1H84A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 4.6
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h84A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h84A02
1BKWA 3CTYA 2BS2A 4EIPA 2YLTA 3H8IA 4YTPA 1NEKA 4X9NA 1B37A 4GCMA 2YR5A 1LQUA 4H2RA 1GT8A 2Z5XA 3DGHA 3S61A 4B67A 2XLPA 1NHQA 4MJWA 3P1WA 4H4XA 4EQWA 3SFEA 1F8WA 2WETA 1Q1RA 1XANA 3L8KA 4OPLA 4U2LA 3UKPA 1H86A 3SM8A 3GDNA 3ICTA 4BV6A 1EL5A 4YSYA 2YWLA 2NPXA 4YSHA 4BJZA 3E1TA 3IHGA 2WPEA 2B9XA 3H8LA 1MXTA 1Q9IA 1TDKA 3DJDA 3KA7A 4J56A 1TYTA 3RHAA 4D04A 4USRA 4O5QA 4IA6A 3CNJA 2B7SA 5ER0A 3QSSA 2Q0LA 1PN0A 2C7GA 2IVDA 3ABVA 2GV8A 3QSEA 1DJNA 1TYPA 1CC4A 2GEWA 4H2NA 4H4WA 1JRXA 3GSIA 1NG4A 1FL2A 3DGZA 1PXCA 3K7MX 4U8LA 3NK2X 3UKHA 4YSZA 2RABA 3KD9A 3AEFA 1O95A 2WDVA 1K0LA 2A8XA 3G5QA 1YQ3A 4TLZA 1BZLA 2NVKX 4J57A 3UTEA 1PBFA 3T37A 4H4TA 4BURA 2GMJA 1D7LA 2XVHA 1IJHA 3DJGX 1E1KA 4JN9A 3GD3A 5CQFA 2BCPA 4EM3A 2PHHA 5J7XA 2XVFA 3QFAA 2X50A 4ZN0A 3CGEA 1L9CA 2XFUA 1L0VA 1BF3A 3IHMA 1LQTA 4HB9A 4B63A 5DBJA 4OPIA 1H84A 1S3BA 5HXIA 4YTNA 1IUSA 5EB4A 4TM4A 4APNA 4H4QA 4JNAA 1H7XA 4U2TA 1RSGA 3F8DA 1EL9A 3C4AA 2WEUA 2X3NA 2VQBA 2VZ2A 2TMDA 2YM2A 2A87A 3ZYXA 2OA1A 1D4DA 1GSNA 2V3BA 1M64A 3Q9TA 4OPUA 3CPJG 2XLTA 3CNSA 3M0OA 1O5WA 3ATQA 1ZK7A 2YLWA 4H4PA 4U8NA 2GQWA 3VQRA 4NZHA 2BS4A 4EQSA 2UZZA 1JEHA 4YT0A 3AEDA 5GRTA 4Z2UA 1IUVA 4IVOB 3NIXA 1VG0A 1KNPA 2BXRA 3OZ2A 3GRTA 1FECA 1GV4A 2CFYA 3BHKA 3AEBA 1DODA 3GRSA 1E1NA 4YXDA 3RP8A 1NHSA 1LTXR 3UOZA 1CJ4A 1GALA 2R0CA 3VRDB 4IVMB 4TLXA 3NN0X 3AE3A 3P4PA 4FK1A 4JY3A 1OJTA 5U63A 3AXBA 3AE5A 1D4EA 4AOSA 2Y6RA 2AR8A 2XLRA 3UOXA 1B4VA 1H82A 3UP4A 4K8DA 4NEVA 4J36A 1S2QA 1GRBA 5U25A 1W4XA 4AOXA 5HY5A 4A7AA 3PS9A 3AEGA 3NYCA 5GSNA 1BGJA 3CN8A 1YY5A 1FEAA 1KSSA 2XYOA 1GRTA 4TM0A 5FS6A 4ZCCA 1CBOA 5EB5A 4CCRA 3ALMA 5BUKA 2YVFA 2OLOA 3CGDA 1ZMCA 4H7UA 2FJDA 3I3LA 5FMHA 4U8IA 1TDNA 4YWOA 1REOA 3F8RA 2XVJA 3UKAA 4B65A 1SEZA 3RNMA 3EF6A 2WESA 4IV9A 3NN6X 4Y4NA 3UKLA 1Y56B 3NRNA 2C70A 3ATRA 3KKJA 4NTDA 1LV0A 2X8CA 4U8JA 4FK1C 1KSUA 1GNDA 2R0PA 4XXGA 4AP1A 4Z25A 5FS9A 1OJDA 2Z5YA 2XLUA 2WU2A 3LXDA 4YKFA 3UOYA 3DH9A 1EL8A 2GH5A 4DGKA 2H88A 3AEAA 1NG3A 3R9UA 3M12A 3COXA 2QAEA 4KX6A 2XLSA 2YG6A 2JBVA 4PABA 1H81A 2OLNA 4D03A 2WQYA 4UP3A 4U8MA 2GAGB 4BK3A 4U8PA 4CY8A 3ICSA 2X99A 4Z2RA 2VVMA 5IQ1A 1D7YA 1RP0A 3GD4A 5IQ4A 1H6VA 1NPXA 2WOVA 3NK1X 1ELIA 1PS9A 3BI4A 3F8PA 2WHDA 2ZZBA 2R0GA 1JRZA 3SFDA 4J2WA 1F3PA 1ZP0A 2C65A 2B7RA 2E1MA 4XWZA 3AE1A 2V60A 1JNRA 4U2SA 4K2XA 1O94A 5U1OA 5LV9A 2YLZA 3ADAB 2BYBA 4H4ZA 1F8RA 1RYIA 2R46A 3L1RA 1PHHA 2YG5A 4OPGA 2VQ7A 4Y4MA 5C3JA 2YAUA 1DNCA 5KVIA 3DA1A 4GF7A 3V3OA 4C77A 5BULA 3AE2A 1JOAA 3K30A 3AD9B 3IF9A 2CULA 1CHUA 3ALLA 4OPCA 4Z26A 2HQMA 2R45A 3GYIA 1E1LA 2C67A 4LA1A 3G5RA 1S3EA 1NENA 3DK8A 1L9EA 4GRTA 3CNPA 1D4CA 1IUUA 4X4JA 4U8KA 1K4QA 1H83A 3ZDNA 4YKGA 2OALA 1D5TA 1LJ1A 4H4VA 3PO7A 4DNAA 1QO8A 2V61A 1KFYA 1ZMDA 2WP9A 3CGBA 4Z24A 4EQRA 4WCTA 2C66A 1QJDA 1Y0PA 3B6DA 1DOBA 2V6OA 5C2TA 3HZLA 2QA1A 1CC2A 4OVIA 2GRTA 3O0HA 4K5RA 5TR3A 4J31A 1NHPA 1IUTA 3NTDA 4NTCA 5HHFA 4LIIA 5HYMA 1GETA 2APGA 3BNMA 1K0IA 5EBKA 2JB1A 4C5OA 1FOHA 4WX1A 1OJ9A 1X31B 5KVHA 2W0HA 2ZZCA 1N1PA 5KOXA 3AD8B 2YG3A 4GR1A 5KXJA 2B9WA 4B1BA 3NH3X 3P4RA 3LJPA 1GRGA 2YLSA 4H2QA 4J33A 1KDGA 1NAAA 3FIMB 3G5SA 3V3NA 2YLRA 4O5UA 1PBDA 1PJ5A 3OC4A 4TM1A 5BVAA 2ZZ0A 2RGOA 2TPRA 1IUWA 2OAMA 2Y6QA 3AYLA 1VG9A 2WDRA 2FBWA 3AWIA 1V59A 4BK1A 4I59A 4A79A 1JNZA 2X8HA 3VR9A 4CNKA 3CIRA 1DJQA 4H50A 4EQXA 3LOVA 3Q6JA 2YLXA 2Q0KA 1GEUA 4PAAA 2JKCA 2J3NA 1KF6A 2QCUA 1FEBA 2X8GA 4C3XA 4NTEA 1GRHA 3NGCX 2AAQA 3P4QA 3REDA 3KU9A 2BC0A 4UDRA 2XVEA 2JK6A 1PBCA 1PBEA 1MO9A 3B3RA 3VRAA 1KNRA 1CF3A 4UDPA 3UOVA 2WPFA 1L9DA 3D8XA 2C76A 3D1CA 3QVPA 3RP7A 2WS3A 3CGCA 3VRBA 2GR1A 2H89A 4B69A 3BI5A 1TDFA 2C64A 4H4RA 2O9ZA 4EMIA 3QVRA 1QLBA 4CCQA 1Y56A 2WOIA 4EMWA 1E7PA 3P9UA 2GF3A 3V76A 4B64A 2EQ8A 2YG7A 4NEWA 2C73A 1EL7A 4H4SA 5JCIA 3QSMA 2RGHA 2BK3A 1M6IA 3UTFA 4CY6A 4REKA 4EMJA 1GXFA 1PDHA 1NDAA 2AQJA 2XFQA 3GMBA 4Y4LA 4A6NB 4ECHA 5L46A 2WDQA 3SQPA 4GDPA 3H4KA 3DJEA 1JU2A 2IVEA 1PJ7A 1E39A 2DKHA 4FX9A 1XDIA 1GPEA 2IIDA 2GR0A 3NYEA 1GTEA 2E5VA 5JCKA 5M0ZA 4AT2A 1YKJA 2BS3A 1GRAA 2RGJA 4B66A 2ACZA 2WU5A 1K0JA 1JRYA 3AEEA 3AE4A 2C3DA 3PVCA 4RG4A 2YR6A 5IPYA 4Z43A 4YTMA 1VRQB 1BWCA 3P4SA 3CNTA 4AP3A 3EAOA 4JY2A 4H2PA 2JB3A 1GREA 2E4GA 3UKFA 1P2HA 1H7WA 3NKSA 2YVJA 1S2YA 2GVCA 2Q6UA 1IUXA 2BA9A 4H4YA 4OPTA 1CJCA 1F8SA 1B5QA 1ZOVA 2C75A 4A9WA 3DK9A 2DKIA 4P9SA 2FJEA 4E0VA 1AOGA 3LADA 2I0ZA 4IA5A 2JB2A 3GYJA 1VQWA 3M13A 1NHRA 1ZDLA 2VVLA 2VOUA 2R9ZA 4FDCB 1GRFA 1HYUA 4H4UA 2BK5A 1GOSA 2XFNA 3C96A 1VDCA 3NTAA 3QJ4A 3AE7A 1FCDA 1F6MA 4Z2TA 4M52A 2EQ9A 1N4WA 5EOWA 4CRTA 1ZX9A 4DSGA 1CJ2A 1ZKQA 2BABA 3ISHA 3KLJA 1CC6A 1DOEA 3IC9A 4K5SA 4Z44A 5JCNA 5M10A 5CKUA 2R4JA 1XPQA 3DJJA 3NLCA 3GWDA 1PXBA 1LPFA 2GR2A 1N4UA 4JQ9A 2EQ7A 4KPRA 1DXLA 2GAHB 3KPFA 3NNEA 4A99A 1PBBA 1GESA 3LZXA 2C3CA 3EPTA 2B76A 2FJBA 4A6NA 2WOWA 1YQZA 3FPZA 2GB0A 3FMWA 1TDEA 2CVJA 2YM1A 2XDOA 3C4NA 3ITJA 4I58A 3GWFA 1B8SA 2XFPA 1EBDA 3GDPA 3AE6A 3LZWA 3AD7B 3S5WA 4RSLA 3UP5A 3WE0A 2B9YA 5J60A 2BXSA 1PXAA 4A65A 3AE8A 3I6DA 4CNJA 3UKKA 5FS7A 1Q1WA 2JAEA 1ZY8A 3AE9A 3K7QX 4OCGA 2V5ZA 3VR8A 3UTGA 2XFOA 1BGNA 4LU6A 2VRLA 3ICRA 1E1MA 4ICYA 1TRBA 2QA2A 1E6EA 3BHFA 3CNDA 4GDEA 4BJYA 2XCGA 3UCLA 3BNUA 4EIQA 4JNQA 4X9MA 5JCMA 2ZBWA 2A89A 2XVIA 3AYJA 2CDUA 3NHOX 2BACA 1GERA 2YVGA 2V3AA 4ADWA 1TDOA 2EQ6A 3RP6A 4HA6A 4A5LA 3IWAA 4K22A 4OPDA 2BC1A 1UKVG 1CL0A 3AECA 3UTHA 2Q7VA 2VVLG 4DSHA 5KWFA 5FS8A 5KRQA 2R4EA 2GR3A 5BRTA 1LVLA 4RG3A 4J34A 1CJ3A 3AYIA 4N9XA 5JCLA 3LB8A 2GQFA 3ALJA 3JSKA 1COYA 2WP6A 2PYXA 3EANA 3DK4A 4B68A 2YQUA 3NK0X 4YSXA 1MOKA 4C74A 1GTHA 3UKQA 1OJAA 3QFBA 2C72A 2F5ZA 2GMHA 2WPCA 1ZOYA 3GMCA 4USQA 4JDRA 3NYFA 4C3YA 2WP5A 4GUVA 2BCGG 3KVEA 3NG7X 5KOWA 2YG4A 2YR4A 1OJCA 1XHCA 1ONFA 2VRMA 4UDQA 3BI2A 3NT6A 4U8OA 3II4A 4K7ZA 4EM4A 3AB1A 1P2EA 1YQ4A 3DMEA 1Z6LA 2ARDA 2BK4A 3URHA 3SGLA 1PJ6A 4ZCDA 4CBQA 3FG2P 3FBSA 3CPIG 4AT0A 4TM3A 4XWRA 2FJAA 1N4VA 3K7TA 2WBAA 4BK2A 3CPHG 1DOCA
chains in the Genus database with same CATH superfamily
1BKWA 3CTYA 2BS2A 4EIPA 2YLTA 3H8IA 4YTPA 1NEKA 4X9NA 1B37A 4GCMA 2YR5A 1LQUA 4H2RA 1GT8A 2Z5XA 3DGHA 3S61A 4B67A 2XLPA 1NHQA 4MJWA 3KPKA 3P1WA 4H4XA 4EQWA 3SFEA 1F8WA 2WETA 1Q1RA 1XANA 3L8KA 4OPLA 3CMMA 4U2LA 3UKPA 1H86A 3SM8A 3GDNA 3ICTA 3T2ZA 1EL5A 4BV6A 4YSYA 2YWLA 2NPXA 4YSHA 4BJZA 3E1TA 3IHGA 2WPEA 2B9XA 3H8LA 1MXTA 1Q9IA 1TDKA 3DJDA 3KA7A 4J56A 1TYTA 3RHAA 4D04A 4USRA 4O5QA 4IA6A 3CNJA 2B7SA 5ER0A 3QSSA 2Q0LA 3SY4A 1PN0A 2C7GA 2IVDA 3ABVA 2GV8A 3QSEA 1DJNA 1TYPA 1CC4A 2GEWA 4H2NA 4H4WA 1JRXA 3GSIA 1NG4A 1FL2A 3DGZA 1PXCA 3K7MX 3T31A 4U8LA 3NK2X 3UKHA 4YSZA 2RABA 3KD9A 4G73A 3AEFA 1O95A 4II2A 2WDVA 1K0LA 2A8XA 3G5QA 1YQ3A 4TLZA 1BZLA 2NVKX 4J57A 3UTEA 1PBFA 3T37A 4H4TA 4BURA 2GMJA 1D7LA 2XVHA 1IJHA 3DJGX 1E1KA 4JN9A 3GD3A 5CQFA 2BCPA 4EM3A 2PHHA 5J7XA 2XVFA 3QFAA 2X50A 4ZN0A 3CGEA 1L9CA 2XFUA 1L0VA 1BF3A 3IHMA 1LQTA 4HB9A 4B63A 5DBJA 4OPIA 1H84A 1S3BA 5HXIA 4YTNA 1IUSA 5EB4A 3T2KA 4TM4A 4APNA 4H4QA 4JNAA 1H7XA 4U2TA 1RSGA 3F8DA 1EL9A 3C4AA 2WEUA 2X3NA 2VQBA 2VZ2A 4G6HA 2TMDA 2YM2A 2A87A 3ZYXA 2OA1A 1D4DA 1GSNA 2V3BA 1M64A 3Q9TA 4OPUA 3CPJG 2XLTA 3CNSA 3M0OA 1O5WA 3ATQA 1ZK7A 2YLWA 4H4PA 4U8NA 2GQWA 3VQRA 4NZHA 2BS4A 4EQSA 2UZZA 1JEHA 4YT0A 3AEDA 5GRTA 4Z2UA 1IUVA 4IVOB 5KMRA 3SX6A 3NIXA 4G9KA 1VG0A 1KNPA 2BXRA 3OZ2A 3GRTA 1FECA 1GV4A 2CFYA 3BHKA 3AEBA 1DODA 3GRSA 1E1NA 4YXDA 3RP8A 1NHSA 1LTXR 3UOZA 1CJ4A 1GALA 2R0CA 2BRAA 3VRDB 4IVMB 4TLXA 3NN0X 3AE3A 3P4PA 3SYIA 2BRYA 4FK1A 4JY3A 1OJTA 5U63A 3AXBA 3AE5A 1D4EA 4AOSA 2Y6RA 2AR8A 2XLRA 3UOXA 1B4VA 1H82A 3UP4A 4K8DA 4NEVA 4J36A 1S2QA 1GRBA 5U25A 1W4XA 4AOXA 5HY5A 4A7AA 3PS9A 3AEGA 3NYCA 5GSNA 1BGJA 3CN8A 1YY5A 1FEAA 1KSSA 2XYOA 1GRTA 4TM0A 5FS6A 4ZCCA 1CBOA 5EB5A 4CCRA 3ALMA 5BUKA 2C4CA 2YVFA 2OLOA 3CGDA 1ZMCA 4H7UA 2FJDA 3I3LA 5FMHA 4U8IA 1TDNA 4YWOA 1REOA 3F8RA 2XVJA 3UKAA 4B65A 1SEZA 3RNMA 3EF6A 2WESA 4IV9A 3T0KA 3NN6X 4Y4NA 3UKLA 1Y56B 3NRNA 2C70A 3ATRA 3KKJA 4NTDA 1LV0A 2X8CA 4U8JA 4FK1C 1KSUA 1GNDA 2R0PA 4XXGA 4AP1A 4Z25A 5FS9A 1OJDA 2Z5YA 2XLUA 2WU2A 3LXDA 4YKFA 3UOYA 3DH9A 1EL8A 2GH5A 4DGKA 2H88A 3AEAA 1NG3A 3R9UA 3GYXA 3M12A 3COXA 2QAEA 4KX6A 2XLSA 2YG6A 2JBVA 4PABA 1H81A 2OLNA 4D03A 2WQYA 4UP3A 4U8MA 2GAGB 4BK3A 4U8PA 4CY8A 3ICSA 2X99A 4Z2RA 2VVMA 5IQ1A 3T14A 1D7YA 1RP0A 3GD4A 5IQ4A 1H6VA 1NPXA 2WOVA 3NK1X 1ELIA 1PS9A 3BI4A 3F8PA 2WHDA 2ZZBA 2R0GA 1JRZA 3SFDA 4J2WA 1F3PA 1ZP0A 2C65A 2B7RA 2E1MA 4XWZA 3AE1A 2V60A 1JNRA 4U2SA 4K2XA 1O94A 5U1OA 5LV9A 2YLZA 3ADAB 2BYBA 4H4ZA 1F8RA 1RYIA 2R46A 3L1RA 1PHHA 2YG5A 4OPGA 2VQ7A 4Y4MA 5C3JA 2YAUA 1DNCA 5KVIA 3DA1A 4GF7A 3V3OA 4C77A 5BULA 3AE2A 3SZ0A 1JOAA 3K30A 3AD9B 3IF9A 2CULA 1CHUA 3ALLA 4OPCA 4Z26A 2HQMA 2R45A 3GYIA 1E1LA 2C67A 4LA1A 3G5RA 1S3EA 1NENA 3DK8A 1L9EA 4GRTA 3CNPA 1D4CA 1IUUA 4X4JA 4U8KA 1K4QA 1H83A 3ZDNA 4YKGA 2OALA 1D5TA 1LJ1A 4H4VA 3PO7A 4DNAA 1QO8A 2V61A 1KFYA 1ZMDA 2WP9A 3CGBA 4Z24A 4EQRA 4WCTA 2C66A 1QJDA 1Y0PA 3B6DA 1DOBA 2V6OA 5C2TA 3HZLA 2QA1A 1CC2A 4OVIA 2GRTA 3O0HA 4K5RA 5TR3A 4J31A 1NHPA 1IUTA 3NTDA 4NTCA 5HHFA 4LIIA 5HYMA 1GETA 2APGA 3BNMA 1K0IA 5EBKA 2JB1A 4C5OA 1FOHA 4WX1A 1OJ9A 1X31B 5KVHA 2W0HA 2ZZCA 1N1PA 5KOXA 3AD8B 2YG3A 4GR1A 5KXJA 2B9WA 4B1BA 3NH3X 3P4RA 3LJPA 4GAVA 1GRGA 2YLSA 4H2QA 4J33A 1KDGA 1NAAA 3FIMB 3G5SA 3V3NA 2YLRA 4O5UA 1PBDA 1PJ5A 3OC4A 4TM1A 5BVAA 2ZZ0A 2RGOA 2TPRA 3T2YA 1IUWA 2OAMA 2Y6QA 3AYLA 4GAPA 1VG9A 2WDRA 2FBWA 3AWIA 1V59A 4NNJA 4BK1A 4I59A 4A79A 1JNZA 2X8HA 3VR9A 4CNKA 3CIRA 1DJQA 4H50A 4EQXA 3LOVA 3Q6JA 2YLXA 2Q0KA 1GEUA 4PAAA 2JKCA 3SZFA 2J3NA 1KF6A 2QCUA 5KMQA 1FEBA 3HYWA 2X8GA 4C3XA 4NTEA 1GRHA 3NGCX 2AAQA 3P4QA 3REDA 3KU9A 2BC0A 4UDRA 2XVEA 2JK6A 1PBCA 1PBEA 1MO9A 3B3RA 3VRAA 1KNRA 1CF3A 4UDPA 3UOVA 2WPFA 3SZCA 1L9DA 3D8XA 2C76A 3D1CA 3QVPA 3RP7A 2WS3A 3CGCA 3VRBA 2GR1A 2H89A 4B69A 3BI5A 1TDFA 2C64A 4H4RA 2O9ZA 4EMIA 3QVRA 1QLBA 4CCQA 1Y56A 2WOIA 4EMWA 1E7PA 3P9UA 2GF3A 3V76A 4B64A 2EQ8A 2YG7A 4NEWA 2C73A 1EL7A 4H4SA 5JCIA 3QSMA 2RGHA 2BK3A 1M6IA 3UTFA 4CY6A 4REKA 4EMJA 1GXFA 1PDHA 1NDAA 2AQJA 2XFQA 3GMBA 4Y4LA 4A6NB 4ECHA 5L46A 2WDQA 3SQPA 4GDPA 3H4KA 3DJEA 1JU2A 2IVEA 1PJ7A 1E39A 2DKHA 4FX9A 1XDIA 1GPEA 2IIDA 2GR0A 3NYEA 1GTEA 2E5VA 5JCKA 5M0ZA 4AT2A 1YKJA 2BS3A 1GRAA 2RGJA 3SZWA 3SXIA 2ACZA 4B66A 2WU5A 1K0JA 1JRYA 3AEEA 3AE4A 2C3DA 3PVCA 4RG4A 2YR6A 5IPYA 3HYVA 4Z43A 4YTMA 1VRQB 1BWCA 3P4SA 3CNTA 4NWZA 4AP3A 3EAOA 4JY2A 4H2PA 2JB3A 1GREA 2E4GA 3UKFA 1P2HA 1H7WA 3HYXA 3NKSA 5KMSA 2YVJA 1S2YA 2GVCA 2Q6UA 1IUXA 2BA9A 4H4YA 4OPTA 1CJCA 1F8SA 1B5QA 1ZOVA 2C75A 4A9WA 3DK9A 2DKIA 4P9SA 2FJEA 4E0VA 1AOGA 3LADA 2I0ZA 4IA5A 2JB2A 3GYJA 1VQWA 3M13A 1NHRA 1ZDLA 2VVLA 2VOUA 2R9ZA 4FDCB 1GRFA 1HYUA 4H4UA 2BK5A 1GOSA 2XFNA 3C96A 1VDCA 3NTAA 3QJ4A 3AE7A 1FCDA 1F6MA 4Z2TA 4M52A 2EQ9A 1N4WA 5EOWA 4CRTA 1ZX9A 4DSGA 1CJ2A 1ZKQA 2BABA 3ISHA 3KLJA 1CC6A 1DOEA 3IC9A 4K5SA 4Z44A 5JCNA 5M10A 5CKUA 2R4JA 1XPQA 3DJJA 3NLCA 3GWDA 1PXBA 1LPFA 2GR2A 1N4UA 4JQ9A 2EQ7A 4KPRA 1DXLA 2GAHB 3KPFA 3NNEA 4A99A 1PBBA 1GESA 3LZXA 2C3CA 3EPTA 2B76A 2FJBA 4G6GA 4A6NA 2WOWA 1YQZA 3FPZA 2GB0A 3FMWA 1TDEA 2CVJA 2YM1A 2XDOA 3C4NA 3ITJA 4I58A 4II3A 3GWFA 1B8SA 2XFPA 1EBDA 3GDPA 3AE6A 3LZWA 3AD7B 3S5WA 4RSLA 3UP5A 3WE0A 2B9YA 5J60A 2BXSA 1PXAA 4A65A 3AE8A 3I6DA 4CNJA 3UKKA 5FS7A 1Q1WA 5KMPA 2JAEA 1ZY8A 3AE9A 3K7QX 4OCGA 2V5ZA 3VR8A 3UTGA 2XFOA 1BGNA 4LU6A 2VRLA 3ICRA 1E1MA 4ICYA 1TRBA 2QA2A 1E6EA 3BHFA 3CNDA 4GDEA 4BJYA 2XCGA 3UCLA 3BNUA 4EIQA 4JNQA 4X9MA 5JCMA 2ZBWA 2A89A 2XVIA 3AYJA 2CDUA 3NHOX 2BACA 1GERA 2YVGA 2V3AA 4ADWA 1TDOA 2EQ6A 3RP6A 4HA6A 4A5LA 3IWAA 4K22A 4OPDA 2BC1A 1UKVG 1CL0A 3AECA 3UTHA 2Q7VA 2VVLG 4DSHA 5KWFA 4G74A 5FS8A 5KRQA 2R4EA 2GR3A 5BRTA 1LVLA 4RG3A 4J34A 1CJ3A 3AYIA 4N9XA 5JCLA 3LB8A 2GQFA 3ALJA 3JSKA 1COYA 2WP6A 2PYXA 3EANA 3DK4A 4B68A 2YQUA 3NK0X 4YSXA 1MOKA 4C74A 1GTHA 3UKQA 1OJAA 3QFBA 2C72A 2F5ZA 2GMHA 2WPCA 1ZOYA 3GMCA 4USQA 4JDRA 3NYFA 4C3YA 2WP5A 4GUVA 2BCGG 3KVEA 3NG7X 5KOWA 2YG4A 2YR4A 1OJCA 1XHCA 1ONFA 2VRMA 4UDQA 3BI2A 3NT6A 4U8OA 3II4A 4K7ZA 4EM4A 3AB1A 1P2EA 1YQ4A 3DMEA 1Z6LA 2ARDA 2BK4A 3URHA 3SGLA 1PJ6A 4ZCDA 4CBQA 3FG2P 3FBSA 3CPIG 4AT0A 5KNLA 4TM3A 4XWRA 2FJAA 1N4VA 3K7TA 2WBAA 4BK2A 3CPHG 1DOCA
chains in the Genus database with same CATH topology
1BKWA 3CTYA 2BS2A 4EIPA 2YLTA 3H8IA 4YTPA 1NEKA 4X9NA 1B37A 4GCMA 2YR5A 1LQUA 4H2RA 1GT8A 2Z5XA 3DGHA 3S61A 4B67A 2XLPA 1NHQA 4MJWA 3KPKA 3P1WA 4H4XA 4EQWA 3SFEA 1F8WA 2WETA 1Q1RA 1XANA 3L8KA 4OPLA 3CMMA 4U2LA 3UKPA 1H86A 3SM8A 3GDNA 3ICTA 3T2ZA 1EL5A 4BV6A 4YSYA 2YWLA 2NPXA 4YSHA 4BJZA 3E1TA 3IHGA 2WPEA 2B9XA 3H8LA 1MXTA 1Q9IA 1TDKA 3DJDA 3KA7A 4J56A 1TYTA 3RHAA 4D04A 4USRA 4O5QA 4IA6A 3CNJA 2B7SA 5ER0A 3QSSA 2Q0LA 3SY4A 1PN0A 2C7GA 2IVDA 3ABVA 2GV8A 3QSEA 1DJNA 1TYPA 1CC4A 2GEWA 4H2NA 4H4WA 1JRXA 3GSIA 1NG4A 1FL2A 3DGZA 1PXCA 3K7MX 3T31A 4U8LA 3NK2X 3UKHA 4YSZA 2RABA 3KD9A 4G73A 3AEFA 1O95A 4II2A 2WDVA 1K0LA 2A8XA 3G5QA 1YQ3A 4TLZA 1BZLA 2NVKX 4J57A 3UTEA 1PBFA 3T37A 4H4TA 4BURA 2GMJA 1D7LA 2XVHA 1IJHA 3DJGX 1E1KA 4JN9A 3GD3A 5CQFA 2BCPA 4EM3A 2PHHA 5J7XA 2XVFA 3QFAA 2X50A 4ZN0A 3CGEA 1L9CA 2XFUA 1L0VA 1BF3A 3IHMA 1LQTA 4HB9A 4B63A 5DBJA 4OPIA 1H84A 1S3BA 5HXIA 4YTNA 1IUSA 5EB4A 3T2KA 4TM4A 4APNA 4H4QA 4JNAA 1H7XA 4U2TA 1RSGA 3F8DA 1EL9A 3C4AA 2WEUA 2X3NA 2VQBA 2VZ2A 4G6HA 2TMDA 2YM2A 2A87A 3ZYXA 2OA1A 1D4DA 1GSNA 2V3BA 1M64A 3Q9TA 4OPUA 3CPJG 2XLTA 3CNSA 3M0OA 1O5WA 3ATQA 1ZK7A 2YLWA 4H4PA 4U8NA 2GQWA 3VQRA 4NZHA 2BS4A 4EQSA 2UZZA 1JEHA 4YT0A 3AEDA 5GRTA 4Z2UA 1IUVA 4IVOB 5KMRA 3SX6A 3NIXA 4G9KA 1VG0A 1KNPA 2BXRA 3OZ2A 3GRTA 1FECA 1GV4A 2CFYA 3BHKA 3AEBA 1DODA 3GRSA 1E1NA 4YXDA 3RP8A 1NHSA 1LTXR 3UOZA 1CJ4A 1GALA 2R0CA 2BRAA 3VRDB 4IVMB 4TLXA 3NN0X 3AE3A 3P4PA 3SYIA 2BRYA 4FK1A 4JY3A 1OJTA 5U63A 3AXBA 3AE5A 1D4EA 4AOSA 2Y6RA 2AR8A 2XLRA 3UOXA 1B4VA 1H82A 3UP4A 4K8DA 4NEVA 4J36A 1S2QA 1GRBA 5U25A 1W4XA 4AOXA 5HY5A 4A7AA 3PS9A 3AEGA 3NYCA 5GSNA 1BGJA 3CN8A 1YY5A 1FEAA 1KSSA 2XYOA 1GRTA 4TM0A 5FS6A 4ZCCA 1CBOA 5EB5A 4CCRA 3ALMA 5BUKA 2C4CA 2YVFA 2OLOA 3CGDA 1ZMCA 4H7UA 2FJDA 3I3LA 5FMHA 4U8IA 1TDNA 4YWOA 1REOA 3F8RA 2XVJA 3UKAA 4B65A 1SEZA 3RNMA 3EF6A 2WESA 4IV9A 3T0KA 3NN6X 4Y4NA 3UKLA 1Y56B 3NRNA 2C70A 3ATRA 3KKJA 4NTDA 1LV0A 2X8CA 4U8JA 4FK1C 1KSUA 1GNDA 2R0PA 4XXGA 4AP1A 4Z25A 5FS9A 1OJDA 2Z5YA 2XLUA 2WU2A 3LXDA 4YKFA 3UOYA 3DH9A 1EL8A 2GH5A 4DGKA 2H88A 3AEAA 1NG3A 3R9UA 3GYXA 3M12A 3COXA 2QAEA 4KX6A 2XLSA 2YG6A 2JBVA 4PABA 1H81A 2OLNA 4D03A 2WQYA 4UP3A 4U8MA 2GAGB 4BK3A 4U8PA 4CY8A 3ICSA 2X99A 4Z2RA 2VVMA 5IQ1A 3T14A 1D7YA 1RP0A 3GD4A 5IQ4A 1H6VA 1NPXA 2WOVA 3NK1X 1ELIA 1PS9A 3BI4A 3F8PA 2WHDA 2ZZBA 2R0GA 1JRZA 3SFDA 4J2WA 1F3PA 1ZP0A 2C65A 2B7RA 2E1MA 4XWZA 3AE1A 2V60A 1JNRA 4U2SA 4K2XA 1O94A 5U1OA 5LV9A 2YLZA 3ADAB 2BYBA 4H4ZA 1F8RA 1RYIA 2R46A 3L1RA 1PHHA 2YG5A 4OPGA 2VQ7A 4Y4MA 5C3JA 2YAUA 1DNCA 5KVIA 3DA1A 4GF7A 3V3OA 4C77A 5BULA 3AE2A 3SZ0A 1JOAA 3K30A 3AD9B 3IF9A 2CULA 1CHUA 3ALLA 4OPCA 4Z26A 2HQMA 2R45A 3GYIA 1E1LA 2C67A 4LA1A 3G5RA 1S3EA 1NENA 3DK8A 1L9EA 4GRTA 3CNPA 1D4CA 1IUUA 4X4JA 4U8KA 1K4QA 1H83A 3ZDNA 4YKGA 2OALA 1D5TA 1LJ1A 4H4VA 3PO7A 4DNAA 1QO8A 2V61A 1KFYA 1ZMDA 2WP9A 3CGBA 4Z24A 4EQRA 4WCTA 2C66A 1QJDA 1Y0PA 3B6DA 1DOBA 2V6OA 5C2TA 3HZLA 2QA1A 1CC2A 4OVIA 2GRTA 3O0HA 4K5RA 5TR3A 4J31A 1NHPA 1IUTA 3NTDA 4NTCA 5HHFA 4LIIA 5HYMA 1GETA 2APGA 3BNMA 1K0IA 5EBKA 2JB1A 4C5OA 1FOHA 4WX1A 1OJ9A 1X31B 5KVHA 2W0HA 2ZZCA 1N1PA 5KOXA 3AD8B 2YG3A 4GR1A 5KXJA 2B9WA 4B1BA 3NH3X 3P4RA 3LJPA 4GAVA 1GRGA 2YLSA 4H2QA 4J33A 1KDGA 1NAAA 3FIMB 3G5SA 3V3NA 2YLRA 4O5UA 1PBDA 1PJ5A 3OC4A 4TM1A 5BVAA 2ZZ0A 2RGOA 2TPRA 3T2YA 1IUWA 2OAMA 2Y6QA 3AYLA 4GAPA 1VG9A 2WDRA 2FBWA 3AWIA 1V59A 4NNJA 4BK1A 4I59A 4A79A 1JNZA 2X8HA 3VR9A 4CNKA 3CIRA 1DJQA 4H50A 4EQXA 3LOVA 3Q6JA 2YLXA 2Q0KA 1GEUA 4PAAA 2JKCA 3SZFA 2J3NA 1KF6A 2QCUA 5KMQA 1FEBA 3HYWA 2X8GA 4C3XA 4NTEA 1GRHA 3NGCX 2AAQA 3P4QA 3REDA 3KU9A 2BC0A 4UDRA 2XVEA 2JK6A 1PBCA 1PBEA 1MO9A 3B3RA 3VRAA 1KNRA 1CF3A 4UDPA 3UOVA 2WPFA 3SZCA 1L9DA 3D8XA 2C76A 3D1CA 3QVPA 3RP7A 2WS3A 3CGCA 3VRBA 2GR1A 2H89A 4B69A 3BI5A 1TDFA 2C64A 4H4RA 2O9ZA 4EMIA 3QVRA 1QLBA 4CCQA 1Y56A 2WOIA 4EMWA 1E7PA 3P9UA 2GF3A 3V76A 4B64A 2EQ8A 2YG7A 4NEWA 2C73A 1EL7A 4H4SA 5JCIA 3QSMA 2RGHA 2BK3A 1M6IA 3UTFA 4CY6A 4REKA 4EMJA 1GXFA 1PDHA 1NDAA 2AQJA 2XFQA 3GMBA 4Y4LA 4A6NB 4ECHA 5L46A 2WDQA 3SQPA 4GDPA 3H4KA 3DJEA 1JU2A 2IVEA 1PJ7A 1E39A 2DKHA 4FX9A 1XDIA 1GPEA 2IIDA 2GR0A 3NYEA 1GTEA 2E5VA 5JCKA 5M0ZA 4AT2A 1YKJA 2BS3A 1GRAA 2RGJA 3SZWA 3SXIA 2ACZA 4B66A 2WU5A 1K0JA 1JRYA 3AEEA 3AE4A 2C3DA 3PVCA 4RG4A 2YR6A 5IPYA 3HYVA 4Z43A 4YTMA 1VRQB 1BWCA 3P4SA 3CNTA 4NWZA 4AP3A 3EAOA 4JY2A 4H2PA 2JB3A 1GREA 2E4GA 3UKFA 1P2HA 1H7WA 3HYXA 3NKSA 5KMSA 2YVJA 1S2YA 2GVCA 2Q6UA 1IUXA 2BA9A 4H4YA 4OPTA 1CJCA 1F8SA 1B5QA 1ZOVA 2C75A 4A9WA 3DK9A 2DKIA 4P9SA 2FJEA 4E0VA 1AOGA 3LADA 2I0ZA 4IA5A 2JB2A 3GYJA 1VQWA 3M13A 1NHRA 1ZDLA 2VVLA 2VOUA 2R9ZA 4FDCB 1GRFA 1HYUA 4H4UA 2BK5A 1GOSA 2XFNA 3C96A 1VDCA 3NTAA 3QJ4A 3AE7A 1FCDA 1F6MA 4Z2TA 4M52A 2EQ9A 1N4WA 5EOWA 4CRTA 1ZX9A 4DSGA 1CJ2A 1ZKQA 2BABA 3ISHA 3KLJA 1CC6A 1DOEA 3IC9A 4K5SA 4Z44A 5JCNA 5M10A 5CKUA 2R4JA 1XPQA 3DJJA 3NLCA 3GWDA 1PXBA 1LPFA 2GR2A 1N4UA 4JQ9A 2EQ7A 4KPRA 1DXLA 2GAHB 3KPFA 3NNEA 4A99A 1PBBA 1GESA 3LZXA 2C3CA 3EPTA 2B76A 2FJBA 4G6GA 4A6NA 2WOWA 1YQZA 3FPZA 2GB0A 3FMWA 1TDEA 2CVJA 2YM1A 2XDOA 3C4NA 3ITJA 4I58A 4II3A 3GWFA 1B8SA 2XFPA 1EBDA 3GDPA 3AE6A 3LZWA 3AD7B 3S5WA 4RSLA 3UP5A 3WE0A 2B9YA 5J60A 2BXSA 1PXAA 4A65A 3AE8A 3I6DA 4CNJA 3UKKA 5FS7A 1Q1WA 5KMPA 2JAEA 1ZY8A 3AE9A 3K7QX 4OCGA 2V5ZA 3VR8A 3UTGA 2XFOA 1BGNA 4LU6A 2VRLA 3ICRA 1E1MA 4ICYA 1TRBA 2QA2A 1E6EA 3BHFA 3CNDA 4GDEA 4BJYA 2XCGA 3UCLA 3BNUA 4EIQA 4JNQA 4X9MA 5JCMA 2ZBWA 2A89A 2XVIA 3AYJA 2CDUA 3NHOX 2BACA 1GERA 2YVGA 2V3AA 4ADWA 1TDOA 2EQ6A 3RP6A 4HA6A 4A5LA 3IWAA 4K22A 4OPDA 2BC1A 1UKVG 1CL0A 3AECA 3UTHA 2Q7VA 2VVLG 4DSHA 5KWFA 4G74A 5FS8A 5KRQA 2R4EA 2GR3A 5BRTA 1LVLA 4RG3A 4J34A 1CJ3A 3AYIA 4N9XA 5JCLA 3LB8A 2GQFA 3ALJA 3JSKA 1COYA 2WP6A 2PYXA 3EANA 3DK4A 4B68A 2YQUA 3NK0X 4YSXA 1MOKA 4C74A 1GTHA 3UKQA 1OJAA 3QFBA 2C72A 2F5ZA 2GMHA 2WPCA 1ZOYA 3GMCA 4USQA 4JDRA 3NYFA 4C3YA 2WP5A 4GUVA 2BCGG 3KVEA 3NG7X 5KOWA 2YG4A 2YR4A 1OJCA 1XHCA 1ONFA 2VRMA 4UDQA 3BI2A 3NT6A 4U8OA 3II4A 4K7ZA 4EM4A 3AB1A 1P2EA 1YQ4A 3DMEA 1Z6LA 2ARDA 2BK4A 3URHA 3SGLA 1PJ6A 4ZCDA 4CBQA 3FG2P 3FBSA 3CPIG 4AT0A 5KNLA 4TM3A 4XWRA 2FJAA 1N4VA 3K7TA 2WBAA 4BK2A 3CPHG 1DOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKW A;  3CTY A;  2BS2 A;  4EIP A;  2YLT A;  3H8I A;  4YTP A;  1NEK A;  4X9N A;  1B37 A;  4GCM A;  2YR5 A;  1LQU A;  4H2R A;  1GT8 A;  2Z5X A;  3DGH A;  3S61 A;  4B67 A;  2XLP A;  1NHQ A;  4MJW A;  3P1W A;  4H4X A;  4EQW A;  3SFE A;  1F8W A;  2WET A;  1Q1R A;  1XAN A;  3L8K A;  4OPL A;  4U2L A;  3UKP A;  1H86 A;  3SM8 A;  3GDN A;  3ICT A;  4BV6 A;  1EL5 A;  4YSY A;  2YWL A;  2NPX A;  4YSH A;  4BJZ A;  3E1T A;  3IHG A;  2WPE A;  2B9X A;  3H8L A;  1MXT A;  1Q9I A;  1TDK A;  3DJD A;  3KA7 A;  4J56 A;  1TYT A;  3RHA A;  4D04 A;  4USR A;  4O5Q A;  4IA6 A;  3CNJ A;  2B7S A;  5ER0 A;  3QSS A;  2Q0L A;  1PN0 A;  2C7G A;  2IVD A;  3ABV A;  2GV8 A;  3QSE A;  1DJN A;  1TYP A;  1CC4 A;  2GEW A;  4H2N A;  4H4W A;  1JRX A;  3GSI A;  1NG4 A;  1FL2 A;  3DGZ A;  1PXC A;  3K7M X;  4U8L A;  3NK2 X;  3UKH A;  4YSZ A;  2RAB A;  3KD9 A;  3AEF A;  1O95 A;  2WDV A;  1K0L A;  2A8X A;  3G5Q A;  1YQ3 A;  4TLZ A;  1BZL A;  2NVK X;  4J57 A;  3UTE A;  1PBF A;  3T37 A;  4H4T A;  4BUR A;  2GMJ A;  1D7L A;  2XVH A;  1IJH A;  3DJG X;  1E1K A;  4JN9 A;  3GD3 A;  5CQF A;  2BCP A;  4EM3 A;  2PHH A;  5J7X A;  2XVF A;  3QFA A;  2X50 A;  4ZN0 A;  3CGE A;  1L9C A;  2XFU A;  1L0V A;  1BF3 A;  3IHM A;  1LQT A;  4HB9 A;  4B63 A;  5DBJ A;  4OPI A;  1H84 A;  1S3B A;  5HXI A;  4YTN A;  1IUS A;  5EB4 A;  4TM4 A;  4APN A;  4H4Q A;  4JNA A;  1H7X A;  4U2T A;  1RSG A;  3F8D A;  1EL9 A;  3C4A A;  2WEU A;  2X3N A;  2VQB A;  2VZ2 A;  2TMD A;  2YM2 A;  2A87 A;  3ZYX A;  2OA1 A;  1D4D A;  1GSN A;  2V3B A;  1M64 A;  3Q9T A;  4OPU A;  3CPJ G;  2XLT A;  3CNS A;  3M0O A;  1O5W A;  3ATQ A;  1ZK7 A;  2YLW A;  4H4P A;  4U8N A;  2GQW A;  3VQR A;  4NZH A;  2BS4 A;  4EQS A;  2UZZ A;  1JEH A;  4YT0 A;  3AED A;  5GRT A;  4Z2U A;  1IUV A;  4IVO B;  3NIX A;  1VG0 A;  1KNP A;  2BXR A;  3OZ2 A;  3GRT A;  1FEC A;  1GV4 A;  2CFY A;  3BHK A;  3AEB A;  1DOD A;  3GRS A;  1E1N A;  4YXD A;  3RP8 A;  1NHS A;  1LTX R;  3UOZ A;  1CJ4 A;  1GAL A;  2R0C A;  3VRD B;  4IVM B;  4TLX A;  3NN0 X;  3AE3 A;  3P4P A;  4FK1 A;  4JY3 A;  1OJT A;  5U63 A;  3AXB A;  3AE5 A;  1D4E A;  4AOS A;  2Y6R A;  2AR8 A;  2XLR A;  3UOX A;  1B4V A;  1H82 A;  3UP4 A;  4K8D A;  4NEV A;  4J36 A;  1S2Q A;  1GRB A;  5U25 A;  1W4X A;  4AOX A;  5HY5 A;  4A7A A;  3PS9 A;  3AEG A;  3NYC A;  5GSN A;  1BGJ A;  3CN8 A;  1YY5 A;  1FEA A;  1KSS A;  2XYO A;  1GRT A;  4TM0 A;  5FS6 A;  4ZCC A;  1CBO A;  5EB5 A;  4CCR A;  3ALM A;  5BUK A;  2YVF A;  2OLO A;  3CGD A;  1ZMC A;  4H7U A;  2FJD A;  3I3L A;  5FMH A;  4U8I A;  1TDN A;  4YWO A;  1REO A;  3F8R A;  2XVJ A;  3UKA A;  4B65 A;  1SEZ A;  3RNM A;  3EF6 A;  2WES A;  4IV9 A;  3NN6 X;  4Y4N A;  3UKL A;  1Y56 B;  3NRN A;  2C70 A;  3ATR A;  3KKJ A;  4NTD A;  1LV0 A;  2X8C A;  4U8J A;  4FK1 C;  1KSU A;  1GND A;  2R0P A;  4XXG A;  4AP1 A;  4Z25 A;  5FS9 A;  1OJD A;  2Z5Y A;  2XLU A;  2WU2 A;  3LXD A;  4YKF A;  3UOY A;  3DH9 A;  1EL8 A;  2GH5 A;  4DGK A;  2H88 A;  3AEA A;  1NG3 A;  3R9U A;  3M12 A;  3COX A;  2QAE A;  4KX6 A;  2XLS A;  2YG6 A;  2JBV A;  4PAB A;  1H81 A;  2OLN A;  4D03 A;  2WQY A;  4UP3 A;  4U8M A;  2GAG B;  4BK3 A;  4U8P A;  4CY8 A;  3ICS A;  2X99 A;  4Z2R A;  2VVM A;  5IQ1 A;  1D7Y A;  1RP0 A;  3GD4 A;  5IQ4 A;  1H6V A;  1NPX A;  2WOV A;  3NK1 X;  1ELI A;  1PS9 A;  3BI4 A;  3F8P A;  2WHD A;  2ZZB A;  2R0G A;  1JRZ A;  3SFD A;  4J2W A;  1F3P A;  1ZP0 A;  2C65 A;  2B7R A;  2E1M A;  4XWZ A;  3AE1 A;  2V60 A;  1JNR A;  4U2S A;  4K2X A;  1O94 A;  5U1O A;  5LV9 A;  2YLZ A;  3ADA B;  2BYB A;  4H4Z A;  1F8R A;  1RYI A;  2R46 A;  3L1R A;  1PHH A;  2YG5 A;  4OPG A;  2VQ7 A;  4Y4M A;  5C3J A;  2YAU A;  1DNC A;  5KVI A;  3DA1 A;  4GF7 A;  3V3O A;  4C77 A;  5BUL A;  3AE2 A;  1JOA A;  3K30 A;  3AD9 B;  3IF9 A;  2CUL A;  1CHU A;  3ALL A;  4OPC A;  4Z26 A;  2HQM A;  2R45 A;  3GYI A;  1E1L A;  2C67 A;  4LA1 A;  3G5R A;  1S3E A;  1NEN A;  3DK8 A;  1L9E A;  4GRT A;  3CNP A;  1D4C A;  1IUU A;  4X4J A;  4U8K A;  1K4Q A;  1H83 A;  3ZDN A;  4YKG A;  2OAL A;  1D5T A;  1LJ1 A;  4H4V A;  3PO7 A;  4DNA A;  1QO8 A;  2V61 A;  1KFY A;  1ZMD A;  2WP9 A;  3CGB A;  4Z24 A;  4EQR A;  4WCT A;  2C66 A;  1QJD A;  1Y0P A;  3B6D A;  1DOB A;  2V6O A;  5C2T A;  3HZL A;  2QA1 A;  1CC2 A;  4OVI A;  2GRT A;  3O0H A;  4K5R A;  5TR3 A;  4J31 A;  1NHP A;  1IUT A;  3NTD A;  4NTC A;  5HHF A;  4LII A;  5HYM A;  1GET A;  2APG A;  3BNM A;  1K0I A;  5EBK A;  2JB1 A;  4C5O A;  1FOH A;  4WX1 A;  1OJ9 A;  1X31 B;  5KVH A;  2W0H A;  2ZZC A;  1N1P A;  5KOX A;  3AD8 B;  2YG3 A;  4GR1 A;  5KXJ A;  2B9W A;  4B1B A;  3NH3 X;  3P4R A;  3LJP A;  1GRG A;  2YLS A;  4H2Q A;  4J33 A;  1KDG A;  1NAA A;  3FIM B;  3G5S A;  3V3N A;  2YLR A;  4O5U A;  1PBD A;  1PJ5 A;  3OC4 A;  4TM1 A;  5BVA A;  2ZZ0 A;  2RGO A;  2TPR A;  1IUW A;  2OAM A;  2Y6Q A;  3AYL A;  1VG9 A;  2WDR A;  2FBW A;  3AWI A;  1V59 A;  4BK1 A;  4I59 A;  4A79 A;  1JNZ A;  2X8H A;  3VR9 A;  4CNK A;  3CIR A;  1DJQ A;  4H50 A;  4EQX A;  3LOV A;  3Q6J A;  2YLX A;  2Q0K A;  1GEU A;  4PAA A;  2JKC A;  2J3N A;  1KF6 A;  2QCU A;  1FEB A;  2X8G A;  4C3X A;  4NTE A;  1GRH A;  3NGC X;  2AAQ A;  3P4Q A;  3RED A;  3KU9 A;  2BC0 A;  4UDR A;  2XVE A;  2JK6 A;  1PBC A;  1PBE A;  1MO9 A;  3B3R A;  3VRA A;  1KNR A;  1CF3 A;  4UDP A;  3UOV A;  2WPF A;  1L9D A;  3D8X A;  2C76 A;  3D1C A;  3QVP A;  3RP7 A;  2WS3 A;  3CGC A;  3VRB A;  2GR1 A;  2H89 A;  4B69 A;  3BI5 A;  1TDF A;  2C64 A;  4H4R A;  2O9Z A;  4EMI A;  3QVR A;  1QLB A;  4CCQ A;  1Y56 A;  2WOI A;  4EMW A;  1E7P A;  3P9U A;  2GF3 A;  3V76 A;  4B64 A;  2EQ8 A;  2YG7 A;  4NEW A;  2C73 A;  1EL7 A;  4H4S A;  5JCI A;  3QSM A;  2RGH A;  2BK3 A;  1M6I A;  3UTF A;  4CY6 A;  4REK A;  4EMJ A;  1GXF A;  1PDH A;  1NDA A;  2AQJ A;  2XFQ A;  3GMB A;  4Y4L A;  4A6N B;  4ECH A;  5L46 A;  2WDQ A;  3SQP A;  4GDP A;  3H4K A;  3DJE A;  1JU2 A;  2IVE A;  1PJ7 A;  1E39 A;  2DKH A;  4FX9 A;  1XDI A;  1GPE A;  2IID A;  2GR0 A;  3NYE A;  1GTE A;  2E5V A;  5JCK A;  5M0Z A;  4AT2 A;  1YKJ A;  2BS3 A;  1GRA A;  2RGJ A;  4B66 A;  2ACZ A;  2WU5 A;  1K0J A;  1JRY A;  3AEE A;  3AE4 A;  2C3D A;  3PVC A;  4RG4 A;  2YR6 A;  5IPY A;  4Z43 A;  4YTM A;  1VRQ B;  1BWC A;  3P4S A;  3CNT A;  4AP3 A;  3EAO A;  4JY2 A;  4H2P A;  2JB3 A;  1GRE A;  2E4G A;  3UKF A;  1P2H A;  1H7W A;  3NKS A;  2YVJ A;  1S2Y A;  2GVC A;  2Q6U A;  1IUX A;  2BA9 A;  4H4Y A;  4OPT A;  1CJC A;  1F8S A;  1B5Q A;  1ZOV A;  2C75 A;  4A9W A;  3DK9 A;  2DKI A;  4P9S A;  2FJE A;  4E0V A;  1AOG A;  3LAD A;  2I0Z A;  4IA5 A;  2JB2 A;  3GYJ A;  1VQW A;  3M13 A;  1NHR A;  1ZDL A;  2VVL A;  2VOU A;  2R9Z A;  4FDC B;  1GRF A;  1HYU A;  4H4U A;  2BK5 A;  1GOS A;  2XFN A;  3C96 A;  1VDC A;  3NTA A;  3QJ4 A;  3AE7 A;  1FCD A;  1F6M A;  4Z2T A;  4M52 A;  2EQ9 A;  1N4W A;  5EOW A;  4CRT A;  1ZX9 A;  4DSG A;  1CJ2 A;  1ZKQ A;  2BAB A;  3ISH A;  3KLJ A;  1CC6 A;  1DOE A;  3IC9 A;  4K5S A;  4Z44 A;  5JCN A;  5M10 A;  5CKU A;  2R4J A;  1XPQ A;  3DJJ A;  3NLC A;  3GWD A;  1PXB A;  1LPF A;  2GR2 A;  1N4U A;  4JQ9 A;  2EQ7 A;  4KPR A;  1DXL A;  2GAH B;  3KPF A;  3NNE A;  4A99 A;  1PBB A;  1GES A;  3LZX A;  2C3C A;  3EPT A;  2B76 A;  2FJB A;  4A6N A;  2WOW A;  1YQZ A;  3FPZ A;  2GB0 A;  3FMW A;  1TDE A;  2CVJ A;  2YM1 A;  2XDO A;  3C4N A;  3ITJ A;  4I58 A;  3GWF A;  1B8S A;  2XFP A;  1EBD A;  3GDP A;  3AE6 A;  3LZW A;  3AD7 B;  3S5W A;  4RSL A;  3UP5 A;  3WE0 A;  2B9Y A;  5J60 A;  2BXS A;  1PXA A;  4A65 A;  3AE8 A;  3I6D A;  4CNJ A;  3UKK A;  5FS7 A;  1Q1W A;  2JAE A;  1ZY8 A;  3AE9 A;  3K7Q X;  4OCG A;  2V5Z A;  3VR8 A;  3UTG A;  2XFO A;  1BGN A;  4LU6 A;  2VRL A;  3ICR A;  1E1M A;  4ICY A;  1TRB A;  2QA2 A;  1E6E A;  3BHF A;  3CND A;  4GDE A;  4BJY A;  2XCG A;  3UCL A;  3BNU A;  4EIQ A;  4JNQ A;  4X9M A;  5JCM A;  2ZBW A;  2A89 A;  2XVI A;  3AYJ A;  2CDU A;  3NHO X;  2BAC A;  1GER A;  2YVG A;  2V3A A;  4ADW A;  1TDO A;  2EQ6 A;  3RP6 A;  4HA6 A;  4A5L A;  3IWA A;  4K22 A;  4OPD A;  2BC1 A;  1UKV G;  1CL0 A;  3AEC A;  3UTH A;  2Q7V A;  2VVL G;  4DSH A;  5KWF A;  5FS8 A;  5KRQ A;  2R4E A;  2GR3 A;  5BRT A;  1LVL A;  4RG3 A;  4J34 A;  1CJ3 A;  3AYI A;  4N9X A;  5JCL A;  3LB8 A;  2GQF A;  3ALJ A;  3JSK A;  1COY A;  2WP6 A;  2PYX A;  3EAN A;  3DK4 A;  4B68 A;  2YQU A;  3NK0 X;  4YSX A;  1MOK A;  4C74 A;  1GTH A;  3UKQ A;  1OJA A;  3QFB A;  2C72 A;  2F5Z A;  2GMH A;  2WPC A;  1ZOY A;  3GMC A;  4USQ A;  4JDR A;  3NYF A;  4C3Y A;  2WP5 A;  4GUV A;  2BCG G;  3KVE A;  3NG7 X;  5KOW A;  2YG4 A;  2YR4 A;  1OJC A;  1XHC A;  1ONF A;  2VRM A;  4UDQ A;  3BI2 A;  3NT6 A;  4U8O A;  3II4 A;  4K7Z A;  4EM4 A;  3AB1 A;  1P2E A;  1YQ4 A;  3DME A;  1Z6L A;  2ARD A;  2BK4 A;  3URH A;  3SGL A;  1PJ6 A;  4ZCD A;  4CBQ A;  3FG2 P;  3FBS A;  3CPI G;  4AT0 A;  4TM3 A;  4XWR A;  2FJA A;  1N4V A;  3K7T A;  2WBA A;  4BK2 A;  3CPH G;  1DOC A; 
#chains in the Genus database with same CATH topology
 1BKW A;  3CTY A;  2BS2 A;  4EIP A;  2YLT A;  3H8I A;  4YTP A;  1NEK A;  4X9N A;  1B37 A;  4GCM A;  2YR5 A;  1LQU A;  4H2R A;  1GT8 A;  2Z5X A;  3DGH A;  3S61 A;  4B67 A;  2XLP A;  1NHQ A;  4MJW A;  3KPK A;  3P1W A;  4H4X A;  4EQW A;  3SFE A;  1F8W A;  2WET A;  1Q1R A;  1XAN A;  3L8K A;  4OPL A;  3CMM A;  4U2L A;  3UKP A;  1H86 A;  3SM8 A;  3GDN A;  3ICT A;  3T2Z A;  1EL5 A;  4BV6 A;  4YSY A;  2YWL A;  2NPX A;  4YSH A;  4BJZ A;  3E1T A;  3IHG A;  2WPE A;  2B9X A;  3H8L A;  1MXT A;  1Q9I A;  1TDK A;  3DJD A;  3KA7 A;  4J56 A;  1TYT A;  3RHA A;  4D04 A;  4USR A;  4O5Q A;  4IA6 A;  3CNJ A;  2B7S A;  5ER0 A;  3QSS A;  2Q0L A;  3SY4 A;  1PN0 A;  2C7G A;  2IVD A;  3ABV A;  2GV8 A;  3QSE A;  1DJN A;  1TYP A;  1CC4 A;  2GEW A;  4H2N A;  4H4W A;  1JRX A;  3GSI A;  1NG4 A;  1FL2 A;  3DGZ A;  1PXC A;  3K7M X;  3T31 A;  4U8L A;  3NK2 X;  3UKH A;  4YSZ A;  2RAB A;  3KD9 A;  4G73 A;  3AEF A;  1O95 A;  4II2 A;  2WDV A;  1K0L A;  2A8X A;  3G5Q A;  1YQ3 A;  4TLZ A;  1BZL A;  2NVK X;  4J57 A;  3UTE A;  1PBF A;  3T37 A;  4H4T A;  4BUR A;  2GMJ A;  1D7L A;  2XVH A;  1IJH A;  3DJG X;  1E1K A;  4JN9 A;  3GD3 A;  5CQF A;  2BCP A;  4EM3 A;  2PHH A;  5J7X A;  2XVF A;  3QFA A;  2X50 A;  4ZN0 A;  3CGE A;  1L9C A;  2XFU A;  1L0V A;  1BF3 A;  3IHM A;  1LQT A;  4HB9 A;  4B63 A;  5DBJ A;  4OPI A;  1H84 A;  1S3B A;  5HXI A;  4YTN A;  1IUS A;  5EB4 A;  3T2K A;  4TM4 A;  4APN A;  4H4Q A;  4JNA A;  1H7X A;  4U2T A;  1RSG A;  3F8D A;  1EL9 A;  3C4A A;  2WEU A;  2X3N A;  2VQB A;  2VZ2 A;  4G6H A;  2TMD A;  2YM2 A;  2A87 A;  3ZYX A;  2OA1 A;  1D4D A;  1GSN A;  2V3B A;  1M64 A;  3Q9T A;  4OPU A;  3CPJ G;  2XLT A;  3CNS A;  3M0O A;  1O5W A;  3ATQ A;  1ZK7 A;  2YLW A;  4H4P A;  4U8N A;  2GQW A;  3VQR A;  4NZH A;  2BS4 A;  4EQS A;  2UZZ A;  1JEH A;  4YT0 A;  3AED A;  5GRT A;  4Z2U A;  1IUV A;  4IVO B;  5KMR A;  3SX6 A;  3NIX A;  4G9K A;  1VG0 A;  1KNP A;  2BXR A;  3OZ2 A;  3GRT A;  1FEC A;  1GV4 A;  2CFY A;  3BHK A;  3AEB A;  1DOD A;  3GRS A;  1E1N A;  4YXD A;  3RP8 A;  1NHS A;  1LTX R;  3UOZ A;  1CJ4 A;  1GAL A;  2R0C A;  2BRA A;  3VRD B;  4IVM B;  4TLX A;  3NN0 X;  3AE3 A;  3P4P A;  3SYI A;  2BRY A;  4FK1 A;  4JY3 A;  1OJT A;  5U63 A;  3AXB A;  3AE5 A;  1D4E A;  4AOS A;  2Y6R A;  2AR8 A;  2XLR A;  3UOX A;  1B4V A;  1H82 A;  3UP4 A;  4K8D A;  4NEV A;  4J36 A;  1S2Q A;  1GRB A;  5U25 A;  1W4X A;  4AOX A;  5HY5 A;  4A7A A;  3PS9 A;  3AEG A;  3NYC A;  5GSN A;  1BGJ A;  3CN8 A;  1YY5 A;  1FEA A;  1KSS A;  2XYO A;  1GRT A;  4TM0 A;  5FS6 A;  4ZCC A;  1CBO A;  5EB5 A;  4CCR A;  3ALM A;  5BUK A;  2C4C A;  2YVF A;  2OLO A;  3CGD A;  1ZMC A;  4H7U A;  2FJD A;  3I3L A;  5FMH A;  4U8I A;  1TDN A;  4YWO A;  1REO A;  3F8R A;  2XVJ A;  3UKA A;  4B65 A;  1SEZ A;  3RNM A;  3EF6 A;  2WES A;  4IV9 A;  3T0K A;  3NN6 X;  4Y4N A;  3UKL A;  1Y56 B;  3NRN A;  2C70 A;  3ATR A;  3KKJ A;  4NTD A;  1LV0 A;  2X8C A;  4U8J A;  4FK1 C;  1KSU A;  1GND A;  2R0P A;  4XXG A;  4AP1 A;  4Z25 A;  5FS9 A;  1OJD A;  2Z5Y A;  2XLU A;  2WU2 A;  3LXD A;  4YKF A;  3UOY A;  3DH9 A;  1EL8 A;  2GH5 A;  4DGK A;  2H88 A;  3AEA A;  1NG3 A;  3R9U A;  3GYX A;  3M12 A;  3COX A;  2QAE A;  4KX6 A;  2XLS A;  2YG6 A;  2JBV A;  4PAB A;  1H81 A;  2OLN A;  4D03 A;  2WQY A;  4UP3 A;  4U8M A;  2GAG B;  4BK3 A;  4U8P A;  4CY8 A;  3ICS A;  2X99 A;  4Z2R A;  2VVM A;  5IQ1 A;  3T14 A;  1D7Y A;  1RP0 A;  3GD4 A;  5IQ4 A;  1H6V A;  1NPX A;  2WOV A;  3NK1 X;  1ELI A;  1PS9 A;  3BI4 A;  3F8P A;  2WHD A;  2ZZB A;  2R0G A;  1JRZ A;  3SFD A;  4J2W A;  1F3P A;  1ZP0 A;  2C65 A;  2B7R A;  2E1M A;  4XWZ A;  3AE1 A;  2V60 A;  1JNR A;  4U2S A;  4K2X A;  1O94 A;  5U1O A;  5LV9 A;  2YLZ A;  3ADA B;  2BYB A;  4H4Z A;  1F8R A;  1RYI A;  2R46 A;  3L1R A;  1PHH A;  2YG5 A;  4OPG A;  2VQ7 A;  4Y4M A;  5C3J A;  2YAU A;  1DNC A;  5KVI A;  3DA1 A;  4GF7 A;  3V3O A;  4C77 A;  5BUL A;  3AE2 A;  3SZ0 A;  1JOA A;  3K30 A;  3AD9 B;  3IF9 A;  2CUL A;  1CHU A;  3ALL A;  4OPC A;  4Z26 A;  2HQM A;  2R45 A;  3GYI A;  1E1L A;  2C67 A;  4LA1 A;  3G5R A;  1S3E A;  1NEN A;  3DK8 A;  1L9E A;  4GRT A;  3CNP A;  1D4C A;  1IUU A;  4X4J A;  4U8K A;  1K4Q A;  1H83 A;  3ZDN A;  4YKG A;  2OAL A;  1D5T A;  1LJ1 A;  4H4V A;  3PO7 A;  4DNA A;  1QO8 A;  2V61 A;  1KFY A;  1ZMD A;  2WP9 A;  3CGB A;  4Z24 A;  4EQR A;  4WCT A;  2C66 A;  1QJD A;  1Y0P A;  3B6D A;  1DOB A;  2V6O A;  5C2T A;  3HZL A;  2QA1 A;  1CC2 A;  4OVI A;  2GRT A;  3O0H A;  4K5R A;  5TR3 A;  4J31 A;  1NHP A;  1IUT A;  3NTD A;  4NTC A;  5HHF A;  4LII A;  5HYM A;  1GET A;  2APG A;  3BNM A;  1K0I A;  5EBK A;  2JB1 A;  4C5O A;  1FOH A;  4WX1 A;  1OJ9 A;  1X31 B;  5KVH A;  2W0H A;  2ZZC A;  1N1P A;  5KOX A;  3AD8 B;  2YG3 A;  4GR1 A;  5KXJ A;  2B9W A;  4B1B A;  3NH3 X;  3P4R A;  3LJP A;  4GAV A;  1GRG A;  2YLS A;  4H2Q A;  4J33 A;  1KDG A;  1NAA A;  3FIM B;  3G5S A;  3V3N A;  2YLR A;  4O5U A;  1PBD A;  1PJ5 A;  3OC4 A;  4TM1 A;  5BVA A;  2ZZ0 A;  2RGO A;  2TPR A;  3T2Y A;  1IUW A;  2OAM A;  2Y6Q A;  3AYL A;  4GAP A;  1VG9 A;  2WDR A;  2FBW A;  3AWI A;  1V59 A;  4NNJ A;  4BK1 A;  4I59 A;  4A79 A;  1JNZ A;  2X8H A;  3VR9 A;  4CNK A;  3CIR A;  1DJQ A;  4H50 A;  4EQX A;  3LOV A;  3Q6J A;  2YLX A;  2Q0K A;  1GEU A;  4PAA A;  2JKC A;  3SZF A;  2J3N A;  1KF6 A;  2QCU A;  5KMQ A;  1FEB A;  3HYW A;  2X8G A;  4C3X A;  4NTE A;  1GRH A;  3NGC X;  2AAQ A;  3P4Q A;  3RED A;  3KU9 A;  2BC0 A;  4UDR A;  2XVE A;  2JK6 A;  1PBC A;  1PBE A;  1MO9 A;  3B3R A;  3VRA A;  1KNR A;  1CF3 A;  4UDP A;  3UOV A;  2WPF A;  3SZC A;  1L9D A;  3D8X A;  2C76 A;  3D1C A;  3QVP A;  3RP7 A;  2WS3 A;  3CGC A;  3VRB A;  2GR1 A;  2H89 A;  4B69 A;  3BI5 A;  1TDF A;  2C64 A;  4H4R A;  2O9Z A;  4EMI A;  3QVR A;  1QLB A;  4CCQ A;  1Y56 A;  2WOI A;  4EMW A;  1E7P A;  3P9U A;  2GF3 A;  3V76 A;  4B64 A;  2EQ8 A;  2YG7 A;  4NEW A;  2C73 A;  1EL7 A;  4H4S A;  5JCI A;  3QSM A;  2RGH A;  2BK3 A;  1M6I A;  3UTF A;  4CY6 A;  4REK A;  4EMJ A;  1GXF A;  1PDH A;  1NDA A;  2AQJ A;  2XFQ A;  3GMB A;  4Y4L A;  4A6N B;  4ECH A;  5L46 A;  2WDQ A;  3SQP A;  4GDP A;  3H4K A;  3DJE A;  1JU2 A;  2IVE A;  1PJ7 A;  1E39 A;  2DKH A;  4FX9 A;  1XDI A;  1GPE A;  2IID A;  2GR0 A;  3NYE A;  1GTE A;  2E5V A;  5JCK A;  5M0Z A;  4AT2 A;  1YKJ A;  2BS3 A;  1GRA A;  2RGJ A;  3SZW A;  3SXI A;  2ACZ A;  4B66 A;  2WU5 A;  1K0J A;  1JRY A;  3AEE A;  3AE4 A;  2C3D A;  3PVC A;  4RG4 A;  2YR6 A;  5IPY A;  3HYV A;  4Z43 A;  4YTM A;  1VRQ B;  1BWC A;  3P4S A;  3CNT A;  4NWZ A;  4AP3 A;  3EAO A;  4JY2 A;  4H2P A;  2JB3 A;  1GRE A;  2E4G A;  3UKF A;  1P2H A;  1H7W A;  3HYX A;  3NKS A;  5KMS A;  2YVJ A;  1S2Y A;  2GVC A;  2Q6U A;  1IUX A;  2BA9 A;  4H4Y A;  4OPT A;  1CJC A;  1F8S A;  1B5Q A;  1ZOV A;  2C75 A;  4A9W A;  3DK9 A;  2DKI A;  4P9S A;  2FJE A;  4E0V A;  1AOG A;  3LAD A;  2I0Z A;  4IA5 A;  2JB2 A;  3GYJ A;  1VQW A;  3M13 A;  1NHR A;  1ZDL A;  2VVL A;  2VOU A;  2R9Z A;  4FDC B;  1GRF A;  1HYU A;  4H4U A;  2BK5 A;  1GOS A;  2XFN A;  3C96 A;  1VDC A;  3NTA A;  3QJ4 A;  3AE7 A;  1FCD A;  1F6M A;  4Z2T A;  4M52 A;  2EQ9 A;  1N4W A;  5EOW A;  4CRT A;  1ZX9 A;  4DSG A;  1CJ2 A;  1ZKQ A;  2BAB A;  3ISH A;  3KLJ A;  1CC6 A;  1DOE A;  3IC9 A;  4K5S A;  4Z44 A;  5JCN A;  5M10 A;  5CKU A;  2R4J A;  1XPQ A;  3DJJ A;  3NLC A;  3GWD A;  1PXB A;  1LPF A;  2GR2 A;  1N4U A;  4JQ9 A;  2EQ7 A;  4KPR A;  1DXL A;  2GAH B;  3KPF A;  3NNE A;  4A99 A;  1PBB A;  1GES A;  3LZX A;  2C3C A;  3EPT A;  2B76 A;  2FJB A;  4G6G A;  4A6N A;  2WOW A;  1YQZ A;  3FPZ A;  2GB0 A;  3FMW A;  1TDE A;  2CVJ A;  2YM1 A;  2XDO A;  3C4N A;  3ITJ A;  4I58 A;  4II3 A;  3GWF A;  1B8S A;  2XFP A;  1EBD A;  3GDP A;  3AE6 A;  3LZW A;  3AD7 B;  3S5W A;  4RSL A;  3UP5 A;  3WE0 A;  2B9Y A;  5J60 A;  2BXS A;  1PXA A;  4A65 A;  3AE8 A;  3I6D A;  4CNJ A;  3UKK A;  5FS7 A;  1Q1W A;  5KMP A;  2JAE A;  1ZY8 A;  3AE9 A;  3K7Q X;  4OCG A;  2V5Z A;  3VR8 A;  3UTG A;  2XFO A;  1BGN A;  4LU6 A;  2VRL A;  3ICR A;  1E1M A;  4ICY A;  1TRB A;  2QA2 A;  1E6E A;  3BHF A;  3CND A;  4GDE A;  4BJY A;  2XCG A;  3UCL A;  3BNU A;  4EIQ A;  4JNQ A;  4X9M A;  5JCM A;  2ZBW A;  2A89 A;  2XVI A;  3AYJ A;  2CDU A;  3NHO X;  2BAC A;  1GER A;  2YVG A;  2V3A A;  4ADW A;  1TDO A;  2EQ6 A;  3RP6 A;  4HA6 A;  4A5L A;  3IWA A;  4K22 A;  4OPD A;  2BC1 A;  1UKV G;  1CL0 A;  3AEC A;  3UTH A;  2Q7V A;  2VVL G;  4DSH A;  5KWF A;  4G74 A;  5FS8 A;  5KRQ A;  2R4E A;  2GR3 A;  5BRT A;  1LVL A;  4RG3 A;  4J34 A;  1CJ3 A;  3AYI A;  4N9X A;  5JCL A;  3LB8 A;  2GQF A;  3ALJ A;  3JSK A;  1COY A;  2WP6 A;  2PYX A;  3EAN A;  3DK4 A;  4B68 A;  2YQU A;  3NK0 X;  4YSX A;  1MOK A;  4C74 A;  1GTH A;  3UKQ A;  1OJA A;  3QFB A;  2C72 A;  2F5Z A;  2GMH A;  2WPC A;  1ZOY A;  3GMC A;  4USQ A;  4JDR A;  3NYF A;  4C3Y A;  2WP5 A;  4GUV A;  2BCG G;  3KVE A;  3NG7 X;  5KOW A;  2YG4 A;  2YR4 A;  1OJC A;  1XHC A;  1ONF A;  2VRM A;  4UDQ A;  3BI2 A;  3NT6 A;  4U8O A;  3II4 A;  4K7Z A;  4EM4 A;  3AB1 A;  1P2E A;  1YQ4 A;  3DME A;  1Z6L A;  2ARD A;  2BK4 A;  3URH A;  3SGL A;  1PJ6 A;  4ZCD A;  4CBQ A;  3FG2 P;  3FBS A;  3CPI G;  4AT0 A;  5KNL A;  4TM3 A;  4XWR A;  2FJA A;  1N4V A;  3K7T A;  2WBA A;  4BK2 A;  3CPH G;  1DOC A; 
#chains in the Genus database with same CATH homology
 1BKW A;  3CTY A;  2BS2 A;  4EIP A;  2YLT A;  3H8I A;  4YTP A;  1NEK A;  4X9N A;  1B37 A;  4GCM A;  2YR5 A;  1LQU A;  4H2R A;  1GT8 A;  2Z5X A;  3DGH A;  3S61 A;  4B67 A;  2XLP A;  1NHQ A;  4MJW A;  3KPK A;  3P1W A;  4H4X A;  4EQW A;  3SFE A;  1F8W A;  2WET A;  1Q1R A;  1XAN A;  3L8K A;  4OPL A;  3CMM A;  4U2L A;  3UKP A;  1H86 A;  3SM8 A;  3GDN A;  3ICT A;  3T2Z A;  1EL5 A;  4BV6 A;  4YSY A;  2YWL A;  2NPX A;  4YSH A;  4BJZ A;  3E1T A;  3IHG A;  2WPE A;  2B9X A;  3H8L A;  1MXT A;  1Q9I A;  1TDK A;  3DJD A;  3KA7 A;  4J56 A;  1TYT A;  3RHA A;  4D04 A;  4USR A;  4O5Q A;  4IA6 A;  3CNJ A;  2B7S A;  5ER0 A;  3QSS A;  2Q0L A;  3SY4 A;  1PN0 A;  2C7G A;  2IVD A;  3ABV A;  2GV8 A;  3QSE A;  1DJN A;  1TYP A;  1CC4 A;  2GEW A;  4H2N A;  4H4W A;  1JRX A;  3GSI A;  1NG4 A;  1FL2 A;  3DGZ A;  1PXC A;  3K7M X;  3T31 A;  4U8L A;  3NK2 X;  3UKH A;  4YSZ A;  2RAB A;  3KD9 A;  4G73 A;  3AEF A;  1O95 A;  4II2 A;  2WDV A;  1K0L A;  2A8X A;  3G5Q A;  1YQ3 A;  4TLZ A;  1BZL A;  2NVK X;  4J57 A;  3UTE A;  1PBF A;  3T37 A;  4H4T A;  4BUR A;  2GMJ A;  1D7L A;  2XVH A;  1IJH A;  3DJG X;  1E1K A;  4JN9 A;  3GD3 A;  5CQF A;  2BCP A;  4EM3 A;  2PHH A;  5J7X A;  2XVF A;  3QFA A;  2X50 A;  4ZN0 A;  3CGE A;  1L9C A;  2XFU A;  1L0V A;  1BF3 A;  3IHM A;  1LQT A;  4HB9 A;  4B63 A;  5DBJ A;  4OPI A;  1H84 A;  1S3B A;  5HXI A;  4YTN A;  1IUS A;  5EB4 A;  3T2K A;  4TM4 A;  4APN A;  4H4Q A;  4JNA A;  1H7X A;  4U2T A;  1RSG A;  3F8D A;  1EL9 A;  3C4A A;  2WEU A;  2X3N A;  2VQB A;  2VZ2 A;  4G6H A;  2TMD A;  2YM2 A;  2A87 A;  3ZYX A;  2OA1 A;  1D4D A;  1GSN A;  2V3B A;  1M64 A;  3Q9T A;  4OPU A;  3CPJ G;  2XLT A;  3CNS A;  3M0O A;  1O5W A;  3ATQ A;  1ZK7 A;  2YLW A;  4H4P A;  4U8N A;  2GQW A;  3VQR A;  4NZH A;  2BS4 A;  4EQS A;  2UZZ A;  1JEH A;  4YT0 A;  3AED A;  5GRT A;  4Z2U A;  1IUV A;  4IVO B;  5KMR A;  3SX6 A;  3NIX A;  4G9K A;  1VG0 A;  1KNP A;  2BXR A;  3OZ2 A;  3GRT A;  1FEC A;  1GV4 A;  2CFY A;  3BHK A;  3AEB A;  1DOD A;  3GRS A;  1E1N A;  4YXD A;  3RP8 A;  1NHS A;  1LTX R;  3UOZ A;  1CJ4 A;  1GAL A;  2R0C A;  2BRA A;  3VRD B;  4IVM B;  4TLX A;  3NN0 X;  3AE3 A;  3P4P A;  3SYI A;  2BRY A;  4FK1 A;  4JY3 A;  1OJT A;  5U63 A;  3AXB A;  3AE5 A;  1D4E A;  4AOS A;  2Y6R A;  2AR8 A;  2XLR A;  3UOX A;  1B4V A;  1H82 A;  3UP4 A;  4K8D A;  4NEV A;  4J36 A;  1S2Q A;  1GRB A;  5U25 A;  1W4X A;  4AOX A;  5HY5 A;  4A7A A;  3PS9 A;  3AEG A;  3NYC A;  5GSN A;  1BGJ A;  3CN8 A;  1YY5 A;  1FEA A;  1KSS A;  2XYO A;  1GRT A;  4TM0 A;  5FS6 A;  4ZCC A;  1CBO A;  5EB5 A;  4CCR A;  3ALM A;  5BUK A;  2C4C A;  2YVF A;  2OLO A;  3CGD A;  1ZMC A;  4H7U A;  2FJD A;  3I3L A;  5FMH A;  4U8I A;  1TDN A;  4YWO A;  1REO A;  3F8R A;  2XVJ A;  3UKA A;  4B65 A;  1SEZ A;  3RNM A;  3EF6 A;  2WES A;  4IV9 A;  3T0K A;  3NN6 X;  4Y4N A;  3UKL A;  1Y56 B;  3NRN A;  2C70 A;  3ATR A;  3KKJ A;  4NTD A;  1LV0 A;  2X8C A;  4U8J A;  4FK1 C;  1KSU A;  1GND A;  2R0P A;  4XXG A;  4AP1 A;  4Z25 A;  5FS9 A;  1OJD A;  2Z5Y A;  2XLU A;  2WU2 A;  3LXD A;  4YKF A;  3UOY A;  3DH9 A;  1EL8 A;  2GH5 A;  4DGK A;  2H88 A;  3AEA A;  1NG3 A;  3R9U A;  3GYX A;  3M12 A;  3COX A;  2QAE A;  4KX6 A;  2XLS A;  2YG6 A;  2JBV A;  4PAB A;  1H81 A;  2OLN A;  4D03 A;  2WQY A;  4UP3 A;  4U8M A;  2GAG B;  4BK3 A;  4U8P A;  4CY8 A;  3ICS A;  2X99 A;  4Z2R A;  2VVM A;  5IQ1 A;  3T14 A;  1D7Y A;  1RP0 A;  3GD4 A;  5IQ4 A;  1H6V A;  1NPX A;  2WOV A;  3NK1 X;  1ELI A;  1PS9 A;  3BI4 A;  3F8P A;  2WHD A;  2ZZB A;  2R0G A;  1JRZ A;  3SFD A;  4J2W A;  1F3P A;  1ZP0 A;  2C65 A;  2B7R A;  2E1M A;  4XWZ A;  3AE1 A;  2V60 A;  1JNR A;  4U2S A;  4K2X A;  1O94 A;  5U1O A;  5LV9 A;  2YLZ A;  3ADA B;  2BYB A;  4H4Z A;  1F8R A;  1RYI A;  2R46 A;  3L1R A;  1PHH A;  2YG5 A;  4OPG A;  2VQ7 A;  4Y4M A;  5C3J A;  2YAU A;  1DNC A;  5KVI A;  3DA1 A;  4GF7 A;  3V3O A;  4C77 A;  5BUL A;  3AE2 A;  3SZ0 A;  1JOA A;  3K30 A;  3AD9 B;  3IF9 A;  2CUL A;  1CHU A;  3ALL A;  4OPC A;  4Z26 A;  2HQM A;  2R45 A;  3GYI A;  1E1L A;  2C67 A;  4LA1 A;  3G5R A;  1S3E A;  1NEN A;  3DK8 A;  1L9E A;  4GRT A;  3CNP A;  1D4C A;  1IUU A;  4X4J A;  4U8K A;  1K4Q A;  1H83 A;  3ZDN A;  4YKG A;  2OAL A;  1D5T A;  1LJ1 A;  4H4V A;  3PO7 A;  4DNA A;  1QO8 A;  2V61 A;  1KFY A;  1ZMD A;  2WP9 A;  3CGB A;  4Z24 A;  4EQR A;  4WCT A;  2C66 A;  1QJD A;  1Y0P A;  3B6D A;  1DOB A;  2V6O A;  5C2T A;  3HZL A;  2QA1 A;  1CC2 A;  4OVI A;  2GRT A;  3O0H A;  4K5R A;  5TR3 A;  4J31 A;  1NHP A;  1IUT A;  3NTD A;  4NTC A;  5HHF A;  4LII A;  5HYM A;  1GET A;  2APG A;  3BNM A;  1K0I A;  5EBK A;  2JB1 A;  4C5O A;  1FOH A;  4WX1 A;  1OJ9 A;  1X31 B;  5KVH A;  2W0H A;  2ZZC A;  1N1P A;  5KOX A;  3AD8 B;  2YG3 A;  4GR1 A;  5KXJ A;  2B9W A;  4B1B A;  3NH3 X;  3P4R A;  3LJP A;  4GAV A;  1GRG A;  2YLS A;  4H2Q A;  4J33 A;  1KDG A;  1NAA A;  3FIM B;  3G5S A;  3V3N A;  2YLR A;  4O5U A;  1PBD A;  1PJ5 A;  3OC4 A;  4TM1 A;  5BVA A;  2ZZ0 A;  2RGO A;  2TPR A;  3T2Y A;  1IUW A;  2OAM A;  2Y6Q A;  3AYL A;  4GAP A;  1VG9 A;  2WDR A;  2FBW A;  3AWI A;  1V59 A;  4NNJ A;  4BK1 A;  4I59 A;  4A79 A;  1JNZ A;  2X8H A;  3VR9 A;  4CNK A;  3CIR A;  1DJQ A;  4H50 A;  4EQX A;  3LOV A;  3Q6J A;  2YLX A;  2Q0K A;  1GEU A;  4PAA A;  2JKC A;  3SZF A;  2J3N A;  1KF6 A;  2QCU A;  5KMQ A;  1FEB A;  3HYW A;  2X8G A;  4C3X A;  4NTE A;  1GRH A;  3NGC X;  2AAQ A;  3P4Q A;  3RED A;  3KU9 A;  2BC0 A;  4UDR A;  2XVE A;  2JK6 A;  1PBC A;  1PBE A;  1MO9 A;  3B3R A;  3VRA A;  1KNR A;  1CF3 A;  4UDP A;  3UOV A;  2WPF A;  3SZC A;  1L9D A;  3D8X A;  2C76 A;  3D1C A;  3QVP A;  3RP7 A;  2WS3 A;  3CGC A;  3VRB A;  2GR1 A;  2H89 A;  4B69 A;  3BI5 A;  1TDF A;  2C64 A;  4H4R A;  2O9Z A;  4EMI A;  3QVR A;  1QLB A;  4CCQ A;  1Y56 A;  2WOI A;  4EMW A;  1E7P A;  3P9U A;  2GF3 A;  3V76 A;  4B64 A;  2EQ8 A;  2YG7 A;  4NEW A;  2C73 A;  1EL7 A;  4H4S A;  5JCI A;  3QSM A;  2RGH A;  2BK3 A;  1M6I A;  3UTF A;  4CY6 A;  4REK A;  4EMJ A;  1GXF A;  1PDH A;  1NDA A;  2AQJ A;  2XFQ A;  3GMB A;  4Y4L A;  4A6N B;  4ECH A;  5L46 A;  2WDQ A;  3SQP A;  4GDP A;  3H4K A;  3DJE A;  1JU2 A;  2IVE A;  1PJ7 A;  1E39 A;  2DKH A;  4FX9 A;  1XDI A;  1GPE A;  2IID A;  2GR0 A;  3NYE A;  1GTE A;  2E5V A;  5JCK A;  5M0Z A;  4AT2 A;  1YKJ A;  2BS3 A;  1GRA A;  2RGJ A;  3SZW A;  3SXI A;  2ACZ A;  4B66 A;  2WU5 A;  1K0J A;  1JRY A;  3AEE A;  3AE4 A;  2C3D A;  3PVC A;  4RG4 A;  2YR6 A;  5IPY A;  3HYV A;  4Z43 A;  4YTM A;  1VRQ B;  1BWC A;  3P4S A;  3CNT A;  4NWZ A;  4AP3 A;  3EAO A;  4JY2 A;  4H2P A;  2JB3 A;  1GRE A;  2E4G A;  3UKF A;  1P2H A;  1H7W A;  3HYX A;  3NKS A;  5KMS A;  2YVJ A;  1S2Y A;  2GVC A;  2Q6U A;  1IUX A;  2BA9 A;  4H4Y A;  4OPT A;  1CJC A;  1F8S A;  1B5Q A;  1ZOV A;  2C75 A;  4A9W A;  3DK9 A;  2DKI A;  4P9S A;  2FJE A;  4E0V A;  1AOG A;  3LAD A;  2I0Z A;  4IA5 A;  2JB2 A;  3GYJ A;  1VQW A;  3M13 A;  1NHR A;  1ZDL A;  2VVL A;  2VOU A;  2R9Z A;  4FDC B;  1GRF A;  1HYU A;  4H4U A;  2BK5 A;  1GOS A;  2XFN A;  3C96 A;  1VDC A;  3NTA A;  3QJ4 A;  3AE7 A;  1FCD A;  1F6M A;  4Z2T A;  4M52 A;  2EQ9 A;  1N4W A;  5EOW A;  4CRT A;  1ZX9 A;  4DSG A;  1CJ2 A;  1ZKQ A;  2BAB A;  3ISH A;  3KLJ A;  1CC6 A;  1DOE A;  3IC9 A;  4K5S A;  4Z44 A;  5JCN A;  5M10 A;  5CKU A;  2R4J A;  1XPQ A;  3DJJ A;  3NLC A;  3GWD A;  1PXB A;  1LPF A;  2GR2 A;  1N4U A;  4JQ9 A;  2EQ7 A;  4KPR A;  1DXL A;  2GAH B;  3KPF A;  3NNE A;  4A99 A;  1PBB A;  1GES A;  3LZX A;  2C3C A;  3EPT A;  2B76 A;  2FJB A;  4G6G A;  4A6N A;  2WOW A;  1YQZ A;  3FPZ A;  2GB0 A;  3FMW A;  1TDE A;  2CVJ A;  2YM1 A;  2XDO A;  3C4N A;  3ITJ A;  4I58 A;  4II3 A;  3GWF A;  1B8S A;  2XFP A;  1EBD A;  3GDP A;  3AE6 A;  3LZW A;  3AD7 B;  3S5W A;  4RSL A;  3UP5 A;  3WE0 A;  2B9Y A;  5J60 A;  2BXS A;  1PXA A;  4A65 A;  3AE8 A;  3I6D A;  4CNJ A;  3UKK A;  5FS7 A;  1Q1W A;  5KMP A;  2JAE A;  1ZY8 A;  3AE9 A;  3K7Q X;  4OCG A;  2V5Z A;  3VR8 A;  3UTG A;  2XFO A;  1BGN A;  4LU6 A;  2VRL A;  3ICR A;  1E1M A;  4ICY A;  1TRB A;  2QA2 A;  1E6E A;  3BHF A;  3CND A;  4GDE A;  4BJY A;  2XCG A;  3UCL A;  3BNU A;  4EIQ A;  4JNQ A;  4X9M A;  5JCM A;  2ZBW A;  2A89 A;  2XVI A;  3AYJ A;  2CDU A;  3NHO X;  2BAC A;  1GER A;  2YVG A;  2V3A A;  4ADW A;  1TDO A;  2EQ6 A;  3RP6 A;  4HA6 A;  4A5L A;  3IWA A;  4K22 A;  4OPD A;  2BC1 A;  1UKV G;  1CL0 A;  3AEC A;  3UTH A;  2Q7V A;  2VVL G;  4DSH A;  5KWF A;  4G74 A;  5FS8 A;  5KRQ A;  2R4E A;  2GR3 A;  5BRT A;  1LVL A;  4RG3 A;  4J34 A;  1CJ3 A;  3AYI A;  4N9X A;  5JCL A;  3LB8 A;  2GQF A;  3ALJ A;  3JSK A;  1COY A;  2WP6 A;  2PYX A;  3EAN A;  3DK4 A;  4B68 A;  2YQU A;  3NK0 X;  4YSX A;  1MOK A;  4C74 A;  1GTH A;  3UKQ A;  1OJA A;  3QFB A;  2C72 A;  2F5Z A;  2GMH A;  2WPC A;  1ZOY A;  3GMC A;  4USQ A;  4JDR A;  3NYF A;  4C3Y A;  2WP5 A;  4GUV A;  2BCG G;  3KVE A;  3NG7 X;  5KOW A;  2YG4 A;  2YR4 A;  1OJC A;  1XHC A;  1ONF A;  2VRM A;  4UDQ A;  3BI2 A;  3NT6 A;  4U8O A;  3II4 A;  4K7Z A;  4EM4 A;  3AB1 A;  1P2E A;  1YQ4 A;  3DME A;  1Z6L A;  2ARD A;  2BK4 A;  3URH A;  3SGL A;  1PJ6 A;  4ZCD A;  4CBQ A;  3FG2 P;  3FBS A;  3CPI G;  4AT0 A;  5KNL A;  4TM3 A;  4XWR A;  2FJA A;  1N4V A;  3K7T A;  2WBA A;  4BK2 A;  3CPH G;  1DOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...