A;  4USQ A;  2VOU A;  5JCL A;  3FMW A;  5IQ4 A;  2Q0L A;  1KF6 A;  2PHH A;  2PYX A;  3K7T A;  4OPG A;  4RG3 A;  3L1R A;  2DKI A;  3ABV A;  4EM3 A;  1E6E A;  1K0J A;  3AEB A;  4YSZ A;  3ICT A;  4PAB A;  3CIR A;  2XFP A;  3UKL A;  4Y4M A;  1LTX R;  4WCT A;  1VG9 A;  2GRT A;  3DJG X;  2NVK X;  4NEV A;  5BVA A;  3ICR A;  1ZMD A;  5BUK A;  3AXB A;  3ATQ A;  3COX A;  1D5T A;  3GSI A;  4KPR A;  2F5Z A;  3PO7 A;  2BXR A;  4EQR A;  1ZOV A;  3ICS A;  1CC6 A;  4U8I A;  1P2H A;  3UOY A;  3DA1 A;  3V76 A;  1GES A;  2C7G A;  3AD7 B;  2IVE A;  4X4J A;  1BZL A;  1RSG A;  3NGC X;  3P4R A;  2E4G A;  2VVM A;  1GXF A;  1DXL A;  2WU2 A;  3ADA B;  3NYF A;  4K22 A;  3UKQ A;  4J57 A;  1GRE A;  2RGO A;  3D1C A;  3AE9 A;  2XLR A;  4D03 A;  1X31 B;  2Z5Y A;  1GRF A;  2OLO A;  4CBQ A;  1H6V A;  1EL5 A;  1GOS A;  4B63 A;  2GR2 A;  3FPZ A;  4I58 A;  4JN9 A;  5ER0 A;  1D4D A;  3VR8 A;  1VDC A;  5J7X A;  5U1O A;  5JCM A;  2R4J A;  4EQS A;  2C70 A;  2YLS A;  4M52 A;  2C73 A;  2RGH A;  2E5V A;  4FDC B;  4I59 A;  4A79 A;  1NEN A;  1OJT A;  1Q1W A;  4AT2 A;  2R0P A;  4O5Q A;  1NDA A;  1S2Y A;  2X8H A;  2GR3 A;  2VQ7 A;  2WDQ A;  3IHM A;  1FOH A;  1GEU A;  2BXS A;  1DOE A;  1CL0 A;  3IC9 A;  3ITJ A;  1YQ3 A;  4D04 A;  1PBC A;  1L9E A;  5C3J A;  3NTD A;  1QJD A;  2WET A;  2NPX A;  3F8R A;  2ZBW A;  3AE2 A;  4DSG A;  3UKA A;  1NAA A;  1GT8 A;  4AOX A;  3E1T A;  1S2Q A;  3K7M X;  3GMB A;  1GV4 A;  1ZKQ A;  1E39 A;  1IUU A;  2FJA A;  3V3N A;  4B67 A;  4B69 A;  3NNE A;  4NZH A;  4OCG A;  1VG0 A;  2YG7 A;  3NIX A;  1ONF A;  3BI2 A;  3V3O A;  2IID A;  2Q0K A;  1ZY8 A;  4H4R A;  4FK1 C;  3AYI A;  4AT0 A;  1VRQ B;  1M64 A;  3S5W A;  1CBO A;  3GWF A;  2WBA A;  1NG3 A;  4YTM A;  3SQP A;  4YSY A;  4JDR A;  3BI5 A;  2Y6R A;  3LZW A;  4NTC A;  3F8D A;  3RP7 A;  3ZDN A;  2XLP A;  2OLN A;  3BNM A;  3LOV A;  4A9W A;  1HYU A;  3QVR A;  4YXD A;  2ARD A;  3FIM B;  2XYO A;  2C64 A;  2C67 A;  2X50 A;  5HXI A;  1DNC A;  2XFQ A;  1H83 A;  1LV0 A;  2XVH A;  3G5S A;  2V6O A;  4Z43 A;  1PXA A;  1S3B A;  2GMH A;  4GRT A;  2YVJ A;  4OPL A;  2V3B A;  3DGZ A;  3O0H A;  2GR0 A;  4Z2U A;  2R0G A;  5FS8 A;  4BJY A;  2YLX A;  1EL9 A;  1LVL A;  1GPE A;  1TDE A;  2GF3 A;  2X3N A;  1CJ2 A;  3CPI G;  3KPF A;  4GCM A;  1FEB A;  1TDK A;  2YR4 A;  5J60 A;  4AOS A;  4Z26 A;  4U2S A;  5FMH A;  3FBS A;  2C72 A;  3VRD B;  4UP3 A;  2YG3 A;  3KLJ A;  2YAU A;  2A87 A;  4TLZ A;  3AEG A;  3SGL A;  3RP6 A;  1E1M A;  1CJC A;  1GTH A;  1E1K A;  1YY5 A;  4IA5 A;  3P9U A;  3CGB A;  3LZX A;  3VQR A;  1FL2 A;  1KSU A;  1REO A;  2B76 A;  1IUW A;  1MXT A;  3QSM A;  4GDP A;  3ZYX A;  4GUV A;  1FCD A;  3UKF A;  1BGN A;  3AYJ A;  5GRT A;  1NPX A;  1PDH A;  2C75 A;  3GDP A;  4YWO A;  1H81 A;  5L46 A;  1OJA A;  1CC4 A;  2A89 A;  3NKS A;  4ZN0 A;  3AE7 A;  4C3Y A;  4K2X A;  1D7Y A;  1ZMC A;  4A5L A;  2TMD A;  2XLS A;  2C76 A;  1DJQ A;  4HA6 A;  2ZZC A;  4ADW A;  3LB8 A;  2BK3 A;  1UKV G;  1PHH A;  1D4E A;  2X8C A;  3AE3 A;  5FS7 A;  3LJP A;  3CPH G;  1IUX A;  1XPQ A;  2AQJ A;  2A8X A;  3OC4 A;  4U2L A;  2C65 A;  3NH3 X;  2VVL G;  2WP9 A;  2YLR A;  2WPC A;  1QLB A;  1JEH A;  1P2E A;  1PJ6 A;  2UZZ A;  3D8X A;  1KSS A;  1OJ9 A;  3SM8 A;  2WOI A;  3HZL A;  1GRH A;  2X99 A;  3CGC A;  3NYE A;  1D7L A;  2QA1 A;  3AYL A;  4FK1 A;  4E0V A;  1KNP A;  2Q6U A;  2GV8 A;  3VR9 A;  2YVF A;  2YR5 A;  4BK3 A;  4J56 A;  4TM3 A;  3F8P A;  4JQ9 A;  2J3N A;  4XWR A;  4YTN A;  2GVC A;  4B64 A;  2BCG G;  3AB1 A;  1GTE A;  4U8P A;  4FX9 A;  2XVE A;  3DK4 A;  4B66 A;  4UDP A;  3QFB A;  1JRY A;  4H4Q A;  2YWL A;  3M0O A;  2YQU A;  3GMC A;  4NEW A;  1TRB A;  3GD3 A;  4DGK A;  2HQM A;  4TLX A;  5EOW A;  3UP4 A;  1ZOY A;  1O94 A;  1TDN A;  1GRT A;  3C4A A;  3R9U A;  3NK2 X;  1B8S A;  4GF7 A;  1RYI A;  2WES A;  5IQ1 A;  4MJW A;  2R45 A;  5U63 A;  3PVC A;  3P4Q A;  2C3D A;  1MOK A;  2BAC A;  4X9M A;  4X9N A;  2BA9 A;  2WU5 A;  3RED A;  1F3P A;  5FS9 A;  2Y6Q A;  3AD9 B;  4P9S A;  2YG5 A;  3GRT A;  1DJN A;  3UOX A;  5JCK A;  5KXJ A;  4RSL A;  4K5S A;  2XFO A;  2BYB A;  3QSE A;  3IWA A;  4H50 A;  4ICY A;  1GRG A;  4K8D A;  4H4T A;  4H7U A;  4Z25 A;  3GWD A;  4EQX A;  3QJ4 A;  5JCI A;  1VQW A;  2FJD A;  2H88 A;  2VRM A;  3AWI A;  1PBD A;  3DME A;  4AP3 A;  3S61 A;  1DOD A;  2WP6 A;  1TYT A;  4J2W A;  4TM4 A;  5EB4 A;  1Z6L A;  2XFU A;  4JNA A;  2OA1 A;  4NTD A;  2IVD A;  1PN0 A;  1JNR A;  3NN0 X;  1PJ5 A;  5FS6 A;  1Y56 B;  1COY A;  2WDR A;  4BV6 A;  2APG A;  3AE6 A;  3AEF A;  2JAE A;  3AE1 A;  3PS9 A;  1E1L A;  1PS9 A;  4H4U A;  1QO8 A;  4AP1 A;  1CHU A;  1LJ1 A;  4YSX A;  3EF6 A;  3DK9 A;  1JRX A;  3WE0 A;  2QAE A;  4ECH A;  1JNZ A;  1H82 A;  3M13 A;  4C5O A;  3BI4 A;  3UKP A;  1DOC A;  3QSS A;  4UDQ A;  5C2T A;  1GAL A;  2CDU A;  4REK A;  1K4Q A;  4DNA A;  3CTY A;  1N4V A;  2YR6 A;  1E7P A;  1BKW A;  3NN6 X;  3GRS A;  2VVL A;  3I6D A;  5HYM A;  4BK1 A;  4PAA A;  1RP0 A;  2WPF A;  3I3L A;  1JU2 A;  2WOW A;  2EQ9 A;  1MO9 A;  5JCN A;  1Q1R A;  3NTA A;  4H2Q A;  4H4V A;  3AE4 A;  1K0I A;  4U8J A;  1O5W A;  5DBJ A;  4EIP A;  3RHA A;  2BK5 A;  4GDE A;  4U8K A;  3UKK A;  4U8N A;  1ZDL A;  1TYP A;  3K7Q X;  1FEC A;  3UP5 A;  1IUV A;  1LQU A;  2WQY A;  4H4Z A;  2CUL A;  2JK6 A;  1GER A;  3FG2 P;  4YTP A;  3NRN A;  1XHC A;  2BCP A;  3UTE A;  4A65 A;  1NHQ A;  2XCG A;  3BHF A;  3AE8 A;  4OPU A;  3GYI A;  4BJZ A;  4H4Y A;  1K0L A;  4C77 A;  1F8R A;  4CRT A;  3EAN A;  4EIQ A;  3CNJ A;  3CPJ G;  2QA2 A;  2C3C A;  2JB1 A;  3G5R A;  4A6N A;  4O5U A;  2YLT A;  5IPY A;  4K5R A;  4EM4 A;  5KOX A;  4CCR A;  3KKJ A;  5KOW A;  3GDN A;  4EMI A;  1NHS A;  2R46 A;  4OPT A;  4J34 A;  5U25 A;  3CND A;  4H2P A;  4ZCD A;  3DGH A;  4CY6 A;  4DSH A;  1O95 A;  2XFN A;  5BRT A;  3DJJ A;  2BC1 A;  4J31 A;  3AEA A;  3CNP A;  4Z2T A;  1JOA A;  1XAN A;  1XDI A;  2Z5X A;  3NHO X;  2VZ2 A;  4OPC A;  4OVI A;  3JSK A;  1CC2 A;  2WP5 A;  1FEA A;  1SEZ A;  3AEC A;  3B6D A;  3P4S A;  1IUT A;  3II4 A;  5TR3 A;  2EQ6 A;  2GH5 A;  3CNS A;  2R0C A;  2GQW A;  3RNM A;  1PJ7 A;  4OPI A;  3KVE A;  2OAL A;  1NHR A;  4HB9 A;  4EMW A;  4C3X A;  4YKF A;  2FBW A;  2V5Z A;  1OJD A;  4LII A;  5GSN A;  3KD9 A;  3IF9 A;  4USR A;  2XVI A;  3Q6J A;  4H4P A;  1H86 A;  4B68 A;  1Y0P A;  2YLZ A;  4CNJ A;  3ALL A;  1KDG A;  1EL8 A;  1PXB A;  1YKJ A;  3UTF A;  4CY8 A;  1LPF A;  4C74 A;  4A99 A;  1GND A;  3UTH A;  1ZX9 A;  4EQW A;  2EQ7 A;  2WEU A;  4K7Z A;  1KFY A;  2YG6 A;  2ZZ0 A;  5EB5 A;  1PBB A;  4U8M A;  4U8L A;  2BC0 A;  3P4P A;  4U8O A;  3KU9 A;  3H8I A;  4BK2 A;  2O9Z A;  2EQ8 A;  2BAB A;  4RG4 A;  2AAQ A;  3NG7 X;  2V61 A;  2XDO A;  2XLT A;  4H2R A;  4LU6 A;  2X8G A;  3EPT A;  2GEW A;  1N4U A;  3ATR A;  4IA6 A;  4J36 A;  1Q9I A;  1B5Q A;  2XVF A;  4EMJ A;  1LQT A;  4H4W A;  1OJC A;  4KX6 A;  1ZP0 A;  5EBK A;  3QFA A;  4U2T A;  4CNK A;  2YM2 A;  3CGD A;  4J33 A;  4TM0 A;  3NK0 X;  2C66 A;  2JBV A;  2WHD A;  3LXD A;  2R9Z A;  4WX1 A;  5CQF A;  1F6M A;  2XVJ A;  3VRB A;  2B9W A;  4A7A A;  1B4V A;  1H84 A;  3C4N A;  5BUL A;  4OPD A;  2BK4 A;  3AE5 A;  4Z44 A;  1GRB A;  2B7R A;  1BWC A;  2QCU A;  3OZ2 A;  3NK1 X;  4JNQ A;  3UTG A;  4N9X A;  1KNR A;  1TDO A;  3DK8 A;  1Y56 A;  3GD4 A;  3H8L A;  3QVP A;  5KVI A;  4APN A;  1EBD A;  1IUS A;  3BHK A;  1L0V A;  2WOV A;  4UDR A;  2GAG B;  2CFY A;  3DH9 A;  4GR1 A;  4YT0 A;  4H2N A;  4H4S A;  2V3A A;  3AD8 B;  1PXC A;  2XLU A;  2ACZ A;  2CVJ A;  3ALJ A;  2RGJ A;  1B37 A;  1PBF A;  2WDV A;  2WPE A;  2GMJ A;  1GRA A;  2ZZB A;  2FJE A;  3AEE A;  3EAO A;  4H4X A;  5KVH A;  3IHG A;  4Y4N A;  3RP8 A;  4IV9 A;  4YSH A;  2R4E A;  1GET A;  1JRZ A;  3UKH A;  4Y4L A;  1YQZ A;  2FJB A;  3LAD A;  1M6I A;  3CNT A;  2YVG A;  2GB0 A;  4IVO B;  1EL7 A;  1CF3 A;  1F8W A;  2GAH B;  3B3R A;  3UOZ A;  1PBE A;  4ZCC A;  2GR1 A;  2I0Z A;  2JB3 A;  5HY5 A;  1TDF A;  3K30 A;  2VRL A;  2YLW A;  1NG4 A;  3C96 A;  3ISH A;  3H4K A;  4IVM B;  2BS2 A;  2B9Y A;  1BGJ A;  1W4X A;  2YG4 A;  3BNU A;  2Q7V A;  5KRQ A;  1GSN A;  1H7X A;  3CGE A;  4XWZ A;  2AR8 A;  3DJE A;  1N4W A;  2E1M A;  4NTE A;  2YM1 A;  4B1B A;  1L9D A;  2VQB A;  1CJ4 A;  3P1W A;  1IJH A;  1YQ4 A;  3NLC A;  1S3E A;  4CCQ A;  3G5Q A;  3NT6 A;  5LV9 A;  2B9X A;  2B7S A;  4Z2R A;  1E1N A;  1BF3 A;  2WS3 A;  3UOV A;  1DOB A;  3NYC A;  3CN8 A;  2H89 A;  4XXG A;  1CJ3 A;  4YKG A;  1ZK7 A;  4JY3 A;  2DKH A;  1NEK A;  3GYJ A;  3SFD A;  4B65 A;  4TM1 A;  3SFE A;  2GQF A;  3AED A;  2W0H A;  3T37 A;  4BUR A;  5KWF A;  2JB2 A;  2V60 A;  3DJD A;  1L9C A;  5HHF A;  3VRA A;  3ALM A;  4Z24 A;  2BS4 A;  2BS3 A;  1F8S A;  1D4C A;  1N1P A;  4JY2 A;  3UCL A;  1H7W A;  4LA1 A;  3Q9T A;  4A6N B;  3L8K A;  1ELI A;  2RAB A;  5M0Z A;  5CKU A;  1AOG A;  2TPR A;  3URH A;  3KA7 A;  1NHP A; 
#chains in the Genus database with same CATH topology
 5M10 A;  1V59 A;  3M12 A;  2JKC A;  2OAM A;  4USQ A;  2VOU A;  5JCL A;  3FMW A;  5IQ4 A;  2Q0L A;  1KF6 A;  2PHH A;  2PYX A;  3K7T A;  4OPG A;  4RG3 A;  3L1R A;  2DKI A;  3ABV A;  3SYI A;  4EM3 A;  1E6E A;  1K0J A;  3AEB A;  4YSZ A;  3ICT A;  4PAB A;  3CIR A;  2XFP A;  3UKL A;  5KMQ A;  4Y4M A;  1LTX R;  4WCT A;  1VG9 A;  4NWZ A;  2GRT A;  3DJG X;  2NVK X;  4NEV A;  5BVA A;  3ICR A;  1ZMD A;  5BUK A;  3AXB A;  3ATQ A;  3COX A;  4NNJ A;  1D5T A;  3GSI A;  4KPR A;  2C4C A;  2F5Z A;  3PO7 A;  2BXR A;  4EQR A;  1ZOV A;  3ICS A;  1CC6 A;  4U8I A;  1P2H A;  3UOY A;  3DA1 A;  3V76 A;  1GES A;  2C7G A;  3AD7 B;  2IVE A;  4X4J A;  1BZL A;  1RSG A;  3NGC X;  3P4R A;  2E4G A;  2VVM A;  1GXF A;  1DXL A;  2WU2 A;  3ADA B;  3NYF A;  4K22 A;  3UKQ A;  4II2 A;  4J57 A;  1GRE A;  2RGO A;  3D1C A;  3AE9 A;  2XLR A;  4D03 A;  1X31 B;  2Z5Y A;  1GRF A;  2OLO A;  4CBQ A;  1H6V A;  1EL5 A;  1GOS A;  4B63 A;  2GR2 A;  3FPZ A;  4I58 A;  4JN9 A;  5ER0 A;  1D4D A;  3VR8 A;  1VDC A;  5J7X A;  5U1O A;  5JCM A;  2R4J A;  4EQS A;  2C70 A;  2YLS A;  4GAV A;  4M52 A;  2C73 A;  2RGH A;  2E5V A;  4FDC B;  4I59 A;  4A79 A;  1NEN A;  1OJT A;  1Q1W A;  4AT2 A;  2R0P A;  4O5Q A;  1NDA A;  1S2Y A;  2X8H A;  2GR3 A;  2VQ7 A;  2WDQ A;  3IHM A;  1FOH A;  1GEU A;  2BXS A;  1DOE A;  1CL0 A;  3IC9 A;  3SZC A;  3ITJ A;  1YQ3 A;  4D04 A;  1PBC A;  1L9E A;  5C3J A;  3NTD A;  1QJD A;  2WET A;  2NPX A;  3F8R A;  2ZBW A;  3AE2 A;  3SZF A;  3T2Y A;  4DSG A;  3UKA A;  1NAA A;  3SXI A;  1GT8 A;  4AOX A;  3E1T A;  1S2Q A;  3K7M X;  4G74 A;  3GMB A;  1GV4 A;  1ZKQ A;  1E39 A;  1IUU A;  2FJA A;  3V3N A;  4B67 A;  4B69 A;  3NNE A;  4NZH A;  4OCG A;  1VG0 A;  2YG7 A;  3NIX A;  1ONF A;  3BI2 A;  3V3O A;  2IID A;  2Q0K A;  1ZY8 A;  4H4R A;  4FK1 C;  3AYI A;  4AT0 A;  1VRQ B;  3HYX A;  1M64 A;  3S5W A;  1CBO A;  3GWF A;  2WBA A;  1NG3 A;  4YTM A;  3SQP A;  2BRY A;  4YSY A;  4JDR A;  3BI5 A;  2Y6R A;  3LZW A;  4NTC A;  3F8D A;  3RP7 A;  3ZDN A;  2XLP A;  2OLN A;  3BNM A;  3LOV A;  4A9W A;  1HYU A;  3QVR A;  4YXD A;  2ARD A;  3FIM B;  2XYO A;  2C64 A;  2C67 A;  2X50 A;  5KMP A;  5HXI A;  1DNC A;  2XFQ A;  1H83 A;  1LV0 A;  2XVH A;  3G5S A;  2V6O A;  4Z43 A;  1PXA A;  1S3B A;  2GMH A;  4GRT A;  2YVJ A;  4OPL A;  2V3B A;  3DGZ A;  3O0H A;  2GR0 A;  4Z2U A;  2R0G A;  5FS8 A;  4BJY A;  2YLX A;  1EL9 A;  1LVL A;  1GPE A;  1TDE A;  2GF3 A;  2X3N A;  1CJ2 A;  3CPI G;  3KPF A;  4GCM A;  1FEB A;  1TDK A;  2YR4 A;  5J60 A;  4AOS A;  4Z26 A;  4U2S A;  5FMH A;  3FBS A;  3T31 A;  2C72 A;  3VRD B;  4UP3 A;  2YG3 A;  3KLJ A;  2YAU A;  2A87 A;  4TLZ A;  3AEG A;  3SGL A;  3RP6 A;  3SZ0 A;  1E1M A;  1CJC A;  1GTH A;  1E1K A;  1YY5 A;  4IA5 A;  3P9U A;  3CGB A;  3LZX A;  3VQR A;  1FL2 A;  1KSU A;  1REO A;  2B76 A;  1IUW A;  1MXT A;  3QSM A;  4GDP A;  3ZYX A;  4GUV A;  1FCD A;  3UKF A;  1BGN A;  3AYJ A;  5GRT A;  1NPX A;  1PDH A;  2C75 A;  3GDP A;  4YWO A;  1H81 A;  5L46 A;  1OJA A;  1CC4 A;  2A89 A;  3NKS A;  4ZN0 A;  3AE7 A;  4C3Y A;  4K2X A;  2BRA A;  1D7Y A;  1ZMC A;  4A5L A;  2TMD A;  2XLS A;  2C76 A;  3SY4 A;  1DJQ A;  4HA6 A;  2ZZC A;  4ADW A;  3LB8 A;  2BK3 A;  1UKV G;  1PHH A;  1D4E A;  2X8C A;  3AE3 A;  3HYV A;  5FS7 A;  3LJP A;  3CPH G;  1IUX A;  1XPQ A;  2AQJ A;  2A8X A;  3OC4 A;  4U2L A;  2C65 A;  3NH3 X;  2VVL G;  2WP9 A;  2YLR A;  2WPC A;  1QLB A;  1JEH A;  1P2E A;  1PJ6 A;  2UZZ A;  3D8X A;  1KSS A;  1OJ9 A;  3SM8 A;  2WOI A;  3HZL A;  1GRH A;  2X99 A;  3CGC A;  3NYE A;  1D7L A;  2QA1 A;  3AYL A;  4FK1 A;  4E0V A;  1KNP A;  2Q6U A;  2GV8 A;  3VR9 A;  2YVF A;  2YR5 A;  4BK3 A;  4J56 A;  4TM3 A;  3F8P A;  4JQ9 A;  2J3N A;  4XWR A;  4YTN A;  2GVC A;  4B64 A;  2BCG G;  3AB1 A;  1GTE A;  4U8P A;  4FX9 A;  2XVE A;  3DK4 A;  4G6H A;  4B66 A;  4UDP A;  3QFB A;  1JRY A;  4H4Q A;  2YWL A;  3M0O A;  2YQU A;  3GMC A;  4NEW A;  1TRB A;  3GD3 A;  4DGK A;  2HQM A;  3KPK A;  4TLX A;  5EOW A;  3UP4 A;  1ZOY A;  1O94 A;  1TDN A;  1GRT A;  3C4A A;  3R9U A;  3NK2 X;  1B8S A;  4GF7 A;  1RYI A;  2WES A;  5IQ1 A;  4MJW A;  2R45 A;  5U63 A;  3PVC A;  3P4Q A;  2C3D A;  1MOK A;  2BAC A;  4X9M A;  4X9N A;  2BA9 A;  2WU5 A;  3RED A;  1F3P A;  5FS9 A;  2Y6Q A;  3AD9 B;  4P9S A;  2YG5 A;  3GRT A;  1DJN A;  3UOX A;  5JCK A;  5KXJ A;  4RSL A;  4K5S A;  2XFO A;  2BYB A;  3QSE A;  3IWA A;  4H50 A;  4ICY A;  1GRG A;  4K8D A;  4H4T A;  4H7U A;  4Z25 A;  3GWD A;  4EQX A;  3QJ4 A;  5KNL A;  5JCI A;  1VQW A;  2FJD A;  2H88 A;  2VRM A;  3AWI A;  1PBD A;  3DME A;  4AP3 A;  3S61 A;  1DOD A;  4G6G A;  3CMM A;  2WP6 A;  1TYT A;  4J2W A;  4TM4 A;  5EB4 A;  1Z6L A;  2XFU A;  4JNA A;  2OA1 A;  4NTD A;  2IVD A;  1PN0 A;  1JNR A;  3NN0 X;  1PJ5 A;  5FS6 A;  1Y56 B;  1COY A;  2WDR A;  4BV6 A;  2APG A;  3AE6 A;  3AEF A;  2JAE A;  3AE1 A;  3PS9 A;  1E1L A;  1PS9 A;  4H4U A;  1QO8 A;  4AP1 A;  1CHU A;  1LJ1 A;  4YSX A;  3EF6 A;  3DK9 A;  1JRX A;  3WE0 A;  2QAE A;  4ECH A;  3T2Z A;  1JNZ A;  1H82 A;  3M13 A;  4C5O A;  3BI4 A;  3UKP A;  1DOC A;  3QSS A;  4UDQ A;  5C2T A;  1GAL A;  2CDU A;  4REK A;  1K4Q A;  4DNA A;  3CTY A;  1N4V A;  2YR6 A;  1E7P A;  1BKW A;  3HYW A;  3NN6 X;  3GRS A;  2VVL A;  3T2K A;  3I6D A;  5HYM A;  4BK1 A;  4G9K A;  4PAA A;  1RP0 A;  2WPF A;  3I3L A;  1JU2 A;  2WOW A;  2EQ9 A;  1MO9 A;  5JCN A;  1Q1R A;  3NTA A;  4H2Q A;  4H4V A;  3AE4 A;  1K0I A;  4U8J A;  1O5W A;  5DBJ A;  4EIP A;  3RHA A;  2BK5 A;  4GDE A;  4U8K A;  3UKK A;  4U8N A;  1ZDL A;  3T14 A;  1TYP A;  3K7Q X;  1FEC A;  3UP5 A;  1IUV A;  1LQU A;  2WQY A;  4H4Z A;  2CUL A;  2JK6 A;  1GER A;  3FG2 P;  4YTP A;  3NRN A;  1XHC A;  2BCP A;  3UTE A;  4A65 A;  1NHQ A;  2XCG A;  3BHF A;  3AE8 A;  4OPU A;  3GYI A;  4BJZ A;  4H4Y A;  1K0L A;  4C77 A;  1F8R A;  4CRT A;  3EAN A;  4EIQ A;  3CNJ A;  3CPJ G;  2QA2 A;  2C3C A;  2JB1 A;  3G5R A;  3GYX A;  4A6N A;  4O5U A;  2YLT A;  5IPY A;  4K5R A;  4EM4 A;  5KOX A;  4CCR A;  3KKJ A;  5KOW A;  3GDN A;  4EMI A;  1NHS A;  2R46 A;  4OPT A;  4J34 A;  5U25 A;  3CND A;  4H2P A;  4ZCD A;  3DGH A;  4CY6 A;  4DSH A;  1O95 A;  2XFN A;  5BRT A;  3DJJ A;  2BC1 A;  4J31 A;  3AEA A;  3CNP A;  4Z2T A;  1JOA A;  1XAN A;  1XDI A;  2Z5X A;  3NHO X;  2VZ2 A;  4OPC A;  4OVI A;  3JSK A;  1CC2 A;  2WP5 A;  1FEA A;  1SEZ A;  3AEC A;  3B6D A;  3P4S A;  1IUT A;  3II4 A;  5TR3 A;  2EQ6 A;  2GH5 A;  3CNS A;  2R0C A;  2GQW A;  3RNM A;  1PJ7 A;  4OPI A;  5KMR A;  3SZW A;  3KVE A;  2OAL A;  1NHR A;  4HB9 A;  5KMS A;  4EMW A;  4C3X A;  4YKF A;  2FBW A;  2V5Z A;  1OJD A;  4LII A;  5GSN A;  3KD9 A;  3IF9 A;  4USR A;  2XVI A;  3Q6J A;  4H4P A;  1H86 A;  4B68 A;  1Y0P A;  2YLZ A;  4CNJ A;  3ALL A;  1KDG A;  1EL8 A;  1PXB A;  1YKJ A;  3UTF A;  4CY8 A;  1LPF A;  4C74 A;  4A99 A;  1GND A;  4G73 A;  1ZX9 A;  3UTH A;  2EQ7 A;  2WEU A;  4EQW A;  4K7Z A;  1KFY A;  2YG6 A;  2ZZ0 A;  5EB5 A;  1PBB A;  4U8M A;  4U8L A;  3T0K A;  2BC0 A;  3P4P A;  4U8O A;  3KU9 A;  3H8I A;  4II3 A;  4BK2 A;  2O9Z A;  2EQ8 A;  2BAB A;  4RG4 A;  2AAQ A;  3NG7 X;  2V61 A;  2XDO A;  2XLT A;  4H2R A;  4LU6 A;  2X8G A;  3EPT A;  2GEW A;  1N4U A;  3ATR A;  4IA6 A;  3SX6 A;  4J36 A;  1Q9I A;  1B5Q A;  2XVF A;  4EMJ A;  1LQT A;  4H4W A;  1OJC A;  4KX6 A;  1ZP0 A;  5EBK A;  3QFA A;  4U2T A;  4CNK A;  2YM2 A;  3CGD A;  4J33 A;  4TM0 A;  3NK0 X;  2C66 A;  2JBV A;  2WHD A;  3LXD A;  2R9Z A;  4WX1 A;  5CQF A;  1F6M A;  2XVJ A;  3VRB A;  2B9W A;  4A7A A;  1B4V A;  1H84 A;  3C4N A;  5BUL A;  4OPD A;  2BK4 A;  3AE5 A;  4Z44 A;  1GRB A;  2B7R A;  1BWC A;  2QCU A;  3OZ2 A;  3NK1 X;  4JNQ A;  3UTG A;  4N9X A;  1KNR A;  1TDO A;  3DK8 A;  1Y56 A;  3GD4 A;  3H8L A;  3QVP A;  5KVI A;  4APN A;  1EBD A;  1IUS A;  3BHK A;  1L0V A;  2WOV A;  4UDR A;  2GAG B;  2CFY A;  3DH9 A;  4GR1 A;  4YT0 A;  4H2N A;  4H4S A;  2V3A A;  3AD8 B;  1PXC A;  2XLU A;  2ACZ A;  2CVJ A;  3ALJ A;  2RGJ A;  1B37 A;  1PBF A;  2WDV A;  2WPE A;  2GMJ A;  1GRA A;  2ZZB A;  2FJE A;  3AEE A;  3EAO A;  4H4X A;  5KVH A;  3IHG A;  4Y4N A;  3RP8 A;  4IV9 A;  4YSH A;  2R4E A;  1GET A;  1JRZ A;  3UKH A;  4Y4L A;  1YQZ A;  2FJB A;  3LAD A;  1M6I A;  3CNT A;  2YVG A;  2GB0 A;  4IVO B;  1EL7 A;  1CF3 A;  1F8W A;  2GAH B;  3B3R A;  3UOZ A;  1PBE A;  4ZCC A;  2GR1 A;  2I0Z A;  2JB3 A;  5HY5 A;  1TDF A;  3K30 A;  2VRL A;  2YLW A;  1NG4 A;  3C96 A;  3ISH A;  3H4K A;  4IVM B;  2BS2 A;  2B9Y A;  1BGJ A;  1W4X A;  2YG4 A;  3BNU A;  2Q7V A;  5KRQ A;  1GSN A;  1H7X A;  3CGE A;  4XWZ A;  2AR8 A;  3DJE A;  1N4W A;  2E1M A;  4NTE A;  2YM1 A;  4B1B A;  1L9D A;  2VQB A;  1CJ4 A;  3P1W A;  1IJH A;  1YQ4 A;  3NLC A;  1S3E A;  4CCQ A;  3G5Q A;  3NT6 A;  5LV9 A;  2B9X A;  2B7S A;  4Z2R A;  1E1N A;  1BF3 A;  2WS3 A;  3UOV A;  1DOB A;  3NYC A;  3CN8 A;  2H89 A;  4XXG A;  1CJ3 A;  4YKG A;  1ZK7 A;  4JY3 A;  2DKH A;  1NEK A;  3GYJ A;  3SFD A;  4B65 A;  4TM1 A;  3SFE A;  2GQF A;  4GAP A;  3AED A;  2W0H A;  3T37 A;  4BUR A;  5KWF A;  2JB2 A;  2V60 A;  3DJD A;  1L9C A;  5HHF A;  3VRA A;  3ALM A;  4Z24 A;  2BS4 A;  2BS3 A;  1F8S A;  1D4C A;  1N1P A;  4JY2 A;  3UCL A;  1H7W A;  4LA1 A;  3Q9T A;  4A6N B;  3L8K A;  1ELI A;  2RAB A;  5M0Z A;  5CKU A;  1AOG A;  2TPR A;  3URH A;  3KA7 A;  1NHP A; 
#chains in the Genus database with same CATH homology
 5M10 A;  1V59 A;  3M12 A;  2JKC A;  2OAM A;  4USQ A;  2VOU A;  5JCL A;  3FMW A;  5IQ4 A;  2Q0L A;  1KF6 A;  2PHH A;  2PYX A;  3K7T A;  4OPG A;  4RG3 A;  3L1R A;  2DKI A;  3ABV A;  3SYI A;  4EM3 A;  1E6E A;  1K0J A;  3AEB A;  4YSZ A;  3ICT A;  4PAB A;  3CIR A;  2XFP A;  3UKL A;  5KMQ A;  4Y4M A;  1LTX R;  4WCT A;  1VG9 A;  4NWZ A;  2GRT A;  3DJG X;  2NVK X;  4NEV A;  5BVA A;  3ICR A;  1ZMD A;  5BUK A;  3AXB A;  3ATQ A;  3COX A;  4NNJ A;  1D5T A;  3GSI A;  4KPR A;  2C4C A;  2F5Z A;  3PO7 A;  2BXR A;  4EQR A;  1ZOV A;  3ICS A;  1CC6 A;  4U8I A;  1P2H A;  3UOY A;  3DA1 A;  3V76 A;  1GES A;  2C7G A;  3AD7 B;  2IVE A;  4X4J A;  1BZL A;  1RSG A;  3NGC X;  3P4R A;  2E4G A;  2VVM A;  1GXF A;  1DXL A;  2WU2 A;  3ADA B;  3NYF A;  4K22 A;  3UKQ A;  4II2 A;  4J57 A;  1GRE A;  2RGO A;  3D1C A;  3AE9 A;  2XLR A;  4D03 A;  1X31 B;  2Z5Y A;  1GRF A;  2OLO A;  4CBQ A;  1H6V A;  1EL5 A;  1GOS A;  4B63 A;  2GR2 A;  3FPZ A;  4I58 A;  4JN9 A;  5ER0 A;  1D4D A;  3VR8 A;  1VDC A;  5J7X A;  5U1O A;  5JCM A;  2R4J A;  4EQS A;  2C70 A;  2YLS A;  4GAV A;  4M52 A;  2C73 A;  2RGH A;  2E5V A;  4FDC B;  4I59 A;  4A79 A;  1NEN A;  1OJT A;  1Q1W A;  4AT2 A;  2R0P A;  4O5Q A;  1NDA A;  1S2Y A;  2X8H A;  2GR3 A;  2VQ7 A;  2WDQ A;  3IHM A;  1FOH A;  1GEU A;  2BXS A;  1DOE A;  1CL0 A;  3IC9 A;  3SZC A;  3ITJ A;  1YQ3 A;  4D04 A;  1PBC A;  1L9E A;  5C3J A;  3NTD A;  1QJD A;  2WET A;  2NPX A;  3F8R A;  2ZBW A;  3AE2 A;  3SZF A;  3T2Y A;  4DSG A;  3UKA A;  1NAA A;  3SXI A;  1GT8 A;  4AOX A;  3E1T A;  1S2Q A;  3K7M X;  4G74 A;  3GMB A;  1GV4 A;  1ZKQ A;  1E39 A;  1IUU A;  2FJA A;  3V3N A;  4B67 A;  4B69 A;  3NNE A;  4NZH A;  4OCG A;  1VG0 A;  2YG7 A;  3NIX A;  1ONF A;  3BI2 A;  3V3O A;  2IID A;  2Q0K A;  1ZY8 A;  4H4R A;  4FK1 C;  3AYI A;  4AT0 A;  1VRQ B;  3HYX A;  1M64 A;  3S5W A;  1CBO A;  3GWF A;  2WBA A;  1NG3 A;  4YTM A;  3SQP A;  2BRY A;  4YSY A;  4JDR A;  3BI5 A;  2Y6R A;  3LZW A;  4NTC A;  3F8D A;  3RP7 A;  3ZDN A;  2XLP A;  2OLN A;  3BNM A;  3LOV A;  4A9W A;  1HYU A;  3QVR A;  4YXD A;  2ARD A;  3FIM B;  2XYO A;  2C64 A;  2C67 A;  2X50 A;  5KMP A;  5HXI A;  1DNC A;  2XFQ A;  1H83 A;  1LV0 A;  2XVH A;  3G5S A;  2V6O A;  4Z43 A;  1PXA A;  1S3B A;  2GMH A;  4GRT A;  2YVJ A;  4OPL A;  2V3B A;  3DGZ A;  3O0H A;  2GR0 A;  4Z2U A;  2R0G A;  5FS8 A;  4BJY A;  2YLX A;  1EL9 A;  1LVL A;  1GPE A;  1TDE A;  2GF3 A;  2X3N A;  1CJ2 A;  3CPI G;  3KPF A;  4GCM A;  1FEB A;  1TDK A;  2YR4 A;  5J60 A;  4AOS A;  4Z26 A;  4U2S A;  5FMH A;  3FBS A;  3T31 A;  2C72 A;  3VRD B;  4UP3 A;  2YG3 A;  3KLJ A;  2YAU A;  2A87 A;  4TLZ A;  3AEG A;  3SGL A;  3RP6 A;  3SZ0 A;  1E1M A;  1CJC A;  1GTH A;  1E1K A;  1YY5 A;  4IA5 A;  3P9U A;  3CGB A;  3LZX A;  3VQR A;  1FL2 A;  1KSU A;  1REO A;  2B76 A;  1IUW A;  1MXT A;  3QSM A;  4GDP A;  3ZYX A;  4GUV A;  1FCD A;  3UKF A;  1BGN A;  3AYJ A;  5GRT A;  1NPX A;  1PDH A;  2C75 A;  3GDP A;  4YWO A;  1H81 A;  5L46 A;  1OJA A;  1CC4 A;  2A89 A;  3NKS A;  4ZN0 A;  3AE7 A;  4C3Y A;  4K2X A;  2BRA A;  1D7Y A;  1ZMC A;  4A5L A;  2TMD A;  2XLS A;  2C76 A;  3SY4 A;  1DJQ A;  4HA6 A;  2ZZC A;  4ADW A;  3LB8 A;  2BK3 A;  1UKV G;  1PHH A;  1D4E A;  2X8C A;  3AE3 A;  3HYV A;  5FS7 A;  3LJP A;  3CPH G;  1IUX A;  1XPQ A;  2AQJ A;  2A8X A;  3OC4 A;  4U2L A;  2C65 A;  3NH3 X;  2VVL G;  2WP9 A;  2YLR A;  2WPC A;  1QLB A;  1JEH A;  1P2E A;  1PJ6 A;  2UZZ A;  3D8X A;  1KSS A;  1OJ9 A;  3SM8 A;  2WOI A;  3HZL A;  1GRH A;  2X99 A;  3CGC A;  3NYE A;  1D7L A;  2QA1 A;  3AYL A;  4FK1 A;  4E0V A;  1KNP A;  2Q6U A;  2GV8 A;  3VR9 A;  2YVF A;  2YR5 A;  4BK3 A;  4J56 A;  4TM3 A;  3F8P A;  4JQ9 A;  2J3N A;  4XWR A;  4YTN A;  2GVC A;  4B64 A;  2BCG G;  3AB1 A;  1GTE A;  4U8P A;  4FX9 A;  2XVE A;  3DK4 A;  4G6H A;  4B66 A;  4UDP A;  3QFB A;  1JRY A;  4H4Q A;  2YWL A;  3M0O A;  2YQU A;  3GMC A;  4NEW A;  1TRB A;  3GD3 A;  4DGK A;  2HQM A;  3KPK A;  4TLX A;  5EOW A;  3UP4 A;  1ZOY A;  1O94 A;  1TDN A;  1GRT A;  3C4A A;  3R9U A;  3NK2 X;  1B8S A;  4GF7 A;  1RYI A;  2WES A;  5IQ1 A;  4MJW A;  2R45 A;  5U63 A;  3PVC A;  3P4Q A;  2C3D A;  1MOK A;  2BAC A;  4X9M A;  4X9N A;  2BA9 A;  2WU5 A;  3RED A;  1F3P A;  5FS9 A;  2Y6Q A;  3AD9 B;  4P9S A;  2YG5 A;  3GRT A;  1DJN A;  3UOX A;  5JCK A;  5KXJ A;  4RSL A;  4K5S A;  2XFO A;  2BYB A;  3QSE A;  3IWA A;  4H50 A;  4ICY A;  1GRG A;  4K8D A;  4H4T A;  4H7U A;  4Z25 A;  3GWD A;  4EQX A;  3QJ4 A;  5KNL A;  5JCI A;  1VQW A;  2FJD A;  2H88 A;  2VRM A;  3AWI A;  1PBD A;  3DME A;  4AP3 A;  3S61 A;  1DOD A;  4G6G A;  3CMM A;  2WP6 A;  1TYT A;  4J2W A;  4TM4 A;  5EB4 A;  1Z6L A;  2XFU A;  4JNA A;  2OA1 A;  4NTD A;  2IVD A;  1PN0 A;  1JNR A;  3NN0 X;  1PJ5 A;  5FS6 A;  1Y56 B;  1COY A;  2WDR A;  4BV6 A;  2APG A;  3AE6 A;  3AEF A;  2JAE A;  3AE1 A;  3PS9 A;  1E1L A;  1PS9 A;  4H4U A;  1QO8 A;  4AP1 A;  1CHU A;  1LJ1 A;  4YSX A;  3EF6 A;  3DK9 A;  1JRX A;  3WE0 A;  2QAE A;  4ECH A;  3T2Z A;  1JNZ A;  1H82 A;  3M13 A;  4C5O A;  3BI4 A;  3UKP A;  1DOC A;  3QSS A;  4UDQ A;  5C2T A;  1GAL A;  2CDU A;  4REK A;  1K4Q A;  4DNA A;  3CTY A;  1N4V A;  2YR6 A;  1E7P A;  1BKW A;  3HYW A;  3NN6 X;  3GRS A;  2VVL A;  3T2K A;  3I6D A;  5HYM A;  4BK1 A;  4G9K A;  4PAA A;  1RP0 A;  2WPF A;  3I3L A;  1JU2 A;  2WOW A;  2EQ9 A;  1MO9 A;  5JCN A;  1Q1R A;  3NTA A;  4H2Q A;  4H4V A;  3AE4 A;  1K0I A;  4U8J A;  1O5W A;  5DBJ A;  4EIP A;  3RHA A;  2BK5 A;  4GDE A;  4U8K A;  3UKK A;  4U8N A;  1ZDL A;  3T14 A;  1TYP A;  3K7Q X;  1FEC A;  3UP5 A;  1IUV A;  1LQU A;  2WQY A;  4H4Z A;  2CUL A;  2JK6 A;  1GER A;  3FG2 P;  4YTP A;  3NRN A;  1XHC A;  2BCP A;  3UTE A;  4A65 A;  1NHQ A;  2XCG A;  3BHF A;  3AE8 A;  4OPU A;  3GYI A;  4BJZ A;  4H4Y A;  1K0L A;  4C77 A;  1F8R A;  4CRT A;  3EAN A;  4EIQ A;  3CNJ A;  3CPJ G;  2QA2 A;  2C3C A;  2JB1 A;  3G5R A;  3GYX A;  4A6N A;  4O5U A;  2YLT A;  5IPY A;  4K5R A;  4EM4 A;  5KOX A;  4CCR A;  3KKJ A;  5KOW A;  3GDN A;  4EMI A;  1NHS A;  2R46 A;  4OPT A;  4J34 A;  5U25 A;  3CND A;  4H2P A;  4ZCD A;  3DGH A;  4CY6 A;  4DSH A;  1O95 A;  2XFN A;  5BRT A;  3DJJ A;  2BC1 A;  4J31 A;  3AEA A;  3CNP A;  4Z2T A;  1JOA A;  1XAN A;  1XDI A;  2Z5X A;  3NHO X;  2VZ2 A;  4OPC A;  4OVI A;  3JSK A;  1CC2 A;  2WP5 A;  1FEA A;  1SEZ A;  3AEC A;  3B6D A;  3P4S A;  1IUT A;  3II4 A;  5TR3 A;  2EQ6 A;  2GH5 A;  3CNS A;  2R0C A;  2GQW A;  3RNM A;  1PJ7 A;  4OPI A;  5KMR A;  3SZW A;  3KVE A;  2OAL A;  1NHR A;  4HB9 A;  5KMS A;  4EMW A;  4C3X A;  4YKF A;  2FBW A;  2V5Z A;  1OJD A;  4LII A;  5GSN A;  3KD9 A;  3IF9 A;  4USR A;  2XVI A;  3Q6J A;  4H4P A;  1H86 A;  4B68 A;  1Y0P A;  2YLZ A;  4CNJ A;  3ALL A;  1KDG A;  1EL8 A;  1PXB A;  1YKJ A;  3UTF A;  4CY8 A;  1LPF A;  4C74 A;  4A99 A;  1GND A;  4G73 A;  1ZX9 A;  3UTH A;  2EQ7 A;  2WEU A;  4EQW A;  4K7Z A;  1KFY A;  2YG6 A;  2ZZ0 A;  5EB5 A;  1PBB A;  4U8M A;  4U8L A;  3T0K A;  2BC0 A;  3P4P A;  4U8O A;  3KU9 A;  3H8I A;  4II3 A;  4BK2 A;  2O9Z A;  2EQ8 A;  2BAB A;  4RG4 A;  2AAQ A;  3NG7 X;  2V61 A;  2XDO A;  2XLT A;  4H2R A;  4LU6 A;  2X8G A;  3EPT A;  2GEW A;  1N4U A;  3ATR A;  4IA6 A;  3SX6 A;  4J36 A;  1Q9I A;  1B5Q A;  2XVF A;  4EMJ A;  1LQT A;  4H4W A;  1OJC A;  4KX6 A;  1ZP0 A;  5EBK A;  3QFA A;  4U2T A;  4CNK A;  2YM2 A;  3CGD A;  4J33 A;  4TM0 A;  3NK0 X;  2C66 A;  2JBV A;  2WHD A;  3LXD A;  2R9Z A;  4WX1 A;  5CQF A;  1F6M A;  2XVJ A;  3VRB A;  2B9W A;  4A7A A;  1B4V A;  1H84 A;  3C4N A;  5BUL A;  4OPD A;  2BK4 A;  3AE5 A;  4Z44 A;  1GRB A;  2B7R A;  1BWC A;  2QCU A;  3OZ2 A;  3NK1 X;  4JNQ A;  3UTG A;  4N9X A;  1KNR A;  1TDO A;  3DK8 A;  1Y56 A;  3GD4 A;  3H8L A;  3QVP A;  5KVI A;  4APN A;  1EBD A;  1IUS A;  3BHK A;  1L0V A;  2WOV A;  4UDR A;  2GAG B;  2CFY A;  3DH9 A;  4GR1 A;  4YT0 A;  4H2N A;  4H4S A;  2V3A A;  3AD8 B;  1PXC A;  2XLU A;  2ACZ A;  2CVJ A;  3ALJ A;  2RGJ A;  1B37 A;  1PBF A;  2WDV A;  2WPE A;  2GMJ A;  1GRA A;  2ZZB A;  2FJE A;  3AEE A;  3EAO A;  4H4X A;  5KVH A;  3IHG A;  4Y4N A;  3RP8 A;  4IV9 A;  4YSH A;  2R4E A;  1GET A;  1JRZ A;  3UKH A;  4Y4L A;  1YQZ A;  2FJB A;  3LAD A;  1M6I A;  3CNT A;  2YVG A;  2GB0 A;  4IVO B;  1EL7 A;  1CF3 A;  1F8W A;  2GAH B;  3B3R A;  3UOZ A;  1PBE A;  4ZCC A;  2GR1 A;  2I0Z A;  2JB3 A;  5HY5 A;  1TDF A;  3K30 A;  2VRL A;  2YLW A;  1NG4 A;  3C96 A;  3ISH A;  3H4K A;  4IVM B;  2BS2 A;  2B9Y A;  1BGJ A;  1W4X A;  2YG4 A;  3BNU A;  2Q7V A;  5KRQ A;  1GSN A;  1H7X A;  3CGE A;  4XWZ A;  2AR8 A;  3DJE A;  1N4W A;  2E1M A;  4NTE A;  2YM1 A;  4B1B A;  1L9D A;  2VQB A;  1CJ4 A;  3P1W A;  1IJH A;  1YQ4 A;  3NLC A;  1S3E A;  4CCQ A;  3G5Q A;  3NT6 A;  5LV9 A;  2B9X A;  2B7S A;  4Z2R A;  1E1N A;  1BF3 A;  2WS3 A;  3UOV A;  1DOB A;  3NYC A;  3CN8 A;  2H89 A;  4XXG A;  1CJ3 A;  4YKG A;  1ZK7 A;  4JY3 A;  2DKH A;  1NEK A;  3GYJ A;  3SFD A;  4B65 A;  4TM1 A;  3SFE A;  2GQF A;  4GAP A;  3AED A;  2W0H A;  3T37 A;  4BUR A;  5KWF A;  2JB2 A;  2V60 A;  3DJD A;  1L9C A;  5HHF A;  3VRA A;  3ALM A;  4Z24 A;  2BS4 A;  2BS3 A;  1F8S A;  1D4C A;  1N1P A;  4JY2 A;  3UCL A;  1H7W A;  4LA1 A;  3Q9T A;  4A6N B;  3L8K A;  1ELI A;  2RAB A;  5M0Z A;  5CKU A;  1AOG A;  2TPR A;  3URH A;  3KA7 A;  1NHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...