4FK1A

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
299
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVMKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thioredoxin reductase
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 92
structure length 299
sequence length 299
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A02
1IJHA 2APGA 4K7ZA 3P9UA 2A89A 2GMHA 1NEKA 1EL9A 3V3NA 1Q9IA 1Y0PA 2OLNA 2VRMA 4ZCCA 3FG2P 1PJ6A 4MJWA 3AEAA 1LTXR 1NG4A 3CN8A 5BRTA 2X99A 5J60A 2HQMA 4CCRA 1ELIA 3AEFA 4A99A 4Z26A 1PXBA 1GRHA 1GOSA 1JNRA 1Q1WA 1JOAA 1PXAA 1GETA 3ALMA 5HY5A 1H84A 2BCGG 4GRTA 4U8IA 2WDVA 5C3JA 4JY2A 4K22A 4K5SA 2XVFA 3CIRA 2WQYA 4U8JA 3RHAA 4B64A 3ICTA 5DBJA 4CCQA 2EQ9A 2E1MA 4BJZA 5JCLA 1XPQA 2B7SA 2EQ8A 1GSNA 4Y4LA 1N4VA 3GDNA 4H4TA 1JRXA 3KKJA 2VRLA 2YM2A 4GDEA 1GT8A 2X3NA 3EF6A 2VVMA 4H2RA 4U8OA 3UOXA 1TDKA 1JNZA 4U8LA 1FEBA 1PDHA 5FS6A 1K4QA 4PABA 3P4PA 4A6NB 5JCIA 2FBWA 2F5ZA 1FL2A 3K30A 4A5LA 1OJTA 4K5RA 1HYUA 1N1PA 1O95A 4ADWA 3NTDA 3IWAA 3C4NA 3NHOX 3LB8A 1GV4A 3HZLA 3K7MX 5IQ1A 4TM0A 3AD7B 2CDUA 4A7AA 1NHPA 2XVJA 2QA1A 1ZDLA 3DK9A 5HXIA 4H4PA 4TM1A 1D4EA 3URHA 2XFUA 2V6OA 1Q1RA 4OPTA 1X31B 3NH3X 3UKPA 4YTNA 3T37A 3GYJA 1N4WA 5EB4A 3R9UA 3NN6X 3CNTA 4OVIA 3UOZA 2CFYA 2V5ZA 3GMBA 4JNAA 1VDCA 1BGNA 4BK1A 2YR6A 3NN0X 2B7RA 2GVCA 1GRBA 3DK8A 3CNSA 2JKCA 4H4QA 3D8XA 1LVLA 1NAAA 4OPLA 3SFDA 4C3YA 3BHKA 1BKWA 1IUUA 4BV6A 2WP9A 2YAUA 1YY5A 2BCPA 2H88A 4JQ9A 4UDRA 2TPRA 4XWZA 3AE1A 3P4RA 1VG9A 2I0ZA 3DJJA 3GRSA 4DSGA 2YVGA 1W4XA 4EMJA 2VVLA 1PJ7A 2GF3A 2WESA 2C3CA 3FIMB 2UZZA 3QSSA 2GH5A 1CL0A 3NTAA 4APNA 5BULA 4O5QA 1ZX9A 1GRAA 2Y6RA 1F8RA 2FJAA 1GERA 1ZY8A 2RABA 2AQJA 1ZOVA 2RGOA 4NTEA 5FS9A 4DGKA 5C2TA 2WP6A 1NDAA 2R46A 3S61A 3ZYXA 2YLZA 1CJ3A 2BS4A 4JN9A 2V61A 3B6DA 2YG5A 1FEAA 1GESA 4CNJA 1LQUA 1Y56B 3P1WA 2WU2A 4Z44A 4GF7A 1BZLA 1KFYA 3RNMA 2WPCA 3GWFA 3V76A 5JCMA 2BABA 2Q7VA 3CNDA 1ZOYA 4YKGA 4E0VA 2BACA 2DKHA 2J3NA 4XXGA 3GDPA 1B8SA 5U1OA 3LZWA 4WX1A 4UP3A 1RYIA 2C72A 3KA7A 4AOSA 4YSYA 4O5UA 3CNJA 2ZZCA 2GB0A 2OALA 1F3PA 2Q0KA 2QAEA 4Y4MA 1JEHA 2W0HA 2YLTA 1CJ2A 4LU6A 1D4DA 1L9DA 3CGEA 4EIPA 4H4UA 1TYTA 4X9NA 1QO8A 4GUVA 1PBBA 3DMEA 1E7PA 1L0VA 4CY8A 1IUTA 3C4AA 3H8IA 3EPTA 3M13A 5CKUA 3REDA 4Z2UA 4ZCDA 1GNDA 2YVJA 3CGBA 4P9SA 3AE3A 1CC2A 2GMJA 1JU2A 4KPRA 4U8KA 3KPFA 1F8WA 1ZP0A 2IVEA 3EAOA 3M12A 2FJDA 1EL7A 3BI2A 2VQBA 1MOKA 4C5OA 2ZZBA 3ITJA 3KLJA 1ONFA 2C64A 2O9ZA 4H4YA 1GXFA 5HYMA 2WOVA 3UKKA 2GR3A 5KRQA 4BK3A 4FK1A 1UKVG 2BS3A 4IA6A 2XFNA 4TLXA 4FK1C 4EMIA 1JRYA 4ZN0A 1H81A 1KNRA 2XVIA 4GR1A 2XDOA 3AYIA 4REKA 3AE8A 2R9ZA 1LPFA 2YLXA 4NZHA 4OPDA 3RP8A 2Q6UA 3LOVA 3ICSA 5JCNA 2OAMA 4B67A 4J56A 3UP5A 1M64A 2GQWA 3ALLA 1YQ4A 2YWLA 3ADAB 3VQRA 4OCGA 2IVDA 3UTEA 4USRA 3UKQA 4BURA 2NVKX 3AYLA 3H8LA 3COXA 3AECA 1H7XA 4U2TA 3H4KA 1N4UA 1IUWA 3AEBA 3JSKA 3KU9A 3AYJA 3GRTA 1JRZA 2YQUA 3K7QX 1LJ1A 4RSLA 2GV8A 3AEDA 3F8PA 1CC6A 4YKFA 4A65A 3CNPA 1K0LA 1B4VA 4B69A 2JAEA 5EB5A 2H89A 3GWDA 5KVHA 1BWCA 2Z5XA 2E4GA 1M6IA 3GD3A 1CJCA 4NEWA 4AP3A 4B65A 1TDOA 4M52A 4AOXA 4H4VA 3II4A 4OPGA 2ACZA 2B9WA 2C75A 2ZZ0A 3BNUA 2BS2A 2GRTA 3BHFA 2PHHA 2Q0LA 4Y4NA 4H2QA 4J2WA 1L9CA 3DJDA 4YT0A 1OJCA 4EQXA 4EM3A 3NG7X 1KSSA 2CULA 2GR1A 3NNEA 3NYFA 3PS9A 1KSUA 1BF3A 1GRGA 3NYCA 1E1LA 1D7YA 1FECA 1GREA 3NIXA 2GAGB 1DXLA 1DODA 5BVAA 1PBDA 2YLRA 5TR3A 1P2HA 4DSHA 4A6NA 3GYIA 4HB9A 3F8DA 3CPJG 3QSEA 2X50A 3DGHA 4TLZA 2B9XA 2VZ2A 3UKHA 1OJ9A 2ARDA 3D1CA 2YLWA 4EM4A 2Y6QA 1NPXA 3OC4A 1GRTA 3KVEA 3AEEA 2WHDA 2WETA 1E1NA 2A8XA 3NT6A 1REOA 1S3BA 4X9MA 1DJQA 2C76A 4IA5A 3O0HA 4C74A 3NK1X 3QFAA 4GDPA 3S5WA 2GAHB 3M0OA 3B3RA 2C65A 1ZKQA 1KF6A 4ECHA 5IQ4A 4CNKA 3AXBA 2XVEA 5M10A 5KOXA 1S2QA 1DJNA 4Z25A 1O94A 3UP4A 4A9WA 4AT2A 1GEUA 2YR5A 3AWIA 1PBEA 2XLPA 3IHMA 3SGLA 3P4QA 3NGCX 4EQWA 2X8CA 3UKLA 1TYPA 3VRBA 4Z2RA 2Z5YA 1CHUA 3UKFA 1NHSA 3AE4A 1PBFA 4WCTA 2FJEA 1LQTA 1PJ5A 1LV0A 4JDRA 3LJPA 3NK0X 3G5QA 3AE7A 4I59A 1FCDA 3QVRA 2BC1A 1MXTA 1ZK7A 3AD9B 1PHHA 3ISHA 2GR0A 4AT0A 4KX6A 4Z43A 1GPEA 5FMHA 1E1KA 3AEGA 1IUVA 3SFEA 2YG7A 3Q9TA 4RG3A 1F6MA 2YG4A 3CTYA 3ZDNA 1V59A 2BC0A 3IF9A 4PAAA 4TM4A 4BK2A 5JCKA 1CF3A 3P4SA 3ATQA 1B37A 4H4XA 3NK2X 1MO9A 1ZMCA 4B1BA 5FS8A 4H2PA 3VRDB 5IPYA 4U8PA 4YSXA 1Y56A 2XLUA 4J34A 4U2LA 2XYOA 4EQSA 2ZBWA 2WOWA 3CPIG 4U8NA 2BXRA 5ER0A 4Z2TA 3IHGA 3AE9A 1S3EA 1VQWA 2EQ7A 3FBSA 3QJ4A 3E1TA 1DOEA 1NHQA 4OPIA 1BGJA 1H86A 4YWOA 3DJGX 2CVJA 5HHFA 2YG6A 2YR4A 3PVCA 4XWRA 5BUKA 2YVFA 1FOHA 4USQA 3UOVA 2XFQA 5GRTA 3C96A 2FJBA 2NPXA 3G5SA 1COYA 2X8HA 4J57A 3WE0A 3DA1A 4TM3A 3ATRA 2BYBA 3CGDA 4CY6A 5KXJA 5U25A 5KOWA 2BK5A 4DNAA 4ICYA 4AP1A 3AE6A 2A87A 1Z6LA 5CQFA 3DK4A 4H7UA 1H83A 2JB2A 4UDQA 1PN0A 1OJDA 2JBVA 4BJYA 4B68A 2V3BA 2V60A 2V3AA 2C73A 3AB1A 1K0JA 3VRAA 1NHRA 3QSMA 2BK4A 3ALJA 1YQ3A 1PBCA 2E5VA 1IUSA 1GTEA 2IIDA 3FPZA 1CC4A 1O5WA 2XFOA 2VOUA 4YXDA 3I6DA 1RSGA 2JB1A 1DOCA 2GR2A 2WPEA 3QFBA 1VG0A 2TMDA 4N9XA 4GCMA 3LXDA 3UKAA 3QVPA 1NENA 2WU5A 3NLCA 4X4JA 2RGJA 1K0IA 2BK3A 2C67A 4C3XA 4EQRA 1D5TA 3I3LA 1EBDA 1NG3A 3LZXA 3NKSA 5L46A 5LV9A 2R4EA 3GMCA 4RG4A 3AE2A 5EBKA 1XDIA 1CBOA 1RP0A 1GTHA 4H4WA 3G5RA 1H6VA 1QJDA 1H82A 4IVMB 4JNQA 1D4CA 3L8KA 3RP7A 2X8GA 2EQ6A 2XCGA 1AOGA 3V3OA 1TRBA 4NTCA 4YTMA 5KVIA 4YTPA 2WP5A 2XLTA 4J33A 4OPUA 2WS3A 1SEZA 2WDRA 1QLBA 2JB3A 2VVLG 1H7WA 2WDQA 3K7TA 1PS9A 3DGZA 4B63A 3PO7A 3EANA 2PYXA 1DNCA 3SQPA 4J31A 1P2EA 4YSZA 1XHCA 2JK6A 3KD9A 3BI5A 2C70A 4D03A 1TDNA 1CJ4A 2B9YA 2R4JA 3AE5A 3OZ2A 4LA1A 4OPCA 2GQFA 1B5QA 2C7GA 1IUXA 2XLRA 5U63A 1EL5A 4EMWA 4LIIA 4FDCB 5FS7A 3DJEA 1GALA 2DKIA 2C3DA 4IVOB 3SM8A 1E6EA 1L9EA 4C77A 3RP6A 1KNPA 1ZMDA 1S2YA 1TDEA 5EOWA 3LADA 2WOIA 1PXCA 3BNMA 3VR8A 2R0PA 4H2NA 4H4ZA 4H4RA 1YKJA 2AR8A 5J7XA 3Q6JA 1F8SA 4UDPA 3IC9A 2VQ7A 2WPFA 3ICRA 4JY3A 2YLSA 2B76A 4CBQA 2QCUA 5KWFA 2R0GA 2WBAA 3BI4A 4H4SA 1GRFA 4I58A 4K2XA 3GSIA 5GSNA 4NTDA 2WEUA 1DOBA 4A79A 1TDFA 2RGHA 2OA1A 3UTHA 2R45A 3F8RA 5M0ZA 4B66A 3AD8B 3UOYA 1E1MA 2BA9A 2QA2A 3ABVA 1D7LA 2AAQA 3L1RA 1XANA 4H50A 1KDGA 2OLOA 4FX9A 4U8MA 1VRQB 3CGCA 4U2SA 3VR9A 1YQZA 1OJAA 1E39A 4D04A 4J36A 4YSHA 1EL8A 2XLSA 3NRNA 2GEWA 3NYEA 4HA6A 2XFPA 3CPHG 4IV9A 3GD4A 4Z24A 3DH9A 3FMWA 4EIQA 3UCLA 2XVHA 4K8DA 2YG3A 2R0CA 3UTGA 2C66A 3UTFA 4NEVA 2YM1A 4CRTA 2BXSA
chains in the Genus database with same CATH superfamily
1IJHA 2APGA 4K7ZA 3P9UA 2A89A 2GMHA 1NEKA 1EL9A 3V3NA 1Q9IA 1Y0PA 2OLNA 2VRMA 3SYIA 4ZCCA 3FG2P 1PJ6A 4MJWA 3AEAA 1LTXR 1NG4A 3CN8A 5BRTA 2X99A 5J60A 2HQMA 4CCRA 1ELIA 3AEFA 4A99A 4Z26A 1PXBA 1GRHA 1GOSA 1JNRA 1Q1WA 1JOAA 1PXAA 1GETA 3ALMA 5HY5A 1H84A 2BCGG 4GRTA 4U8IA 2WDVA 5C3JA 4JY2A 4K22A 4K5SA 2XVFA 3CIRA 2WQYA 4U8JA 3RHAA 4G9KA 4B64A 3ICTA 5DBJA 4CCQA 2EQ9A 2E1MA 4BJZA 5JCLA 1XPQA 2B7SA 2EQ8A 1GSNA 4Y4LA 1N4VA 3GDNA 4H4TA 1JRXA 3KKJA 2VRLA 2YM2A 4GDEA 1GT8A 2X3NA 3EF6A 2VVMA 4H2RA 4U8OA 3UOXA 1TDKA 1JNZA 4U8LA 1FEBA 1PDHA 5FS6A 1K4QA 4PABA 3SX6A 3P4PA 4A6NB 5JCIA 2FBWA 2F5ZA 1FL2A 3K30A 4A5LA 1OJTA 4K5RA 1HYUA 1N1PA 1O95A 4ADWA 3NTDA 2BRAA 3IWAA 3C4NA 3NHOX 5KMSA 3LB8A 1GV4A 3HZLA 3K7MX 3SZFA 5IQ1A 4TM0A 3AD7B 2CDUA 4A7AA 1NHPA 2XVJA 2QA1A 1ZDLA 3DK9A 5HXIA 4H4PA 4TM1A 1D4EA 3URHA 2XFUA 2V6OA 1Q1RA 4OPTA 5KMRA 1X31B 3NH3X 3UKPA 4YTNA 3T37A 3GYJA 1N4WA 5EB4A 2BRYA 3R9UA 3NN6X 3CNTA 4OVIA 3UOZA 2CFYA 2V5ZA 3GMBA 4JNAA 3KPKA 1VDCA 1BGNA 4BK1A 2YR6A 3SZ0A 3NN0X 2B7RA 2GVCA 1GRBA 3DK8A 3CNSA 2JKCA 4H4QA 3D8XA 3HYVA 1LVLA 1NAAA 4OPLA 3SFDA 4C3YA 3CMMA 3BHKA 1BKWA 1IUUA 4BV6A 2WP9A 4G6GA 2YAUA 1YY5A 2BCPA 2H88A 4JQ9A 4UDRA 2TPRA 4XWZA 3AE1A 3P4RA 1VG9A 2I0ZA 3DJJA 3GRSA 4DSGA 2YVGA 1W4XA 4EMJA 2VVLA 1PJ7A 2GF3A 2WESA 2C3CA 3FIMB 2UZZA 3QSSA 2GH5A 1CL0A 3NTAA 4APNA 5BULA 4O5QA 1ZX9A 1GRAA 2Y6RA 1F8RA 2FJAA 1GERA 1ZY8A 2RABA 2AQJA 1ZOVA 2RGOA 4NTEA 5FS9A 4DGKA 5C2TA 2WP6A 1NDAA 2R46A 3S61A 3ZYXA 2YLZA 1CJ3A 2BS4A 4JN9A 2V61A 3T2YA 3B6DA 2YG5A 1FEAA 1GESA 4CNJA 1LQUA 1Y56B 3P1WA 2WU2A 4Z44A 4GF7A 1BZLA 1KFYA 3RNMA 2WPCA 3GWFA 3V76A 5JCMA 2BABA 2Q7VA 3CNDA 1ZOYA 4YKGA 4E0VA 2BACA 2DKHA 2J3NA 4XXGA 3GDPA 1B8SA 5U1OA 3LZWA 4WX1A 4UP3A 5KMPA 1RYIA 2C72A 3KA7A 4AOSA 4YSYA 4O5UA 3CNJA 2ZZCA 2GB0A 2OALA 1F3PA 2Q0KA 2QAEA 4Y4MA 1JEHA 2W0HA 2YLTA 1CJ2A 4LU6A 1D4DA 1L9DA 3CGEA 4EIPA 4H4UA 1TYTA 4X9NA 1QO8A 4GUVA 1PBBA 3DMEA 1E7PA 1L0VA 4CY8A 1IUTA 3C4AA 3H8IA 3EPTA 3M13A 5CKUA 3REDA 4Z2UA 4ZCDA 1GNDA 2YVJA 3CGBA 4P9SA 3AE3A 1CC2A 2GMJA 1JU2A 4KPRA 4U8KA 3KPFA 1F8WA 1ZP0A 2IVEA 3EAOA 3M12A 2FJDA 1EL7A 3BI2A 2VQBA 1MOKA 4C5OA 2ZZBA 4NNJA 3ITJA 3KLJA 1ONFA 2C64A 2O9ZA 4H4YA 1GXFA 5HYMA 2WOVA 3UKKA 2GR3A 5KRQA 4BK3A 4FK1A 1UKVG 2BS3A 4IA6A 2XFNA 4TLXA 4FK1C 4EMIA 1JRYA 4ZN0A 1H81A 1KNRA 2XVIA 4GR1A 2XDOA 3AYIA 4REKA 3AE8A 2R9ZA 1LPFA 2YLXA 4NZHA 4OPDA 3RP8A 3SY4A 2Q6UA 3LOVA 3ICSA 5JCNA 2OAMA 4B67A 4J56A 3UP5A 1M64A 2GQWA 3ALLA 1YQ4A 2YWLA 3ADAB 3VQRA 4OCGA 4NWZA 2IVDA 3UTEA 4USRA 3UKQA 4BURA 2NVKX 3AYLA 3H8LA 3COXA 3AECA 1H7XA 4U2TA 3H4KA 1N4UA 1IUWA 3AEBA 3JSKA 3KU9A 3AYJA 3GRTA 1JRZA 2YQUA 3K7QX 1LJ1A 4RSLA 2GV8A 3AEDA 3F8PA 1CC6A 4YKFA 4A65A 3CNPA 1K0LA 1B4VA 4B69A 2JAEA 5EB5A 2H89A 3GWDA 5KVHA 1BWCA 2Z5XA 2E4GA 1M6IA 3GD3A 1CJCA 4NEWA 4AP3A 4B65A 1TDOA 4M52A 4AOXA 4H4VA 3II4A 4OPGA 2ACZA 2B9WA 2C75A 2ZZ0A 3BNUA 2BS2A 2GRTA 3BHFA 2PHHA 2Q0LA 4Y4NA 4H2QA 4J2WA 1L9CA 3DJDA 4YT0A 1OJCA 4EQXA 4EM3A 3NG7X 1KSSA 2CULA 2GR1A 3NNEA 3NYFA 3PS9A 1KSUA 1BF3A 1GRGA 3NYCA 1E1LA 1D7YA 1FECA 1GREA 3NIXA 2GAGB 1DXLA 1DODA 5BVAA 1PBDA 2YLRA 5TR3A 1P2HA 4DSHA 4A6NA 3GYIA 4HB9A 3F8DA 3CPJG 3QSEA 2X50A 3DGHA 4TLZA 2B9XA 2VZ2A 3UKHA 1OJ9A 2ARDA 3D1CA 2YLWA 4EM4A 2Y6QA 1NPXA 3OC4A 1GRTA 3KVEA 3AEEA 2WHDA 2WETA 1E1NA 2A8XA 3NT6A 1REOA 1S3BA 4X9MA 1DJQA 2C76A 4IA5A 3O0HA 4C74A 3NK1X 3QFAA 4GDPA 3S5WA 2GAHB 3M0OA 3B3RA 2C65A 1ZKQA 1KF6A 4ECHA 5IQ4A 4CNKA 3AXBA 2XVEA 5M10A 2C4CA 5KOXA 1S2QA 1DJNA 4Z25A 1O94A 3UP4A 4A9WA 4AT2A 1GEUA 2YR5A 3AWIA 1PBEA 2XLPA 3IHMA 3SGLA 3P4QA 3NGCX 4EQWA 2X8CA 3UKLA 1TYPA 3VRBA 4Z2RA 2Z5YA 1CHUA 3UKFA 1NHSA 3AE4A 1PBFA 4WCTA 2FJEA 4II2A 1LQTA 1PJ5A 1LV0A 4JDRA 3LJPA 3NK0X 3G5QA 3AE7A 4I59A 1FCDA 3QVRA 2BC1A 1MXTA 1ZK7A 3AD9B 1PHHA 3ISHA 2GR0A 4AT0A 4KX6A 4Z43A 1GPEA 5FMHA 1E1KA 3AEGA 1IUVA 3SFEA 2YG7A 3Q9TA 4RG3A 1F6MA 2YG4A 3CTYA 4G6HA 3ZDNA 1V59A 2BC0A 3IF9A 4PAAA 4TM4A 4BK2A 5JCKA 5KMQA 1CF3A 3P4SA 3ATQA 1B37A 4H4XA 3NK2X 1MO9A 1ZMCA 4B1BA 5FS8A 4H2PA 3VRDB 5IPYA 4U8PA 4YSXA 1Y56A 2XLUA 4J34A 4U2LA 2XYOA 4EQSA 2ZBWA 2WOWA 3CPIG 3SZCA 4U8NA 2BXRA 5ER0A 4Z2TA 3IHGA 3AE9A 1S3EA 1VQWA 2EQ7A 3FBSA 3QJ4A 3E1TA 1DOEA 1NHQA 4OPIA 1BGJA 1H86A 4YWOA 3DJGX 2CVJA 5HHFA 2YG6A 2YR4A 3PVCA 4XWRA 5BUKA 2YVFA 1FOHA 4USQA 3UOVA 2XFQA 3HYXA 5GRTA 3C96A 2FJBA 2NPXA 3G5SA 1COYA 2X8HA 4J57A 3WE0A 3DA1A 4TM3A 3ATRA 2BYBA 3CGDA 4CY6A 5KXJA 5U25A 5KOWA 2BK5A 4DNAA 4ICYA 4AP1A 3AE6A 2A87A 1Z6LA 5CQFA 3DK4A 4H7UA 1H83A 2JB2A 4UDQA 1PN0A 1OJDA 2JBVA 4BJYA 4B68A 2V3BA 2V60A 4II3A 2V3AA 2C73A 3AB1A 3T2KA 1K0JA 3VRAA 1NHRA 3QSMA 2BK4A 3ALJA 1YQ3A 1PBCA 2E5VA 1IUSA 1GTEA 2IIDA 3FPZA 1CC4A 1O5WA 2XFOA 2VOUA 4G74A 4YXDA 3I6DA 1RSGA 2JB1A 1DOCA 2GR2A 2WPEA 3QFBA 1VG0A 2TMDA 4N9XA 4GCMA 3LXDA 3UKAA 3QVPA 1NENA 2WU5A 3NLCA 4X4JA 2RGJA 3GYXA 1K0IA 2BK3A 2C67A 4C3XA 4EQRA 1D5TA 3I3LA 1EBDA 1NG3A 3LZXA 3NKSA 5L46A 5LV9A 2R4EA 3GMCA 4RG4A 3AE2A 5EBKA 1XDIA 1CBOA 1RP0A 1GTHA 4H4WA 3G5RA 1H6VA 1QJDA 1H82A 4IVMB 3T31A 4JNQA 1D4CA 3L8KA 3RP7A 2X8GA 2EQ6A 2XCGA 3SZWA 1AOGA 3V3OA 1TRBA 4NTCA 4YTMA 5KVIA 4YTPA 2WP5A 2XLTA 4J33A 4OPUA 2WS3A 1SEZA 2WDRA 1QLBA 2JB3A 2VVLG 1H7WA 2WDQA 3K7TA 1PS9A 3DGZA 4B63A 3PO7A 3EANA 2PYXA 1DNCA 3SQPA 4J31A 1P2EA 4YSZA 1XHCA 2JK6A 3KD9A 3BI5A 2C70A 4D03A 1TDNA 1CJ4A 2B9YA 2R4JA 3AE5A 3OZ2A 4LA1A 4OPCA 2GQFA 1B5QA 2C7GA 1IUXA 2XLRA 5U63A 1EL5A 4EMWA 4LIIA 4FDCB 5FS7A 3DJEA 1GALA 2DKIA 2C3DA 4IVOB 3SM8A 1E6EA 1L9EA 4C77A 3RP6A 3HYWA 1KNPA 1ZMDA 1S2YA 1TDEA 5EOWA 3T0KA 3LADA 2WOIA 1PXCA 3BNMA 3VR8A 2R0PA 4H2NA 4H4ZA 4H4RA 1YKJA 2AR8A 5J7XA 3Q6JA 1F8SA 4UDPA 3IC9A 2VQ7A 2WPFA 3ICRA 5KNLA 4JY3A 2YLSA 2B76A 4CBQA 2QCUA 5KWFA 2R0GA 2WBAA 3BI4A 4G73A 4H4SA 1GRFA 4I58A 4K2XA 3GSIA 3SXIA 5GSNA 4NTDA 2WEUA 1DOBA 4A79A 1TDFA 2RGHA 2OA1A 3UTHA 2R45A 3F8RA 5M0ZA 4B66A 3AD8B 3UOYA 1E1MA 2BA9A 2QA2A 3ABVA 1D7LA 2AAQA 3L1RA 1XANA 4H50A 1KDGA 2OLOA 4FX9A 4U8MA 1VRQB 3CGCA 4U2SA 3VR9A 1YQZA 1OJAA 1E39A 4D04A 4J36A 4YSHA 1EL8A 4GAPA 3T2ZA 2XLSA 3NRNA 2GEWA 3NYEA 4HA6A 2XFPA 3CPHG 4GAVA 3GD4A 4IV9A 3DH9A 3FMWA 4Z24A 3UCLA 2XVHA 4EIQA 3T14A 4K8DA 2YG3A 2R0CA 3UTGA 2C66A 3UTFA 4NEVA 2YM1A 4CRTA 2BXSA
chains in the Genus database with same CATH topology
1IJHA 2APGA 4K7ZA 3P9UA 2A89A 2GMHA 1NEKA 1EL9A 3V3NA 1Q9IA 1Y0PA 2OLNA 2VRMA 3SYIA 4ZCCA 3FG2P 1PJ6A 4MJWA 3AEAA 1LTXR 1NG4A 3CN8A 5BRTA 2X99A 5J60A 2HQMA 4CCRA 1ELIA 3AEFA 4A99A 4Z26A 1PXBA 1GRHA 1GOSA 1JNRA 1Q1WA 1JOAA 1PXAA 1GETA 3ALMA 5HY5A 1H84A 2BCGG 4GRTA 4U8IA 2WDVA 5C3JA 4JY2A 4K22A 4K5SA 2XVFA 3CIRA 2WQYA 4U8JA 3RHAA 4G9KA 4B64A 3ICTA 5DBJA 4CCQA 2EQ9A 2E1MA 4BJZA 5JCLA 1XPQA 2B7SA 2EQ8A 1GSNA 4Y4LA 1N4VA 3GDNA 4H4TA 1JRXA 3KKJA 2VRLA 2YM2A 4GDEA 1GT8A 2X3NA 3EF6A 2VVMA 4H2RA 4U8OA 3UOXA 1TDKA 1JNZA 4U8LA 1FEBA 1PDHA 5FS6A 1K4QA 4PABA 3SX6A 3P4PA 4A6NB 5JCIA 2FBWA 2F5ZA 1FL2A 3K30A 4A5LA 1OJTA 4K5RA 1HYUA 1N1PA 1O95A 4ADWA 3NTDA 2BRAA 3IWAA 3C4NA 3NHOX 5KMSA 3LB8A 1GV4A 3HZLA 3K7MX 3SZFA 5IQ1A 4TM0A 3AD7B 2CDUA 4A7AA 1NHPA 2XVJA 2QA1A 1ZDLA 3DK9A 5HXIA 4H4PA 4TM1A 1D4EA 3URHA 2XFUA 2V6OA 1Q1RA 4OPTA 5KMRA 1X31B 3NH3X 3UKPA 4YTNA 3T37A 3GYJA 1N4WA 5EB4A 2BRYA 3R9UA 3NN6X 3CNTA 4OVIA 3UOZA 2CFYA 2V5ZA 3GMBA 4JNAA 3KPKA 1VDCA 1BGNA 4BK1A 2YR6A 3SZ0A 3NN0X 2B7RA 2GVCA 1GRBA 3DK8A 3CNSA 2JKCA 4H4QA 3D8XA 3HYVA 1LVLA 1NAAA 4OPLA 3SFDA 4C3YA 3CMMA 3BHKA 1BKWA 1IUUA 4BV6A 2WP9A 4G6GA 2YAUA 1YY5A 2BCPA 2H88A 4JQ9A 4UDRA 2TPRA 4XWZA 3AE1A 3P4RA 1VG9A 2I0ZA 3DJJA 3GRSA 4DSGA 2YVGA 1W4XA 4EMJA 2VVLA 1PJ7A 2GF3A 2WESA 2C3CA 3FIMB 2UZZA 3QSSA 2GH5A 1CL0A 3NTAA 4APNA 5BULA 4O5QA 1ZX9A 1GRAA 2Y6RA 1F8RA 2FJAA 1GERA 1ZY8A 2RABA 2AQJA 1ZOVA 2RGOA 4NTEA 5FS9A 4DGKA 5C2TA 2WP6A 1NDAA 2R46A 3S61A 3ZYXA 2YLZA 1CJ3A 2BS4A 4JN9A 2V61A 3T2YA 3B6DA 2YG5A 1FEAA 1GESA 4CNJA 1LQUA 1Y56B 3P1WA 2WU2A 4Z44A 4GF7A 1BZLA 1KFYA 3RNMA 2WPCA 3GWFA 3V76A 5JCMA 2BABA 2Q7VA 3CNDA 1ZOYA 4YKGA 4E0VA 2BACA 2DKHA 2J3NA 4XXGA 3GDPA 1B8SA 5U1OA 3LZWA 4WX1A 4UP3A 5KMPA 1RYIA 2C72A 3KA7A 4AOSA 4YSYA 4O5UA 3CNJA 2ZZCA 2GB0A 2OALA 1F3PA 2Q0KA 2QAEA 4Y4MA 1JEHA 2W0HA 2YLTA 1CJ2A 4LU6A 1D4DA 1L9DA 3CGEA 4EIPA 4H4UA 1TYTA 4X9NA 1QO8A 4GUVA 1PBBA 3DMEA 1E7PA 1L0VA 4CY8A 1IUTA 3C4AA 3H8IA 3EPTA 3M13A 5CKUA 3REDA 4Z2UA 4ZCDA 1GNDA 2YVJA 3CGBA 4P9SA 3AE3A 1CC2A 2GMJA 1JU2A 4KPRA 4U8KA 3KPFA 1F8WA 1ZP0A 2IVEA 3EAOA 3M12A 2FJDA 1EL7A 3BI2A 2VQBA 1MOKA 4C5OA 2ZZBA 4NNJA 3ITJA 3KLJA 1ONFA 2C64A 2O9ZA 4H4YA 1GXFA 5HYMA 2WOVA 3UKKA 2GR3A 5KRQA 4BK3A 4FK1A 1UKVG 2BS3A 4IA6A 2XFNA 4TLXA 4FK1C 4EMIA 1JRYA 4ZN0A 1H81A 1KNRA 2XVIA 4GR1A 2XDOA 3AYIA 4REKA 3AE8A 2R9ZA 1LPFA 2YLXA 4NZHA 4OPDA 3RP8A 3SY4A 2Q6UA 3LOVA 3ICSA 5JCNA 2OAMA 4B67A 4J56A 3UP5A 1M64A 2GQWA 3ALLA 1YQ4A 2YWLA 3ADAB 3VQRA 4OCGA 4NWZA 2IVDA 3UTEA 4USRA 3UKQA 4BURA 2NVKX 3AYLA 3H8LA 3COXA 3AECA 1H7XA 4U2TA 3H4KA 1N4UA 1IUWA 3AEBA 3JSKA 3KU9A 3AYJA 3GRTA 1JRZA 2YQUA 3K7QX 1LJ1A 4RSLA 2GV8A 3AEDA 3F8PA 1CC6A 4YKFA 4A65A 3CNPA 1K0LA 1B4VA 4B69A 2JAEA 5EB5A 2H89A 3GWDA 5KVHA 1BWCA 2Z5XA 2E4GA 1M6IA 3GD3A 1CJCA 4NEWA 4AP3A 4B65A 1TDOA 4M52A 4AOXA 4H4VA 3II4A 4OPGA 2ACZA 2B9WA 2C75A 2ZZ0A 3BNUA 2BS2A 2GRTA 3BHFA 2PHHA 2Q0LA 4Y4NA 4H2QA 4J2WA 1L9CA 3DJDA 4YT0A 1OJCA 4EQXA 4EM3A 3NG7X 1KSSA 2CULA 2GR1A 3NNEA 3NYFA 3PS9A 1KSUA 1BF3A 1GRGA 3NYCA 1E1LA 1D7YA 1FECA 1GREA 3NIXA 2GAGB 1DXLA 1DODA 5BVAA 1PBDA 2YLRA 5TR3A 1P2HA 4DSHA 4A6NA 3GYIA 4HB9A 3F8DA 3CPJG 3QSEA 2X50A 3DGHA 4TLZA 2B9XA 2VZ2A 3UKHA 1OJ9A 2ARDA 3D1CA 2YLWA 4EM4A 2Y6QA 1NPXA 3OC4A 1GRTA 3KVEA 3AEEA 2WHDA 2WETA 1E1NA 2A8XA 3NT6A 1REOA 1S3BA 4X9MA 1DJQA 2C76A 4IA5A 3O0HA 4C74A 3NK1X 3QFAA 4GDPA 3S5WA 2GAHB 3M0OA 3B3RA 2C65A 1ZKQA 1KF6A 4ECHA 5IQ4A 4CNKA 3AXBA 2XVEA 5M10A 2C4CA 5KOXA 1S2QA 1DJNA 4Z25A 1O94A 3UP4A 4A9WA 4AT2A 1GEUA 2YR5A 3AWIA 1PBEA 2XLPA 3IHMA 3SGLA 3P4QA 3NGCX 4EQWA 2X8CA 3UKLA 1TYPA 3VRBA 4Z2RA 2Z5YA 1CHUA 3UKFA 1NHSA 3AE4A 1PBFA 4WCTA 2FJEA 4II2A 1LQTA 1PJ5A 1LV0A 4JDRA 3LJPA 3NK0X 3G5QA 3AE7A 4I59A 1FCDA 3QVRA 2BC1A 1MXTA 1ZK7A 3AD9B 1PHHA 3ISHA 2GR0A 4AT0A 4KX6A 4Z43A 1GPEA 5FMHA 1E1KA 3AEGA 1IUVA 3SFEA 2YG7A 3Q9TA 4RG3A 1F6MA 2YG4A 3CTYA 4G6HA 3ZDNA 1V59A 2BC0A 3IF9A 4PAAA 4TM4A 4BK2A 5JCKA 5KMQA 1CF3A 3P4SA 3ATQA 1B37A 4H4XA 3NK2X 1MO9A 1ZMCA 4B1BA 5FS8A 4H2PA 3VRDB 5IPYA 4U8PA 4YSXA 1Y56A 2XLUA 4J34A 4U2LA 2XYOA 4EQSA 2ZBWA 2WOWA 3CPIG 3SZCA 4U8NA 2BXRA 5ER0A 4Z2TA 3IHGA 3AE9A 1S3EA 1VQWA 2EQ7A 3FBSA 3QJ4A 3E1TA 1DOEA 1NHQA 4OPIA 1BGJA 1H86A 4YWOA 3DJGX 2CVJA 5HHFA 2YG6A 2YR4A 3PVCA 4XWRA 5BUKA 2YVFA 1FOHA 4USQA 3UOVA 2XFQA 3HYXA 5GRTA 3C96A 2FJBA 2NPXA 3G5SA 1COYA 2X8HA 4J57A 3WE0A 3DA1A 4TM3A 3ATRA 2BYBA 3CGDA 4CY6A 5KXJA 5U25A 5KOWA 2BK5A 4DNAA 4ICYA 4AP1A 3AE6A 2A87A 1Z6LA 5CQFA 3DK4A 4H7UA 1H83A 2JB2A 4UDQA 1PN0A 1OJDA 2JBVA 4BJYA 4B68A 2V3BA 2V60A 4II3A 2V3AA 2C73A 3AB1A 3T2KA 1K0JA 3VRAA 1NHRA 3QSMA 2BK4A 3ALJA 1YQ3A 1PBCA 2E5VA 1IUSA 1GTEA 2IIDA 3FPZA 1CC4A 1O5WA 2XFOA 2VOUA 4G74A 4YXDA 3I6DA 1RSGA 2JB1A 1DOCA 2GR2A 2WPEA 3QFBA 1VG0A 2TMDA 4N9XA 4GCMA 3LXDA 3UKAA 3QVPA 1NENA 2WU5A 3NLCA 4X4JA 2RGJA 3GYXA 1K0IA 2BK3A 2C67A 4C3XA 4EQRA 1D5TA 3I3LA 1EBDA 1NG3A 3LZXA 3NKSA 5L46A 5LV9A 2R4EA 3GMCA 4RG4A 3AE2A 5EBKA 1XDIA 1CBOA 1RP0A 1GTHA 4H4WA 3G5RA 1H6VA 1QJDA 1H82A 4IVMB 3T31A 4JNQA 1D4CA 3L8KA 3RP7A 2X8GA 2EQ6A 2XCGA 3SZWA 1AOGA 3V3OA 1TRBA 4NTCA 4YTMA 5KVIA 4YTPA 2WP5A 2XLTA 4J33A 4OPUA 2WS3A 1SEZA 2WDRA 1QLBA 2JB3A 2VVLG 1H7WA 2WDQA 3K7TA 1PS9A 3DGZA 4B63A 3PO7A 3EANA 2PYXA 1DNCA 3SQPA 4J31A 1P2EA 4YSZA 1XHCA 2JK6A 3KD9A 3BI5A 2C70A 4D03A 1TDNA 1CJ4A 2B9YA 2R4JA 3AE5A 3OZ2A 4LA1A 4OPCA 2GQFA 1B5QA 2C7GA 1IUXA 2XLRA 5U63A 1EL5A 4EMWA 4LIIA 4FDCB 5FS7A 3DJEA 1GALA 2DKIA 2C3DA 4IVOB 3SM8A 1E6EA 1L9EA 4C77A 3RP6A 3HYWA 1KNPA 1ZMDA 1S2YA 1TDEA 5EOWA 3T0KA 3LADA 2WOIA 1PXCA 3BNMA 3VR8A 2R0PA 4H2NA 4H4ZA 4H4RA 1YKJA 2AR8A 5J7XA 3Q6JA 1F8SA 4UDPA 3IC9A 2VQ7A 2WPFA 3ICRA 5KNLA 4JY3A 2YLSA 2B76A 4CBQA 2QCUA 5KWFA 2R0GA 2WBAA 3BI4A 4G73A 4H4SA 1GRFA 4I58A 4K2XA 3GSIA 3SXIA 5GSNA 4NTDA 2WEUA 1DOBA 4A79A 1TDFA 2RGHA 2OA1A 3UTHA 2R45A 3F8RA 5M0ZA 4B66A 3AD8B 3UOYA 1E1MA 2BA9A 2QA2A 3ABVA 1D7LA 2AAQA 3L1RA 1XANA 4H50A 1KDGA 2OLOA 4FX9A 4U8MA 1VRQB 3CGCA 4U2SA 3VR9A 1YQZA 1OJAA 1E39A 4D04A 4J36A 4YSHA 1EL8A 4GAPA 3T2ZA 2XLSA 3NRNA 2GEWA 3NYEA 4HA6A 2XFPA 3CPHG 4GAVA 3GD4A 4IV9A 3DH9A 3FMWA 4Z24A 3UCLA 2XVHA 4EIQA 3T14A 4K8DA 2YG3A 2R0CA 3UTGA 2C66A 3UTFA 4NEVA 2YM1A 4CRTA 2BXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJH A;  2APG A;  4K7Z A;  3P9U A;  2A89 A;  2GMH A;  1NEK A;  1EL9 A;  3V3N A;  1Q9I A;  1Y0P A;  2OLN A;  2VRM A;  4ZCC A;  3FG2 P;  1PJ6 A;  4MJW A;  3AEA A;  1LTX R;  1NG4 A;  3CN8 A;  5BRT A;  2X99 A;  5J60 A;  2HQM A;  4CCR A;  1ELI A;  3AEF A;  4A99 A;  4Z26 A;  1PXB A;  1GRH A;  1GOS A;  1JNR A;  1Q1W A;  1JOA A;  1PXA A;  1GET A;  3ALM A;  5HY5 A;  1H84 A;  2BCG G;  4GRT A;  4U8I A;  2WDV A;  5C3J A;  4JY2 A;  4K22 A;  4K5S A;  2XVF A;  3CIR A;  2WQY A;  4U8J A;  3RHA A;  4B64 A;  3ICT A;  5DBJ A;  4CCQ A;  2EQ9 A;  2E1M A;  4BJZ A;  5JCL A;  1XPQ A;  2B7S A;  2EQ8 A;  1GSN A;  4Y4L A;  1N4V A;  3GDN A;  4H4T A;  1JRX A;  3KKJ A;  2VRL A;  2YM2 A;  4GDE A;  1GT8 A;  2X3N A;  3EF6 A;  2VVM A;  4H2R A;  4U8O A;  3UOX A;  1TDK A;  1JNZ A;  4U8L A;  1FEB A;  1PDH A;  5FS6 A;  1K4Q A;  4PAB A;  3P4P A;  4A6N B;  5JCI A;  2FBW A;  2F5Z A;  1FL2 A;  3K30 A;  4A5L A;  1OJT A;  4K5R A;  1HYU A;  1N1P A;  1O95 A;  4ADW A;  3NTD A;  3IWA A;  3C4N A;  3NHO X;  3LB8 A;  1GV4 A;  3HZL A;  3K7M X;  5IQ1 A;  4TM0 A;  3AD7 B;  2CDU A;  4A7A A;  1NHP A;  2XVJ A;  2QA1 A;  1ZDL A;  3DK9 A;  5HXI A;  4H4P A;  4TM1 A;  1D4E A;  3URH A;  2XFU A;  2V6O A;  1Q1R A;  4OPT A;  1X31 B;  3NH3 X;  3UKP A;  4YTN A;  3T37 A;  3GYJ A;  1N4W A;  5EB4 A;  3R9U A;  3NN6 X;  3CNT A;  4OVI A;  3UOZ A;  2CFY A;  2V5Z A;  3GMB A;  4JNA A;  1VDC A;  1BGN A;  4BK1 A;  2YR6 A;  3NN0 X;  2B7R A;  2GVC A;  1GRB A;  3DK8 A;  3CNS A;  2JKC A;  4H4Q A;  3D8X A;  1LVL A;  1NAA A;  4OPL A;  3SFD A;  4C3Y A;  3BHK A;  1BKW A;  1IUU A;  4BV6 A;  2WP9 A;  2YAU A;  1YY5 A;  2BCP A;  2H88 A;  4JQ9 A;  4UDR A;  2TPR A;  4XWZ A;  3AE1 A;  3P4R A;  1VG9 A;  2I0Z A;  3DJJ A;  3GRS A;  4DSG A;  2YVG A;  1W4X A;  4EMJ A;  2VVL A;  1PJ7 A;  2GF3 A;  2WES A;  2C3C A;  3FIM B;  2UZZ A;  3QSS A;  2GH5 A;  1CL0 A;  3NTA A;  4APN A;  5BUL A;  4O5Q A;  1ZX9 A;  1GRA A;  2Y6R A;  1F8R A;  2FJA A;  1GER A;  1ZY8 A;  2RAB A;  2AQJ A;  1ZOV A;  2RGO A;  4NTE A;  5FS9 A;  4DGK A;  5C2T A;  2WP6 A;  1NDA A;  2R46 A;  3S61 A;  3ZYX A;  2YLZ A;  1CJ3 A;  2BS4 A;  4JN9 A;  2V61 A;  3B6D A;  2YG5 A;  1FEA A;  1GES A;  4CNJ A;  1LQU A;  1Y56 B;  3P1W A;  2WU2 A;  4Z44 A;  4GF7 A;  1BZL A;  1KFY A;  3RNM A;  2WPC A;  3GWF A;  3V76 A;  5JCM A;  2BAB A;  2Q7V A;  3CND A;  1ZOY A;  4YKG A;  4E0V A;  2BAC A;  2DKH A;  2J3N A;  4XXG A;  3GDP A;  1B8S A;  5U1O A;  3LZW A;  4WX1 A;  4UP3 A;  1RYI A;  2C72 A;  3KA7 A;  4AOS A;  4YSY A;  4O5U A;  3CNJ A;  2ZZC A;  2GB0 A;  2OAL A;  1F3P A;  2Q0K A;  2QAE A;  4Y4M A;  1JEH A;  2W0H A;  2YLT A;  1CJ2 A;  4LU6 A;  1D4D A;  1L9D A;  3CGE A;  4EIP A;  4H4U A;  1TYT A;  4X9N A;  1QO8 A;  4GUV A;  1PBB A;  3DME A;  1E7P A;  1L0V A;  4CY8 A;  1IUT A;  3C4A A;  3H8I A;  3EPT A;  3M13 A;  5CKU A;  3RED A;  4Z2U A;  4ZCD A;  1GND A;  2YVJ A;  3CGB A;  4P9S A;  3AE3 A;  1CC2 A;  2GMJ A;  1JU2 A;  4KPR A;  4U8K A;  3KPF A;  1F8W A;  1ZP0 A;  2IVE A;  3EAO A;  3M12 A;  2FJD A;  1EL7 A;  3BI2 A;  2VQB A;  1MOK A;  4C5O A;  2ZZB A;  3ITJ A;  3KLJ A;  1ONF A;  2C64 A;  2O9Z A;  4H4Y A;  1GXF A;  5HYM A;  2WOV A;  3UKK A;  2GR3 A;  5KRQ A;  4BK3 A;  4FK1 A;  1UKV G;  2BS3 A;  4IA6 A;  2XFN A;  4TLX A;  4FK1 C;  4EMI A;  1JRY A;  4ZN0 A;  1H81 A;  1KNR A;  2XVI A;  4GR1 A;  2XDO A;  3AYI A;  4REK A;  3AE8 A;  2R9Z A;  1LPF A;  2YLX A;  4NZH A;  4OPD A;  3RP8 A;  2Q6U A;  3LOV A;  3ICS A;  5JCN A;  2OAM A;  4B67 A;  4J56 A;  3UP5 A;  1M64 A;  2GQW A;  3ALL A;  1YQ4 A;  2YWL A;  3ADA B;  3VQR A;  4OCG A;  2IVD A;  3UTE A;  4USR A;  3UKQ A;  4BUR A;  2NVK X;  3AYL A;  3H8L A;  3COX A;  3AEC A;  1H7X A;  4U2T A;  3H4K A;  1N4U A;  1IUW A;  3AEB A;  3JSK A;  3KU9 A;  3AYJ A;  3GRT A;  1JRZ A;  2YQU A;  3K7Q X;  1LJ1 A;  4RSL A;  2GV8 A;  3AED A;  3F8P A;  1CC6 A;  4YKF A;  4A65 A;  3CNP A;  1K0L A;  1B4V A;  4B69 A;  2JAE A;  5EB5 A;  2H89 A;  3GWD A;  5KVH A;  1BWC A;  2Z5X A;  2E4G A;  1M6I A;  3GD3 A;  1CJC A;  4NEW A;  4AP3 A;  4B65 A;  1TDO A;  4M52 A;  4AOX A;  4H4V A;  3II4 A;  4OPG A;  2ACZ A;  2B9W A;  2C75 A;  2ZZ0 A;  3BNU A;  2BS2 A;  2GRT A;  3BHF A;  2PHH A;  2Q0L A;  4Y4N A;  4H2Q A;  4J2W A;  1L9C A;  3DJD A;  4YT0 A;  1OJC A;  4EQX A;  4EM3 A;  3NG7 X;  1KSS A;  2CUL A;  2GR1 A;  3NNE A;  3NYF A;  3PS9 A;  1KSU A;  1BF3 A;  1GRG A;  3NYC A;  1E1L A;  1D7Y A;  1FEC A;  1GRE A;  3NIX A;  2GAG B;  1DXL A;  1DOD A;  5BVA A;  1PBD A;  2YLR A;  5TR3 A;  1P2H A;  4DSH A;  4A6N A;  3GYI A;  4HB9 A;  3F8D A;  3CPJ G;  3QSE A;  2X50 A;  3DGH A;  4TLZ A;  2B9X A;  2VZ2 A;  3UKH A;  1OJ9 A;  2ARD A;  3D1C A;  2YLW A;  4EM4 A;  2Y6Q A;  1NPX A;  3OC4 A;  1GRT A;  3KVE A;  3AEE A;  2WHD A;  2WET A;  1E1N A;  2A8X A;  3NT6 A;  1REO A;  1S3B A;  4X9M A;  1DJQ A;  2C76 A;  4IA5 A;  3O0H A;  4C74 A;  3NK1 X;  3QFA A;  4GDP A;  3S5W A;  2GAH B;  3M0O A;  3B3R A;  2C65 A;  1ZKQ A;  1KF6 A;  4ECH A;  5IQ4 A;  4CNK A;  3AXB A;  2XVE A;  5M10 A;  5KOX A;  1S2Q A;  1DJN A;  4Z25 A;  1O94 A;  3UP4 A;  4A9W A;  4AT2 A;  1GEU A;  2YR5 A;  3AWI A;  1PBE A;  2XLP A;  3IHM A;  3SGL A;  3P4Q A;  3NGC X;  4EQW A;  2X8C A;  3UKL A;  1TYP A;  3VRB A;  4Z2R A;  2Z5Y A;  1CHU A;  3UKF A;  1NHS A;  3AE4 A;  1PBF A;  4WCT A;  2FJE A;  1LQT A;  1PJ5 A;  1LV0 A;  4JDR A;  3LJP A;  3NK0 X;  3G5Q A;  3AE7 A;  4I59 A;  1FCD A;  3QVR A;  2BC1 A;  1MXT A;  1ZK7 A;  3AD9 B;  1PHH A;  3ISH A;  2GR0 A;  4AT0 A;  4KX6 A;  4Z43 A;  1GPE A;  5FMH A;  1E1K A;  3AEG A;  1IUV A;  3SFE A;  2YG7 A;  3Q9T A;  4RG3 A;  1F6M A;  2YG4 A;  3CTY A;  3ZDN A;  1V59 A;  2BC0 A;  3IF9 A;  4PAA A;  4TM4 A;  4BK2 A;  5JCK A;  1CF3 A;  3P4S A;  3ATQ A;  1B37 A;  4H4X A;  3NK2 X;  1MO9 A;  1ZMC A;  4B1B A;  5FS8 A;  4H2P A;  3VRD B;  5IPY A;  4U8P A;  4YSX A;  1Y56 A;  2XLU A;  4J34 A;  4U2L A;  2XYO A;  4EQS A;  2ZBW A;  2WOW A;  3CPI G;  4U8N A;  2BXR A;  5ER0 A;  4Z2T A;  3IHG A;  3AE9 A;  1S3E A;  1VQW A;  2EQ7 A;  3FBS A;  3QJ4 A;  3E1T A;  1DOE A;  1NHQ A;  4OPI A;  1BGJ A;  1H86 A;  4YWO A;  3DJG X;  2CVJ A;  5HHF A;  2YG6 A;  2YR4 A;  3PVC A;  4XWR A;  5BUK A;  2YVF A;  1FOH A;  4USQ A;  3UOV A;  2XFQ A;  5GRT A;  3C96 A;  2FJB A;  2NPX A;  3G5S A;  1COY A;  2X8H A;  4J57 A;  3WE0 A;  3DA1 A;  4TM3 A;  3ATR A;  2BYB A;  3CGD A;  4CY6 A;  5KXJ A;  5U25 A;  5KOW A;  2BK5 A;  4DNA A;  4ICY A;  4AP1 A;  3AE6 A;  2A87 A;  1Z6L A;  5CQF A;  3DK4 A;  4H7U A;  1H83 A;  2JB2 A;  4UDQ A;  1PN0 A;  1OJD A;  2JBV A;  4BJY A;  4B68 A;  2V3B A;  2V60 A;  2V3A A;  2C73 A;  3AB1 A;  1K0J A;  3VRA A;  1NHR A;  3QSM A;  2BK4 A;  3ALJ A;  1YQ3 A;  1PBC A;  2E5V A;  1IUS A;  1GTE A;  2IID A;  3FPZ A;  1CC4 A;  1O5W A;  2XFO A;  2VOU A;  4YXD A;  3I6D A;  1RSG A;  2JB1 A;  1DOC A;  2GR2 A;  2WPE A;  3QFB A;  1VG0 A;  2TMD A;  4N9X A;  4GCM A;  3LXD A;  3UKA A;  3QVP A;  1NEN A;  2WU5 A;  3NLC A;  4X4J A;  2RGJ A;  1K0I A;  2BK3 A;  2C67 A;  4C3X A;  4EQR A;  1D5T A;  3I3L A;  1EBD A;  1NG3 A;  3LZX A;  3NKS A;  5L46 A;  5LV9 A;  2R4E A;  3GMC A;  4RG4 A;  3AE2 A;  5EBK A;  1XDI A;  1CBO A;  1RP0 A;  1GTH A;  4H4W A;  3G5R A;  1H6V A;  1QJD A;  1H82 A;  4IVM B;  4JNQ A;  1D4C A;  3L8K A;  3RP7 A;  2X8G A;  2EQ6 A;  2XCG A;  1AOG A;  3V3O A;  1TRB A;  4NTC A;  4YTM A;  5KVI A;  4YTP A;  2WP5 A;  2XLT A;  4J33 A;  4OPU A;  2WS3 A;  1SEZ A;  2WDR A;  1QLB A;  2JB3 A;  2VVL G;  1H7W A;  2WDQ A;  3K7T A;  1PS9 A;  3DGZ A;  4B63 A;  3PO7 A;  3EAN A;  2PYX A;  1DNC A;  3SQP A;  4J31 A;  1P2E A;  4YSZ A;  1XHC A;  2JK6 A;  3KD9 A;  3BI5 A;  2C70 A;  4D03 A;  1TDN A;  1CJ4 A;  2B9Y A;  2R4J A;  3AE5 A;  3OZ2 A;  4LA1 A;  4OPC A;  2GQF A;  1B5Q A;  2C7G A;  1IUX A;  2XLR A;  5U63 A;  1EL5 A;  4EMW A;  4LII A;  4FDC B;  5FS7 A;  3DJE A;  1GAL A;  2DKI A;  2C3D A;  4IVO B;  3SM8 A;  1E6E A;  1L9E A;  4C77 A;  3RP6 A;  1KNP A;  1ZMD A;  1S2Y A;  1TDE A;  5EOW A;  3LAD A;  2WOI A;  1PXC A;  3BNM A;  3VR8 A;  2R0P A;  4H2N A;  4H4Z A;  4H4R A;  1YKJ A;  2AR8 A;  5J7X A;  3Q6J A;  1F8S A;  4UDP A;  3IC9 A;  2VQ7 A;  2WPF A;  3ICR A;  4JY3 A;  2YLS A;  2B76 A;  4CBQ A;  2QCU A;  5KWF A;  2R0G A;  2WBA A;  3BI4 A;  4H4S A;  1GRF A;  4I58 A;  4K2X A;  3GSI A;  5GSN A;  4NTD A;  2WEU A;  1DOB A;  4A79 A;  1TDF A;  2RGH A;  2OA1 A;  3UTH A;  2R45 A;  3F8R A;  5M0Z A;  4B66 A;  3AD8 B;  3UOY A;  1E1M A;  2BA9 A;  2QA2 A;  3ABV A;  1D7L A;  2AAQ A;  3L1R A;  1XAN A;  4H50 A;  1KDG A;  2OLO A;  4FX9 A;  4U8M A;  1VRQ B;  3CGC A;  4U2S A;  3VR9 A;  1YQZ A;  1OJA A;  1E39 A;  4D04 A;  4J36 A;  4YSH A;  1EL8 A;  2XLS A;  3NRN A;  2GEW A;  3NYE A;  4HA6 A;  2XFP A;  3CPH G;  4IV9 A;  3GD4 A;  4Z24 A;  3DH9 A;  3FMW A;  4EIQ A;  3UCL A;  2XVH A;  4K8D A;  2YG3 A;  2R0C A;  3UTG A;  2C66 A;  3UTF A;  4NEV A;  2YM1 A;  4CRT A;  2BXS A; 
#chains in the Genus database with same CATH topology
 1IJH A;  2APG A;  4K7Z A;  3P9U A;  2A89 A;  2GMH A;  1NEK A;  1EL9 A;  3V3N A;  1Q9I A;  1Y0P A;  2OLN A;  2VRM A;  3SYI A;  4ZCC A;  3FG2 P;  1PJ6 A;  4MJW A;  3AEA A;  1LTX R;  1NG4 A;  3CN8 A;  5BRT A;  2X99 A;  5J60 A;  2HQM A;  4CCR A;  1ELI A;  3AEF A;  4A99 A;  4Z26 A;  1PXB A;  1GRH A;  1GOS A;  1JNR A;  1Q1W A;  1JOA A;  1PXA A;  1GET A;  3ALM A;  5HY5 A;  1H84 A;  2BCG G;  4GRT A;  4U8I A;  2WDV A;  5C3J A;  4JY2 A;  4K22 A;  4K5S A;  2XVF A;  3CIR A;  2WQY A;  4U8J A;  3RHA A;  4G9K A;  4B64 A;  3ICT A;  5DBJ A;  4CCQ A;  2EQ9 A;  2E1M A;  4BJZ A;  5JCL A;  1XPQ A;  2B7S A;  2EQ8 A;  1GSN A;  4Y4L A;  1N4V A;  3GDN A;  4H4T A;  1JRX A;  3KKJ A;  2VRL A;  2YM2 A;  4GDE A;  1GT8 A;  2X3N A;  3EF6 A;  2VVM A;  4H2R A;  4U8O A;  3UOX A;  1TDK A;  1JNZ A;  4U8L A;  1FEB A;  1PDH A;  5FS6 A;  1K4Q A;  4PAB A;  3SX6 A;  3P4P A;  4A6N B;  5JCI A;  2FBW A;  2F5Z A;  1FL2 A;  3K30 A;  4A5L A;  1OJT A;  4K5R A;  1HYU A;  1N1P A;  1O95 A;  4ADW A;  3NTD A;  2BRA A;  3IWA A;  3C4N A;  3NHO X;  5KMS A;  3LB8 A;  1GV4 A;  3HZL A;  3K7M X;  3SZF A;  5IQ1 A;  4TM0 A;  3AD7 B;  2CDU A;  4A7A A;  1NHP A;  2XVJ A;  2QA1 A;  1ZDL A;  3DK9 A;  5HXI A;  4H4P A;  4TM1 A;  1D4E A;  3URH A;  2XFU A;  2V6O A;  1Q1R A;  4OPT A;  5KMR A;  1X31 B;  3NH3 X;  3UKP A;  4YTN A;  3T37 A;  3GYJ A;  1N4W A;  5EB4 A;  2BRY A;  3R9U A;  3NN6 X;  3CNT A;  4OVI A;  3UOZ A;  2CFY A;  2V5Z A;  3GMB A;  4JNA A;  3KPK A;  1VDC A;  1BGN A;  4BK1 A;  2YR6 A;  3SZ0 A;  3NN0 X;  2B7R A;  2GVC A;  1GRB A;  3DK8 A;  3CNS A;  2JKC A;  4H4Q A;  3D8X A;  3HYV A;  1LVL A;  1NAA A;  4OPL A;  3SFD A;  4C3Y A;  3CMM A;  3BHK A;  1BKW A;  1IUU A;  4BV6 A;  2WP9 A;  4G6G A;  2YAU A;  1YY5 A;  2BCP A;  2H88 A;  4JQ9 A;  4UDR A;  2TPR A;  4XWZ A;  3AE1 A;  3P4R A;  1VG9 A;  2I0Z A;  3DJJ A;  3GRS A;  4DSG A;  2YVG A;  1W4X A;  4EMJ A;  2VVL A;  1PJ7 A;  2GF3 A;  2WES A;  2C3C A;  3FIM B;  2UZZ A;  3QSS A;  2GH5 A;  1CL0 A;  3NTA A;  4APN A;  5BUL A;  4O5Q A;  1ZX9 A;  1GRA A;  2Y6R A;  1F8R A;  2FJA A;  1GER A;  1ZY8 A;  2RAB A;  2AQJ A;  1ZOV A;  2RGO A;  4NTE A;  5FS9 A;  4DGK A;  5C2T A;  2WP6 A;  1NDA A;  2R46 A;  3S61 A;  3ZYX A;  2YLZ A;  1CJ3 A;  2BS4 A;  4JN9 A;  2V61 A;  3T2Y A;  3B6D A;  2YG5 A;  1FEA A;  1GES A;  4CNJ A;  1LQU A;  1Y56 B;  3P1W A;  2WU2 A;  4Z44 A;  4GF7 A;  1BZL A;  1KFY A;  3RNM A;  2WPC A;  3GWF A;  3V76 A;  5JCM A;  2BAB A;  2Q7V A;  3CND A;  1ZOY A;  4YKG A;  4E0V A;  2BAC A;  2DKH A;  2J3N A;  4XXG A;  3GDP A;  1B8S A;  5U1O A;  3LZW A;  4WX1 A;  4UP3 A;  5KMP A;  1RYI A;  2C72 A;  3KA7 A;  4AOS A;  4YSY A;  4O5U A;  3CNJ A;  2ZZC A;  2GB0 A;  2OAL A;  1F3P A;  2Q0K A;  2QAE A;  4Y4M A;  1JEH A;  2W0H A;  2YLT A;  1CJ2 A;  4LU6 A;  1D4D A;  1L9D A;  3CGE A;  4EIP A;  4H4U A;  1TYT A;  4X9N A;  1QO8 A;  4GUV A;  1PBB A;  3DME A;  1E7P A;  1L0V A;  4CY8 A;  1IUT A;  3C4A A;  3H8I A;  3EPT A;  3M13 A;  5CKU A;  3RED A;  4Z2U A;  4ZCD A;  1GND A;  2YVJ A;  3CGB A;  4P9S A;  3AE3 A;  1CC2 A;  2GMJ A;  1JU2 A;  4KPR A;  4U8K A;  3KPF A;  1F8W A;  1ZP0 A;  2IVE A;  3EAO A;  3M12 A;  2FJD A;  1EL7 A;  3BI2 A;  2VQB A;  1MOK A;  4C5O A;  2ZZB A;  4NNJ A;  3ITJ A;  3KLJ A;  1ONF A;  2C64 A;  2O9Z A;  4H4Y A;  1GXF A;  5HYM A;  2WOV A;  3UKK A;  2GR3 A;  5KRQ A;  4BK3 A;  4FK1 A;  1UKV G;  2BS3 A;  4IA6 A;  2XFN A;  4TLX A;  4FK1 C;  4EMI A;  1JRY A;  4ZN0 A;  1H81 A;  1KNR A;  2XVI A;  4GR1 A;  2XDO A;  3AYI A;  4REK A;  3AE8 A;  2R9Z A;  1LPF A;  2YLX A;  4NZH A;  4OPD A;  3RP8 A;  3SY4 A;  2Q6U A;  3LOV A;  3ICS A;  5JCN A;  2OAM A;  4B67 A;  4J56 A;  3UP5 A;  1M64 A;  2GQW A;  3ALL A;  1YQ4 A;  2YWL A;  3ADA B;  3VQR A;  4OCG A;  4NWZ A;  2IVD A;  3UTE A;  4USR A;  3UKQ A;  4BUR A;  2NVK X;  3AYL A;  3H8L A;  3COX A;  3AEC A;  1H7X A;  4U2T A;  3H4K A;  1N4U A;  1IUW A;  3AEB A;  3JSK A;  3KU9 A;  3AYJ A;  3GRT A;  1JRZ A;  2YQU A;  3K7Q X;  1LJ1 A;  4RSL A;  2GV8 A;  3AED A;  3F8P A;  1CC6 A;  4YKF A;  4A65 A;  3CNP A;  1K0L A;  1B4V A;  4B69 A;  2JAE A;  5EB5 A;  2H89 A;  3GWD A;  5KVH A;  1BWC A;  2Z5X A;  2E4G A;  1M6I A;  3GD3 A;  1CJC A;  4NEW A;  4AP3 A;  4B65 A;  1TDO A;  4M52 A;  4AOX A;  4H4V A;  3II4 A;  4OPG A;  2ACZ A;  2B9W A;  2C75 A;  2ZZ0 A;  3BNU A;  2BS2 A;  2GRT A;  3BHF A;  2PHH A;  2Q0L A;  4Y4N A;  4H2Q A;  4J2W A;  1L9C A;  3DJD A;  4YT0 A;  1OJC A;  4EQX A;  4EM3 A;  3NG7 X;  1KSS A;  2CUL A;  2GR1 A;  3NNE A;  3NYF A;  3PS9 A;  1KSU A;  1BF3 A;  1GRG A;  3NYC A;  1E1L A;  1D7Y A;  1FEC A;  1GRE A;  3NIX A;  2GAG B;  1DXL A;  1DOD A;  5BVA A;  1PBD A;  2YLR A;  5TR3 A;  1P2H A;  4DSH A;  4A6N A;  3GYI A;  4HB9 A;  3F8D A;  3CPJ G;  3QSE A;  2X50 A;  3DGH A;  4TLZ A;  2B9X A;  2VZ2 A;  3UKH A;  1OJ9 A;  2ARD A;  3D1C A;  2YLW A;  4EM4 A;  2Y6Q A;  1NPX A;  3OC4 A;  1GRT A;  3KVE A;  3AEE A;  2WHD A;  2WET A;  1E1N A;  2A8X A;  3NT6 A;  1REO A;  1S3B A;  4X9M A;  1DJQ A;  2C76 A;  4IA5 A;  3O0H A;  4C74 A;  3NK1 X;  3QFA A;  4GDP A;  3S5W A;  2GAH B;  3M0O A;  3B3R A;  2C65 A;  1ZKQ A;  1KF6 A;  4ECH A;  5IQ4 A;  4CNK A;  3AXB A;  2XVE A;  5M10 A;  2C4C A;  5KOX A;  1S2Q A;  1DJN A;  4Z25 A;  1O94 A;  3UP4 A;  4A9W A;  4AT2 A;  1GEU A;  2YR5 A;  3AWI A;  1PBE A;  2XLP A;  3IHM A;  3SGL A;  3P4Q A;  3NGC X;  4EQW A;  2X8C A;  3UKL A;  1TYP A;  3VRB A;  4Z2R A;  2Z5Y A;  1CHU A;  3UKF A;  1NHS A;  3AE4 A;  1PBF A;  4WCT A;  2FJE A;  4II2 A;  1LQT A;  1PJ5 A;  1LV0 A;  4JDR A;  3LJP A;  3NK0 X;  3G5Q A;  3AE7 A;  4I59 A;  1FCD A;  3QVR A;  2BC1 A;  1MXT A;  1ZK7 A;  3AD9 B;  1PHH A;  3ISH A;  2GR0 A;  4AT0 A;  4KX6 A;  4Z43 A;  1GPE A;  5FMH A;  1E1K A;  3AEG A;  1IUV A;  3SFE A;  2YG7 A;  3Q9T A;  4RG3 A;  1F6M A;  2YG4 A;  3CTY A;  4G6H A;  3ZDN A;  1V59 A;  2BC0 A;  3IF9 A;  4PAA A;  4TM4 A;  4BK2 A;  5JCK A;  5KMQ A;  1CF3 A;  3P4S A;  3ATQ A;  1B37 A;  4H4X A;  3NK2 X;  1MO9 A;  1ZMC A;  4B1B A;  5FS8 A;  4H2P A;  3VRD B;  5IPY A;  4U8P A;  4YSX A;  1Y56 A;  2XLU A;  4J34 A;  4U2L A;  2XYO A;  4EQS A;  2ZBW A;  2WOW A;  3CPI G;  3SZC A;  4U8N A;  2BXR A;  5ER0 A;  4Z2T A;  3IHG A;  3AE9 A;  1S3E A;  1VQW A;  2EQ7 A;  3FBS A;  3QJ4 A;  3E1T A;  1DOE A;  1NHQ A;  4OPI A;  1BGJ A;  1H86 A;  4YWO A;  3DJG X;  2CVJ A;  5HHF A;  2YG6 A;  2YR4 A;  3PVC A;  4XWR A;  5BUK A;  2YVF A;  1FOH A;  4USQ A;  3UOV A;  2XFQ A;  3HYX A;  5GRT A;  3C96 A;  2FJB A;  2NPX A;  3G5S A;  1COY A;  2X8H A;  4J57 A;  3WE0 A;  3DA1 A;  4TM3 A;  3ATR A;  2BYB A;  3CGD A;  4CY6 A;  5KXJ A;  5U25 A;  5KOW A;  2BK5 A;  4DNA A;  4ICY A;  4AP1 A;  3AE6 A;  2A87 A;  1Z6L A;  5CQF A;  3DK4 A;  4H7U A;  1H83 A;  2JB2 A;  4UDQ A;  1PN0 A;  1OJD A;  2JBV A;  4BJY A;  4B68 A;  2V3B A;  2V60 A;  4II3 A;  2V3A A;  2C73 A;  3AB1 A;  3T2K A;  1K0J A;  3VRA A;  1NHR A;  3QSM A;  2BK4 A;  3ALJ A;  1YQ3 A;  1PBC A;  2E5V A;  1IUS A;  1GTE A;  2IID A;  3FPZ A;  1CC4 A;  1O5W A;  2XFO A;  2VOU A;  4G74 A;  4YXD A;  3I6D A;  1RSG A;  2JB1 A;  1DOC A;  2GR2 A;  2WPE A;  3QFB A;  1VG0 A;  2TMD A;  4N9X A;  4GCM A;  3LXD A;  3UKA A;  3QVP A;  1NEN A;  2WU5 A;  3NLC A;  4X4J A;  2RGJ A;  3GYX A;  1K0I A;  2BK3 A;  2C67 A;  4C3X A;  4EQR A;  1D5T A;  3I3L A;  1EBD A;  1NG3 A;  3LZX A;  3NKS A;  5L46 A;  5LV9 A;  2R4E A;  3GMC A;  4RG4 A;  3AE2 A;  5EBK A;  1XDI A;  1CBO A;  1RP0 A;  1GTH A;  4H4W A;  3G5R A;  1H6V A;  1QJD A;  1H82 A;  4IVM B;  3T31 A;  4JNQ A;  1D4C A;  3L8K A;  3RP7 A;  2X8G A;  2EQ6 A;  2XCG A;  3SZW A;  1AOG A;  3V3O A;  1TRB A;  4NTC A;  4YTM A;  5KVI A;  4YTP A;  2WP5 A;  2XLT A;  4J33 A;  4OPU A;  2WS3 A;  1SEZ A;  2WDR A;  1QLB A;  2JB3 A;  2VVL G;  1H7W A;  2WDQ A;  3K7T A;  1PS9 A;  3DGZ A;  4B63 A;  3PO7 A;  3EAN A;  2PYX A;  1DNC A;  3SQP A;  4J31 A;  1P2E A;  4YSZ A;  1XHC A;  2JK6 A;  3KD9 A;  3BI5 A;  2C70 A;  4D03 A;  1TDN A;  1CJ4 A;  2B9Y A;  2R4J A;  3AE5 A;  3OZ2 A;  4LA1 A;  4OPC A;  2GQF A;  1B5Q A;  2C7G A;  1IUX A;  2XLR A;  5U63 A;  1EL5 A;  4EMW A;  4LII A;  4FDC B;  5FS7 A;  3DJE A;  1GAL A;  2DKI A;  2C3D A;  4IVO B;  3SM8 A;  1E6E A;  1L9E A;  4C77 A;  3RP6 A;  3HYW A;  1KNP A;  1ZMD A;  1S2Y A;  1TDE A;  5EOW A;  3T0K A;  3LAD A;  2WOI A;  1PXC A;  3BNM A;  3VR8 A;  2R0P A;  4H2N A;  4H4Z A;  4H4R A;  1YKJ A;  2AR8 A;  5J7X A;  3Q6J A;  1F8S A;  4UDP A;  3IC9 A;  2VQ7 A;  2WPF A;  3ICR A;  5KNL A;  4JY3 A;  2YLS A;  2B76 A;  4CBQ A;  2QCU A;  5KWF A;  2R0G A;  2WBA A;  3BI4 A;  4G73 A;  4H4S A;  1GRF A;  4I58 A;  4K2X A;  3GSI A;  3SXI A;  5GSN A;  4NTD A;  2WEU A;  1DOB A;  4A79 A;  1TDF A;  2RGH A;  2OA1 A;  3UTH A;  2R45 A;  3F8R A;  5M0Z A;  4B66 A;  3AD8 B;  3UOY A;  1E1M A;  2BA9 A;  2QA2 A;  3ABV A;  1D7L A;  2AAQ A;  3L1R A;  1XAN A;  4H50 A;  1KDG A;  2OLO A;  4FX9 A;  4U8M A;  1VRQ B;  3CGC A;  4U2S A;  3VR9 A;  1YQZ A;  1OJA A;  1E39 A;  4D04 A;  4J36 A;  4YSH A;  1EL8 A;  4GAP A;  3T2Z A;  2XLS A;  3NRN A;  2GEW A;  3NYE A;  4HA6 A;  2XFP A;  3CPH G;  4GAV A;  3GD4 A;  4IV9 A;  3DH9 A;  3FMW A;  4Z24 A;  3UCL A;  2XVH A;  4EIQ A;  3T14 A;  4K8D A;  2YG3 A;  2R0C A;  3UTG A;  2C66 A;  3UTF A;  4NEV A;  2YM1 A;  4CRT A;  2BXS A; 
#chains in the Genus database with same CATH homology
 1IJH A;  2APG A;  4K7Z A;  3P9U A;  2A89 A;  2GMH A;  1NEK A;  1EL9 A;  3V3N A;  1Q9I A;  1Y0P A;  2OLN A;  2VRM A;  3SYI A;  4ZCC A;  3FG2 P;  1PJ6 A;  4MJW A;  3AEA A;  1LTX R;  1NG4 A;  3CN8 A;  5BRT A;  2X99 A;  5J60 A;  2HQM A;  4CCR A;  1ELI A;  3AEF A;  4A99 A;  4Z26 A;  1PXB A;  1GRH A;  1GOS A;  1JNR A;  1Q1W A;  1JOA A;  1PXA A;  1GET A;  3ALM A;  5HY5 A;  1H84 A;  2BCG G;  4GRT A;  4U8I A;  2WDV A;  5C3J A;  4JY2 A;  4K22 A;  4K5S A;  2XVF A;  3CIR A;  2WQY A;  4U8J A;  3RHA A;  4G9K A;  4B64 A;  3ICT A;  5DBJ A;  4CCQ A;  2EQ9 A;  2E1M A;  4BJZ A;  5JCL A;  1XPQ A;  2B7S A;  2EQ8 A;  1GSN A;  4Y4L A;  1N4V A;  3GDN A;  4H4T A;  1JRX A;  3KKJ A;  2VRL A;  2YM2 A;  4GDE A;  1GT8 A;  2X3N A;  3EF6 A;  2VVM A;  4H2R A;  4U8O A;  3UOX A;  1TDK A;  1JNZ A;  4U8L A;  1FEB A;  1PDH A;  5FS6 A;  1K4Q A;  4PAB A;  3SX6 A;  3P4P A;  4A6N B;  5JCI A;  2FBW A;  2F5Z A;  1FL2 A;  3K30 A;  4A5L A;  1OJT A;  4K5R A;  1HYU A;  1N1P A;  1O95 A;  4ADW A;  3NTD A;  2BRA A;  3IWA A;  3C4N A;  3NHO X;  5KMS A;  3LB8 A;  1GV4 A;  3HZL A;  3K7M X;  3SZF A;  5IQ1 A;  4TM0 A;  3AD7 B;  2CDU A;  4A7A A;  1NHP A;  2XVJ A;  2QA1 A;  1ZDL A;  3DK9 A;  5HXI A;  4H4P A;  4TM1 A;  1D4E A;  3URH A;  2XFU A;  2V6O A;  1Q1R A;  4OPT A;  5KMR A;  1X31 B;  3NH3 X;  3UKP A;  4YTN A;  3T37 A;  3GYJ A;  1N4W A;  5EB4 A;  2BRY A;  3R9U A;  3NN6 X;  3CNT A;  4OVI A;  3UOZ A;  2CFY A;  2V5Z A;  3GMB A;  4JNA A;  3KPK A;  1VDC A;  1BGN A;  4BK1 A;  2YR6 A;  3SZ0 A;  3NN0 X;  2B7R A;  2GVC A;  1GRB A;  3DK8 A;  3CNS A;  2JKC A;  4H4Q A;  3D8X A;  3HYV A;  1LVL A;  1NAA A;  4OPL A;  3SFD A;  4C3Y A;  3CMM A;  3BHK A;  1BKW A;  1IUU A;  4BV6 A;  2WP9 A;  4G6G A;  2YAU A;  1YY5 A;  2BCP A;  2H88 A;  4JQ9 A;  4UDR A;  2TPR A;  4XWZ A;  3AE1 A;  3P4R A;  1VG9 A;  2I0Z A;  3DJJ A;  3GRS A;  4DSG A;  2YVG A;  1W4X A;  4EMJ A;  2VVL A;  1PJ7 A;  2GF3 A;  2WES A;  2C3C A;  3FIM B;  2UZZ A;  3QSS A;  2GH5 A;  1CL0 A;  3NTA A;  4APN A;  5BUL A;  4O5Q A;  1ZX9 A;  1GRA A;  2Y6R A;  1F8R A;  2FJA A;  1GER A;  1ZY8 A;  2RAB A;  2AQJ A;  1ZOV A;  2RGO A;  4NTE A;  5FS9 A;  4DGK A;  5C2T A;  2WP6 A;  1NDA A;  2R46 A;  3S61 A;  3ZYX A;  2YLZ A;  1CJ3 A;  2BS4 A;  4JN9 A;  2V61 A;  3T2Y A;  3B6D A;  2YG5 A;  1FEA A;  1GES A;  4CNJ A;  1LQU A;  1Y56 B;  3P1W A;  2WU2 A;  4Z44 A;  4GF7 A;  1BZL A;  1KFY A;  3RNM A;  2WPC A;  3GWF A;  3V76 A;  5JCM A;  2BAB A;  2Q7V A;  3CND A;  1ZOY A;  4YKG A;  4E0V A;  2BAC A;  2DKH A;  2J3N A;  4XXG A;  3GDP A;  1B8S A;  5U1O A;  3LZW A;  4WX1 A;  4UP3 A;  5KMP A;  1RYI A;  2C72 A;  3KA7 A;  4AOS A;  4YSY A;  4O5U A;  3CNJ A;  2ZZC A;  2GB0 A;  2OAL A;  1F3P A;  2Q0K A;  2QAE A;  4Y4M A;  1JEH A;  2W0H A;  2YLT A;  1CJ2 A;  4LU6 A;  1D4D A;  1L9D A;  3CGE A;  4EIP A;  4H4U A;  1TYT A;  4X9N A;  1QO8 A;  4GUV A;  1PBB A;  3DME A;  1E7P A;  1L0V A;  4CY8 A;  1IUT A;  3C4A A;  3H8I A;  3EPT A;  3M13 A;  5CKU A;  3RED A;  4Z2U A;  4ZCD A;  1GND A;  2YVJ A;  3CGB A;  4P9S A;  3AE3 A;  1CC2 A;  2GMJ A;  1JU2 A;  4KPR A;  4U8K A;  3KPF A;  1F8W A;  1ZP0 A;  2IVE A;  3EAO A;  3M12 A;  2FJD A;  1EL7 A;  3BI2 A;  2VQB A;  1MOK A;  4C5O A;  2ZZB A;  4NNJ A;  3ITJ A;  3KLJ A;  1ONF A;  2C64 A;  2O9Z A;  4H4Y A;  1GXF A;  5HYM A;  2WOV A;  3UKK A;  2GR3 A;  5KRQ A;  4BK3 A;  4FK1 A;  1UKV G;  2BS3 A;  4IA6 A;  2XFN A;  4TLX A;  4FK1 C;  4EMI A;  1JRY A;  4ZN0 A;  1H81 A;  1KNR A;  2XVI A;  4GR1 A;  2XDO A;  3AYI A;  4REK A;  3AE8 A;  2R9Z A;  1LPF A;  2YLX A;  4NZH A;  4OPD A;  3RP8 A;  3SY4 A;  2Q6U A;  3LOV A;  3ICS A;  5JCN A;  2OAM A;  4B67 A;  4J56 A;  3UP5 A;  1M64 A;  2GQW A;  3ALL A;  1YQ4 A;  2YWL A;  3ADA B;  3VQR A;  4OCG A;  4NWZ A;  2IVD A;  3UTE A;  4USR A;  3UKQ A;  4BUR A;  2NVK X;  3AYL A;  3H8L A;  3COX A;  3AEC A;  1H7X A;  4U2T A;  3H4K A;  1N4U A;  1IUW A;  3AEB A;  3JSK A;  3KU9 A;  3AYJ A;  3GRT A;  1JRZ A;  2YQU A;  3K7Q X;  1LJ1 A;  4RSL A;  2GV8 A;  3AED A;  3F8P A;  1CC6 A;  4YKF A;  4A65 A;  3CNP A;  1K0L A;  1B4V A;  4B69 A;  2JAE A;  5EB5 A;  2H89 A;  3GWD A;  5KVH A;  1BWC A;  2Z5X A;  2E4G A;  1M6I A;  3GD3 A;  1CJC A;  4NEW A;  4AP3 A;  4B65 A;  1TDO A;  4M52 A;  4AOX A;  4H4V A;  3II4 A;  4OPG A;  2ACZ A;  2B9W A;  2C75 A;  2ZZ0 A;  3BNU A;  2BS2 A;  2GRT A;  3BHF A;  2PHH A;  2Q0L A;  4Y4N A;  4H2Q A;  4J2W A;  1L9C A;  3DJD A;  4YT0 A;  1OJC A;  4EQX A;  4EM3 A;  3NG7 X;  1KSS A;  2CUL A;  2GR1 A;  3NNE A;  3NYF A;  3PS9 A;  1KSU A;  1BF3 A;  1GRG A;  3NYC A;  1E1L A;  1D7Y A;  1FEC A;  1GRE A;  3NIX A;  2GAG B;  1DXL A;  1DOD A;  5BVA A;  1PBD A;  2YLR A;  5TR3 A;  1P2H A;  4DSH A;  4A6N A;  3GYI A;  4HB9 A;  3F8D A;  3CPJ G;  3QSE A;  2X50 A;  3DGH A;  4TLZ A;  2B9X A;  2VZ2 A;  3UKH A;  1OJ9 A;  2ARD A;  3D1C A;  2YLW A;  4EM4 A;  2Y6Q A;  1NPX A;  3OC4 A;  1GRT A;  3KVE A;  3AEE A;  2WHD A;  2WET A;  1E1N A;  2A8X A;  3NT6 A;  1REO A;  1S3B A;  4X9M A;  1DJQ A;  2C76 A;  4IA5 A;  3O0H A;  4C74 A;  3NK1 X;  3QFA A;  4GDP A;  3S5W A;  2GAH B;  3M0O A;  3B3R A;  2C65 A;  1ZKQ A;  1KF6 A;  4ECH A;  5IQ4 A;  4CNK A;  3AXB A;  2XVE A;  5M10 A;  2C4C A;  5KOX A;  1S2Q A;  1DJN A;  4Z25 A;  1O94 A;  3UP4 A;  4A9W A;  4AT2 A;  1GEU A;  2YR5 A;  3AWI A;  1PBE A;  2XLP A;  3IHM A;  3SGL A;  3P4Q A;  3NGC X;  4EQW A;  2X8C A;  3UKL A;  1TYP A;  3VRB A;  4Z2R A;  2Z5Y A;  1CHU A;  3UKF A;  1NHS A;  3AE4 A;  1PBF A;  4WCT A;  2FJE A;  4II2 A;  1LQT A;  1PJ5 A;  1LV0 A;  4JDR A;  3LJP A;  3NK0 X;  3G5Q A;  3AE7 A;  4I59 A;  1FCD A;  3QVR A;  2BC1 A;  1MXT A;  1ZK7 A;  3AD9 B;  1PHH A;  3ISH A;  2GR0 A;  4AT0 A;  4KX6 A;  4Z43 A;  1GPE A;  5FMH A;  1E1K A;  3AEG A;  1IUV A;  3SFE A;  2YG7 A;  3Q9T A;  4RG3 A;  1F6M A;  2YG4 A;  3CTY A;  4G6H A;  3ZDN A;  1V59 A;  2BC0 A;  3IF9 A;  4PAA A;  4TM4 A;  4BK2 A;  5JCK A;  5KMQ A;  1CF3 A;  3P4S A;  3ATQ A;  1B37 A;  4H4X A;  3NK2 X;  1MO9 A;  1ZMC A;  4B1B A;  5FS8 A;  4H2P A;  3VRD B;  5IPY A;  4U8P A;  4YSX A;  1Y56 A;  2XLU A;  4J34 A;  4U2L A;  2XYO A;  4EQS A;  2ZBW A;  2WOW A;  3CPI G;  3SZC A;  4U8N A;  2BXR A;  5ER0 A;  4Z2T A;  3IHG A;  3AE9 A;  1S3E A;  1VQW A;  2EQ7 A;  3FBS A;  3QJ4 A;  3E1T A;  1DOE A;  1NHQ A;  4OPI A;  1BGJ A;  1H86 A;  4YWO A;  3DJG X;  2CVJ A;  5HHF A;  2YG6 A;  2YR4 A;  3PVC A;  4XWR A;  5BUK A;  2YVF A;  1FOH A;  4USQ A;  3UOV A;  2XFQ A;  3HYX A;  5GRT A;  3C96 A;  2FJB A;  2NPX A;  3G5S A;  1COY A;  2X8H A;  4J57 A;  3WE0 A;  3DA1 A;  4TM3 A;  3ATR A;  2BYB A;  3CGD A;  4CY6 A;  5KXJ A;  5U25 A;  5KOW A;  2BK5 A;  4DNA A;  4ICY A;  4AP1 A;  3AE6 A;  2A87 A;  1Z6L A;  5CQF A;  3DK4 A;  4H7U A;  1H83 A;  2JB2 A;  4UDQ A;  1PN0 A;  1OJD A;  2JBV A;  4BJY A;  4B68 A;  2V3B A;  2V60 A;  4II3 A;  2V3A A;  2C73 A;  3AB1 A;  3T2K A;  1K0J A;  3VRA A;  1NHR A;  3QSM A;  2BK4 A;  3ALJ A;  1YQ3 A;  1PBC A;  2E5V A;  1IUS A;  1GTE A;  2IID A;  3FPZ A;  1CC4 A;  1O5W A;  2XFO A;  2VOU A;  4G74 A;  4YXD A;  3I6D A;  1RSG A;  2JB1 A;  1DOC A;  2GR2 A;  2WPE A;  3QFB A;  1VG0 A;  2TMD A;  4N9X A;  4GCM A;  3LXD A;  3UKA A;  3QVP A;  1NEN A;  2WU5 A;  3NLC A;  4X4J A;  2RGJ A;  3GYX A;  1K0I A;  2BK3 A;  2C67 A;  4C3X A;  4EQR A;  1D5T A;  3I3L A;  1EBD A;  1NG3 A;  3LZX A;  3NKS A;  5L46 A;  5LV9 A;  2R4E A;  3GMC A;  4RG4 A;  3AE2 A;  5EBK A;  1XDI A;  1CBO A;  1RP0 A;  1GTH A;  4H4W A;  3G5R A;  1H6V A;  1QJD A;  1H82 A;  4IVM B;  3T31 A;  4JNQ A;  1D4C A;  3L8K A;  3RP7 A;  2X8G A;  2EQ6 A;  2XCG A;  3SZW A;  1AOG A;  3V3O A;  1TRB A;  4NTC A;  4YTM A;  5KVI A;  4YTP A;  2WP5 A;  2XLT A;  4J33 A;  4OPU A;  2WS3 A;  1SEZ A;  2WDR A;  1QLB A;  2JB3 A;  2VVL G;  1H7W A;  2WDQ A;  3K7T A;  1PS9 A;  3DGZ A;  4B63 A;  3PO7 A;  3EAN A;  2PYX A;  1DNC A;  3SQP A;  4J31 A;  1P2E A;  4YSZ A;  1XHC A;  2JK6 A;  3KD9 A;  3BI5 A;  2C70 A;  4D03 A;  1TDN A;  1CJ4 A;  2B9Y A;  2R4J A;  3AE5 A;  3OZ2 A;  4LA1 A;  4OPC A;  2GQF A;  1B5Q A;  2C7G A;  1IUX A;  2XLR A;  5U63 A;  1EL5 A;  4EMW A;  4LII A;  4FDC B;  5FS7 A;  3DJE A;  1GAL A;  2DKI A;  2C3D A;  4IVO B;  3SM8 A;  1E6E A;  1L9E A;  4C77 A;  3RP6 A;  3HYW A;  1KNP A;  1ZMD A;  1S2Y A;  1TDE A;  5EOW A;  3T0K A;  3LAD A;  2WOI A;  1PXC A;  3BNM A;  3VR8 A;  2R0P A;  4H2N A;  4H4Z A;  4H4R A;  1YKJ A;  2AR8 A;  5J7X A;  3Q6J A;  1F8S A;  4UDP A;  3IC9 A;  2VQ7 A;  2WPF A;  3ICR A;  5KNL A;  4JY3 A;  2YLS A;  2B76 A;  4CBQ A;  2QCU A;  5KWF A;  2R0G A;  2WBA A;  3BI4 A;  4G73 A;  4H4S A;  1GRF A;  4I58 A;  4K2X A;  3GSI A;  3SXI A;  5GSN A;  4NTD A;  2WEU A;  1DOB A;  4A79 A;  1TDF A;  2RGH A;  2OA1 A;  3UTH A;  2R45 A;  3F8R A;  5M0Z A;  4B66 A;  3AD8 B;  3UOY A;  1E1M A;  2BA9 A;  2QA2 A;  3ABV A;  1D7L A;  2AAQ A;  3L1R A;  1XAN A;  4H50 A;  1KDG A;  2OLO A;  4FX9 A;  4U8M A;  1VRQ B;  3CGC A;  4U2S A;  3VR9 A;  1YQZ A;  1OJA A;  1E39 A;  4D04 A;  4J36 A;  4YSH A;  1EL8 A;  4GAP A;  3T2Z A;  2XLS A;  3NRN A;  2GEW A;  3NYE A;  4HA6 A;  2XFP A;  3CPH G;  4GAV A;  3GD4 A;  4IV9 A;  3DH9 A;  3FMW A;  4Z24 A;  3UCL A;  2XVH A;  4EIQ A;  3T14 A;  4K8D A;  2YG3 A;  2R0C A;  3UTG A;  2C66 A;  3UTF A;  4NEV A;  2YM1 A;  4CRT A;  2BXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...