4FK1A

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
299
structure length
299
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVMKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin reductase
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 92
structure length 299
sequence length 299
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1A02
4X9NA 3VRAA 1HYUA 3AE4A 2YG6A 3G5SA 4TM4A 1PBEA 5HY5A 2YWLA 1FL2A 3KPFA 1K4QA 3M0OA 2CFYA 3GD3A 1RYIA 3AEFA 3B3RA 4C3YA 2WOIA 1NPXA 4U2LA 1ZX9A 3DGZA 3C4NA 1JOAA 2B9YA 1O94A 2X3NA 2QCUA 3V3OA 1XPQA 3S5WA 3BNMA 2YG7A 4TM1A 5LV9A 1REOA 2FJDA 3UTGA 2ARDA 1S3EA 2C70A 3Q6JA 1PJ6A 3CGEA 4TLZA 4ZN0A 5DBJA 3HZLA 3EPTA 1E7PA 4KX6A 3AYLA 4J56A 4GUVA 4EMJA 4U8LA 2XFUA 1PBBA 1PHHA 1NHRA 1YKJA 2WHDA 2AQJA 2GH5A 3AE1A 3AWIA 3FBSA 1NHPA 3UOXA 3KKJA 4ICYA 3UP5A 4GR1A 1N4VA 4H7UA 2A8XA 1E6EA 1LQTA 4MJWA 1YY5A 3KU9A 3PS9A 3LXDA 3L1RA 4RG3A 2BCGG 5U63A 4XXGA 3IHGA 4YSYA 4EQSA 1O5WA 2E5VA 2Q0KA 3K7TA 1NENA 1JNZA 2AAQA 2I0ZA 4B69A 1B5QA 4K5SA 2V6OA 3EF6A 1F6MA 1NDAA 4BJYA 1EL7A 4PABA 4YSHA 2BK5A 3NYCA 3DH9A 5EB5A 4H4TA 4CY6A 1D4EA 4H2PA 5BUKA 5C2TA 3ICRA 4N9XA 3DK4A 1GRGA 1K0LA 3GSIA 4H4YA 4E0VA 4JY3A 4DSHA 2VZ2A 2VQ7A 4K7ZA 2XLUA 5FS6A 1GXFA 1Y0PA 2EQ8A 4HA6A 4JN9A 4LA1A 4U2TA 4B67A 1YQZA 2YVJA 2BYBA 2DKHA 3GYJA 4X9MA 4YKGA 2GEWA 1JEHA 1GETA 2WEUA 3CNSA 1CC4A 4DNAA 3AE8A 2A87A 1B4VA 1GRAA 3NK2X 3P4SA 2C65A 2GR2A 1PJ7A 3H8IA 1CJ2A 5EBKA 4UP3A 4B66A 1NG3A 2YLZA 2GQFA 1RSGA 5EB4A 4UDRA 4RSLA 4UDPA 2WU2A 5U25A 3VR9A 5KVHA 1NAAA 3GRSA 4OPDA 2CULA 5CQFA 1S2YA 3M13A 1QLBA 3P4RA 3CGDA 5M0ZA 2IVDA 1CC2A 4J31A 3E1TA 2BA9A 2QA2A 4EIQA 1L9CA 2OLOA 2X8HA 2Q0LA 3H4KA 2ZBWA 4IV9A 4I59A 1D7YA 1EBDA 4D04A 5L46A 2YAUA 1ZP0A 1Q1RA 4OPGA 1KNRA 2YR5A 1FOHA 1NHQA 1ZMCA 2XVEA 1ZK7A 3UTEA 4I58A 2XVJA 5BVAA 5J7XA 1IUUA 2VVMA 3CGCA 4H4ZA 4A6NA 1TDNA 3RNMA 1B8SA 4U8JA 2XFOA 3BI2A 1ZKQA 2BXSA 1O95A 3ZYXA 5J60A 2B76A 4A7AA 2QA1A 2WPEA 5GRTA 3UKFA 3COXA 3PVCA 1GRHA 1GESA 2NVKX 4C3XA 1BWCA 4YXDA 5HXIA 4H4SA 3BHKA 2OALA 2XCGA 3K7MX 3G5QA 2R45A 1ELIA 2GR3A 1E1LA 2YG3A 3B6DA 3UP4A 4OCGA 2J3NA 3NTAA 4KPRA 1FEAA 4Y4LA 3EAOA 4BK3A 2IVEA 2WBAA 4Z25A 2GR0A 2GQWA 3QSEA 4JQ9A 5IPYA 1VQWA 4FK1A 3NH3X 1LTXR 4IVMB 2EQ7A 2R4JA 3VR8A 1CJ4A 4FK1C 4CCQA 4CRTA 3C96A 1GV4A 3KVEA 4K8DA 1PJ5A 1JRXA 3CNTA 1CBOA 3QFAA 3VQRA 2JAEA 1JRZA 1TDFA 3I3LA 2DKIA 3PO7A 2YLSA 3GRTA 2PYXA 2YM1A 3QVRA 2YLWA 3ALLA 4Z24A 5JCMA 3F8RA 1D4CA 2BC1A 4TLXA 2WP9A 2R9ZA 2WS3A 3BHFA 3AE6A 3P4PA 5JCNA 1E1KA 2XFNA 2GAGB 1CC6A 4IVOB 3DJDA 4CNJA 2W0HA 4USRA 3UKLA 4C77A 3DA1A 2BK4A 3DK9A 4OPLA 5BULA 2XLSA 1GPEA 3AD9B 2Q7VA 2PHHA 3LJPA 2GAHB 4XWZA 3UOZA 1IJHA 3H8LA 2WQYA 2V5ZA 3BI4A 4U8MA 2Y6QA 1LPFA 2XDOA 3CNJA 2B9WA 4U8OA 1OJTA 2VRMA 4OPCA 2WESA 1ZOVA 3AYJA 3UOVA 3UTHA 3NRNA 1JNRA 2X8CA 3DJGX 5ER0A 2BS2A 4K2XA 4EM3A 4CY8A 1TYTA 2XYOA 4Z44A 1N1PA 2QAEA 1PXBA 2JKCA 2ZZCA 3UCLA 1D7LA 1DNCA 1N4UA 2Q6UA 3ABVA 3IWAA 4GDEA 4P9SA 4U8PA 3P4QA 4H2QA 3AEGA 4H4PA 2BCPA 5FS8A 5JCLA 1LQUA 2VVLA 1NEKA 1ZOYA 3NYFA 1PBDA 4NEVA 3QFBA 4AP1A 2GB0A 2VRLA 2YM2A 5FS9A 4AT0A 4J34A 4EQWA 1VRQB 3NT6A 1E39A 3VRDB 1CJ3A 3AD8B 5KWFA 2B7SA 2OA1A 2RGOA 3NK1X 3KD9A 2CDUA 1S3BA 2Z5YA 1KF6A 5C3JA 1TDEA 1IUXA 5IQ1A 4H4UA 1DOCA 2WPFA 1KFYA 3CIRA 1KDGA 2EQ6A 1BGNA 1GEUA 1PS9A 2GR1A 2V3BA 3LB8A 1SEZA 3NNEA 5KOWA 3GWFA 1H83A 4H4XA 1NHSA 3AE3A 1JRYA 3NTDA 3AE9A 3KA7A 1COYA 2TMDA 2CVJA 4LU6A 4GDPA 2UZZA 1F8RA 4A5LA 1KNPA 2BXRA 1KSUA 3SFDA 2ZZBA 4B1BA 3LZWA 3IHMA 2X99A 2RGJA 1D5TA 3QSSA 1F8SA 4IA5A 4U2SA 3CNPA 4CNKA 4A65A 1BKWA 2GF3A 4H2RA 5CKUA 1QO8A 4AOSA 3D1CA 2YLXA 4YTMA 2R0CA 4TM3A 4TM0A 1GTEA 1VDCA 1PDHA 3D8XA 4GCMA 4APNA 2YR4A 1Y56A 3NKSA 2H88A 4Z2TA 2GVCA 1PBCA 1LJ1A 4J2WA 3M12A 1F8WA 2V61A 1TRBA 3AB1A 3UKPA 4BK1A 3SGLA 1S2QA 2NPXA 4Z2RA 2C3CA 3DK8A 1L9DA 1TDOA 3P9UA 4Y4MA 2BACA 1B37A 1ZDLA 2V60A 1PXCA 5FS7A 2IIDA 4YTNA 2WDQA 1IUSA 4FX9A 3C4AA 4DGKA 2C66A 1EL8A 4JDRA 4M52A 4U8KA 2JB2A 2O9ZA 3FPZA 2XFPA 1EL9A 4EMIA 4X4JA 3CPIG 4YSXA 4ECHA 3ICSA 3RP8A 2B7RA 1D4DA 2BK3A 1X31B 3WE0A 2YLTA 3ICTA 4A9WA 3CTYA 1GSNA 3ITJA 4J33A 4GF7A 1VG9A 2OAMA 4A79A 1GALA 2WP6A 3G5RA 3UTFA 3K7QX 1DOBA 1K0JA 2F5ZA 2OLNA 2WOVA 3AECA 3LOVA 1PBFA 2YLRA 1L9EA 1PXAA 5HHFA 2XLRA 1XANA 2BC0A 3AYIA 4WX1A 4B63A 2GMJA 3AE2A 2R0GA 1E1NA 3UKAA 3UKKA 3NGCX 4RG4A 1M64A 3NLCA 5EOWA 2GMHA 3BI5A 1DJQA 3GDPA 4BK2A 4U8IA 3VRBA 3ISHA 4EIPA 3ALMA 4C5OA 2WOWA 2BS3A 3V3NA 4Y4NA 1YQ3A 2WETA 1CF3A 2WPCA 4H4QA 1NG4A 1XHCA 3QVPA 4AT2A 1IUTA 3UOYA 1XDIA 1GRTA 4WCTA 5TR3A 4REKA 3DGHA 4H2NA 2E4GA 1H81A 3KLJA 3ADAB 1BF3A 2YQUA 3ZDNA 1CJCA 3SQPA 4YKFA 3DJEA 3EANA 4IA6A 1GNDA 2JB1A 1IUVA 1GRBA 1W4XA 1Q9IA 3AD7B 4FDCB 4H50A 5GSNA 1Y56B 4JY2A 4D03A 1OJCA 5JCKA 5HYMA 4A6NB 1ONFA 2RGHA 3F8PA 3NG7X 3GWDA 1OJAA 4H4RA 3RP7A 3BNUA 2C75A 3CPJG 1CL0A 4NTCA 1E1MA 3P1WA 4JNAA 2C76A 4AP3A 4H4VA 2XFQA 3V76A 2XLPA 3II4A 2X8GA 2FJAA 4B64A 2XLTA 3K30A 2C3DA 3AEEA 2ZZ0A 3GD4A 3LADA 4UDQA 2YR6A 3AXBA 2YG5A 4C74A 4YTPA 4H4WA 4JNQA 2V3AA 3CGBA 4OPIA 1OJ9A 1P2HA 1V59A 4O5QA 1H7WA 3GDNA 4NEWA 1OJDA 4AOXA 3JSKA 3OC4A 2XVFA 1Z6LA 2JK6A 3CN8A 1ZMDA 3L8KA 1YQ4A 1TDKA 5IQ4A 4Z43A 2E1MA 3O0HA 4CCRA 2YG4A 1RP0A 3CPHG 1BZLA 3FIMB 5U1OA 5JCIA 1GRFA 3SFEA 3QSMA 4DSGA 4YT0A 2BABA 2AR8A 3ALJA 3DJJA 3OZ2A 2WDRA 4K5RA 4ZCCA 2JBVA 1MXTA 3Q9TA 1UKVG 2WDVA 2WU5A 2R4EA 3AE5A 3AE7A 3REDA 2BS4A 1H84A 2HQMA 4NTDA 4NZHA 3IF9A 3UKQA 1MOKA 2C73A 2FBWA 4B65A 1DODA 3I6DA 3AEAA 3NN0X 4Z2UA 1IUWA 1AOGA 1JU2A 3NYEA 2ACZA 3FG2P 3LZXA 3S61A 1KSSA 4CBQA 1VG0A 2YVGA 1H82A 4BURA 2Z5XA 1EL5A 1LV0A 4K22A 4PAAA 1MO9A 5KVIA 1TYPA 4LIIA 1CHUA 2X50A 1DXLA 1H7XA 2TPRA 4ADWA 3NK0X 2Y6RA 4J57A 4B68A 3SM8A 3ATRA 4NTEA 3F8DA 1Q1WA 1FCDA 2FJBA 3RP6A 2GRTA 4YSZA 3NHOX 3NN6X 1GREA 3IC9A 1DOEA 1N4WA 4J36A 5FMHA 5KXJA 1H6VA 5BRTA 2R0PA 2APGA 3DMEA 3T37A 2A89A 4OVIA 1GTHA 2B9XA 1PN0A 4HB9A 3R9UA 3FMWA 1GERA 1QJDA 3GMBA 4EMWA 3AEDA 3NIXA 5KRQA 2XVIA 2C7GA 4U8NA 2GV8A 1LVLA 2C64A 4OPTA 2XVHA 2WP5A 3UKHA 2VOUA 4USQA 2C72A 2FJEA 2RABA 1BGJA 1ZY8A 4YWOA 4XWRA 1FECA 4ZCDA 4OPUA 4GRTA 3URHA 3GMCA 2JB3A 4Z26A 1GT8A 3AEBA 4EQXA 5M10A 1L0VA 3RHAA 1P2EA 4BV6A 2H89A 2VVLG 2R46A 1FEBA 4BJZA 1K0IA 1DJNA 1H86A 2C67A 3CNDA 3QJ4A 1F3PA 1GOSA 4O5UA 1M6IA 4EQRA 2VQBA 5KOXA 4A99A 2EQ9A 3GYIA 3ATQA 4EM4A 2YVFA
chains in the Genus database with same CATH superfamily
4X9NA 3VRAA 1HYUA 3AE4A 2YG6A 3G5SA 4TM4A 1PBEA 5HY5A 2YWLA 1FL2A 3KPFA 1K4QA 3M0OA 2CFYA 3GD3A 1RYIA 3AEFA 3B3RA 4C3YA 2WOIA 1NPXA 4U2LA 1ZX9A 3DGZA 3C4NA 1JOAA 2B9YA 1O94A 2X3NA 2QCUA 3V3OA 1XPQA 3S5WA 3BNMA 2YG7A 4TM1A 5LV9A 1REOA 2FJDA 3UTGA 2ARDA 3HYVA 1S3EA 2C70A 3KPKA 3Q6JA 1PJ6A 3CGEA 4TLZA 4ZN0A 5DBJA 3HZLA 3EPTA 1E7PA 4KX6A 3AYLA 4J56A 4GUVA 4EMJA 4U8LA 2XFUA 1PBBA 1PHHA 1NHRA 1YKJA 2WHDA 2AQJA 2GH5A 3AE1A 3AWIA 5KMQA 4G6HA 3FBSA 1NHPA 3UOXA 3KKJA 4ICYA 3UP5A 4GR1A 1N4VA 4H7UA 2A8XA 1E6EA 1LQTA 4MJWA 1YY5A 3KU9A 3PS9A 3LXDA 3L1RA 4RG3A 2BCGG 5U63A 4XXGA 3IHGA 4YSYA 4EQSA 1O5WA 2E5VA 2Q0KA 3K7TA 1NENA 1JNZA 2AAQA 2I0ZA 4B69A 1B5QA 4K5SA 2V6OA 3EF6A 1F6MA 1NDAA 4BJYA 1EL7A 4PABA 4YSHA 2BK5A 3NYCA 3DH9A 5EB5A 4H4TA 4CY6A 1D4EA 4H2PA 5BUKA 5C2TA 3ICRA 4N9XA 3DK4A 1GRGA 1K0LA 3SZ0A 3GSIA 4H4YA 4E0VA 4JY3A 4DSHA 2VZ2A 2VQ7A 4K7ZA 2XLUA 5FS6A 1GXFA 1Y0PA 2EQ8A 4HA6A 3GYXA 4JN9A 4LA1A 4U2TA 1YQZA 4B67A 2YVJA 3SZWA 2BRYA 2BYBA 2DKHA 3GYJA 4X9MA 4YKGA 2GEWA 1JEHA 1GETA 2WEUA 3CNSA 1CC4A 4DNAA 3AE8A 5KMPA 2A87A 1B4VA 1GRAA 3NK2X 3P4SA 2C65A 2GR2A 1PJ7A 3H8IA 1CJ2A 5EBKA 4UP3A 4B66A 1NG3A 2YLZA 2GQFA 1RSGA 5EB4A 4UDRA 4RSLA 4UDPA 2WU2A 5U25A 3VR9A 5KVHA 1NAAA 3T14A 3GRSA 4OPDA 2CULA 5CQFA 1S2YA 3M13A 1QLBA 3P4RA 3CGDA 5M0ZA 2IVDA 1CC2A 4J31A 3E1TA 2BA9A 2QA2A 4EIQA 1L9CA 2OLOA 2X8HA 2Q0LA 3H4KA 2ZBWA 4IV9A 4I59A 1D7YA 1EBDA 4D04A 5L46A 2YAUA 1ZP0A 1Q1RA 4OPGA 1KNRA 2YR5A 4NWZA 1FOHA 1NHQA 1ZMCA 2XVEA 1ZK7A 3UTEA 4I58A 2XVJA 5BVAA 5J7XA 1IUUA 2VVMA 3CGCA 4H4ZA 4A6NA 1TDNA 3RNMA 1B8SA 4U8JA 2XFOA 3BI2A 1ZKQA 2BXSA 1O95A 3ZYXA 5J60A 2B76A 4A7AA 2QA1A 2WPEA 5GRTA 3UKFA 3COXA 3PVCA 1GRHA 1GESA 2NVKX 4C3XA 1BWCA 4YXDA 5HXIA 4H4SA 3BHKA 2OALA 2XCGA 3K7MX 3G5QA 2R45A 1ELIA 2GR3A 1E1LA 2YG3A 3B6DA 3UP4A 4OCGA 2J3NA 3NTAA 4KPRA 1FEAA 4Y4LA 3EAOA 4BK3A 2IVEA 2WBAA 4Z25A 2GR0A 2GQWA 3QSEA 4JQ9A 5IPYA 1VQWA 4FK1A 3NH3X 1LTXR 4IVMB 3SZFA 2EQ7A 2R4JA 3VR8A 1CJ4A 3HYWA 4FK1C 4CCQA 3C96A 1GV4A 3KVEA 4K8DA 4CRTA 1PJ5A 1JRXA 3CNTA 2C4CA 1CBOA 3QFAA 3VQRA 2JAEA 1JRZA 1TDFA 3I3LA 2DKIA 3PO7A 2YLSA 3GRTA 2PYXA 2YM1A 3QVRA 2YLWA 3ALLA 4Z24A 5JCMA 3F8RA 1D4CA 2BC1A 4TLXA 2WP9A 2R9ZA 2WS3A 3BHFA 3AE6A 3P4PA 5JCNA 1E1KA 2XFNA 2GAGB 1CC6A 4IVOB 3DJDA 4CNJA 2W0HA 4USRA 3UKLA 4C77A 3DA1A 2BK4A 3DK9A 4OPLA 5BULA 2XLSA 1GPEA 3AD9B 2Q7VA 2PHHA 3LJPA 2GAHB 4XWZA 3UOZA 1IJHA 3H8LA 2WQYA 2V5ZA 3BI4A 4U8MA 2Y6QA 1LPFA 2XDOA 3CNJA 2B9WA 4NNJA 4U8OA 1OJTA 2VRMA 4OPCA 2WESA 1ZOVA 3AYJA 3UOVA 3UTHA 3NRNA 1JNRA 2X8CA 3DJGX 5ER0A 2BS2A 4K2XA 3T2YA 4EM3A 4CY8A 1TYTA 2XYOA 4Z44A 1N1PA 2QAEA 1PXBA 2JKCA 2ZZCA 3UCLA 1D7LA 1DNCA 1N4UA 2Q6UA 3ABVA 3IWAA 4GDEA 4P9SA 4U8PA 3P4QA 4H2QA 3AEGA 4H4PA 2BCPA 5FS8A 5JCLA 1LQUA 2VVLA 1NEKA 1ZOYA 3NYFA 4G73A 1PBDA 4NEVA 3QFBA 4AP1A 2GB0A 2VRLA 2YM2A 5FS9A 4AT0A 4J34A 4EQWA 1VRQB 3NT6A 1E39A 3VRDB 1CJ3A 2BRAA 3AD8B 5KWFA 2B7SA 2OA1A 2RGOA 3NK1X 3CMMA 3KD9A 2CDUA 1S3BA 2Z5YA 1KF6A 5C3JA 1TDEA 1IUXA 5IQ1A 4H4UA 1DOCA 5KNLA 2WPFA 1KFYA 3CIRA 1KDGA 2EQ6A 5KMSA 1BGNA 1GEUA 1PS9A 2GR1A 2V3BA 3LB8A 1SEZA 3NNEA 5KOWA 3GWFA 1H83A 4H4XA 1NHSA 3AE3A 1JRYA 3NTDA 3AE9A 3KA7A 1COYA 2TMDA 2CVJA 4LU6A 4GDPA 2UZZA 1F8RA 4A5LA 1KNPA 2BXRA 1KSUA 3SFDA 2ZZBA 4B1BA 3LZWA 3IHMA 2X99A 2RGJA 1D5TA 3QSSA 1F8SA 4IA5A 4U2SA 4GAVA 3CNPA 4CNKA 3SZCA 4A65A 1BKWA 2GF3A 4H2RA 5CKUA 1QO8A 4AOSA 3D1CA 2YLXA 4YTMA 2R0CA 4TM3A 4TM0A 1GTEA 1VDCA 1PDHA 3D8XA 4GCMA 3T2KA 2YR4A 1Y56A 4APNA 3NKSA 2H88A 4Z2TA 2GVCA 1PBCA 1LJ1A 4J2WA 3M12A 1F8WA 2V61A 1TRBA 3AB1A 3UKPA 4BK1A 3SGLA 1S2QA 2NPXA 4Z2RA 2C3CA 3DK8A 1L9DA 1TDOA 3P9UA 4Y4MA 3T31A 2BACA 1B37A 1ZDLA 2V60A 5KMRA 1PXCA 5FS7A 2IIDA 4YTNA 2WDQA 1IUSA 4FX9A 3C4AA 4DGKA 2C66A 1EL8A 4JDRA 4M52A 4U8KA 2JB2A 2O9ZA 3FPZA 2XFPA 1EL9A 4EMIA 4X4JA 3CPIG 4YSXA 4ECHA 3ICSA 3RP8A 2B7RA 1D4DA 2BK3A 1X31B 3WE0A 2YLTA 3ICTA 4A9WA 3CTYA 1GSNA 3ITJA 4J33A 4GF7A 1VG9A 2OAMA 4A79A 1GALA 2WP6A 3G5RA 3UTFA 3K7QX 3T0KA 1DOBA 1K0JA 2F5ZA 2OLNA 2WOVA 3AECA 3LOVA 1PBFA 2YLRA 1L9EA 1PXAA 5HHFA 2XLRA 1XANA 2BC0A 3AYIA 4G9KA 4WX1A 4B63A 2GMJA 3AE2A 2R0GA 1E1NA 3UKAA 3UKKA 3NGCX 4RG4A 1M64A 3NLCA 5EOWA 2GMHA 3BI5A 1DJQA 3GDPA 4BK2A 4U8IA 3SY4A 3VRBA 3ISHA 4EIPA 3ALMA 4G6GA 4C5OA 2WOWA 2BS3A 3V3NA 4Y4NA 1YQ3A 2WETA 1CF3A 2WPCA 4H4QA 4II2A 1NG4A 1XHCA 3QVPA 3HYXA 4AT2A 1IUTA 3UOYA 1XDIA 1GRTA 4WCTA 5TR3A 4REKA 3DGHA 4H2NA 4II3A 2E4GA 1H81A 3KLJA 3ADAB 1BF3A 2YQUA 3ZDNA 1CJCA 3SQPA 4YKFA 3DJEA 3EANA 4IA6A 1GNDA 2JB1A 1IUVA 1GRBA 1W4XA 1Q9IA 3AD7B 4FDCB 4H50A 5GSNA 1Y56B 4JY2A 4D03A 1OJCA 5JCKA 5HYMA 4A6NB 1ONFA 2RGHA 3F8PA 3NG7X 3GWDA 1OJAA 4H4RA 3RP7A 3BNUA 2C75A 3CPJG 1CL0A 4NTCA 1E1MA 3P1WA 4JNAA 2C76A 4AP3A 4H4VA 2XFQA 3V76A 2XLPA 3II4A 2X8GA 2FJAA 4B64A 2XLTA 3K30A 2C3DA 3AEEA 2ZZ0A 3GD4A 3LADA 4UDQA 2YR6A 3AXBA 2YG5A 4C74A 4YTPA 4H4WA 4JNQA 2V3AA 3CGBA 4OPIA 1OJ9A 1P2HA 1V59A 4O5QA 1H7WA 3GDNA 4NEWA 1OJDA 4AOXA 3JSKA 3OC4A 2XVFA 1Z6LA 3T2ZA 2JK6A 3CN8A 1ZMDA 3L8KA 1YQ4A 1TDKA 5IQ4A 3SYIA 4Z43A 2E1MA 3O0HA 4G74A 4CCRA 2YG4A 1RP0A 3CPHG 1BZLA 3FIMB 5U1OA 5JCIA 1GRFA 3SFEA 3QSMA 4DSGA 4YT0A 2BABA 2AR8A 3ALJA 3DJJA 3OZ2A 2WDRA 4K5RA 4ZCCA 2JBVA 1MXTA 3Q9TA 1UKVG 2WDVA 2WU5A 2R4EA 3AE5A 3AE7A 3REDA 2BS4A 1H84A 2HQMA 4NTDA 4NZHA 3IF9A 3SXIA 3UKQA 1MOKA 2C73A 2FBWA 4B65A 1DODA 3I6DA 3AEAA 3NN0X 4Z2UA 1IUWA 1AOGA 1JU2A 3NYEA 2ACZA 3FG2P 3LZXA 3S61A 1KSSA 4CBQA 1VG0A 2YVGA 1H82A 4BURA 2Z5XA 1EL5A 1LV0A 4K22A 4PAAA 1MO9A 4GAPA 5KVIA 1TYPA 4LIIA 1CHUA 2X50A 1DXLA 1H7XA 2TPRA 4ADWA 3NK0X 2Y6RA 4J57A 4B68A 3SM8A 3ATRA 4NTEA 3F8DA 1Q1WA 1FCDA 2FJBA 3RP6A 2GRTA 4YSZA 3NHOX 3NN6X 1GREA 3IC9A 1DOEA 1N4WA 4J36A 5FMHA 5KXJA 1H6VA 5BRTA 2R0PA 2APGA 3DMEA 3T37A 2A89A 4OVIA 1GTHA 2B9XA 1PN0A 4HB9A 3R9UA 3FMWA 1GERA 1QJDA 3GMBA 4EMWA 3AEDA 3NIXA 5KRQA 2XVIA 2C7GA 4U8NA 2GV8A 1LVLA 2C64A 4OPTA 2XVHA 2WP5A 3UKHA 2VOUA 4USQA 2C72A 2FJEA 2RABA 1BGJA 1ZY8A 4YWOA 4XWRA 1FECA 4ZCDA 4OPUA 4GRTA 3URHA 3GMCA 2JB3A 4Z26A 1GT8A 3AEBA 4EQXA 5M10A 1L0VA 3RHAA 1P2EA 4BV6A 2H89A 2VVLG 2R46A 1FEBA 3SX6A 4BJZA 1K0IA 1DJNA 1H86A 2C67A 3CNDA 3QJ4A 1F3PA 1GOSA 4O5UA 1M6IA 4EQRA 2VQBA 5KOXA 4A99A 2EQ9A 3GYIA 3ATQA 4EM4A 2YVFA
chains in the Genus database with same CATH topology
4X9NA 3VRAA 1HYUA 3AE4A 2YG6A 3G5SA 4TM4A 1PBEA 5HY5A 2YWLA 1FL2A 3KPFA 1K4QA 3M0OA 2CFYA 3GD3A 1RYIA 3AEFA 3B3RA 4C3YA 2WOIA 1NPXA 4U2LA 1ZX9A 3DGZA 3C4NA 1JOAA 2B9YA 1O94A 2X3NA 2QCUA 3V3OA 1XPQA 3S5WA 3BNMA 2YG7A 4TM1A 5LV9A 1REOA 2FJDA 3UTGA 2ARDA 3HYVA 1S3EA 2C70A 3KPKA 3Q6JA 1PJ6A 3CGEA 4TLZA 4ZN0A 5DBJA 3HZLA 3EPTA 1E7PA 4KX6A 3AYLA 4J56A 4GUVA 4EMJA 4U8LA 2XFUA 1PBBA 1PHHA 1NHRA 1YKJA 2WHDA 2AQJA 2GH5A 3AE1A 3AWIA 5KMQA 4G6HA 3FBSA 1NHPA 3UOXA 3KKJA 4ICYA 3UP5A 4GR1A 1N4VA 4H7UA 2A8XA 1E6EA 1LQTA 4MJWA 1YY5A 3KU9A 3PS9A 3LXDA 3L1RA 4RG3A 2BCGG 5U63A 4XXGA 3IHGA 4YSYA 4EQSA 1O5WA 2E5VA 2Q0KA 3K7TA 1NENA 1JNZA 2AAQA 2I0ZA 4B69A 1B5QA 4K5SA 2V6OA 3EF6A 1F6MA 1NDAA 4BJYA 1EL7A 4PABA 4YSHA 2BK5A 3NYCA 3DH9A 5EB5A 4H4TA 4CY6A 1D4EA 4H2PA 5BUKA 5C2TA 3ICRA 4N9XA 3DK4A 1GRGA 1K0LA 3SZ0A 3GSIA 4H4YA 4E0VA 4JY3A 4DSHA 2VZ2A 2VQ7A 4K7ZA 2XLUA 5FS6A 1GXFA 1Y0PA 2EQ8A 4HA6A 3GYXA 4JN9A 4LA1A 4U2TA 1YQZA 4B67A 2YVJA 3SZWA 2BRYA 2BYBA 2DKHA 3GYJA 4X9MA 4YKGA 2GEWA 1JEHA 1GETA 2WEUA 3CNSA 1CC4A 4DNAA 3AE8A 5KMPA 2A87A 1B4VA 1GRAA 3NK2X 3P4SA 2C65A 2GR2A 1PJ7A 3H8IA 1CJ2A 5EBKA 4UP3A 4B66A 1NG3A 2YLZA 2GQFA 1RSGA 5EB4A 4UDRA 4RSLA 4UDPA 2WU2A 5U25A 3VR9A 5KVHA 1NAAA 3T14A 3GRSA 4OPDA 2CULA 5CQFA 1S2YA 3M13A 1QLBA 3P4RA 3CGDA 5M0ZA 2IVDA 1CC2A 4J31A 3E1TA 2BA9A 2QA2A 4EIQA 1L9CA 2OLOA 2X8HA 2Q0LA 3H4KA 2ZBWA 4IV9A 4I59A 1D7YA 1EBDA 4D04A 5L46A 2YAUA 1ZP0A 1Q1RA 4OPGA 1KNRA 2YR5A 4NWZA 1FOHA 1NHQA 1ZMCA 2XVEA 1ZK7A 3UTEA 4I58A 2XVJA 5BVAA 5J7XA 1IUUA 2VVMA 3CGCA 4H4ZA 4A6NA 1TDNA 3RNMA 1B8SA 4U8JA 2XFOA 3BI2A 1ZKQA 2BXSA 1O95A 3ZYXA 5J60A 2B76A 4A7AA 2QA1A 2WPEA 5GRTA 3UKFA 3COXA 3PVCA 1GRHA 1GESA 2NVKX 4C3XA 1BWCA 4YXDA 5HXIA 4H4SA 3BHKA 2OALA 2XCGA 3K7MX 3G5QA 2R45A 1ELIA 2GR3A 1E1LA 2YG3A 3B6DA 3UP4A 4OCGA 2J3NA 3NTAA 4KPRA 1FEAA 4Y4LA 3EAOA 4BK3A 2IVEA 2WBAA 4Z25A 2GR0A 2GQWA 3QSEA 4JQ9A 5IPYA 1VQWA 4FK1A 3NH3X 1LTXR 4IVMB 3SZFA 2EQ7A 2R4JA 3VR8A 1CJ4A 3HYWA 4FK1C 4CCQA 3C96A 1GV4A 3KVEA 4K8DA 4CRTA 1PJ5A 1JRXA 3CNTA 2C4CA 1CBOA 3QFAA 3VQRA 2JAEA 1JRZA 1TDFA 3I3LA 2DKIA 3PO7A 2YLSA 3GRTA 2PYXA 2YM1A 3QVRA 2YLWA 3ALLA 4Z24A 5JCMA 3F8RA 1D4CA 2BC1A 4TLXA 2WP9A 2R9ZA 2WS3A 3BHFA 3AE6A 3P4PA 5JCNA 1E1KA 2XFNA 2GAGB 1CC6A 4IVOB 3DJDA 4CNJA 2W0HA 4USRA 3UKLA 4C77A 3DA1A 2BK4A 3DK9A 4OPLA 5BULA 2XLSA 1GPEA 3AD9B 2Q7VA 2PHHA 3LJPA 2GAHB 4XWZA 3UOZA 1IJHA 3H8LA 2WQYA 2V5ZA 3BI4A 4U8MA 2Y6QA 1LPFA 2XDOA 3CNJA 2B9WA 4NNJA 4U8OA 1OJTA 2VRMA 4OPCA 2WESA 1ZOVA 3AYJA 3UOVA 3UTHA 3NRNA 1JNRA 2X8CA 3DJGX 5ER0A 2BS2A 4K2XA 3T2YA 4EM3A 4CY8A 1TYTA 2XYOA 4Z44A 1N1PA 2QAEA 1PXBA 2JKCA 2ZZCA 3UCLA 1D7LA 1DNCA 1N4UA 2Q6UA 3ABVA 3IWAA 4GDEA 4P9SA 4U8PA 3P4QA 4H2QA 3AEGA 4H4PA 2BCPA 5FS8A 5JCLA 1LQUA 2VVLA 1NEKA 1ZOYA 3NYFA 4G73A 1PBDA 4NEVA 3QFBA 4AP1A 2GB0A 2VRLA 2YM2A 5FS9A 4AT0A 4J34A 4EQWA 1VRQB 3NT6A 1E39A 3VRDB 1CJ3A 2BRAA 3AD8B 5KWFA 2B7SA 2OA1A 2RGOA 3NK1X 3CMMA 3KD9A 2CDUA 1S3BA 2Z5YA 1KF6A 5C3JA 1TDEA 1IUXA 5IQ1A 4H4UA 1DOCA 5KNLA 2WPFA 1KFYA 3CIRA 1KDGA 2EQ6A 5KMSA 1BGNA 1GEUA 1PS9A 2GR1A 2V3BA 3LB8A 1SEZA 3NNEA 5KOWA 3GWFA 1H83A 4H4XA 1NHSA 3AE3A 1JRYA 3NTDA 3AE9A 3KA7A 1COYA 2TMDA 2CVJA 4LU6A 4GDPA 2UZZA 1F8RA 4A5LA 1KNPA 2BXRA 1KSUA 3SFDA 2ZZBA 4B1BA 3LZWA 3IHMA 2X99A 2RGJA 1D5TA 3QSSA 1F8SA 4IA5A 4U2SA 4GAVA 3CNPA 4CNKA 3SZCA 4A65A 1BKWA 2GF3A 4H2RA 5CKUA 1QO8A 4AOSA 3D1CA 2YLXA 4YTMA 2R0CA 4TM3A 4TM0A 1GTEA 1VDCA 1PDHA 3D8XA 4GCMA 3T2KA 2YR4A 1Y56A 4APNA 3NKSA 2H88A 4Z2TA 2GVCA 1PBCA 1LJ1A 4J2WA 3M12A 1F8WA 2V61A 1TRBA 3AB1A 3UKPA 4BK1A 3SGLA 1S2QA 2NPXA 4Z2RA 2C3CA 3DK8A 1L9DA 1TDOA 3P9UA 4Y4MA 3T31A 2BACA 1B37A 1ZDLA 2V60A 5KMRA 1PXCA 5FS7A 2IIDA 4YTNA 2WDQA 1IUSA 4FX9A 3C4AA 4DGKA 2C66A 1EL8A 4JDRA 4M52A 4U8KA 2JB2A 2O9ZA 3FPZA 2XFPA 1EL9A 4EMIA 4X4JA 3CPIG 4YSXA 4ECHA 3ICSA 3RP8A 2B7RA 1D4DA 2BK3A 1X31B 3WE0A 2YLTA 3ICTA 4A9WA 3CTYA 1GSNA 3ITJA 4J33A 4GF7A 1VG9A 2OAMA 4A79A 1GALA 2WP6A 3G5RA 3UTFA 3K7QX 3T0KA 1DOBA 1K0JA 2F5ZA 2OLNA 2WOVA 3AECA 3LOVA 1PBFA 2YLRA 1L9EA 1PXAA 5HHFA 2XLRA 1XANA 2BC0A 3AYIA 4G9KA 4WX1A 4B63A 2GMJA 3AE2A 2R0GA 1E1NA 3UKAA 3UKKA 3NGCX 4RG4A 1M64A 3NLCA 5EOWA 2GMHA 3BI5A 1DJQA 3GDPA 4BK2A 4U8IA 3SY4A 3VRBA 3ISHA 4EIPA 3ALMA 4G6GA 4C5OA 2WOWA 2BS3A 3V3NA 4Y4NA 1YQ3A 2WETA 1CF3A 2WPCA 4H4QA 4II2A 1NG4A 1XHCA 3QVPA 3HYXA 4AT2A 1IUTA 3UOYA 1XDIA 1GRTA 4WCTA 5TR3A 4REKA 3DGHA 4H2NA 4II3A 2E4GA 1H81A 3KLJA 3ADAB 1BF3A 2YQUA 3ZDNA 1CJCA 3SQPA 4YKFA 3DJEA 3EANA 4IA6A 1GNDA 2JB1A 1IUVA 1GRBA 1W4XA 1Q9IA 3AD7B 4FDCB 4H50A 5GSNA 1Y56B 4JY2A 4D03A 1OJCA 5JCKA 5HYMA 4A6NB 1ONFA 2RGHA 3F8PA 3NG7X 3GWDA 1OJAA 4H4RA 3RP7A 3BNUA 2C75A 3CPJG 1CL0A 4NTCA 1E1MA 3P1WA 4JNAA 2C76A 4AP3A 4H4VA 2XFQA 3V76A 2XLPA 3II4A 2X8GA 2FJAA 4B64A 2XLTA 3K30A 2C3DA 3AEEA 2ZZ0A 3GD4A 3LADA 4UDQA 2YR6A 3AXBA 2YG5A 4C74A 4YTPA 4H4WA 4JNQA 2V3AA 3CGBA 4OPIA 1OJ9A 1P2HA 1V59A 4O5QA 1H7WA 3GDNA 4NEWA 1OJDA 4AOXA 3JSKA 3OC4A 2XVFA 1Z6LA 3T2ZA 2JK6A 3CN8A 1ZMDA 3L8KA 1YQ4A 1TDKA 5IQ4A 3SYIA 4Z43A 2E1MA 3O0HA 4G74A 4CCRA 2YG4A 1RP0A 3CPHG 1BZLA 3FIMB 5U1OA 5JCIA 1GRFA 3SFEA 3QSMA 4DSGA 4YT0A 2BABA 2AR8A 3ALJA 3DJJA 3OZ2A 2WDRA 4K5RA 4ZCCA 2JBVA 1MXTA 3Q9TA 1UKVG 2WDVA 2WU5A 2R4EA 3AE5A 3AE7A 3REDA 2BS4A 1H84A 2HQMA 4NTDA 4NZHA 3IF9A 3SXIA 3UKQA 1MOKA 2C73A 2FBWA 4B65A 1DODA 3I6DA 3AEAA 3NN0X 4Z2UA 1IUWA 1AOGA 1JU2A 3NYEA 2ACZA 3FG2P 3LZXA 3S61A 1KSSA 4CBQA 1VG0A 2YVGA 1H82A 4BURA 2Z5XA 1EL5A 1LV0A 4K22A 4PAAA 1MO9A 4GAPA 5KVIA 1TYPA 4LIIA 1CHUA 2X50A 1DXLA 1H7XA 2TPRA 4ADWA 3NK0X 2Y6RA 4J57A 4B68A 3SM8A 3ATRA 4NTEA 3F8DA 1Q1WA 1FCDA 2FJBA 3RP6A 2GRTA 4YSZA 3NHOX 3NN6X 1GREA 3IC9A 1DOEA 1N4WA 4J36A 5FMHA 5KXJA 1H6VA 5BRTA 2R0PA 2APGA 3DMEA 3T37A 2A89A 4OVIA 1GTHA 2B9XA 1PN0A 4HB9A 3R9UA 3FMWA 1GERA 1QJDA 3GMBA 4EMWA 3AEDA 3NIXA 5KRQA 2XVIA 2C7GA 4U8NA 2GV8A 1LVLA 2C64A 4OPTA 2XVHA 2WP5A 3UKHA 2VOUA 4USQA 2C72A 2FJEA 2RABA 1BGJA 1ZY8A 4YWOA 4XWRA 1FECA 4ZCDA 4OPUA 4GRTA 3URHA 3GMCA 2JB3A 4Z26A 1GT8A 3AEBA 4EQXA 5M10A 1L0VA 3RHAA 1P2EA 4BV6A 2H89A 2VVLG 2R46A 1FEBA 3SX6A 4BJZA 1K0IA 1DJNA 1H86A 2C67A 3CNDA 3QJ4A 1F3PA 1GOSA 4O5UA 1M6IA 4EQRA 2VQBA 5KOXA 4A99A 2EQ9A 3GYIA 3ATQA 4EM4A 2YVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X9N A;  3VRA A;  1HYU A;  3AE4 A;  2YG6 A;  3G5S A;  4TM4 A;  1PBE A;  5HY5 A;  2YWL A;  1FL2 A;  3KPF A;  1K4Q A;  3M0O A;  2CFY A;  3GD3 A;  1RYI A;  3AEF A;  3B3R A;  4C3Y A;  2WOI A;  1NPX A;  4U2L A;  1ZX9 A;  3DGZ A;  3C4N A;  1JOA A;  2B9Y A;  1O94 A;  2X3N A;  2QCU A;  3V3O A;  1XPQ A;  3S5W A;  3BNM A;  2YG7 A;  4TM1 A;  5LV9 A;  1REO A;  2FJD A;  3UTG A;  2ARD A;  1S3E A;  2C70 A;  3Q6J A;  1PJ6 A;  3CGE A;  4TLZ A;  4ZN0 A;  5DBJ A;  3HZL A;  3EPT A;  1E7P A;  4KX6 A;  3AYL A;  4J56 A;  4GUV A;  4EMJ A;  4U8L A;  2XFU A;  1PBB A;  1PHH A;  1NHR A;  1YKJ A;  2WHD A;  2AQJ A;  2GH5 A;  3AE1 A;  3AWI A;  3FBS A;  1NHP A;  3UOX A;  3KKJ A;  4ICY A;  3UP5 A;  4GR1 A;  1N4V A;  4H7U A;  2A8X A;  1E6E A;  1LQT A;  4MJW A;  1YY5 A;  3KU9 A;  3PS9 A;  3LXD A;  3L1R A;  4RG3 A;  2BCG G;  5U63 A;  4XXG A;  3IHG A;  4YSY A;  4EQS A;  1O5W A;  2E5V A;  2Q0K A;  3K7T A;  1NEN A;  1JNZ A;  2AAQ A;  2I0Z A;  4B69 A;  1B5Q A;  4K5S A;  2V6O A;  3EF6 A;  1F6M A;  1NDA A;  4BJY A;  1EL7 A;  4PAB A;  4YSH A;  2BK5 A;  3NYC A;  3DH9 A;  5EB5 A;  4H4T A;  4CY6 A;  1D4E A;  4H2P A;  5BUK A;  5C2T A;  3ICR A;  4N9X A;  3DK4 A;  1GRG A;  1K0L A;  3GSI A;  4H4Y A;  4E0V A;  4JY3 A;  4DSH A;  2VZ2 A;  2VQ7 A;  4K7Z A;  2XLU A;  5FS6 A;  1GXF A;  1Y0P A;  2EQ8 A;  4HA6 A;  4JN9 A;  4LA1 A;  4U2T A;  4B67 A;  1YQZ A;  2YVJ A;  2BYB A;  2DKH A;  3GYJ A;  4X9M A;  4YKG A;  2GEW A;  1JEH A;  1GET A;  2WEU A;  3CNS A;  1CC4 A;  4DNA A;  3AE8 A;  2A87 A;  1B4V A;  1GRA A;  3NK2 X;  3P4S A;  2C65 A;  2GR2 A;  1PJ7 A;  3H8I A;  1CJ2 A;  5EBK A;  4UP3 A;  4B66 A;  1NG3 A;  2YLZ A;  2GQF A;  1RSG A;  5EB4 A;  4UDR A;  4RSL A;  4UDP A;  2WU2 A;  5U25 A;  3VR9 A;  5KVH A;  1NAA A;  3GRS A;  4OPD A;  2CUL A;  5CQF A;  1S2Y A;  3M13 A;  1QLB A;  3P4R A;  3CGD A;  5M0Z A;  2IVD A;  1CC2 A;  4J31 A;  3E1T A;  2BA9 A;  2QA2 A;  4EIQ A;  1L9C A;  2OLO A;  2X8H A;  2Q0L A;  3H4K A;  2ZBW A;  4IV9 A;  4I59 A;  1D7Y A;  1EBD A;  4D04 A;  5L46 A;  2YAU A;  1ZP0 A;  1Q1R A;  4OPG A;  1KNR A;  2YR5 A;  1FOH A;  1NHQ A;  1ZMC A;  2XVE A;  1ZK7 A;  3UTE A;  4I58 A;  2XVJ A;  5BVA A;  5J7X A;  1IUU A;  2VVM A;  3CGC A;  4H4Z A;  4A6N A;  1TDN A;  3RNM A;  1B8S A;  4U8J A;  2XFO A;  3BI2 A;  1ZKQ A;  2BXS A;  1O95 A;  3ZYX A;  5J60 A;  2B76 A;  4A7A A;  2QA1 A;  2WPE A;  5GRT A;  3UKF A;  3COX A;  3PVC A;  1GRH A;  1GES A;  2NVK X;  4C3X A;  1BWC A;  4YXD A;  5HXI A;  4H4S A;  3BHK A;  2OAL A;  2XCG A;  3K7M X;  3G5Q A;  2R45 A;  1ELI A;  2GR3 A;  1E1L A;  2YG3 A;  3B6D A;  3UP4 A;  4OCG A;  2J3N A;  3NTA A;  4KPR A;  1FEA A;  4Y4L A;  3EAO A;  4BK3 A;  2IVE A;  2WBA A;  4Z25 A;  2GR0 A;  2GQW A;  3QSE A;  4JQ9 A;  5IPY A;  1VQW A;  4FK1 A;  3NH3 X;  1LTX R;  4IVM B;  2EQ7 A;  2R4J A;  3VR8 A;  1CJ4 A;  4FK1 C;  4CCQ A;  4CRT A;  3C96 A;  1GV4 A;  3KVE A;  4K8D A;  1PJ5 A;  1JRX A;  3CNT A;  1CBO A;  3QFA A;  3VQR A;  2JAE A;  1JRZ A;  1TDF A;  3I3L A;  2DKI A;  3PO7 A;  2YLS A;  3GRT A;  2PYX A;  2YM1 A;  3QVR A;  2YLW A;  3ALL A;  4Z24 A;  5JCM A;  3F8R A;  1D4C A;  2BC1 A;  4TLX A;  2WP9 A;  2R9Z A;  2WS3 A;  3BHF A;  3AE6 A;  3P4P A;  5JCN A;  1E1K A;  2XFN A;  2GAG B;  1CC6 A;  4IVO B;  3DJD A;  4CNJ A;  2W0H A;  4USR A;  3UKL A;  4C77 A;  3DA1 A;  2BK4 A;  3DK9 A;  4OPL A;  5BUL A;  2XLS A;  1GPE A;  3AD9 B;  2Q7V A;  2PHH A;  3LJP A;  2GAH B;  4XWZ A;  3UOZ A;  1IJH A;  3H8L A;  2WQY A;  2V5Z A;  3BI4 A;  4U8M A;  2Y6Q A;  1LPF A;  2XDO A;  3CNJ A;  2B9W A;  4U8O A;  1OJT A;  2VRM A;  4OPC A;  2WES A;  1ZOV A;  3AYJ A;  3UOV A;  3UTH A;  3NRN A;  1JNR A;  2X8C A;  3DJG X;  5ER0 A;  2BS2 A;  4K2X A;  4EM3 A;  4CY8 A;  1TYT A;  2XYO A;  4Z44 A;  1N1P A;  2QAE A;  1PXB A;  2JKC A;  2ZZC A;  3UCL A;  1D7L A;  1DNC A;  1N4U A;  2Q6U A;  3ABV A;  3IWA A;  4GDE A;  4P9S A;  4U8P A;  3P4Q A;  4H2Q A;  3AEG A;  4H4P A;  2BCP A;  5FS8 A;  5JCL A;  1LQU A;  2VVL A;  1NEK A;  1ZOY A;  3NYF A;  1PBD A;  4NEV A;  3QFB A;  4AP1 A;  2GB0 A;  2VRL A;  2YM2 A;  5FS9 A;  4AT0 A;  4J34 A;  4EQW A;  1VRQ B;  3NT6 A;  1E39 A;  3VRD B;  1CJ3 A;  3AD8 B;  5KWF A;  2B7S A;  2OA1 A;  2RGO A;  3NK1 X;  3KD9 A;  2CDU A;  1S3B A;  2Z5Y A;  1KF6 A;  5C3J A;  1TDE A;  1IUX A;  5IQ1 A;  4H4U A;  1DOC A;  2WPF A;  1KFY A;  3CIR A;  1KDG A;  2EQ6 A;  1BGN A;  1GEU A;  1PS9 A;  2GR1 A;  2V3B A;  3LB8 A;  1SEZ A;  3NNE A;  5KOW A;  3GWF A;  1H83 A;  4H4X A;  1NHS A;  3AE3 A;  1JRY A;  3NTD A;  3AE9 A;  3KA7 A;  1COY A;  2TMD A;  2CVJ A;  4LU6 A;  4GDP A;  2UZZ A;  1F8R A;  4A5L A;  1KNP A;  2BXR A;  1KSU A;  3SFD A;  2ZZB A;  4B1B A;  3LZW A;  3IHM A;  2X99 A;  2RGJ A;  1D5T A;  3QSS A;  1F8S A;  4IA5 A;  4U2S A;  3CNP A;  4CNK A;  4A65 A;  1BKW A;  2GF3 A;  4H2R A;  5CKU A;  1QO8 A;  4AOS A;  3D1C A;  2YLX A;  4YTM A;  2R0C A;  4TM3 A;  4TM0 A;  1GTE A;  1VDC A;  1PDH A;  3D8X A;  4GCM A;  4APN A;  2YR4 A;  1Y56 A;  3NKS A;  2H88 A;  4Z2T A;  2GVC A;  1PBC A;  1LJ1 A;  4J2W A;  3M12 A;  1F8W A;  2V61 A;  1TRB A;  3AB1 A;  3UKP A;  4BK1 A;  3SGL A;  1S2Q A;  2NPX A;  4Z2R A;  2C3C A;  3DK8 A;  1L9D A;  1TDO A;  3P9U A;  4Y4M A;  2BAC A;  1B37 A;  1ZDL A;  2V60 A;  1PXC A;  5FS7 A;  2IID A;  4YTN A;  2WDQ A;  1IUS A;  4FX9 A;  3C4A A;  4DGK A;  2C66 A;  1EL8 A;  4JDR A;  4M52 A;  4U8K A;  2JB2 A;  2O9Z A;  3FPZ A;  2XFP A;  1EL9 A;  4EMI A;  4X4J A;  3CPI G;  4YSX A;  4ECH A;  3ICS A;  3RP8 A;  2B7R A;  1D4D A;  2BK3 A;  1X31 B;  3WE0 A;  2YLT A;  3ICT A;  4A9W A;  3CTY A;  1GSN A;  3ITJ A;  4J33 A;  4GF7 A;  1VG9 A;  2OAM A;  4A79 A;  1GAL A;  2WP6 A;  3G5R A;  3UTF A;  3K7Q X;  1DOB A;  1K0J A;  2F5Z A;  2OLN A;  2WOV A;  3AEC A;  3LOV A;  1PBF A;  2YLR A;  1L9E A;  1PXA A;  5HHF A;  2XLR A;  1XAN A;  2BC0 A;  3AYI A;  4WX1 A;  4B63 A;  2GMJ A;  3AE2 A;  2R0G A;  1E1N A;  3UKA A;  3UKK A;  3NGC X;  4RG4 A;  1M64 A;  3NLC A;  5EOW A;  2GMH A;  3BI5 A;  1DJQ A;  3GDP A;  4BK2 A;  4U8I A;  3VRB A;  3ISH A;  4EIP A;  3ALM A;  4C5O A;  2WOW A;  2BS3 A;  3V3N A;  4Y4N A;  1YQ3 A;  2WET A;  1CF3 A;  2WPC A;  4H4Q A;  1NG4 A;  1XHC A;  3QVP A;  4AT2 A;  1IUT A;  3UOY A;  1XDI A;  1GRT A;  4WCT A;  5TR3 A;  4REK A;  3DGH A;  4H2N A;  2E4G A;  1H81 A;  3KLJ A;  3ADA B;  1BF3 A;  2YQU A;  3ZDN A;  1CJC A;  3SQP A;  4YKF A;  3DJE A;  3EAN A;  4IA6 A;  1GND A;  2JB1 A;  1IUV A;  1GRB A;  1W4X A;  1Q9I A;  3AD7 B;  4FDC B;  4H50 A;  5GSN A;  1Y56 B;  4JY2 A;  4D03 A;  1OJC A;  5JCK A;  5HYM A;  4A6N B;  1ONF A;  2RGH A;  3F8P A;  3NG7 X;  3GWD A;  1OJA A;  4H4R A;  3RP7 A;  3BNU A;  2C75 A;  3CPJ G;  1CL0 A;  4NTC A;  1E1M A;  3P1W A;  4JNA A;  2C76 A;  4AP3 A;  4H4V A;  2XFQ A;  3V76 A;  2XLP A;  3II4 A;  2X8G A;  2FJA A;  4B64 A;  2XLT A;  3K30 A;  2C3D A;  3AEE A;  2ZZ0 A;  3GD4 A;  3LAD A;  4UDQ A;  2YR6 A;  3AXB A;  2YG5 A;  4C74 A;  4YTP A;  4H4W A;  4JNQ A;  2V3A A;  3CGB A;  4OPI A;  1OJ9 A;  1P2H A;  1V59 A;  4O5Q A;  1H7W A;  3GDN A;  4NEW A;  1OJD A;  4AOX A;  3JSK A;  3OC4 A;  2XVF A;  1Z6L A;  2JK6 A;  3CN8 A;  1ZMD A;  3L8K A;  1YQ4 A;  1TDK A;  5IQ4 A;  4Z43 A;  2E1M A;  3O0H A;  4CCR A;  2YG4 A;  1RP0 A;  3CPH G;  1BZL A;  3FIM B;  5U1O A;  5JCI A;  1GRF A;  3SFE A;  3QSM A;  4DSG A;  4YT0 A;  2BAB A;  2AR8 A;  3ALJ A;  3DJJ A;  3OZ2 A;  2WDR A;  4K5R A;  4ZCC A;  2JBV A;  1MXT A;  3Q9T A;  1UKV G;  2WDV A;  2WU5 A;  2R4E A;  3AE5 A;  3AE7 A;  3RED A;  2BS4 A;  1H84 A;  2HQM A;  4NTD A;  4NZH A;  3IF9 A;  3UKQ A;  1MOK A;  2C73 A;  2FBW A;  4B65 A;  1DOD A;  3I6D A;  3AEA A;  3NN0 X;  4Z2U A;  1IUW A;  1AOG A;  1JU2 A;  3NYE A;  2ACZ A;  3FG2 P;  3LZX A;  3S61 A;  1KSS A;  4CBQ A;  1VG0 A;  2YVG A;  1H82 A;  4BUR A;  2Z5X A;  1EL5 A;  1LV0 A;  4K22 A;  4PAA A;  1MO9 A;  5KVI A;  1TYP A;  4LII A;  1CHU A;  2X50 A;  1DXL A;  1H7X A;  2TPR A;  4ADW A;  3NK0 X;  2Y6R A;  4J57 A;  4B68 A;  3SM8 A;  3ATR A;  4NTE A;  3F8D A;  1Q1W A;  1FCD A;  2FJB A;  3RP6 A;  2GRT A;  4YSZ A;  3NHO X;  3NN6 X;  1GRE A;  3IC9 A;  1DOE A;  1N4W A;  4J36 A;  5FMH A;  5KXJ A;  1H6V A;  5BRT A;  2R0P A;  2APG A;  3DME A;  3T37 A;  2A89 A;  4OVI A;  1GTH A;  2B9X A;  1PN0 A;  4HB9 A;  3R9U A;  3FMW A;  1GER A;  1QJD A;  3GMB A;  4EMW A;  3AED A;  3NIX A;  5KRQ A;  2XVI A;  2C7G A;  4U8N A;  2GV8 A;  1LVL A;  2C64 A;  4OPT A;  2XVH A;  2WP5 A;  3UKH A;  2VOU A;  4USQ A;  2C72 A;  2FJE A;  2RAB A;  1BGJ A;  1ZY8 A;  4YWO A;  4XWR A;  1FEC A;  4ZCD A;  4OPU A;  4GRT A;  3URH A;  3GMC A;  2JB3 A;  4Z26 A;  1GT8 A;  3AEB A;  4EQX A;  5M10 A;  1L0V A;  3RHA A;  1P2E A;  4BV6 A;  2H89 A;  2VVL G;  2R46 A;  1FEB A;  4BJZ A;  1K0I A;  1DJN A;  1H86 A;  2C67 A;  3CND A;  3QJ4 A;  1F3P A;  1GOS A;  4O5U A;  1M6I A;  4EQR A;  2VQB A;  5KOX A;  4A99 A;  2EQ9 A;  3GYI A;  3ATQ A;  4EM4 A;  2YVF A; 
#chains in the Genus database with same CATH topology
 4X9N A;  3VRA A;  1HYU A;  3AE4 A;  2YG6 A;  3G5S A;  4TM4 A;  1PBE A;  5HY5 A;  2YWL A;  1FL2 A;  3KPF A;  1K4Q A;  3M0O A;  2CFY A;  3GD3 A;  1RYI A;  3AEF A;  3B3R A;  4C3Y A;  2WOI A;  1NPX A;  4U2L A;  1ZX9 A;  3DGZ A;  3C4N A;  1JOA A;  2B9Y A;  1O94 A;  2X3N A;  2QCU A;  3V3O A;  1XPQ A;  3S5W A;  3BNM A;  2YG7 A;  4TM1 A;  5LV9 A;  1REO A;  2FJD A;  3UTG A;  2ARD A;  3HYV A;  1S3E A;  2C70 A;  3KPK A;  3Q6J A;  1PJ6 A;  3CGE A;  4TLZ A;  4ZN0 A;  5DBJ A;  3HZL A;  3EPT A;  1E7P A;  4KX6 A;  3AYL A;  4J56 A;  4GUV A;  4EMJ A;  4U8L A;  2XFU A;  1PBB A;  1PHH A;  1NHR A;  1YKJ A;  2WHD A;  2AQJ A;  2GH5 A;  3AE1 A;  3AWI A;  5KMQ A;  4G6H A;  3FBS A;  1NHP A;  3UOX A;  3KKJ A;  4ICY A;  3UP5 A;  4GR1 A;  1N4V A;  4H7U A;  2A8X A;  1E6E A;  1LQT A;  4MJW A;  1YY5 A;  3KU9 A;  3PS9 A;  3LXD A;  3L1R A;  4RG3 A;  2BCG G;  5U63 A;  4XXG A;  3IHG A;  4YSY A;  4EQS A;  1O5W A;  2E5V A;  2Q0K A;  3K7T A;  1NEN A;  1JNZ A;  2AAQ A;  2I0Z A;  4B69 A;  1B5Q A;  4K5S A;  2V6O A;  3EF6 A;  1F6M A;  1NDA A;  4BJY A;  1EL7 A;  4PAB A;  4YSH A;  2BK5 A;  3NYC A;  3DH9 A;  5EB5 A;  4H4T A;  4CY6 A;  1D4E A;  4H2P A;  5BUK A;  5C2T A;  3ICR A;  4N9X A;  3DK4 A;  1GRG A;  1K0L A;  3SZ0 A;  3GSI A;  4H4Y A;  4E0V A;  4JY3 A;  4DSH A;  2VZ2 A;  2VQ7 A;  4K7Z A;  2XLU A;  5FS6 A;  1GXF A;  1Y0P A;  2EQ8 A;  4HA6 A;  3GYX A;  4JN9 A;  4LA1 A;  4U2T A;  1YQZ A;  4B67 A;  2YVJ A;  3SZW A;  2BRY A;  2BYB A;  2DKH A;  3GYJ A;  4X9M A;  4YKG A;  2GEW A;  1JEH A;  1GET A;  2WEU A;  3CNS A;  1CC4 A;  4DNA A;  3AE8 A;  5KMP A;  2A87 A;  1B4V A;  1GRA A;  3NK2 X;  3P4S A;  2C65 A;  2GR2 A;  1PJ7 A;  3H8I A;  1CJ2 A;  5EBK A;  4UP3 A;  4B66 A;  1NG3 A;  2YLZ A;  2GQF A;  1RSG A;  5EB4 A;  4UDR A;  4RSL A;  4UDP A;  2WU2 A;  5U25 A;  3VR9 A;  5KVH A;  1NAA A;  3T14 A;  3GRS A;  4OPD A;  2CUL A;  5CQF A;  1S2Y A;  3M13 A;  1QLB A;  3P4R A;  3CGD A;  5M0Z A;  2IVD A;  1CC2 A;  4J31 A;  3E1T A;  2BA9 A;  2QA2 A;  4EIQ A;  1L9C A;  2OLO A;  2X8H A;  2Q0L A;  3H4K A;  2ZBW A;  4IV9 A;  4I59 A;  1D7Y A;  1EBD A;  4D04 A;  5L46 A;  2YAU A;  1ZP0 A;  1Q1R A;  4OPG A;  1KNR A;  2YR5 A;  4NWZ A;  1FOH A;  1NHQ A;  1ZMC A;  2XVE A;  1ZK7 A;  3UTE A;  4I58 A;  2XVJ A;  5BVA A;  5J7X A;  1IUU A;  2VVM A;  3CGC A;  4H4Z A;  4A6N A;  1TDN A;  3RNM A;  1B8S A;  4U8J A;  2XFO A;  3BI2 A;  1ZKQ A;  2BXS A;  1O95 A;  3ZYX A;  5J60 A;  2B76 A;  4A7A A;  2QA1 A;  2WPE A;  5GRT A;  3UKF A;  3COX A;  3PVC A;  1GRH A;  1GES A;  2NVK X;  4C3X A;  1BWC A;  4YXD A;  5HXI A;  4H4S A;  3BHK A;  2OAL A;  2XCG A;  3K7M X;  3G5Q A;  2R45 A;  1ELI A;  2GR3 A;  1E1L A;  2YG3 A;  3B6D A;  3UP4 A;  4OCG A;  2J3N A;  3NTA A;  4KPR A;  1FEA A;  4Y4L A;  3EAO A;  4BK3 A;  2IVE A;  2WBA A;  4Z25 A;  2GR0 A;  2GQW A;  3QSE A;  4JQ9 A;  5IPY A;  1VQW A;  4FK1 A;  3NH3 X;  1LTX R;  4IVM B;  3SZF A;  2EQ7 A;  2R4J A;  3VR8 A;  1CJ4 A;  3HYW A;  4FK1 C;  4CCQ A;  3C96 A;  1GV4 A;  3KVE A;  4K8D A;  4CRT A;  1PJ5 A;  1JRX A;  3CNT A;  2C4C A;  1CBO A;  3QFA A;  3VQR A;  2JAE A;  1JRZ A;  1TDF A;  3I3L A;  2DKI A;  3PO7 A;  2YLS A;  3GRT A;  2PYX A;  2YM1 A;  3QVR A;  2YLW A;  3ALL A;  4Z24 A;  5JCM A;  3F8R A;  1D4C A;  2BC1 A;  4TLX A;  2WP9 A;  2R9Z A;  2WS3 A;  3BHF A;  3AE6 A;  3P4P A;  5JCN A;  1E1K A;  2XFN A;  2GAG B;  1CC6 A;  4IVO B;  3DJD A;  4CNJ A;  2W0H A;  4USR A;  3UKL A;  4C77 A;  3DA1 A;  2BK4 A;  3DK9 A;  4OPL A;  5BUL A;  2XLS A;  1GPE A;  3AD9 B;  2Q7V A;  2PHH A;  3LJP A;  2GAH B;  4XWZ A;  3UOZ A;  1IJH A;  3H8L A;  2WQY A;  2V5Z A;  3BI4 A;  4U8M A;  2Y6Q A;  1LPF A;  2XDO A;  3CNJ A;  2B9W A;  4NNJ A;  4U8O A;  1OJT A;  2VRM A;  4OPC A;  2WES A;  1ZOV A;  3AYJ A;  3UOV A;  3UTH A;  3NRN A;  1JNR A;  2X8C A;  3DJG X;  5ER0 A;  2BS2 A;  4K2X A;  3T2Y A;  4EM3 A;  4CY8 A;  1TYT A;  2XYO A;  4Z44 A;  1N1P A;  2QAE A;  1PXB A;  2JKC A;  2ZZC A;  3UCL A;  1D7L A;  1DNC A;  1N4U A;  2Q6U A;  3ABV A;  3IWA A;  4GDE A;  4P9S A;  4U8P A;  3P4Q A;  4H2Q A;  3AEG A;  4H4P A;  2BCP A;  5FS8 A;  5JCL A;  1LQU A;  2VVL A;  1NEK A;  1ZOY A;  3NYF A;  4G73 A;  1PBD A;  4NEV A;  3QFB A;  4AP1 A;  2GB0 A;  2VRL A;  2YM2 A;  5FS9 A;  4AT0 A;  4J34 A;  4EQW A;  1VRQ B;  3NT6 A;  1E39 A;  3VRD B;  1CJ3 A;  2BRA A;  3AD8 B;  5KWF A;  2B7S A;  2OA1 A;  2RGO A;  3NK1 X;  3CMM A;  3KD9 A;  2CDU A;  1S3B A;  2Z5Y A;  1KF6 A;  5C3J A;  1TDE A;  1IUX A;  5IQ1 A;  4H4U A;  1DOC A;  5KNL A;  2WPF A;  1KFY A;  3CIR A;  1KDG A;  2EQ6 A;  5KMS A;  1BGN A;  1GEU A;  1PS9 A;  2GR1 A;  2V3B A;  3LB8 A;  1SEZ A;  3NNE A;  5KOW A;  3GWF A;  1H83 A;  4H4X A;  1NHS A;  3AE3 A;  1JRY A;  3NTD A;  3AE9 A;  3KA7 A;  1COY A;  2TMD A;  2CVJ A;  4LU6 A;  4GDP A;  2UZZ A;  1F8R A;  4A5L A;  1KNP A;  2BXR A;  1KSU A;  3SFD A;  2ZZB A;  4B1B A;  3LZW A;  3IHM A;  2X99 A;  2RGJ A;  1D5T A;  3QSS A;  1F8S A;  4IA5 A;  4U2S A;  4GAV A;  3CNP A;  4CNK A;  3SZC A;  4A65 A;  1BKW A;  2GF3 A;  4H2R A;  5CKU A;  1QO8 A;  4AOS A;  3D1C A;  2YLX A;  4YTM A;  2R0C A;  4TM3 A;  4TM0 A;  1GTE A;  1VDC A;  1PDH A;  3D8X A;  4GCM A;  3T2K A;  2YR4 A;  1Y56 A;  4APN A;  3NKS A;  2H88 A;  4Z2T A;  2GVC A;  1PBC A;  1LJ1 A;  4J2W A;  3M12 A;  1F8W A;  2V61 A;  1TRB A;  3AB1 A;  3UKP A;  4BK1 A;  3SGL A;  1S2Q A;  2NPX A;  4Z2R A;  2C3C A;  3DK8 A;  1L9D A;  1TDO A;  3P9U A;  4Y4M A;  3T31 A;  2BAC A;  1B37 A;  1ZDL A;  2V60 A;  5KMR A;  1PXC A;  5FS7 A;  2IID A;  4YTN A;  2WDQ A;  1IUS A;  4FX9 A;  3C4A A;  4DGK A;  2C66 A;  1EL8 A;  4JDR A;  4M52 A;  4U8K A;  2JB2 A;  2O9Z A;  3FPZ A;  2XFP A;  1EL9 A;  4EMI A;  4X4J A;  3CPI G;  4YSX A;  4ECH A;  3ICS A;  3RP8 A;  2B7R A;  1D4D A;  2BK3 A;  1X31 B;  3WE0 A;  2YLT A;  3ICT A;  4A9W A;  3CTY A;  1GSN A;  3ITJ A;  4J33 A;  4GF7 A;  1VG9 A;  2OAM A;  4A79 A;  1GAL A;  2WP6 A;  3G5R A;  3UTF A;  3K7Q X;  3T0K A;  1DOB A;  1K0J A;  2F5Z A;  2OLN A;  2WOV A;  3AEC A;  3LOV A;  1PBF A;  2YLR A;  1L9E A;  1PXA A;  5HHF A;  2XLR A;  1XAN A;  2BC0 A;  3AYI A;  4G9K A;  4WX1 A;  4B63 A;  2GMJ A;  3AE2 A;  2R0G A;  1E1N A;  3UKA A;  3UKK A;  3NGC X;  4RG4 A;  1M64 A;  3NLC A;  5EOW A;  2GMH A;  3BI5 A;  1DJQ A;  3GDP A;  4BK2 A;  4U8I A;  3SY4 A;  3VRB A;  3ISH A;  4EIP A;  3ALM A;  4G6G A;  4C5O A;  2WOW A;  2BS3 A;  3V3N A;  4Y4N A;  1YQ3 A;  2WET A;  1CF3 A;  2WPC A;  4H4Q A;  4II2 A;  1NG4 A;  1XHC A;  3QVP A;  3HYX A;  4AT2 A;  1IUT A;  3UOY A;  1XDI A;  1GRT A;  4WCT A;  5TR3 A;  4REK A;  3DGH A;  4H2N A;  4II3 A;  2E4G A;  1H81 A;  3KLJ A;  3ADA B;  1BF3 A;  2YQU A;  3ZDN A;  1CJC A;  3SQP A;  4YKF A;  3DJE A;  3EAN A;  4IA6 A;  1GND A;  2JB1 A;  1IUV A;  1GRB A;  1W4X A;  1Q9I A;  3AD7 B;  4FDC B;  4H50 A;  5GSN A;  1Y56 B;  4JY2 A;  4D03 A;  1OJC A;  5JCK A;  5HYM A;  4A6N B;  1ONF A;  2RGH A;  3F8P A;  3NG7 X;  3GWD A;  1OJA A;  4H4R A;  3RP7 A;  3BNU A;  2C75 A;  3CPJ G;  1CL0 A;  4NTC A;  1E1M A;  3P1W A;  4JNA A;  2C76 A;  4AP3 A;  4H4V A;  2XFQ A;  3V76 A;  2XLP A;  3II4 A;  2X8G A;  2FJA A;  4B64 A;  2XLT A;  3K30 A;  2C3D A;  3AEE A;  2ZZ0 A;  3GD4 A;  3LAD A;  4UDQ A;  2YR6 A;  3AXB A;  2YG5 A;  4C74 A;  4YTP A;  4H4W A;  4JNQ A;  2V3A A;  3CGB A;  4OPI A;  1OJ9 A;  1P2H A;  1V59 A;  4O5Q A;  1H7W A;  3GDN A;  4NEW A;  1OJD A;  4AOX A;  3JSK A;  3OC4 A;  2XVF A;  1Z6L A;  3T2Z A;  2JK6 A;  3CN8 A;  1ZMD A;  3L8K A;  1YQ4 A;  1TDK A;  5IQ4 A;  3SYI A;  4Z43 A;  2E1M A;  3O0H A;  4G74 A;  4CCR A;  2YG4 A;  1RP0 A;  3CPH G;  1BZL A;  3FIM B;  5U1O A;  5JCI A;  1GRF A;  3SFE A;  3QSM A;  4DSG A;  4YT0 A;  2BAB A;  2AR8 A;  3ALJ A;  3DJJ A;  3OZ2 A;  2WDR A;  4K5R A;  4ZCC A;  2JBV A;  1MXT A;  3Q9T A;  1UKV G;  2WDV A;  2WU5 A;  2R4E A;  3AE5 A;  3AE7 A;  3RED A;  2BS4 A;  1H84 A;  2HQM A;  4NTD A;  4NZH A;  3IF9 A;  3SXI A;  3UKQ A;  1MOK A;  2C73 A;  2FBW A;  4B65 A;  1DOD A;  3I6D A;  3AEA A;  3NN0 X;  4Z2U A;  1IUW A;  1AOG A;  1JU2 A;  3NYE A;  2ACZ A;  3FG2 P;  3LZX A;  3S61 A;  1KSS A;  4CBQ A;  1VG0 A;  2YVG A;  1H82 A;  4BUR A;  2Z5X A;  1EL5 A;  1LV0 A;  4K22 A;  4PAA A;  1MO9 A;  4GAP A;  5KVI A;  1TYP A;  4LII A;  1CHU A;  2X50 A;  1DXL A;  1H7X A;  2TPR A;  4ADW A;  3NK0 X;  2Y6R A;  4J57 A;  4B68 A;  3SM8 A;  3ATR A;  4NTE A;  3F8D A;  1Q1W A;  1FCD A;  2FJB A;  3RP6 A;  2GRT A;  4YSZ A;  3NHO X;  3NN6 X;  1GRE A;  3IC9 A;  1DOE A;  1N4W A;  4J36 A;  5FMH A;  5KXJ A;  1H6V A;  5BRT A;  2R0P A;  2APG A;  3DME A;  3T37 A;  2A89 A;  4OVI A;  1GTH A;  2B9X A;  1PN0 A;  4HB9 A;  3R9U A;  3FMW A;  1GER A;  1QJD A;  3GMB A;  4EMW A;  3AED A;  3NIX A;  5KRQ A;  2XVI A;  2C7G A;  4U8N A;  2GV8 A;  1LVL A;  2C64 A;  4OPT A;  2XVH A;  2WP5 A;  3UKH A;  2VOU A;  4USQ A;  2C72 A;  2FJE A;  2RAB A;  1BGJ A;  1ZY8 A;  4YWO A;  4XWR A;  1FEC A;  4ZCD A;  4OPU A;  4GRT A;  3URH A;  3GMC A;  2JB3 A;  4Z26 A;  1GT8 A;  3AEB A;  4EQX A;  5M10 A;  1L0V A;  3RHA A;  1P2E A;  4BV6 A;  2H89 A;  2VVL G;  2R46 A;  1FEB A;  3SX6 A;  4BJZ A;  1K0I A;  1DJN A;  1H86 A;  2C67 A;  3CND A;  3QJ4 A;  1F3P A;  1GOS A;  4O5U A;  1M6I A;  4EQR A;  2VQB A;  5KOX A;  4A99 A;  2EQ9 A;  3GYI A;  3ATQ A;  4EM4 A;  2YVF A; 
#chains in the Genus database with same CATH homology
 4X9N A;  3VRA A;  1HYU A;  3AE4 A;  2YG6 A;  3G5S A;  4TM4 A;  1PBE A;  5HY5 A;  2YWL A;  1FL2 A;  3KPF A;  1K4Q A;  3M0O A;  2CFY A;  3GD3 A;  1RYI A;  3AEF A;  3B3R A;  4C3Y A;  2WOI A;  1NPX A;  4U2L A;  1ZX9 A;  3DGZ A;  3C4N A;  1JOA A;  2B9Y A;  1O94 A;  2X3N A;  2QCU A;  3V3O A;  1XPQ A;  3S5W A;  3BNM A;  2YG7 A;  4TM1 A;  5LV9 A;  1REO A;  2FJD A;  3UTG A;  2ARD A;  3HYV A;  1S3E A;  2C70 A;  3KPK A;  3Q6J A;  1PJ6 A;  3CGE A;  4TLZ A;  4ZN0 A;  5DBJ A;  3HZL A;  3EPT A;  1E7P A;  4KX6 A;  3AYL A;  4J56 A;  4GUV A;  4EMJ A;  4U8L A;  2XFU A;  1PBB A;  1PHH A;  1NHR A;  1YKJ A;  2WHD A;  2AQJ A;  2GH5 A;  3AE1 A;  3AWI A;  5KMQ A;  4G6H A;  3FBS A;  1NHP A;  3UOX A;  3KKJ A;  4ICY A;  3UP5 A;  4GR1 A;  1N4V A;  4H7U A;  2A8X A;  1E6E A;  1LQT A;  4MJW A;  1YY5 A;  3KU9 A;  3PS9 A;  3LXD A;  3L1R A;  4RG3 A;  2BCG G;  5U63 A;  4XXG A;  3IHG A;  4YSY A;  4EQS A;  1O5W A;  2E5V A;  2Q0K A;  3K7T A;  1NEN A;  1JNZ A;  2AAQ A;  2I0Z A;  4B69 A;  1B5Q A;  4K5S A;  2V6O A;  3EF6 A;  1F6M A;  1NDA A;  4BJY A;  1EL7 A;  4PAB A;  4YSH A;  2BK5 A;  3NYC A;  3DH9 A;  5EB5 A;  4H4T A;  4CY6 A;  1D4E A;  4H2P A;  5BUK A;  5C2T A;  3ICR A;  4N9X A;  3DK4 A;  1GRG A;  1K0L A;  3SZ0 A;  3GSI A;  4H4Y A;  4E0V A;  4JY3 A;  4DSH A;  2VZ2 A;  2VQ7 A;  4K7Z A;  2XLU A;  5FS6 A;  1GXF A;  1Y0P A;  2EQ8 A;  4HA6 A;  3GYX A;  4JN9 A;  4LA1 A;  4U2T A;  1YQZ A;  4B67 A;  2YVJ A;  3SZW A;  2BRY A;  2BYB A;  2DKH A;  3GYJ A;  4X9M A;  4YKG A;  2GEW A;  1JEH A;  1GET A;  2WEU A;  3CNS A;  1CC4 A;  4DNA A;  3AE8 A;  5KMP A;  2A87 A;  1B4V A;  1GRA A;  3NK2 X;  3P4S A;  2C65 A;  2GR2 A;  1PJ7 A;  3H8I A;  1CJ2 A;  5EBK A;  4UP3 A;  4B66 A;  1NG3 A;  2YLZ A;  2GQF A;  1RSG A;  5EB4 A;  4UDR A;  4RSL A;  4UDP A;  2WU2 A;  5U25 A;  3VR9 A;  5KVH A;  1NAA A;  3T14 A;  3GRS A;  4OPD A;  2CUL A;  5CQF A;  1S2Y A;  3M13 A;  1QLB A;  3P4R A;  3CGD A;  5M0Z A;  2IVD A;  1CC2 A;  4J31 A;  3E1T A;  2BA9 A;  2QA2 A;  4EIQ A;  1L9C A;  2OLO A;  2X8H A;  2Q0L A;  3H4K A;  2ZBW A;  4IV9 A;  4I59 A;  1D7Y A;  1EBD A;  4D04 A;  5L46 A;  2YAU A;  1ZP0 A;  1Q1R A;  4OPG A;  1KNR A;  2YR5 A;  4NWZ A;  1FOH A;  1NHQ A;  1ZMC A;  2XVE A;  1ZK7 A;  3UTE A;  4I58 A;  2XVJ A;  5BVA A;  5J7X A;  1IUU A;  2VVM A;  3CGC A;  4H4Z A;  4A6N A;  1TDN A;  3RNM A;  1B8S A;  4U8J A;  2XFO A;  3BI2 A;  1ZKQ A;  2BXS A;  1O95 A;  3ZYX A;  5J60 A;  2B76 A;  4A7A A;  2QA1 A;  2WPE A;  5GRT A;  3UKF A;  3COX A;  3PVC A;  1GRH A;  1GES A;  2NVK X;  4C3X A;  1BWC A;  4YXD A;  5HXI A;  4H4S A;  3BHK A;  2OAL A;  2XCG A;  3K7M X;  3G5Q A;  2R45 A;  1ELI A;  2GR3 A;  1E1L A;  2YG3 A;  3B6D A;  3UP4 A;  4OCG A;  2J3N A;  3NTA A;  4KPR A;  1FEA A;  4Y4L A;  3EAO A;  4BK3 A;  2IVE A;  2WBA A;  4Z25 A;  2GR0 A;  2GQW A;  3QSE A;  4JQ9 A;  5IPY A;  1VQW A;  4FK1 A;  3NH3 X;  1LTX R;  4IVM B;  3SZF A;  2EQ7 A;  2R4J A;  3VR8 A;  1CJ4 A;  3HYW A;  4FK1 C;  4CCQ A;  3C96 A;  1GV4 A;  3KVE A;  4K8D A;  4CRT A;  1PJ5 A;  1JRX A;  3CNT A;  2C4C A;  1CBO A;  3QFA A;  3VQR A;  2JAE A;  1JRZ A;  1TDF A;  3I3L A;  2DKI A;  3PO7 A;  2YLS A;  3GRT A;  2PYX A;  2YM1 A;  3QVR A;  2YLW A;  3ALL A;  4Z24 A;  5JCM A;  3F8R A;  1D4C A;  2BC1 A;  4TLX A;  2WP9 A;  2R9Z A;  2WS3 A;  3BHF A;  3AE6 A;  3P4P A;  5JCN A;  1E1K A;  2XFN A;  2GAG B;  1CC6 A;  4IVO B;  3DJD A;  4CNJ A;  2W0H A;  4USR A;  3UKL A;  4C77 A;  3DA1 A;  2BK4 A;  3DK9 A;  4OPL A;  5BUL A;  2XLS A;  1GPE A;  3AD9 B;  2Q7V A;  2PHH A;  3LJP A;  2GAH B;  4XWZ A;  3UOZ A;  1IJH A;  3H8L A;  2WQY A;  2V5Z A;  3BI4 A;  4U8M A;  2Y6Q A;  1LPF A;  2XDO A;  3CNJ A;  2B9W A;  4NNJ A;  4U8O A;  1OJT A;  2VRM A;  4OPC A;  2WES A;  1ZOV A;  3AYJ A;  3UOV A;  3UTH A;  3NRN A;  1JNR A;  2X8C A;  3DJG X;  5ER0 A;  2BS2 A;  4K2X A;  3T2Y A;  4EM3 A;  4CY8 A;  1TYT A;  2XYO A;  4Z44 A;  1N1P A;  2QAE A;  1PXB A;  2JKC A;  2ZZC A;  3UCL A;  1D7L A;  1DNC A;  1N4U A;  2Q6U A;  3ABV A;  3IWA A;  4GDE A;  4P9S A;  4U8P A;  3P4Q A;  4H2Q A;  3AEG A;  4H4P A;  2BCP A;  5FS8 A;  5JCL A;  1LQU A;  2VVL A;  1NEK A;  1ZOY A;  3NYF A;  4G73 A;  1PBD A;  4NEV A;  3QFB A;  4AP1 A;  2GB0 A;  2VRL A;  2YM2 A;  5FS9 A;  4AT0 A;  4J34 A;  4EQW A;  1VRQ B;  3NT6 A;  1E39 A;  3VRD B;  1CJ3 A;  2BRA A;  3AD8 B;  5KWF A;  2B7S A;  2OA1 A;  2RGO A;  3NK1 X;  3CMM A;  3KD9 A;  2CDU A;  1S3B A;  2Z5Y A;  1KF6 A;  5C3J A;  1TDE A;  1IUX A;  5IQ1 A;  4H4U A;  1DOC A;  5KNL A;  2WPF A;  1KFY A;  3CIR A;  1KDG A;  2EQ6 A;  5KMS A;  1BGN A;  1GEU A;  1PS9 A;  2GR1 A;  2V3B A;  3LB8 A;  1SEZ A;  3NNE A;  5KOW A;  3GWF A;  1H83 A;  4H4X A;  1NHS A;  3AE3 A;  1JRY A;  3NTD A;  3AE9 A;  3KA7 A;  1COY A;  2TMD A;  2CVJ A;  4LU6 A;  4GDP A;  2UZZ A;  1F8R A;  4A5L A;  1KNP A;  2BXR A;  1KSU A;  3SFD A;  2ZZB A;  4B1B A;  3LZW A;  3IHM A;  2X99 A;  2RGJ A;  1D5T A;  3QSS A;  1F8S A;  4IA5 A;  4U2S A;  4GAV A;  3CNP A;  4CNK A;  3SZC A;  4A65 A;  1BKW A;  2GF3 A;  4H2R A;  5CKU A;  1QO8 A;  4AOS A;  3D1C A;  2YLX A;  4YTM A;  2R0C A;  4TM3 A;  4TM0 A;  1GTE A;  1VDC A;  1PDH A;  3D8X A;  4GCM A;  3T2K A;  2YR4 A;  1Y56 A;  4APN A;  3NKS A;  2H88 A;  4Z2T A;  2GVC A;  1PBC A;  1LJ1 A;  4J2W A;  3M12 A;  1F8W A;  2V61 A;  1TRB A;  3AB1 A;  3UKP A;  4BK1 A;  3SGL A;  1S2Q A;  2NPX A;  4Z2R A;  2C3C A;  3DK8 A;  1L9D A;  1TDO A;  3P9U A;  4Y4M A;  3T31 A;  2BAC A;  1B37 A;  1ZDL A;  2V60 A;  5KMR A;  1PXC A;  5FS7 A;  2IID A;  4YTN A;  2WDQ A;  1IUS A;  4FX9 A;  3C4A A;  4DGK A;  2C66 A;  1EL8 A;  4JDR A;  4M52 A;  4U8K A;  2JB2 A;  2O9Z A;  3FPZ A;  2XFP A;  1EL9 A;  4EMI A;  4X4J A;  3CPI G;  4YSX A;  4ECH A;  3ICS A;  3RP8 A;  2B7R A;  1D4D A;  2BK3 A;  1X31 B;  3WE0 A;  2YLT A;  3ICT A;  4A9W A;  3CTY A;  1GSN A;  3ITJ A;  4J33 A;  4GF7 A;  1VG9 A;  2OAM A;  4A79 A;  1GAL A;  2WP6 A;  3G5R A;  3UTF A;  3K7Q X;  3T0K A;  1DOB A;  1K0J A;  2F5Z A;  2OLN A;  2WOV A;  3AEC A;  3LOV A;  1PBF A;  2YLR A;  1L9E A;  1PXA A;  5HHF A;  2XLR A;  1XAN A;  2BC0 A;  3AYI A;  4G9K A;  4WX1 A;  4B63 A;  2GMJ A;  3AE2 A;  2R0G A;  1E1N A;  3UKA A;  3UKK A;  3NGC X;  4RG4 A;  1M64 A;  3NLC A;  5EOW A;  2GMH A;  3BI5 A;  1DJQ A;  3GDP A;  4BK2 A;  4U8I A;  3SY4 A;  3VRB A;  3ISH A;  4EIP A;  3ALM A;  4G6G A;  4C5O A;  2WOW A;  2BS3 A;  3V3N A;  4Y4N A;  1YQ3 A;  2WET A;  1CF3 A;  2WPC A;  4H4Q A;  4II2 A;  1NG4 A;  1XHC A;  3QVP A;  3HYX A;  4AT2 A;  1IUT A;  3UOY A;  1XDI A;  1GRT A;  4WCT A;  5TR3 A;  4REK A;  3DGH A;  4H2N A;  4II3 A;  2E4G A;  1H81 A;  3KLJ A;  3ADA B;  1BF3 A;  2YQU A;  3ZDN A;  1CJC A;  3SQP A;  4YKF A;  3DJE A;  3EAN A;  4IA6 A;  1GND A;  2JB1 A;  1IUV A;  1GRB A;  1W4X A;  1Q9I A;  3AD7 B;  4FDC B;  4H50 A;  5GSN A;  1Y56 B;  4JY2 A;  4D03 A;  1OJC A;  5JCK A;  5HYM A;  4A6N B;  1ONF A;  2RGH A;  3F8P A;  3NG7 X;  3GWD A;  1OJA A;  4H4R A;  3RP7 A;  3BNU A;  2C75 A;  3CPJ G;  1CL0 A;  4NTC A;  1E1M A;  3P1W A;  4JNA A;  2C76 A;  4AP3 A;  4H4V A;  2XFQ A;  3V76 A;  2XLP A;  3II4 A;  2X8G A;  2FJA A;  4B64 A;  2XLT A;  3K30 A;  2C3D A;  3AEE A;  2ZZ0 A;  3GD4 A;  3LAD A;  4UDQ A;  2YR6 A;  3AXB A;  2YG5 A;  4C74 A;  4YTP A;  4H4W A;  4JNQ A;  2V3A A;  3CGB A;  4OPI A;  1OJ9 A;  1P2H A;  1V59 A;  4O5Q A;  1H7W A;  3GDN A;  4NEW A;  1OJD A;  4AOX A;  3JSK A;  3OC4 A;  2XVF A;  1Z6L A;  3T2Z A;  2JK6 A;  3CN8 A;  1ZMD A;  3L8K A;  1YQ4 A;  1TDK A;  5IQ4 A;  3SYI A;  4Z43 A;  2E1M A;  3O0H A;  4G74 A;  4CCR A;  2YG4 A;  1RP0 A;  3CPH G;  1BZL A;  3FIM B;  5U1O A;  5JCI A;  1GRF A;  3SFE A;  3QSM A;  4DSG A;  4YT0 A;  2BAB A;  2AR8 A;  3ALJ A;  3DJJ A;  3OZ2 A;  2WDR A;  4K5R A;  4ZCC A;  2JBV A;  1MXT A;  3Q9T A;  1UKV G;  2WDV A;  2WU5 A;  2R4E A;  3AE5 A;  3AE7 A;  3RED A;  2BS4 A;  1H84 A;  2HQM A;  4NTD A;  4NZH A;  3IF9 A;  3SXI A;  3UKQ A;  1MOK A;  2C73 A;  2FBW A;  4B65 A;  1DOD A;  3I6D A;  3AEA A;  3NN0 X;  4Z2U A;  1IUW A;  1AOG A;  1JU2 A;  3NYE A;  2ACZ A;  3FG2 P;  3LZX A;  3S61 A;  1KSS A;  4CBQ A;  1VG0 A;  2YVG A;  1H82 A;  4BUR A;  2Z5X A;  1EL5 A;  1LV0 A;  4K22 A;  4PAA A;  1MO9 A;  4GAP A;  5KVI A;  1TYP A;  4LII A;  1CHU A;  2X50 A;  1DXL A;  1H7X A;  2TPR A;  4ADW A;  3NK0 X;  2Y6R A;  4J57 A;  4B68 A;  3SM8 A;  3ATR A;  4NTE A;  3F8D A;  1Q1W A;  1FCD A;  2FJB A;  3RP6 A;  2GRT A;  4YSZ A;  3NHO X;  3NN6 X;  1GRE A;  3IC9 A;  1DOE A;  1N4W A;  4J36 A;  5FMH A;  5KXJ A;  1H6V A;  5BRT A;  2R0P A;  2APG A;  3DME A;  3T37 A;  2A89 A;  4OVI A;  1GTH A;  2B9X A;  1PN0 A;  4HB9 A;  3R9U A;  3FMW A;  1GER A;  1QJD A;  3GMB A;  4EMW A;  3AED A;  3NIX A;  5KRQ A;  2XVI A;  2C7G A;  4U8N A;  2GV8 A;  1LVL A;  2C64 A;  4OPT A;  2XVH A;  2WP5 A;  3UKH A;  2VOU A;  4USQ A;  2C72 A;  2FJE A;  2RAB A;  1BGJ A;  1ZY8 A;  4YWO A;  4XWR A;  1FEC A;  4ZCD A;  4OPU A;  4GRT A;  3URH A;  3GMC A;  2JB3 A;  4Z26 A;  1GT8 A;  3AEB A;  4EQX A;  5M10 A;  1L0V A;  3RHA A;  1P2E A;  4BV6 A;  2H89 A;  2VVL G;  2R46 A;  1FEB A;  3SX6 A;  4BJZ A;  1K0I A;  1DJN A;  1H86 A;  2C67 A;  3CND A;  3QJ4 A;  1F3P A;  1GOS A;  4O5U A;  1M6I A;  4EQR A;  2VQB A;  5KOX A;  4A99 A;  2EQ9 A;  3GYI A;  3ATQ A;  4EM4 A;  2YVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...