1FL2A

Catalytic core component of the alkylhydroperoxide reductase ahpf from e.coli
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
310
structure length
310
Chain Sequence
AYDVLIVGSGPAGAAAAIYSARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSASKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
publication title Crystal structure of the catalytic core component of the alkylhydroperoxide reductase AhpF from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 310
sequence length 310
ec nomenclature ec 1.8.1.-:
pdb deposition date 2000-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1fl2A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1fl2A02
4P9SA 2B9YA 1OJTA 1X31B 1REOA 3CGBA 4J56A 3CNPA 3CNJA 1KSUA 2YLWA 4FDCB 2BABA 1XDIA 5CQFA 1FL2A 1DOEA 1K0IA 2C67A 1E1MA 4EMJA 2C76A 3H4KA 3V3NA 2YG4A 2Z5XA 4K5SA 4YTMA 2WPCA 2C66A 1ZDLA 1ELIA 3AEAA 3BI5A 2YG3A 1VG0A 2EQ9A 4C3XA 1ZMCA 3RP7A 2CULA 2V5ZA 3ALLA 4EMWA 5HYMA 5L46A 1VQWA 2B9XA 2QAEA 3D8XA 3CNDA 2NPXA 2YVFA 1NEKA 4B69A 2GEWA 3P4SA 4N9XA 4EQRA 2R4EA 2XVFA 2YLSA 4J36A 2WPFA 2NVKX 4OPGA 2GB0A 3NG7X 2Q6UA 1YY5A 1VRQB 1SEZA 3V76A 1GTEA 1GRGA 1EL5A 2F5ZA 2C3DA 3DH9A 3FMWA 1ZMDA 2WP6A 2YLXA 3EANA 2XVHA 3VR8A 2APGA 4E0VA 1H86A 5C2TA 2WDVA 2X8CA 4NTEA 3ISHA 4GCMA 2GVCA 1N1PA 1E39A 3AXBA 3PVCA 4C74A 2R0CA 3HZLA 3KPFA 4YXDA 2E1MA 4TM3A 3G5RA 4B66A 1RYIA 1E7PA 5U25A 3V3OA 1TYPA 1ZOYA 2BXSA 2YLRA 2A89A 1ZKQA 2GR1A 3G5QA 5JCNA 1GRBA 2XLRA 4IVMB 4LIIA 3ZYXA 4USQA 1PXAA 2AR8A 1TDEA 2V61A 4USRA 3UKLA 4DNAA 4H4PA 4KX6A 2XCGA 3CPJG 4TM1A 2IIDA 2WETA 3BHKA 3DGZA 5EBKA 1H82A 1LJ1A 1JU2A 4BK3A 4U2LA 4BK1A 1XPQA 3K7TA 2GR2A 3M13A 1JNRA 3PO7A 2BC0A 2FJAA 2VRLA 1JOAA 2X8GA 1CJ2A 4NZHA 4PAAA 4OPUA 1H83A 1OJAA 5IQ4A 3C96A 2B76A 3QFBA 5EOWA 4BV6A 3K7QX 1PBFA 4GF7A 4CCQA 3BNMA 2ACZA 4Z44A 2BS3A 5HXIA 3LZXA 1L9DA 4BURA 1N4UA 3VR9A 1CL0A 2XFNA 2GAHB 3M0OA 2WESA 2EQ7A 2RGOA 3EF6A 4FK1A 4A65A 4Z43A 3GMBA 3H8IA 2QA1A 1N4VA 1GEUA 1S2QA 4H4ZA 4U8MA 4H2QA 4OPLA 3RHAA 4AOXA 5HY5A 4JNQA 3EPTA 4TM4A 1NHRA 3P9UA 1GPEA 3NTDA 2E4GA 3NLCA 4CRTA 4H4SA 2YG6A 4AP1A 4EIPA 1ZK7A 2GRTA 3KU9A 4XWZA 4AOSA 4K2XA 2XFOA 1NHSA 4OVIA 4D04A 3DK9A 2VZ2A 1PXCA 4Z2RA 2A87A 2X8HA 3AWIA 3QFAA 4K7ZA 4NEVA 5J60A 3WE0A 3CN8A 3B3RA 2YWLA 3AEFA 2RGHA 3BI2A 3F8DA 2BCGG 1D7YA 1VDCA 4GR1A 3NH3X 1LTXR 2EQ8A 1Z6LA 3AEGA 4REKA 2X3NA 3KA7A 2WHDA 1Y56A 3NT6A 3KKJA 2DKIA 1GRHA 2JBVA 2QCUA 2R0GA 3DJGX 3OC4A 3UOVA 3OZ2A 3L8KA 1GOSA 1PJ6A 1EL8A 4C77A 3NYFA 2CFYA 1BF3A 1DOCA 2OLNA 2GMJA 1KNRA 2Y6RA 4H2RA 4ADWA 1NG3A 3AE8A 1CC4A 1BGJA 1TDFA 4RG4A 3UOYA 1F8RA 2BXRA 1N4WA 4J2WA 3GSIA 2BK4A 2JKCA 4U8NA 1HYUA 4EM3A 2XDOA 3NYCA 5JCIA 4J34A 2YLTA 2I0ZA 3M12A 4ZCCA 3VRDB 5LV9A 2GMHA 3DJDA 3DK8A 3S5WA 4JN9A 2BCPA 3QVPA 3UCLA 2BYBA 4UDPA 3KLJA 1L9CA 4ZN0A 4GDEA 3AEBA 3GD3A 3LZWA 2XLTA 2C7GA 4H4QA 2R46A 5JCMA 5KOWA 2WBAA 4A79A 1CC2A 4RG3A 4U8PA 4J57A 4EM4A 3NKSA 4CY8A 1FEAA 1P2EA 1IUTA 3IC9A 1PBCA 4A9WA 2FBWA 2GF3A 2JB1A 2UZZA 3CNSA 1O95A 2XVEA 4TM0A 1DOBA 4A6NB 1K4QA 3LJPA 3BI4A 2WOIA 4B1BA 4YSXA 2OALA 2C64A 1KSSA 1PXBA 5U63A 3NK2X 1E1NA 1PDHA 2ARDA 1CJ3A 2ZBWA 4I58A 4U8KA 4A7AA 2X50A 2BA9A 2JAEA 2R9ZA 3S61A 1K0JA 4YTNA 4KPRA 3ALMA 3UKHA 4U8JA 1Q9IA 4OPIA 1GETA 3NTAA 3P4RA 4H4YA 2Q0LA 4MJWA 4BK2A 4D03A 1LQTA 3AE7A 3R9UA 1H84A 4JY2A 2C73A 4CBQA 1F6MA 3ICTA 2IVDA 1NENA 1QJDA 1H7XA 3COXA 4J33A 5J7XA 4K22A 1FCDA 2VVLA 2YM1A 3AECA 1LQUA 4FK1C 3GDNA 5FS8A 3GWFA 4DSGA 4OPCA 4PABA 3II4A 2Q7VA 2R4JA 2YVGA 2ZZ0A 3NYEA 4K8DA 5CKUA 3UKAA 4CY6A 2GR3A 4DGKA 4YSHA 1NHPA 3I6DA 2Y6QA 1PBEA 2VQ7A 3UTEA 4EIQA 4H4VA 1ZY8A 1NG4A 3UOXA 1VG9A 2V3AA 3AE2A 1KNPA 1LV0A 2FJEA 3CPIG 5M10A 2B7RA 1ZOVA 3ICSA 2VOUA 4U2TA 3I3LA 3NN0X 4UDQA 4APNA 3AE6A 4WCTA 1BGNA 4NTDA 2YR5A 3UKPA 4C3YA 2BK3A 2XLUA 3Q9TA 5FS7A 2B7SA 5KVHA 2BS4A 4JDRA 4TLZA 2H89A 3GYIA 3AYIA 1UKVG 1Q1WA 3VRAA 4YKGA 4O5UA 1MO9A 1GV4A 1BKWA 1CC6A 1OJ9A 3DJJA 3UP5A 4AT0A 2PHHA 1DNCA 2WU5A 3GMCA 4HA6A 2VRMA 3SQPA 4J31A 2EQ6A 5IQ1A 1GXFA 2WQYA 1E1LA 2GQWA 2O9ZA 5BRTA 2AQJA 1GRFA 3GRTA 2ZZCA 3K30A 3NGCX 4B64A 3L1RA 3ZDNA 4EMIA 1GTHA 4H2NA 2WP5A 1F8WA 1FOHA 1D5TA 3E1TA 2BK5A 5KWFA 4U8OA 1H7WA 2CVJA 2GR0A 4IA5A 1LVLA 5U1OA 2VVLG 4H7UA 2WDQA 3KD9A 2C75A 4JQ9A 4YSYA 2JB2A 2BC1A 1DJQA 4BJYA 3LOVA 1PJ7A 3NK0X 3RP6A 4AP3A 1ZP0A 2XFPA 3FPZA 3UP4A 4Z25A 4GDPA 4CNKA 1NPXA 2B9WA 3P4QA 2YR4A 2PYXA 3DA1A 4ECHA 2C70A 3NRNA 3NNEA 5ER0A 1EL9A 1MOKA 1PJ5A 3AD8B 3FG2P 1K0LA 3UTGA 3C4NA 4EQSA 3IWAA 1ONFA 2DKHA 1JEHA 1S2YA 4H4WA 3CNTA 4X9MA 3REDA 3VQRA 3NN6X 5JCKA 3NIXA 5KVIA 3AE4A 1PBDA 2YG7A 3UTFA 1EBDA 2R0PA 2WOWA 1O94A 4K5RA 2YR6A 2OLOA 1KF6A 1GNDA 2AAQA 2V60A 4ICYA 4Y4MA 4TLXA 2BACA 3AEEA 1D4DA 3BHFA 1EL7A 3O0HA 5FS6A 3SM8A 2H88A 2XYOA 1H6VA 1CF3A 3CGCA 2FJBA 2WP9A 3P1WA 1NDAA 1YQ4A 3DGHA 4Y4LA 3AE3A 3QSSA 2IVEA 5BVAA 3NK1X 1H81A 1CJ4A 4A5LA 4H4RA 2OA1A 2YM2A 4M52A 2FJDA 4X4JA 4B65A 1M6IA 5HHFA 2WS3A 1V59A 5FS9A 1B4VA 5DBJA 4XWRA 4RSLA 4Z2UA 3KVEA 1IJHA 1S3EA 2YLZA 3DJEA 3IF9A 1D4CA 4B63A 4H2PA 1CHUA 1LPFA 4NEWA 4XXGA 1Y0PA 2BS2A 1PN0A 1L9EA 3SGLA 1XHCA 4LA1A 2QA2A 2WOVA 4LU6A 1FECA 1M64A 4UDRA 5GRTA 4BJZA 5IPYA 4C5OA 2XVJA 1DXLA 1D7LA 2JK6A 5TR3A 4UP3A 2VQBA 3CTYA 2WEUA 2R45A 5FMHA 3GDPA 5GSNA 3UOZA 3AE1A 2YG5A 2XVIA 3IHMA 3Q6JA 1YKJA 2Z5YA 1PBBA 5M0ZA 3AD7B 1F8SA 2HQMA 4AT2A 3AD9B 3UKKA 1GT8A 4GRTA 4A99A 4YTPA 4U8LA 5EB5A 2XFQA 4O5QA 1TYTA 3AE9A 5BULA 4FX9A 1B37A 1JRXA 2GH5A 3RNMA 3FBSA 1YQ3A 3DMEA 2ZZBA 1B8SA 4A6NA 4B68A 1TRBA 5KOXA 1GSNA 1S3BA 3AYJA 1W4XA 4ZCDA 4B67A 2WDRA 3D1CA 4Z24A 1NHQA 2GV8A 1PS9A 3AB1A 4YWOA 1DODA 3DK4A 1OJDA 3CGDA 3LB8A 1BZLA 3GD4A 1KDGA 3IHGA 4CNJA 2XFUA 5KRQA 3B6DA 5KXJA 2W0HA 1F3PA 2J3NA 4WX1A 2WU2A 3URHA 2CDUA 3ADAB 1DJNA 2OAMA 1IUUA 1GESA 3UTHA 4Z2TA 1CJCA 2C72A 3T37A 2V3BA 5BUKA 1QLBA 2GAGB 4IV9A 4Y4NA 1L0VA 2X99A 2YAUA 1GRAA 2V6OA 1TDKA 2Q0KA 2VVMA 3QJ4A 1O5WA 1GALA 1ZX9A 2XLSA 1GREA 3CIRA 3QSMA 1PHHA 1TDOA 4JNAA 3ALJA 2YQUA 5JCLA 3C4AA 1JRYA 1OJCA 1AOGA 3F8PA 3SFEA 3ITJA 3F8RA 3ABVA 1IUVA 4NTCA 5C3JA 4IA6A 1MXTA 1IUXA 1CBOA 4U2SA 1TDNA 5EB4A 1NAAA 1JNZA 4H4TA 1XANA 1Y56B 3LXDA 1Q1RA 3ICRA 1IUWA 3AE5A 1GERA 3P4PA 3NHOX 4JY3A 4CCRA 2TPRA 3VRBA 2XLPA 3BNUA 1JRZA 1FEBA 2RABA 3ATRA 4H4UA 3UKFA 3H8LA 4HB9A 4U8IA 4YSZA 1E1KA 2C3CA 4EQXA 1D4EA 1COYA 3UKQA 2WPEA 2C65A 3PS9A 4H50A 3GWDA 3GRSA 3AYLA 1BWCA 3CGEA 3RP8A 3EAOA 3ATQA 4H4XA 3LADA 4IVOB 3CPHG 3QSEA 1IUSA 4I59A 1RP0A 3G5SA 3QVRA 2E5VA 2RGJA 2JB3A 3JSKA 1KFYA 1QO8A 4OCGA 2GQFA 1RSGA 3GYJA 1GRTA 1B5QA 3FIMB 4X9NA 4EQWA 4YT0A 2TMDA 4DSHA 4GUVA 1YQZA 4YKFA 1E6EA 3AEDA 2A8XA 4OPTA 3SFDA 2YVJA 3K7MX 4OPDA 1P2HA 4Z26A
chains in the Genus database with same CATH superfamily
4P9SA 2B9YA 1OJTA 1X31B 1REOA 3CGBA 4J56A 3CNPA 3CNJA 1KSUA 2YLWA 4FDCB 2BABA 1XDIA 3HYWA 5CQFA 1FL2A 1DOEA 1K0IA 2C67A 1E1MA 4EMJA 2C76A 3H4KA 3V3NA 2YG4A 2Z5XA 4K5SA 4YTMA 3SZWA 2WPCA 2C66A 1ZDLA 1ELIA 3AEAA 3BI5A 2YG3A 1VG0A 2EQ9A 4C3XA 1ZMCA 3RP7A 2CULA 2V5ZA 3ALLA 4EMWA 5HYMA 5L46A 1VQWA 2B9XA 2QAEA 3D8XA 3CNDA 2NPXA 2YVFA 1NEKA 4B69A 2GEWA 3P4SA 4N9XA 4EQRA 2R4EA 2XVFA 2YLSA 4J36A 3SZ0A 2WPFA 2NVKX 4OPGA 2GB0A 3NG7X 2Q6UA 1YY5A 1VRQB 1SEZA 3V76A 1GTEA 1GRGA 1EL5A 2F5ZA 2C3DA 3DH9A 3FMWA 1ZMDA 2WP6A 2YLXA 3EANA 2XVHA 3VR8A 3KPKA 2APGA 4E0VA 1H86A 5C2TA 2WDVA 2X8CA 4NTEA 3ISHA 4GCMA 2GVCA 1N1PA 1E39A 3AXBA 3PVCA 4C74A 2R0CA 3HZLA 3KPFA 4YXDA 2E1MA 4TM3A 3G5RA 4B66A 1RYIA 1E7PA 5U25A 3V3OA 1TYPA 1ZOYA 2BXSA 2YLRA 2A89A 1ZKQA 2GR1A 3G5QA 5JCNA 1GRBA 2XLRA 4IVMB 4LIIA 3ZYXA 4USQA 1PXAA 2AR8A 1TDEA 2V61A 4USRA 3UKLA 4DNAA 4H4PA 4KX6A 2XCGA 3CPJG 4TM1A 2IIDA 2WETA 3BHKA 3DGZA 5EBKA 1H82A 4GAVA 1LJ1A 1JU2A 4BK3A 4U2LA 4BK1A 1XPQA 3K7TA 2GR2A 3M13A 1JNRA 3PO7A 2BC0A 2FJAA 2VRLA 1JOAA 2X8GA 1CJ2A 4NZHA 4PAAA 4OPUA 1H83A 1OJAA 5IQ4A 3C96A 2B76A 3QFBA 5EOWA 4BV6A 3K7QX 1PBFA 4GF7A 4CCQA 3BNMA 2ACZA 4Z44A 5KMRA 2BS3A 5HXIA 3LZXA 1L9DA 4BURA 1N4UA 3VR9A 1CL0A 2XFNA 5KMSA 2GAHB 3M0OA 2WESA 2EQ7A 2RGOA 3EF6A 4FK1A 4A65A 4Z43A 3GMBA 3H8IA 2QA1A 1N4VA 1GEUA 1S2QA 4H4ZA 4U8MA 4H2QA 3GYXA 4OPLA 3RHAA 4AOXA 4JNQA 3EPTA 5HY5A 4TM4A 1NHRA 3P9UA 1GPEA 3NTDA 2E4GA 3NLCA 3SX6A 4CRTA 4H4SA 2YG6A 4AP1A 4EIPA 1ZK7A 2GRTA 3KU9A 4XWZA 4AOSA 4K2XA 2XFOA 1NHSA 4OVIA 4D04A 3DK9A 2VZ2A 3SY4A 1PXCA 4Z2RA 2A87A 2X8HA 3AWIA 3QFAA 4K7ZA 4NEVA 5J60A 3WE0A 3CN8A 3B3RA 2YWLA 3AEFA 2RGHA 3BI2A 3F8DA 2BCGG 1D7YA 1VDCA 4GR1A 3NH3X 1LTXR 2EQ8A 1Z6LA 3AEGA 4REKA 2X3NA 3KA7A 2WHDA 1Y56A 3NT6A 3KKJA 2DKIA 1GRHA 2JBVA 2QCUA 2R0GA 3DJGX 3OC4A 3UOVA 4G73A 3OZ2A 3L8KA 1GOSA 1PJ6A 1EL8A 4C77A 3NYFA 2CFYA 1BF3A 1DOCA 2OLNA 2GMJA 1KNRA 2Y6RA 4II3A 3T2YA 4H2RA 4ADWA 1NG3A 3AE8A 1CC4A 1BGJA 1TDFA 4RG4A 3UOYA 1F8RA 2BXRA 1N4WA 4J2WA 3GSIA 2BK4A 2JKCA 4U8NA 1HYUA 4EM3A 2XDOA 3NYCA 5JCIA 4J34A 3T0KA 4NWZA 2YLTA 2I0ZA 3M12A 4NNJA 4ZCCA 3VRDB 5LV9A 2GMHA 3DJDA 3DK8A 3S5WA 4JN9A 2BCPA 3QVPA 3UCLA 2BYBA 4UDPA 3KLJA 1L9CA 4ZN0A 4GDEA 3AEBA 3GD3A 3LZWA 2XLTA 2C7GA 4H4QA 2R46A 5JCMA 5KOWA 2WBAA 4A79A 1CC2A 4RG3A 4U8PA 4J57A 4EM4A 3NKSA 4CY8A 1FEAA 1P2EA 3CMMA 1IUTA 3IC9A 1PBCA 4G9KA 4A9WA 2FBWA 2GF3A 2JB1A 2UZZA 3T2KA 3CNSA 1O95A 2XVEA 4TM0A 1DOBA 4A6NB 1K4QA 3LJPA 3BI4A 2WOIA 4B1BA 4YSXA 2OALA 2BRAA 5KMPA 2C64A 1KSSA 1PXBA 5U63A 3NK2X 1E1NA 1PDHA 2ARDA 1CJ3A 2ZBWA 4I58A 4U8KA 2C4CA 4A7AA 2X50A 2BA9A 2JAEA 2R9ZA 3S61A 1K0JA 3T14A 4KPRA 4YTNA 3ALMA 3UKHA 4U8JA 1Q9IA 4OPIA 1GETA 3NTAA 3P4RA 4H4YA 2Q0LA 4MJWA 4BK2A 4D03A 1LQTA 3AE7A 3R9UA 1H84A 4JY2A 2C73A 4CBQA 1F6MA 3ICTA 2IVDA 1NENA 1QJDA 1H7XA 3COXA 4J33A 5J7XA 4K22A 1FCDA 2VVLA 2YM1A 3AECA 1LQUA 4FK1C 3GDNA 5FS8A 3GWFA 4DSGA 4OPCA 4PABA 3II4A 2Q7VA 2R4JA 2YVGA 2ZZ0A 3HYVA 3NYEA 4K8DA 5CKUA 3UKAA 4CY6A 2GR3A 4DGKA 4YSHA 1NHPA 3I6DA 2Y6QA 1PBEA 2VQ7A 3UTEA 4EIQA 4H4VA 1ZY8A 1NG4A 3UOXA 1VG9A 2V3AA 3AE2A 1KNPA 1LV0A 2FJEA 3CPIG 5M10A 2B7RA 3SYIA 1ZOVA 3ICSA 2VOUA 4U2TA 3I3LA 3NN0X 4UDQA 4APNA 3AE6A 4WCTA 1BGNA 4NTDA 2YR5A 3UKPA 4C3YA 2BK3A 2XLUA 3Q9TA 5FS7A 2B7SA 5KVHA 2BS4A 4JDRA 4TLZA 2H89A 3GYIA 3AYIA 1UKVG 4G6HA 1Q1WA 3VRAA 4YKGA 4O5UA 1MO9A 1GV4A 1BKWA 1CC6A 1OJ9A 3DJJA 3UP5A 4AT0A 2PHHA 1DNCA 2WU5A 3GMCA 4HA6A 2VRMA 3SQPA 4J31A 4II2A 2EQ6A 5IQ1A 1GXFA 2WQYA 1E1LA 2GQWA 2O9ZA 5BRTA 2AQJA 1GRFA 3GRTA 2ZZCA 3K30A 3NGCX 4B64A 3L1RA 3ZDNA 4EMIA 1GTHA 4H2NA 2WP5A 1F8WA 1FOHA 1D5TA 3E1TA 2BK5A 4GAPA 5KWFA 4U8OA 1H7WA 2CVJA 2GR0A 4IA5A 1LVLA 5U1OA 2VVLG 4H7UA 2WDQA 3KD9A 2C75A 4JQ9A 4YSYA 2JB2A 2BC1A 1DJQA 4BJYA 3LOVA 1PJ7A 3NK0X 3RP6A 4AP3A 1ZP0A 2XFPA 3FPZA 3UP4A 4Z25A 4GDPA 4CNKA 1NPXA 2B9WA 3P4QA 2YR4A 2PYXA 3DA1A 4ECHA 2C70A 3NRNA 3NNEA 5ER0A 1EL9A 1MOKA 1PJ5A 3AD8B 3FG2P 1K0LA 3UTGA 3C4NA 4EQSA 5KMQA 3IWAA 1ONFA 2DKHA 1JEHA 1S2YA 4H4WA 3CNTA 4X9MA 3REDA 3VQRA 3NN6X 5JCKA 3NIXA 5KVIA 3AE4A 2BRYA 1PBDA 2YG7A 3UTFA 1EBDA 2R0PA 2WOWA 1O94A 4K5RA 2YR6A 2OLOA 1KF6A 1GNDA 2AAQA 2V60A 4ICYA 4Y4MA 4TLXA 2BACA 3AEEA 1D4DA 3BHFA 1EL7A 3O0HA 5FS6A 3SM8A 2H88A 2XYOA 1H6VA 1CF3A 3CGCA 2FJBA 2WP9A 3P1WA 1NDAA 1YQ4A 3DGHA 4Y4LA 3AE3A 3QSSA 2IVEA 3HYXA 5BVAA 3T2ZA 3NK1X 1H81A 1CJ4A 4A5LA 4H4RA 2OA1A 2YM2A 4M52A 3SZFA 2FJDA 4X4JA 4B65A 1M6IA 5HHFA 2WS3A 1V59A 3SZCA 5FS9A 1B4VA 5DBJA 4XWRA 4RSLA 4Z2UA 3KVEA 1IJHA 1S3EA 2YLZA 3DJEA 3IF9A 1D4CA 4B63A 4H2PA 1CHUA 1LPFA 4NEWA 4XXGA 1Y0PA 2BS2A 1PN0A 1L9EA 3SGLA 1XHCA 4LA1A 2QA2A 2WOVA 4LU6A 1FECA 1M64A 4UDRA 5GRTA 4BJZA 5IPYA 4C5OA 2XVJA 3SXIA 1DXLA 1D7LA 2JK6A 5TR3A 5KNLA 4UP3A 2VQBA 3CTYA 2WEUA 2R45A 5FMHA 3GDPA 5GSNA 3UOZA 3AE1A 2YG5A 2XVIA 3IHMA 3Q6JA 1YKJA 2Z5YA 1PBBA 5M0ZA 3AD7B 1F8SA 2HQMA 4AT2A 3AD9B 3UKKA 1GT8A 4GRTA 4A99A 4YTPA 4U8LA 5EB5A 2XFQA 4O5QA 1TYTA 3AE9A 5BULA 4FX9A 1B37A 1JRXA 2GH5A 3RNMA 3FBSA 1YQ3A 3DMEA 2ZZBA 1B8SA 3T31A 4A6NA 4B68A 1TRBA 5KOXA 1GSNA 1S3BA 3AYJA 1W4XA 4G74A 4ZCDA 4B67A 2WDRA 3D1CA 4Z24A 1NHQA 2GV8A 1PS9A 3AB1A 4YWOA 1DODA 3DK4A 1OJDA 3CGDA 3LB8A 1BZLA 3GD4A 1KDGA 3IHGA 4CNJA 2XFUA 5KRQA 3B6DA 5KXJA 2W0HA 1F3PA 2J3NA 4WX1A 2WU2A 3URHA 2CDUA 3ADAB 1DJNA 2OAMA 1IUUA 1GESA 3UTHA 4Z2TA 1CJCA 2C72A 3T37A 2V3BA 5BUKA 1QLBA 2GAGB 4IV9A 4Y4NA 1L0VA 2X99A 2YAUA 1GRAA 2V6OA 1TDKA 2Q0KA 2VVMA 3QJ4A 1O5WA 1GALA 1ZX9A 2XLSA 1GREA 3CIRA 3QSMA 1PHHA 1TDOA 4JNAA 3ALJA 2YQUA 5JCLA 3C4AA 1JRYA 1OJCA 1AOGA 3F8PA 3SFEA 3ITJA 3F8RA 3ABVA 1IUVA 4NTCA 5C3JA 4IA6A 1MXTA 1IUXA 1CBOA 4U2SA 1TDNA 5EB4A 1NAAA 1JNZA 4H4TA 1XANA 1Y56B 3LXDA 1Q1RA 3ICRA 1IUWA 3AE5A 1GERA 3P4PA 3NHOX 4JY3A 4CCRA 2TPRA 3VRBA 2XLPA 3BNUA 1JRZA 1FEBA 2RABA 3ATRA 4H4UA 3UKFA 3H8LA 4HB9A 4U8IA 4YSZA 1E1KA 2C3CA 4EQXA 1D4EA 1COYA 3UKQA 2WPEA 2C65A 3PS9A 4H50A 3GWDA 3GRSA 3AYLA 1BWCA 3CGEA 3RP8A 3EAOA 3ATQA 4H4XA 3LADA 4IVOB 3CPHG 3QSEA 1IUSA 4I59A 1RP0A 3G5SA 3QVRA 2E5VA 2RGJA 2JB3A 3JSKA 1KFYA 1QO8A 4OCGA 2GQFA 1RSGA 4G6GA 3GYJA 1GRTA 1B5QA 3FIMB 4X9NA 4EQWA 4YT0A 2TMDA 4DSHA 4GUVA 1YQZA 4YKFA 1E6EA 3AEDA 2A8XA 4OPTA 3SFDA 2YVJA 3K7MX 4OPDA 1P2HA 4Z26A
chains in the Genus database with same CATH topology
4P9SA 2B9YA 1OJTA 1X31B 1REOA 3CGBA 4J56A 3CNPA 3CNJA 1KSUA 2YLWA 4FDCB 2BABA 1XDIA 3HYWA 5CQFA 1FL2A 1DOEA 1K0IA 2C67A 1E1MA 4EMJA 2C76A 3H4KA 3V3NA 2YG4A 2Z5XA 4K5SA 4YTMA 3SZWA 2WPCA 2C66A 1ZDLA 1ELIA 3AEAA 3BI5A 2YG3A 1VG0A 2EQ9A 4C3XA 1ZMCA 3RP7A 2CULA 2V5ZA 3ALLA 4EMWA 5HYMA 5L46A 1VQWA 2B9XA 2QAEA 3D8XA 3CNDA 2NPXA 2YVFA 1NEKA 4B69A 2GEWA 3P4SA 4N9XA 4EQRA 2R4EA 2XVFA 2YLSA 4J36A 3SZ0A 2WPFA 2NVKX 4OPGA 2GB0A 3NG7X 2Q6UA 1YY5A 1VRQB 1SEZA 3V76A 1GTEA 1GRGA 1EL5A 2F5ZA 2C3DA 3DH9A 3FMWA 1ZMDA 2WP6A 2YLXA 3EANA 2XVHA 3VR8A 3KPKA 2APGA 4E0VA 1H86A 5C2TA 2WDVA 2X8CA 4NTEA 3ISHA 4GCMA 2GVCA 1N1PA 1E39A 3AXBA 3PVCA 4C74A 2R0CA 3HZLA 3KPFA 4YXDA 2E1MA 4TM3A 3G5RA 4B66A 1RYIA 1E7PA 5U25A 3V3OA 1TYPA 1ZOYA 2BXSA 2YLRA 2A89A 1ZKQA 2GR1A 3G5QA 5JCNA 1GRBA 2XLRA 4IVMB 4LIIA 3ZYXA 4USQA 1PXAA 2AR8A 1TDEA 2V61A 4USRA 3UKLA 4DNAA 4H4PA 4KX6A 2XCGA 3CPJG 4TM1A 2IIDA 2WETA 3BHKA 3DGZA 5EBKA 1H82A 4GAVA 1LJ1A 1JU2A 4BK3A 4U2LA 4BK1A 1XPQA 3K7TA 2GR2A 3M13A 1JNRA 3PO7A 2BC0A 2FJAA 2VRLA 1JOAA 2X8GA 1CJ2A 4NZHA 4PAAA 4OPUA 1H83A 1OJAA 5IQ4A 3C96A 2B76A 3QFBA 5EOWA 4BV6A 3K7QX 1PBFA 4GF7A 4CCQA 3BNMA 2ACZA 4Z44A 5KMRA 2BS3A 5HXIA 3LZXA 1L9DA 4BURA 1N4UA 3VR9A 1CL0A 2XFNA 5KMSA 2GAHB 3M0OA 2WESA 2EQ7A 2RGOA 3EF6A 4FK1A 4A65A 4Z43A 3GMBA 3H8IA 2QA1A 1N4VA 1GEUA 1S2QA 4H4ZA 4U8MA 4H2QA 3GYXA 4OPLA 3RHAA 4AOXA 4JNQA 3EPTA 5HY5A 4TM4A 1NHRA 3P9UA 1GPEA 3NTDA 2E4GA 3NLCA 3SX6A 4CRTA 4H4SA 2YG6A 4AP1A 4EIPA 1ZK7A 2GRTA 3KU9A 4XWZA 4AOSA 4K2XA 2XFOA 1NHSA 4OVIA 4D04A 3DK9A 2VZ2A 3SY4A 1PXCA 4Z2RA 2A87A 2X8HA 3AWIA 3QFAA 4K7ZA 4NEVA 5J60A 3WE0A 3CN8A 3B3RA 2YWLA 3AEFA 2RGHA 3BI2A 3F8DA 2BCGG 1D7YA 1VDCA 4GR1A 3NH3X 1LTXR 2EQ8A 1Z6LA 3AEGA 4REKA 2X3NA 3KA7A 2WHDA 1Y56A 3NT6A 3KKJA 2DKIA 1GRHA 2JBVA 2QCUA 2R0GA 3DJGX 3OC4A 3UOVA 4G73A 3OZ2A 3L8KA 1GOSA 1PJ6A 1EL8A 4C77A 3NYFA 2CFYA 1BF3A 1DOCA 2OLNA 2GMJA 1KNRA 2Y6RA 4II3A 3T2YA 4H2RA 4ADWA 1NG3A 3AE8A 1CC4A 1BGJA 1TDFA 4RG4A 3UOYA 1F8RA 2BXRA 1N4WA 4J2WA 3GSIA 2BK4A 2JKCA 4U8NA 1HYUA 4EM3A 2XDOA 3NYCA 5JCIA 4J34A 3T0KA 4NWZA 2YLTA 2I0ZA 3M12A 4NNJA 4ZCCA 3VRDB 5LV9A 2GMHA 3DJDA 3DK8A 3S5WA 4JN9A 2BCPA 3QVPA 3UCLA 2BYBA 4UDPA 3KLJA 1L9CA 4ZN0A 4GDEA 3AEBA 3GD3A 3LZWA 2XLTA 2C7GA 4H4QA 2R46A 5JCMA 5KOWA 2WBAA 4A79A 1CC2A 4RG3A 4U8PA 4J57A 4EM4A 3NKSA 4CY8A 1FEAA 1P2EA 3CMMA 1IUTA 3IC9A 1PBCA 4G9KA 4A9WA 2FBWA 2GF3A 2JB1A 2UZZA 3T2KA 3CNSA 1O95A 2XVEA 4TM0A 1DOBA 4A6NB 1K4QA 3LJPA 3BI4A 2WOIA 4B1BA 4YSXA 2OALA 2BRAA 5KMPA 2C64A 1KSSA 1PXBA 5U63A 3NK2X 1E1NA 1PDHA 2ARDA 1CJ3A 2ZBWA 4I58A 4U8KA 2C4CA 4A7AA 2X50A 2BA9A 2JAEA 2R9ZA 3S61A 1K0JA 3T14A 4KPRA 4YTNA 3ALMA 3UKHA 4U8JA 1Q9IA 4OPIA 1GETA 3NTAA 3P4RA 4H4YA 2Q0LA 4MJWA 4BK2A 4D03A 1LQTA 3AE7A 3R9UA 1H84A 4JY2A 2C73A 4CBQA 1F6MA 3ICTA 2IVDA 1NENA 1QJDA 1H7XA 3COXA 4J33A 5J7XA 4K22A 1FCDA 2VVLA 2YM1A 3AECA 1LQUA 4FK1C 3GDNA 5FS8A 3GWFA 4DSGA 4OPCA 4PABA 3II4A 2Q7VA 2R4JA 2YVGA 2ZZ0A 3HYVA 3NYEA 4K8DA 5CKUA 3UKAA 4CY6A 2GR3A 4DGKA 4YSHA 1NHPA 3I6DA 2Y6QA 1PBEA 2VQ7A 3UTEA 4EIQA 4H4VA 1ZY8A 1NG4A 3UOXA 1VG9A 2V3AA 3AE2A 1KNPA 1LV0A 2FJEA 3CPIG 5M10A 2B7RA 3SYIA 1ZOVA 3ICSA 2VOUA 4U2TA 3I3LA 3NN0X 4UDQA 4APNA 3AE6A 4WCTA 1BGNA 4NTDA 2YR5A 3UKPA 4C3YA 2BK3A 2XLUA 3Q9TA 5FS7A 2B7SA 5KVHA 2BS4A 4JDRA 4TLZA 2H89A 3GYIA 3AYIA 1UKVG 4G6HA 1Q1WA 3VRAA 4YKGA 4O5UA 1MO9A 1GV4A 1BKWA 1CC6A 1OJ9A 3DJJA 3UP5A 4AT0A 2PHHA 1DNCA 2WU5A 3GMCA 4HA6A 2VRMA 3SQPA 4J31A 4II2A 2EQ6A 5IQ1A 1GXFA 2WQYA 1E1LA 2GQWA 2O9ZA 5BRTA 2AQJA 1GRFA 3GRTA 2ZZCA 3K30A 3NGCX 4B64A 3L1RA 3ZDNA 4EMIA 1GTHA 4H2NA 2WP5A 1F8WA 1FOHA 1D5TA 3E1TA 2BK5A 4GAPA 5KWFA 4U8OA 1H7WA 2CVJA 2GR0A 4IA5A 1LVLA 5U1OA 2VVLG 4H7UA 2WDQA 3KD9A 2C75A 4JQ9A 4YSYA 2JB2A 2BC1A 1DJQA 4BJYA 3LOVA 1PJ7A 3NK0X 3RP6A 4AP3A 1ZP0A 2XFPA 3FPZA 3UP4A 4Z25A 4GDPA 4CNKA 1NPXA 2B9WA 3P4QA 2YR4A 2PYXA 3DA1A 4ECHA 2C70A 3NRNA 3NNEA 5ER0A 1EL9A 1MOKA 1PJ5A 3AD8B 3FG2P 1K0LA 3UTGA 3C4NA 4EQSA 5KMQA 3IWAA 1ONFA 2DKHA 1JEHA 1S2YA 4H4WA 3CNTA 4X9MA 3REDA 3VQRA 3NN6X 5JCKA 3NIXA 5KVIA 3AE4A 2BRYA 1PBDA 2YG7A 3UTFA 1EBDA 2R0PA 2WOWA 1O94A 4K5RA 2YR6A 2OLOA 1KF6A 1GNDA 2AAQA 2V60A 4ICYA 4Y4MA 4TLXA 2BACA 3AEEA 1D4DA 3BHFA 1EL7A 3O0HA 5FS6A 3SM8A 2H88A 2XYOA 1H6VA 1CF3A 3CGCA 2FJBA 2WP9A 3P1WA 1NDAA 1YQ4A 3DGHA 4Y4LA 3AE3A 3QSSA 2IVEA 3HYXA 5BVAA 3T2ZA 3NK1X 1H81A 1CJ4A 4A5LA 4H4RA 2OA1A 2YM2A 4M52A 3SZFA 2FJDA 4X4JA 4B65A 1M6IA 5HHFA 2WS3A 1V59A 3SZCA 5FS9A 1B4VA 5DBJA 4XWRA 4RSLA 4Z2UA 3KVEA 1IJHA 1S3EA 2YLZA 3DJEA 3IF9A 1D4CA 4B63A 4H2PA 1CHUA 1LPFA 4NEWA 4XXGA 1Y0PA 2BS2A 1PN0A 1L9EA 3SGLA 1XHCA 4LA1A 2QA2A 2WOVA 4LU6A 1FECA 1M64A 4UDRA 5GRTA 4BJZA 5IPYA 4C5OA 2XVJA 3SXIA 1DXLA 1D7LA 2JK6A 5TR3A 5KNLA 4UP3A 2VQBA 3CTYA 2WEUA 2R45A 5FMHA 3GDPA 5GSNA 3UOZA 3AE1A 2YG5A 2XVIA 3IHMA 3Q6JA 1YKJA 2Z5YA 1PBBA 5M0ZA 3AD7B 1F8SA 2HQMA 4AT2A 3AD9B 3UKKA 1GT8A 4GRTA 4A99A 4YTPA 4U8LA 5EB5A 2XFQA 4O5QA 1TYTA 3AE9A 5BULA 4FX9A 1B37A 1JRXA 2GH5A 3RNMA 3FBSA 1YQ3A 3DMEA 2ZZBA 1B8SA 3T31A 4A6NA 4B68A 1TRBA 5KOXA 1GSNA 1S3BA 3AYJA 1W4XA 4G74A 4ZCDA 4B67A 2WDRA 3D1CA 4Z24A 1NHQA 2GV8A 1PS9A 3AB1A 4YWOA 1DODA 3DK4A 1OJDA 3CGDA 3LB8A 1BZLA 3GD4A 1KDGA 3IHGA 4CNJA 2XFUA 5KRQA 3B6DA 5KXJA 2W0HA 1F3PA 2J3NA 4WX1A 2WU2A 3URHA 2CDUA 3ADAB 1DJNA 2OAMA 1IUUA 1GESA 3UTHA 4Z2TA 1CJCA 2C72A 3T37A 2V3BA 5BUKA 1QLBA 2GAGB 4IV9A 4Y4NA 1L0VA 2X99A 2YAUA 1GRAA 2V6OA 1TDKA 2Q0KA 2VVMA 3QJ4A 1O5WA 1GALA 1ZX9A 2XLSA 1GREA 3CIRA 3QSMA 1PHHA 1TDOA 4JNAA 3ALJA 2YQUA 5JCLA 3C4AA 1JRYA 1OJCA 1AOGA 3F8PA 3SFEA 3ITJA 3F8RA 3ABVA 1IUVA 4NTCA 5C3JA 4IA6A 1MXTA 1IUXA 1CBOA 4U2SA 1TDNA 5EB4A 1NAAA 1JNZA 4H4TA 1XANA 1Y56B 3LXDA 1Q1RA 3ICRA 1IUWA 3AE5A 1GERA 3P4PA 3NHOX 4JY3A 4CCRA 2TPRA 3VRBA 2XLPA 3BNUA 1JRZA 1FEBA 2RABA 3ATRA 4H4UA 3UKFA 3H8LA 4HB9A 4U8IA 4YSZA 1E1KA 2C3CA 4EQXA 1D4EA 1COYA 3UKQA 2WPEA 2C65A 3PS9A 4H50A 3GWDA 3GRSA 3AYLA 1BWCA 3CGEA 3RP8A 3EAOA 3ATQA 4H4XA 3LADA 4IVOB 3CPHG 3QSEA 1IUSA 4I59A 1RP0A 3G5SA 3QVRA 2E5VA 2RGJA 2JB3A 3JSKA 1KFYA 1QO8A 4OCGA 2GQFA 1RSGA 4G6GA 3GYJA 1GRTA 1B5QA 3FIMB 4X9NA 4EQWA 4YT0A 2TMDA 4DSHA 4GUVA 1YQZA 4YKFA 1E6EA 3AEDA 2A8XA 4OPTA 3SFDA 2YVJA 3K7MX 4OPDA 1P2HA 4Z26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9S A;  2B9Y A;  1OJT A;  1X31 B;  1REO A;  3CGB A;  4J56 A;  3CNP A;  3CNJ A;  1KSU A;  2YLW A;  4FDC B;  2BAB A;  1XDI A;  5CQF A;  1FL2 A;  1DOE A;  1K0I A;  2C67 A;  1E1M A;  4EMJ A;  2C76 A;  3H4K A;  3V3N A;  2YG4 A;  2Z5X A;  4K5S A;  4YTM A;  2WPC A;  2C66 A;  1ZDL A;  1ELI A;  3AEA A;  3BI5 A;  2YG3 A;  1VG0 A;  2EQ9 A;  4C3X A;  1ZMC A;  3RP7 A;  2CUL A;  2V5Z A;  3ALL A;  4EMW A;  5HYM A;  5L46 A;  1VQW A;  2B9X A;  2QAE A;  3D8X A;  3CND A;  2NPX A;  2YVF A;  1NEK A;  4B69 A;  2GEW A;  3P4S A;  4N9X A;  4EQR A;  2R4E A;  2XVF A;  2YLS A;  4J36 A;  2WPF A;  2NVK X;  4OPG A;  2GB0 A;  3NG7 X;  2Q6U A;  1YY5 A;  1VRQ B;  1SEZ A;  3V76 A;  1GTE A;  1GRG A;  1EL5 A;  2F5Z A;  2C3D A;  3DH9 A;  3FMW A;  1ZMD A;  2WP6 A;  2YLX A;  3EAN A;  2XVH A;  3VR8 A;  2APG A;  4E0V A;  1H86 A;  5C2T A;  2WDV A;  2X8C A;  4NTE A;  3ISH A;  4GCM A;  2GVC A;  1N1P A;  1E39 A;  3AXB A;  3PVC A;  4C74 A;  2R0C A;  3HZL A;  3KPF A;  4YXD A;  2E1M A;  4TM3 A;  3G5R A;  4B66 A;  1RYI A;  1E7P A;  5U25 A;  3V3O A;  1TYP A;  1ZOY A;  2BXS A;  2YLR A;  2A89 A;  1ZKQ A;  2GR1 A;  3G5Q A;  5JCN A;  1GRB A;  2XLR A;  4IVM B;  4LII A;  3ZYX A;  4USQ A;  1PXA A;  2AR8 A;  1TDE A;  2V61 A;  4USR A;  3UKL A;  4DNA A;  4H4P A;  4KX6 A;  2XCG A;  3CPJ G;  4TM1 A;  2IID A;  2WET A;  3BHK A;  3DGZ A;  5EBK A;  1H82 A;  1LJ1 A;  1JU2 A;  4BK3 A;  4U2L A;  4BK1 A;  1XPQ A;  3K7T A;  2GR2 A;  3M13 A;  1JNR A;  3PO7 A;  2BC0 A;  2FJA A;  2VRL A;  1JOA A;  2X8G A;  1CJ2 A;  4NZH A;  4PAA A;  4OPU A;  1H83 A;  1OJA A;  5IQ4 A;  3C96 A;  2B76 A;  3QFB A;  5EOW A;  4BV6 A;  3K7Q X;  1PBF A;  4GF7 A;  4CCQ A;  3BNM A;  2ACZ A;  4Z44 A;  2BS3 A;  5HXI A;  3LZX A;  1L9D A;  4BUR A;  1N4U A;  3VR9 A;  1CL0 A;  2XFN A;  2GAH B;  3M0O A;  2WES A;  2EQ7 A;  2RGO A;  3EF6 A;  4FK1 A;  4A65 A;  4Z43 A;  3GMB A;  3H8I A;  2QA1 A;  1N4V A;  1GEU A;  1S2Q A;  4H4Z A;  4U8M A;  4H2Q A;  4OPL A;  3RHA A;  4AOX A;  5HY5 A;  4JNQ A;  3EPT A;  4TM4 A;  1NHR A;  3P9U A;  1GPE A;  3NTD A;  2E4G A;  3NLC A;  4CRT A;  4H4S A;  2YG6 A;  4AP1 A;  4EIP A;  1ZK7 A;  2GRT A;  3KU9 A;  4XWZ A;  4AOS A;  4K2X A;  2XFO A;  1NHS A;  4OVI A;  4D04 A;  3DK9 A;  2VZ2 A;  1PXC A;  4Z2R A;  2A87 A;  2X8H A;  3AWI A;  3QFA A;  4K7Z A;  4NEV A;  5J60 A;  3WE0 A;  3CN8 A;  3B3R A;  2YWL A;  3AEF A;  2RGH A;  3BI2 A;  3F8D A;  2BCG G;  1D7Y A;  1VDC A;  4GR1 A;  3NH3 X;  1LTX R;  2EQ8 A;  1Z6L A;  3AEG A;  4REK A;  2X3N A;  3KA7 A;  2WHD A;  1Y56 A;  3NT6 A;  3KKJ A;  2DKI A;  1GRH A;  2JBV A;  2QCU A;  2R0G A;  3DJG X;  3OC4 A;  3UOV A;  3OZ2 A;  3L8K A;  1GOS A;  1PJ6 A;  1EL8 A;  4C77 A;  3NYF A;  2CFY A;  1BF3 A;  1DOC A;  2OLN A;  2GMJ A;  1KNR A;  2Y6R A;  4H2R A;  4ADW A;  1NG3 A;  3AE8 A;  1CC4 A;  1BGJ A;  1TDF A;  4RG4 A;  3UOY A;  1F8R A;  2BXR A;  1N4W A;  4J2W A;  3GSI A;  2BK4 A;  2JKC A;  4U8N A;  1HYU A;  4EM3 A;  2XDO A;  3NYC A;  5JCI A;  4J34 A;  2YLT A;  2I0Z A;  3M12 A;  4ZCC A;  3VRD B;  5LV9 A;  2GMH A;  3DJD A;  3DK8 A;  3S5W A;  4JN9 A;  2BCP A;  3QVP A;  3UCL A;  2BYB A;  4UDP A;  3KLJ A;  1L9C A;  4ZN0 A;  4GDE A;  3AEB A;  3GD3 A;  3LZW A;  2XLT A;  2C7G A;  4H4Q A;  2R46 A;  5JCM A;  5KOW A;  2WBA A;  4A79 A;  1CC2 A;  4RG3 A;  4U8P A;  4J57 A;  4EM4 A;  3NKS A;  4CY8 A;  1FEA A;  1P2E A;  1IUT A;  3IC9 A;  1PBC A;  4A9W A;  2FBW A;  2GF3 A;  2JB1 A;  2UZZ A;  3CNS A;  1O95 A;  2XVE A;  4TM0 A;  1DOB A;  4A6N B;  1K4Q A;  3LJP A;  3BI4 A;  2WOI A;  4B1B A;  4YSX A;  2OAL A;  2C64 A;  1KSS A;  1PXB A;  5U63 A;  3NK2 X;  1E1N A;  1PDH A;  2ARD A;  1CJ3 A;  2ZBW A;  4I58 A;  4U8K A;  4A7A A;  2X50 A;  2BA9 A;  2JAE A;  2R9Z A;  3S61 A;  1K0J A;  4YTN A;  4KPR A;  3ALM A;  3UKH A;  4U8J A;  1Q9I A;  4OPI A;  1GET A;  3NTA A;  3P4R A;  4H4Y A;  2Q0L A;  4MJW A;  4BK2 A;  4D03 A;  1LQT A;  3AE7 A;  3R9U A;  1H84 A;  4JY2 A;  2C73 A;  4CBQ A;  1F6M A;  3ICT A;  2IVD A;  1NEN A;  1QJD A;  1H7X A;  3COX A;  4J33 A;  5J7X A;  4K22 A;  1FCD A;  2VVL A;  2YM1 A;  3AEC A;  1LQU A;  4FK1 C;  3GDN A;  5FS8 A;  3GWF A;  4DSG A;  4OPC A;  4PAB A;  3II4 A;  2Q7V A;  2R4J A;  2YVG A;  2ZZ0 A;  3NYE A;  4K8D A;  5CKU A;  3UKA A;  4CY6 A;  2GR3 A;  4DGK A;  4YSH A;  1NHP A;  3I6D A;  2Y6Q A;  1PBE A;  2VQ7 A;  3UTE A;  4EIQ A;  4H4V A;  1ZY8 A;  1NG4 A;  3UOX A;  1VG9 A;  2V3A A;  3AE2 A;  1KNP A;  1LV0 A;  2FJE A;  3CPI G;  5M10 A;  2B7R A;  1ZOV A;  3ICS A;  2VOU A;  4U2T A;  3I3L A;  3NN0 X;  4UDQ A;  4APN A;  3AE6 A;  4WCT A;  1BGN A;  4NTD A;  2YR5 A;  3UKP A;  4C3Y A;  2BK3 A;  2XLU A;  3Q9T A;  5FS7 A;  2B7S A;  5KVH A;  2BS4 A;  4JDR A;  4TLZ A;  2H89 A;  3GYI A;  3AYI A;  1UKV G;  1Q1W A;  3VRA A;  4YKG A;  4O5U A;  1MO9 A;  1GV4 A;  1BKW A;  1CC6 A;  1OJ9 A;  3DJJ A;  3UP5 A;  4AT0 A;  2PHH A;  1DNC A;  2WU5 A;  3GMC A;  4HA6 A;  2VRM A;  3SQP A;  4J31 A;  2EQ6 A;  5IQ1 A;  1GXF A;  2WQY A;  1E1L A;  2GQW A;  2O9Z A;  5BRT A;  2AQJ A;  1GRF A;  3GRT A;  2ZZC A;  3K30 A;  3NGC X;  4B64 A;  3L1R A;  3ZDN A;  4EMI A;  1GTH A;  4H2N A;  2WP5 A;  1F8W A;  1FOH A;  1D5T A;  3E1T A;  2BK5 A;  5KWF A;  4U8O A;  1H7W A;  2CVJ A;  2GR0 A;  4IA5 A;  1LVL A;  5U1O A;  2VVL G;  4H7U A;  2WDQ A;  3KD9 A;  2C75 A;  4JQ9 A;  4YSY A;  2JB2 A;  2BC1 A;  1DJQ A;  4BJY A;  3LOV A;  1PJ7 A;  3NK0 X;  3RP6 A;  4AP3 A;  1ZP0 A;  2XFP A;  3FPZ A;  3UP4 A;  4Z25 A;  4GDP A;  4CNK A;  1NPX A;  2B9W A;  3P4Q A;  2YR4 A;  2PYX A;  3DA1 A;  4ECH A;  2C70 A;  3NRN A;  3NNE A;  5ER0 A;  1EL9 A;  1MOK A;  1PJ5 A;  3AD8 B;  3FG2 P;  1K0L A;  3UTG A;  3C4N A;  4EQS A;  3IWA A;  1ONF A;  2DKH A;  1JEH A;  1S2Y A;  4H4W A;  3CNT A;  4X9M A;  3RED A;  3VQR A;  3NN6 X;  5JCK A;  3NIX A;  5KVI A;  3AE4 A;  1PBD A;  2YG7 A;  3UTF A;  1EBD A;  2R0P A;  2WOW A;  1O94 A;  4K5R A;  2YR6 A;  2OLO A;  1KF6 A;  1GND A;  2AAQ A;  2V60 A;  4ICY A;  4Y4M A;  4TLX A;  2BAC A;  3AEE A;  1D4D A;  3BHF A;  1EL7 A;  3O0H A;  5FS6 A;  3SM8 A;  2H88 A;  2XYO A;  1H6V A;  1CF3 A;  3CGC A;  2FJB A;  2WP9 A;  3P1W A;  1NDA A;  1YQ4 A;  3DGH A;  4Y4L A;  3AE3 A;  3QSS A;  2IVE A;  5BVA A;  3NK1 X;  1H81 A;  1CJ4 A;  4A5L A;  4H4R A;  2OA1 A;  2YM2 A;  4M52 A;  2FJD A;  4X4J A;  4B65 A;  1M6I A;  5HHF A;  2WS3 A;  1V59 A;  5FS9 A;  1B4V A;  5DBJ A;  4XWR A;  4RSL A;  4Z2U A;  3KVE A;  1IJH A;  1S3E A;  2YLZ A;  3DJE A;  3IF9 A;  1D4C A;  4B63 A;  4H2P A;  1CHU A;  1LPF A;  4NEW A;  4XXG A;  1Y0P A;  2BS2 A;  1PN0 A;  1L9E A;  3SGL A;  1XHC A;  4LA1 A;  2QA2 A;  2WOV A;  4LU6 A;  1FEC A;  1M64 A;  4UDR A;  5GRT A;  4BJZ A;  5IPY A;  4C5O A;  2XVJ A;  1DXL A;  1D7L A;  2JK6 A;  5TR3 A;  4UP3 A;  2VQB A;  3CTY A;  2WEU A;  2R45 A;  5FMH A;  3GDP A;  5GSN A;  3UOZ A;  3AE1 A;  2YG5 A;  2XVI A;  3IHM A;  3Q6J A;  1YKJ A;  2Z5Y A;  1PBB A;  5M0Z A;  3AD7 B;  1F8S A;  2HQM A;  4AT2 A;  3AD9 B;  3UKK A;  1GT8 A;  4GRT A;  4A99 A;  4YTP A;  4U8L A;  5EB5 A;  2XFQ A;  4O5Q A;  1TYT A;  3AE9 A;  5BUL A;  4FX9 A;  1B37 A;  1JRX A;  2GH5 A;  3RNM A;  3FBS A;  1YQ3 A;  3DME A;  2ZZB A;  1B8S A;  4A6N A;  4B68 A;  1TRB A;  5KOX A;  1GSN A;  1S3B A;  3AYJ A;  1W4X A;  4ZCD A;  4B67 A;  2WDR A;  3D1C A;  4Z24 A;  1NHQ A;  2GV8 A;  1PS9 A;  3AB1 A;  4YWO A;  1DOD A;  3DK4 A;  1OJD A;  3CGD A;  3LB8 A;  1BZL A;  3GD4 A;  1KDG A;  3IHG A;  4CNJ A;  2XFU A;  5KRQ A;  3B6D A;  5KXJ A;  2W0H A;  1F3P A;  2J3N A;  4WX1 A;  2WU2 A;  3URH A;  2CDU A;  3ADA B;  1DJN A;  2OAM A;  1IUU A;  1GES A;  3UTH A;  4Z2T A;  1CJC A;  2C72 A;  3T37 A;  2V3B A;  5BUK A;  1QLB A;  2GAG B;  4IV9 A;  4Y4N A;  1L0V A;  2X99 A;  2YAU A;  1GRA A;  2V6O A;  1TDK A;  2Q0K A;  2VVM A;  3QJ4 A;  1O5W A;  1GAL A;  1ZX9 A;  2XLS A;  1GRE A;  3CIR A;  3QSM A;  1PHH A;  1TDO A;  4JNA A;  3ALJ A;  2YQU A;  5JCL A;  3C4A A;  1JRY A;  1OJC A;  1AOG A;  3F8P A;  3SFE A;  3ITJ A;  3F8R A;  3ABV A;  1IUV A;  4NTC A;  5C3J A;  4IA6 A;  1MXT A;  1IUX A;  1CBO A;  4U2S A;  1TDN A;  5EB4 A;  1NAA A;  1JNZ A;  4H4T A;  1XAN A;  1Y56 B;  3LXD A;  1Q1R A;  3ICR A;  1IUW A;  3AE5 A;  1GER A;  3P4P A;  3NHO X;  4JY3 A;  4CCR A;  2TPR A;  3VRB A;  2XLP A;  3BNU A;  1JRZ A;  1FEB A;  2RAB A;  3ATR A;  4H4U A;  3UKF A;  3H8L A;  4HB9 A;  4U8I A;  4YSZ A;  1E1K A;  2C3C A;  4EQX A;  1D4E A;  1COY A;  3UKQ A;  2WPE A;  2C65 A;  3PS9 A;  4H50 A;  3GWD A;  3GRS A;  3AYL A;  1BWC A;  3CGE A;  3RP8 A;  3EAO A;  3ATQ A;  4H4X A;  3LAD A;  4IVO B;  3CPH G;  3QSE A;  1IUS A;  4I59 A;  1RP0 A;  3G5S A;  3QVR A;  2E5V A;  2RGJ A;  2JB3 A;  3JSK A;  1KFY A;  1QO8 A;  4OCG A;  2GQF A;  1RSG A;  3GYJ A;  1GRT A;  1B5Q A;  3FIM B;  4X9N A;  4EQW A;  4YT0 A;  2TMD A;  4DSH A;  4GUV A;  1YQZ A;  4YKF A;  1E6E A;  3AED A;  2A8X A;  4OPT A;  3SFD A;  2YVJ A;  3K7M X;  4OPD A;  1P2H A;  4Z26 A; 
#chains in the Genus database with same CATH topology
 4P9S A;  2B9Y A;  1OJT A;  1X31 B;  1REO A;  3CGB A;  4J56 A;  3CNP A;  3CNJ A;  1KSU A;  2YLW A;  4FDC B;  2BAB A;  1XDI A;  3HYW A;  5CQF A;  1FL2 A;  1DOE A;  1K0I A;  2C67 A;  1E1M A;  4EMJ A;  2C76 A;  3H4K A;  3V3N A;  2YG4 A;  2Z5X A;  4K5S A;  4YTM A;  3SZW A;  2WPC A;  2C66 A;  1ZDL A;  1ELI A;  3AEA A;  3BI5 A;  2YG3 A;  1VG0 A;  2EQ9 A;  4C3X A;  1ZMC A;  3RP7 A;  2CUL A;  2V5Z A;  3ALL A;  4EMW A;  5HYM A;  5L46 A;  1VQW A;  2B9X A;  2QAE A;  3D8X A;  3CND A;  2NPX A;  2YVF A;  1NEK A;  4B69 A;  2GEW A;  3P4S A;  4N9X A;  4EQR A;  2R4E A;  2XVF A;  2YLS A;  4J36 A;  3SZ0 A;  2WPF A;  2NVK X;  4OPG A;  2GB0 A;  3NG7 X;  2Q6U A;  1YY5 A;  1VRQ B;  1SEZ A;  3V76 A;  1GTE A;  1GRG A;  1EL5 A;  2F5Z A;  2C3D A;  3DH9 A;  3FMW A;  1ZMD A;  2WP6 A;  2YLX A;  3EAN A;  2XVH A;  3VR8 A;  3KPK A;  2APG A;  4E0V A;  1H86 A;  5C2T A;  2WDV A;  2X8C A;  4NTE A;  3ISH A;  4GCM A;  2GVC A;  1N1P A;  1E39 A;  3AXB A;  3PVC A;  4C74 A;  2R0C A;  3HZL A;  3KPF A;  4YXD A;  2E1M A;  4TM3 A;  3G5R A;  4B66 A;  1RYI A;  1E7P A;  5U25 A;  3V3O A;  1TYP A;  1ZOY A;  2BXS A;  2YLR A;  2A89 A;  1ZKQ A;  2GR1 A;  3G5Q A;  5JCN A;  1GRB A;  2XLR A;  4IVM B;  4LII A;  3ZYX A;  4USQ A;  1PXA A;  2AR8 A;  1TDE A;  2V61 A;  4USR A;  3UKL A;  4DNA A;  4H4P A;  4KX6 A;  2XCG A;  3CPJ G;  4TM1 A;  2IID A;  2WET A;  3BHK A;  3DGZ A;  5EBK A;  1H82 A;  4GAV A;  1LJ1 A;  1JU2 A;  4BK3 A;  4U2L A;  4BK1 A;  1XPQ A;  3K7T A;  2GR2 A;  3M13 A;  1JNR A;  3PO7 A;  2BC0 A;  2FJA A;  2VRL A;  1JOA A;  2X8G A;  1CJ2 A;  4NZH A;  4PAA A;  4OPU A;  1H83 A;  1OJA A;  5IQ4 A;  3C96 A;  2B76 A;  3QFB A;  5EOW A;  4BV6 A;  3K7Q X;  1PBF A;  4GF7 A;  4CCQ A;  3BNM A;  2ACZ A;  4Z44 A;  5KMR A;  2BS3 A;  5HXI A;  3LZX A;  1L9D A;  4BUR A;  1N4U A;  3VR9 A;  1CL0 A;  2XFN A;  5KMS A;  2GAH B;  3M0O A;  2WES A;  2EQ7 A;  2RGO A;  3EF6 A;  4FK1 A;  4A65 A;  4Z43 A;  3GMB A;  3H8I A;  2QA1 A;  1N4V A;  1GEU A;  1S2Q A;  4H4Z A;  4U8M A;  4H2Q A;  3GYX A;  4OPL A;  3RHA A;  4AOX A;  4JNQ A;  3EPT A;  5HY5 A;  4TM4 A;  1NHR A;  3P9U A;  1GPE A;  3NTD A;  2E4G A;  3NLC A;  3SX6 A;  4CRT A;  4H4S A;  2YG6 A;  4AP1 A;  4EIP A;  1ZK7 A;  2GRT A;  3KU9 A;  4XWZ A;  4AOS A;  4K2X A;  2XFO A;  1NHS A;  4OVI A;  4D04 A;  3DK9 A;  2VZ2 A;  3SY4 A;  1PXC A;  4Z2R A;  2A87 A;  2X8H A;  3AWI A;  3QFA A;  4K7Z A;  4NEV A;  5J60 A;  3WE0 A;  3CN8 A;  3B3R A;  2YWL A;  3AEF A;  2RGH A;  3BI2 A;  3F8D A;  2BCG G;  1D7Y A;  1VDC A;  4GR1 A;  3NH3 X;  1LTX R;  2EQ8 A;  1Z6L A;  3AEG A;  4REK A;  2X3N A;  3KA7 A;  2WHD A;  1Y56 A;  3NT6 A;  3KKJ A;  2DKI A;  1GRH A;  2JBV A;  2QCU A;  2R0G A;  3DJG X;  3OC4 A;  3UOV A;  4G73 A;  3OZ2 A;  3L8K A;  1GOS A;  1PJ6 A;  1EL8 A;  4C77 A;  3NYF A;  2CFY A;  1BF3 A;  1DOC A;  2OLN A;  2GMJ A;  1KNR A;  2Y6R A;  4II3 A;  3T2Y A;  4H2R A;  4ADW A;  1NG3 A;  3AE8 A;  1CC4 A;  1BGJ A;  1TDF A;  4RG4 A;  3UOY A;  1F8R A;  2BXR A;  1N4W A;  4J2W A;  3GSI A;  2BK4 A;  2JKC A;  4U8N A;  1HYU A;  4EM3 A;  2XDO A;  3NYC A;  5JCI A;  4J34 A;  3T0K A;  4NWZ A;  2YLT A;  2I0Z A;  3M12 A;  4NNJ A;  4ZCC A;  3VRD B;  5LV9 A;  2GMH A;  3DJD A;  3DK8 A;  3S5W A;  4JN9 A;  2BCP A;  3QVP A;  3UCL A;  2BYB A;  4UDP A;  3KLJ A;  1L9C A;  4ZN0 A;  4GDE A;  3AEB A;  3GD3 A;  3LZW A;  2XLT A;  2C7G A;  4H4Q A;  2R46 A;  5JCM A;  5KOW A;  2WBA A;  4A79 A;  1CC2 A;  4RG3 A;  4U8P A;  4J57 A;  4EM4 A;  3NKS A;  4CY8 A;  1FEA A;  1P2E A;  3CMM A;  1IUT A;  3IC9 A;  1PBC A;  4G9K A;  4A9W A;  2FBW A;  2GF3 A;  2JB1 A;  2UZZ A;  3T2K A;  3CNS A;  1O95 A;  2XVE A;  4TM0 A;  1DOB A;  4A6N B;  1K4Q A;  3LJP A;  3BI4 A;  2WOI A;  4B1B A;  4YSX A;  2OAL A;  2BRA A;  5KMP A;  2C64 A;  1KSS A;  1PXB A;  5U63 A;  3NK2 X;  1E1N A;  1PDH A;  2ARD A;  1CJ3 A;  2ZBW A;  4I58 A;  4U8K A;  2C4C A;  4A7A A;  2X50 A;  2BA9 A;  2JAE A;  2R9Z A;  3S61 A;  1K0J A;  3T14 A;  4KPR A;  4YTN A;  3ALM A;  3UKH A;  4U8J A;  1Q9I A;  4OPI A;  1GET A;  3NTA A;  3P4R A;  4H4Y A;  2Q0L A;  4MJW A;  4BK2 A;  4D03 A;  1LQT A;  3AE7 A;  3R9U A;  1H84 A;  4JY2 A;  2C73 A;  4CBQ A;  1F6M A;  3ICT A;  2IVD A;  1NEN A;  1QJD A;  1H7X A;  3COX A;  4J33 A;  5J7X A;  4K22 A;  1FCD A;  2VVL A;  2YM1 A;  3AEC A;  1LQU A;  4FK1 C;  3GDN A;  5FS8 A;  3GWF A;  4DSG A;  4OPC A;  4PAB A;  3II4 A;  2Q7V A;  2R4J A;  2YVG A;  2ZZ0 A;  3HYV A;  3NYE A;  4K8D A;  5CKU A;  3UKA A;  4CY6 A;  2GR3 A;  4DGK A;  4YSH A;  1NHP A;  3I6D A;  2Y6Q A;  1PBE A;  2VQ7 A;  3UTE A;  4EIQ A;  4H4V A;  1ZY8 A;  1NG4 A;  3UOX A;  1VG9 A;  2V3A A;  3AE2 A;  1KNP A;  1LV0 A;  2FJE A;  3CPI G;  5M10 A;  2B7R A;  3SYI A;  1ZOV A;  3ICS A;  2VOU A;  4U2T A;  3I3L A;  3NN0 X;  4UDQ A;  4APN A;  3AE6 A;  4WCT A;  1BGN A;  4NTD A;  2YR5 A;  3UKP A;  4C3Y A;  2BK3 A;  2XLU A;  3Q9T A;  5FS7 A;  2B7S A;  5KVH A;  2BS4 A;  4JDR A;  4TLZ A;  2H89 A;  3GYI A;  3AYI A;  1UKV G;  4G6H A;  1Q1W A;  3VRA A;  4YKG A;  4O5U A;  1MO9 A;  1GV4 A;  1BKW A;  1CC6 A;  1OJ9 A;  3DJJ A;  3UP5 A;  4AT0 A;  2PHH A;  1DNC A;  2WU5 A;  3GMC A;  4HA6 A;  2VRM A;  3SQP A;  4J31 A;  4II2 A;  2EQ6 A;  5IQ1 A;  1GXF A;  2WQY A;  1E1L A;  2GQW A;  2O9Z A;  5BRT A;  2AQJ A;  1GRF A;  3GRT A;  2ZZC A;  3K30 A;  3NGC X;  4B64 A;  3L1R A;  3ZDN A;  4EMI A;  1GTH A;  4H2N A;  2WP5 A;  1F8W A;  1FOH A;  1D5T A;  3E1T A;  2BK5 A;  4GAP A;  5KWF A;  4U8O A;  1H7W A;  2CVJ A;  2GR0 A;  4IA5 A;  1LVL A;  5U1O A;  2VVL G;  4H7U A;  2WDQ A;  3KD9 A;  2C75 A;  4JQ9 A;  4YSY A;  2JB2 A;  2BC1 A;  1DJQ A;  4BJY A;  3LOV A;  1PJ7 A;  3NK0 X;  3RP6 A;  4AP3 A;  1ZP0 A;  2XFP A;  3FPZ A;  3UP4 A;  4Z25 A;  4GDP A;  4CNK A;  1NPX A;  2B9W A;  3P4Q A;  2YR4 A;  2PYX A;  3DA1 A;  4ECH A;  2C70 A;  3NRN A;  3NNE A;  5ER0 A;  1EL9 A;  1MOK A;  1PJ5 A;  3AD8 B;  3FG2 P;  1K0L A;  3UTG A;  3C4N A;  4EQS A;  5KMQ A;  3IWA A;  1ONF A;  2DKH A;  1JEH A;  1S2Y A;  4H4W A;  3CNT A;  4X9M A;  3RED A;  3VQR A;  3NN6 X;  5JCK A;  3NIX A;  5KVI A;  3AE4 A;  2BRY A;  1PBD A;  2YG7 A;  3UTF A;  1EBD A;  2R0P A;  2WOW A;  1O94 A;  4K5R A;  2YR6 A;  2OLO A;  1KF6 A;  1GND A;  2AAQ A;  2V60 A;  4ICY A;  4Y4M A;  4TLX A;  2BAC A;  3AEE A;  1D4D A;  3BHF A;  1EL7 A;  3O0H A;  5FS6 A;  3SM8 A;  2H88 A;  2XYO A;  1H6V A;  1CF3 A;  3CGC A;  2FJB A;  2WP9 A;  3P1W A;  1NDA A;  1YQ4 A;  3DGH A;  4Y4L A;  3AE3 A;  3QSS A;  2IVE A;  3HYX A;  5BVA A;  3T2Z A;  3NK1 X;  1H81 A;  1CJ4 A;  4A5L A;  4H4R A;  2OA1 A;  2YM2 A;  4M52 A;  3SZF A;  2FJD A;  4X4J A;  4B65 A;  1M6I A;  5HHF A;  2WS3 A;  1V59 A;  3SZC A;  5FS9 A;  1B4V A;  5DBJ A;  4XWR A;  4RSL A;  4Z2U A;  3KVE A;  1IJH A;  1S3E A;  2YLZ A;  3DJE A;  3IF9 A;  1D4C A;  4B63 A;  4H2P A;  1CHU A;  1LPF A;  4NEW A;  4XXG A;  1Y0P A;  2BS2 A;  1PN0 A;  1L9E A;  3SGL A;  1XHC A;  4LA1 A;  2QA2 A;  2WOV A;  4LU6 A;  1FEC A;  1M64 A;  4UDR A;  5GRT A;  4BJZ A;  5IPY A;  4C5O A;  2XVJ A;  3SXI A;  1DXL A;  1D7L A;  2JK6 A;  5TR3 A;  5KNL A;  4UP3 A;  2VQB A;  3CTY A;  2WEU A;  2R45 A;  5FMH A;  3GDP A;  5GSN A;  3UOZ A;  3AE1 A;  2YG5 A;  2XVI A;  3IHM A;  3Q6J A;  1YKJ A;  2Z5Y A;  1PBB A;  5M0Z A;  3AD7 B;  1F8S A;  2HQM A;  4AT2 A;  3AD9 B;  3UKK A;  1GT8 A;  4GRT A;  4A99 A;  4YTP A;  4U8L A;  5EB5 A;  2XFQ A;  4O5Q A;  1TYT A;  3AE9 A;  5BUL A;  4FX9 A;  1B37 A;  1JRX A;  2GH5 A;  3RNM A;  3FBS A;  1YQ3 A;  3DME A;  2ZZB A;  1B8S A;  3T31 A;  4A6N A;  4B68 A;  1TRB A;  5KOX A;  1GSN A;  1S3B A;  3AYJ A;  1W4X A;  4G74 A;  4ZCD A;  4B67 A;  2WDR A;  3D1C A;  4Z24 A;  1NHQ A;  2GV8 A;  1PS9 A;  3AB1 A;  4YWO A;  1DOD A;  3DK4 A;  1OJD A;  3CGD A;  3LB8 A;  1BZL A;  3GD4 A;  1KDG A;  3IHG A;  4CNJ A;  2XFU A;  5KRQ A;  3B6D A;  5KXJ A;  2W0H A;  1F3P A;  2J3N A;  4WX1 A;  2WU2 A;  3URH A;  2CDU A;  3ADA B;  1DJN A;  2OAM A;  1IUU A;  1GES A;  3UTH A;  4Z2T A;  1CJC A;  2C72 A;  3T37 A;  2V3B A;  5BUK A;  1QLB A;  2GAG B;  4IV9 A;  4Y4N A;  1L0V A;  2X99 A;  2YAU A;  1GRA A;  2V6O A;  1TDK A;  2Q0K A;  2VVM A;  3QJ4 A;  1O5W A;  1GAL A;  1ZX9 A;  2XLS A;  1GRE A;  3CIR A;  3QSM A;  1PHH A;  1TDO A;  4JNA A;  3ALJ A;  2YQU A;  5JCL A;  3C4A A;  1JRY A;  1OJC A;  1AOG A;  3F8P A;  3SFE A;  3ITJ A;  3F8R A;  3ABV A;  1IUV A;  4NTC A;  5C3J A;  4IA6 A;  1MXT A;  1IUX A;  1CBO A;  4U2S A;  1TDN A;  5EB4 A;  1NAA A;  1JNZ A;  4H4T A;  1XAN A;  1Y56 B;  3LXD A;  1Q1R A;  3ICR A;  1IUW A;  3AE5 A;  1GER A;  3P4P A;  3NHO X;  4JY3 A;  4CCR A;  2TPR A;  3VRB A;  2XLP A;  3BNU A;  1JRZ A;  1FEB A;  2RAB A;  3ATR A;  4H4U A;  3UKF A;  3H8L A;  4HB9 A;  4U8I A;  4YSZ A;  1E1K A;  2C3C A;  4EQX A;  1D4E A;  1COY A;  3UKQ A;  2WPE A;  2C65 A;  3PS9 A;  4H50 A;  3GWD A;  3GRS A;  3AYL A;  1BWC A;  3CGE A;  3RP8 A;  3EAO A;  3ATQ A;  4H4X A;  3LAD A;  4IVO B;  3CPH G;  3QSE A;  1IUS A;  4I59 A;  1RP0 A;  3G5S A;  3QVR A;  2E5V A;  2RGJ A;  2JB3 A;  3JSK A;  1KFY A;  1QO8 A;  4OCG A;  2GQF A;  1RSG A;  4G6G A;  3GYJ A;  1GRT A;  1B5Q A;  3FIM B;  4X9N A;  4EQW A;  4YT0 A;  2TMD A;  4DSH A;  4GUV A;  1YQZ A;  4YKF A;  1E6E A;  3AED A;  2A8X A;  4OPT A;  3SFD A;  2YVJ A;  3K7M X;  4OPD A;  1P2H A;  4Z26 A; 
#chains in the Genus database with same CATH homology
 4P9S A;  2B9Y A;  1OJT A;  1X31 B;  1REO A;  3CGB A;  4J56 A;  3CNP A;  3CNJ A;  1KSU A;  2YLW A;  4FDC B;  2BAB A;  1XDI A;  3HYW A;  5CQF A;  1FL2 A;  1DOE A;  1K0I A;  2C67 A;  1E1M A;  4EMJ A;  2C76 A;  3H4K A;  3V3N A;  2YG4 A;  2Z5X A;  4K5S A;  4YTM A;  3SZW A;  2WPC A;  2C66 A;  1ZDL A;  1ELI A;  3AEA A;  3BI5 A;  2YG3 A;  1VG0 A;  2EQ9 A;  4C3X A;  1ZMC A;  3RP7 A;  2CUL A;  2V5Z A;  3ALL A;  4EMW A;  5HYM A;  5L46 A;  1VQW A;  2B9X A;  2QAE A;  3D8X A;  3CND A;  2NPX A;  2YVF A;  1NEK A;  4B69 A;  2GEW A;  3P4S A;  4N9X A;  4EQR A;  2R4E A;  2XVF A;  2YLS A;  4J36 A;  3SZ0 A;  2WPF A;  2NVK X;  4OPG A;  2GB0 A;  3NG7 X;  2Q6U A;  1YY5 A;  1VRQ B;  1SEZ A;  3V76 A;  1GTE A;  1GRG A;  1EL5 A;  2F5Z A;  2C3D A;  3DH9 A;  3FMW A;  1ZMD A;  2WP6 A;  2YLX A;  3EAN A;  2XVH A;  3VR8 A;  3KPK A;  2APG A;  4E0V A;  1H86 A;  5C2T A;  2WDV A;  2X8C A;  4NTE A;  3ISH A;  4GCM A;  2GVC A;  1N1P A;  1E39 A;  3AXB A;  3PVC A;  4C74 A;  2R0C A;  3HZL A;  3KPF A;  4YXD A;  2E1M A;  4TM3 A;  3G5R A;  4B66 A;  1RYI A;  1E7P A;  5U25 A;  3V3O A;  1TYP A;  1ZOY A;  2BXS A;  2YLR A;  2A89 A;  1ZKQ A;  2GR1 A;  3G5Q A;  5JCN A;  1GRB A;  2XLR A;  4IVM B;  4LII A;  3ZYX A;  4USQ A;  1PXA A;  2AR8 A;  1TDE A;  2V61 A;  4USR A;  3UKL A;  4DNA A;  4H4P A;  4KX6 A;  2XCG A;  3CPJ G;  4TM1 A;  2IID A;  2WET A;  3BHK A;  3DGZ A;  5EBK A;  1H82 A;  4GAV A;  1LJ1 A;  1JU2 A;  4BK3 A;  4U2L A;  4BK1 A;  1XPQ A;  3K7T A;  2GR2 A;  3M13 A;  1JNR A;  3PO7 A;  2BC0 A;  2FJA A;  2VRL A;  1JOA A;  2X8G A;  1CJ2 A;  4NZH A;  4PAA A;  4OPU A;  1H83 A;  1OJA A;  5IQ4 A;  3C96 A;  2B76 A;  3QFB A;  5EOW A;  4BV6 A;  3K7Q X;  1PBF A;  4GF7 A;  4CCQ A;  3BNM A;  2ACZ A;  4Z44 A;  5KMR A;  2BS3 A;  5HXI A;  3LZX A;  1L9D A;  4BUR A;  1N4U A;  3VR9 A;  1CL0 A;  2XFN A;  5KMS A;  2GAH B;  3M0O A;  2WES A;  2EQ7 A;  2RGO A;  3EF6 A;  4FK1 A;  4A65 A;  4Z43 A;  3GMB A;  3H8I A;  2QA1 A;  1N4V A;  1GEU A;  1S2Q A;  4H4Z A;  4U8M A;  4H2Q A;  3GYX A;  4OPL A;  3RHA A;  4AOX A;  4JNQ A;  3EPT A;  5HY5 A;  4TM4 A;  1NHR A;  3P9U A;  1GPE A;  3NTD A;  2E4G A;  3NLC A;  3SX6 A;  4CRT A;  4H4S A;  2YG6 A;  4AP1 A;  4EIP A;  1ZK7 A;  2GRT A;  3KU9 A;  4XWZ A;  4AOS A;  4K2X A;  2XFO A;  1NHS A;  4OVI A;  4D04 A;  3DK9 A;  2VZ2 A;  3SY4 A;  1PXC A;  4Z2R A;  2A87 A;  2X8H A;  3AWI A;  3QFA A;  4K7Z A;  4NEV A;  5J60 A;  3WE0 A;  3CN8 A;  3B3R A;  2YWL A;  3AEF A;  2RGH A;  3BI2 A;  3F8D A;  2BCG G;  1D7Y A;  1VDC A;  4GR1 A;  3NH3 X;  1LTX R;  2EQ8 A;  1Z6L A;  3AEG A;  4REK A;  2X3N A;  3KA7 A;  2WHD A;  1Y56 A;  3NT6 A;  3KKJ A;  2DKI A;  1GRH A;  2JBV A;  2QCU A;  2R0G A;  3DJG X;  3OC4 A;  3UOV A;  4G73 A;  3OZ2 A;  3L8K A;  1GOS A;  1PJ6 A;  1EL8 A;  4C77 A;  3NYF A;  2CFY A;  1BF3 A;  1DOC A;  2OLN A;  2GMJ A;  1KNR A;  2Y6R A;  4II3 A;  3T2Y A;  4H2R A;  4ADW A;  1NG3 A;  3AE8 A;  1CC4 A;  1BGJ A;  1TDF A;  4RG4 A;  3UOY A;  1F8R A;  2BXR A;  1N4W A;  4J2W A;  3GSI A;  2BK4 A;  2JKC A;  4U8N A;  1HYU A;  4EM3 A;  2XDO A;  3NYC A;  5JCI A;  4J34 A;  3T0K A;  4NWZ A;  2YLT A;  2I0Z A;  3M12 A;  4NNJ A;  4ZCC A;  3VRD B;  5LV9 A;  2GMH A;  3DJD A;  3DK8 A;  3S5W A;  4JN9 A;  2BCP A;  3QVP A;  3UCL A;  2BYB A;  4UDP A;  3KLJ A;  1L9C A;  4ZN0 A;  4GDE A;  3AEB A;  3GD3 A;  3LZW A;  2XLT A;  2C7G A;  4H4Q A;  2R46 A;  5JCM A;  5KOW A;  2WBA A;  4A79 A;  1CC2 A;  4RG3 A;  4U8P A;  4J57 A;  4EM4 A;  3NKS A;  4CY8 A;  1FEA A;  1P2E A;  3CMM A;  1IUT A;  3IC9 A;  1PBC A;  4G9K A;  4A9W A;  2FBW A;  2GF3 A;  2JB1 A;  2UZZ A;  3T2K A;  3CNS A;  1O95 A;  2XVE A;  4TM0 A;  1DOB A;  4A6N B;  1K4Q A;  3LJP A;  3BI4 A;  2WOI A;  4B1B A;  4YSX A;  2OAL A;  2BRA A;  5KMP A;  2C64 A;  1KSS A;  1PXB A;  5U63 A;  3NK2 X;  1E1N A;  1PDH A;  2ARD A;  1CJ3 A;  2ZBW A;  4I58 A;  4U8K A;  2C4C A;  4A7A A;  2X50 A;  2BA9 A;  2JAE A;  2R9Z A;  3S61 A;  1K0J A;  3T14 A;  4KPR A;  4YTN A;  3ALM A;  3UKH A;  4U8J A;  1Q9I A;  4OPI A;  1GET A;  3NTA A;  3P4R A;  4H4Y A;  2Q0L A;  4MJW A;  4BK2 A;  4D03 A;  1LQT A;  3AE7 A;  3R9U A;  1H84 A;  4JY2 A;  2C73 A;  4CBQ A;  1F6M A;  3ICT A;  2IVD A;  1NEN A;  1QJD A;  1H7X A;  3COX A;  4J33 A;  5J7X A;  4K22 A;  1FCD A;  2VVL A;  2YM1 A;  3AEC A;  1LQU A;  4FK1 C;  3GDN A;  5FS8 A;  3GWF A;  4DSG A;  4OPC A;  4PAB A;  3II4 A;  2Q7V A;  2R4J A;  2YVG A;  2ZZ0 A;  3HYV A;  3NYE A;  4K8D A;  5CKU A;  3UKA A;  4CY6 A;  2GR3 A;  4DGK A;  4YSH A;  1NHP A;  3I6D A;  2Y6Q A;  1PBE A;  2VQ7 A;  3UTE A;  4EIQ A;  4H4V A;  1ZY8 A;  1NG4 A;  3UOX A;  1VG9 A;  2V3A A;  3AE2 A;  1KNP A;  1LV0 A;  2FJE A;  3CPI G;  5M10 A;  2B7R A;  3SYI A;  1ZOV A;  3ICS A;  2VOU A;  4U2T A;  3I3L A;  3NN0 X;  4UDQ A;  4APN A;  3AE6 A;  4WCT A;  1BGN A;  4NTD A;  2YR5 A;  3UKP A;  4C3Y A;  2BK3 A;  2XLU A;  3Q9T A;  5FS7 A;  2B7S A;  5KVH A;  2BS4 A;  4JDR A;  4TLZ A;  2H89 A;  3GYI A;  3AYI A;  1UKV G;  4G6H A;  1Q1W A;  3VRA A;  4YKG A;  4O5U A;  1MO9 A;  1GV4 A;  1BKW A;  1CC6 A;  1OJ9 A;  3DJJ A;  3UP5 A;  4AT0 A;  2PHH A;  1DNC A;  2WU5 A;  3GMC A;  4HA6 A;  2VRM A;  3SQP A;  4J31 A;  4II2 A;  2EQ6 A;  5IQ1 A;  1GXF A;  2WQY A;  1E1L A;  2GQW A;  2O9Z A;  5BRT A;  2AQJ A;  1GRF A;  3GRT A;  2ZZC A;  3K30 A;  3NGC X;  4B64 A;  3L1R A;  3ZDN A;  4EMI A;  1GTH A;  4H2N A;  2WP5 A;  1F8W A;  1FOH A;  1D5T A;  3E1T A;  2BK5 A;  4GAP A;  5KWF A;  4U8O A;  1H7W A;  2CVJ A;  2GR0 A;  4IA5 A;  1LVL A;  5U1O A;  2VVL G;  4H7U A;  2WDQ A;  3KD9 A;  2C75 A;  4JQ9 A;  4YSY A;  2JB2 A;  2BC1 A;  1DJQ A;  4BJY A;  3LOV A;  1PJ7 A;  3NK0 X;  3RP6 A;  4AP3 A;  1ZP0 A;  2XFP A;  3FPZ A;  3UP4 A;  4Z25 A;  4GDP A;  4CNK A;  1NPX A;  2B9W A;  3P4Q A;  2YR4 A;  2PYX A;  3DA1 A;  4ECH A;  2C70 A;  3NRN A;  3NNE A;  5ER0 A;  1EL9 A;  1MOK A;  1PJ5 A;  3AD8 B;  3FG2 P;  1K0L A;  3UTG A;  3C4N A;  4EQS A;  5KMQ A;  3IWA A;  1ONF A;  2DKH A;  1JEH A;  1S2Y A;  4H4W A;  3CNT A;  4X9M A;  3RED A;  3VQR A;  3NN6 X;  5JCK A;  3NIX A;  5KVI A;  3AE4 A;  2BRY A;  1PBD A;  2YG7 A;  3UTF A;  1EBD A;  2R0P A;  2WOW A;  1O94 A;  4K5R A;  2YR6 A;  2OLO A;  1KF6 A;  1GND A;  2AAQ A;  2V60 A;  4ICY A;  4Y4M A;  4TLX A;  2BAC A;  3AEE A;  1D4D A;  3BHF A;  1EL7 A;  3O0H A;  5FS6 A;  3SM8 A;  2H88 A;  2XYO A;  1H6V A;  1CF3 A;  3CGC A;  2FJB A;  2WP9 A;  3P1W A;  1NDA A;  1YQ4 A;  3DGH A;  4Y4L A;  3AE3 A;  3QSS A;  2IVE A;  3HYX A;  5BVA A;  3T2Z A;  3NK1 X;  1H81 A;  1CJ4 A;  4A5L A;  4H4R A;  2OA1 A;  2YM2 A;  4M52 A;  3SZF A;  2FJD A;  4X4J A;  4B65 A;  1M6I A;  5HHF A;  2WS3 A;  1V59 A;  3SZC A;  5FS9 A;  1B4V A;  5DBJ A;  4XWR A;  4RSL A;  4Z2U A;  3KVE A;  1IJH A;  1S3E A;  2YLZ A;  3DJE A;  3IF9 A;  1D4C A;  4B63 A;  4H2P A;  1CHU A;  1LPF A;  4NEW A;  4XXG A;  1Y0P A;  2BS2 A;  1PN0 A;  1L9E A;  3SGL A;  1XHC A;  4LA1 A;  2QA2 A;  2WOV A;  4LU6 A;  1FEC A;  1M64 A;  4UDR A;  5GRT A;  4BJZ A;  5IPY A;  4C5O A;  2XVJ A;  3SXI A;  1DXL A;  1D7L A;  2JK6 A;  5TR3 A;  5KNL A;  4UP3 A;  2VQB A;  3CTY A;  2WEU A;  2R45 A;  5FMH A;  3GDP A;  5GSN A;  3UOZ A;  3AE1 A;  2YG5 A;  2XVI A;  3IHM A;  3Q6J A;  1YKJ A;  2Z5Y A;  1PBB A;  5M0Z A;  3AD7 B;  1F8S A;  2HQM A;  4AT2 A;  3AD9 B;  3UKK A;  1GT8 A;  4GRT A;  4A99 A;  4YTP A;  4U8L A;  5EB5 A;  2XFQ A;  4O5Q A;  1TYT A;  3AE9 A;  5BUL A;  4FX9 A;  1B37 A;  1JRX A;  2GH5 A;  3RNM A;  3FBS A;  1YQ3 A;  3DME A;  2ZZB A;  1B8S A;  3T31 A;  4A6N A;  4B68 A;  1TRB A;  5KOX A;  1GSN A;  1S3B A;  3AYJ A;  1W4X A;  4G74 A;  4ZCD A;  4B67 A;  2WDR A;  3D1C A;  4Z24 A;  1NHQ A;  2GV8 A;  1PS9 A;  3AB1 A;  4YWO A;  1DOD A;  3DK4 A;  1OJD A;  3CGD A;  3LB8 A;  1BZL A;  3GD4 A;  1KDG A;  3IHG A;  4CNJ A;  2XFU A;  5KRQ A;  3B6D A;  5KXJ A;  2W0H A;  1F3P A;  2J3N A;  4WX1 A;  2WU2 A;  3URH A;  2CDU A;  3ADA B;  1DJN A;  2OAM A;  1IUU A;  1GES A;  3UTH A;  4Z2T A;  1CJC A;  2C72 A;  3T37 A;  2V3B A;  5BUK A;  1QLB A;  2GAG B;  4IV9 A;  4Y4N A;  1L0V A;  2X99 A;  2YAU A;  1GRA A;  2V6O A;  1TDK A;  2Q0K A;  2VVM A;  3QJ4 A;  1O5W A;  1GAL A;  1ZX9 A;  2XLS A;  1GRE A;  3CIR A;  3QSM A;  1PHH A;  1TDO A;  4JNA A;  3ALJ A;  2YQU A;  5JCL A;  3C4A A;  1JRY A;  1OJC A;  1AOG A;  3F8P A;  3SFE A;  3ITJ A;  3F8R A;  3ABV A;  1IUV A;  4NTC A;  5C3J A;  4IA6 A;  1MXT A;  1IUX A;  1CBO A;  4U2S A;  1TDN A;  5EB4 A;  1NAA A;  1JNZ A;  4H4T A;  1XAN A;  1Y56 B;  3LXD A;  1Q1R A;  3ICR A;  1IUW A;  3AE5 A;  1GER A;  3P4P A;  3NHO X;  4JY3 A;  4CCR A;  2TPR A;  3VRB A;  2XLP A;  3BNU A;  1JRZ A;  1FEB A;  2RAB A;  3ATR A;  4H4U A;  3UKF A;  3H8L A;  4HB9 A;  4U8I A;  4YSZ A;  1E1K A;  2C3C A;  4EQX A;  1D4E A;  1COY A;  3UKQ A;  2WPE A;  2C65 A;  3PS9 A;  4H50 A;  3GWD A;  3GRS A;  3AYL A;  1BWC A;  3CGE A;  3RP8 A;  3EAO A;  3ATQ A;  4H4X A;  3LAD A;  4IVO B;  3CPH G;  3QSE A;  1IUS A;  4I59 A;  1RP0 A;  3G5S A;  3QVR A;  2E5V A;  2RGJ A;  2JB3 A;  3JSK A;  1KFY A;  1QO8 A;  4OCG A;  2GQF A;  1RSG A;  4G6G A;  3GYJ A;  1GRT A;  1B5Q A;  3FIM B;  4X9N A;  4EQW A;  4YT0 A;  2TMD A;  4DSH A;  4GUV A;  1YQZ A;  4YKF A;  1E6E A;  3AED A;  2A8X A;  4OPT A;  3SFD A;  2YVJ A;  3K7M X;  4OPD A;  1P2H A;  4Z26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...