1FL2A

Catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
310
structure length
310
Chain Sequence
AYDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
publication title Crystal structure of the catalytic core component of the alkylhydroperoxide reductase AhpF from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 96
structure length 310
sequence length 310
ec nomenclature ec 1.8.1.-:
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1fl2A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1fl2A02
2GQWA 3AE5A 4Z25A 1O5WA 1NHSA 3B6DA 1ZDLA 3UOXA 2B9XA 2BABA 2ZZ0A 2WPEA 3PVCA 4U8NA 5U25A 3DJGX 3WE0A 3AEEA 4C77A 1PDHA 2B76A 1LQTA 2C67A 2O9ZA 4H4ZA 3UOZA 1PXBA 1BGNA 3RNMA 2WEUA 3CNSA 3KU9A 1GRGA 3CGDA 5BRTA 3I3LA 4Z44A 4J36A 2XFPA 5M0ZA 3LXDA 2YVGA 2X8HA 1KF6A 4J31A 1CBOA 2YM2A 2XFUA 4U8MA 4EIPA 4EM4A 1RYIA 3V3NA 1X31B 4HA6A 4ICYA 4XXGA 1DJNA 1XHCA 3GMBA 3IWAA 4GR1A 1ZKQA 1EL5A 2C7GA 3QFBA 5IPYA 4J34A 5JCMA 4USQA 3EANA 3P4PA 3NTDA 1Z6LA 1PJ7A 3S5WA 3S61A 3QFAA 4PABA 2IIDA 3ITJA 1BGJA 1LJ1A 1FOHA 4U8LA 1FL2A 4NZHA 1D7YA 2BCGG 4OPUA 1CHUA 3Q6JA 2BA9A 4A6NB 3EPTA 1OJCA 1YY5A 3NK2X 3E1TA 1PBFA 3EAOA 3BNUA 2B7SA 3ALJA 3LADA 2XFNA 2BC0A 4C5OA 1B8SA 4A7AA 3AYIA 1RSGA 2XCGA 2UZZA 3SM8A 3AEDA 2YR6A 4NTDA 2V5ZA 3ABVA 5EBKA 4KPRA 4Z43A 5J60A 3VR8A 1JU2A 1PBBA 1D4EA 4U8JA 2EQ9A 3QSEA 5BUKA 5L46A 5FS7A 1ZY8A 4A6NA 3BNMA 4H4WA 5GSNA 4OPGA 2PYXA 3KA7A 4BURA 4JY3A 4KX6A 2YVFA 1IUVA 2R0CA 1QLBA 3QJ4A 3R9UA 1ZMCA 2X3NA 1K0JA 2YR4A 3IF9A 3ADAB 3GWDA 3RHAA 4EM3A 4Z2TA 5J7XA 3AWIA 4H4TA 4K5RA 2BXRA 2R4EA 2XVEA 1GRTA 2C64A 4DSGA 3B3RA 1OJ9A 1N4WA 2C72A 3ICRA 3FG2P 2BK5A 4N9XA 3UTHA 5KOWA 1DXLA 3DMEA 3NTAA 3BHFA 1XPQA 1KDGA 1E7PA 1TDFA 2V3BA 1PJ5A 3AECA 1F8RA 3NK0X 5DBJA 3O0HA 2H89A 1BKWA 3LZXA 4TM3A 3NN0X 3KPFA 2BK3A 3AYLA 3GDPA 3NHOX 1LPFA 1TDKA 2XVJA 3AE8A 4BJZA 1GXFA 2WOWA 3UCLA 2WPCA 2A89A 5CQFA 2Q7VA 2XLTA 1BWCA 2QA2A 5HHFA 4JY2A 3UKLA 2OAMA 3CNPA 4J57A 1XDIA 2IVDA 2GH5A 4BK2A 5ER0A 1DOEA 3LJPA 4EQWA 4LA1A 4TM4A 1GNDA 2WDRA 3GSIA 4H4PA 1B4VA 1NEKA 5C2TA 3NRNA 2V61A 2CFYA 1NG4A 4TM0A 3ICTA 3UKHA 4EMJA 4K8DA 1LVLA 4NEVA 2GR3A 2XDOA 4B67A 4CCRA 3NN6X 5EOWA 1IUXA 3SFDA 1LQUA 1CL0A 3SQPA 2GVCA 4OPTA 5FS6A 3GD4A 5BULA 1YKJA 5BVAA 1MXTA 3AD9B 1GETA 1EBDA 3QVPA 3C4NA 1IUTA 2WHDA 3KVEA 1D7LA 2XVFA 3BI2A 1D4CA 3FBSA 2XFOA 4Z24A 1DOCA 3CNDA 1H7WA 1LV0A 2CVJA 1YQ3A 3URHA 3P9UA 5KRQA 3M0OA 2C3DA 1Q9IA 2X50A 4RG3A 1GERA 3UOVA 4Z2UA 4OPIA 3AE6A 4GDPA 4GCMA 4JN9A 1B37A 3BI5A 3CGEA 3CIRA 1PXAA 2X8GA 4EIQA 3G5RA 2PHHA 2RABA 2TMDA 4UP3A 1MOKA 3D8XA 1NDAA 1REOA 3C4AA 4AP1A 5EB5A 2YG7A 1TDOA 5GRTA 1BF3A 2BS3A 2GRTA 2CDUA 2ZZBA 4CNKA 1ZX9A 2CULA 2YG4A 1NHPA 3DK8A 2JKCA 3ALLA 1V59A 1F8WA 3P1WA 3K7TA 2QCUA 4BJYA 4D04A 2WOVA 2WS3A 1CC4A 2XLPA 2WP6A 3CGBA 3AE7A 4H2QA 3M13A 1GEUA 3LB8A 3AXBA 2YAUA 4LU6A 2YLWA 4YTNA 2FJDA 5JCNA 1GSNA 2R0PA 3VRAA 3UKFA 1IUWA 2BYBA 1JRZA 4A65A 2YLZA 5CKUA 4A5LA 1ZP0A 4JQ9A 4EMWA 4OPDA 4X4JA 3AEGA 4EQSA 2WDQA 4O5QA 4RSLA 1KSUA 1NPXA 3IHGA 4AT2A 3UKAA 3VQRA 4Z2RA 1S3BA 4J56A 2VVLG 3DK4A 2FJEA 3UTFA 3ICSA 3SFEA 3DGZA 3C96A 3GDNA 2FJAA 5KVIA 1L0VA 2AR8A 4XWRA 1DODA 2B9WA 4NEWA 1TDNA 4AT0A 4H4SA 2Z5XA 1JRYA 2C73A 2JAEA 2H88A 5KXJA 2Y6RA 3DJJA 4YT0A 4REKA 1TDEA 3RP8A 1CJ2A 1CJCA 1H6VA 4CRTA 2A8XA 4K5SA 2X99A 2XLSA 3CN8A 3IHMA 1F6MA 4IVMB 4AOXA 1VDCA 2WU2A 4OVIA 1GPEA 4YTMA 1QO8A 1E39A 2FJBA 2WESA 4GF7A 3I6DA 2BC1A 3ALMA 4H4YA 5JCKA 2BS2A 5IQ1A 2C3CA 2VQBA 1O94A 4FDCB 5KVHA 4GDEA 4XWZA 4J2WA 1F8SA 4YXDA 3CPIG 4USRA 3GYIA 3H4KA 1AOGA 2ZBWA 4C3YA 5M10A 4B65A 1N4UA 2R45A 3AYJA 3K7QX 3UKPA 1VG9A 3LZWA 1H86A 4WX1A 4EMIA 2C66A 3NKSA 4PAAA 4E0VA 3VRBA 4YSHA 3UP4A 2XVIA 1OJTA 2GMHA 2NPXA 1GRFA 2EQ8A 3NIXA 4BK3A 1DJQA 1GTEA 3CPHG 5HXIA 5TR3A 1OJAA 2YM1A 3COXA 2OA1A 1COYA 3DJEA 3KKJA 1H84A 2BCPA 4YSZA 1PBDA 4B68A 2HQMA 2WU5A 3P4QA 1IJHA 1EL8A 1K4QA 3UTEA 2WP9A 1H83A 2IVEA 2FBWA 3P4SA 4CY8A 5IQ4A 1B5QA 4ZN0A 1KNPA 2YG3A 4FX9A 4Y4NA 4X9NA 1CC2A 2WDVA 2WP5A 1JOAA 1GT8A 1GESA 4K22A 1GRBA 5C3JA 2GR1A 3ZYXA 1F3PA 4OCGA 3UKQA 1PS9A 4H4VA 4I59A 3RP7A 3VR9A 1E1NA 2XLRA 2XFQA 4RG4A 2JB1A 1NENA 4H4QA 4Z26A 2GAHB 2E4GA 4AOSA 4P9SA 4A9WA 1GRHA 2V3AA 1K0LA 4K2XA 3JSKA 2QA1A 4B69A 3REDA 3NYFA 2W0HA 4H50A 2C75A 1YQ4A 2TPRA 1XANA 3AEAA 2RGOA 2YLXA 3H8IA 3DK9A 2VOUA 2Q0KA 3CNJA 3AE1A 4IA6A 4H2NA 3UKKA 5KOXA 1VQWA 2OLNA 3GRTA 1IUSA 3K30A 2XLUA 1FECA 1Q1RA 5LV9A 2R0GA 2WETA 3AE3A 3UP5A 1FEAA 1L9CA 3DA1A 2GEWA 2YWLA 1GALA 3F8DA 5JCIA 1N4VA 2WBAA 5FMHA 2APGA 4BK1A 5EB4A 1Y56B 4YSYA 4YSXA 4FK1C 1L9EA 1PBCA 2I0ZA 4J33A 2V6OA 1GREA 4UDRA 4OPLA 2YG5A 3NT6A 3T37A 2OALA 3F8PA 2J3NA 1Q1WA 4ZCDA 4A79A 1NG3A 4C3XA 3NYCA 2VZ2A 2YLRA 3AD7B 3GYJA 3V3OA 1BZLA 3RP6A 2VRMA 1JNRA 1JEHA 1Y56A 3AD8B 3AE2A 2JB3A 1E1MA 2BK4A 4YKFA 2R46A 3CGCA 3FMWA 1GOSA 4UDPA 1PJ6A 4C74A 2YLSA 4EQRA 4CY6A 1N1PA 3L8KA 1DOBA 4HB9A 2XVHA 3QVRA 1CJ3A 4DGKA 2C70A 4B1BA 1H82A 4YWOA 1NHRA 3ZDNA 4APNA 1O95A 2RGHA 1EL7A 3VRDB 1PBEA 3ATQA 1KNRA 1E1KA 1GRAA 3AEBA 4FK1A 4H4UA 3IC9A 1D5TA 4U8IA 2VRLA 4M52A 1PN0A 1D4DA 2RGJA 2Y6QA 4JDRA 3ATRA 1P2HA 1H81A 2BACA 4MJWA 1K0IA 3FPZA 1IUUA 3L1RA 3OC4A 4H7UA 1DNCA 3LOVA 3DJDA 1RP0A 5FS8A 4EQXA 1S3EA 1UKVG 3NG7X 1Y0PA 4U8PA 2Q0LA 1NHQA 3BHKA 4ECHA 2F5ZA 5U1OA 3SGLA 2E1MA 4A99A 2WOIA 2GR0A 3NLCA 1H7XA 4IV9A 3G5QA 1CC6A 4JNAA 1CJ4A 2EQ6A 3BI4A 1JNZA 4BV6A 2YVJA 4AP3A 4GUVA 4B63A 1CF3A 1VRQB 2JB2A 2X8CA 4B66A 4U2SA 2YR5A 4CCQA 1FCDA 2ARDA 2EQ7A 1GV4A 1M6IA 1OJDA 4DSHA 1ELIA 3NYEA 1MO9A 3NK1X 2ACZA 4JNQA 2JK6A 4TM1A 2C76A 3CPJG 3GD3A 1FEBA 3EF6A 2E5VA 2Z5YA 4H2PA 1E1LA 3V76A 1ZK7A 1ZOVA 4DNAA 1ZMDA 3AE9A 2JBVA 3D1CA 2DKHA 3ISHA 4K7ZA 4O5UA 1TYTA 2GB0A 2BXSA 2WPFA 2GV8A 2R9ZA 2ZZCA 4X9MA 4UDQA 2GQFA 3NH3X 3GWFA 1L9DA 2VQ7A 3PO7A 1NAAA 1PXCA 3GMCA 4U8OA 3UTGA 1LTXR 3NNEA 4YKGA 3KLJA 4U8KA 1ZOYA 3QSSA 4ZCCA 2V60A 1KSSA 2WQYA 4NTEA 2VVMA 4U2TA 4CBQA 3NGCX 1S2QA 4IVOB 3HZLA 2C65A 4GRTA 2AAQA 1TRBA 3H8LA 4ADWA 1KFYA 2XYOA 3OZ2A 4YTPA 1EL9A 1ONFA 3G5SA 4Y4LA 1GTHA 2NVKX 4TLXA 1VG0A 2OLOA 3FIMB 3KD9A 5JCLA 2A87A 2GR2A 4Y4MA 5FS9A 4NTCA 1YQZA 3K7MX 2B9YA 3II4A 2B7RA 4IA5A 3DH9A 5KWFA 2GAGB 1P2EA 3AE4A 3GRSA 5HYMA 2R4JA 2GF3A 4B64A 3Q9TA 4WCTA 3AB1A 4OPCA 3P4RA 1SEZA 1E6EA 2GMJA 3QSMA 2BS4A 2VVLA 5HY5A 2QAEA 4I58A 4D03A 3DGHA 4H4XA 4U2LA 1PHHA 1S2YA 4TLZA 3M12A 2YLTA 1TYPA 1QJDA 4CNJA 3F8RA 2YG6A 3CTYA 4H2RA 2DKIA 3AEFA 2YQUA 3CNTA 1M64A 2AQJA 2Q6UA 4LIIA 5U63A 4H4RA 1W4XA 3UOYA 3PS9A 1HYUA 1JRXA
chains in the Genus database with same CATH superfamily
2GQWA 3AE5A 4Z25A 1O5WA 1NHSA 3B6DA 1ZDLA 3UOXA 2B9XA 3SZCA 2BABA 2ZZ0A 2WPEA 3PVCA 4U8NA 5U25A 3DJGX 3WE0A 3AEEA 4C77A 1PDHA 2B76A 1LQTA 2C67A 2O9ZA 4H4ZA 3UOZA 1PXBA 1BGNA 3RNMA 2WEUA 3CNSA 3KU9A 1GRGA 3CGDA 5BRTA 3I3LA 4Z44A 4J36A 2XFPA 5M0ZA 3LXDA 2YVGA 2X8HA 1KF6A 4J31A 1CBOA 2YM2A 2XFUA 4U8MA 4EIPA 3T2YA 1RYIA 3V3NA 1X31B 4HA6A 4G73A 4ICYA 4XXGA 1DJNA 1XHCA 3GMBA 3IWAA 4GR1A 1ZKQA 5KMQA 1EL5A 2C7GA 3QFBA 5IPYA 4J34A 5JCMA 4USQA 3EANA 3P4PA 3NTDA 1Z6LA 1PJ7A 3S5WA 3S61A 3QFAA 4PABA 2IIDA 3ITJA 1BGJA 1LJ1A 1FOHA 4U8LA 1FL2A 4NZHA 1D7YA 2BCGG 4OPUA 1CHUA 3Q6JA 2BA9A 4A6NB 3EPTA 1OJCA 1YY5A 3NK2X 3E1TA 1PBFA 3EAOA 3BNUA 2B7SA 3ALJA 3LADA 2XFNA 2BC0A 4C5OA 1B8SA 4A7AA 3AYIA 1RSGA 2XCGA 2UZZA 3SM8A 3AEDA 2YR6A 4NWZA 4NTDA 2V5ZA 5KMRA 3ABVA 5EBKA 4KPRA 4Z43A 5J60A 3VR8A 1JU2A 1PBBA 1D4EA 4U8JA 2EQ9A 3QSEA 4G9KA 5BUKA 5L46A 5FS7A 1ZY8A 4A6NA 3BNMA 4H4WA 5GSNA 4OPGA 2PYXA 3KA7A 4BURA 4JY3A 4KX6A 2YVFA 1IUVA 2R0CA 1QLBA 3QJ4A 3R9UA 1ZMCA 2X3NA 1K0JA 2YR4A 3IF9A 4II2A 3T14A 3ADAB 3GWDA 3RHAA 4EM3A 4Z2TA 5J7XA 3AWIA 4H4TA 4K5RA 2BXRA 2R4EA 2XVEA 1GRTA 2C64A 4DSGA 3B3RA 1OJ9A 1N4WA 2C72A 3ICRA 3FG2P 2BK5A 4N9XA 3UTHA 5KOWA 1DXLA 3DMEA 3NTAA 3BHFA 1XPQA 1KDGA 1E7PA 1TDFA 2V3BA 1PJ5A 3AECA 1F8RA 3NK0X 5DBJA 3O0HA 2H89A 1BKWA 3LZXA 4TM3A 3NN0X 3KPFA 2BK3A 3AYLA 3GDPA 3NHOX 1LPFA 1TDKA 2XVJA 3AE8A 4BJZA 1GXFA 2WOWA 3UCLA 2WPCA 2A89A 5CQFA 2Q7VA 2XLTA 1BWCA 2QA2A 5HHFA 4JY2A 3UKLA 2OAMA 3CNPA 4J57A 1XDIA 2IVDA 2GH5A 4BK2A 5ER0A 1DOEA 3LJPA 4EQWA 4LA1A 4TM4A 1GNDA 2WDRA 3GSIA 4H4PA 1B4VA 1NEKA 5C2TA 3NRNA 2V61A 2CFYA 1NG4A 4TM0A 3ICTA 3UKHA 4EMJA 4K8DA 1LVLA 4NEVA 2GR3A 2XDOA 4B67A 4CCRA 3NN6X 5EOWA 1IUXA 3SFDA 1LQUA 1CL0A 3SQPA 3SYIA 2GVCA 4OPTA 5FS6A 3GD4A 5BULA 1YKJA 5BVAA 1MXTA 3AD9B 3T2KA 1GETA 1EBDA 3QVPA 3C4NA 4II3A 1IUTA 2WHDA 3KVEA 1D7LA 2XVFA 3BI2A 1D4CA 3FBSA 2XFOA 4Z24A 1DOCA 3CNDA 1H7WA 1LV0A 2CVJA 1YQ3A 3URHA 3P9UA 5KRQA 3M0OA 2C3DA 1Q9IA 2X50A 4RG3A 1GERA 3UOVA 4Z2UA 4OPIA 3AE6A 4GDPA 4GCMA 4JN9A 1B37A 3BI5A 3CGEA 3CIRA 1PXAA 2X8GA 4EIQA 3G5RA 2PHHA 2RABA 2TMDA 3HYVA 4UP3A 1MOKA 3D8XA 1NDAA 1REOA 3C4AA 4AP1A 5EB5A 2YG7A 1TDOA 5GRTA 3HYXA 1BF3A 2BS3A 2GRTA 2CDUA 2ZZBA 4CNKA 1ZX9A 2CULA 2YG4A 1NHPA 3DK8A 2JKCA 3ALLA 1V59A 1F8WA 3P1WA 3K7TA 2QCUA 4BJYA 4D04A 2WOVA 2WS3A 1CC4A 2XLPA 2WP6A 3CGBA 3AE7A 4H2QA 3M13A 1GEUA 3LB8A 3AXBA 2YAUA 4LU6A 2YLWA 4YTNA 2FJDA 5JCNA 1GSNA 2R0PA 4GAVA 3UKFA 1IUWA 2BYBA 3VRAA 1JRZA 4A65A 2YLZA 5CKUA 4A5LA 1ZP0A 4JQ9A 4EMWA 4OPDA 4X4JA 3AEGA 4EQSA 2WDQA 4O5QA 4RSLA 1KSUA 1NPXA 3IHGA 4AT2A 3UKAA 3VQRA 4Z2RA 1S3BA 4J56A 2VVLG 3DK4A 2FJEA 3UTFA 3ICSA 3SFEA 3DGZA 3C96A 3GDNA 2FJAA 5KVIA 1L0VA 2AR8A 4XWRA 1DODA 2B9WA 4NEWA 1TDNA 4AT0A 4H4SA 2Z5XA 1JRYA 2C73A 2JAEA 2H88A 5KXJA 2Y6RA 3DJJA 4YT0A 4REKA 1TDEA 3RP8A 3SZ0A 1CJ2A 1CJCA 1H6VA 4CRTA 2A8XA 4K5SA 2X99A 2XLSA 3CN8A 3IHMA 1F6MA 4IVMB 3CMMA 4AOXA 1VDCA 2WU2A 5KMSA 4OVIA 1GPEA 4YTMA 1QO8A 1E39A 4G6HA 2FJBA 2WESA 4GF7A 3I6DA 2BC1A 3ALMA 4H4YA 5JCKA 2BS2A 5IQ1A 2C3CA 2VQBA 1O94A 4FDCB 5KVHA 4GDEA 4XWZA 4J2WA 1F8SA 4YXDA 3CPIG 4USRA 3GYIA 3H4KA 1AOGA 2ZBWA 4C3YA 5M10A 4B65A 1N4UA 2R45A 3AYJA 3K7QX 3UKPA 1VG9A 3HYWA 3LZWA 1H86A 4G74A 4WX1A 4EMIA 2C66A 3NKSA 4PAAA 4E0VA 3VRBA 4YSHA 3UP4A 2XVIA 3SZFA 1OJTA 2GMHA 2NPXA 1GRFA 2EQ8A 3NIXA 4BK3A 1DJQA 1GTEA 2BRYA 3CPHG 5TR3A 1OJAA 2YM1A 3COXA 2OA1A 5HXIA 1COYA 4G6GA 3DJEA 3KKJA 1H84A 2BCPA 4YSZA 1PBDA 4B68A 2HQMA 2WU5A 3P4QA 1IJHA 1EL8A 1K4QA 3UTEA 2WP9A 1H83A 2IVEA 3T0KA 2FBWA 3P4SA 4CY8A 5IQ4A 1B5QA 4ZN0A 1KNPA 2YG3A 4FX9A 4Y4NA 4X9NA 1CC2A 2WDVA 2WP5A 1JOAA 1GT8A 1GESA 4K22A 1GRBA 5C3JA 2GR1A 3ZYXA 1F3PA 4OCGA 3UKQA 1PS9A 4H4VA 4I59A 3RP7A 3VR9A 1E1NA 2XLRA 2XFQA 4RG4A 2JB1A 1NENA 4H4QA 4Z26A 2GAHB 2E4GA 4AOSA 4P9SA 4A9WA 1GRHA 2V3AA 1K0LA 4K2XA 3JSKA 2QA1A 2BRAA 4B69A 3REDA 3NYFA 2W0HA 4H50A 2C75A 1YQ4A 2TPRA 1XANA 3AEAA 2RGOA 2YLXA 3H8IA 3DK9A 2VOUA 2Q0KA 3CNJA 3AE1A 4IA6A 4H2NA 3UKKA 5KOXA 1VQWA 2OLNA 3GRTA 1IUSA 3K30A 2XLUA 1FECA 1Q1RA 3T2ZA 5LV9A 2R0GA 2WETA 3AE3A 3UP5A 1FEAA 1L9CA 3DA1A 2GEWA 2YWLA 3SY4A 1GALA 3F8DA 5JCIA 1N4VA 2WBAA 5FMHA 2APGA 4BK1A 5EB4A 1Y56B 4YSYA 4YSXA 4FK1C 1L9EA 1PBCA 2I0ZA 4J33A 2V6OA 1GREA 4UDRA 4OPLA 2YG5A 3NT6A 3T37A 2OALA 4EM4A 3F8PA 2J3NA 1Q1WA 4ZCDA 4A79A 1NG3A 4C3XA 3NYCA 2VZ2A 3SZWA 2YLRA 3AD7B 3GYJA 3V3OA 4NNJA 1BZLA 3RP6A 2VRMA 1JNRA 1JEHA 1Y56A 3AD8B 3AE2A 2JB3A 1E1MA 2BK4A 4YKFA 2R46A 3CGCA 3FMWA 1GOSA 4UDPA 1PJ6A 4C74A 2YLSA 5KMPA 4EQRA 4CY6A 1N1PA 3L8KA 1DOBA 2C4CA 2XVHA 4HB9A 3QVRA 1CJ3A 4DGKA 2C70A 4B1BA 1H82A 4YWOA 1NHRA 3ZDNA 4APNA 1O95A 2RGHA 1EL7A 3VRDB 1PBEA 3ATQA 1KNRA 1E1KA 1GRAA 3AEBA 4FK1A 4H4UA 3IC9A 1D5TA 4U8IA 2VRLA 3T31A 4M52A 1PN0A 1D4DA 2RGJA 2Y6QA 4JDRA 3ATRA 1P2HA 1H81A 2BACA 4MJWA 1K0IA 3FPZA 1IUUA 3L1RA 3OC4A 4H7UA 1DNCA 3LOVA 3DJDA 1RP0A 5FS8A 4EQXA 1S3EA 1UKVG 3NG7X 1Y0PA 4U8PA 2Q0LA 1NHQA 3BHKA 4ECHA 2F5ZA 5U1OA 3GYXA 3SGLA 2E1MA 4A99A 2WOIA 2GR0A 3NLCA 1H7XA 4IV9A 3G5QA 1CC6A 4JNAA 1CJ4A 2EQ6A 3BI4A 1JNZA 4BV6A 2YVJA 5KNLA 4AP3A 4GUVA 4B63A 1CF3A 1VRQB 2JB2A 2X8CA 4B66A 4U2SA 2YR5A 4CCQA 1FCDA 2ARDA 2EQ7A 1GV4A 1M6IA 1OJDA 4DSHA 1ELIA 3NYEA 1MO9A 3NK1X 2ACZA 4JNQA 2JK6A 4TM1A 2C76A 3CPJG 3GD3A 1FEBA 3EF6A 2E5VA 2Z5YA 4H2PA 3KPKA 1E1LA 3V76A 1ZK7A 1ZOVA 4DNAA 1ZMDA 3AE9A 2JBVA 3D1CA 2DKHA 3ISHA 4K7ZA 4O5UA 1TYTA 2GB0A 2BXSA 2WPFA 2GV8A 2R9ZA 2ZZCA 4X9MA 4UDQA 2GQFA 3NH3X 3GWFA 1L9DA 2VQ7A 3PO7A 1NAAA 1PXCA 3GMCA 4U8OA 3UTGA 1LTXR 3NNEA 4YKGA 3KLJA 4U8KA 1ZOYA 3QSSA 4ZCCA 2V60A 1KSSA 2WQYA 4NTEA 2VVMA 4U2TA 4CBQA 3NGCX 1S2QA 4IVOB 3HZLA 2C65A 4GRTA 2AAQA 1TRBA 3H8LA 4ADWA 1KFYA 2XYOA 3OZ2A 4YTPA 1EL9A 1ONFA 3G5SA 4Y4LA 1GTHA 2NVKX 4TLXA 1VG0A 2OLOA 3FIMB 3KD9A 5JCLA 2A87A 2GR2A 4Y4MA 5FS9A 4NTCA 1YQZA 3K7MX 2B9YA 3II4A 2B7RA 4IA5A 3DH9A 5KWFA 2GAGB 1P2EA 3AE4A 3GRSA 5HYMA 2R4JA 2GF3A 4B64A 3Q9TA 4WCTA 3AB1A 4OPCA 3P4RA 1SEZA 1E6EA 2GMJA 3QSMA 2BS4A 2VVLA 5HY5A 2QAEA 4I58A 4D03A 3DGHA 4H4XA 4U2LA 1PHHA 1S2YA 4TLZA 3M12A 2YLTA 1TYPA 1QJDA 4CNJA 3SXIA 3F8RA 2YG6A 4GAPA 3CTYA 4H2RA 2DKIA 3AEFA 2YQUA 3CNTA 1M64A 2AQJA 2Q6UA 4LIIA 5U63A 4H4RA 1W4XA 3SX6A 3UOYA 3PS9A 1HYUA 1JRXA
chains in the Genus database with same CATH topology
2GQWA 3AE5A 4Z25A 1O5WA 1NHSA 3B6DA 1ZDLA 3UOXA 2B9XA 3SZCA 2BABA 2ZZ0A 2WPEA 3PVCA 4U8NA 5U25A 3DJGX 3WE0A 3AEEA 4C77A 1PDHA 2B76A 1LQTA 2C67A 2O9ZA 4H4ZA 3UOZA 1PXBA 1BGNA 3RNMA 2WEUA 3CNSA 3KU9A 1GRGA 3CGDA 5BRTA 3I3LA 4Z44A 4J36A 2XFPA 5M0ZA 3LXDA 2YVGA 2X8HA 1KF6A 4J31A 1CBOA 2YM2A 2XFUA 4U8MA 4EIPA 3T2YA 1RYIA 3V3NA 1X31B 4HA6A 4G73A 4ICYA 4XXGA 1DJNA 1XHCA 3GMBA 3IWAA 4GR1A 1ZKQA 5KMQA 1EL5A 2C7GA 3QFBA 5IPYA 4J34A 5JCMA 4USQA 3EANA 3P4PA 3NTDA 1Z6LA 1PJ7A 3S5WA 3S61A 3QFAA 4PABA 2IIDA 3ITJA 1BGJA 1LJ1A 1FOHA 4U8LA 1FL2A 4NZHA 1D7YA 2BCGG 4OPUA 1CHUA 3Q6JA 2BA9A 4A6NB 3EPTA 1OJCA 1YY5A 3NK2X 3E1TA 1PBFA 3EAOA 3BNUA 2B7SA 3ALJA 3LADA 2XFNA 2BC0A 4C5OA 1B8SA 4A7AA 3AYIA 1RSGA 2XCGA 2UZZA 3SM8A 3AEDA 2YR6A 4NWZA 4NTDA 2V5ZA 5KMRA 3ABVA 5EBKA 4KPRA 4Z43A 5J60A 3VR8A 1JU2A 1PBBA 1D4EA 4U8JA 2EQ9A 3QSEA 4G9KA 5BUKA 5L46A 5FS7A 1ZY8A 4A6NA 3BNMA 4H4WA 5GSNA 4OPGA 2PYXA 3KA7A 4BURA 4JY3A 4KX6A 2YVFA 1IUVA 2R0CA 1QLBA 3QJ4A 3R9UA 1ZMCA 2X3NA 1K0JA 2YR4A 3IF9A 4II2A 3T14A 3ADAB 3GWDA 3RHAA 4EM3A 4Z2TA 5J7XA 3AWIA 4H4TA 4K5RA 2BXRA 2R4EA 2XVEA 1GRTA 2C64A 4DSGA 3B3RA 1OJ9A 1N4WA 2C72A 3ICRA 3FG2P 2BK5A 4N9XA 3UTHA 5KOWA 1DXLA 3DMEA 3NTAA 3BHFA 1XPQA 1KDGA 1E7PA 1TDFA 2V3BA 1PJ5A 3AECA 1F8RA 3NK0X 5DBJA 3O0HA 2H89A 1BKWA 3LZXA 4TM3A 3NN0X 3KPFA 2BK3A 3AYLA 3GDPA 3NHOX 1LPFA 1TDKA 2XVJA 3AE8A 4BJZA 1GXFA 2WOWA 3UCLA 2WPCA 2A89A 5CQFA 2Q7VA 2XLTA 1BWCA 2QA2A 5HHFA 4JY2A 3UKLA 2OAMA 3CNPA 4J57A 1XDIA 2IVDA 2GH5A 4BK2A 5ER0A 1DOEA 3LJPA 4EQWA 4LA1A 4TM4A 1GNDA 2WDRA 3GSIA 4H4PA 1B4VA 1NEKA 5C2TA 3NRNA 2V61A 2CFYA 1NG4A 4TM0A 3ICTA 3UKHA 4EMJA 4K8DA 1LVLA 4NEVA 2GR3A 2XDOA 4B67A 4CCRA 3NN6X 5EOWA 1IUXA 3SFDA 1LQUA 1CL0A 3SQPA 3SYIA 2GVCA 4OPTA 5FS6A 3GD4A 5BULA 1YKJA 5BVAA 1MXTA 3AD9B 3T2KA 1GETA 1EBDA 3QVPA 3C4NA 4II3A 1IUTA 2WHDA 3KVEA 1D7LA 2XVFA 3BI2A 1D4CA 3FBSA 2XFOA 4Z24A 1DOCA 3CNDA 1H7WA 1LV0A 2CVJA 1YQ3A 3URHA 3P9UA 5KRQA 3M0OA 2C3DA 1Q9IA 2X50A 4RG3A 1GERA 3UOVA 4Z2UA 4OPIA 3AE6A 4GDPA 4GCMA 4JN9A 1B37A 3BI5A 3CGEA 3CIRA 1PXAA 2X8GA 4EIQA 3G5RA 2PHHA 2RABA 2TMDA 3HYVA 4UP3A 1MOKA 3D8XA 1NDAA 1REOA 3C4AA 4AP1A 5EB5A 2YG7A 1TDOA 5GRTA 3HYXA 1BF3A 2BS3A 2GRTA 2CDUA 2ZZBA 4CNKA 1ZX9A 2CULA 2YG4A 1NHPA 3DK8A 2JKCA 3ALLA 1V59A 1F8WA 3P1WA 3K7TA 2QCUA 4BJYA 4D04A 2WOVA 2WS3A 1CC4A 2XLPA 2WP6A 3CGBA 3AE7A 4H2QA 3M13A 1GEUA 3LB8A 3AXBA 2YAUA 4LU6A 2YLWA 4YTNA 2FJDA 5JCNA 1GSNA 2R0PA 4GAVA 3UKFA 1IUWA 2BYBA 3VRAA 1JRZA 4A65A 2YLZA 5CKUA 4A5LA 1ZP0A 4JQ9A 4EMWA 4OPDA 4X4JA 3AEGA 4EQSA 2WDQA 4O5QA 4RSLA 1KSUA 1NPXA 3IHGA 4AT2A 3UKAA 3VQRA 4Z2RA 1S3BA 4J56A 2VVLG 3DK4A 2FJEA 3UTFA 3ICSA 3SFEA 3DGZA 3C96A 3GDNA 2FJAA 5KVIA 1L0VA 2AR8A 4XWRA 1DODA 2B9WA 4NEWA 1TDNA 4AT0A 4H4SA 2Z5XA 1JRYA 2C73A 2JAEA 2H88A 5KXJA 2Y6RA 3DJJA 4YT0A 4REKA 1TDEA 3RP8A 3SZ0A 1CJ2A 1CJCA 1H6VA 4CRTA 2A8XA 4K5SA 2X99A 2XLSA 3CN8A 3IHMA 1F6MA 4IVMB 3CMMA 4AOXA 1VDCA 2WU2A 5KMSA 4OVIA 1GPEA 4YTMA 1QO8A 1E39A 4G6HA 2FJBA 2WESA 4GF7A 3I6DA 2BC1A 3ALMA 4H4YA 5JCKA 2BS2A 5IQ1A 2C3CA 2VQBA 1O94A 4FDCB 5KVHA 4GDEA 4XWZA 4J2WA 1F8SA 4YXDA 3CPIG 4USRA 3GYIA 3H4KA 1AOGA 2ZBWA 4C3YA 5M10A 4B65A 1N4UA 2R45A 3AYJA 3K7QX 3UKPA 1VG9A 3HYWA 3LZWA 1H86A 4G74A 4WX1A 4EMIA 2C66A 3NKSA 4PAAA 4E0VA 3VRBA 4YSHA 3UP4A 2XVIA 3SZFA 1OJTA 2GMHA 2NPXA 1GRFA 2EQ8A 3NIXA 4BK3A 1DJQA 1GTEA 2BRYA 3CPHG 5TR3A 1OJAA 2YM1A 3COXA 2OA1A 5HXIA 1COYA 4G6GA 3DJEA 3KKJA 1H84A 2BCPA 4YSZA 1PBDA 4B68A 2HQMA 2WU5A 3P4QA 1IJHA 1EL8A 1K4QA 3UTEA 2WP9A 1H83A 2IVEA 3T0KA 2FBWA 3P4SA 4CY8A 5IQ4A 1B5QA 4ZN0A 1KNPA 2YG3A 4FX9A 4Y4NA 4X9NA 1CC2A 2WDVA 2WP5A 1JOAA 1GT8A 1GESA 4K22A 1GRBA 5C3JA 2GR1A 3ZYXA 1F3PA 4OCGA 3UKQA 1PS9A 4H4VA 4I59A 3RP7A 3VR9A 1E1NA 2XLRA 2XFQA 4RG4A 2JB1A 1NENA 4H4QA 4Z26A 2GAHB 2E4GA 4AOSA 4P9SA 4A9WA 1GRHA 2V3AA 1K0LA 4K2XA 3JSKA 2QA1A 2BRAA 4B69A 3REDA 3NYFA 2W0HA 4H50A 2C75A 1YQ4A 2TPRA 1XANA 3AEAA 2RGOA 2YLXA 3H8IA 3DK9A 2VOUA 2Q0KA 3CNJA 3AE1A 4IA6A 4H2NA 3UKKA 5KOXA 1VQWA 2OLNA 3GRTA 1IUSA 3K30A 2XLUA 1FECA 1Q1RA 3T2ZA 5LV9A 2R0GA 2WETA 3AE3A 3UP5A 1FEAA 1L9CA 3DA1A 2GEWA 2YWLA 3SY4A 1GALA 3F8DA 5JCIA 1N4VA 2WBAA 5FMHA 2APGA 4BK1A 5EB4A 1Y56B 4YSYA 4YSXA 4FK1C 1L9EA 1PBCA 2I0ZA 4J33A 2V6OA 1GREA 4UDRA 4OPLA 2YG5A 3NT6A 3T37A 2OALA 4EM4A 3F8PA 2J3NA 1Q1WA 4ZCDA 4A79A 1NG3A 4C3XA 3NYCA 2VZ2A 3SZWA 2YLRA 3AD7B 3GYJA 3V3OA 4NNJA 1BZLA 3RP6A 2VRMA 1JNRA 1JEHA 1Y56A 3AD8B 3AE2A 2JB3A 1E1MA 2BK4A 4YKFA 2R46A 3CGCA 3FMWA 1GOSA 4UDPA 1PJ6A 4C74A 2YLSA 5KMPA 4EQRA 4CY6A 1N1PA 3L8KA 1DOBA 2C4CA 2XVHA 4HB9A 3QVRA 1CJ3A 4DGKA 2C70A 4B1BA 1H82A 4YWOA 1NHRA 3ZDNA 4APNA 1O95A 2RGHA 1EL7A 3VRDB 1PBEA 3ATQA 1KNRA 1E1KA 1GRAA 3AEBA 4FK1A 4H4UA 3IC9A 1D5TA 4U8IA 2VRLA 3T31A 4M52A 1PN0A 1D4DA 2RGJA 2Y6QA 4JDRA 3ATRA 1P2HA 1H81A 2BACA 4MJWA 1K0IA 3FPZA 1IUUA 3L1RA 3OC4A 4H7UA 1DNCA 3LOVA 3DJDA 1RP0A 5FS8A 4EQXA 1S3EA 1UKVG 3NG7X 1Y0PA 4U8PA 2Q0LA 1NHQA 3BHKA 4ECHA 2F5ZA 5U1OA 3GYXA 3SGLA 2E1MA 4A99A 2WOIA 2GR0A 3NLCA 1H7XA 4IV9A 3G5QA 1CC6A 4JNAA 1CJ4A 2EQ6A 3BI4A 1JNZA 4BV6A 2YVJA 5KNLA 4AP3A 4GUVA 4B63A 1CF3A 1VRQB 2JB2A 2X8CA 4B66A 4U2SA 2YR5A 4CCQA 1FCDA 2ARDA 2EQ7A 1GV4A 1M6IA 1OJDA 4DSHA 1ELIA 3NYEA 1MO9A 3NK1X 2ACZA 4JNQA 2JK6A 4TM1A 2C76A 3CPJG 3GD3A 1FEBA 3EF6A 2E5VA 2Z5YA 4H2PA 3KPKA 1E1LA 3V76A 1ZK7A 1ZOVA 4DNAA 1ZMDA 3AE9A 2JBVA 3D1CA 2DKHA 3ISHA 4K7ZA 4O5UA 1TYTA 2GB0A 2BXSA 2WPFA 2GV8A 2R9ZA 2ZZCA 4X9MA 4UDQA 2GQFA 3NH3X 3GWFA 1L9DA 2VQ7A 3PO7A 1NAAA 1PXCA 3GMCA 4U8OA 3UTGA 1LTXR 3NNEA 4YKGA 3KLJA 4U8KA 1ZOYA 3QSSA 4ZCCA 2V60A 1KSSA 2WQYA 4NTEA 2VVMA 4U2TA 4CBQA 3NGCX 1S2QA 4IVOB 3HZLA 2C65A 4GRTA 2AAQA 1TRBA 3H8LA 4ADWA 1KFYA 2XYOA 3OZ2A 4YTPA 1EL9A 1ONFA 3G5SA 4Y4LA 1GTHA 2NVKX 4TLXA 1VG0A 2OLOA 3FIMB 3KD9A 5JCLA 2A87A 2GR2A 4Y4MA 5FS9A 4NTCA 1YQZA 3K7MX 2B9YA 3II4A 2B7RA 4IA5A 3DH9A 5KWFA 2GAGB 1P2EA 3AE4A 3GRSA 5HYMA 2R4JA 2GF3A 4B64A 3Q9TA 4WCTA 3AB1A 4OPCA 3P4RA 1SEZA 1E6EA 2GMJA 3QSMA 2BS4A 2VVLA 5HY5A 2QAEA 4I58A 4D03A 3DGHA 4H4XA 4U2LA 1PHHA 1S2YA 4TLZA 3M12A 2YLTA 1TYPA 1QJDA 4CNJA 3SXIA 3F8RA 2YG6A 4GAPA 3CTYA 4H2RA 2DKIA 3AEFA 2YQUA 3CNTA 1M64A 2AQJA 2Q6UA 4LIIA 5U63A 4H4RA 1W4XA 3SX6A 3UOYA 3PS9A 1HYUA 1JRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQW A;  3AE5 A;  4Z25 A;  1O5W A;  1NHS A;  3B6D A;  1ZDL A;  3UOX A;  2B9X A;  2BAB A;  2ZZ0 A;  2WPE A;  3PVC A;  4U8N A;  5U25 A;  3DJG X;  3WE0 A;  3AEE A;  4C77 A;  1PDH A;  2B76 A;  1LQT A;  2C67 A;  2O9Z A;  4H4Z A;  3UOZ A;  1PXB A;  1BGN A;  3RNM A;  2WEU A;  3CNS A;  3KU9 A;  1GRG A;  3CGD A;  5BRT A;  3I3L A;  4Z44 A;  4J36 A;  2XFP A;  5M0Z A;  3LXD A;  2YVG A;  2X8H A;  1KF6 A;  4J31 A;  1CBO A;  2YM2 A;  2XFU A;  4U8M A;  4EIP A;  4EM4 A;  1RYI A;  3V3N A;  1X31 B;  4HA6 A;  4ICY A;  4XXG A;  1DJN A;  1XHC A;  3GMB A;  3IWA A;  4GR1 A;  1ZKQ A;  1EL5 A;  2C7G A;  3QFB A;  5IPY A;  4J34 A;  5JCM A;  4USQ A;  3EAN A;  3P4P A;  3NTD A;  1Z6L A;  1PJ7 A;  3S5W A;  3S61 A;  3QFA A;  4PAB A;  2IID A;  3ITJ A;  1BGJ A;  1LJ1 A;  1FOH A;  4U8L A;  1FL2 A;  4NZH A;  1D7Y A;  2BCG G;  4OPU A;  1CHU A;  3Q6J A;  2BA9 A;  4A6N B;  3EPT A;  1OJC A;  1YY5 A;  3NK2 X;  3E1T A;  1PBF A;  3EAO A;  3BNU A;  2B7S A;  3ALJ A;  3LAD A;  2XFN A;  2BC0 A;  4C5O A;  1B8S A;  4A7A A;  3AYI A;  1RSG A;  2XCG A;  2UZZ A;  3SM8 A;  3AED A;  2YR6 A;  4NTD A;  2V5Z A;  3ABV A;  5EBK A;  4KPR A;  4Z43 A;  5J60 A;  3VR8 A;  1JU2 A;  1PBB A;  1D4E A;  4U8J A;  2EQ9 A;  3QSE A;  5BUK A;  5L46 A;  5FS7 A;  1ZY8 A;  4A6N A;  3BNM A;  4H4W A;  5GSN A;  4OPG A;  2PYX A;  3KA7 A;  4BUR A;  4JY3 A;  4KX6 A;  2YVF A;  1IUV A;  2R0C A;  1QLB A;  3QJ4 A;  3R9U A;  1ZMC A;  2X3N A;  1K0J A;  2YR4 A;  3IF9 A;  3ADA B;  3GWD A;  3RHA A;  4EM3 A;  4Z2T A;  5J7X A;  3AWI A;  4H4T A;  4K5R A;  2BXR A;  2R4E A;  2XVE A;  1GRT A;  2C64 A;  4DSG A;  3B3R A;  1OJ9 A;  1N4W A;  2C72 A;  3ICR A;  3FG2 P;  2BK5 A;  4N9X A;  3UTH A;  5KOW A;  1DXL A;  3DME A;  3NTA A;  3BHF A;  1XPQ A;  1KDG A;  1E7P A;  1TDF A;  2V3B A;  1PJ5 A;  3AEC A;  1F8R A;  3NK0 X;  5DBJ A;  3O0H A;  2H89 A;  1BKW A;  3LZX A;  4TM3 A;  3NN0 X;  3KPF A;  2BK3 A;  3AYL A;  3GDP A;  3NHO X;  1LPF A;  1TDK A;  2XVJ A;  3AE8 A;  4BJZ A;  1GXF A;  2WOW A;  3UCL A;  2WPC A;  2A89 A;  5CQF A;  2Q7V A;  2XLT A;  1BWC A;  2QA2 A;  5HHF A;  4JY2 A;  3UKL A;  2OAM A;  3CNP A;  4J57 A;  1XDI A;  2IVD A;  2GH5 A;  4BK2 A;  5ER0 A;  1DOE A;  3LJP A;  4EQW A;  4LA1 A;  4TM4 A;  1GND A;  2WDR A;  3GSI A;  4H4P A;  1B4V A;  1NEK A;  5C2T A;  3NRN A;  2V61 A;  2CFY A;  1NG4 A;  4TM0 A;  3ICT A;  3UKH A;  4EMJ A;  4K8D A;  1LVL A;  4NEV A;  2GR3 A;  2XDO A;  4B67 A;  4CCR A;  3NN6 X;  5EOW A;  1IUX A;  3SFD A;  1LQU A;  1CL0 A;  3SQP A;  2GVC A;  4OPT A;  5FS6 A;  3GD4 A;  5BUL A;  1YKJ A;  5BVA A;  1MXT A;  3AD9 B;  1GET A;  1EBD A;  3QVP A;  3C4N A;  1IUT A;  2WHD A;  3KVE A;  1D7L A;  2XVF A;  3BI2 A;  1D4C A;  3FBS A;  2XFO A;  4Z24 A;  1DOC A;  3CND A;  1H7W A;  1LV0 A;  2CVJ A;  1YQ3 A;  3URH A;  3P9U A;  5KRQ A;  3M0O A;  2C3D A;  1Q9I A;  2X50 A;  4RG3 A;  1GER A;  3UOV A;  4Z2U A;  4OPI A;  3AE6 A;  4GDP A;  4GCM A;  4JN9 A;  1B37 A;  3BI5 A;  3CGE A;  3CIR A;  1PXA A;  2X8G A;  4EIQ A;  3G5R A;  2PHH A;  2RAB A;  2TMD A;  4UP3 A;  1MOK A;  3D8X A;  1NDA A;  1REO A;  3C4A A;  4AP1 A;  5EB5 A;  2YG7 A;  1TDO A;  5GRT A;  1BF3 A;  2BS3 A;  2GRT A;  2CDU A;  2ZZB A;  4CNK A;  1ZX9 A;  2CUL A;  2YG4 A;  1NHP A;  3DK8 A;  2JKC A;  3ALL A;  1V59 A;  1F8W A;  3P1W A;  3K7T A;  2QCU A;  4BJY A;  4D04 A;  2WOV A;  2WS3 A;  1CC4 A;  2XLP A;  2WP6 A;  3CGB A;  3AE7 A;  4H2Q A;  3M13 A;  1GEU A;  3LB8 A;  3AXB A;  2YAU A;  4LU6 A;  2YLW A;  4YTN A;  2FJD A;  5JCN A;  1GSN A;  2R0P A;  3VRA A;  3UKF A;  1IUW A;  2BYB A;  1JRZ A;  4A65 A;  2YLZ A;  5CKU A;  4A5L A;  1ZP0 A;  4JQ9 A;  4EMW A;  4OPD A;  4X4J A;  3AEG A;  4EQS A;  2WDQ A;  4O5Q A;  4RSL A;  1KSU A;  1NPX A;  3IHG A;  4AT2 A;  3UKA A;  3VQR A;  4Z2R A;  1S3B A;  4J56 A;  2VVL G;  3DK4 A;  2FJE A;  3UTF A;  3ICS A;  3SFE A;  3DGZ A;  3C96 A;  3GDN A;  2FJA A;  5KVI A;  1L0V A;  2AR8 A;  4XWR A;  1DOD A;  2B9W A;  4NEW A;  1TDN A;  4AT0 A;  4H4S A;  2Z5X A;  1JRY A;  2C73 A;  2JAE A;  2H88 A;  5KXJ A;  2Y6R A;  3DJJ A;  4YT0 A;  4REK A;  1TDE A;  3RP8 A;  1CJ2 A;  1CJC A;  1H6V A;  4CRT A;  2A8X A;  4K5S A;  2X99 A;  2XLS A;  3CN8 A;  3IHM A;  1F6M A;  4IVM B;  4AOX A;  1VDC A;  2WU2 A;  4OVI A;  1GPE A;  4YTM A;  1QO8 A;  1E39 A;  2FJB A;  2WES A;  4GF7 A;  3I6D A;  2BC1 A;  3ALM A;  4H4Y A;  5JCK A;  2BS2 A;  5IQ1 A;  2C3C A;  2VQB A;  1O94 A;  4FDC B;  5KVH A;  4GDE A;  4XWZ A;  4J2W A;  1F8S A;  4YXD A;  3CPI G;  4USR A;  3GYI A;  3H4K A;  1AOG A;  2ZBW A;  4C3Y A;  5M10 A;  4B65 A;  1N4U A;  2R45 A;  3AYJ A;  3K7Q X;  3UKP A;  1VG9 A;  3LZW A;  1H86 A;  4WX1 A;  4EMI A;  2C66 A;  3NKS A;  4PAA A;  4E0V A;  3VRB A;  4YSH A;  3UP4 A;  2XVI A;  1OJT A;  2GMH A;  2NPX A;  1GRF A;  2EQ8 A;  3NIX A;  4BK3 A;  1DJQ A;  1GTE A;  3CPH G;  5HXI A;  5TR3 A;  1OJA A;  2YM1 A;  3COX A;  2OA1 A;  1COY A;  3DJE A;  3KKJ A;  1H84 A;  2BCP A;  4YSZ A;  1PBD A;  4B68 A;  2HQM A;  2WU5 A;  3P4Q A;  1IJH A;  1EL8 A;  1K4Q A;  3UTE A;  2WP9 A;  1H83 A;  2IVE A;  2FBW A;  3P4S A;  4CY8 A;  5IQ4 A;  1B5Q A;  4ZN0 A;  1KNP A;  2YG3 A;  4FX9 A;  4Y4N A;  4X9N A;  1CC2 A;  2WDV A;  2WP5 A;  1JOA A;  1GT8 A;  1GES A;  4K22 A;  1GRB A;  5C3J A;  2GR1 A;  3ZYX A;  1F3P A;  4OCG A;  3UKQ A;  1PS9 A;  4H4V A;  4I59 A;  3RP7 A;  3VR9 A;  1E1N A;  2XLR A;  2XFQ A;  4RG4 A;  2JB1 A;  1NEN A;  4H4Q A;  4Z26 A;  2GAH B;  2E4G A;  4AOS A;  4P9S A;  4A9W A;  1GRH A;  2V3A A;  1K0L A;  4K2X A;  3JSK A;  2QA1 A;  4B69 A;  3RED A;  3NYF A;  2W0H A;  4H50 A;  2C75 A;  1YQ4 A;  2TPR A;  1XAN A;  3AEA A;  2RGO A;  2YLX A;  3H8I A;  3DK9 A;  2VOU A;  2Q0K A;  3CNJ A;  3AE1 A;  4IA6 A;  4H2N A;  3UKK A;  5KOX A;  1VQW A;  2OLN A;  3GRT A;  1IUS A;  3K30 A;  2XLU A;  1FEC A;  1Q1R A;  5LV9 A;  2R0G A;  2WET A;  3AE3 A;  3UP5 A;  1FEA A;  1L9C A;  3DA1 A;  2GEW A;  2YWL A;  1GAL A;  3F8D A;  5JCI A;  1N4V A;  2WBA A;  5FMH A;  2APG A;  4BK1 A;  5EB4 A;  1Y56 B;  4YSY A;  4YSX A;  4FK1 C;  1L9E A;  1PBC A;  2I0Z A;  4J33 A;  2V6O A;  1GRE A;  4UDR A;  4OPL A;  2YG5 A;  3NT6 A;  3T37 A;  2OAL A;  3F8P A;  2J3N A;  1Q1W A;  4ZCD A;  4A79 A;  1NG3 A;  4C3X A;  3NYC A;  2VZ2 A;  2YLR A;  3AD7 B;  3GYJ A;  3V3O A;  1BZL A;  3RP6 A;  2VRM A;  1JNR A;  1JEH A;  1Y56 A;  3AD8 B;  3AE2 A;  2JB3 A;  1E1M A;  2BK4 A;  4YKF A;  2R46 A;  3CGC A;  3FMW A;  1GOS A;  4UDP A;  1PJ6 A;  4C74 A;  2YLS A;  4EQR A;  4CY6 A;  1N1P A;  3L8K A;  1DOB A;  4HB9 A;  2XVH A;  3QVR A;  1CJ3 A;  4DGK A;  2C70 A;  4B1B A;  1H82 A;  4YWO A;  1NHR A;  3ZDN A;  4APN A;  1O95 A;  2RGH A;  1EL7 A;  3VRD B;  1PBE A;  3ATQ A;  1KNR A;  1E1K A;  1GRA A;  3AEB A;  4FK1 A;  4H4U A;  3IC9 A;  1D5T A;  4U8I A;  2VRL A;  4M52 A;  1PN0 A;  1D4D A;  2RGJ A;  2Y6Q A;  4JDR A;  3ATR A;  1P2H A;  1H81 A;  2BAC A;  4MJW A;  1K0I A;  3FPZ A;  1IUU A;  3L1R A;  3OC4 A;  4H7U A;  1DNC A;  3LOV A;  3DJD A;  1RP0 A;  5FS8 A;  4EQX A;  1S3E A;  1UKV G;  3NG7 X;  1Y0P A;  4U8P A;  2Q0L A;  1NHQ A;  3BHK A;  4ECH A;  2F5Z A;  5U1O A;  3SGL A;  2E1M A;  4A99 A;  2WOI A;  2GR0 A;  3NLC A;  1H7X A;  4IV9 A;  3G5Q A;  1CC6 A;  4JNA A;  1CJ4 A;  2EQ6 A;  3BI4 A;  1JNZ A;  4BV6 A;  2YVJ A;  4AP3 A;  4GUV A;  4B63 A;  1CF3 A;  1VRQ B;  2JB2 A;  2X8C A;  4B66 A;  4U2S A;  2YR5 A;  4CCQ A;  1FCD A;  2ARD A;  2EQ7 A;  1GV4 A;  1M6I A;  1OJD A;  4DSH A;  1ELI A;  3NYE A;  1MO9 A;  3NK1 X;  2ACZ A;  4JNQ A;  2JK6 A;  4TM1 A;  2C76 A;  3CPJ G;  3GD3 A;  1FEB A;  3EF6 A;  2E5V A;  2Z5Y A;  4H2P A;  1E1L A;  3V76 A;  1ZK7 A;  1ZOV A;  4DNA A;  1ZMD A;  3AE9 A;  2JBV A;  3D1C A;  2DKH A;  3ISH A;  4K7Z A;  4O5U A;  1TYT A;  2GB0 A;  2BXS A;  2WPF A;  2GV8 A;  2R9Z A;  2ZZC A;  4X9M A;  4UDQ A;  2GQF A;  3NH3 X;  3GWF A;  1L9D A;  2VQ7 A;  3PO7 A;  1NAA A;  1PXC A;  3GMC A;  4U8O A;  3UTG A;  1LTX R;  3NNE A;  4YKG A;  3KLJ A;  4U8K A;  1ZOY A;  3QSS A;  4ZCC A;  2V60 A;  1KSS A;  2WQY A;  4NTE A;  2VVM A;  4U2T A;  4CBQ A;  3NGC X;  1S2Q A;  4IVO B;  3HZL A;  2C65 A;  4GRT A;  2AAQ A;  1TRB A;  3H8L A;  4ADW A;  1KFY A;  2XYO A;  3OZ2 A;  4YTP A;  1EL9 A;  1ONF A;  3G5S A;  4Y4L A;  1GTH A;  2NVK X;  4TLX A;  1VG0 A;  2OLO A;  3FIM B;  3KD9 A;  5JCL A;  2A87 A;  2GR2 A;  4Y4M A;  5FS9 A;  4NTC A;  1YQZ A;  3K7M X;  2B9Y A;  3II4 A;  2B7R A;  4IA5 A;  3DH9 A;  5KWF A;  2GAG B;  1P2E A;  3AE4 A;  3GRS A;  5HYM A;  2R4J A;  2GF3 A;  4B64 A;  3Q9T A;  4WCT A;  3AB1 A;  4OPC A;  3P4R A;  1SEZ A;  1E6E A;  2GMJ A;  3QSM A;  2BS4 A;  2VVL A;  5HY5 A;  2QAE A;  4I58 A;  4D03 A;  3DGH A;  4H4X A;  4U2L A;  1PHH A;  1S2Y A;  4TLZ A;  3M12 A;  2YLT A;  1TYP A;  1QJD A;  4CNJ A;  3F8R A;  2YG6 A;  3CTY A;  4H2R A;  2DKI A;  3AEF A;  2YQU A;  3CNT A;  1M64 A;  2AQJ A;  2Q6U A;  4LII A;  5U63 A;  4H4R A;  1W4X A;  3UOY A;  3PS9 A;  1HYU A;  1JRX A; 
#chains in the Genus database with same CATH topology
 2GQW A;  3AE5 A;  4Z25 A;  1O5W A;  1NHS A;  3B6D A;  1ZDL A;  3UOX A;  2B9X A;  3SZC A;  2BAB A;  2ZZ0 A;  2WPE A;  3PVC A;  4U8N A;  5U25 A;  3DJG X;  3WE0 A;  3AEE A;  4C77 A;  1PDH A;  2B76 A;  1LQT A;  2C67 A;  2O9Z A;  4H4Z A;  3UOZ A;  1PXB A;  1BGN A;  3RNM A;  2WEU A;  3CNS A;  3KU9 A;  1GRG A;  3CGD A;  5BRT A;  3I3L A;  4Z44 A;  4J36 A;  2XFP A;  5M0Z A;  3LXD A;  2YVG A;  2X8H A;  1KF6 A;  4J31 A;  1CBO A;  2YM2 A;  2XFU A;  4U8M A;  4EIP A;  3T2Y A;  1RYI A;  3V3N A;  1X31 B;  4HA6 A;  4G73 A;  4ICY A;  4XXG A;  1DJN A;  1XHC A;  3GMB A;  3IWA A;  4GR1 A;  1ZKQ A;  5KMQ A;  1EL5 A;  2C7G A;  3QFB A;  5IPY A;  4J34 A;  5JCM A;  4USQ A;  3EAN A;  3P4P A;  3NTD A;  1Z6L A;  1PJ7 A;  3S5W A;  3S61 A;  3QFA A;  4PAB A;  2IID A;  3ITJ A;  1BGJ A;  1LJ1 A;  1FOH A;  4U8L A;  1FL2 A;  4NZH A;  1D7Y A;  2BCG G;  4OPU A;  1CHU A;  3Q6J A;  2BA9 A;  4A6N B;  3EPT A;  1OJC A;  1YY5 A;  3NK2 X;  3E1T A;  1PBF A;  3EAO A;  3BNU A;  2B7S A;  3ALJ A;  3LAD A;  2XFN A;  2BC0 A;  4C5O A;  1B8S A;  4A7A A;  3AYI A;  1RSG A;  2XCG A;  2UZZ A;  3SM8 A;  3AED A;  2YR6 A;  4NWZ A;  4NTD A;  2V5Z A;  5KMR A;  3ABV A;  5EBK A;  4KPR A;  4Z43 A;  5J60 A;  3VR8 A;  1JU2 A;  1PBB A;  1D4E A;  4U8J A;  2EQ9 A;  3QSE A;  4G9K A;  5BUK A;  5L46 A;  5FS7 A;  1ZY8 A;  4A6N A;  3BNM A;  4H4W A;  5GSN A;  4OPG A;  2PYX A;  3KA7 A;  4BUR A;  4JY3 A;  4KX6 A;  2YVF A;  1IUV A;  2R0C A;  1QLB A;  3QJ4 A;  3R9U A;  1ZMC A;  2X3N A;  1K0J A;  2YR4 A;  3IF9 A;  4II2 A;  3T14 A;  3ADA B;  3GWD A;  3RHA A;  4EM3 A;  4Z2T A;  5J7X A;  3AWI A;  4H4T A;  4K5R A;  2BXR A;  2R4E A;  2XVE A;  1GRT A;  2C64 A;  4DSG A;  3B3R A;  1OJ9 A;  1N4W A;  2C72 A;  3ICR A;  3FG2 P;  2BK5 A;  4N9X A;  3UTH A;  5KOW A;  1DXL A;  3DME A;  3NTA A;  3BHF A;  1XPQ A;  1KDG A;  1E7P A;  1TDF A;  2V3B A;  1PJ5 A;  3AEC A;  1F8R A;  3NK0 X;  5DBJ A;  3O0H A;  2H89 A;  1BKW A;  3LZX A;  4TM3 A;  3NN0 X;  3KPF A;  2BK3 A;  3AYL A;  3GDP A;  3NHO X;  1LPF A;  1TDK A;  2XVJ A;  3AE8 A;  4BJZ A;  1GXF A;  2WOW A;  3UCL A;  2WPC A;  2A89 A;  5CQF A;  2Q7V A;  2XLT A;  1BWC A;  2QA2 A;  5HHF A;  4JY2 A;  3UKL A;  2OAM A;  3CNP A;  4J57 A;  1XDI A;  2IVD A;  2GH5 A;  4BK2 A;  5ER0 A;  1DOE A;  3LJP A;  4EQW A;  4LA1 A;  4TM4 A;  1GND A;  2WDR A;  3GSI A;  4H4P A;  1B4V A;  1NEK A;  5C2T A;  3NRN A;  2V61 A;  2CFY A;  1NG4 A;  4TM0 A;  3ICT A;  3UKH A;  4EMJ A;  4K8D A;  1LVL A;  4NEV A;  2GR3 A;  2XDO A;  4B67 A;  4CCR A;  3NN6 X;  5EOW A;  1IUX A;  3SFD A;  1LQU A;  1CL0 A;  3SQP A;  3SYI A;  2GVC A;  4OPT A;  5FS6 A;  3GD4 A;  5BUL A;  1YKJ A;  5BVA A;  1MXT A;  3AD9 B;  3T2K A;  1GET A;  1EBD A;  3QVP A;  3C4N A;  4II3 A;  1IUT A;  2WHD A;  3KVE A;  1D7L A;  2XVF A;  3BI2 A;  1D4C A;  3FBS A;  2XFO A;  4Z24 A;  1DOC A;  3CND A;  1H7W A;  1LV0 A;  2CVJ A;  1YQ3 A;  3URH A;  3P9U A;  5KRQ A;  3M0O A;  2C3D A;  1Q9I A;  2X50 A;  4RG3 A;  1GER A;  3UOV A;  4Z2U A;  4OPI A;  3AE6 A;  4GDP A;  4GCM A;  4JN9 A;  1B37 A;  3BI5 A;  3CGE A;  3CIR A;  1PXA A;  2X8G A;  4EIQ A;  3G5R A;  2PHH A;  2RAB A;  2TMD A;  3HYV A;  4UP3 A;  1MOK A;  3D8X A;  1NDA A;  1REO A;  3C4A A;  4AP1 A;  5EB5 A;  2YG7 A;  1TDO A;  5GRT A;  3HYX A;  1BF3 A;  2BS3 A;  2GRT A;  2CDU A;  2ZZB A;  4CNK A;  1ZX9 A;  2CUL A;  2YG4 A;  1NHP A;  3DK8 A;  2JKC A;  3ALL A;  1V59 A;  1F8W A;  3P1W A;  3K7T A;  2QCU A;  4BJY A;  4D04 A;  2WOV A;  2WS3 A;  1CC4 A;  2XLP A;  2WP6 A;  3CGB A;  3AE7 A;  4H2Q A;  3M13 A;  1GEU A;  3LB8 A;  3AXB A;  2YAU A;  4LU6 A;  2YLW A;  4YTN A;  2FJD A;  5JCN A;  1GSN A;  2R0P A;  4GAV A;  3UKF A;  1IUW A;  2BYB A;  3VRA A;  1JRZ A;  4A65 A;  2YLZ A;  5CKU A;  4A5L A;  1ZP0 A;  4JQ9 A;  4EMW A;  4OPD A;  4X4J A;  3AEG A;  4EQS A;  2WDQ A;  4O5Q A;  4RSL A;  1KSU A;  1NPX A;  3IHG A;  4AT2 A;  3UKA A;  3VQR A;  4Z2R A;  1S3B A;  4J56 A;  2VVL G;  3DK4 A;  2FJE A;  3UTF A;  3ICS A;  3SFE A;  3DGZ A;  3C96 A;  3GDN A;  2FJA A;  5KVI A;  1L0V A;  2AR8 A;  4XWR A;  1DOD A;  2B9W A;  4NEW A;  1TDN A;  4AT0 A;  4H4S A;  2Z5X A;  1JRY A;  2C73 A;  2JAE A;  2H88 A;  5KXJ A;  2Y6R A;  3DJJ A;  4YT0 A;  4REK A;  1TDE A;  3RP8 A;  3SZ0 A;  1CJ2 A;  1CJC A;  1H6V A;  4CRT A;  2A8X A;  4K5S A;  2X99 A;  2XLS A;  3CN8 A;  3IHM A;  1F6M A;  4IVM B;  3CMM A;  4AOX A;  1VDC A;  2WU2 A;  5KMS A;  4OVI A;  1GPE A;  4YTM A;  1QO8 A;  1E39 A;  4G6H A;  2FJB A;  2WES A;  4GF7 A;  3I6D A;  2BC1 A;  3ALM A;  4H4Y A;  5JCK A;  2BS2 A;  5IQ1 A;  2C3C A;  2VQB A;  1O94 A;  4FDC B;  5KVH A;  4GDE A;  4XWZ A;  4J2W A;  1F8S A;  4YXD A;  3CPI G;  4USR A;  3GYI A;  3H4K A;  1AOG A;  2ZBW A;  4C3Y A;  5M10 A;  4B65 A;  1N4U A;  2R45 A;  3AYJ A;  3K7Q X;  3UKP A;  1VG9 A;  3HYW A;  3LZW A;  1H86 A;  4G74 A;  4WX1 A;  4EMI A;  2C66 A;  3NKS A;  4PAA A;  4E0V A;  3VRB A;  4YSH A;  3UP4 A;  2XVI A;  3SZF A;  1OJT A;  2GMH A;  2NPX A;  1GRF A;  2EQ8 A;  3NIX A;  4BK3 A;  1DJQ A;  1GTE A;  2BRY A;  3CPH G;  5TR3 A;  1OJA A;  2YM1 A;  3COX A;  2OA1 A;  5HXI A;  1COY A;  4G6G A;  3DJE A;  3KKJ A;  1H84 A;  2BCP A;  4YSZ A;  1PBD A;  4B68 A;  2HQM A;  2WU5 A;  3P4Q A;  1IJH A;  1EL8 A;  1K4Q A;  3UTE A;  2WP9 A;  1H83 A;  2IVE A;  3T0K A;  2FBW A;  3P4S A;  4CY8 A;  5IQ4 A;  1B5Q A;  4ZN0 A;  1KNP A;  2YG3 A;  4FX9 A;  4Y4N A;  4X9N A;  1CC2 A;  2WDV A;  2WP5 A;  1JOA A;  1GT8 A;  1GES A;  4K22 A;  1GRB A;  5C3J A;  2GR1 A;  3ZYX A;  1F3P A;  4OCG A;  3UKQ A;  1PS9 A;  4H4V A;  4I59 A;  3RP7 A;  3VR9 A;  1E1N A;  2XLR A;  2XFQ A;  4RG4 A;  2JB1 A;  1NEN A;  4H4Q A;  4Z26 A;  2GAH B;  2E4G A;  4AOS A;  4P9S A;  4A9W A;  1GRH A;  2V3A A;  1K0L A;  4K2X A;  3JSK A;  2QA1 A;  2BRA A;  4B69 A;  3RED A;  3NYF A;  2W0H A;  4H50 A;  2C75 A;  1YQ4 A;  2TPR A;  1XAN A;  3AEA A;  2RGO A;  2YLX A;  3H8I A;  3DK9 A;  2VOU A;  2Q0K A;  3CNJ A;  3AE1 A;  4IA6 A;  4H2N A;  3UKK A;  5KOX A;  1VQW A;  2OLN A;  3GRT A;  1IUS A;  3K30 A;  2XLU A;  1FEC A;  1Q1R A;  3T2Z A;  5LV9 A;  2R0G A;  2WET A;  3AE3 A;  3UP5 A;  1FEA A;  1L9C A;  3DA1 A;  2GEW A;  2YWL A;  3SY4 A;  1GAL A;  3F8D A;  5JCI A;  1N4V A;  2WBA A;  5FMH A;  2APG A;  4BK1 A;  5EB4 A;  1Y56 B;  4YSY A;  4YSX A;  4FK1 C;  1L9E A;  1PBC A;  2I0Z A;  4J33 A;  2V6O A;  1GRE A;  4UDR A;  4OPL A;  2YG5 A;  3NT6 A;  3T37 A;  2OAL A;  4EM4 A;  3F8P A;  2J3N A;  1Q1W A;  4ZCD A;  4A79 A;  1NG3 A;  4C3X A;  3NYC A;  2VZ2 A;  3SZW A;  2YLR A;  3AD7 B;  3GYJ A;  3V3O A;  4NNJ A;  1BZL A;  3RP6 A;  2VRM A;  1JNR A;  1JEH A;  1Y56 A;  3AD8 B;  3AE2 A;  2JB3 A;  1E1M A;  2BK4 A;  4YKF A;  2R46 A;  3CGC A;  3FMW A;  1GOS A;  4UDP A;  1PJ6 A;  4C74 A;  2YLS A;  5KMP A;  4EQR A;  4CY6 A;  1N1P A;  3L8K A;  1DOB A;  2C4C A;  2XVH A;  4HB9 A;  3QVR A;  1CJ3 A;  4DGK A;  2C70 A;  4B1B A;  1H82 A;  4YWO A;  1NHR A;  3ZDN A;  4APN A;  1O95 A;  2RGH A;  1EL7 A;  3VRD B;  1PBE A;  3ATQ A;  1KNR A;  1E1K A;  1GRA A;  3AEB A;  4FK1 A;  4H4U A;  3IC9 A;  1D5T A;  4U8I A;  2VRL A;  3T31 A;  4M52 A;  1PN0 A;  1D4D A;  2RGJ A;  2Y6Q A;  4JDR A;  3ATR A;  1P2H A;  1H81 A;  2BAC A;  4MJW A;  1K0I A;  3FPZ A;  1IUU A;  3L1R A;  3OC4 A;  4H7U A;  1DNC A;  3LOV A;  3DJD A;  1RP0 A;  5FS8 A;  4EQX A;  1S3E A;  1UKV G;  3NG7 X;  1Y0P A;  4U8P A;  2Q0L A;  1NHQ A;  3BHK A;  4ECH A;  2F5Z A;  5U1O A;  3GYX A;  3SGL A;  2E1M A;  4A99 A;  2WOI A;  2GR0 A;  3NLC A;  1H7X A;  4IV9 A;  3G5Q A;  1CC6 A;  4JNA A;  1CJ4 A;  2EQ6 A;  3BI4 A;  1JNZ A;  4BV6 A;  2YVJ A;  5KNL A;  4AP3 A;  4GUV A;  4B63 A;  1CF3 A;  1VRQ B;  2JB2 A;  2X8C A;  4B66 A;  4U2S A;  2YR5 A;  4CCQ A;  1FCD A;  2ARD A;  2EQ7 A;  1GV4 A;  1M6I A;  1OJD A;  4DSH A;  1ELI A;  3NYE A;  1MO9 A;  3NK1 X;  2ACZ A;  4JNQ A;  2JK6 A;  4TM1 A;  2C76 A;  3CPJ G;  3GD3 A;  1FEB A;  3EF6 A;  2E5V A;  2Z5Y A;  4H2P A;  3KPK A;  1E1L A;  3V76 A;  1ZK7 A;  1ZOV A;  4DNA A;  1ZMD A;  3AE9 A;  2JBV A;  3D1C A;  2DKH A;  3ISH A;  4K7Z A;  4O5U A;  1TYT A;  2GB0 A;  2BXS A;  2WPF A;  2GV8 A;  2R9Z A;  2ZZC A;  4X9M A;  4UDQ A;  2GQF A;  3NH3 X;  3GWF A;  1L9D A;  2VQ7 A;  3PO7 A;  1NAA A;  1PXC A;  3GMC A;  4U8O A;  3UTG A;  1LTX R;  3NNE A;  4YKG A;  3KLJ A;  4U8K A;  1ZOY A;  3QSS A;  4ZCC A;  2V60 A;  1KSS A;  2WQY A;  4NTE A;  2VVM A;  4U2T A;  4CBQ A;  3NGC X;  1S2Q A;  4IVO B;  3HZL A;  2C65 A;  4GRT A;  2AAQ A;  1TRB A;  3H8L A;  4ADW A;  1KFY A;  2XYO A;  3OZ2 A;  4YTP A;  1EL9 A;  1ONF A;  3G5S A;  4Y4L A;  1GTH A;  2NVK X;  4TLX A;  1VG0 A;  2OLO A;  3FIM B;  3KD9 A;  5JCL A;  2A87 A;  2GR2 A;  4Y4M A;  5FS9 A;  4NTC A;  1YQZ A;  3K7M X;  2B9Y A;  3II4 A;  2B7R A;  4IA5 A;  3DH9 A;  5KWF A;  2GAG B;  1P2E A;  3AE4 A;  3GRS A;  5HYM A;  2R4J A;  2GF3 A;  4B64 A;  3Q9T A;  4WCT A;  3AB1 A;  4OPC A;  3P4R A;  1SEZ A;  1E6E A;  2GMJ A;  3QSM A;  2BS4 A;  2VVL A;  5HY5 A;  2QAE A;  4I58 A;  4D03 A;  3DGH A;  4H4X A;  4U2L A;  1PHH A;  1S2Y A;  4TLZ A;  3M12 A;  2YLT A;  1TYP A;  1QJD A;  4CNJ A;  3SXI A;  3F8R A;  2YG6 A;  4GAP A;  3CTY A;  4H2R A;  2DKI A;  3AEF A;  2YQU A;  3CNT A;  1M64 A;  2AQJ A;  2Q6U A;  4LII A;  5U63 A;  4H4R A;  1W4X A;  3SX6 A;  3UOY A;  3PS9 A;  1HYU A;  1JRX A; 
#chains in the Genus database with same CATH homology
 2GQW A;  3AE5 A;  4Z25 A;  1O5W A;  1NHS A;  3B6D A;  1ZDL A;  3UOX A;  2B9X A;  3SZC A;  2BAB A;  2ZZ0 A;  2WPE A;  3PVC A;  4U8N A;  5U25 A;  3DJG X;  3WE0 A;  3AEE A;  4C77 A;  1PDH A;  2B76 A;  1LQT A;  2C67 A;  2O9Z A;  4H4Z A;  3UOZ A;  1PXB A;  1BGN A;  3RNM A;  2WEU A;  3CNS A;  3KU9 A;  1GRG A;  3CGD A;  5BRT A;  3I3L A;  4Z44 A;  4J36 A;  2XFP A;  5M0Z A;  3LXD A;  2YVG A;  2X8H A;  1KF6 A;  4J31 A;  1CBO A;  2YM2 A;  2XFU A;  4U8M A;  4EIP A;  3T2Y A;  1RYI A;  3V3N A;  1X31 B;  4HA6 A;  4G73 A;  4ICY A;  4XXG A;  1DJN A;  1XHC A;  3GMB A;  3IWA A;  4GR1 A;  1ZKQ A;  5KMQ A;  1EL5 A;  2C7G A;  3QFB A;  5IPY A;  4J34 A;  5JCM A;  4USQ A;  3EAN A;  3P4P A;  3NTD A;  1Z6L A;  1PJ7 A;  3S5W A;  3S61 A;  3QFA A;  4PAB A;  2IID A;  3ITJ A;  1BGJ A;  1LJ1 A;  1FOH A;  4U8L A;  1FL2 A;  4NZH A;  1D7Y A;  2BCG G;  4OPU A;  1CHU A;  3Q6J A;  2BA9 A;  4A6N B;  3EPT A;  1OJC A;  1YY5 A;  3NK2 X;  3E1T A;  1PBF A;  3EAO A;  3BNU A;  2B7S A;  3ALJ A;  3LAD A;  2XFN A;  2BC0 A;  4C5O A;  1B8S A;  4A7A A;  3AYI A;  1RSG A;  2XCG A;  2UZZ A;  3SM8 A;  3AED A;  2YR6 A;  4NWZ A;  4NTD A;  2V5Z A;  5KMR A;  3ABV A;  5EBK A;  4KPR A;  4Z43 A;  5J60 A;  3VR8 A;  1JU2 A;  1PBB A;  1D4E A;  4U8J A;  2EQ9 A;  3QSE A;  4G9K A;  5BUK A;  5L46 A;  5FS7 A;  1ZY8 A;  4A6N A;  3BNM A;  4H4W A;  5GSN A;  4OPG A;  2PYX A;  3KA7 A;  4BUR A;  4JY3 A;  4KX6 A;  2YVF A;  1IUV A;  2R0C A;  1QLB A;  3QJ4 A;  3R9U A;  1ZMC A;  2X3N A;  1K0J A;  2YR4 A;  3IF9 A;  4II2 A;  3T14 A;  3ADA B;  3GWD A;  3RHA A;  4EM3 A;  4Z2T A;  5J7X A;  3AWI A;  4H4T A;  4K5R A;  2BXR A;  2R4E A;  2XVE A;  1GRT A;  2C64 A;  4DSG A;  3B3R A;  1OJ9 A;  1N4W A;  2C72 A;  3ICR A;  3FG2 P;  2BK5 A;  4N9X A;  3UTH A;  5KOW A;  1DXL A;  3DME A;  3NTA A;  3BHF A;  1XPQ A;  1KDG A;  1E7P A;  1TDF A;  2V3B A;  1PJ5 A;  3AEC A;  1F8R A;  3NK0 X;  5DBJ A;  3O0H A;  2H89 A;  1BKW A;  3LZX A;  4TM3 A;  3NN0 X;  3KPF A;  2BK3 A;  3AYL A;  3GDP A;  3NHO X;  1LPF A;  1TDK A;  2XVJ A;  3AE8 A;  4BJZ A;  1GXF A;  2WOW A;  3UCL A;  2WPC A;  2A89 A;  5CQF A;  2Q7V A;  2XLT A;  1BWC A;  2QA2 A;  5HHF A;  4JY2 A;  3UKL A;  2OAM A;  3CNP A;  4J57 A;  1XDI A;  2IVD A;  2GH5 A;  4BK2 A;  5ER0 A;  1DOE A;  3LJP A;  4EQW A;  4LA1 A;  4TM4 A;  1GND A;  2WDR A;  3GSI A;  4H4P A;  1B4V A;  1NEK A;  5C2T A;  3NRN A;  2V61 A;  2CFY A;  1NG4 A;  4TM0 A;  3ICT A;  3UKH A;  4EMJ A;  4K8D A;  1LVL A;  4NEV A;  2GR3 A;  2XDO A;  4B67 A;  4CCR A;  3NN6 X;  5EOW A;  1IUX A;  3SFD A;  1LQU A;  1CL0 A;  3SQP A;  3SYI A;  2GVC A;  4OPT A;  5FS6 A;  3GD4 A;  5BUL A;  1YKJ A;  5BVA A;  1MXT A;  3AD9 B;  3T2K A;  1GET A;  1EBD A;  3QVP A;  3C4N A;  4II3 A;  1IUT A;  2WHD A;  3KVE A;  1D7L A;  2XVF A;  3BI2 A;  1D4C A;  3FBS A;  2XFO A;  4Z24 A;  1DOC A;  3CND A;  1H7W A;  1LV0 A;  2CVJ A;  1YQ3 A;  3URH A;  3P9U A;  5KRQ A;  3M0O A;  2C3D A;  1Q9I A;  2X50 A;  4RG3 A;  1GER A;  3UOV A;  4Z2U A;  4OPI A;  3AE6 A;  4GDP A;  4GCM A;  4JN9 A;  1B37 A;  3BI5 A;  3CGE A;  3CIR A;  1PXA A;  2X8G A;  4EIQ A;  3G5R A;  2PHH A;  2RAB A;  2TMD A;  3HYV A;  4UP3 A;  1MOK A;  3D8X A;  1NDA A;  1REO A;  3C4A A;  4AP1 A;  5EB5 A;  2YG7 A;  1TDO A;  5GRT A;  3HYX A;  1BF3 A;  2BS3 A;  2GRT A;  2CDU A;  2ZZB A;  4CNK A;  1ZX9 A;  2CUL A;  2YG4 A;  1NHP A;  3DK8 A;  2JKC A;  3ALL A;  1V59 A;  1F8W A;  3P1W A;  3K7T A;  2QCU A;  4BJY A;  4D04 A;  2WOV A;  2WS3 A;  1CC4 A;  2XLP A;  2WP6 A;  3CGB A;  3AE7 A;  4H2Q A;  3M13 A;  1GEU A;  3LB8 A;  3AXB A;  2YAU A;  4LU6 A;  2YLW A;  4YTN A;  2FJD A;  5JCN A;  1GSN A;  2R0P A;  4GAV A;  3UKF A;  1IUW A;  2BYB A;  3VRA A;  1JRZ A;  4A65 A;  2YLZ A;  5CKU A;  4A5L A;  1ZP0 A;  4JQ9 A;  4EMW A;  4OPD A;  4X4J A;  3AEG A;  4EQS A;  2WDQ A;  4O5Q A;  4RSL A;  1KSU A;  1NPX A;  3IHG A;  4AT2 A;  3UKA A;  3VQR A;  4Z2R A;  1S3B A;  4J56 A;  2VVL G;  3DK4 A;  2FJE A;  3UTF A;  3ICS A;  3SFE A;  3DGZ A;  3C96 A;  3GDN A;  2FJA A;  5KVI A;  1L0V A;  2AR8 A;  4XWR A;  1DOD A;  2B9W A;  4NEW A;  1TDN A;  4AT0 A;  4H4S A;  2Z5X A;  1JRY A;  2C73 A;  2JAE A;  2H88 A;  5KXJ A;  2Y6R A;  3DJJ A;  4YT0 A;  4REK A;  1TDE A;  3RP8 A;  3SZ0 A;  1CJ2 A;  1CJC A;  1H6V A;  4CRT A;  2A8X A;  4K5S A;  2X99 A;  2XLS A;  3CN8 A;  3IHM A;  1F6M A;  4IVM B;  3CMM A;  4AOX A;  1VDC A;  2WU2 A;  5KMS A;  4OVI A;  1GPE A;  4YTM A;  1QO8 A;  1E39 A;  4G6H A;  2FJB A;  2WES A;  4GF7 A;  3I6D A;  2BC1 A;  3ALM A;  4H4Y A;  5JCK A;  2BS2 A;  5IQ1 A;  2C3C A;  2VQB A;  1O94 A;  4FDC B;  5KVH A;  4GDE A;  4XWZ A;  4J2W A;  1F8S A;  4YXD A;  3CPI G;  4USR A;  3GYI A;  3H4K A;  1AOG A;  2ZBW A;  4C3Y A;  5M10 A;  4B65 A;  1N4U A;  2R45 A;  3AYJ A;  3K7Q X;  3UKP A;  1VG9 A;  3HYW A;  3LZW A;  1H86 A;  4G74 A;  4WX1 A;  4EMI A;  2C66 A;  3NKS A;  4PAA A;  4E0V A;  3VRB A;  4YSH A;  3UP4 A;  2XVI A;  3SZF A;  1OJT A;  2GMH A;  2NPX A;  1GRF A;  2EQ8 A;  3NIX A;  4BK3 A;  1DJQ A;  1GTE A;  2BRY A;  3CPH G;  5TR3 A;  1OJA A;  2YM1 A;  3COX A;  2OA1 A;  5HXI A;  1COY A;  4G6G A;  3DJE A;  3KKJ A;  1H84 A;  2BCP A;  4YSZ A;  1PBD A;  4B68 A;  2HQM A;  2WU5 A;  3P4Q A;  1IJH A;  1EL8 A;  1K4Q A;  3UTE A;  2WP9 A;  1H83 A;  2IVE A;  3T0K A;  2FBW A;  3P4S A;  4CY8 A;  5IQ4 A;  1B5Q A;  4ZN0 A;  1KNP A;  2YG3 A;  4FX9 A;  4Y4N A;  4X9N A;  1CC2 A;  2WDV A;  2WP5 A;  1JOA A;  1GT8 A;  1GES A;  4K22 A;  1GRB A;  5C3J A;  2GR1 A;  3ZYX A;  1F3P A;  4OCG A;  3UKQ A;  1PS9 A;  4H4V A;  4I59 A;  3RP7 A;  3VR9 A;  1E1N A;  2XLR A;  2XFQ A;  4RG4 A;  2JB1 A;  1NEN A;  4H4Q A;  4Z26 A;  2GAH B;  2E4G A;  4AOS A;  4P9S A;  4A9W A;  1GRH A;  2V3A A;  1K0L A;  4K2X A;  3JSK A;  2QA1 A;  2BRA A;  4B69 A;  3RED A;  3NYF A;  2W0H A;  4H50 A;  2C75 A;  1YQ4 A;  2TPR A;  1XAN A;  3AEA A;  2RGO A;  2YLX A;  3H8I A;  3DK9 A;  2VOU A;  2Q0K A;  3CNJ A;  3AE1 A;  4IA6 A;  4H2N A;  3UKK A;  5KOX A;  1VQW A;  2OLN A;  3GRT A;  1IUS A;  3K30 A;  2XLU A;  1FEC A;  1Q1R A;  3T2Z A;  5LV9 A;  2R0G A;  2WET A;  3AE3 A;  3UP5 A;  1FEA A;  1L9C A;  3DA1 A;  2GEW A;  2YWL A;  3SY4 A;  1GAL A;  3F8D A;  5JCI A;  1N4V A;  2WBA A;  5FMH A;  2APG A;  4BK1 A;  5EB4 A;  1Y56 B;  4YSY A;  4YSX A;  4FK1 C;  1L9E A;  1PBC A;  2I0Z A;  4J33 A;  2V6O A;  1GRE A;  4UDR A;  4OPL A;  2YG5 A;  3NT6 A;  3T37 A;  2OAL A;  4EM4 A;  3F8P A;  2J3N A;  1Q1W A;  4ZCD A;  4A79 A;  1NG3 A;  4C3X A;  3NYC A;  2VZ2 A;  3SZW A;  2YLR A;  3AD7 B;  3GYJ A;  3V3O A;  4NNJ A;  1BZL A;  3RP6 A;  2VRM A;  1JNR A;  1JEH A;  1Y56 A;  3AD8 B;  3AE2 A;  2JB3 A;  1E1M A;  2BK4 A;  4YKF A;  2R46 A;  3CGC A;  3FMW A;  1GOS A;  4UDP A;  1PJ6 A;  4C74 A;  2YLS A;  5KMP A;  4EQR A;  4CY6 A;  1N1P A;  3L8K A;  1DOB A;  2C4C A;  2XVH A;  4HB9 A;  3QVR A;  1CJ3 A;  4DGK A;  2C70 A;  4B1B A;  1H82 A;  4YWO A;  1NHR A;  3ZDN A;  4APN A;  1O95 A;  2RGH A;  1EL7 A;  3VRD B;  1PBE A;  3ATQ A;  1KNR A;  1E1K A;  1GRA A;  3AEB A;  4FK1 A;  4H4U A;  3IC9 A;  1D5T A;  4U8I A;  2VRL A;  3T31 A;  4M52 A;  1PN0 A;  1D4D A;  2RGJ A;  2Y6Q A;  4JDR A;  3ATR A;  1P2H A;  1H81 A;  2BAC A;  4MJW A;  1K0I A;  3FPZ A;  1IUU A;  3L1R A;  3OC4 A;  4H7U A;  1DNC A;  3LOV A;  3DJD A;  1RP0 A;  5FS8 A;  4EQX A;  1S3E A;  1UKV G;  3NG7 X;  1Y0P A;  4U8P A;  2Q0L A;  1NHQ A;  3BHK A;  4ECH A;  2F5Z A;  5U1O A;  3GYX A;  3SGL A;  2E1M A;  4A99 A;  2WOI A;  2GR0 A;  3NLC A;  1H7X A;  4IV9 A;  3G5Q A;  1CC6 A;  4JNA A;  1CJ4 A;  2EQ6 A;  3BI4 A;  1JNZ A;  4BV6 A;  2YVJ A;  5KNL A;  4AP3 A;  4GUV A;  4B63 A;  1CF3 A;  1VRQ B;  2JB2 A;  2X8C A;  4B66 A;  4U2S A;  2YR5 A;  4CCQ A;  1FCD A;  2ARD A;  2EQ7 A;  1GV4 A;  1M6I A;  1OJD A;  4DSH A;  1ELI A;  3NYE A;  1MO9 A;  3NK1 X;  2ACZ A;  4JNQ A;  2JK6 A;  4TM1 A;  2C76 A;  3CPJ G;  3GD3 A;  1FEB A;  3EF6 A;  2E5V A;  2Z5Y A;  4H2P A;  3KPK A;  1E1L A;  3V76 A;  1ZK7 A;  1ZOV A;  4DNA A;  1ZMD A;  3AE9 A;  2JBV A;  3D1C A;  2DKH A;  3ISH A;  4K7Z A;  4O5U A;  1TYT A;  2GB0 A;  2BXS A;  2WPF A;  2GV8 A;  2R9Z A;  2ZZC A;  4X9M A;  4UDQ A;  2GQF A;  3NH3 X;  3GWF A;  1L9D A;  2VQ7 A;  3PO7 A;  1NAA A;  1PXC A;  3GMC A;  4U8O A;  3UTG A;  1LTX R;  3NNE A;  4YKG A;  3KLJ A;  4U8K A;  1ZOY A;  3QSS A;  4ZCC A;  2V60 A;  1KSS A;  2WQY A;  4NTE A;  2VVM A;  4U2T A;  4CBQ A;  3NGC X;  1S2Q A;  4IVO B;  3HZL A;  2C65 A;  4GRT A;  2AAQ A;  1TRB A;  3H8L A;  4ADW A;  1KFY A;  2XYO A;  3OZ2 A;  4YTP A;  1EL9 A;  1ONF A;  3G5S A;  4Y4L A;  1GTH A;  2NVK X;  4TLX A;  1VG0 A;  2OLO A;  3FIM B;  3KD9 A;  5JCL A;  2A87 A;  2GR2 A;  4Y4M A;  5FS9 A;  4NTC A;  1YQZ A;  3K7M X;  2B9Y A;  3II4 A;  2B7R A;  4IA5 A;  3DH9 A;  5KWF A;  2GAG B;  1P2E A;  3AE4 A;  3GRS A;  5HYM A;  2R4J A;  2GF3 A;  4B64 A;  3Q9T A;  4WCT A;  3AB1 A;  4OPC A;  3P4R A;  1SEZ A;  1E6E A;  2GMJ A;  3QSM A;  2BS4 A;  2VVL A;  5HY5 A;  2QAE A;  4I58 A;  4D03 A;  3DGH A;  4H4X A;  4U2L A;  1PHH A;  1S2Y A;  4TLZ A;  3M12 A;  2YLT A;  1TYP A;  1QJD A;  4CNJ A;  3SXI A;  3F8R A;  2YG6 A;  4GAP A;  3CTY A;  4H2R A;  2DKI A;  3AEF A;  2YQU A;  3CNT A;  1M64 A;  2AQJ A;  2Q6U A;  4LII A;  5U63 A;  4H4R A;  1W4X A;  3SX6 A;  3UOY A;  3PS9 A;  1HYU A;  1JRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...