3QJ4A

Crystal structure of human renalase (isoform 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
341
structure length
335
Chain Sequence
MAQVLIVGAGMTGSLCAALLRRQTGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTDVPWAGQYITSNPCIRFVSIDNKKRNIESSIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Renalase
publication title FAD-binding site and NADP reactivity in human renalase: a new enzyme involved in blood pressure regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 335
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3qj4A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3qj4A02
2GR1A 2OLNA 1GESA 1PBFA 2JK6A 2VVLA 1LQUA 2WDVA 2YG6A 3ATRA 3L1RA 2ACZA 2WU2A 2NPXA 3NHOX 2WDQA 1CF3A 3BHFA 2A87A 3ICSA 4XXGA 1E6EA 3DJGX 3AD9B 4K5SA 3LOVA 2XFNA 2XFOA 4CY8A 1IUWA 2YLSA 1GRFA 1K0JA 4H2RA 4CRTA 1KFYA 3R9UA 2X3NA 2XCGA 2C3DA 4GDPA 4D03A 3NIXA 4U8LA 4PAAA 3AEFA 3QSSA 4YT0A 3S61A 1GRTA 1VG9A 4YTPA 2GAHB 2JB1A 4FK1C 1TRBA 1ZOVA 1DXLA 5IQ1A 1UKVG 1E1KA 2V6OA 2B9WA 2BC0A 5TR3A 1REOA 3GD4A 1BZLA 4K8DA 3ICRA 2B7SA 3P4PA 2XFPA 1QO8A 1JNRA 1KSUA 1ZY8A 2BK5A 1TDOA 2C65A 3DH9A 3DGZA 3GDPA 2BS4A 4WX1A 1Y56B 4EMIA 4U2LA 1CBOA 2AAQA 2DKHA 2XLSA 3DGHA 3FIMB 4CY6A 1ZX9A 4AP3A 1EBDA 3AWIA 4J57A 3ISHA 2QAEA 3SGLA 3LXDA 4IVMB 4NZHA 5M10A 5L46A 3EANA 2YLXA 1DOBA 1RSGA 4YWOA 4Y4MA 3SFEA 3UTGA 1PXBA 3NYCA 4FX9A 1CC2A 2V5ZA 3GWFA 1B5QA 2YLRA 2BCGG 4OPGA 1K0LA 3C4NA 4BJYA 1CHUA 3ITJA 2WP9A 3B3RA 1ZMDA 1OJ9A 1GRBA 1NHPA 2WU5A 1O5WA 1NG4A 3AEEA 3IHGA 3LJPA 3CPJG 3LZXA 2AQJA 3PO7A 3AD7B 2WQYA 1GSNA 2YWLA 3B6DA 2WESA 3CTYA 4O5UA 3NK0X 4A79A 3G5QA 3V3OA 1B8SA 3COXA 2NVKX 2V3AA 2X8CA 2UZZA 4CBQA 2RGHA 1YQZA 2PYXA 2GR3A 4CCQA 2C66A 3QFAA 1DOCA 1LTXR 2CFYA 4H4UA 4JY3A 1X31B 2A8XA 2Y6QA 3ALJA 2B9YA 2IIDA 3FG2P 5IQ4A 3ABVA 1H7XA 4BURA 3CPIG 3Q6JA 4EM3A 1K4QA 4EM4A 2YG3A 5JCKA 4H4QA 1H82A 1GRGA 3T37A 2VRLA 5KXJA 3NK2X 4USQA 4JY2A 4U8JA 3FPZA 3LZWA 3DJEA 1NENA 2WOIA 4TM0A 4ZN0A 5C3JA 3ALLA 1CC4A 2VZ2A 2XVIA 3UKAA 4BK2A 1ZMCA 3RHAA 3VRAA 2GR2A 1OJCA 2GV8A 2CDUA 2R4JA 1DODA 2HQMA 1P2HA 3H4KA 4AOSA 3K7QX 4K2XA 4NTCA 2RABA 5KVIA 1BF3A 3QJ4A 3UOZA 4A65A 1W4XA 2H88A 2WPCA 4H4XA 2IVDA 4ADWA 4PABA 2BACA 3L8KA 2FJDA 5KWFA 1E1MA 1GT8A 1GALA 2JB3A 2VRMA 3H8IA 4ZCCA 3UTFA 5FS8A 1B37A 5KOWA 1FEBA 1PBDA 3JSKA 3OZ2A 1Y56A 2YG7A 3AE7A 3UKQA 4ZCDA 1TDEA 1XANA 2C72A 2C73A 1O95A 2Q7VA 3AECA 3O0HA 3UCLA 1LJ1A 1LPFA 3NK1X 4M52A 1NDAA 4YKFA 1LVLA 1S3BA 4TM3A 1V59A 4TM4A 4YTMA 1D4DA 1EL9A 2ZBWA 5ER0A 4J33A 3SFDA 2BYBA 2TPRA 2YLTA 4HA6A 3DA1A 4H4RA 1BGNA 3NN6X 2WDRA 3G5RA 4OVIA 1H83A 3KD9A 4UDRA 2Z5XA 4U8KA 1PJ6A 2WEUA 2WP6A 2EQ7A 2YM1A 3DJJA 4I59A 5CKUA 1TDKA 3AEAA 4TM1A 2YR4A 2WPFA 4AT0A 1D7LA 3URHA 2XDOA 4H2QA 4JQ9A 4KPRA 4C3XA 1CJ3A 3ZDNA 3ADAB 3I6DA 1S2YA 5KVHA 1QJDA 3EF6A 3KPFA 4C5OA 4GUVA 1NHSA 3M13A 5GRTA 4B69A 1PJ7A 3IC9A 3RP7A 4BV6A 4Z2RA 4Z2TA 5GSNA 2QCUA 4JNAA 3DMEA 4B66A 1L0VA 3DK4A 1GETA 3QVRA 2TMDA 3NTAA 4GRTA 1MXTA 4OPIA 3E1TA 4U8NA 5FS6A 4Z24A 4C77A 4LIIA 5FS9A 3UOXA 1D5TA 1XHCA 5EOWA 2E5VA 4H4WA 1E7PA 3CNDA 1KSSA 2I0ZA 1GTEA 3F8PA 4DSGA 3AE9A 3AEDA 3P4SA 2OALA 2X8GA 4CNKA 1Q1RA 3AYJA 3G5SA 1ZK7A 1BGJA 1N4UA 2YR6A 3CGCA 1YKJA 4BK3A 4OPUA 1PBCA 3GYJA 3KLJA 2PHHA 4N9XA 1GERA 5BULA 1NHQA 4FDCB 3FMWA 2WP5A 3NKSA 3ATQA 4NTEA 2X8HA 2WS3A 1GV4A 3AD8B 2R0GA 2EQ9A 3KKJA 1KF6A 1Z6LA 3NTDA 4EQWA 4AT2A 2JKCA 1FCDA 4H50A 3RP8A 1CJ4A 1GEUA 2VQ7A 4B63A 1F8WA 1F8SA 3SQPA 1N4VA 1XPQA 4B1BA 1ONFA 3AYIA 2EQ6A 5U1OA 1NG3A 3P4QA 4K5RA 3ZYXA 1NAAA 3AYLA 3C96A 2FJAA 2H89A 3VRBA 4EQXA 2WOWA 2C3CA 1GRAA 5KRQA 1GRHA 4OCGA 1EL8A 3NG7X 5IPYA 1JOAA 4AP1A 2CULA 2BA9A 2JB2A 2VVLG 3QFBA 4EIQA 1FOHA 2EQ8A 2RGJA 2QA1A 4WCTA 4EMWA 3LADA 2BS2A 3RP6A 2YQUA 2XVHA 1L9DA 2GVCA 3ALMA 4GF7A 2WHDA 3K7MX 2C76A 2C75A 4GR1A 4J36A 4JN9A 2YVGA 4K7ZA 2QA2A 1LQTA 4H2NA 2ARDA 5U63A 1AOGA 2Q6UA 1JRXA 4Z2UA 1JEHA 3K7TA 3KVEA 1F3PA 2GQWA 1GXFA 4JNQA 4REKA 2VQBA 1PXAA 1DJQA 2OA1A 4H4YA 2E1MA 4E0VA 2OAMA 3GMBA 1Q9IA 4YKGA 5HYMA 2AR8A 4J2WA 4YSXA 1HYUA 2R4EA 3V3NA 1NPXA 4H2PA 4A6NB 1F6MA 5J7XA 2OLOA 3I3LA 4IV9A 4P9SA 1YY5A 2YVFA 2C67A 3CNTA 3PVCA 4X9MA 3Q9TA 4U8IA 4U2TA 2XLPA 2YR5A 4IA6A 2FJEA 2XVJA 5M0ZA 5C2TA 2DKIA 1MOKA 1CJCA 1EL7A 2BK3A 3AXBA 4B65A 4U2SA 4H4PA 3QSEA 2GQFA 2GEWA 3M12A 3FBSA 1YQ4A 2GAGB 4NEWA 1JRYA 4UDQA 5HHFA 3AE2A 2JBVA 3EPTA 2RGOA 3UTHA 3DK8A 1H81A 3GWDA 3DJDA 4LU6A 4OPLA 3VR8A 4H4SA 2YAUA 1CC6A 4KX6A 1QLBA 1TDFA 2YLZA 3BI5A 3F8RA 3NN0X 3RNMA 4IVOB 3VRDB 4B67A 2Q0LA 3BNUA 4O5QA 3AE6A 2FJBA 3F8DA 4TLXA 1DOEA 1FECA 1FL2A 1PS9A 3UKKA 4ECHA 2F5ZA 1VDCA 4A7AA 4A5LA 3NYFA 4OPDA 1GOSA 1VQWA 2C7GA 4Z26A 1H86A 2YLWA 4YXDA 1L9EA 3CGEA 3D8XA 3V76A 2WBAA 3BI4A 2J3NA 3AE1A 1CJ2A 2C64A 2GB0A 3NNEA 1JRZA 1Q1WA 3GYIA 2WETA 1ELIA 4H4ZA 1VG0A 4CCRA 4EQRA 3UOYA 4Y4LA 3CGBA 4J34A 4AOXA 3NLCA 3EAOA 3KA7A 4A6NA 1IUVA 1JU2A 1JNZA 4RG3A 5CQFA 3P4RA 4TLZA 2BXRA 4Z43A 2WOVA 4OPTA 1LV0A 4UP3A 4UDPA 3GDNA 5JCIA 3VQRA 3CNPA 3WE0A 5U25A 2W0HA 3GMCA 5HXIA 3D1CA 4D04A 4U8MA 1D4CA 2BC1A 2BCPA 1S2QA 3IHMA 1K0IA 4K22A 3UP4A 1TDNA 4EIPA 2XLTA 2R0CA 4CNJA 1PHHA 2X50A 1TYTA 3ICTA 2BABA 1GNDA 4C74A 1BKWA 3BHKA 2YM2A 2BS3A 1CL0A 3S5WA 3GSIA 5FS7A 1OJTA 5EBKA 2ZZCA 5JCNA 2V61A 4YTNA 4XWRA 2ZZ0A 3CN8A 1RP0A 4DNAA 2XLUA 5FMHA 1PBBA 4I58A 2XYOA 2WPEA 4HB9A 2GR0A 1IJHA 1FEAA 1PJ5A 1NHRA 1GREA 4A9WA 1H84A 1GPEA 2GMHA 1E1LA 2ZZBA 2XVFA 1KDGA 2B9XA 3AE3A 1COYA 4GCMA 3UKHA 5BUKA 3GD3A 1M64A 1H7WA 3CPHG 1MO9A 3GRSA 3NYEA 2CVJA 3CGDA 2BXSA 2YG4A 3IF9A 1SEZA 3CIRA 1GTHA 1NEKA 2GH5A 3IWAA 2Y6RA 3AE4A 3II4A 1N4WA 4IA5A 4B68A 3KU9A 2C70A 2E4GA 1XDIA 4MJWA 3GRTA 1ZKQA 1P2EA 2YG5A 3QSMA 4OPCA 4EQSA 5J60A 5JCLA 2Z5YA 1DJNA 3REDA 3UOVA 1PBEA 1ZP0A 5BVAA 4H7UA 1H6VA 5KOXA 3VR9A 3QVPA 4USRA 1IUSA 4YSZA 3HZLA 4J31A 4GDEA 4RG4A 4B64A 2VOUA 1PN0A 2GMJA 1OJAA 5EB5A 1D7YA 3P1WA 3AE8A 1F8RA 3AEBA 1DNCA 5BRTA 1IUXA 3UKPA 3P9UA 1ZDLA 1VRQB 1Y0PA 2XLRA 4H4TA 1EL5A 1KNPA 1OJDA 5LV9A 2JAEA 3NGCX 1L9CA 2GRTA 4BK1A 3M0OA 2R45A 1BWCA 4ICYA 3CNSA 1E39A 2IVEA 1D4EA 1O94A 2FBWA 3UKLA 1M6IA 3UKFA 3NT6A 3AB1A 1KNRA 3NRNA 4XWZA 3UTEA 4X9NA 3UP5A 1YQ3A 4DGKA 4LA1A 1IUUA 4U8PA 2A89A 1IUTA 2X99A 4Z44A 4NEVA 4YSHA 2APGA 4NTDA 3NH3X 2O9ZA 4C3YA 3LB8A 4FK1A 1PXCA 2XFUA 3SM8A 3BI2A 5JCMA 3PS9A 5HY5A 2V3BA 1RYIA 4A99A 3AE5A 1PDHA 1N1PA 2XVEA 1S3EA 4X4JA 2V60A 1E1NA 2B76A 4RSLA 1TYPA 4U8OA 4Z25A 5EB4A 3C4AA 2R0PA 2B7RA 4YSYA 2XFQA 2R9ZA 1ZOYA 4Y4NA 2R46A 3BNMA 4DSHA 4BJZA 3DK9A 4APNA 5DBJA 2GF3A 4JDRA 3CNJA 3AEGA 3OC4A 4H4VA 3H8LA 3K30A 4J56A 2Q0KA 4EMJA 2YVJA 1B4VA 2BK4A 2VVMA
chains in the Genus database with same CATH superfamily
2GR1A 2OLNA 1GESA 1PBFA 2JK6A 2VVLA 1LQUA 2WDVA 2YG6A 3ATRA 3L1RA 2ACZA 2WU2A 2NPXA 3NHOX 2WDQA 4G6HA 1CF3A 3BHFA 2A87A 3ICSA 4XXGA 1E6EA 3DJGX 3AD9B 4K5SA 3LOVA 2XFNA 2XFOA 4CY8A 1IUWA 2YLSA 1GRFA 1K0JA 4H2RA 4G6GA 1KFYA 3R9UA 4CRTA 2X3NA 2XCGA 2C3DA 4GDPA 4D03A 3NIXA 4U8LA 4PAAA 3AEFA 3QSSA 4YT0A 3S61A 1GRTA 1VG9A 4YTPA 2GAHB 2JB1A 4FK1C 1TRBA 1ZOVA 1DXLA 5IQ1A 1UKVG 1E1KA 2V6OA 5KNLA 2B9WA 2BC0A 3HYVA 1REOA 3GD4A 5TR3A 1BZLA 4K8DA 3ICRA 2B7SA 3P4PA 2XFPA 1QO8A 1JNRA 1KSUA 1ZY8A 2BK5A 1TDOA 2C65A 3DH9A 3DGZA 3GDPA 2BS4A 4WX1A 1Y56B 4EMIA 4U2LA 1CBOA 2AAQA 2DKHA 2XLSA 3DGHA 3FIMB 4CY6A 1ZX9A 4AP3A 1EBDA 3AWIA 4J57A 3ISHA 2QAEA 3SGLA 3LXDA 4IVMB 4NZHA 5M10A 5L46A 3EANA 2YLXA 1DOBA 1RSGA 4NWZA 4YWOA 4Y4MA 3SFEA 3UTGA 1PXBA 3NYCA 4FX9A 1CC2A 2V5ZA 3GWFA 1B5QA 2YLRA 3CMMA 2BCGG 4OPGA 1K0LA 3C4NA 3SZCA 1CHUA 4BJYA 3ITJA 2WP9A 3B3RA 1ZMDA 1OJ9A 1GRBA 1NHPA 2WU5A 1O5WA 1NG4A 3AEEA 3IHGA 3LJPA 3CPJG 3LZXA 2AQJA 3PO7A 3AD7B 2WQYA 1GSNA 2YWLA 3B6DA 2WESA 3CTYA 4O5UA 3NK0X 4A79A 3G5QA 3V3OA 1B8SA 3COXA 2NVKX 2V3AA 2X8CA 2UZZA 4CBQA 2RGHA 1YQZA 2PYXA 2GR3A 4CCQA 2C66A 3QFAA 1DOCA 1LTXR 2CFYA 4H4UA 4JY3A 1X31B 2A8XA 2Y6QA 3ALJA 2B9YA 2IIDA 3FG2P 5IQ4A 3ABVA 1H7XA 4BURA 3CPIG 3Q6JA 4EM3A 1K4QA 4EM4A 2YG3A 5JCKA 4H4QA 1H82A 1GRGA 3T37A 2VRLA 5KXJA 3NK2X 4USQA 4JY2A 4U8JA 3FPZA 3LZWA 3DJEA 1NENA 2WOIA 4TM0A 4ZN0A 5C3JA 3ALLA 1CC4A 2VZ2A 2XVIA 3UKAA 4BK2A 1ZMCA 3RHAA 3VRAA 5KMRA 2GR2A 1OJCA 2GV8A 2CDUA 2R4JA 5KMPA 5KMSA 1DODA 2HQMA 1P2HA 3H4KA 4AOSA 3K7QX 4K2XA 4NTCA 2RABA 5KVIA 1BF3A 3QJ4A 3UOZA 4A65A 1W4XA 2H88A 2WPCA 4H4XA 2IVDA 4ADWA 4PABA 2BACA 3L8KA 2FJDA 5KWFA 1E1MA 1GT8A 1GALA 2JB3A 2VRMA 3H8IA 4ZCCA 3UTFA 5FS8A 1B37A 5KOWA 1FEBA 1PBDA 3JSKA 3OZ2A 3T0KA 1Y56A 2YG7A 3AE7A 3UKQA 4ZCDA 1TDEA 1XANA 2C72A 2C73A 1O95A 2Q7VA 2BRAA 3AECA 3O0HA 1LJ1A 3UCLA 1LPFA 3NK1X 4M52A 1NDAA 4YKFA 1LVLA 1S3BA 4TM3A 1V59A 4TM4A 4YTMA 1D4DA 1EL9A 3SX6A 2ZBWA 5ER0A 4J33A 3SFDA 2BYBA 2TPRA 2YLTA 4HA6A 3DA1A 4H4RA 1BGNA 3NN6X 2WDRA 3G5RA 4OVIA 1H83A 3KD9A 3SXIA 4UDRA 2Z5XA 4U8KA 1PJ6A 2WEUA 2WP6A 2EQ7A 2YM1A 3DJJA 4I59A 5CKUA 1TDKA 3AEAA 4TM1A 2YR4A 2WPFA 4AT0A 1D7LA 3URHA 2XDOA 4II3A 4H2QA 4JQ9A 4KPRA 4C3XA 1CJ3A 3ZDNA 3ADAB 3I6DA 1S2YA 2C4CA 5KVHA 1QJDA 3EF6A 3KPFA 4C5OA 4GUVA 1NHSA 3M13A 5GRTA 4B69A 1PJ7A 3IC9A 3RP7A 4BV6A 4Z2RA 4Z2TA 5GSNA 2QCUA 4JNAA 3DMEA 4B66A 1L0VA 3DK4A 1GETA 3QVRA 2TMDA 3NTAA 4GRTA 1MXTA 4OPIA 3E1TA 4U8NA 5FS6A 4Z24A 4C77A 4LIIA 5FS9A 3UOXA 1D5TA 1XHCA 3T2KA 5EOWA 2E5VA 4H4WA 1E7PA 3CNDA 1KSSA 2I0ZA 1GTEA 3F8PA 4DSGA 3AE9A 3AEDA 3P4SA 2OALA 2X8GA 4CNKA 1Q1RA 3AYJA 3G5SA 1ZK7A 1BGJA 1N4UA 2YR6A 3CGCA 1YKJA 4BK3A 4OPUA 1PBCA 3GYJA 3KLJA 2PHHA 4N9XA 1GERA 5BULA 1NHQA 4FDCB 3FMWA 2WP5A 3NKSA 3ATQA 4NTEA 2X8HA 2WS3A 1GV4A 3AD8B 2R0GA 2EQ9A 3KKJA 1KF6A 1Z6LA 3NTDA 4EQWA 4AT2A 2JKCA 1FCDA 4H50A 3RP8A 1CJ4A 1GEUA 2VQ7A 4B63A 1F8WA 1F8SA 3SQPA 1N4VA 1XPQA 4B1BA 1ONFA 3AYIA 2EQ6A 5U1OA 1NG3A 3P4QA 4K5RA 3ZYXA 1NAAA 3AYLA 3C96A 2FJAA 2H89A 3VRBA 4EQXA 2WOWA 4G74A 2C3CA 1GRAA 5KRQA 1GRHA 4OCGA 1EL8A 3NG7X 5IPYA 1JOAA 4AP1A 2CULA 3T2YA 2BA9A 2JB2A 2VVLG 3HYWA 3QFBA 4EIQA 1FOHA 2EQ8A 2RGJA 2QA1A 4WCTA 4EMWA 3LADA 2BS2A 3RP6A 2YQUA 2XVHA 1L9DA 2GVCA 3ALMA 4GF7A 2WHDA 3K7MX 2C76A 2C75A 4GR1A 4J36A 4JN9A 5KMQA 3SZWA 2YVGA 4K7ZA 2QA2A 1LQTA 4H2NA 2ARDA 5U63A 1AOGA 2Q6UA 1JRXA 4Z2UA 1JEHA 3K7TA 3KVEA 1F3PA 2GQWA 1GXFA 4JNQA 4REKA 2VQBA 1PXAA 1DJQA 2OA1A 4H4YA 2E1MA 4E0VA 2OAMA 3GMBA 1Q9IA 4YKGA 5HYMA 2AR8A 4J2WA 4YSXA 1HYUA 2R4EA 3V3NA 1NPXA 4H2PA 4A6NB 1F6MA 5J7XA 2OLOA 3I3LA 4IV9A 4P9SA 1YY5A 2YVFA 2C67A 3CNTA 3PVCA 4X9MA 3Q9TA 4U8IA 4U2TA 2XLPA 2YR5A 4IA6A 2FJEA 2XVJA 5M0ZA 5C2TA 2DKIA 1MOKA 1CJCA 1EL7A 2BK3A 3AXBA 4B65A 4U2SA 4H4PA 3QSEA 2GQFA 2GEWA 3M12A 3FBSA 1YQ4A 2GAGB 4NEWA 1JRYA 4UDQA 5HHFA 3AE2A 4G73A 2JBVA 3EPTA 2RGOA 3UTHA 3DK8A 1H81A 3GWDA 3DJDA 4LU6A 4OPLA 3VR8A 4H4SA 2YAUA 1CC6A 4KX6A 4NNJA 1QLBA 1TDFA 2YLZA 3BI5A 3F8RA 3NN0X 3RNMA 4IVOB 3VRDB 4B67A 2Q0LA 3BNUA 4O5QA 3AE6A 2FJBA 3F8DA 4TLXA 1DOEA 1FECA 1FL2A 1PS9A 3UKKA 4ECHA 2F5ZA 1VDCA 4A7AA 4A5LA 3NYFA 4OPDA 1GOSA 1VQWA 2C7GA 4Z26A 1H86A 2YLWA 4YXDA 1L9EA 3CGEA 3D8XA 3V76A 2WBAA 3BI4A 2J3NA 3AE1A 1CJ2A 2C64A 2GB0A 3SY4A 3NNEA 1JRZA 1Q1WA 3GYIA 2WETA 1ELIA 4H4ZA 1VG0A 4II2A 4CCRA 4EQRA 3UOYA 4Y4LA 3CGBA 4J34A 4AOXA 3NLCA 3EAOA 3KA7A 4A6NA 1IUVA 1JU2A 1JNZA 4RG3A 5CQFA 3P4RA 4TLZA 2BXRA 4Z43A 2WOVA 4OPTA 1LV0A 4UP3A 4UDPA 3GDNA 5JCIA 3VQRA 3CNPA 3WE0A 5U25A 2W0HA 3GMCA 5HXIA 3D1CA 4D04A 4U8MA 1D4CA 2BC1A 2BCPA 1S2QA 3IHMA 1K0IA 4K22A 3UP4A 1TDNA 4EIPA 2XLTA 2R0CA 4CNJA 1PHHA 2X50A 1TYTA 3ICTA 2BABA 1GNDA 4C74A 1BKWA 3SZFA 3BHKA 2YM2A 2BS3A 1CL0A 3S5WA 3GSIA 5FS7A 1OJTA 5EBKA 2ZZCA 5JCNA 2V61A 4YTNA 4XWRA 2ZZ0A 4G9KA 3CN8A 1RP0A 4DNAA 2XLUA 5FMHA 1PBBA 4I58A 2XYOA 2WPEA 4GAVA 4HB9A 2GR0A 1IJHA 1FEAA 1PJ5A 1NHRA 1GREA 4A9WA 1H84A 1GPEA 2GMHA 1E1LA 2ZZBA 2XVFA 1KDGA 2B9XA 3AE3A 1COYA 4GCMA 3UKHA 5BUKA 3GD3A 1M64A 1H7WA 3CPHG 1MO9A 3GRSA 3NYEA 2CVJA 3CGDA 2BXSA 2YG4A 3IF9A 1SEZA 3CIRA 1GTHA 1NEKA 2GH5A 3IWAA 2Y6RA 3AE4A 3II4A 1N4WA 4IA5A 4B68A 3KU9A 2C70A 2E4GA 1XDIA 4MJWA 3HYXA 3GRTA 1ZKQA 1P2EA 2YG5A 3QSMA 4OPCA 3SZ0A 4EQSA 5J60A 2Z5YA 1DJNA 3REDA 3UOVA 1PBEA 5JCLA 1ZP0A 5BVAA 4H7UA 1H6VA 5KOXA 3VR9A 2BRYA 3QVPA 4USRA 1IUSA 4YSZA 3HZLA 4J31A 4GDEA 4RG4A 3KPKA 4B64A 2VOUA 1PN0A 2GMJA 1OJAA 5EB5A 1D7YA 3P1WA 3AE8A 1F8RA 3AEBA 1DNCA 3GYXA 5BRTA 1IUXA 3UKPA 3P9UA 1ZDLA 1VRQB 1Y0PA 2XLRA 4H4TA 1EL5A 1KNPA 1OJDA 5LV9A 2JAEA 3NGCX 1L9CA 2GRTA 4BK1A 3M0OA 2R45A 1BWCA 4ICYA 3T2ZA 3CNSA 1E39A 2IVEA 1D4EA 1O94A 2FBWA 3T14A 3UKLA 1M6IA 3UKFA 3NT6A 3AB1A 1KNRA 3NRNA 4XWZA 3UTEA 4X9NA 3UP5A 1YQ3A 4DGKA 4LA1A 1IUUA 4U8PA 2A89A 1IUTA 2X99A 4Z44A 4NEVA 3T31A 4YSHA 2APGA 4NTDA 3NH3X 2O9ZA 4C3YA 3LB8A 4FK1A 1PXCA 2XFUA 3SM8A 3BI2A 5JCMA 3PS9A 5HY5A 2V3BA 4GAPA 1RYIA 4A99A 3AE5A 1PDHA 1N1PA 2XVEA 1S3EA 4X4JA 2V60A 1E1NA 2B76A 4RSLA 1TYPA 4U8OA 4Z25A 5EB4A 3C4AA 2R0PA 2B7RA 4YSYA 2XFQA 2R9ZA 1ZOYA 4Y4NA 2R46A 3BNMA 4DSHA 4BJZA 3DK9A 4APNA 5DBJA 3SYIA 2GF3A 4JDRA 3CNJA 3AEGA 3OC4A 4H4VA 3H8LA 3K30A 4J56A 2Q0KA 4EMJA 2YVJA 1B4VA 2BK4A 2VVMA
chains in the Genus database with same CATH topology
2GR1A 2OLNA 1GESA 1PBFA 2JK6A 2VVLA 1LQUA 2WDVA 2YG6A 3ATRA 3L1RA 2ACZA 2WU2A 2NPXA 3NHOX 2WDQA 4G6HA 1CF3A 3BHFA 2A87A 3ICSA 4XXGA 1E6EA 3DJGX 3AD9B 4K5SA 3LOVA 2XFNA 2XFOA 4CY8A 1IUWA 2YLSA 1GRFA 1K0JA 4H2RA 4G6GA 1KFYA 3R9UA 4CRTA 2X3NA 2XCGA 2C3DA 4GDPA 4D03A 3NIXA 4U8LA 4PAAA 3AEFA 3QSSA 4YT0A 3S61A 1GRTA 1VG9A 4YTPA 2GAHB 2JB1A 4FK1C 1TRBA 1ZOVA 1DXLA 5IQ1A 1UKVG 1E1KA 2V6OA 5KNLA 2B9WA 2BC0A 3HYVA 1REOA 3GD4A 5TR3A 1BZLA 4K8DA 3ICRA 2B7SA 3P4PA 2XFPA 1QO8A 1JNRA 1KSUA 1ZY8A 2BK5A 1TDOA 2C65A 3DH9A 3DGZA 3GDPA 2BS4A 4WX1A 1Y56B 4EMIA 4U2LA 1CBOA 2AAQA 2DKHA 2XLSA 3DGHA 3FIMB 4CY6A 1ZX9A 4AP3A 1EBDA 3AWIA 4J57A 3ISHA 2QAEA 3SGLA 3LXDA 4IVMB 4NZHA 5M10A 5L46A 3EANA 2YLXA 1DOBA 1RSGA 4NWZA 4YWOA 4Y4MA 3SFEA 3UTGA 1PXBA 3NYCA 4FX9A 1CC2A 2V5ZA 3GWFA 1B5QA 2YLRA 3CMMA 2BCGG 4OPGA 1K0LA 3C4NA 3SZCA 1CHUA 4BJYA 3ITJA 2WP9A 3B3RA 1ZMDA 1OJ9A 1GRBA 1NHPA 2WU5A 1O5WA 1NG4A 3AEEA 3IHGA 3LJPA 3CPJG 3LZXA 2AQJA 3PO7A 3AD7B 2WQYA 1GSNA 2YWLA 3B6DA 2WESA 3CTYA 4O5UA 3NK0X 4A79A 3G5QA 3V3OA 1B8SA 3COXA 2NVKX 2V3AA 2X8CA 2UZZA 4CBQA 2RGHA 1YQZA 2PYXA 2GR3A 4CCQA 2C66A 3QFAA 1DOCA 1LTXR 2CFYA 4H4UA 4JY3A 1X31B 2A8XA 2Y6QA 3ALJA 2B9YA 2IIDA 3FG2P 5IQ4A 3ABVA 1H7XA 4BURA 3CPIG 3Q6JA 4EM3A 1K4QA 4EM4A 2YG3A 5JCKA 4H4QA 1H82A 1GRGA 3T37A 2VRLA 5KXJA 3NK2X 4USQA 4JY2A 4U8JA 3FPZA 3LZWA 3DJEA 1NENA 2WOIA 4TM0A 4ZN0A 5C3JA 3ALLA 1CC4A 2VZ2A 2XVIA 3UKAA 4BK2A 1ZMCA 3RHAA 3VRAA 5KMRA 2GR2A 1OJCA 2GV8A 2CDUA 2R4JA 5KMPA 5KMSA 1DODA 2HQMA 1P2HA 3H4KA 4AOSA 3K7QX 4K2XA 4NTCA 2RABA 5KVIA 1BF3A 3QJ4A 3UOZA 4A65A 1W4XA 2H88A 2WPCA 4H4XA 2IVDA 4ADWA 4PABA 2BACA 3L8KA 2FJDA 5KWFA 1E1MA 1GT8A 1GALA 2JB3A 2VRMA 3H8IA 4ZCCA 3UTFA 5FS8A 1B37A 5KOWA 1FEBA 1PBDA 3JSKA 3OZ2A 3T0KA 1Y56A 2YG7A 3AE7A 3UKQA 4ZCDA 1TDEA 1XANA 2C72A 2C73A 1O95A 2Q7VA 2BRAA 3AECA 3O0HA 1LJ1A 3UCLA 1LPFA 3NK1X 4M52A 1NDAA 4YKFA 1LVLA 1S3BA 4TM3A 1V59A 4TM4A 4YTMA 1D4DA 1EL9A 3SX6A 2ZBWA 5ER0A 4J33A 3SFDA 2BYBA 2TPRA 2YLTA 4HA6A 3DA1A 4H4RA 1BGNA 3NN6X 2WDRA 3G5RA 4OVIA 1H83A 3KD9A 3SXIA 4UDRA 2Z5XA 4U8KA 1PJ6A 2WEUA 2WP6A 2EQ7A 2YM1A 3DJJA 4I59A 5CKUA 1TDKA 3AEAA 4TM1A 2YR4A 2WPFA 4AT0A 1D7LA 3URHA 2XDOA 4II3A 4H2QA 4JQ9A 4KPRA 4C3XA 1CJ3A 3ZDNA 3ADAB 3I6DA 1S2YA 2C4CA 5KVHA 1QJDA 3EF6A 3KPFA 4C5OA 4GUVA 1NHSA 3M13A 5GRTA 4B69A 1PJ7A 3IC9A 3RP7A 4BV6A 4Z2RA 4Z2TA 5GSNA 2QCUA 4JNAA 3DMEA 4B66A 1L0VA 3DK4A 1GETA 3QVRA 2TMDA 3NTAA 4GRTA 1MXTA 4OPIA 3E1TA 4U8NA 5FS6A 4Z24A 4C77A 4LIIA 5FS9A 3UOXA 1D5TA 1XHCA 3T2KA 5EOWA 2E5VA 4H4WA 1E7PA 3CNDA 1KSSA 2I0ZA 1GTEA 3F8PA 4DSGA 3AE9A 3AEDA 3P4SA 2OALA 2X8GA 4CNKA 1Q1RA 3AYJA 3G5SA 1ZK7A 1BGJA 1N4UA 2YR6A 3CGCA 1YKJA 4BK3A 4OPUA 1PBCA 3GYJA 3KLJA 2PHHA 4N9XA 1GERA 5BULA 1NHQA 4FDCB 3FMWA 2WP5A 3NKSA 3ATQA 4NTEA 2X8HA 2WS3A 1GV4A 3AD8B 2R0GA 2EQ9A 3KKJA 1KF6A 1Z6LA 3NTDA 4EQWA 4AT2A 2JKCA 1FCDA 4H50A 3RP8A 1CJ4A 1GEUA 2VQ7A 4B63A 1F8WA 1F8SA 3SQPA 1N4VA 1XPQA 4B1BA 1ONFA 3AYIA 2EQ6A 5U1OA 1NG3A 3P4QA 4K5RA 3ZYXA 1NAAA 3AYLA 3C96A 2FJAA 2H89A 3VRBA 4EQXA 2WOWA 4G74A 2C3CA 1GRAA 5KRQA 1GRHA 4OCGA 1EL8A 3NG7X 5IPYA 1JOAA 4AP1A 2CULA 3T2YA 2BA9A 2JB2A 2VVLG 3HYWA 3QFBA 4EIQA 1FOHA 2EQ8A 2RGJA 2QA1A 4WCTA 4EMWA 3LADA 2BS2A 3RP6A 2YQUA 2XVHA 1L9DA 2GVCA 3ALMA 4GF7A 2WHDA 3K7MX 2C76A 2C75A 4GR1A 4J36A 4JN9A 5KMQA 3SZWA 2YVGA 4K7ZA 2QA2A 1LQTA 4H2NA 2ARDA 5U63A 1AOGA 2Q6UA 1JRXA 4Z2UA 1JEHA 3K7TA 3KVEA 1F3PA 2GQWA 1GXFA 4JNQA 4REKA 2VQBA 1PXAA 1DJQA 2OA1A 4H4YA 2E1MA 4E0VA 2OAMA 3GMBA 1Q9IA 4YKGA 5HYMA 2AR8A 4J2WA 4YSXA 1HYUA 2R4EA 3V3NA 1NPXA 4H2PA 4A6NB 1F6MA 5J7XA 2OLOA 3I3LA 4IV9A 4P9SA 1YY5A 2YVFA 2C67A 3CNTA 3PVCA 4X9MA 3Q9TA 4U8IA 4U2TA 2XLPA 2YR5A 4IA6A 2FJEA 2XVJA 5M0ZA 5C2TA 2DKIA 1MOKA 1CJCA 1EL7A 2BK3A 3AXBA 4B65A 4U2SA 4H4PA 3QSEA 2GQFA 2GEWA 3M12A 3FBSA 1YQ4A 2GAGB 4NEWA 1JRYA 4UDQA 5HHFA 3AE2A 4G73A 2JBVA 3EPTA 2RGOA 3UTHA 3DK8A 1H81A 3GWDA 3DJDA 4LU6A 4OPLA 3VR8A 4H4SA 2YAUA 1CC6A 4KX6A 4NNJA 1QLBA 1TDFA 2YLZA 3BI5A 3F8RA 3NN0X 3RNMA 4IVOB 3VRDB 4B67A 2Q0LA 3BNUA 4O5QA 3AE6A 2FJBA 3F8DA 4TLXA 1DOEA 1FECA 1FL2A 1PS9A 3UKKA 4ECHA 2F5ZA 1VDCA 4A7AA 4A5LA 3NYFA 4OPDA 1GOSA 1VQWA 2C7GA 4Z26A 1H86A 2YLWA 4YXDA 1L9EA 3CGEA 3D8XA 3V76A 2WBAA 3BI4A 2J3NA 3AE1A 1CJ2A 2C64A 2GB0A 3SY4A 3NNEA 1JRZA 1Q1WA 3GYIA 2WETA 1ELIA 4H4ZA 1VG0A 4II2A 4CCRA 4EQRA 3UOYA 4Y4LA 3CGBA 4J34A 4AOXA 3NLCA 3EAOA 3KA7A 4A6NA 1IUVA 1JU2A 1JNZA 4RG3A 5CQFA 3P4RA 4TLZA 2BXRA 4Z43A 2WOVA 4OPTA 1LV0A 4UP3A 4UDPA 3GDNA 5JCIA 3VQRA 3CNPA 3WE0A 5U25A 2W0HA 3GMCA 5HXIA 3D1CA 4D04A 4U8MA 1D4CA 2BC1A 2BCPA 1S2QA 3IHMA 1K0IA 4K22A 3UP4A 1TDNA 4EIPA 2XLTA 2R0CA 4CNJA 1PHHA 2X50A 1TYTA 3ICTA 2BABA 1GNDA 4C74A 1BKWA 3SZFA 3BHKA 2YM2A 2BS3A 1CL0A 3S5WA 3GSIA 5FS7A 1OJTA 5EBKA 2ZZCA 5JCNA 2V61A 4YTNA 4XWRA 2ZZ0A 4G9KA 3CN8A 1RP0A 4DNAA 2XLUA 5FMHA 1PBBA 4I58A 2XYOA 2WPEA 4GAVA 4HB9A 2GR0A 1IJHA 1FEAA 1PJ5A 1NHRA 1GREA 4A9WA 1H84A 1GPEA 2GMHA 1E1LA 2ZZBA 2XVFA 1KDGA 2B9XA 3AE3A 1COYA 4GCMA 3UKHA 5BUKA 3GD3A 1M64A 1H7WA 3CPHG 1MO9A 3GRSA 3NYEA 2CVJA 3CGDA 2BXSA 2YG4A 3IF9A 1SEZA 3CIRA 1GTHA 1NEKA 2GH5A 3IWAA 2Y6RA 3AE4A 3II4A 1N4WA 4IA5A 4B68A 3KU9A 2C70A 2E4GA 1XDIA 4MJWA 3HYXA 3GRTA 1ZKQA 1P2EA 2YG5A 3QSMA 4OPCA 3SZ0A 4EQSA 5J60A 2Z5YA 1DJNA 3REDA 3UOVA 1PBEA 5JCLA 1ZP0A 5BVAA 4H7UA 1H6VA 5KOXA 3VR9A 2BRYA 3QVPA 4USRA 1IUSA 4YSZA 3HZLA 4J31A 4GDEA 4RG4A 3KPKA 4B64A 2VOUA 1PN0A 2GMJA 1OJAA 5EB5A 1D7YA 3P1WA 3AE8A 1F8RA 3AEBA 1DNCA 3GYXA 5BRTA 1IUXA 3UKPA 3P9UA 1ZDLA 1VRQB 1Y0PA 2XLRA 4H4TA 1EL5A 1KNPA 1OJDA 5LV9A 2JAEA 3NGCX 1L9CA 2GRTA 4BK1A 3M0OA 2R45A 1BWCA 4ICYA 3T2ZA 3CNSA 1E39A 2IVEA 1D4EA 1O94A 2FBWA 3T14A 3UKLA 1M6IA 3UKFA 3NT6A 3AB1A 1KNRA 3NRNA 4XWZA 3UTEA 4X9NA 3UP5A 1YQ3A 4DGKA 4LA1A 1IUUA 4U8PA 2A89A 1IUTA 2X99A 4Z44A 4NEVA 3T31A 4YSHA 2APGA 4NTDA 3NH3X 2O9ZA 4C3YA 3LB8A 4FK1A 1PXCA 2XFUA 3SM8A 3BI2A 5JCMA 3PS9A 5HY5A 2V3BA 4GAPA 1RYIA 4A99A 3AE5A 1PDHA 1N1PA 2XVEA 1S3EA 4X4JA 2V60A 1E1NA 2B76A 4RSLA 1TYPA 4U8OA 4Z25A 5EB4A 3C4AA 2R0PA 2B7RA 4YSYA 2XFQA 2R9ZA 1ZOYA 4Y4NA 2R46A 3BNMA 4DSHA 4BJZA 3DK9A 4APNA 5DBJA 3SYIA 2GF3A 4JDRA 3CNJA 3AEGA 3OC4A 4H4VA 3H8LA 3K30A 4J56A 2Q0KA 4EMJA 2YVJA 1B4VA 2BK4A 2VVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR1 A;  2OLN A;  1GES A;  1PBF A;  2JK6 A;  2VVL A;  1LQU A;  2WDV A;  2YG6 A;  3ATR A;  3L1R A;  2ACZ A;  2WU2 A;  2NPX A;  3NHO X;  2WDQ A;  1CF3 A;  3BHF A;  2A87 A;  3ICS A;  4XXG A;  1E6E A;  3DJG X;  3AD9 B;  4K5S A;  3LOV A;  2XFN A;  2XFO A;  4CY8 A;  1IUW A;  2YLS A;  1GRF A;  1K0J A;  4H2R A;  4CRT A;  1KFY A;  3R9U A;  2X3N A;  2XCG A;  2C3D A;  4GDP A;  4D03 A;  3NIX A;  4U8L A;  4PAA A;  3AEF A;  3QSS A;  4YT0 A;  3S61 A;  1GRT A;  1VG9 A;  4YTP A;  2GAH B;  2JB1 A;  4FK1 C;  1TRB A;  1ZOV A;  1DXL A;  5IQ1 A;  1UKV G;  1E1K A;  2V6O A;  2B9W A;  2BC0 A;  5TR3 A;  1REO A;  3GD4 A;  1BZL A;  4K8D A;  3ICR A;  2B7S A;  3P4P A;  2XFP A;  1QO8 A;  1JNR A;  1KSU A;  1ZY8 A;  2BK5 A;  1TDO A;  2C65 A;  3DH9 A;  3DGZ A;  3GDP A;  2BS4 A;  4WX1 A;  1Y56 B;  4EMI A;  4U2L A;  1CBO A;  2AAQ A;  2DKH A;  2XLS A;  3DGH A;  3FIM B;  4CY6 A;  1ZX9 A;  4AP3 A;  1EBD A;  3AWI A;  4J57 A;  3ISH A;  2QAE A;  3SGL A;  3LXD A;  4IVM B;  4NZH A;  5M10 A;  5L46 A;  3EAN A;  2YLX A;  1DOB A;  1RSG A;  4YWO A;  4Y4M A;  3SFE A;  3UTG A;  1PXB A;  3NYC A;  4FX9 A;  1CC2 A;  2V5Z A;  3GWF A;  1B5Q A;  2YLR A;  2BCG G;  4OPG A;  1K0L A;  3C4N A;  4BJY A;  1CHU A;  3ITJ A;  2WP9 A;  3B3R A;  1ZMD A;  1OJ9 A;  1GRB A;  1NHP A;  2WU5 A;  1O5W A;  1NG4 A;  3AEE A;  3IHG A;  3LJP A;  3CPJ G;  3LZX A;  2AQJ A;  3PO7 A;  3AD7 B;  2WQY A;  1GSN A;  2YWL A;  3B6D A;  2WES A;  3CTY A;  4O5U A;  3NK0 X;  4A79 A;  3G5Q A;  3V3O A;  1B8S A;  3COX A;  2NVK X;  2V3A A;  2X8C A;  2UZZ A;  4CBQ A;  2RGH A;  1YQZ A;  2PYX A;  2GR3 A;  4CCQ A;  2C66 A;  3QFA A;  1DOC A;  1LTX R;  2CFY A;  4H4U A;  4JY3 A;  1X31 B;  2A8X A;  2Y6Q A;  3ALJ A;  2B9Y A;  2IID A;  3FG2 P;  5IQ4 A;  3ABV A;  1H7X A;  4BUR A;  3CPI G;  3Q6J A;  4EM3 A;  1K4Q A;  4EM4 A;  2YG3 A;  5JCK A;  4H4Q A;  1H82 A;  1GRG A;  3T37 A;  2VRL A;  5KXJ A;  3NK2 X;  4USQ A;  4JY2 A;  4U8J A;  3FPZ A;  3LZW A;  3DJE A;  1NEN A;  2WOI A;  4TM0 A;  4ZN0 A;  5C3J A;  3ALL A;  1CC4 A;  2VZ2 A;  2XVI A;  3UKA A;  4BK2 A;  1ZMC A;  3RHA A;  3VRA A;  2GR2 A;  1OJC A;  2GV8 A;  2CDU A;  2R4J A;  1DOD A;  2HQM A;  1P2H A;  3H4K A;  4AOS A;  3K7Q X;  4K2X A;  4NTC A;  2RAB A;  5KVI A;  1BF3 A;  3QJ4 A;  3UOZ A;  4A65 A;  1W4X A;  2H88 A;  2WPC A;  4H4X A;  2IVD A;  4ADW A;  4PAB A;  2BAC A;  3L8K A;  2FJD A;  5KWF A;  1E1M A;  1GT8 A;  1GAL A;  2JB3 A;  2VRM A;  3H8I A;  4ZCC A;  3UTF A;  5FS8 A;  1B37 A;  5KOW A;  1FEB A;  1PBD A;  3JSK A;  3OZ2 A;  1Y56 A;  2YG7 A;  3AE7 A;  3UKQ A;  4ZCD A;  1TDE A;  1XAN A;  2C72 A;  2C73 A;  1O95 A;  2Q7V A;  3AEC A;  3O0H A;  3UCL A;  1LJ1 A;  1LPF A;  3NK1 X;  4M52 A;  1NDA A;  4YKF A;  1LVL A;  1S3B A;  4TM3 A;  1V59 A;  4TM4 A;  4YTM A;  1D4D A;  1EL9 A;  2ZBW A;  5ER0 A;  4J33 A;  3SFD A;  2BYB A;  2TPR A;  2YLT A;  4HA6 A;  3DA1 A;  4H4R A;  1BGN A;  3NN6 X;  2WDR A;  3G5R A;  4OVI A;  1H83 A;  3KD9 A;  4UDR A;  2Z5X A;  4U8K A;  1PJ6 A;  2WEU A;  2WP6 A;  2EQ7 A;  2YM1 A;  3DJJ A;  4I59 A;  5CKU A;  1TDK A;  3AEA A;  4TM1 A;  2YR4 A;  2WPF A;  4AT0 A;  1D7L A;  3URH A;  2XDO A;  4H2Q A;  4JQ9 A;  4KPR A;  4C3X A;  1CJ3 A;  3ZDN A;  3ADA B;  3I6D A;  1S2Y A;  5KVH A;  1QJD A;  3EF6 A;  3KPF A;  4C5O A;  4GUV A;  1NHS A;  3M13 A;  5GRT A;  4B69 A;  1PJ7 A;  3IC9 A;  3RP7 A;  4BV6 A;  4Z2R A;  4Z2T A;  5GSN A;  2QCU A;  4JNA A;  3DME A;  4B66 A;  1L0V A;  3DK4 A;  1GET A;  3QVR A;  2TMD A;  3NTA A;  4GRT A;  1MXT A;  4OPI A;  3E1T A;  4U8N A;  5FS6 A;  4Z24 A;  4C77 A;  4LII A;  5FS9 A;  3UOX A;  1D5T A;  1XHC A;  5EOW A;  2E5V A;  4H4W A;  1E7P A;  3CND A;  1KSS A;  2I0Z A;  1GTE A;  3F8P A;  4DSG A;  3AE9 A;  3AED A;  3P4S A;  2OAL A;  2X8G A;  4CNK A;  1Q1R A;  3AYJ A;  3G5S A;  1ZK7 A;  1BGJ A;  1N4U A;  2YR6 A;  3CGC A;  1YKJ A;  4BK3 A;  4OPU A;  1PBC A;  3GYJ A;  3KLJ A;  2PHH A;  4N9X A;  1GER A;  5BUL A;  1NHQ A;  4FDC B;  3FMW A;  2WP5 A;  3NKS A;  3ATQ A;  4NTE A;  2X8H A;  2WS3 A;  1GV4 A;  3AD8 B;  2R0G A;  2EQ9 A;  3KKJ A;  1KF6 A;  1Z6L A;  3NTD A;  4EQW A;  4AT2 A;  2JKC A;  1FCD A;  4H50 A;  3RP8 A;  1CJ4 A;  1GEU A;  2VQ7 A;  4B63 A;  1F8W A;  1F8S A;  3SQP A;  1N4V A;  1XPQ A;  4B1B A;  1ONF A;  3AYI A;  2EQ6 A;  5U1O A;  1NG3 A;  3P4Q A;  4K5R A;  3ZYX A;  1NAA A;  3AYL A;  3C96 A;  2FJA A;  2H89 A;  3VRB A;  4EQX A;  2WOW A;  2C3C A;  1GRA A;  5KRQ A;  1GRH A;  4OCG A;  1EL8 A;  3NG7 X;  5IPY A;  1JOA A;  4AP1 A;  2CUL A;  2BA9 A;  2JB2 A;  2VVL G;  3QFB A;  4EIQ A;  1FOH A;  2EQ8 A;  2RGJ A;  2QA1 A;  4WCT A;  4EMW A;  3LAD A;  2BS2 A;  3RP6 A;  2YQU A;  2XVH A;  1L9D A;  2GVC A;  3ALM A;  4GF7 A;  2WHD A;  3K7M X;  2C76 A;  2C75 A;  4GR1 A;  4J36 A;  4JN9 A;  2YVG A;  4K7Z A;  2QA2 A;  1LQT A;  4H2N A;  2ARD A;  5U63 A;  1AOG A;  2Q6U A;  1JRX A;  4Z2U A;  1JEH A;  3K7T A;  3KVE A;  1F3P A;  2GQW A;  1GXF A;  4JNQ A;  4REK A;  2VQB A;  1PXA A;  1DJQ A;  2OA1 A;  4H4Y A;  2E1M A;  4E0V A;  2OAM A;  3GMB A;  1Q9I A;  4YKG A;  5HYM A;  2AR8 A;  4J2W A;  4YSX A;  1HYU A;  2R4E A;  3V3N A;  1NPX A;  4H2P A;  4A6N B;  1F6M A;  5J7X A;  2OLO A;  3I3L A;  4IV9 A;  4P9S A;  1YY5 A;  2YVF A;  2C67 A;  3CNT A;  3PVC A;  4X9M A;  3Q9T A;  4U8I A;  4U2T A;  2XLP A;  2YR5 A;  4IA6 A;  2FJE A;  2XVJ A;  5M0Z A;  5C2T A;  2DKI A;  1MOK A;  1CJC A;  1EL7 A;  2BK3 A;  3AXB A;  4B65 A;  4U2S A;  4H4P A;  3QSE A;  2GQF A;  2GEW A;  3M12 A;  3FBS A;  1YQ4 A;  2GAG B;  4NEW A;  1JRY A;  4UDQ A;  5HHF A;  3AE2 A;  2JBV A;  3EPT A;  2RGO A;  3UTH A;  3DK8 A;  1H81 A;  3GWD A;  3DJD A;  4LU6 A;  4OPL A;  3VR8 A;  4H4S A;  2YAU A;  1CC6 A;  4KX6 A;  1QLB A;  1TDF A;  2YLZ A;  3BI5 A;  3F8R A;  3NN0 X;  3RNM A;  4IVO B;  3VRD B;  4B67 A;  2Q0L A;  3BNU A;  4O5Q A;  3AE6 A;  2FJB A;  3F8D A;  4TLX A;  1DOE A;  1FEC A;  1FL2 A;  1PS9 A;  3UKK A;  4ECH A;  2F5Z A;  1VDC A;  4A7A A;  4A5L A;  3NYF A;  4OPD A;  1GOS A;  1VQW A;  2C7G A;  4Z26 A;  1H86 A;  2YLW A;  4YXD A;  1L9E A;  3CGE A;  3D8X A;  3V76 A;  2WBA A;  3BI4 A;  2J3N A;  3AE1 A;  1CJ2 A;  2C64 A;  2GB0 A;  3NNE A;  1JRZ A;  1Q1W A;  3GYI A;  2WET A;  1ELI A;  4H4Z A;  1VG0 A;  4CCR A;  4EQR A;  3UOY A;  4Y4L A;  3CGB A;  4J34 A;  4AOX A;  3NLC A;  3EAO A;  3KA7 A;  4A6N A;  1IUV A;  1JU2 A;  1JNZ A;  4RG3 A;  5CQF A;  3P4R A;  4TLZ A;  2BXR A;  4Z43 A;  2WOV A;  4OPT A;  1LV0 A;  4UP3 A;  4UDP A;  3GDN A;  5JCI A;  3VQR A;  3CNP A;  3WE0 A;  5U25 A;  2W0H A;  3GMC A;  5HXI A;  3D1C A;  4D04 A;  4U8M A;  1D4C A;  2BC1 A;  2BCP A;  1S2Q A;  3IHM A;  1K0I A;  4K22 A;  3UP4 A;  1TDN A;  4EIP A;  2XLT A;  2R0C A;  4CNJ A;  1PHH A;  2X50 A;  1TYT A;  3ICT A;  2BAB A;  1GND A;  4C74 A;  1BKW A;  3BHK A;  2YM2 A;  2BS3 A;  1CL0 A;  3S5W A;  3GSI A;  5FS7 A;  1OJT A;  5EBK A;  2ZZC A;  5JCN A;  2V61 A;  4YTN A;  4XWR A;  2ZZ0 A;  3CN8 A;  1RP0 A;  4DNA A;  2XLU A;  5FMH A;  1PBB A;  4I58 A;  2XYO A;  2WPE A;  4HB9 A;  2GR0 A;  1IJH A;  1FEA A;  1PJ5 A;  1NHR A;  1GRE A;  4A9W A;  1H84 A;  1GPE A;  2GMH A;  1E1L A;  2ZZB A;  2XVF A;  1KDG A;  2B9X A;  3AE3 A;  1COY A;  4GCM A;  3UKH A;  5BUK A;  3GD3 A;  1M64 A;  1H7W A;  3CPH G;  1MO9 A;  3GRS A;  3NYE A;  2CVJ A;  3CGD A;  2BXS A;  2YG4 A;  3IF9 A;  1SEZ A;  3CIR A;  1GTH A;  1NEK A;  2GH5 A;  3IWA A;  2Y6R A;  3AE4 A;  3II4 A;  1N4W A;  4IA5 A;  4B68 A;  3KU9 A;  2C70 A;  2E4G A;  1XDI A;  4MJW A;  3GRT A;  1ZKQ A;  1P2E A;  2YG5 A;  3QSM A;  4OPC A;  4EQS A;  5J60 A;  5JCL A;  2Z5Y A;  1DJN A;  3RED A;  3UOV A;  1PBE A;  1ZP0 A;  5BVA A;  4H7U A;  1H6V A;  5KOX A;  3VR9 A;  3QVP A;  4USR A;  1IUS A;  4YSZ A;  3HZL A;  4J31 A;  4GDE A;  4RG4 A;  4B64 A;  2VOU A;  1PN0 A;  2GMJ A;  1OJA A;  5EB5 A;  1D7Y A;  3P1W A;  3AE8 A;  1F8R A;  3AEB A;  1DNC A;  5BRT A;  1IUX A;  3UKP A;  3P9U A;  1ZDL A;  1VRQ B;  1Y0P A;  2XLR A;  4H4T A;  1EL5 A;  1KNP A;  1OJD A;  5LV9 A;  2JAE A;  3NGC X;  1L9C A;  2GRT A;  4BK1 A;  3M0O A;  2R45 A;  1BWC A;  4ICY A;  3CNS A;  1E39 A;  2IVE A;  1D4E A;  1O94 A;  2FBW A;  3UKL A;  1M6I A;  3UKF A;  3NT6 A;  3AB1 A;  1KNR A;  3NRN A;  4XWZ A;  3UTE A;  4X9N A;  3UP5 A;  1YQ3 A;  4DGK A;  4LA1 A;  1IUU A;  4U8P A;  2A89 A;  1IUT A;  2X99 A;  4Z44 A;  4NEV A;  4YSH A;  2APG A;  4NTD A;  3NH3 X;  2O9Z A;  4C3Y A;  3LB8 A;  4FK1 A;  1PXC A;  2XFU A;  3SM8 A;  3BI2 A;  5JCM A;  3PS9 A;  5HY5 A;  2V3B A;  1RYI A;  4A99 A;  3AE5 A;  1PDH A;  1N1P A;  2XVE A;  1S3E A;  4X4J A;  2V60 A;  1E1N A;  2B76 A;  4RSL A;  1TYP A;  4U8O A;  4Z25 A;  5EB4 A;  3C4A A;  2R0P A;  2B7R A;  4YSY A;  2XFQ A;  2R9Z A;  1ZOY A;  4Y4N A;  2R46 A;  3BNM A;  4DSH A;  4BJZ A;  3DK9 A;  4APN A;  5DBJ A;  2GF3 A;  4JDR A;  3CNJ A;  3AEG A;  3OC4 A;  4H4V A;  3H8L A;  3K30 A;  4J56 A;  2Q0K A;  4EMJ A;  2YVJ A;  1B4V A;  2BK4 A;  2VVM A; 
#chains in the Genus database with same CATH topology
 2GR1 A;  2OLN A;  1GES A;  1PBF A;  2JK6 A;  2VVL A;  1LQU A;  2WDV A;  2YG6 A;  3ATR A;  3L1R A;  2ACZ A;  2WU2 A;  2NPX A;  3NHO X;  2WDQ A;  4G6H A;  1CF3 A;  3BHF A;  2A87 A;  3ICS A;  4XXG A;  1E6E A;  3DJG X;  3AD9 B;  4K5S A;  3LOV A;  2XFN A;  2XFO A;  4CY8 A;  1IUW A;  2YLS A;  1GRF A;  1K0J A;  4H2R A;  4G6G A;  1KFY A;  3R9U A;  4CRT A;  2X3N A;  2XCG A;  2C3D A;  4GDP A;  4D03 A;  3NIX A;  4U8L A;  4PAA A;  3AEF A;  3QSS A;  4YT0 A;  3S61 A;  1GRT A;  1VG9 A;  4YTP A;  2GAH B;  2JB1 A;  4FK1 C;  1TRB A;  1ZOV A;  1DXL A;  5IQ1 A;  1UKV G;  1E1K A;  2V6O A;  5KNL A;  2B9W A;  2BC0 A;  3HYV A;  1REO A;  3GD4 A;  5TR3 A;  1BZL A;  4K8D A;  3ICR A;  2B7S A;  3P4P A;  2XFP A;  1QO8 A;  1JNR A;  1KSU A;  1ZY8 A;  2BK5 A;  1TDO A;  2C65 A;  3DH9 A;  3DGZ A;  3GDP A;  2BS4 A;  4WX1 A;  1Y56 B;  4EMI A;  4U2L A;  1CBO A;  2AAQ A;  2DKH A;  2XLS A;  3DGH A;  3FIM B;  4CY6 A;  1ZX9 A;  4AP3 A;  1EBD A;  3AWI A;  4J57 A;  3ISH A;  2QAE A;  3SGL A;  3LXD A;  4IVM B;  4NZH A;  5M10 A;  5L46 A;  3EAN A;  2YLX A;  1DOB A;  1RSG A;  4NWZ A;  4YWO A;  4Y4M A;  3SFE A;  3UTG A;  1PXB A;  3NYC A;  4FX9 A;  1CC2 A;  2V5Z A;  3GWF A;  1B5Q A;  2YLR A;  3CMM A;  2BCG G;  4OPG A;  1K0L A;  3C4N A;  3SZC A;  1CHU A;  4BJY A;  3ITJ A;  2WP9 A;  3B3R A;  1ZMD A;  1OJ9 A;  1GRB A;  1NHP A;  2WU5 A;  1O5W A;  1NG4 A;  3AEE A;  3IHG A;  3LJP A;  3CPJ G;  3LZX A;  2AQJ A;  3PO7 A;  3AD7 B;  2WQY A;  1GSN A;  2YWL A;  3B6D A;  2WES A;  3CTY A;  4O5U A;  3NK0 X;  4A79 A;  3G5Q A;  3V3O A;  1B8S A;  3COX A;  2NVK X;  2V3A A;  2X8C A;  2UZZ A;  4CBQ A;  2RGH A;  1YQZ A;  2PYX A;  2GR3 A;  4CCQ A;  2C66 A;  3QFA A;  1DOC A;  1LTX R;  2CFY A;  4H4U A;  4JY3 A;  1X31 B;  2A8X A;  2Y6Q A;  3ALJ A;  2B9Y A;  2IID A;  3FG2 P;  5IQ4 A;  3ABV A;  1H7X A;  4BUR A;  3CPI G;  3Q6J A;  4EM3 A;  1K4Q A;  4EM4 A;  2YG3 A;  5JCK A;  4H4Q A;  1H82 A;  1GRG A;  3T37 A;  2VRL A;  5KXJ A;  3NK2 X;  4USQ A;  4JY2 A;  4U8J A;  3FPZ A;  3LZW A;  3DJE A;  1NEN A;  2WOI A;  4TM0 A;  4ZN0 A;  5C3J A;  3ALL A;  1CC4 A;  2VZ2 A;  2XVI A;  3UKA A;  4BK2 A;  1ZMC A;  3RHA A;  3VRA A;  5KMR A;  2GR2 A;  1OJC A;  2GV8 A;  2CDU A;  2R4J A;  5KMP A;  5KMS A;  1DOD A;  2HQM A;  1P2H A;  3H4K A;  4AOS A;  3K7Q X;  4K2X A;  4NTC A;  2RAB A;  5KVI A;  1BF3 A;  3QJ4 A;  3UOZ A;  4A65 A;  1W4X A;  2H88 A;  2WPC A;  4H4X A;  2IVD A;  4ADW A;  4PAB A;  2BAC A;  3L8K A;  2FJD A;  5KWF A;  1E1M A;  1GT8 A;  1GAL A;  2JB3 A;  2VRM A;  3H8I A;  4ZCC A;  3UTF A;  5FS8 A;  1B37 A;  5KOW A;  1FEB A;  1PBD A;  3JSK A;  3OZ2 A;  3T0K A;  1Y56 A;  2YG7 A;  3AE7 A;  3UKQ A;  4ZCD A;  1TDE A;  1XAN A;  2C72 A;  2C73 A;  1O95 A;  2Q7V A;  2BRA A;  3AEC A;  3O0H A;  1LJ1 A;  3UCL A;  1LPF A;  3NK1 X;  4M52 A;  1NDA A;  4YKF A;  1LVL A;  1S3B A;  4TM3 A;  1V59 A;  4TM4 A;  4YTM A;  1D4D A;  1EL9 A;  3SX6 A;  2ZBW A;  5ER0 A;  4J33 A;  3SFD A;  2BYB A;  2TPR A;  2YLT A;  4HA6 A;  3DA1 A;  4H4R A;  1BGN A;  3NN6 X;  2WDR A;  3G5R A;  4OVI A;  1H83 A;  3KD9 A;  3SXI A;  4UDR A;  2Z5X A;  4U8K A;  1PJ6 A;  2WEU A;  2WP6 A;  2EQ7 A;  2YM1 A;  3DJJ A;  4I59 A;  5CKU A;  1TDK A;  3AEA A;  4TM1 A;  2YR4 A;  2WPF A;  4AT0 A;  1D7L A;  3URH A;  2XDO A;  4II3 A;  4H2Q A;  4JQ9 A;  4KPR A;  4C3X A;  1CJ3 A;  3ZDN A;  3ADA B;  3I6D A;  1S2Y A;  2C4C A;  5KVH A;  1QJD A;  3EF6 A;  3KPF A;  4C5O A;  4GUV A;  1NHS A;  3M13 A;  5GRT A;  4B69 A;  1PJ7 A;  3IC9 A;  3RP7 A;  4BV6 A;  4Z2R A;  4Z2T A;  5GSN A;  2QCU A;  4JNA A;  3DME A;  4B66 A;  1L0V A;  3DK4 A;  1GET A;  3QVR A;  2TMD A;  3NTA A;  4GRT A;  1MXT A;  4OPI A;  3E1T A;  4U8N A;  5FS6 A;  4Z24 A;  4C77 A;  4LII A;  5FS9 A;  3UOX A;  1D5T A;  1XHC A;  3T2K A;  5EOW A;  2E5V A;  4H4W A;  1E7P A;  3CND A;  1KSS A;  2I0Z A;  1GTE A;  3F8P A;  4DSG A;  3AE9 A;  3AED A;  3P4S A;  2OAL A;  2X8G A;  4CNK A;  1Q1R A;  3AYJ A;  3G5S A;  1ZK7 A;  1BGJ A;  1N4U A;  2YR6 A;  3CGC A;  1YKJ A;  4BK3 A;  4OPU A;  1PBC A;  3GYJ A;  3KLJ A;  2PHH A;  4N9X A;  1GER A;  5BUL A;  1NHQ A;  4FDC B;  3FMW A;  2WP5 A;  3NKS A;  3ATQ A;  4NTE A;  2X8H A;  2WS3 A;  1GV4 A;  3AD8 B;  2R0G A;  2EQ9 A;  3KKJ A;  1KF6 A;  1Z6L A;  3NTD A;  4EQW A;  4AT2 A;  2JKC A;  1FCD A;  4H50 A;  3RP8 A;  1CJ4 A;  1GEU A;  2VQ7 A;  4B63 A;  1F8W A;  1F8S A;  3SQP A;  1N4V A;  1XPQ A;  4B1B A;  1ONF A;  3AYI A;  2EQ6 A;  5U1O A;  1NG3 A;  3P4Q A;  4K5R A;  3ZYX A;  1NAA A;  3AYL A;  3C96 A;  2FJA A;  2H89 A;  3VRB A;  4EQX A;  2WOW A;  4G74 A;  2C3C A;  1GRA A;  5KRQ A;  1GRH A;  4OCG A;  1EL8 A;  3NG7 X;  5IPY A;  1JOA A;  4AP1 A;  2CUL A;  3T2Y A;  2BA9 A;  2JB2 A;  2VVL G;  3HYW A;  3QFB A;  4EIQ A;  1FOH A;  2EQ8 A;  2RGJ A;  2QA1 A;  4WCT A;  4EMW A;  3LAD A;  2BS2 A;  3RP6 A;  2YQU A;  2XVH A;  1L9D A;  2GVC A;  3ALM A;  4GF7 A;  2WHD A;  3K7M X;  2C76 A;  2C75 A;  4GR1 A;  4J36 A;  4JN9 A;  5KMQ A;  3SZW A;  2YVG A;  4K7Z A;  2QA2 A;  1LQT A;  4H2N A;  2ARD A;  5U63 A;  1AOG A;  2Q6U A;  1JRX A;  4Z2U A;  1JEH A;  3K7T A;  3KVE A;  1F3P A;  2GQW A;  1GXF A;  4JNQ A;  4REK A;  2VQB A;  1PXA A;  1DJQ A;  2OA1 A;  4H4Y A;  2E1M A;  4E0V A;  2OAM A;  3GMB A;  1Q9I A;  4YKG A;  5HYM A;  2AR8 A;  4J2W A;  4YSX A;  1HYU A;  2R4E A;  3V3N A;  1NPX A;  4H2P A;  4A6N B;  1F6M A;  5J7X A;  2OLO A;  3I3L A;  4IV9 A;  4P9S A;  1YY5 A;  2YVF A;  2C67 A;  3CNT A;  3PVC A;  4X9M A;  3Q9T A;  4U8I A;  4U2T A;  2XLP A;  2YR5 A;  4IA6 A;  2FJE A;  2XVJ A;  5M0Z A;  5C2T A;  2DKI A;  1MOK A;  1CJC A;  1EL7 A;  2BK3 A;  3AXB A;  4B65 A;  4U2S A;  4H4P A;  3QSE A;  2GQF A;  2GEW A;  3M12 A;  3FBS A;  1YQ4 A;  2GAG B;  4NEW A;  1JRY A;  4UDQ A;  5HHF A;  3AE2 A;  4G73 A;  2JBV A;  3EPT A;  2RGO A;  3UTH A;  3DK8 A;  1H81 A;  3GWD A;  3DJD A;  4LU6 A;  4OPL A;  3VR8 A;  4H4S A;  2YAU A;  1CC6 A;  4KX6 A;  4NNJ A;  1QLB A;  1TDF A;  2YLZ A;  3BI5 A;  3F8R A;  3NN0 X;  3RNM A;  4IVO B;  3VRD B;  4B67 A;  2Q0L A;  3BNU A;  4O5Q A;  3AE6 A;  2FJB A;  3F8D A;  4TLX A;  1DOE A;  1FEC A;  1FL2 A;  1PS9 A;  3UKK A;  4ECH A;  2F5Z A;  1VDC A;  4A7A A;  4A5L A;  3NYF A;  4OPD A;  1GOS A;  1VQW A;  2C7G A;  4Z26 A;  1H86 A;  2YLW A;  4YXD A;  1L9E A;  3CGE A;  3D8X A;  3V76 A;  2WBA A;  3BI4 A;  2J3N A;  3AE1 A;  1CJ2 A;  2C64 A;  2GB0 A;  3SY4 A;  3NNE A;  1JRZ A;  1Q1W A;  3GYI A;  2WET A;  1ELI A;  4H4Z A;  1VG0 A;  4II2 A;  4CCR A;  4EQR A;  3UOY A;  4Y4L A;  3CGB A;  4J34 A;  4AOX A;  3NLC A;  3EAO A;  3KA7 A;  4A6N A;  1IUV A;  1JU2 A;  1JNZ A;  4RG3 A;  5CQF A;  3P4R A;  4TLZ A;  2BXR A;  4Z43 A;  2WOV A;  4OPT A;  1LV0 A;  4UP3 A;  4UDP A;  3GDN A;  5JCI A;  3VQR A;  3CNP A;  3WE0 A;  5U25 A;  2W0H A;  3GMC A;  5HXI A;  3D1C A;  4D04 A;  4U8M A;  1D4C A;  2BC1 A;  2BCP A;  1S2Q A;  3IHM A;  1K0I A;  4K22 A;  3UP4 A;  1TDN A;  4EIP A;  2XLT A;  2R0C A;  4CNJ A;  1PHH A;  2X50 A;  1TYT A;  3ICT A;  2BAB A;  1GND A;  4C74 A;  1BKW A;  3SZF A;  3BHK A;  2YM2 A;  2BS3 A;  1CL0 A;  3S5W A;  3GSI A;  5FS7 A;  1OJT A;  5EBK A;  2ZZC A;  5JCN A;  2V61 A;  4YTN A;  4XWR A;  2ZZ0 A;  4G9K A;  3CN8 A;  1RP0 A;  4DNA A;  2XLU A;  5FMH A;  1PBB A;  4I58 A;  2XYO A;  2WPE A;  4GAV A;  4HB9 A;  2GR0 A;  1IJH A;  1FEA A;  1PJ5 A;  1NHR A;  1GRE A;  4A9W A;  1H84 A;  1GPE A;  2GMH A;  1E1L A;  2ZZB A;  2XVF A;  1KDG A;  2B9X A;  3AE3 A;  1COY A;  4GCM A;  3UKH A;  5BUK A;  3GD3 A;  1M64 A;  1H7W A;  3CPH G;  1MO9 A;  3GRS A;  3NYE A;  2CVJ A;  3CGD A;  2BXS A;  2YG4 A;  3IF9 A;  1SEZ A;  3CIR A;  1GTH A;  1NEK A;  2GH5 A;  3IWA A;  2Y6R A;  3AE4 A;  3II4 A;  1N4W A;  4IA5 A;  4B68 A;  3KU9 A;  2C70 A;  2E4G A;  1XDI A;  4MJW A;  3HYX A;  3GRT A;  1ZKQ A;  1P2E A;  2YG5 A;  3QSM A;  4OPC A;  3SZ0 A;  4EQS A;  5J60 A;  2Z5Y A;  1DJN A;  3RED A;  3UOV A;  1PBE A;  5JCL A;  1ZP0 A;  5BVA A;  4H7U A;  1H6V A;  5KOX A;  3VR9 A;  2BRY A;  3QVP A;  4USR A;  1IUS A;  4YSZ A;  3HZL A;  4J31 A;  4GDE A;  4RG4 A;  3KPK A;  4B64 A;  2VOU A;  1PN0 A;  2GMJ A;  1OJA A;  5EB5 A;  1D7Y A;  3P1W A;  3AE8 A;  1F8R A;  3AEB A;  1DNC A;  3GYX A;  5BRT A;  1IUX A;  3UKP A;  3P9U A;  1ZDL A;  1VRQ B;  1Y0P A;  2XLR A;  4H4T A;  1EL5 A;  1KNP A;  1OJD A;  5LV9 A;  2JAE A;  3NGC X;  1L9C A;  2GRT A;  4BK1 A;  3M0O A;  2R45 A;  1BWC A;  4ICY A;  3T2Z A;  3CNS A;  1E39 A;  2IVE A;  1D4E A;  1O94 A;  2FBW A;  3T14 A;  3UKL A;  1M6I A;  3UKF A;  3NT6 A;  3AB1 A;  1KNR A;  3NRN A;  4XWZ A;  3UTE A;  4X9N A;  3UP5 A;  1YQ3 A;  4DGK A;  4LA1 A;  1IUU A;  4U8P A;  2A89 A;  1IUT A;  2X99 A;  4Z44 A;  4NEV A;  3T31 A;  4YSH A;  2APG A;  4NTD A;  3NH3 X;  2O9Z A;  4C3Y A;  3LB8 A;  4FK1 A;  1PXC A;  2XFU A;  3SM8 A;  3BI2 A;  5JCM A;  3PS9 A;  5HY5 A;  2V3B A;  4GAP A;  1RYI A;  4A99 A;  3AE5 A;  1PDH A;  1N1P A;  2XVE A;  1S3E A;  4X4J A;  2V60 A;  1E1N A;  2B76 A;  4RSL A;  1TYP A;  4U8O A;  4Z25 A;  5EB4 A;  3C4A A;  2R0P A;  2B7R A;  4YSY A;  2XFQ A;  2R9Z A;  1ZOY A;  4Y4N A;  2R46 A;  3BNM A;  4DSH A;  4BJZ A;  3DK9 A;  4APN A;  5DBJ A;  3SYI A;  2GF3 A;  4JDR A;  3CNJ A;  3AEG A;  3OC4 A;  4H4V A;  3H8L A;  3K30 A;  4J56 A;  2Q0K A;  4EMJ A;  2YVJ A;  1B4V A;  2BK4 A;  2VVM A; 
#chains in the Genus database with same CATH homology
 2GR1 A;  2OLN A;  1GES A;  1PBF A;  2JK6 A;  2VVL A;  1LQU A;  2WDV A;  2YG6 A;  3ATR A;  3L1R A;  2ACZ A;  2WU2 A;  2NPX A;  3NHO X;  2WDQ A;  4G6H A;  1CF3 A;  3BHF A;  2A87 A;  3ICS A;  4XXG A;  1E6E A;  3DJG X;  3AD9 B;  4K5S A;  3LOV A;  2XFN A;  2XFO A;  4CY8 A;  1IUW A;  2YLS A;  1GRF A;  1K0J A;  4H2R A;  4G6G A;  1KFY A;  3R9U A;  4CRT A;  2X3N A;  2XCG A;  2C3D A;  4GDP A;  4D03 A;  3NIX A;  4U8L A;  4PAA A;  3AEF A;  3QSS A;  4YT0 A;  3S61 A;  1GRT A;  1VG9 A;  4YTP A;  2GAH B;  2JB1 A;  4FK1 C;  1TRB A;  1ZOV A;  1DXL A;  5IQ1 A;  1UKV G;  1E1K A;  2V6O A;  5KNL A;  2B9W A;  2BC0 A;  3HYV A;  1REO A;  3GD4 A;  5TR3 A;  1BZL A;  4K8D A;  3ICR A;  2B7S A;  3P4P A;  2XFP A;  1QO8 A;  1JNR A;  1KSU A;  1ZY8 A;  2BK5 A;  1TDO A;  2C65 A;  3DH9 A;  3DGZ A;  3GDP A;  2BS4 A;  4WX1 A;  1Y56 B;  4EMI A;  4U2L A;  1CBO A;  2AAQ A;  2DKH A;  2XLS A;  3DGH A;  3FIM B;  4CY6 A;  1ZX9 A;  4AP3 A;  1EBD A;  3AWI A;  4J57 A;  3ISH A;  2QAE A;  3SGL A;  3LXD A;  4IVM B;  4NZH A;  5M10 A;  5L46 A;  3EAN A;  2YLX A;  1DOB A;  1RSG A;  4NWZ A;  4YWO A;  4Y4M A;  3SFE A;  3UTG A;  1PXB A;  3NYC A;  4FX9 A;  1CC2 A;  2V5Z A;  3GWF A;  1B5Q A;  2YLR A;  3CMM A;  2BCG G;  4OPG A;  1K0L A;  3C4N A;  3SZC A;  1CHU A;  4BJY A;  3ITJ A;  2WP9 A;  3B3R A;  1ZMD A;  1OJ9 A;  1GRB A;  1NHP A;  2WU5 A;  1O5W A;  1NG4 A;  3AEE A;  3IHG A;  3LJP A;  3CPJ G;  3LZX A;  2AQJ A;  3PO7 A;  3AD7 B;  2WQY A;  1GSN A;  2YWL A;  3B6D A;  2WES A;  3CTY A;  4O5U A;  3NK0 X;  4A79 A;  3G5Q A;  3V3O A;  1B8S A;  3COX A;  2NVK X;  2V3A A;  2X8C A;  2UZZ A;  4CBQ A;  2RGH A;  1YQZ A;  2PYX A;  2GR3 A;  4CCQ A;  2C66 A;  3QFA A;  1DOC A;  1LTX R;  2CFY A;  4H4U A;  4JY3 A;  1X31 B;  2A8X A;  2Y6Q A;  3ALJ A;  2B9Y A;  2IID A;  3FG2 P;  5IQ4 A;  3ABV A;  1H7X A;  4BUR A;  3CPI G;  3Q6J A;  4EM3 A;  1K4Q A;  4EM4 A;  2YG3 A;  5JCK A;  4H4Q A;  1H82 A;  1GRG A;  3T37 A;  2VRL A;  5KXJ A;  3NK2 X;  4USQ A;  4JY2 A;  4U8J A;  3FPZ A;  3LZW A;  3DJE A;  1NEN A;  2WOI A;  4TM0 A;  4ZN0 A;  5C3J A;  3ALL A;  1CC4 A;  2VZ2 A;  2XVI A;  3UKA A;  4BK2 A;  1ZMC A;  3RHA A;  3VRA A;  5KMR A;  2GR2 A;  1OJC A;  2GV8 A;  2CDU A;  2R4J A;  5KMP A;  5KMS A;  1DOD A;  2HQM A;  1P2H A;  3H4K A;  4AOS A;  3K7Q X;  4K2X A;  4NTC A;  2RAB A;  5KVI A;  1BF3 A;  3QJ4 A;  3UOZ A;  4A65 A;  1W4X A;  2H88 A;  2WPC A;  4H4X A;  2IVD A;  4ADW A;  4PAB A;  2BAC A;  3L8K A;  2FJD A;  5KWF A;  1E1M A;  1GT8 A;  1GAL A;  2JB3 A;  2VRM A;  3H8I A;  4ZCC A;  3UTF A;  5FS8 A;  1B37 A;  5KOW A;  1FEB A;  1PBD A;  3JSK A;  3OZ2 A;  3T0K A;  1Y56 A;  2YG7 A;  3AE7 A;  3UKQ A;  4ZCD A;  1TDE A;  1XAN A;  2C72 A;  2C73 A;  1O95 A;  2Q7V A;  2BRA A;  3AEC A;  3O0H A;  1LJ1 A;  3UCL A;  1LPF A;  3NK1 X;  4M52 A;  1NDA A;  4YKF A;  1LVL A;  1S3B A;  4TM3 A;  1V59 A;  4TM4 A;  4YTM A;  1D4D A;  1EL9 A;  3SX6 A;  2ZBW A;  5ER0 A;  4J33 A;  3SFD A;  2BYB A;  2TPR A;  2YLT A;  4HA6 A;  3DA1 A;  4H4R A;  1BGN A;  3NN6 X;  2WDR A;  3G5R A;  4OVI A;  1H83 A;  3KD9 A;  3SXI A;  4UDR A;  2Z5X A;  4U8K A;  1PJ6 A;  2WEU A;  2WP6 A;  2EQ7 A;  2YM1 A;  3DJJ A;  4I59 A;  5CKU A;  1TDK A;  3AEA A;  4TM1 A;  2YR4 A;  2WPF A;  4AT0 A;  1D7L A;  3URH A;  2XDO A;  4II3 A;  4H2Q A;  4JQ9 A;  4KPR A;  4C3X A;  1CJ3 A;  3ZDN A;  3ADA B;  3I6D A;  1S2Y A;  2C4C A;  5KVH A;  1QJD A;  3EF6 A;  3KPF A;  4C5O A;  4GUV A;  1NHS A;  3M13 A;  5GRT A;  4B69 A;  1PJ7 A;  3IC9 A;  3RP7 A;  4BV6 A;  4Z2R A;  4Z2T A;  5GSN A;  2QCU A;  4JNA A;  3DME A;  4B66 A;  1L0V A;  3DK4 A;  1GET A;  3QVR A;  2TMD A;  3NTA A;  4GRT A;  1MXT A;  4OPI A;  3E1T A;  4U8N A;  5FS6 A;  4Z24 A;  4C77 A;  4LII A;  5FS9 A;  3UOX A;  1D5T A;  1XHC A;  3T2K A;  5EOW A;  2E5V A;  4H4W A;  1E7P A;  3CND A;  1KSS A;  2I0Z A;  1GTE A;  3F8P A;  4DSG A;  3AE9 A;  3AED A;  3P4S A;  2OAL A;  2X8G A;  4CNK A;  1Q1R A;  3AYJ A;  3G5S A;  1ZK7 A;  1BGJ A;  1N4U A;  2YR6 A;  3CGC A;  1YKJ A;  4BK3 A;  4OPU A;  1PBC A;  3GYJ A;  3KLJ A;  2PHH A;  4N9X A;  1GER A;  5BUL A;  1NHQ A;  4FDC B;  3FMW A;  2WP5 A;  3NKS A;  3ATQ A;  4NTE A;  2X8H A;  2WS3 A;  1GV4 A;  3AD8 B;  2R0G A;  2EQ9 A;  3KKJ A;  1KF6 A;  1Z6L A;  3NTD A;  4EQW A;  4AT2 A;  2JKC A;  1FCD A;  4H50 A;  3RP8 A;  1CJ4 A;  1GEU A;  2VQ7 A;  4B63 A;  1F8W A;  1F8S A;  3SQP A;  1N4V A;  1XPQ A;  4B1B A;  1ONF A;  3AYI A;  2EQ6 A;  5U1O A;  1NG3 A;  3P4Q A;  4K5R A;  3ZYX A;  1NAA A;  3AYL A;  3C96 A;  2FJA A;  2H89 A;  3VRB A;  4EQX A;  2WOW A;  4G74 A;  2C3C A;  1GRA A;  5KRQ A;  1GRH A;  4OCG A;  1EL8 A;  3NG7 X;  5IPY A;  1JOA A;  4AP1 A;  2CUL A;  3T2Y A;  2BA9 A;  2JB2 A;  2VVL G;  3HYW A;  3QFB A;  4EIQ A;  1FOH A;  2EQ8 A;  2RGJ A;  2QA1 A;  4WCT A;  4EMW A;  3LAD A;  2BS2 A;  3RP6 A;  2YQU A;  2XVH A;  1L9D A;  2GVC A;  3ALM A;  4GF7 A;  2WHD A;  3K7M X;  2C76 A;  2C75 A;  4GR1 A;  4J36 A;  4JN9 A;  5KMQ A;  3SZW A;  2YVG A;  4K7Z A;  2QA2 A;  1LQT A;  4H2N A;  2ARD A;  5U63 A;  1AOG A;  2Q6U A;  1JRX A;  4Z2U A;  1JEH A;  3K7T A;  3KVE A;  1F3P A;  2GQW A;  1GXF A;  4JNQ A;  4REK A;  2VQB A;  1PXA A;  1DJQ A;  2OA1 A;  4H4Y A;  2E1M A;  4E0V A;  2OAM A;  3GMB A;  1Q9I A;  4YKG A;  5HYM A;  2AR8 A;  4J2W A;  4YSX A;  1HYU A;  2R4E A;  3V3N A;  1NPX A;  4H2P A;  4A6N B;  1F6M A;  5J7X A;  2OLO A;  3I3L A;  4IV9 A;  4P9S A;  1YY5 A;  2YVF A;  2C67 A;  3CNT A;  3PVC A;  4X9M A;  3Q9T A;  4U8I A;  4U2T A;  2XLP A;  2YR5 A;  4IA6 A;  2FJE A;  2XVJ A;  5M0Z A;  5C2T A;  2DKI A;  1MOK A;  1CJC A;  1EL7 A;  2BK3 A;  3AXB A;  4B65 A;  4U2S A;  4H4P A;  3QSE A;  2GQF A;  2GEW A;  3M12 A;  3FBS A;  1YQ4 A;  2GAG B;  4NEW A;  1JRY A;  4UDQ A;  5HHF A;  3AE2 A;  4G73 A;  2JBV A;  3EPT A;  2RGO A;  3UTH A;  3DK8 A;  1H81 A;  3GWD A;  3DJD A;  4LU6 A;  4OPL A;  3VR8 A;  4H4S A;  2YAU A;  1CC6 A;  4KX6 A;  4NNJ A;  1QLB A;  1TDF A;  2YLZ A;  3BI5 A;  3F8R A;  3NN0 X;  3RNM A;  4IVO B;  3VRD B;  4B67 A;  2Q0L A;  3BNU A;  4O5Q A;  3AE6 A;  2FJB A;  3F8D A;  4TLX A;  1DOE A;  1FEC A;  1FL2 A;  1PS9 A;  3UKK A;  4ECH A;  2F5Z A;  1VDC A;  4A7A A;  4A5L A;  3NYF A;  4OPD A;  1GOS A;  1VQW A;  2C7G A;  4Z26 A;  1H86 A;  2YLW A;  4YXD A;  1L9E A;  3CGE A;  3D8X A;  3V76 A;  2WBA A;  3BI4 A;  2J3N A;  3AE1 A;  1CJ2 A;  2C64 A;  2GB0 A;  3SY4 A;  3NNE A;  1JRZ A;  1Q1W A;  3GYI A;  2WET A;  1ELI A;  4H4Z A;  1VG0 A;  4II2 A;  4CCR A;  4EQR A;  3UOY A;  4Y4L A;  3CGB A;  4J34 A;  4AOX A;  3NLC A;  3EAO A;  3KA7 A;  4A6N A;  1IUV A;  1JU2 A;  1JNZ A;  4RG3 A;  5CQF A;  3P4R A;  4TLZ A;  2BXR A;  4Z43 A;  2WOV A;  4OPT A;  1LV0 A;  4UP3 A;  4UDP A;  3GDN A;  5JCI A;  3VQR A;  3CNP A;  3WE0 A;  5U25 A;  2W0H A;  3GMC A;  5HXI A;  3D1C A;  4D04 A;  4U8M A;  1D4C A;  2BC1 A;  2BCP A;  1S2Q A;  3IHM A;  1K0I A;  4K22 A;  3UP4 A;  1TDN A;  4EIP A;  2XLT A;  2R0C A;  4CNJ A;  1PHH A;  2X50 A;  1TYT A;  3ICT A;  2BAB A;  1GND A;  4C74 A;  1BKW A;  3SZF A;  3BHK A;  2YM2 A;  2BS3 A;  1CL0 A;  3S5W A;  3GSI A;  5FS7 A;  1OJT A;  5EBK A;  2ZZC A;  5JCN A;  2V61 A;  4YTN A;  4XWR A;  2ZZ0 A;  4G9K A;  3CN8 A;  1RP0 A;  4DNA A;  2XLU A;  5FMH A;  1PBB A;  4I58 A;  2XYO A;  2WPE A;  4GAV A;  4HB9 A;  2GR0 A;  1IJH A;  1FEA A;  1PJ5 A;  1NHR A;  1GRE A;  4A9W A;  1H84 A;  1GPE A;  2GMH A;  1E1L A;  2ZZB A;  2XVF A;  1KDG A;  2B9X A;  3AE3 A;  1COY A;  4GCM A;  3UKH A;  5BUK A;  3GD3 A;  1M64 A;  1H7W A;  3CPH G;  1MO9 A;  3GRS A;  3NYE A;  2CVJ A;  3CGD A;  2BXS A;  2YG4 A;  3IF9 A;  1SEZ A;  3CIR A;  1GTH A;  1NEK A;  2GH5 A;  3IWA A;  2Y6R A;  3AE4 A;  3II4 A;  1N4W A;  4IA5 A;  4B68 A;  3KU9 A;  2C70 A;  2E4G A;  1XDI A;  4MJW A;  3HYX A;  3GRT A;  1ZKQ A;  1P2E A;  2YG5 A;  3QSM A;  4OPC A;  3SZ0 A;  4EQS A;  5J60 A;  2Z5Y A;  1DJN A;  3RED A;  3UOV A;  1PBE A;  5JCL A;  1ZP0 A;  5BVA A;  4H7U A;  1H6V A;  5KOX A;  3VR9 A;  2BRY A;  3QVP A;  4USR A;  1IUS A;  4YSZ A;  3HZL A;  4J31 A;  4GDE A;  4RG4 A;  3KPK A;  4B64 A;  2VOU A;  1PN0 A;  2GMJ A;  1OJA A;  5EB5 A;  1D7Y A;  3P1W A;  3AE8 A;  1F8R A;  3AEB A;  1DNC A;  3GYX A;  5BRT A;  1IUX A;  3UKP A;  3P9U A;  1ZDL A;  1VRQ B;  1Y0P A;  2XLR A;  4H4T A;  1EL5 A;  1KNP A;  1OJD A;  5LV9 A;  2JAE A;  3NGC X;  1L9C A;  2GRT A;  4BK1 A;  3M0O A;  2R45 A;  1BWC A;  4ICY A;  3T2Z A;  3CNS A;  1E39 A;  2IVE A;  1D4E A;  1O94 A;  2FBW A;  3T14 A;  3UKL A;  1M6I A;  3UKF A;  3NT6 A;  3AB1 A;  1KNR A;  3NRN A;  4XWZ A;  3UTE A;  4X9N A;  3UP5 A;  1YQ3 A;  4DGK A;  4LA1 A;  1IUU A;  4U8P A;  2A89 A;  1IUT A;  2X99 A;  4Z44 A;  4NEV A;  3T31 A;  4YSH A;  2APG A;  4NTD A;  3NH3 X;  2O9Z A;  4C3Y A;  3LB8 A;  4FK1 A;  1PXC A;  2XFU A;  3SM8 A;  3BI2 A;  5JCM A;  3PS9 A;  5HY5 A;  2V3B A;  4GAP A;  1RYI A;  4A99 A;  3AE5 A;  1PDH A;  1N1P A;  2XVE A;  1S3E A;  4X4J A;  2V60 A;  1E1N A;  2B76 A;  4RSL A;  1TYP A;  4U8O A;  4Z25 A;  5EB4 A;  3C4A A;  2R0P A;  2B7R A;  4YSY A;  2XFQ A;  2R9Z A;  1ZOY A;  4Y4N A;  2R46 A;  3BNM A;  4DSH A;  4BJZ A;  3DK9 A;  4APN A;  5DBJ A;  3SYI A;  2GF3 A;  4JDR A;  3CNJ A;  3AEG A;  3OC4 A;  4H4V A;  3H8L A;  3K30 A;  4J56 A;  2Q0K A;  4EMJ A;  2YVJ A;  1B4V A;  2BK4 A;  2VVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...