1H84A

Covalent adduct between polyamine oxidase and n1ethyln11((cycloheptyl)methyl)4,8diazaundecane at ph 4.6
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
total genus 165
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h84A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h84A02
2WP6A 2WOWA 1KSUA 3NRNA 4H50A 5FS6A 4I58A 3NHOX 4NTDA 4YSXA 2XYOA 3B3RA 5HHFA 3O0HA 2BXSA 2QAEA 4PABA 2C72A 3NGCX 4EMJA 4B69A 2GAHB 2H88A 2V3BA 3L1RA 5CQFA 3G5QA 4FK1C 4D04A 4YSYA 5IQ4A 5KXJA 4EQRA 1IUXA 2BK3A 2R0CA 3UP5A 1CBOA 2R4EA 1GERA 3KKJA 4EQWA 1LQTA 1Q1RA 4X9MA 2WPEA 3I3LA 4OPLA 3E1TA 4RSLA 4AOXA 1PS9A 2WEUA 1TDKA 2HQMA 3AE2A 3VRDB 4U8LA 1N1PA 2GR0A 2GVCA 4C3YA 1BGNA 3UOYA 4A79A 1HYUA 3RHAA 1XHCA 4H4WA 3OZ2A 3UTHA 4ZN0A 1S2YA 2FJBA 2V5ZA 3I6DA 3AE1A 1BGJA 2BA9A 2XLSA 3AE3A 2C67A 4TM4A 1P2HA 3DMEA 1DODA 1QLBA 1D4DA 2B76A 2Z5YA 4Z2RA 2WDQA 2C7GA 3NYEA 4CY6A 4H2RA 4J36A 1LTXR 3P4RA 1L9EA 4O5QA 4Z44A 4WX1A 3AXBA 1GEUA 3AD8B 2ZBWA 4U2LA 1EBDA 4YTNA 3LADA 4Z2TA 5HXIA 2AR8A 2EQ9A 5GRTA 4Y4NA 1TRBA 1GNDA 3QVRA 3EANA 1FECA 2JK6A 2YR5A 1O94A 3WE0A 1ZOVA 2YVGA 3UOVA 4TLXA 1Y0PA 3ICTA 2YG3A 5EB4A 2FJAA 4DSGA 4Z25A 1NAAA 2RGJA 3ICRA 3CNDA 2YLSA 4X9NA 2YAUA 4J34A 1E1MA 2YG7A 2EQ8A 3CNSA 3C4NA 4OPCA 2Q0KA 5U1OA 5JCNA 1EL8A 1E1NA 2JB1A 3NK0X 2W0HA 3UP4A 4RG3A 1PJ5A 2UZZA 4FDCB 1NHQA 2RGOA 3GDNA 4H2PA 2QA2A 2WHDA 1QO8A 1GRGA 2C64A 4UP3A 3DA1A 1K0IA 4TLZA 4IA5A 2XFPA 1OJTA 3UKHA 1KNRA 4E0VA 5IPYA 5HYMA 3FIMB 3EAOA 2YQUA 2XLUA 2BYBA 3DK4A 1OJCA 2XCGA 3EPTA 4BURA 1TYPA 3UKKA 1JRXA 2YVJA 2YWLA 1NG4A 2X8CA 2ZZCA 4NTEA 4ICYA 3GMBA 2BS4A 3AE4A 4M52A 2WPFA 1ZX9A 1DOBA 2FJEA 2V3AA 3NN6X 3IWAA 4OPGA 4EQXA 1PBBA 1GRHA 2BS3A 4EIPA 5BULA 2B9WA 2WQYA 4USQA 2GMJA 3VQRA 2CDUA 4CY8A 3P1WA 1CC2A 1B5QA 3SFDA 1LV0A 2VOUA 2XLTA 2IVDA 2YM2A 3K7MX 1GTEA 1H82A 1PJ6A 4GF7A 3AEBA 2EQ7A 1PBFA 2GB0A 1F8SA 2NPXA 4UDPA 4BV6A 2WOIA 2C73A 4MJWA 1VG0A 3H8IA 3GRTA 3SM8A 1RYIA 1E39A 3H8LA 3K7TA 3RNMA 3M13A 2BC0A 2WU2A 4K8DA 4B65A 3NIXA 1H7XA 3NG7X 2PYXA 2C66A 3LB8A 3UKPA 5BRTA 1GOSA 2GR1A 4YT0A 1VG9A 2Q7VA 5FMHA 1OJ9A 1NHSA 1PHHA 2GH5A 1YY5A 2GQFA 2JB3A 3V3NA 3AE8A 4ADWA 4AP3A 5JCKA 3VRAA 1GRBA 1LPFA 1IUSA 5FS7A 2WU5A 3II4A 1H84A 4B63A 1EL5A 4H4YA 2AAQA 3AECA 5M10A 3M0OA 2C65A 4H4RA 4YKFA 4D03A 1CJCA 4PAAA 3DK8A 1MXTA 2Y6RA 4K7ZA 3NN0X 2YG5A 3ALLA 3BI2A 4GUVA 1CJ3A 2V6OA 3QSMA 4H4UA 1NG3A 1GTHA 2VRLA 3FMWA 4RG4A 4CNJA 3NK1X 2VQBA 4H4TA 5EBKA 3GWFA 1LVLA 4H4SA 1V59A 3AD7B 1FOHA 3P4PA 3DH9A 1CJ2A 4EMWA 2XDOA 1DXLA 3ALJA 3IC9A 3CGBA 4OPIA 2GAGB 2OLOA 3UKAA 1Z6LA 4A65A 3ISHA 3V3OA 1NENA 4OVIA 1JOAA 3VRBA 3DJEA 3JSKA 4YSZA 2GF3A 4JY2A 4A99A 4LIIA 2BABA 3F8DA 3ITJA 1ZY8A 4B64A 3NH3X 5KRQA 3L8KA 1YQZA 1B4VA 3AE9A 4K5SA 1O5WA 2WDRA 3CN8A 4U2TA 4XXGA 3SFEA 4B68A 4YWOA 1XPQA 2BC1A 4H7UA 2BXRA 4YTMA 2XFUA 4AT0A 1ELIA 1CF3A 1W4XA 1N4VA 3CGCA 4Z43A 4Z26A 4Z2UA 3NYFA 2E5VA 1OJDA 5U63A 2JB2A 4C77A 3BHKA 2IVEA 5KOXA 1N4WA 4AP1A 3CPJG 4B66A 2JKCA 3CGEA 5U25A 1L9CA 1F8RA 1F8WA 3D8XA 3GDPA 3NLCA 2YLWA 2XVJA 1LQUA 3GWDA 4DSHA 2B9XA 2R45A 2XVFA 4NEWA 2X8HA 3VR9A 1KNPA 5ER0A 3QJ4A 3ABVA 2JAEA 1CC6A 3CPHG 2TMDA 2A87A 3CNTA 1BWCA 1D7LA 3GYJA 3BI4A 4JY3A 1ZDLA 1TDEA 3REDA 3C96A 2WDVA 2BACA 2RGHA 3DK9A 1E6EA 2NVKX 5JCIA 2GQWA 1DNCA 1PBEA 2VZ2A 3BI5A 3QFBA 4LU6A 1DOCA 3F8PA 4B67A 4KPRA 5KWFA 4K2XA 1LJ1A 3FG2P 2XVEA 4OCGA 1COYA 4TM1A 2Y6QA 1P2EA 1NEKA 3AYJA 4FK1A 2CFYA 3CGDA 4DGKA 2GR2A 1YQ3A 3AE5A 4H4VA 1N4UA 4I59A 2OLNA 4XWRA 3UTFA 2R9ZA 3EF6A 3KA7A 1VQWA 4BJZA 1ZOYA 1FEBA 4GCMA 4O5UA 3OC4A 3NNEA 2ARDA 3UTEA 1GRFA 1E7PA 4Z24A 3IHGA 1BKWA 1KF6A 4AOSA 2YLXA 1PBDA 3G5SA 3LXDA 3QSSA 1JEHA 2XFNA 2R0PA 3K7QX 1AOGA 4JDRA 4YKGA 2XVHA 2VRMA 2X99A 1GPEA 1B8SA 4BK1A 4HA6A 4IVOB 4B1BA 4H4XA 3IF9A 3UOZA 3GD3A 4NEVA 5LV9A 3ZDNA 5FS8A 1MO9A 2OAMA 2WS3A 4P9SA 2C70A 3Q9TA 5M0ZA 3AEDA 3CTYA 2YR4A 2BK4A 3LOVA 1ZKQA 2B7RA 4J57A 2WETA 5C3JA 4A7AA 1JNRA 4IVMB 2OA1A 1NPXA 3RP6A 2J3NA 2XVIA 2FJDA 1H86A 3DGHA 3QFAA 5IQ1A 1JRZA 4A5LA 3M12A 3AYIA 2VVMA 1DJQA 1GREA 1Q1WA 4CRTA 4H4PA 1NHRA 2C3CA 2BS2A 2GV8A 2YG4A 1NHPA 2GMHA 2QA1A 3Q6JA 4A6NA 2R46A 1PXBA 4EQSA 1H81A 1JU2A 4DNAA 1H6VA 2FBWA 4APNA 2F5ZA 4CNKA 2A89A 3G5RA 4OPUA 4CCQA 4H2QA 1SEZA 1VRQB 4CBQA 2APGA 1RSGA 2TPRA 1TDNA 2E1MA 3UKFA 1F3PA 1FL2A 4NTCA 1GSNA 1L9DA 3B6DA 2WESA 4GDPA 5JCMA 3CPIG 4U8NA 1ZK7A 1EL7A 2X8GA 5TR3A 2WP9A 1BZLA 2DKIA 1KDGA 4ZCDA 1CC4A 2BCPA 2IIDA 5KVIA 3SGLA 4C74A 4YTPA 1VDCA 3IHMA 3ZYXA 1MOKA 2A8XA 1ZMCA 2OALA 1FCDA 2WP5A 1ONFA 1X31B 3CNJA 1F6MA 3LZWA 1XANA 3GD4A 3SQPA 3GMCA 5BVAA 5GSNA 2RABA 4U8KA 3AEAA 3S5WA 2Q0LA 3DJJA 5EB5A 5L46A 4WCTA 2VVLG 3UCLA 3DGZA 3NTAA 1Q9IA 1NDAA 2V60A 3F8RA 4J33A 1ZP0A 3P9UA 1PBCA 1JNZA 2XFOA 1REOA 3NTDA 1CHUA 4AT2A 3KLJA 4YSHA 1QJDA 2CULA 2GR3A 1YQ4A 3UKLA 5JCLA 1H7WA 2WBAA 4XWZA 5KVHA 3T37A 1IUTA 3AE7A 3FBSA 2X50A 4H4QA 4Y4LA 3AB1A 2B7SA 1PN0A 1S3EA 3DJDA 4C5OA 1TDOA 1PXAA 3PO7A 3H4KA 4TM0A 2Q6UA 3GRSA 2AQJA 1Y56B 4ZCCA 3VR8A 5J60A 1IJHA 4H2NA 1E1LA 3GYIA 4U8OA 5CKUA 5BUKA 3DJGX 1PXCA 1Y56A 1JRYA 4GR1A 4CCRA 4K22A 3AYLA 4H4ZA 2VVLA 4U8JA 3AE6A 3FPZA 4C3XA 2Z5XA 4EM3A 1FEAA 4N9XA 4Y4MA 1ZMDA 1D7YA 1KFYA 2O9ZA 4EIQA 4A9WA 3QVPA 1TDFA 2YR6A 3ADAB 2YG6A 3NT6A 5KOWA 1D4EA 1K0JA 4J56A 5C2TA 2WPCA 2XLPA 2H89A 3KVEA 4U8PA 3S61A 2EQ6A 2GRTA 3AD9B 2VQ7A 3KPFA 3COXA 3NKSA 4TM3A 2ZZ0A 1M64A 2BK5A 2C3DA 3AEGA 4K5RA 1S2QA 5FS9A 1K0LA 4USRA 4IA6A 3LZXA 4EMIA 3KU9A 3URHA 3UOXA 4HB9A 4X4JA 1S3BA 1IUUA 4JQ9A 1E1KA 4GRTA 1L0VA 1M6IA 1GRTA 1PDHA 2PHHA 3NK2X 2E4GA 4REKA 1OJAA 4YXDA 3ATQA 3AWIA 4J2WA 1H83A 3UTGA 3BHFA 2WOVA 3P4QA 3BNUA 3PVCA 3V76A 2YLTA 4IV9A 3CNPA 2YM1A 3QSEA 1XDIA 1GESA 2C75A 4KX6A 2R0GA 4LA1A 4JNQA 1IUWA 1O95A 1YKJA 1GT8A 2C76A 3NYCA 3CIRA 1D4CA 1RP0A 1TYTA 2XLRA 2YLZA 2CVJA 4U2SA 1GETA 1GRAA 1GXFA 1KSSA 3ICSA 3ALMA 1CJ4A 4BK2A 3D1CA 1EL9A 2JBVA 3GSIA 2I0ZA 2V61A 2R4JA 2ZZBA 4JN9A 2YLRA 5EOWA 4U8MA 2GEWA 3RP7A 1PJ7A 5HY5A 3HZLA 3PS9A 1B37A 3UKQA 1IUVA 3KD9A 1BF3A 4BK3A 3AEFA 4NZHA 3ATRA 1UKVG 4GDEA 4UDQA 3K30A 5DBJA 3LJPA 2QCUA 3AEEA 1GV4A 4EM4A 4JNAA 1CL0A 2XFQA 4OPTA 2B9YA 3BNMA 4UDRA 1DOEA 5J7XA 4A6NB 2DKHA 3RP8A 4ECHA 4U8IA 1DJNA 4OPDA 3P4SA 3R9UA 1GALA 3C4AA 2BCGG 4BJYA 2X3NA 4J31A 2ACZA 2YVFA 4FX9A 1D5TA 1K4QA
chains in the Genus database with same CATH superfamily
2WP6A 2WOWA 1KSUA 3NRNA 4H50A 5FS6A 4I58A 3NHOX 4NTDA 4YSXA 2XYOA 3B3RA 5HHFA 3O0HA 2BXSA 2QAEA 4PABA 3SXIA 2C72A 3NGCX 4EMJA 4B69A 2GAHB 2H88A 2V3BA 3L1RA 5CQFA 3G5QA 4FK1C 4GAPA 4D04A 4YSYA 5IQ4A 5KMSA 3T31A 5KXJA 4EQRA 1IUXA 2BK3A 2R0CA 3UP5A 1CBOA 2R4EA 1GERA 3KKJA 4EQWA 1LQTA 1Q1RA 4X9MA 2WPEA 3I3LA 4OPLA 3E1TA 4RSLA 4AOXA 1PS9A 2WEUA 4II3A 1TDKA 2HQMA 3AE2A 3VRDB 4U8LA 1N1PA 2GR0A 2GVCA 4C3YA 1BGNA 3UOYA 3T14A 4A79A 1HYUA 3RHAA 1XHCA 4H4WA 3OZ2A 3UTHA 4ZN0A 1S2YA 2FJBA 2V5ZA 3CMMA 3I6DA 3AE1A 1BGJA 2BA9A 2XLSA 3AE3A 2C67A 4TM4A 1P2HA 3DMEA 1DODA 1QLBA 1D4DA 2B76A 2Z5YA 4Z2RA 2WDQA 2C7GA 3NYEA 4CY6A 4H2RA 4J36A 1LTXR 3P4RA 1L9EA 4O5QA 3T2ZA 4Z44A 4WX1A 3AXBA 1GEUA 3AD8B 2ZBWA 4U2LA 1EBDA 4YTNA 3LADA 4Z2TA 5HXIA 4NWZA 2AR8A 2EQ9A 5GRTA 4Y4NA 1TRBA 1GNDA 3QVRA 3EANA 1FECA 2JK6A 2YR5A 1O94A 3WE0A 1ZOVA 2YVGA 3UOVA 4TLXA 1Y0PA 3ICTA 2YG3A 5EB4A 2FJAA 4DSGA 4Z25A 1NAAA 2RGJA 2BRAA 3ICRA 3CNDA 2YLSA 4X9NA 2YAUA 4J34A 1E1MA 2YG7A 3T0KA 2EQ8A 3CNSA 3C4NA 4OPCA 2Q0KA 5U1OA 5JCNA 1EL8A 1E1NA 2JB1A 3NK0X 2W0HA 3UP4A 4RG3A 1PJ5A 2UZZA 4FDCB 1NHQA 2RGOA 3GDNA 4H2PA 2QA2A 2WHDA 1QO8A 1GRGA 2C64A 4UP3A 3DA1A 1K0IA 4TLZA 4IA5A 2XFPA 1OJTA 3UKHA 1KNRA 4E0VA 5IPYA 5HYMA 3FIMB 3EAOA 2YQUA 2XLUA 2BYBA 3DK4A 1OJCA 2XCGA 3EPTA 4BURA 1TYPA 3UKKA 1JRXA 2YVJA 2YWLA 1NG4A 2X8CA 2ZZCA 4NTEA 4ICYA 3GMBA 2BS4A 3AE4A 4M52A 2WPFA 1ZX9A 1DOBA 2FJEA 2V3AA 3SZCA 3NN6X 3IWAA 4OPGA 4EQXA 1PBBA 1GRHA 2BS3A 4EIPA 5BULA 2B9WA 2WQYA 4USQA 2GMJA 3VQRA 2CDUA 4CY8A 3P1WA 1CC2A 1B5QA 3SFDA 1LV0A 2VOUA 2XLTA 2IVDA 2YM2A 3K7MX 1GTEA 1H82A 1PJ6A 4GF7A 3AEBA 4G74A 3KPKA 2EQ7A 1PBFA 2GB0A 1F8SA 2NPXA 4UDPA 4BV6A 2WOIA 2C73A 4MJWA 1VG0A 3H8IA 3GRTA 3SM8A 1RYIA 1E39A 3H8LA 3K7TA 3RNMA 5KNLA 3M13A 2BC0A 2WU2A 4K8DA 4B65A 3NIXA 1H7XA 3NG7X 2PYXA 2C66A 3LB8A 3UKPA 5BRTA 1GOSA 2GR1A 4YT0A 1VG9A 2Q7VA 5FMHA 1OJ9A 1NHSA 1PHHA 2GH5A 1YY5A 2GQFA 2JB3A 3V3NA 3AE8A 4ADWA 4AP3A 5JCKA 3VRAA 1GRBA 4G6HA 1LPFA 1IUSA 5FS7A 2WU5A 3II4A 1H84A 4B63A 1EL5A 4H4YA 2AAQA 3AECA 5M10A 3M0OA 2C65A 4H4RA 4YKFA 4D03A 1CJCA 4PAAA 3DK8A 1MXTA 2Y6RA 4K7ZA 3NN0X 2YG5A 3ALLA 3BI2A 4GUVA 1CJ3A 3SYIA 2V6OA 3QSMA 4H4UA 1NG3A 1GTHA 2VRLA 3FMWA 4RG4A 4CNJA 3NK1X 2VQBA 4H4TA 5EBKA 3GWFA 1LVLA 4H4SA 1V59A 3AD7B 5KMQA 1FOHA 3P4PA 3DH9A 1CJ2A 4EMWA 2XDOA 1DXLA 3ALJA 3T2KA 3IC9A 3CGBA 4OPIA 2GAGB 2OLOA 3UKAA 1Z6LA 4A65A 3ISHA 3V3OA 1NENA 4OVIA 3HYWA 1JOAA 3VRBA 3DJEA 3JSKA 4NNJA 4YSZA 2GF3A 4JY2A 4A99A 4LIIA 2BABA 3F8DA 3ITJA 1ZY8A 4B64A 3NH3X 5KRQA 3L8KA 1YQZA 1B4VA 3AE9A 4K5SA 1O5WA 2WDRA 3CN8A 4U2TA 4XXGA 3SFEA 4B68A 4YWOA 1XPQA 2BC1A 4H7UA 2BXRA 4YTMA 2XFUA 4AT0A 1ELIA 1CF3A 1W4XA 1N4VA 3CGCA 4Z43A 4Z26A 4Z2UA 3NYFA 2E5VA 1OJDA 5U63A 2JB2A 4C77A 3BHKA 2IVEA 5KOXA 1N4WA 4AP1A 3CPJG 4B66A 2JKCA 3CGEA 5U25A 1L9CA 1F8RA 1F8WA 3D8XA 3GDPA 3NLCA 2YLWA 2XVJA 1LQUA 3GWDA 4DSHA 2B9XA 2R45A 2XVFA 4NEWA 2X8HA 3VR9A 1KNPA 5ER0A 3QJ4A 3ABVA 2JAEA 1CC6A 3CPHG 2TMDA 2A87A 3CNTA 1BWCA 1D7LA 3GYJA 3BI4A 4JY3A 1ZDLA 1TDEA 3REDA 3C96A 4GAVA 2WDVA 2BACA 2RGHA 3DK9A 1E6EA 2NVKX 5JCIA 2GQWA 1DNCA 1PBEA 2VZ2A 3BI5A 3QFBA 4LU6A 1DOCA 3F8PA 4B67A 4KPRA 5KWFA 4K2XA 1LJ1A 3FG2P 2XVEA 4OCGA 1COYA 4TM1A 2Y6QA 1P2EA 1NEKA 3AYJA 4FK1A 2CFYA 3CGDA 4DGKA 2GR2A 1YQ3A 3AE5A 4H4VA 1N4UA 4I59A 2OLNA 4XWRA 3UTFA 2R9ZA 3EF6A 3KA7A 1VQWA 4BJZA 1ZOYA 1FEBA 4GCMA 4O5UA 3OC4A 3NNEA 2ARDA 3UTEA 3SZ0A 1GRFA 1E7PA 4Z24A 3IHGA 1BKWA 1KF6A 4AOSA 2YLXA 1PBDA 3G5SA 3LXDA 3QSSA 1JEHA 2XFNA 2R0PA 3K7QX 1AOGA 4JDRA 4YKGA 2XVHA 2VRMA 2X99A 1GPEA 1B8SA 4BK1A 4HA6A 4IVOB 4II2A 4B1BA 4H4XA 3IF9A 3UOZA 3GD3A 4NEVA 5LV9A 3ZDNA 5FS8A 1MO9A 2OAMA 2WS3A 4P9SA 2C70A 3Q9TA 5M0ZA 3AEDA 3CTYA 2YR4A 2BK4A 3LOVA 1ZKQA 2B7RA 4J57A 2WETA 5C3JA 4G9KA 1JNRA 4A7AA 4IVMB 2OA1A 1NPXA 3RP6A 2J3NA 2XVIA 2FJDA 1H86A 3GYXA 3DGHA 3QFAA 5IQ1A 1JRZA 4A5LA 3M12A 3AYIA 2VVMA 1DJQA 1GREA 1Q1WA 4CRTA 4H4PA 1NHRA 2C3CA 2BS2A 2GV8A 2YG4A 1NHPA 2GMHA 2QA1A 3Q6JA 4A6NA 2R46A 1PXBA 4EQSA 1H81A 1JU2A 4DNAA 1H6VA 2FBWA 4APNA 2F5ZA 4CNKA 2A89A 3G5RA 4OPUA 4CCQA 4H2QA 1SEZA 1VRQB 4CBQA 2APGA 1RSGA 2TPRA 1TDNA 2E1MA 3UKFA 1F3PA 1FL2A 4NTCA 1GSNA 1L9DA 3SY4A 3SZWA 3B6DA 2WESA 4GDPA 5JCMA 3CPIG 4U8NA 1ZK7A 1EL7A 2X8GA 5TR3A 2WP9A 1BZLA 2DKIA 1KDGA 4ZCDA 1CC4A 2BCPA 2IIDA 5KVIA 3SGLA 4C74A 4YTPA 1VDCA 3IHMA 3ZYXA 1MOKA 3T2YA 5KMPA 2A8XA 1ZMCA 2OALA 1FCDA 2WP5A 1ONFA 1X31B 3CNJA 1F6MA 3LZWA 1XANA 3GD4A 3SQPA 3GMCA 5BVAA 5GSNA 2RABA 4U8KA 3AEAA 3S5WA 2Q0LA 3DJJA 5EB5A 5L46A 4WCTA 2VVLG 3UCLA 3DGZA 3NTAA 1Q9IA 1NDAA 2V60A 3F8RA 4J33A 1ZP0A 3P9UA 1PBCA 1JNZA 2XFOA 1REOA 3NTDA 1CHUA 4AT2A 3KLJA 4YSHA 1QJDA 2CULA 2GR3A 1YQ4A 3UKLA 5JCLA 1H7WA 2WBAA 4XWZA 5KVHA 3T37A 1IUTA 3AE7A 3FBSA 2X50A 4H4QA 4Y4LA 4G73A 3AB1A 2B7SA 1PN0A 1S3EA 3DJDA 4C5OA 1TDOA 1PXAA 3PO7A 3H4KA 4TM0A 2Q6UA 3GRSA 2AQJA 1Y56B 4ZCCA 3VR8A 5J60A 1IJHA 4H2NA 1E1LA 3GYIA 4U8OA 5CKUA 5BUKA 3DJGX 1PXCA 1Y56A 1JRYA 4GR1A 4CCRA 4K22A 3AYLA 4H4ZA 3SX6A 2VVLA 4U8JA 3AE6A 3FPZA 4C3XA 2Z5XA 4EM3A 1FEAA 4N9XA 4Y4MA 1ZMDA 1D7YA 1KFYA 2O9ZA 4EIQA 4A9WA 3QVPA 1TDFA 2YR6A 3ADAB 2YG6A 3NT6A 5KOWA 1D4EA 1K0JA 4J56A 5C2TA 2WPCA 2XLPA 2H89A 3KVEA 4U8PA 3S61A 2EQ6A 2GRTA 3AD9B 2VQ7A 2BRYA 3COXA 3KPFA 3NKSA 4G6GA 4TM3A 2ZZ0A 3SZFA 1M64A 2BK5A 2C3DA 3AEGA 4K5RA 1S2QA 5FS9A 1K0LA 4USRA 4IA6A 3LZXA 4EMIA 3KU9A 3URHA 3UOXA 4HB9A 4X4JA 2C4CA 1S3BA 1IUUA 4JQ9A 1E1KA 4GRTA 1L0VA 1M6IA 1GRTA 1PDHA 2PHHA 3NK2X 2E4GA 4REKA 1OJAA 4YXDA 3ATQA 3AWIA 4J2WA 1H83A 3UTGA 3BHFA 2WOVA 3P4QA 3BNUA 3PVCA 3V76A 3HYXA 2YLTA 4IV9A 3CNPA 2YM1A 3QSEA 1XDIA 1GESA 2C75A 4KX6A 2R0GA 4LA1A 4JNQA 1IUWA 1O95A 1YKJA 1GT8A 2C76A 3NYCA 3CIRA 1D4CA 1RP0A 1TYTA 2XLRA 2YLZA 2CVJA 4U2SA 1GETA 1GRAA 1GXFA 1KSSA 3ICSA 3ALMA 1CJ4A 4BK2A 3D1CA 1EL9A 2JBVA 3GSIA 2I0ZA 2V61A 2R4JA 2ZZBA 4JN9A 2YLRA 5EOWA 4U8MA 2GEWA 3RP7A 1PJ7A 5HY5A 3HZLA 3PS9A 1B37A 3UKQA 1IUVA 3KD9A 1BF3A 4BK3A 3AEFA 4NZHA 3ATRA 1UKVG 4GDEA 4UDQA 3K30A 5DBJA 3LJPA 2QCUA 3AEEA 1GV4A 4EM4A 4JNAA 1CL0A 2XFQA 4OPTA 2B9YA 3BNMA 4UDRA 1DOEA 5J7XA 4A6NB 2DKHA 3RP8A 4ECHA 4U8IA 5KMRA 1DJNA 4OPDA 3P4SA 3R9UA 1GALA 3C4AA 2BCGG 3HYVA 4BJYA 2X3NA 4J31A 2ACZA 2YVFA 4FX9A 1D5TA 1K4QA
chains in the Genus database with same CATH topology
2WP6A 2WOWA 1KSUA 3NRNA 4H50A 5FS6A 4I58A 3NHOX 4NTDA 4YSXA 2XYOA 3B3RA 5HHFA 3O0HA 2BXSA 2QAEA 4PABA 3SXIA 2C72A 3NGCX 4EMJA 4B69A 2GAHB 2H88A 2V3BA 3L1RA 5CQFA 3G5QA 4FK1C 4GAPA 4D04A 4YSYA 5IQ4A 5KMSA 3T31A 5KXJA 4EQRA 1IUXA 2BK3A 2R0CA 3UP5A 1CBOA 2R4EA 1GERA 3KKJA 4EQWA 1LQTA 1Q1RA 4X9MA 2WPEA 3I3LA 4OPLA 3E1TA 4RSLA 4AOXA 1PS9A 2WEUA 4II3A 1TDKA 2HQMA 3AE2A 3VRDB 4U8LA 1N1PA 2GR0A 2GVCA 4C3YA 1BGNA 3UOYA 3T14A 4A79A 1HYUA 3RHAA 1XHCA 4H4WA 3OZ2A 3UTHA 4ZN0A 1S2YA 2FJBA 2V5ZA 3CMMA 3I6DA 3AE1A 1BGJA 2BA9A 2XLSA 3AE3A 2C67A 4TM4A 1P2HA 3DMEA 1DODA 1QLBA 1D4DA 2B76A 2Z5YA 4Z2RA 2WDQA 2C7GA 3NYEA 4CY6A 4H2RA 4J36A 1LTXR 3P4RA 1L9EA 4O5QA 3T2ZA 4Z44A 4WX1A 3AXBA 1GEUA 3AD8B 2ZBWA 4U2LA 1EBDA 4YTNA 3LADA 4Z2TA 5HXIA 4NWZA 2AR8A 2EQ9A 5GRTA 4Y4NA 1TRBA 1GNDA 3QVRA 3EANA 1FECA 2JK6A 2YR5A 1O94A 3WE0A 1ZOVA 2YVGA 3UOVA 4TLXA 1Y0PA 3ICTA 2YG3A 5EB4A 2FJAA 4DSGA 4Z25A 1NAAA 2RGJA 2BRAA 3ICRA 3CNDA 2YLSA 4X9NA 2YAUA 4J34A 1E1MA 2YG7A 3T0KA 2EQ8A 3CNSA 3C4NA 4OPCA 2Q0KA 5U1OA 5JCNA 1EL8A 1E1NA 2JB1A 3NK0X 2W0HA 3UP4A 4RG3A 1PJ5A 2UZZA 4FDCB 1NHQA 2RGOA 3GDNA 4H2PA 2QA2A 2WHDA 1QO8A 1GRGA 2C64A 4UP3A 3DA1A 1K0IA 4TLZA 4IA5A 2XFPA 1OJTA 3UKHA 1KNRA 4E0VA 5IPYA 5HYMA 3FIMB 3EAOA 2YQUA 2XLUA 2BYBA 3DK4A 1OJCA 2XCGA 3EPTA 4BURA 1TYPA 3UKKA 1JRXA 2YVJA 2YWLA 1NG4A 2X8CA 2ZZCA 4NTEA 4ICYA 3GMBA 2BS4A 3AE4A 4M52A 2WPFA 1ZX9A 1DOBA 2FJEA 2V3AA 3SZCA 3NN6X 3IWAA 4OPGA 4EQXA 1PBBA 1GRHA 2BS3A 4EIPA 5BULA 2B9WA 2WQYA 4USQA 2GMJA 3VQRA 2CDUA 4CY8A 3P1WA 1CC2A 1B5QA 3SFDA 1LV0A 2VOUA 2XLTA 2IVDA 2YM2A 3K7MX 1GTEA 1H82A 1PJ6A 4GF7A 3AEBA 4G74A 3KPKA 2EQ7A 1PBFA 2GB0A 1F8SA 2NPXA 4UDPA 4BV6A 2WOIA 2C73A 4MJWA 1VG0A 3H8IA 3GRTA 3SM8A 1RYIA 1E39A 3H8LA 3K7TA 3RNMA 5KNLA 3M13A 2BC0A 2WU2A 4K8DA 4B65A 3NIXA 1H7XA 3NG7X 2PYXA 2C66A 3LB8A 3UKPA 5BRTA 1GOSA 2GR1A 4YT0A 1VG9A 2Q7VA 5FMHA 1OJ9A 1NHSA 1PHHA 2GH5A 1YY5A 2GQFA 2JB3A 3V3NA 3AE8A 4ADWA 4AP3A 5JCKA 3VRAA 1GRBA 4G6HA 1LPFA 1IUSA 5FS7A 2WU5A 3II4A 1H84A 4B63A 1EL5A 4H4YA 2AAQA 3AECA 5M10A 3M0OA 2C65A 4H4RA 4YKFA 4D03A 1CJCA 4PAAA 3DK8A 1MXTA 2Y6RA 4K7ZA 3NN0X 2YG5A 3ALLA 3BI2A 4GUVA 1CJ3A 3SYIA 2V6OA 3QSMA 4H4UA 1NG3A 1GTHA 2VRLA 3FMWA 4RG4A 4CNJA 3NK1X 2VQBA 4H4TA 5EBKA 3GWFA 1LVLA 4H4SA 1V59A 3AD7B 5KMQA 1FOHA 3P4PA 3DH9A 1CJ2A 4EMWA 2XDOA 1DXLA 3ALJA 3T2KA 3IC9A 3CGBA 4OPIA 2GAGB 2OLOA 3UKAA 1Z6LA 4A65A 3ISHA 3V3OA 1NENA 4OVIA 3HYWA 1JOAA 3VRBA 3DJEA 3JSKA 4NNJA 4YSZA 2GF3A 4JY2A 4A99A 4LIIA 2BABA 3F8DA 3ITJA 1ZY8A 4B64A 3NH3X 5KRQA 3L8KA 1YQZA 1B4VA 3AE9A 4K5SA 1O5WA 2WDRA 3CN8A 4U2TA 4XXGA 3SFEA 4B68A 4YWOA 1XPQA 2BC1A 4H7UA 2BXRA 4YTMA 2XFUA 4AT0A 1ELIA 1CF3A 1W4XA 1N4VA 3CGCA 4Z43A 4Z26A 4Z2UA 3NYFA 2E5VA 1OJDA 5U63A 2JB2A 4C77A 3BHKA 2IVEA 5KOXA 1N4WA 4AP1A 3CPJG 4B66A 2JKCA 3CGEA 5U25A 1L9CA 1F8RA 1F8WA 3D8XA 3GDPA 3NLCA 2YLWA 2XVJA 1LQUA 3GWDA 4DSHA 2B9XA 2R45A 2XVFA 4NEWA 2X8HA 3VR9A 1KNPA 5ER0A 3QJ4A 3ABVA 2JAEA 1CC6A 3CPHG 2TMDA 2A87A 3CNTA 1BWCA 1D7LA 3GYJA 3BI4A 4JY3A 1ZDLA 1TDEA 3REDA 3C96A 4GAVA 2WDVA 2BACA 2RGHA 3DK9A 1E6EA 2NVKX 5JCIA 2GQWA 1DNCA 1PBEA 2VZ2A 3BI5A 3QFBA 4LU6A 1DOCA 3F8PA 4B67A 4KPRA 5KWFA 4K2XA 1LJ1A 3FG2P 2XVEA 4OCGA 1COYA 4TM1A 2Y6QA 1P2EA 1NEKA 3AYJA 4FK1A 2CFYA 3CGDA 4DGKA 2GR2A 1YQ3A 3AE5A 4H4VA 1N4UA 4I59A 2OLNA 4XWRA 3UTFA 2R9ZA 3EF6A 3KA7A 1VQWA 4BJZA 1ZOYA 1FEBA 4GCMA 4O5UA 3OC4A 3NNEA 2ARDA 3UTEA 3SZ0A 1GRFA 1E7PA 4Z24A 3IHGA 1BKWA 1KF6A 4AOSA 2YLXA 1PBDA 3G5SA 3LXDA 3QSSA 1JEHA 2XFNA 2R0PA 3K7QX 1AOGA 4JDRA 4YKGA 2XVHA 2VRMA 2X99A 1GPEA 1B8SA 4BK1A 4HA6A 4IVOB 4II2A 4B1BA 4H4XA 3IF9A 3UOZA 3GD3A 4NEVA 5LV9A 3ZDNA 5FS8A 1MO9A 2OAMA 2WS3A 4P9SA 2C70A 3Q9TA 5M0ZA 3AEDA 3CTYA 2YR4A 2BK4A 3LOVA 1ZKQA 2B7RA 4J57A 2WETA 5C3JA 4G9KA 1JNRA 4A7AA 4IVMB 2OA1A 1NPXA 3RP6A 2J3NA 2XVIA 2FJDA 1H86A 3GYXA 3DGHA 3QFAA 5IQ1A 1JRZA 4A5LA 3M12A 3AYIA 2VVMA 1DJQA 1GREA 1Q1WA 4CRTA 4H4PA 1NHRA 2C3CA 2BS2A 2GV8A 2YG4A 1NHPA 2GMHA 2QA1A 3Q6JA 4A6NA 2R46A 1PXBA 4EQSA 1H81A 1JU2A 4DNAA 1H6VA 2FBWA 4APNA 2F5ZA 4CNKA 2A89A 3G5RA 4OPUA 4CCQA 4H2QA 1SEZA 1VRQB 4CBQA 2APGA 1RSGA 2TPRA 1TDNA 2E1MA 3UKFA 1F3PA 1FL2A 4NTCA 1GSNA 1L9DA 3SY4A 3SZWA 3B6DA 2WESA 4GDPA 5JCMA 3CPIG 4U8NA 1ZK7A 1EL7A 2X8GA 5TR3A 2WP9A 1BZLA 2DKIA 1KDGA 4ZCDA 1CC4A 2BCPA 2IIDA 5KVIA 3SGLA 4C74A 4YTPA 1VDCA 3IHMA 3ZYXA 1MOKA 3T2YA 5KMPA 2A8XA 1ZMCA 2OALA 1FCDA 2WP5A 1ONFA 1X31B 3CNJA 1F6MA 3LZWA 1XANA 3GD4A 3SQPA 3GMCA 5BVAA 5GSNA 2RABA 4U8KA 3AEAA 3S5WA 2Q0LA 3DJJA 5EB5A 5L46A 4WCTA 2VVLG 3UCLA 3DGZA 3NTAA 1Q9IA 1NDAA 2V60A 3F8RA 4J33A 1ZP0A 3P9UA 1PBCA 1JNZA 2XFOA 1REOA 3NTDA 1CHUA 4AT2A 3KLJA 4YSHA 1QJDA 2CULA 2GR3A 1YQ4A 3UKLA 5JCLA 1H7WA 2WBAA 4XWZA 5KVHA 3T37A 1IUTA 3AE7A 3FBSA 2X50A 4H4QA 4Y4LA 4G73A 3AB1A 2B7SA 1PN0A 1S3EA 3DJDA 4C5OA 1TDOA 1PXAA 3PO7A 3H4KA 4TM0A 2Q6UA 3GRSA 2AQJA 1Y56B 4ZCCA 3VR8A 5J60A 1IJHA 4H2NA 1E1LA 3GYIA 4U8OA 5CKUA 5BUKA 3DJGX 1PXCA 1Y56A 1JRYA 4GR1A 4CCRA 4K22A 3AYLA 4H4ZA 3SX6A 2VVLA 4U8JA 3AE6A 3FPZA 4C3XA 2Z5XA 4EM3A 1FEAA 4N9XA 4Y4MA 1ZMDA 1D7YA 1KFYA 2O9ZA 4EIQA 4A9WA 3QVPA 1TDFA 2YR6A 3ADAB 2YG6A 3NT6A 5KOWA 1D4EA 1K0JA 4J56A 5C2TA 2WPCA 2XLPA 2H89A 3KVEA 4U8PA 3S61A 2EQ6A 2GRTA 3AD9B 2VQ7A 2BRYA 3COXA 3KPFA 3NKSA 4G6GA 4TM3A 2ZZ0A 3SZFA 1M64A 2BK5A 2C3DA 3AEGA 4K5RA 1S2QA 5FS9A 1K0LA 4USRA 4IA6A 3LZXA 4EMIA 3KU9A 3URHA 3UOXA 4HB9A 4X4JA 2C4CA 1S3BA 1IUUA 4JQ9A 1E1KA 4GRTA 1L0VA 1M6IA 1GRTA 1PDHA 2PHHA 3NK2X 2E4GA 4REKA 1OJAA 4YXDA 3ATQA 3AWIA 4J2WA 1H83A 3UTGA 3BHFA 2WOVA 3P4QA 3BNUA 3PVCA 3V76A 3HYXA 2YLTA 4IV9A 3CNPA 2YM1A 3QSEA 1XDIA 1GESA 2C75A 4KX6A 2R0GA 4LA1A 4JNQA 1IUWA 1O95A 1YKJA 1GT8A 2C76A 3NYCA 3CIRA 1D4CA 1RP0A 1TYTA 2XLRA 2YLZA 2CVJA 4U2SA 1GETA 1GRAA 1GXFA 1KSSA 3ICSA 3ALMA 1CJ4A 4BK2A 3D1CA 1EL9A 2JBVA 3GSIA 2I0ZA 2V61A 2R4JA 2ZZBA 4JN9A 2YLRA 5EOWA 4U8MA 2GEWA 3RP7A 1PJ7A 5HY5A 3HZLA 3PS9A 1B37A 3UKQA 1IUVA 3KD9A 1BF3A 4BK3A 3AEFA 4NZHA 3ATRA 1UKVG 4GDEA 4UDQA 3K30A 5DBJA 3LJPA 2QCUA 3AEEA 1GV4A 4EM4A 4JNAA 1CL0A 2XFQA 4OPTA 2B9YA 3BNMA 4UDRA 1DOEA 5J7XA 4A6NB 2DKHA 3RP8A 4ECHA 4U8IA 5KMRA 1DJNA 4OPDA 3P4SA 3R9UA 1GALA 3C4AA 2BCGG 3HYVA 4BJYA 2X3NA 4J31A 2ACZA 2YVFA 4FX9A 1D5TA 1K4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP6 A;  2WOW A;  1KSU A;  3NRN A;  4H50 A;  5FS6 A;  4I58 A;  3NHO X;  4NTD A;  4YSX A;  2XYO A;  3B3R A;  5HHF A;  3O0H A;  2BXS A;  2QAE A;  4PAB A;  2C72 A;  3NGC X;  4EMJ A;  4B69 A;  2GAH B;  2H88 A;  2V3B A;  3L1R A;  5CQF A;  3G5Q A;  4FK1 C;  4D04 A;  4YSY A;  5IQ4 A;  5KXJ A;  4EQR A;  1IUX A;  2BK3 A;  2R0C A;  3UP5 A;  1CBO A;  2R4E A;  1GER A;  3KKJ A;  4EQW A;  1LQT A;  1Q1R A;  4X9M A;  2WPE A;  3I3L A;  4OPL A;  3E1T A;  4RSL A;  4AOX A;  1PS9 A;  2WEU A;  1TDK A;  2HQM A;  3AE2 A;  3VRD B;  4U8L A;  1N1P A;  2GR0 A;  2GVC A;  4C3Y A;  1BGN A;  3UOY A;  4A79 A;  1HYU A;  3RHA A;  1XHC A;  4H4W A;  3OZ2 A;  3UTH A;  4ZN0 A;  1S2Y A;  2FJB A;  2V5Z A;  3I6D A;  3AE1 A;  1BGJ A;  2BA9 A;  2XLS A;  3AE3 A;  2C67 A;  4TM4 A;  1P2H A;  3DME A;  1DOD A;  1QLB A;  1D4D A;  2B76 A;  2Z5Y A;  4Z2R A;  2WDQ A;  2C7G A;  3NYE A;  4CY6 A;  4H2R A;  4J36 A;  1LTX R;  3P4R A;  1L9E A;  4O5Q A;  4Z44 A;  4WX1 A;  3AXB A;  1GEU A;  3AD8 B;  2ZBW A;  4U2L A;  1EBD A;  4YTN A;  3LAD A;  4Z2T A;  5HXI A;  2AR8 A;  2EQ9 A;  5GRT A;  4Y4N A;  1TRB A;  1GND A;  3QVR A;  3EAN A;  1FEC A;  2JK6 A;  2YR5 A;  1O94 A;  3WE0 A;  1ZOV A;  2YVG A;  3UOV A;  4TLX A;  1Y0P A;  3ICT A;  2YG3 A;  5EB4 A;  2FJA A;  4DSG A;  4Z25 A;  1NAA A;  2RGJ A;  3ICR A;  3CND A;  2YLS A;  4X9N A;  2YAU A;  4J34 A;  1E1M A;  2YG7 A;  2EQ8 A;  3CNS A;  3C4N A;  4OPC A;  2Q0K A;  5U1O A;  5JCN A;  1EL8 A;  1E1N A;  2JB1 A;  3NK0 X;  2W0H A;  3UP4 A;  4RG3 A;  1PJ5 A;  2UZZ A;  4FDC B;  1NHQ A;  2RGO A;  3GDN A;  4H2P A;  2QA2 A;  2WHD A;  1QO8 A;  1GRG A;  2C64 A;  4UP3 A;  3DA1 A;  1K0I A;  4TLZ A;  4IA5 A;  2XFP A;  1OJT A;  3UKH A;  1KNR A;  4E0V A;  5IPY A;  5HYM A;  3FIM B;  3EAO A;  2YQU A;  2XLU A;  2BYB A;  3DK4 A;  1OJC A;  2XCG A;  3EPT A;  4BUR A;  1TYP A;  3UKK A;  1JRX A;  2YVJ A;  2YWL A;  1NG4 A;  2X8C A;  2ZZC A;  4NTE A;  4ICY A;  3GMB A;  2BS4 A;  3AE4 A;  4M52 A;  2WPF A;  1ZX9 A;  1DOB A;  2FJE A;  2V3A A;  3NN6 X;  3IWA A;  4OPG A;  4EQX A;  1PBB A;  1GRH A;  2BS3 A;  4EIP A;  5BUL A;  2B9W A;  2WQY A;  4USQ A;  2GMJ A;  3VQR A;  2CDU A;  4CY8 A;  3P1W A;  1CC2 A;  1B5Q A;  3SFD A;  1LV0 A;  2VOU A;  2XLT A;  2IVD A;  2YM2 A;  3K7M X;  1GTE A;  1H82 A;  1PJ6 A;  4GF7 A;  3AEB A;  2EQ7 A;  1PBF A;  2GB0 A;  1F8S A;  2NPX A;  4UDP A;  4BV6 A;  2WOI A;  2C73 A;  4MJW A;  1VG0 A;  3H8I A;  3GRT A;  3SM8 A;  1RYI A;  1E39 A;  3H8L A;  3K7T A;  3RNM A;  3M13 A;  2BC0 A;  2WU2 A;  4K8D A;  4B65 A;  3NIX A;  1H7X A;  3NG7 X;  2PYX A;  2C66 A;  3LB8 A;  3UKP A;  5BRT A;  1GOS A;  2GR1 A;  4YT0 A;  1VG9 A;  2Q7V A;  5FMH A;  1OJ9 A;  1NHS A;  1PHH A;  2GH5 A;  1YY5 A;  2GQF A;  2JB3 A;  3V3N A;  3AE8 A;  4ADW A;  4AP3 A;  5JCK A;  3VRA A;  1GRB A;  1LPF A;  1IUS A;  5FS7 A;  2WU5 A;  3II4 A;  1H84 A;  4B63 A;  1EL5 A;  4H4Y A;  2AAQ A;  3AEC A;  5M10 A;  3M0O A;  2C65 A;  4H4R A;  4YKF A;  4D03 A;  1CJC A;  4PAA A;  3DK8 A;  1MXT A;  2Y6R A;  4K7Z A;  3NN0 X;  2YG5 A;  3ALL A;  3BI2 A;  4GUV A;  1CJ3 A;  2V6O A;  3QSM A;  4H4U A;  1NG3 A;  1GTH A;  2VRL A;  3FMW A;  4RG4 A;  4CNJ A;  3NK1 X;  2VQB A;  4H4T A;  5EBK A;  3GWF A;  1LVL A;  4H4S A;  1V59 A;  3AD7 B;  1FOH A;  3P4P A;  3DH9 A;  1CJ2 A;  4EMW A;  2XDO A;  1DXL A;  3ALJ A;  3IC9 A;  3CGB A;  4OPI A;  2GAG B;  2OLO A;  3UKA A;  1Z6L A;  4A65 A;  3ISH A;  3V3O A;  1NEN A;  4OVI A;  1JOA A;  3VRB A;  3DJE A;  3JSK A;  4YSZ A;  2GF3 A;  4JY2 A;  4A99 A;  4LII A;  2BAB A;  3F8D A;  3ITJ A;  1ZY8 A;  4B64 A;  3NH3 X;  5KRQ A;  3L8K A;  1YQZ A;  1B4V A;  3AE9 A;  4K5S A;  1O5W A;  2WDR A;  3CN8 A;  4U2T A;  4XXG A;  3SFE A;  4B68 A;  4YWO A;  1XPQ A;  2BC1 A;  4H7U A;  2BXR A;  4YTM A;  2XFU A;  4AT0 A;  1ELI A;  1CF3 A;  1W4X A;  1N4V A;  3CGC A;  4Z43 A;  4Z26 A;  4Z2U A;  3NYF A;  2E5V A;  1OJD A;  5U63 A;  2JB2 A;  4C77 A;  3BHK A;  2IVE A;  5KOX A;  1N4W A;  4AP1 A;  3CPJ G;  4B66 A;  2JKC A;  3CGE A;  5U25 A;  1L9C A;  1F8R A;  1F8W A;  3D8X A;  3GDP A;  3NLC A;  2YLW A;  2XVJ A;  1LQU A;  3GWD A;  4DSH A;  2B9X A;  2R45 A;  2XVF A;  4NEW A;  2X8H A;  3VR9 A;  1KNP A;  5ER0 A;  3QJ4 A;  3ABV A;  2JAE A;  1CC6 A;  3CPH G;  2TMD A;  2A87 A;  3CNT A;  1BWC A;  1D7L A;  3GYJ A;  3BI4 A;  4JY3 A;  1ZDL A;  1TDE A;  3RED A;  3C96 A;  2WDV A;  2BAC A;  2RGH A;  3DK9 A;  1E6E A;  2NVK X;  5JCI A;  2GQW A;  1DNC A;  1PBE A;  2VZ2 A;  3BI5 A;  3QFB A;  4LU6 A;  1DOC A;  3F8P A;  4B67 A;  4KPR A;  5KWF A;  4K2X A;  1LJ1 A;  3FG2 P;  2XVE A;  4OCG A;  1COY A;  4TM1 A;  2Y6Q A;  1P2E A;  1NEK A;  3AYJ A;  4FK1 A;  2CFY A;  3CGD A;  4DGK A;  2GR2 A;  1YQ3 A;  3AE5 A;  4H4V A;  1N4U A;  4I59 A;  2OLN A;  4XWR A;  3UTF A;  2R9Z A;  3EF6 A;  3KA7 A;  1VQW A;  4BJZ A;  1ZOY A;  1FEB A;  4GCM A;  4O5U A;  3OC4 A;  3NNE A;  2ARD A;  3UTE A;  1GRF A;  1E7P A;  4Z24 A;  3IHG A;  1BKW A;  1KF6 A;  4AOS A;  2YLX A;  1PBD A;  3G5S A;  3LXD A;  3QSS A;  1JEH A;  2XFN A;  2R0P A;  3K7Q X;  1AOG A;  4JDR A;  4YKG A;  2XVH A;  2VRM A;  2X99 A;  1GPE A;  1B8S A;  4BK1 A;  4HA6 A;  4IVO B;  4B1B A;  4H4X A;  3IF9 A;  3UOZ A;  3GD3 A;  4NEV A;  5LV9 A;  3ZDN A;  5FS8 A;  1MO9 A;  2OAM A;  2WS3 A;  4P9S A;  2C70 A;  3Q9T A;  5M0Z A;  3AED A;  3CTY A;  2YR4 A;  2BK4 A;  3LOV A;  1ZKQ A;  2B7R A;  4J57 A;  2WET A;  5C3J A;  4A7A A;  1JNR A;  4IVM B;  2OA1 A;  1NPX A;  3RP6 A;  2J3N A;  2XVI A;  2FJD A;  1H86 A;  3DGH A;  3QFA A;  5IQ1 A;  1JRZ A;  4A5L A;  3M12 A;  3AYI A;  2VVM A;  1DJQ A;  1GRE A;  1Q1W A;  4CRT A;  4H4P A;  1NHR A;  2C3C A;  2BS2 A;  2GV8 A;  2YG4 A;  1NHP A;  2GMH A;  2QA1 A;  3Q6J A;  4A6N A;  2R46 A;  1PXB A;  4EQS A;  1H81 A;  1JU2 A;  4DNA A;  1H6V A;  2FBW A;  4APN A;  2F5Z A;  4CNK A;  2A89 A;  3G5R A;  4OPU A;  4CCQ A;  4H2Q A;  1SEZ A;  1VRQ B;  4CBQ A;  2APG A;  1RSG A;  2TPR A;  1TDN A;  2E1M A;  3UKF A;  1F3P A;  1FL2 A;  4NTC A;  1GSN A;  1L9D A;  3B6D A;  2WES A;  4GDP A;  5JCM A;  3CPI G;  4U8N A;  1ZK7 A;  1EL7 A;  2X8G A;  5TR3 A;  2WP9 A;  1BZL A;  2DKI A;  1KDG A;  4ZCD A;  1CC4 A;  2BCP A;  2IID A;  5KVI A;  3SGL A;  4C74 A;  4YTP A;  1VDC A;  3IHM A;  3ZYX A;  1MOK A;  2A8X A;  1ZMC A;  2OAL A;  1FCD A;  2WP5 A;  1ONF A;  1X31 B;  3CNJ A;  1F6M A;  3LZW A;  1XAN A;  3GD4 A;  3SQP A;  3GMC A;  5BVA A;  5GSN A;  2RAB A;  4U8K A;  3AEA A;  3S5W A;  2Q0L A;  3DJJ A;  5EB5 A;  5L46 A;  4WCT A;  2VVL G;  3UCL A;  3DGZ A;  3NTA A;  1Q9I A;  1NDA A;  2V60 A;  3F8R A;  4J33 A;  1ZP0 A;  3P9U A;  1PBC A;  1JNZ A;  2XFO A;  1REO A;  3NTD A;  1CHU A;  4AT2 A;  3KLJ A;  4YSH A;  1QJD A;  2CUL A;  2GR3 A;  1YQ4 A;  3UKL A;  5JCL A;  1H7W A;  2WBA A;  4XWZ A;  5KVH A;  3T37 A;  1IUT A;  3AE7 A;  3FBS A;  2X50 A;  4H4Q A;  4Y4L A;  3AB1 A;  2B7S A;  1PN0 A;  1S3E A;  3DJD A;  4C5O A;  1TDO A;  1PXA A;  3PO7 A;  3H4K A;  4TM0 A;  2Q6U A;  3GRS A;  2AQJ A;  1Y56 B;  4ZCC A;  3VR8 A;  5J60 A;  1IJH A;  4H2N A;  1E1L A;  3GYI A;  4U8O A;  5CKU A;  5BUK A;  3DJG X;  1PXC A;  1Y56 A;  1JRY A;  4GR1 A;  4CCR A;  4K22 A;  3AYL A;  4H4Z A;  2VVL A;  4U8J A;  3AE6 A;  3FPZ A;  4C3X A;  2Z5X A;  4EM3 A;  1FEA A;  4N9X A;  4Y4M A;  1ZMD A;  1D7Y A;  1KFY A;  2O9Z A;  4EIQ A;  4A9W A;  3QVP A;  1TDF A;  2YR6 A;  3ADA B;  2YG6 A;  3NT6 A;  5KOW A;  1D4E A;  1K0J A;  4J56 A;  5C2T A;  2WPC A;  2XLP A;  2H89 A;  3KVE A;  4U8P A;  3S61 A;  2EQ6 A;  2GRT A;  3AD9 B;  2VQ7 A;  3KPF A;  3COX A;  3NKS A;  4TM3 A;  2ZZ0 A;  1M64 A;  2BK5 A;  2C3D A;  3AEG A;  4K5R A;  1S2Q A;  5FS9 A;  1K0L A;  4USR A;  4IA6 A;  3LZX A;  4EMI A;  3KU9 A;  3URH A;  3UOX A;  4HB9 A;  4X4J A;  1S3B A;  1IUU A;  4JQ9 A;  1E1K A;  4GRT A;  1L0V A;  1M6I A;  1GRT A;  1PDH A;  2PHH A;  3NK2 X;  2E4G A;  4REK A;  1OJA A;  4YXD A;  3ATQ A;  3AWI A;  4J2W A;  1H83 A;  3UTG A;  3BHF A;  2WOV A;  3P4Q A;  3BNU A;  3PVC A;  3V76 A;  2YLT A;  4IV9 A;  3CNP A;  2YM1 A;  3QSE A;  1XDI A;  1GES A;  2C75 A;  4KX6 A;  2R0G A;  4LA1 A;  4JNQ A;  1IUW A;  1O95 A;  1YKJ A;  1GT8 A;  2C76 A;  3NYC A;  3CIR A;  1D4C A;  1RP0 A;  1TYT A;  2XLR A;  2YLZ A;  2CVJ A;  4U2S A;  1GET A;  1GRA A;  1GXF A;  1KSS A;  3ICS A;  3ALM A;  1CJ4 A;  4BK2 A;  3D1C A;  1EL9 A;  2JBV A;  3GSI A;  2I0Z A;  2V61 A;  2R4J A;  2ZZB A;  4JN9 A;  2YLR A;  5EOW A;  4U8M A;  2GEW A;  3RP7 A;  1PJ7 A;  5HY5 A;  3HZL A;  3PS9 A;  1B37 A;  3UKQ A;  1IUV A;  3KD9 A;  1BF3 A;  4BK3 A;  3AEF A;  4NZH A;  3ATR A;  1UKV G;  4GDE A;  4UDQ A;  3K30 A;  5DBJ A;  3LJP A;  2QCU A;  3AEE A;  1GV4 A;  4EM4 A;  4JNA A;  1CL0 A;  2XFQ A;  4OPT A;  2B9Y A;  3BNM A;  4UDR A;  1DOE A;  5J7X A;  4A6N B;  2DKH A;  3RP8 A;  4ECH A;  4U8I A;  1DJN A;  4OPD A;  3P4S A;  3R9U A;  1GAL A;  3C4A A;  2BCG G;  4BJY A;  2X3N A;  4J31 A;  2ACZ A;  2YVF A;  4FX9 A;  1D5T A;  1K4Q A; 
#chains in the Genus database with same CATH topology
 2WP6 A;  2WOW A;  1KSU A;  3NRN A;  4H50 A;  5FS6 A;  4I58 A;  3NHO X;  4NTD A;  4YSX A;  2XYO A;  3B3R A;  5HHF A;  3O0H A;  2BXS A;  2QAE A;  4PAB A;  3SXI A;  2C72 A;  3NGC X;  4EMJ A;  4B69 A;  2GAH B;  2H88 A;  2V3B A;  3L1R A;  5CQF A;  3G5Q A;  4FK1 C;  4GAP A;  4D04 A;  4YSY A;  5IQ4 A;  5KMS A;  3T31 A;  5KXJ A;  4EQR A;  1IUX A;  2BK3 A;  2R0C A;  3UP5 A;  1CBO A;  2R4E A;  1GER A;  3KKJ A;  4EQW A;  1LQT A;  1Q1R A;  4X9M A;  2WPE A;  3I3L A;  4OPL A;  3E1T A;  4RSL A;  4AOX A;  1PS9 A;  2WEU A;  4II3 A;  1TDK A;  2HQM A;  3AE2 A;  3VRD B;  4U8L A;  1N1P A;  2GR0 A;  2GVC A;  4C3Y A;  1BGN A;  3UOY A;  3T14 A;  4A79 A;  1HYU A;  3RHA A;  1XHC A;  4H4W A;  3OZ2 A;  3UTH A;  4ZN0 A;  1S2Y A;  2FJB A;  2V5Z A;  3CMM A;  3I6D A;  3AE1 A;  1BGJ A;  2BA9 A;  2XLS A;  3AE3 A;  2C67 A;  4TM4 A;  1P2H A;  3DME A;  1DOD A;  1QLB A;  1D4D A;  2B76 A;  2Z5Y A;  4Z2R A;  2WDQ A;  2C7G A;  3NYE A;  4CY6 A;  4H2R A;  4J36 A;  1LTX R;  3P4R A;  1L9E A;  4O5Q A;  3T2Z A;  4Z44 A;  4WX1 A;  3AXB A;  1GEU A;  3AD8 B;  2ZBW A;  4U2L A;  1EBD A;  4YTN A;  3LAD A;  4Z2T A;  5HXI A;  4NWZ A;  2AR8 A;  2EQ9 A;  5GRT A;  4Y4N A;  1TRB A;  1GND A;  3QVR A;  3EAN A;  1FEC A;  2JK6 A;  2YR5 A;  1O94 A;  3WE0 A;  1ZOV A;  2YVG A;  3UOV A;  4TLX A;  1Y0P A;  3ICT A;  2YG3 A;  5EB4 A;  2FJA A;  4DSG A;  4Z25 A;  1NAA A;  2RGJ A;  2BRA A;  3ICR A;  3CND A;  2YLS A;  4X9N A;  2YAU A;  4J34 A;  1E1M A;  2YG7 A;  3T0K A;  2EQ8 A;  3CNS A;  3C4N A;  4OPC A;  2Q0K A;  5U1O A;  5JCN A;  1EL8 A;  1E1N A;  2JB1 A;  3NK0 X;  2W0H A;  3UP4 A;  4RG3 A;  1PJ5 A;  2UZZ A;  4FDC B;  1NHQ A;  2RGO A;  3GDN A;  4H2P A;  2QA2 A;  2WHD A;  1QO8 A;  1GRG A;  2C64 A;  4UP3 A;  3DA1 A;  1K0I A;  4TLZ A;  4IA5 A;  2XFP A;  1OJT A;  3UKH A;  1KNR A;  4E0V A;  5IPY A;  5HYM A;  3FIM B;  3EAO A;  2YQU A;  2XLU A;  2BYB A;  3DK4 A;  1OJC A;  2XCG A;  3EPT A;  4BUR A;  1TYP A;  3UKK A;  1JRX A;  2YVJ A;  2YWL A;  1NG4 A;  2X8C A;  2ZZC A;  4NTE A;  4ICY A;  3GMB A;  2BS4 A;  3AE4 A;  4M52 A;  2WPF A;  1ZX9 A;  1DOB A;  2FJE A;  2V3A A;  3SZC A;  3NN6 X;  3IWA A;  4OPG A;  4EQX A;  1PBB A;  1GRH A;  2BS3 A;  4EIP A;  5BUL A;  2B9W A;  2WQY A;  4USQ A;  2GMJ A;  3VQR A;  2CDU A;  4CY8 A;  3P1W A;  1CC2 A;  1B5Q A;  3SFD A;  1LV0 A;  2VOU A;  2XLT A;  2IVD A;  2YM2 A;  3K7M X;  1GTE A;  1H82 A;  1PJ6 A;  4GF7 A;  3AEB A;  4G74 A;  3KPK A;  2EQ7 A;  1PBF A;  2GB0 A;  1F8S A;  2NPX A;  4UDP A;  4BV6 A;  2WOI A;  2C73 A;  4MJW A;  1VG0 A;  3H8I A;  3GRT A;  3SM8 A;  1RYI A;  1E39 A;  3H8L A;  3K7T A;  3RNM A;  5KNL A;  3M13 A;  2BC0 A;  2WU2 A;  4K8D A;  4B65 A;  3NIX A;  1H7X A;  3NG7 X;  2PYX A;  2C66 A;  3LB8 A;  3UKP A;  5BRT A;  1GOS A;  2GR1 A;  4YT0 A;  1VG9 A;  2Q7V A;  5FMH A;  1OJ9 A;  1NHS A;  1PHH A;  2GH5 A;  1YY5 A;  2GQF A;  2JB3 A;  3V3N A;  3AE8 A;  4ADW A;  4AP3 A;  5JCK A;  3VRA A;  1GRB A;  4G6H A;  1LPF A;  1IUS A;  5FS7 A;  2WU5 A;  3II4 A;  1H84 A;  4B63 A;  1EL5 A;  4H4Y A;  2AAQ A;  3AEC A;  5M10 A;  3M0O A;  2C65 A;  4H4R A;  4YKF A;  4D03 A;  1CJC A;  4PAA A;  3DK8 A;  1MXT A;  2Y6R A;  4K7Z A;  3NN0 X;  2YG5 A;  3ALL A;  3BI2 A;  4GUV A;  1CJ3 A;  3SYI A;  2V6O A;  3QSM A;  4H4U A;  1NG3 A;  1GTH A;  2VRL A;  3FMW A;  4RG4 A;  4CNJ A;  3NK1 X;  2VQB A;  4H4T A;  5EBK A;  3GWF A;  1LVL A;  4H4S A;  1V59 A;  3AD7 B;  5KMQ A;  1FOH A;  3P4P A;  3DH9 A;  1CJ2 A;  4EMW A;  2XDO A;  1DXL A;  3ALJ A;  3T2K A;  3IC9 A;  3CGB A;  4OPI A;  2GAG B;  2OLO A;  3UKA A;  1Z6L A;  4A65 A;  3ISH A;  3V3O A;  1NEN A;  4OVI A;  3HYW A;  1JOA A;  3VRB A;  3DJE A;  3JSK A;  4NNJ A;  4YSZ A;  2GF3 A;  4JY2 A;  4A99 A;  4LII A;  2BAB A;  3F8D A;  3ITJ A;  1ZY8 A;  4B64 A;  3NH3 X;  5KRQ A;  3L8K A;  1YQZ A;  1B4V A;  3AE9 A;  4K5S A;  1O5W A;  2WDR A;  3CN8 A;  4U2T A;  4XXG A;  3SFE A;  4B68 A;  4YWO A;  1XPQ A;  2BC1 A;  4H7U A;  2BXR A;  4YTM A;  2XFU A;  4AT0 A;  1ELI A;  1CF3 A;  1W4X A;  1N4V A;  3CGC A;  4Z43 A;  4Z26 A;  4Z2U A;  3NYF A;  2E5V A;  1OJD A;  5U63 A;  2JB2 A;  4C77 A;  3BHK A;  2IVE A;  5KOX A;  1N4W A;  4AP1 A;  3CPJ G;  4B66 A;  2JKC A;  3CGE A;  5U25 A;  1L9C A;  1F8R A;  1F8W A;  3D8X A;  3GDP A;  3NLC A;  2YLW A;  2XVJ A;  1LQU A;  3GWD A;  4DSH A;  2B9X A;  2R45 A;  2XVF A;  4NEW A;  2X8H A;  3VR9 A;  1KNP A;  5ER0 A;  3QJ4 A;  3ABV A;  2JAE A;  1CC6 A;  3CPH G;  2TMD A;  2A87 A;  3CNT A;  1BWC A;  1D7L A;  3GYJ A;  3BI4 A;  4JY3 A;  1ZDL A;  1TDE A;  3RED A;  3C96 A;  4GAV A;  2WDV A;  2BAC A;  2RGH A;  3DK9 A;  1E6E A;  2NVK X;  5JCI A;  2GQW A;  1DNC A;  1PBE A;  2VZ2 A;  3BI5 A;  3QFB A;  4LU6 A;  1DOC A;  3F8P A;  4B67 A;  4KPR A;  5KWF A;  4K2X A;  1LJ1 A;  3FG2 P;  2XVE A;  4OCG A;  1COY A;  4TM1 A;  2Y6Q A;  1P2E A;  1NEK A;  3AYJ A;  4FK1 A;  2CFY A;  3CGD A;  4DGK A;  2GR2 A;  1YQ3 A;  3AE5 A;  4H4V A;  1N4U A;  4I59 A;  2OLN A;  4XWR A;  3UTF A;  2R9Z A;  3EF6 A;  3KA7 A;  1VQW A;  4BJZ A;  1ZOY A;  1FEB A;  4GCM A;  4O5U A;  3OC4 A;  3NNE A;  2ARD A;  3UTE A;  3SZ0 A;  1GRF A;  1E7P A;  4Z24 A;  3IHG A;  1BKW A;  1KF6 A;  4AOS A;  2YLX A;  1PBD A;  3G5S A;  3LXD A;  3QSS A;  1JEH A;  2XFN A;  2R0P A;  3K7Q X;  1AOG A;  4JDR A;  4YKG A;  2XVH A;  2VRM A;  2X99 A;  1GPE A;  1B8S A;  4BK1 A;  4HA6 A;  4IVO B;  4II2 A;  4B1B A;  4H4X A;  3IF9 A;  3UOZ A;  3GD3 A;  4NEV A;  5LV9 A;  3ZDN A;  5FS8 A;  1MO9 A;  2OAM A;  2WS3 A;  4P9S A;  2C70 A;  3Q9T A;  5M0Z A;  3AED A;  3CTY A;  2YR4 A;  2BK4 A;  3LOV A;  1ZKQ A;  2B7R A;  4J57 A;  2WET A;  5C3J A;  4G9K A;  1JNR A;  4A7A A;  4IVM B;  2OA1 A;  1NPX A;  3RP6 A;  2J3N A;  2XVI A;  2FJD A;  1H86 A;  3GYX A;  3DGH A;  3QFA A;  5IQ1 A;  1JRZ A;  4A5L A;  3M12 A;  3AYI A;  2VVM A;  1DJQ A;  1GRE A;  1Q1W A;  4CRT A;  4H4P A;  1NHR A;  2C3C A;  2BS2 A;  2GV8 A;  2YG4 A;  1NHP A;  2GMH A;  2QA1 A;  3Q6J A;  4A6N A;  2R46 A;  1PXB A;  4EQS A;  1H81 A;  1JU2 A;  4DNA A;  1H6V A;  2FBW A;  4APN A;  2F5Z A;  4CNK A;  2A89 A;  3G5R A;  4OPU A;  4CCQ A;  4H2Q A;  1SEZ A;  1VRQ B;  4CBQ A;  2APG A;  1RSG A;  2TPR A;  1TDN A;  2E1M A;  3UKF A;  1F3P A;  1FL2 A;  4NTC A;  1GSN A;  1L9D A;  3SY4 A;  3SZW A;  3B6D A;  2WES A;  4GDP A;  5JCM A;  3CPI G;  4U8N A;  1ZK7 A;  1EL7 A;  2X8G A;  5TR3 A;  2WP9 A;  1BZL A;  2DKI A;  1KDG A;  4ZCD A;  1CC4 A;  2BCP A;  2IID A;  5KVI A;  3SGL A;  4C74 A;  4YTP A;  1VDC A;  3IHM A;  3ZYX A;  1MOK A;  3T2Y A;  5KMP A;  2A8X A;  1ZMC A;  2OAL A;  1FCD A;  2WP5 A;  1ONF A;  1X31 B;  3CNJ A;  1F6M A;  3LZW A;  1XAN A;  3GD4 A;  3SQP A;  3GMC A;  5BVA A;  5GSN A;  2RAB A;  4U8K A;  3AEA A;  3S5W A;  2Q0L A;  3DJJ A;  5EB5 A;  5L46 A;  4WCT A;  2VVL G;  3UCL A;  3DGZ A;  3NTA A;  1Q9I A;  1NDA A;  2V60 A;  3F8R A;  4J33 A;  1ZP0 A;  3P9U A;  1PBC A;  1JNZ A;  2XFO A;  1REO A;  3NTD A;  1CHU A;  4AT2 A;  3KLJ A;  4YSH A;  1QJD A;  2CUL A;  2GR3 A;  1YQ4 A;  3UKL A;  5JCL A;  1H7W A;  2WBA A;  4XWZ A;  5KVH A;  3T37 A;  1IUT A;  3AE7 A;  3FBS A;  2X50 A;  4H4Q A;  4Y4L A;  4G73 A;  3AB1 A;  2B7S A;  1PN0 A;  1S3E A;  3DJD A;  4C5O A;  1TDO A;  1PXA A;  3PO7 A;  3H4K A;  4TM0 A;  2Q6U A;  3GRS A;  2AQJ A;  1Y56 B;  4ZCC A;  3VR8 A;  5J60 A;  1IJH A;  4H2N A;  1E1L A;  3GYI A;  4U8O A;  5CKU A;  5BUK A;  3DJG X;  1PXC A;  1Y56 A;  1JRY A;  4GR1 A;  4CCR A;  4K22 A;  3AYL A;  4H4Z A;  3SX6 A;  2VVL A;  4U8J A;  3AE6 A;  3FPZ A;  4C3X A;  2Z5X A;  4EM3 A;  1FEA A;  4N9X A;  4Y4M A;  1ZMD A;  1D7Y A;  1KFY A;  2O9Z A;  4EIQ A;  4A9W A;  3QVP A;  1TDF A;  2YR6 A;  3ADA B;  2YG6 A;  3NT6 A;  5KOW A;  1D4E A;  1K0J A;  4J56 A;  5C2T A;  2WPC A;  2XLP A;  2H89 A;  3KVE A;  4U8P A;  3S61 A;  2EQ6 A;  2GRT A;  3AD9 B;  2VQ7 A;  2BRY A;  3COX A;  3KPF A;  3NKS A;  4G6G A;  4TM3 A;  2ZZ0 A;  3SZF A;  1M64 A;  2BK5 A;  2C3D A;  3AEG A;  4K5R A;  1S2Q A;  5FS9 A;  1K0L A;  4USR A;  4IA6 A;  3LZX A;  4EMI A;  3KU9 A;  3URH A;  3UOX A;  4HB9 A;  4X4J A;  2C4C A;  1S3B A;  1IUU A;  4JQ9 A;  1E1K A;  4GRT A;  1L0V A;  1M6I A;  1GRT A;  1PDH A;  2PHH A;  3NK2 X;  2E4G A;  4REK A;  1OJA A;  4YXD A;  3ATQ A;  3AWI A;  4J2W A;  1H83 A;  3UTG A;  3BHF A;  2WOV A;  3P4Q A;  3BNU A;  3PVC A;  3V76 A;  3HYX A;  2YLT A;  4IV9 A;  3CNP A;  2YM1 A;  3QSE A;  1XDI A;  1GES A;  2C75 A;  4KX6 A;  2R0G A;  4LA1 A;  4JNQ A;  1IUW A;  1O95 A;  1YKJ A;  1GT8 A;  2C76 A;  3NYC A;  3CIR A;  1D4C A;  1RP0 A;  1TYT A;  2XLR A;  2YLZ A;  2CVJ A;  4U2S A;  1GET A;  1GRA A;  1GXF A;  1KSS A;  3ICS A;  3ALM A;  1CJ4 A;  4BK2 A;  3D1C A;  1EL9 A;  2JBV A;  3GSI A;  2I0Z A;  2V61 A;  2R4J A;  2ZZB A;  4JN9 A;  2YLR A;  5EOW A;  4U8M A;  2GEW A;  3RP7 A;  1PJ7 A;  5HY5 A;  3HZL A;  3PS9 A;  1B37 A;  3UKQ A;  1IUV A;  3KD9 A;  1BF3 A;  4BK3 A;  3AEF A;  4NZH A;  3ATR A;  1UKV G;  4GDE A;  4UDQ A;  3K30 A;  5DBJ A;  3LJP A;  2QCU A;  3AEE A;  1GV4 A;  4EM4 A;  4JNA A;  1CL0 A;  2XFQ A;  4OPT A;  2B9Y A;  3BNM A;  4UDR A;  1DOE A;  5J7X A;  4A6N B;  2DKH A;  3RP8 A;  4ECH A;  4U8I A;  5KMR A;  1DJN A;  4OPD A;  3P4S A;  3R9U A;  1GAL A;  3C4A A;  2BCG G;  3HYV A;  4BJY A;  2X3N A;  4J31 A;  2ACZ A;  2YVF A;  4FX9 A;  1D5T A;  1K4Q A; 
#chains in the Genus database with same CATH homology
 2WP6 A;  2WOW A;  1KSU A;  3NRN A;  4H50 A;  5FS6 A;  4I58 A;  3NHO X;  4NTD A;  4YSX A;  2XYO A;  3B3R A;  5HHF A;  3O0H A;  2BXS A;  2QAE A;  4PAB A;  3SXI A;  2C72 A;  3NGC X;  4EMJ A;  4B69 A;  2GAH B;  2H88 A;  2V3B A;  3L1R A;  5CQF A;  3G5Q A;  4FK1 C;  4GAP A;  4D04 A;  4YSY A;  5IQ4 A;  5KMS A;  3T31 A;  5KXJ A;  4EQR A;  1IUX A;  2BK3 A;  2R0C A;  3UP5 A;  1CBO A;  2R4E A;  1GER A;  3KKJ A;  4EQW A;  1LQT A;  1Q1R A;  4X9M A;  2WPE A;  3I3L A;  4OPL A;  3E1T A;  4RSL A;  4AOX A;  1PS9 A;  2WEU A;  4II3 A;  1TDK A;  2HQM A;  3AE2 A;  3VRD B;  4U8L A;  1N1P A;  2GR0 A;  2GVC A;  4C3Y A;  1BGN A;  3UOY A;  3T14 A;  4A79 A;  1HYU A;  3RHA A;  1XHC A;  4H4W A;  3OZ2 A;  3UTH A;  4ZN0 A;  1S2Y A;  2FJB A;  2V5Z A;  3CMM A;  3I6D A;  3AE1 A;  1BGJ A;  2BA9 A;  2XLS A;  3AE3 A;  2C67 A;  4TM4 A;  1P2H A;  3DME A;  1DOD A;  1QLB A;  1D4D A;  2B76 A;  2Z5Y A;  4Z2R A;  2WDQ A;  2C7G A;  3NYE A;  4CY6 A;  4H2R A;  4J36 A;  1LTX R;  3P4R A;  1L9E A;  4O5Q A;  3T2Z A;  4Z44 A;  4WX1 A;  3AXB A;  1GEU A;  3AD8 B;  2ZBW A;  4U2L A;  1EBD A;  4YTN A;  3LAD A;  4Z2T A;  5HXI A;  4NWZ A;  2AR8 A;  2EQ9 A;  5GRT A;  4Y4N A;  1TRB A;  1GND A;  3QVR A;  3EAN A;  1FEC A;  2JK6 A;  2YR5 A;  1O94 A;  3WE0 A;  1ZOV A;  2YVG A;  3UOV A;  4TLX A;  1Y0P A;  3ICT A;  2YG3 A;  5EB4 A;  2FJA A;  4DSG A;  4Z25 A;  1NAA A;  2RGJ A;  2BRA A;  3ICR A;  3CND A;  2YLS A;  4X9N A;  2YAU A;  4J34 A;  1E1M A;  2YG7 A;  3T0K A;  2EQ8 A;  3CNS A;  3C4N A;  4OPC A;  2Q0K A;  5U1O A;  5JCN A;  1EL8 A;  1E1N A;  2JB1 A;  3NK0 X;  2W0H A;  3UP4 A;  4RG3 A;  1PJ5 A;  2UZZ A;  4FDC B;  1NHQ A;  2RGO A;  3GDN A;  4H2P A;  2QA2 A;  2WHD A;  1QO8 A;  1GRG A;  2C64 A;  4UP3 A;  3DA1 A;  1K0I A;  4TLZ A;  4IA5 A;  2XFP A;  1OJT A;  3UKH A;  1KNR A;  4E0V A;  5IPY A;  5HYM A;  3FIM B;  3EAO A;  2YQU A;  2XLU A;  2BYB A;  3DK4 A;  1OJC A;  2XCG A;  3EPT A;  4BUR A;  1TYP A;  3UKK A;  1JRX A;  2YVJ A;  2YWL A;  1NG4 A;  2X8C A;  2ZZC A;  4NTE A;  4ICY A;  3GMB A;  2BS4 A;  3AE4 A;  4M52 A;  2WPF A;  1ZX9 A;  1DOB A;  2FJE A;  2V3A A;  3SZC A;  3NN6 X;  3IWA A;  4OPG A;  4EQX A;  1PBB A;  1GRH A;  2BS3 A;  4EIP A;  5BUL A;  2B9W A;  2WQY A;  4USQ A;  2GMJ A;  3VQR A;  2CDU A;  4CY8 A;  3P1W A;  1CC2 A;  1B5Q A;  3SFD A;  1LV0 A;  2VOU A;  2XLT A;  2IVD A;  2YM2 A;  3K7M X;  1GTE A;  1H82 A;  1PJ6 A;  4GF7 A;  3AEB A;  4G74 A;  3KPK A;  2EQ7 A;  1PBF A;  2GB0 A;  1F8S A;  2NPX A;  4UDP A;  4BV6 A;  2WOI A;  2C73 A;  4MJW A;  1VG0 A;  3H8I A;  3GRT A;  3SM8 A;  1RYI A;  1E39 A;  3H8L A;  3K7T A;  3RNM A;  5KNL A;  3M13 A;  2BC0 A;  2WU2 A;  4K8D A;  4B65 A;  3NIX A;  1H7X A;  3NG7 X;  2PYX A;  2C66 A;  3LB8 A;  3UKP A;  5BRT A;  1GOS A;  2GR1 A;  4YT0 A;  1VG9 A;  2Q7V A;  5FMH A;  1OJ9 A;  1NHS A;  1PHH A;  2GH5 A;  1YY5 A;  2GQF A;  2JB3 A;  3V3N A;  3AE8 A;  4ADW A;  4AP3 A;  5JCK A;  3VRA A;  1GRB A;  4G6H A;  1LPF A;  1IUS A;  5FS7 A;  2WU5 A;  3II4 A;  1H84 A;  4B63 A;  1EL5 A;  4H4Y A;  2AAQ A;  3AEC A;  5M10 A;  3M0O A;  2C65 A;  4H4R A;  4YKF A;  4D03 A;  1CJC A;  4PAA A;  3DK8 A;  1MXT A;  2Y6R A;  4K7Z A;  3NN0 X;  2YG5 A;  3ALL A;  3BI2 A;  4GUV A;  1CJ3 A;  3SYI A;  2V6O A;  3QSM A;  4H4U A;  1NG3 A;  1GTH A;  2VRL A;  3FMW A;  4RG4 A;  4CNJ A;  3NK1 X;  2VQB A;  4H4T A;  5EBK A;  3GWF A;  1LVL A;  4H4S A;  1V59 A;  3AD7 B;  5KMQ A;  1FOH A;  3P4P A;  3DH9 A;  1CJ2 A;  4EMW A;  2XDO A;  1DXL A;  3ALJ A;  3T2K A;  3IC9 A;  3CGB A;  4OPI A;  2GAG B;  2OLO A;  3UKA A;  1Z6L A;  4A65 A;  3ISH A;  3V3O A;  1NEN A;  4OVI A;  3HYW A;  1JOA A;  3VRB A;  3DJE A;  3JSK A;  4NNJ A;  4YSZ A;  2GF3 A;  4JY2 A;  4A99 A;  4LII A;  2BAB A;  3F8D A;  3ITJ A;  1ZY8 A;  4B64 A;  3NH3 X;  5KRQ A;  3L8K A;  1YQZ A;  1B4V A;  3AE9 A;  4K5S A;  1O5W A;  2WDR A;  3CN8 A;  4U2T A;  4XXG A;  3SFE A;  4B68 A;  4YWO A;  1XPQ A;  2BC1 A;  4H7U A;  2BXR A;  4YTM A;  2XFU A;  4AT0 A;  1ELI A;  1CF3 A;  1W4X A;  1N4V A;  3CGC A;  4Z43 A;  4Z26 A;  4Z2U A;  3NYF A;  2E5V A;  1OJD A;  5U63 A;  2JB2 A;  4C77 A;  3BHK A;  2IVE A;  5KOX A;  1N4W A;  4AP1 A;  3CPJ G;  4B66 A;  2JKC A;  3CGE A;  5U25 A;  1L9C A;  1F8R A;  1F8W A;  3D8X A;  3GDP A;  3NLC A;  2YLW A;  2XVJ A;  1LQU A;  3GWD A;  4DSH A;  2B9X A;  2R45 A;  2XVF A;  4NEW A;  2X8H A;  3VR9 A;  1KNP A;  5ER0 A;  3QJ4 A;  3ABV A;  2JAE A;  1CC6 A;  3CPH G;  2TMD A;  2A87 A;  3CNT A;  1BWC A;  1D7L A;  3GYJ A;  3BI4 A;  4JY3 A;  1ZDL A;  1TDE A;  3RED A;  3C96 A;  4GAV A;  2WDV A;  2BAC A;  2RGH A;  3DK9 A;  1E6E A;  2NVK X;  5JCI A;  2GQW A;  1DNC A;  1PBE A;  2VZ2 A;  3BI5 A;  3QFB A;  4LU6 A;  1DOC A;  3F8P A;  4B67 A;  4KPR A;  5KWF A;  4K2X A;  1LJ1 A;  3FG2 P;  2XVE A;  4OCG A;  1COY A;  4TM1 A;  2Y6Q A;  1P2E A;  1NEK A;  3AYJ A;  4FK1 A;  2CFY A;  3CGD A;  4DGK A;  2GR2 A;  1YQ3 A;  3AE5 A;  4H4V A;  1N4U A;  4I59 A;  2OLN A;  4XWR A;  3UTF A;  2R9Z A;  3EF6 A;  3KA7 A;  1VQW A;  4BJZ A;  1ZOY A;  1FEB A;  4GCM A;  4O5U A;  3OC4 A;  3NNE A;  2ARD A;  3UTE A;  3SZ0 A;  1GRF A;  1E7P A;  4Z24 A;  3IHG A;  1BKW A;  1KF6 A;  4AOS A;  2YLX A;  1PBD A;  3G5S A;  3LXD A;  3QSS A;  1JEH A;  2XFN A;  2R0P A;  3K7Q X;  1AOG A;  4JDR A;  4YKG A;  2XVH A;  2VRM A;  2X99 A;  1GPE A;  1B8S A;  4BK1 A;  4HA6 A;  4IVO B;  4II2 A;  4B1B A;  4H4X A;  3IF9 A;  3UOZ A;  3GD3 A;  4NEV A;  5LV9 A;  3ZDN A;  5FS8 A;  1MO9 A;  2OAM A;  2WS3 A;  4P9S A;  2C70 A;  3Q9T A;  5M0Z A;  3AED A;  3CTY A;  2YR4 A;  2BK4 A;  3LOV A;  1ZKQ A;  2B7R A;  4J57 A;  2WET A;  5C3J A;  4G9K A;  1JNR A;  4A7A A;  4IVM B;  2OA1 A;  1NPX A;  3RP6 A;  2J3N A;  2XVI A;  2FJD A;  1H86 A;  3GYX A;  3DGH A;  3QFA A;  5IQ1 A;  1JRZ A;  4A5L A;  3M12 A;  3AYI A;  2VVM A;  1DJQ A;  1GRE A;  1Q1W A;  4CRT A;  4H4P A;  1NHR A;  2C3C A;  2BS2 A;  2GV8 A;  2YG4 A;  1NHP A;  2GMH A;  2QA1 A;  3Q6J A;  4A6N A;  2R46 A;  1PXB A;  4EQS A;  1H81 A;  1JU2 A;  4DNA A;  1H6V A;  2FBW A;  4APN A;  2F5Z A;  4CNK A;  2A89 A;  3G5R A;  4OPU A;  4CCQ A;  4H2Q A;  1SEZ A;  1VRQ B;  4CBQ A;  2APG A;  1RSG A;  2TPR A;  1TDN A;  2E1M A;  3UKF A;  1F3P A;  1FL2 A;  4NTC A;  1GSN A;  1L9D A;  3SY4 A;  3SZW A;  3B6D A;  2WES A;  4GDP A;  5JCM A;  3CPI G;  4U8N A;  1ZK7 A;  1EL7 A;  2X8G A;  5TR3 A;  2WP9 A;  1BZL A;  2DKI A;  1KDG A;  4ZCD A;  1CC4 A;  2BCP A;  2IID A;  5KVI A;  3SGL A;  4C74 A;  4YTP A;  1VDC A;  3IHM A;  3ZYX A;  1MOK A;  3T2Y A;  5KMP A;  2A8X A;  1ZMC A;  2OAL A;  1FCD A;  2WP5 A;  1ONF A;  1X31 B;  3CNJ A;  1F6M A;  3LZW A;  1XAN A;  3GD4 A;  3SQP A;  3GMC A;  5BVA A;  5GSN A;  2RAB A;  4U8K A;  3AEA A;  3S5W A;  2Q0L A;  3DJJ A;  5EB5 A;  5L46 A;  4WCT A;  2VVL G;  3UCL A;  3DGZ A;  3NTA A;  1Q9I A;  1NDA A;  2V60 A;  3F8R A;  4J33 A;  1ZP0 A;  3P9U A;  1PBC A;  1JNZ A;  2XFO A;  1REO A;  3NTD A;  1CHU A;  4AT2 A;  3KLJ A;  4YSH A;  1QJD A;  2CUL A;  2GR3 A;  1YQ4 A;  3UKL A;  5JCL A;  1H7W A;  2WBA A;  4XWZ A;  5KVH A;  3T37 A;  1IUT A;  3AE7 A;  3FBS A;  2X50 A;  4H4Q A;  4Y4L A;  4G73 A;  3AB1 A;  2B7S A;  1PN0 A;  1S3E A;  3DJD A;  4C5O A;  1TDO A;  1PXA A;  3PO7 A;  3H4K A;  4TM0 A;  2Q6U A;  3GRS A;  2AQJ A;  1Y56 B;  4ZCC A;  3VR8 A;  5J60 A;  1IJH A;  4H2N A;  1E1L A;  3GYI A;  4U8O A;  5CKU A;  5BUK A;  3DJG X;  1PXC A;  1Y56 A;  1JRY A;  4GR1 A;  4CCR A;  4K22 A;  3AYL A;  4H4Z A;  3SX6 A;  2VVL A;  4U8J A;  3AE6 A;  3FPZ A;  4C3X A;  2Z5X A;  4EM3 A;  1FEA A;  4N9X A;  4Y4M A;  1ZMD A;  1D7Y A;  1KFY A;  2O9Z A;  4EIQ A;  4A9W A;  3QVP A;  1TDF A;  2YR6 A;  3ADA B;  2YG6 A;  3NT6 A;  5KOW A;  1D4E A;  1K0J A;  4J56 A;  5C2T A;  2WPC A;  2XLP A;  2H89 A;  3KVE A;  4U8P A;  3S61 A;  2EQ6 A;  2GRT A;  3AD9 B;  2VQ7 A;  2BRY A;  3COX A;  3KPF A;  3NKS A;  4G6G A;  4TM3 A;  2ZZ0 A;  3SZF A;  1M64 A;  2BK5 A;  2C3D A;  3AEG A;  4K5R A;  1S2Q A;  5FS9 A;  1K0L A;  4USR A;  4IA6 A;  3LZX A;  4EMI A;  3KU9 A;  3URH A;  3UOX A;  4HB9 A;  4X4J A;  2C4C A;  1S3B A;  1IUU A;  4JQ9 A;  1E1K A;  4GRT A;  1L0V A;  1M6I A;  1GRT A;  1PDH A;  2PHH A;  3NK2 X;  2E4G A;  4REK A;  1OJA A;  4YXD A;  3ATQ A;  3AWI A;  4J2W A;  1H83 A;  3UTG A;  3BHF A;  2WOV A;  3P4Q A;  3BNU A;  3PVC A;  3V76 A;  3HYX A;  2YLT A;  4IV9 A;  3CNP A;  2YM1 A;  3QSE A;  1XDI A;  1GES A;  2C75 A;  4KX6 A;  2R0G A;  4LA1 A;  4JNQ A;  1IUW A;  1O95 A;  1YKJ A;  1GT8 A;  2C76 A;  3NYC A;  3CIR A;  1D4C A;  1RP0 A;  1TYT A;  2XLR A;  2YLZ A;  2CVJ A;  4U2S A;  1GET A;  1GRA A;  1GXF A;  1KSS A;  3ICS A;  3ALM A;  1CJ4 A;  4BK2 A;  3D1C A;  1EL9 A;  2JBV A;  3GSI A;  2I0Z A;  2V61 A;  2R4J A;  2ZZB A;  4JN9 A;  2YLR A;  5EOW A;  4U8M A;  2GEW A;  3RP7 A;  1PJ7 A;  5HY5 A;  3HZL A;  3PS9 A;  1B37 A;  3UKQ A;  1IUV A;  3KD9 A;  1BF3 A;  4BK3 A;  3AEF A;  4NZH A;  3ATR A;  1UKV G;  4GDE A;  4UDQ A;  3K30 A;  5DBJ A;  3LJP A;  2QCU A;  3AEE A;  1GV4 A;  4EM4 A;  4JNA A;  1CL0 A;  2XFQ A;  4OPT A;  2B9Y A;  3BNM A;  4UDR A;  1DOE A;  5J7X A;  4A6N B;  2DKH A;  3RP8 A;  4ECH A;  4U8I A;  5KMR A;  1DJN A;  4OPD A;  3P4S A;  3R9U A;  1GAL A;  3C4A A;  2BCG G;  3HYV A;  4BJY A;  2X3N A;  4J31 A;  2ACZ A;  2YVF A;  4FX9 A;  1D5T A;  1K4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...