3QJ4A

Crystal structure of human renalase (isoform 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
341
structure length
335
Chain Sequence
MAQVLIVGAGMTGSLCAALLRRQTGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTDVPWAGQYITSNPCIRFVSIDNKKRNIESSIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Renalase
publication title FAD-binding site and NADP reactivity in human renalase: a new enzyme involved in blood pressure regulation
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 335
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3qj4A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3qj4A02
4GRTA 4TM4A 2WDQA 3SFEA 1CF3A 3AWIA 3DGZA 1GXFA 2WEUA 4XXGA 5GRTA 5L46A 3OZ2A 4CCQA 1E1LA 2FJAA 1CC2A 3KPFA 3RP6A 3AD7B 3C96A 1V59A 4GDPA 3ZYXA 1ZK7A 3IF9A 4B65A 1M64A 4AP3A 1PBBA 2WP6A 2Q0KA 3D8XA 3UKPA 3UTFA 2BS3A 2C3CA 4U8KA 5C2TA 2YR6A 1GALA 1DJQA 3ICSA 3ALJA 4OPCA 1DOEA 4BJZA 1NDAA 1PS9A 1VG0A 2E1MA 3JSKA 2GAHB 4O5QA 4GCMA 2HQMA 4H4UA 4BK2A 2IVEA 4OPTA 4OPIA 1JU2A 2JAEA 2AR8A 4H4XA 4RG4A 1E39A 3Q6JA 1XPQA 2XVIA 2BC1A 4EIPA 4AT2A 2XFPA 2WPCA 3IC9A 2X3NA 4EM4A 1PBEA 4ICYA 3BNUA 3AXBA 1H7WA 3AYJA 5HXIA 4EQRA 1L0VA 2J3NA 1LQUA 1O94A 4FK1A 4Z2RA 3CNDA 5KVHA 2VVLG 4REKA 4D04A 1PJ6A 2VZ2A 2Q6UA 4K5SA 3LZXA 4AT0A 4CY8A 4YTPA 2YG6A 2V6OA 3KD9A 4A6NB 2ACZA 4U8IA 5FS9A 3GDNA 2BK4A 1DODA 3NIXA 2C70A 4USRA 3QSEA 1ZOVA 1GEUA 3RHAA 4YSHA 3AB1A 1JRYA 1KFYA 3KLJA 4A7AA 3AE7A 2DKIA 3P1WA 3IHGA 2V3AA 3NRNA 4LU6A 3AE1A 1JEHA 2XYOA 1PJ5A 5IQ4A 2C66A 1KNPA 1B8SA 4K8DA 5J60A 1NPXA 1IUTA 3LJPA 3AECA 2QAEA 1VQWA 4C3XA 4B66A 1QJDA 3UTGA 3NTAA 1YY5A 1CJCA 2QCUA 2VRLA 1XDIA 3VR8A 2BS4A 1DXLA 2XVFA 2A89A 2GF3A 4WCTA 4AP1A 5JCMA 1BF3A 4YKFA 2R45A 4U8PA 5KOXA 2OAMA 4H4WA 2YM1A 3LZWA 1TDEA 1GRGA 3KKJA 4ZCCA 4YSYA 1YQZA 4YTMA 4J36A 4GF7A 1M6IA 4K2XA 2BYBA 1VDCA 2YG7A 1F8SA 3K7MX 1LPFA 2CULA 3DJEA 3DK8A 3RP8A 4J56A 3DK4A 5KWFA 1BGNA 3GWFA 1GETA 4NZHA 2C65A 4B64A 3CN8A 3EPTA 3GD4A 2WU2A 5TR3A 1CJ4A 1KNRA 2C75A 2CFYA 2XLSA 4U8JA 2E5VA 3II4A 1KF6A 2Z5XA 1YQ3A 2BK3A 4BK1A 4YT0A 4JDRA 1D4EA 3P4PA 3UKHA 2F5ZA 2WPEA 3V3NA 4NTCA 5HYMA 1N1PA 1OJAA 4ZN0A 2YLXA 3I6DA 2VQBA 1MOKA 1K0IA 1CJ2A 2YLWA 1RP0A 3ITJA 2WOWA 1DOCA 1KSSA 5BULA 5JCNA 2GRTA 2APGA 3DH9A 2WHDA 5JCKA 1LV0A 1BGJA 4OPLA 3LXDA 3NNEA 2Y6QA 3NN6X 3ICTA 4ZCDA 1NHPA 4K7ZA 5M10A 2XCGA 1B37A 3B3RA 3H4KA 3DMEA 3BHFA 1IUUA 1N4WA 2OALA 3P4RA 1BZLA 1CL0A 3CNJA 1QLBA 4DGKA 5U1OA 2R0CA 5JCLA 3AE2A 5EB5A 3GYJA 3P9UA 4AOXA 5HY5A 1TDKA 1H81A 3GRSA 4CCRA 1E1NA 4OPDA 2YG5A 1LQTA 3GMBA 2IVDA 4BJYA 2Q0LA 4OPUA 4TLXA 3DJJA 3NK1X 4N9XA 2FJEA 2YR4A 2YLSA 4O5UA 4EQXA 3LB8A 1Y56A 3LOVA 1L9DA 5J7XA 4NTDA 3K7QX 4FX9A 1H84A 1LVLA 3AEDA 3F8PA 4J34A 1IUXA 1TRBA 3VRAA 4H2NA 2EQ8A 2C67A 4H4RA 3G5RA 3CNTA 2WS3A 2GEWA 2BABA 3FBSA 2BXSA 2BCGG 3C4NA 2O9ZA 4MJWA 2NPXA 2YVJA 3PO7A 3QSMA 2X8CA 3DGHA 3IWAA 2WOVA 4P9SA 2JK6A 3GDPA 3EF6A 3UKQA 2PYXA 2R46A 1ZMDA 3EANA 1N4UA 1OJDA 3CTYA 2C72A 3P4QA 1TYPA 3VRDB 4H4ZA 1EL8A 3QJ4A 1S3BA 1TDFA 1B5QA 1S2QA 3V3OA 4Z26A 3H8LA 1PDHA 5FMHA 1JRXA 4BK3A 1COYA 1E7PA 4EMIA 2C64A 3ICRA 4H50A 4A79A 1FOHA 3V76A 4YSXA 3K7TA 4IVMB 3UTHA 4Y4LA 2VQ7A 1KSUA 2OLNA 1KDGA 3ALLA 1QO8A 4H4TA 3GD3A 4CBQA 1VRQB 2XFUA 2YG3A 4C3YA 4Y4NA 1YKJA 1TDNA 3PVCA 1MO9A 3FG2P 3QFBA 4NEWA 4DSHA 3AE5A 5KOWA 3CGDA 4D03A 4UP3A 1EL7A 4JNQA 5EB4A 4Z25A 3RNMA 2X99A 1GRHA 4GDEA 4KPRA 3BI4A 3COXA 1H83A 2ARDA 2QA2A 1IUWA 1FECA 4GR1A 3ZDNA 2IIDA 2VRMA 3QSSA 1PXCA 1BWCA 3NKSA 3NYEA 2ZZBA 3GMCA 1RSGA 3O0HA 2AAQA 2I0ZA 3M13A 1HYUA 3S61A 4J2WA 1GNDA 4J33A 5ER0A 4K5RA 2XFQA 4H7UA 5LV9A 3SM8A 4TM3A 1F6MA 1E1KA 1H7XA 1Y56B 4I59A 4H4QA 4J57A 1B4VA 3NHOX 1E6EA 1GSNA 1XHCA 1FEBA 3I3LA 3AE4A 1IJHA 1Y0PA 3ISHA 3L1RA 3UKLA 3KU9A 4IA6A 3AE8A 2FJDA 1NAAA 2XFNA 2Y6RA 4LIIA 4TM1A 3UOYA 4Z44A 3AEFA 4JN9A 4CY6A 2B9WA 4X9MA 2B7RA 3AEGA 4AOSA 1GV4A 1CJ3A 2RGHA 1N4VA 5C3JA 1XANA 3WE0A 3CNSA 3E1TA 2EQ7A 3AYIA 4EQWA 1GRTA 2B7SA 3SQPA 2TPRA 5KXJA 2GMJA 4WX1A 1ZKQA 4YTNA 3CPJG 3L8KA 1NEKA 3NK2X 4EM3A 2WOIA 1S3EA 3NGCX 4A6NA 2BC0A 1BKWA 2EQ9A 1D4CA 3QFAA 2R4EA 4Z43A 4JY2A 4E0VA 4DSGA 1H82A 3DJDA 2GH5A 5JCIA 1S2YA 2CDUA 4ADWA 4JQ9A 4IV9A 4H4PA 1D5TA 2X8HA 1TYTA 3C4AA 4C5OA 3NN0X 5M0ZA 4CNJA 1CBOA 4EMWA 3CIRA 4LA1A 3ATRA 2WQYA 2XLPA 1FCDA 1FEAA 4Z2TA 2XLUA 4OVIA 4EQSA 1K0JA 4B69A 2YWLA 4B67A 4U2TA 4B1BA 1FL2A 2A8XA 3S5WA 4A9WA 2GR3A 2A87A 4H4VA 4YSZA 3M12A 1GRBA 4PAAA 3DJGX 3IHMA 4FDCB 4H2PA 4H4YA 4IA5A 4JNAA 1EL9A 1CC6A 2YLTA 3FMWA 2RABA 3AE3A 1Z6LA 3UP5A 1DOBA 2XDOA 3KVEA 2H89A 4Z2UA 3ALMA 2AQJA 4UDRA 3BI5A 3VR9A 1W4XA 2R4JA 2WDVA 4JY3A 1GTHA 3BNMA 4Z24A 2ZBWA 2GR1A 2JB1A 3AEEA 1X31B 2X50A 1NENA 2BS2A 5EOWA 1ZY8A 1P2EA 2Z5YA 5CQFA 1P2HA 1PXAA 3CGCA 2W0HA 4C77A 3NYCA 3UKKA 3VQRA 1PHHA 3DA1A 2B9YA 5FS6A 1GESA 1K0LA 3NLCA 4C74A 2JB3A 1F3PA 2GQWA 4XWRA 3ATQA 3AD9B 3GSIA 4U2SA 3NT6A 4BURA 2XFOA 2BK5A 4J31A 1MXTA 2H88A 5IPYA 1O5WA 2C3DA 2GV8A 2R9ZA 3BI2A 1OJTA 1Q1WA 1EBDA 1EL5A 1JRZA 5FS7A 1ZDLA 3QVRA 1CHUA 2VVMA 2YLRA 3H8IA 5U25A 1O95A 3T37A 1JOAA 2C73A 2WPFA 4CNKA 3NTDA 1F8WA 1ZMCA 2WP9A 2YLZA 4A5LA 2GB0A 4B68A 2R0GA 5IQ1A 3SFDA 1SEZA 3AEBA 1H6VA 3HZLA 1UKVG 1Q9IA 5KRQA 3CPHG 1GPEA 2PHHA 2C7GA 4APNA 4YKGA 2VOUA 3CPIG 1LTXR 2GQFA 2FBWA 1PBCA 4KX6A 2TMDA 4DNAA 5U63A 4CRTA 1PN0A 2NVKX 3PS9A 4U8OA 4EIQA 3UKFA 2RGOA 4X4JA 2WESA 1GRAA 3R9UA 1OJCA 4NEVA 4B63A 2JKCA 4RG3A 1NHSA 3AEAA 1ONFA 2V3BA 3GYIA 2GVCA 3B6DA 2UZZA 2WP5A 2EQ6A 3NYFA 4XWZA 1AOGA 1REOA 4PABA 1NG4A 2JBVA 2VVLA 3G5QA 3OC4A 4K22A 4U2LA 2BCPA 2YR5A 2R0PA 5BUKA 3LADA 2OA1A 4H2QA 2WDRA 3KA7A 3URHA 2BA9A 4H4SA 3UOXA 1PXBA 3EAOA 4I58A 2WBAA 3GRTA 3AD8B 2X8GA 3D1CA 1NHQA 2JB2A 5BVAA 2V60A 4Y4MA 1IUSA 3AYLA 4X9NA 5GSNA 1DNCA 3QVPA 3AE9A 3CGBA 1E1MA 1LJ1A 3ADAB 1NG3A 3F8RA 3CGEA 1D7YA 3M0OA 2YG4A 3Q9TA 2FJBA 3UP4A 1JNZA 3UOVA 2C76A 3UTEA 4EMJA 1NHRA 4GUVA 3SGLA 5BRTA 1GERA 1ZX9A 4M52A 1ZP0A 5DBJA 1CC4A 1D4DA 2ZZCA 1L9EA 3UCLA 4TM0A 4FK1C 1GT8A 1YQ4A 2E4GA 2YVGA 1ZOYA 4OCGA 3FIMB 1PJ7A 3VRBA 1K4QA 1VG9A 2OLOA 2XLTA 1RYIA 2GMHA 2XVHA 4YXDA 2BXRA 2Q7VA 4HB9A 4A99A 3NH3X 3NG7X 2RGJA 2YM2A 3G5SA 5KVIA 4BV6A 1DJNA 1GOSA 2YAUA 5HHFA 1PBDA 2GR0A 4NTEA 2DKHA 3CNPA 2GAGB 4IVOB 1GREA 2GR2A 3REDA 3UKAA 3DK9A 1PBFA 4USQA 4A65A 2WETA 2BACA 1Q1RA 2CVJA 2YVFA 1D7LA 2V5ZA 3GWDA 4UDQA 2V61A 2YQUA 3F8DA 4H2RA 4U8LA 4YWOA 1JNRA 2XVEA 3RP7A 3FPZA 4U8MA 3AE6A 3ABVA 1H86A 3NK0X 3P4SA 1GTEA 3BHKA 1GRFA 5FS8A 2B76A 1IUVA 1L9CA 2XVJA 1TDOA 4RSLA 2ZZ0A 2QA1A 4UDPA 1F8RA 3K30A 4OPGA 4TLZA 2WU5A 2XLRA 1OJ9A 4HA6A 5CKUA 5EBKA 3UOZA 4ECHA 1ELIA 2B9XA 4U8NA
chains in the Genus database with same CATH superfamily
4GRTA 4TM4A 2WDQA 3SFEA 1CF3A 3AWIA 3DGZA 1GXFA 2WEUA 4XXGA 5GRTA 5L46A 3OZ2A 4CCQA 1E1LA 2FJAA 1CC2A 3KPFA 3RP6A 3AD7B 3C96A 1V59A 4GDPA 3ZYXA 1ZK7A 3IF9A 4B65A 1M64A 4AP3A 1PBBA 2WP6A 2Q0KA 3D8XA 3UKPA 3UTFA 2BS3A 2C3CA 4U8KA 5C2TA 2YR6A 1GALA 1DJQA 3ICSA 3ALJA 4OPCA 1DOEA 4BJZA 1NDAA 1PS9A 1VG0A 2E1MA 3JSKA 2GAHB 4O5QA 4GCMA 2HQMA 4H4UA 4BK2A 2IVEA 4OPTA 4OPIA 1JU2A 2JAEA 2AR8A 4H4XA 4RG4A 1E39A 5KNLA 3Q6JA 1XPQA 2XVIA 2BC1A 4EIPA 4AT2A 2XFPA 2WPCA 3IC9A 2X3NA 4EM4A 1PBEA 4ICYA 3BNUA 3AXBA 1H7WA 3AYJA 5HXIA 4EQRA 4G6HA 1L0VA 2J3NA 1LQUA 1O94A 4FK1A 4Z2RA 3CNDA 5KVHA 2VVLG 4REKA 4D04A 1PJ6A 2VZ2A 2Q6UA 4K5SA 3LZXA 4AT0A 4CY8A 4YTPA 2YG6A 2V6OA 3KD9A 4A6NB 2ACZA 4U8IA 5FS9A 3GDNA 2BK4A 1DODA 3NIXA 2C70A 4USRA 3QSEA 1ZOVA 1GEUA 3RHAA 4YSHA 3AB1A 1JRYA 1KFYA 3KLJA 4A7AA 3AE7A 2DKIA 3P1WA 3IHGA 2V3AA 3KPKA 3NRNA 4LU6A 3AE1A 1JEHA 2XYOA 1PJ5A 5IQ4A 2C66A 1KNPA 1B8SA 4K8DA 5J60A 1NPXA 1IUTA 3LJPA 3AECA 2QAEA 1VQWA 4C3XA 4B66A 1QJDA 3UTGA 3NTAA 1YY5A 1CJCA 2QCUA 2VRLA 1XDIA 3VR8A 2BS4A 1DXLA 2XVFA 2A89A 2GF3A 4WCTA 4AP1A 5JCMA 1BF3A 4YKFA 2R45A 4U8PA 5KOXA 2OAMA 4H4WA 2YM1A 3LZWA 1TDEA 1GRGA 3KKJA 4ZCCA 3T2ZA 4YSYA 1YQZA 4YTMA 4J36A 4GF7A 1M6IA 4K2XA 2BYBA 1VDCA 2YG7A 1F8SA 3K7MX 1LPFA 2CULA 3DJEA 3DK8A 3RP8A 4J56A 3DK4A 4II2A 5KWFA 1BGNA 3GWFA 1GETA 4NZHA 2C65A 4B64A 3CN8A 3EPTA 3GD4A 2WU2A 5TR3A 1CJ4A 1KNRA 2C75A 2CFYA 2XLSA 4U8JA 2E5VA 3II4A 1KF6A 2Z5XA 1YQ3A 2BK3A 4BK1A 4YT0A 4JDRA 1D4EA 3P4PA 5KMQA 3UKHA 2F5ZA 2WPEA 3V3NA 4NTCA 5HYMA 1N1PA 1OJAA 4ZN0A 2YLXA 3I6DA 2VQBA 1MOKA 1K0IA 1CJ2A 2YLWA 2C4CA 1RP0A 3ITJA 2WOWA 4G9KA 1DOCA 1KSSA 5BULA 5JCNA 2GRTA 2APGA 3DH9A 2WHDA 5JCKA 1LV0A 1BGJA 4OPLA 3LXDA 3NNEA 2Y6QA 3NN6X 3ICTA 4ZCDA 1NHPA 4K7ZA 5M10A 2XCGA 1B37A 3B3RA 3H4KA 3DMEA 3BHFA 1IUUA 1N4WA 2OALA 3P4RA 1BZLA 1CL0A 3CNJA 1QLBA 4DGKA 5U1OA 2R0CA 5JCLA 3AE2A 5EB5A 3GYJA 3P9UA 4AOXA 5HY5A 1TDKA 1H81A 3GRSA 4CCRA 1E1NA 2BRAA 4OPDA 2YG5A 1LQTA 3GMBA 2IVDA 4BJYA 2Q0LA 4OPUA 4TLXA 3DJJA 3NK1X 4N9XA 2FJEA 2YR4A 2YLSA 4O5UA 4EQXA 3LB8A 1Y56A 3LOVA 1L9DA 4G74A 5J7XA 4NTDA 3SY4A 3K7QX 4FX9A 1H84A 1LVLA 3AEDA 4GAPA 3F8PA 4J34A 1IUXA 1TRBA 3T31A 3VRAA 4H2NA 2EQ8A 2C67A 4H4RA 3G5RA 3CNTA 2WS3A 3T2KA 2GEWA 2BABA 3SZFA 3FBSA 2BXSA 2BCGG 3C4NA 2O9ZA 4MJWA 2NPXA 2YVJA 3PO7A 3QSMA 2X8CA 3DGHA 3IWAA 2WOVA 4P9SA 2JK6A 3GDPA 3EF6A 3UKQA 2PYXA 2R46A 1ZMDA 3EANA 1N4UA 4NNJA 1OJDA 3CTYA 2C72A 3P4QA 1TYPA 3VRDB 4H4ZA 1EL8A 3QJ4A 1S3BA 1TDFA 1B5QA 1S2QA 3V3OA 4Z26A 3H8LA 1PDHA 5FMHA 1JRXA 4BK3A 1COYA 1E7PA 4EMIA 2C64A 3ICRA 4H50A 4A79A 1FOHA 3V76A 4YSXA 3K7TA 4IVMB 3UTHA 4Y4LA 2VQ7A 1KSUA 2OLNA 1KDGA 3ALLA 1QO8A 4H4TA 3GD3A 4CBQA 1VRQB 2XFUA 2YG3A 4C3YA 4Y4NA 1YKJA 1TDNA 3GYXA 1MO9A 3FG2P 3PVCA 3QFBA 4NEWA 4DSHA 3AE5A 5KOWA 3CGDA 4D03A 4UP3A 1EL7A 4JNQA 5EB4A 4Z25A 3SZ0A 3RNMA 3HYVA 2X99A 1GRHA 4GDEA 4KPRA 3BI4A 3COXA 1H83A 2ARDA 2QA2A 1IUWA 1FECA 4GR1A 3ZDNA 2IIDA 2VRMA 3QSSA 1PXCA 1BWCA 3NKSA 3NYEA 2ZZBA 3GMCA 1RSGA 3O0HA 2AAQA 2I0ZA 3M13A 1HYUA 3S61A 4J2WA 1GNDA 4J33A 5ER0A 4K5RA 2XFQA 4H7UA 5LV9A 3SM8A 4TM3A 1F6MA 1E1KA 1H7XA 1Y56B 4I59A 4H4QA 4J57A 1B4VA 3NHOX 1E6EA 1GSNA 1XHCA 1FEBA 3I3LA 3AE4A 1IJHA 1Y0PA 3ISHA 3L1RA 3UKLA 3KU9A 4IA6A 3AE8A 2FJDA 1NAAA 2XFNA 2Y6RA 4LIIA 4TM1A 3UOYA 4Z44A 3AEFA 4JN9A 4G73A 2B9WA 4CY6A 4X9MA 2B7RA 3AEGA 4AOSA 1GV4A 1CJ3A 2RGHA 1N4VA 5C3JA 1XANA 3WE0A 3CNSA 3E1TA 2EQ7A 3AYIA 4EQWA 1GRTA 2B7SA 3SQPA 2TPRA 5KXJA 2GMJA 4WX1A 1ZKQA 4YTNA 3CPJG 3L8KA 1NEKA 3NK2X 4EM3A 4G6GA 2WOIA 1S3EA 3NGCX 4A6NA 2BC0A 1BKWA 2EQ9A 1D4CA 3QFAA 2R4EA 4NWZA 4JY2A 3T0KA 4E0VA 4DSGA 4Z43A 1H82A 3DJDA 2GH5A 5JCIA 1S2YA 2CDUA 4ADWA 4JQ9A 4IV9A 4H4PA 1D5TA 2X8HA 1TYTA 3C4AA 4C5OA 3NN0X 5M0ZA 4CNJA 1CBOA 4EMWA 3CIRA 4LA1A 3ATRA 2WQYA 2XLPA 1FCDA 1FEAA 4Z2TA 2XLUA 4OVIA 4EQSA 1K0JA 4B69A 2YWLA 3CMMA 4B67A 4U2TA 4B1BA 1FL2A 2A8XA 3S5WA 4A9WA 2GR3A 2A87A 4H4VA 4YSZA 3M12A 1GRBA 4PAAA 3DJGX 3IHMA 4FDCB 4H2PA 4H4YA 3HYXA 4IA5A 4JNAA 1EL9A 1CC6A 2YLTA 3FMWA 2RABA 3AE3A 2BRYA 1Z6LA 3UP5A 1DOBA 2XDOA 3KVEA 2H89A 4Z2UA 3ALMA 2AQJA 4UDRA 3BI5A 3VR9A 1W4XA 2R4JA 2WDVA 4JY3A 1GTHA 3BNMA 4Z24A 3SYIA 2ZBWA 2GR1A 3SX6A 2JB1A 3AEEA 1X31B 2X50A 1NENA 2BS2A 5EOWA 1ZY8A 1P2EA 3T2YA 2Z5YA 5CQFA 1P2HA 1PXAA 3CGCA 2W0HA 4C77A 3NYCA 3UKKA 3VQRA 1PHHA 3DA1A 2B9YA 5FS6A 1GESA 1K0LA 3NLCA 4C74A 2JB3A 1F3PA 2GQWA 4II3A 4XWRA 3ATQA 3AD9B 3GSIA 4U2SA 3SZCA 3T14A 3NT6A 4BURA 2XFOA 2BK5A 4J31A 1MXTA 2H88A 5IPYA 1O5WA 2C3DA 2GV8A 2R9ZA 3BI2A 1OJTA 1Q1WA 1EBDA 1EL5A 1JRZA 5FS7A 1ZDLA 3QVRA 1CHUA 2VVMA 2YLRA 3H8IA 5U25A 1O95A 3T37A 1JOAA 2C73A 2WPFA 4CNKA 3NTDA 1F8WA 1ZMCA 2WP9A 2YLZA 5KMRA 4A5LA 2GB0A 4B68A 2R0GA 5IQ1A 3SFDA 1SEZA 3AEBA 1H6VA 3HZLA 1UKVG 1Q9IA 5KRQA 3CPHG 1GPEA 2PHHA 2C7GA 4APNA 4YKGA 2VOUA 3CPIG 1LTXR 2GQFA 2FBWA 1PBCA 4KX6A 2TMDA 4DNAA 5U63A 4CRTA 1PN0A 2NVKX 3PS9A 4U8OA 4EIQA 3UKFA 2RGOA 4X4JA 2WESA 1GRAA 3R9UA 1OJCA 4NEVA 4B63A 2JKCA 4RG3A 1NHSA 3AEAA 1ONFA 2V3BA 3HYWA 3GYIA 2GVCA 3B6DA 2UZZA 5KMSA 4GAVA 2WP5A 2EQ6A 3NYFA 4XWZA 1AOGA 1REOA 4PABA 1NG4A 2JBVA 2VVLA 3G5QA 3OC4A 4K22A 4U2LA 2BCPA 2YR5A 2R0PA 5BUKA 3LADA 2OA1A 4H2QA 2WDRA 3KA7A 3URHA 2BA9A 4H4SA 3UOXA 1PXBA 3EAOA 4I58A 2WBAA 3SZWA 3GRTA 3AD8B 2X8GA 3D1CA 3SXIA 1NHQA 2JB2A 5BVAA 2V60A 4Y4MA 1IUSA 3AYLA 4X9NA 5GSNA 1DNCA 3QVPA 3AE9A 3CGBA 1E1MA 1LJ1A 3ADAB 1NG3A 3F8RA 3CGEA 1D7YA 3M0OA 2YG4A 3Q9TA 2FJBA 3UP4A 1JNZA 3UOVA 2C76A 3UTEA 4EMJA 1NHRA 4GUVA 3SGLA 5BRTA 1GERA 1ZX9A 4M52A 1ZP0A 5DBJA 1CC4A 1D4DA 2ZZCA 1L9EA 3UCLA 5KMPA 4TM0A 4FK1C 1GT8A 1YQ4A 2E4GA 2YVGA 1ZOYA 4OCGA 3FIMB 1PJ7A 3VRBA 1K4QA 1VG9A 2OLOA 2XLTA 1RYIA 2GMHA 2XVHA 4YXDA 2BXRA 2Q7VA 4HB9A 4A99A 3NH3X 3NG7X 2RGJA 2YM2A 3G5SA 5KVIA 4BV6A 1DJNA 1GOSA 2YAUA 5HHFA 1PBDA 2GR0A 4NTEA 2DKHA 3CNPA 2GAGB 4IVOB 1GREA 2GR2A 3REDA 3UKAA 3DK9A 1PBFA 4USQA 4A65A 2WETA 2BACA 1Q1RA 2CVJA 2YVFA 1D7LA 2V5ZA 3GWDA 4UDQA 2V61A 2YQUA 3F8DA 4H2RA 4U8LA 4YWOA 1JNRA 2XVEA 3RP7A 3FPZA 4U8MA 3AE6A 3ABVA 1H86A 3NK0X 3P4SA 1GTEA 3BHKA 1GRFA 5FS8A 2B76A 1IUVA 1L9CA 2XVJA 1TDOA 4RSLA 2ZZ0A 2QA1A 4UDPA 1F8RA 3K30A 4OPGA 4TLZA 2WU5A 2XLRA 1OJ9A 4HA6A 5CKUA 5EBKA 3UOZA 4ECHA 1ELIA 2B9XA 4U8NA
chains in the Genus database with same CATH topology
4GRTA 4TM4A 2WDQA 3SFEA 1CF3A 3AWIA 3DGZA 1GXFA 2WEUA 4XXGA 5GRTA 5L46A 3OZ2A 4CCQA 1E1LA 2FJAA 1CC2A 3KPFA 3RP6A 3AD7B 3C96A 1V59A 4GDPA 3ZYXA 1ZK7A 3IF9A 4B65A 1M64A 4AP3A 1PBBA 2WP6A 2Q0KA 3D8XA 3UKPA 3UTFA 2BS3A 2C3CA 4U8KA 5C2TA 2YR6A 1GALA 1DJQA 3ICSA 3ALJA 4OPCA 1DOEA 4BJZA 1NDAA 1PS9A 1VG0A 2E1MA 3JSKA 2GAHB 4O5QA 4GCMA 2HQMA 4H4UA 4BK2A 2IVEA 4OPTA 4OPIA 1JU2A 2JAEA 2AR8A 4H4XA 4RG4A 1E39A 5KNLA 3Q6JA 1XPQA 2XVIA 2BC1A 4EIPA 4AT2A 2XFPA 2WPCA 3IC9A 2X3NA 4EM4A 1PBEA 4ICYA 3BNUA 3AXBA 1H7WA 3AYJA 5HXIA 4EQRA 4G6HA 1L0VA 2J3NA 1LQUA 1O94A 4FK1A 4Z2RA 3CNDA 5KVHA 2VVLG 4REKA 4D04A 1PJ6A 2VZ2A 2Q6UA 4K5SA 3LZXA 4AT0A 4CY8A 4YTPA 2YG6A 2V6OA 3KD9A 4A6NB 2ACZA 4U8IA 5FS9A 3GDNA 2BK4A 1DODA 3NIXA 2C70A 4USRA 3QSEA 1ZOVA 1GEUA 3RHAA 4YSHA 3AB1A 1JRYA 1KFYA 3KLJA 4A7AA 3AE7A 2DKIA 3P1WA 3IHGA 2V3AA 3KPKA 3NRNA 4LU6A 3AE1A 1JEHA 2XYOA 1PJ5A 5IQ4A 2C66A 1KNPA 1B8SA 4K8DA 5J60A 1NPXA 1IUTA 3LJPA 3AECA 2QAEA 1VQWA 4C3XA 4B66A 1QJDA 3UTGA 3NTAA 1YY5A 1CJCA 2QCUA 2VRLA 1XDIA 3VR8A 2BS4A 1DXLA 2XVFA 2A89A 2GF3A 4WCTA 4AP1A 5JCMA 1BF3A 4YKFA 2R45A 4U8PA 5KOXA 2OAMA 4H4WA 2YM1A 3LZWA 1TDEA 1GRGA 3KKJA 4ZCCA 3T2ZA 4YSYA 1YQZA 4YTMA 4J36A 4GF7A 1M6IA 4K2XA 2BYBA 1VDCA 2YG7A 1F8SA 3K7MX 1LPFA 2CULA 3DJEA 3DK8A 3RP8A 4J56A 3DK4A 4II2A 5KWFA 1BGNA 3GWFA 1GETA 4NZHA 2C65A 4B64A 3CN8A 3EPTA 3GD4A 2WU2A 5TR3A 1CJ4A 1KNRA 2C75A 2CFYA 2XLSA 4U8JA 2E5VA 3II4A 1KF6A 2Z5XA 1YQ3A 2BK3A 4BK1A 4YT0A 4JDRA 1D4EA 3P4PA 5KMQA 3UKHA 2F5ZA 2WPEA 3V3NA 4NTCA 5HYMA 1N1PA 1OJAA 4ZN0A 2YLXA 3I6DA 2VQBA 1MOKA 1K0IA 1CJ2A 2YLWA 2C4CA 1RP0A 3ITJA 2WOWA 4G9KA 1DOCA 1KSSA 5BULA 5JCNA 2GRTA 2APGA 3DH9A 2WHDA 5JCKA 1LV0A 1BGJA 4OPLA 3LXDA 3NNEA 2Y6QA 3NN6X 3ICTA 4ZCDA 1NHPA 4K7ZA 5M10A 2XCGA 1B37A 3B3RA 3H4KA 3DMEA 3BHFA 1IUUA 1N4WA 2OALA 3P4RA 1BZLA 1CL0A 3CNJA 1QLBA 4DGKA 5U1OA 2R0CA 5JCLA 3AE2A 5EB5A 3GYJA 3P9UA 4AOXA 5HY5A 1TDKA 1H81A 3GRSA 4CCRA 1E1NA 2BRAA 4OPDA 2YG5A 1LQTA 3GMBA 2IVDA 4BJYA 2Q0LA 4OPUA 4TLXA 3DJJA 3NK1X 4N9XA 2FJEA 2YR4A 2YLSA 4O5UA 4EQXA 3LB8A 1Y56A 3LOVA 1L9DA 4G74A 5J7XA 4NTDA 3SY4A 3K7QX 4FX9A 1H84A 1LVLA 3AEDA 4GAPA 3F8PA 4J34A 1IUXA 1TRBA 3T31A 3VRAA 4H2NA 2EQ8A 2C67A 4H4RA 3G5RA 3CNTA 2WS3A 3T2KA 2GEWA 2BABA 3SZFA 3FBSA 2BXSA 2BCGG 3C4NA 2O9ZA 4MJWA 2NPXA 2YVJA 3PO7A 3QSMA 2X8CA 3DGHA 3IWAA 2WOVA 4P9SA 2JK6A 3GDPA 3EF6A 3UKQA 2PYXA 2R46A 1ZMDA 3EANA 1N4UA 4NNJA 1OJDA 3CTYA 2C72A 3P4QA 1TYPA 3VRDB 4H4ZA 1EL8A 3QJ4A 1S3BA 1TDFA 1B5QA 1S2QA 3V3OA 4Z26A 3H8LA 1PDHA 5FMHA 1JRXA 4BK3A 1COYA 1E7PA 4EMIA 2C64A 3ICRA 4H50A 4A79A 1FOHA 3V76A 4YSXA 3K7TA 4IVMB 3UTHA 4Y4LA 2VQ7A 1KSUA 2OLNA 1KDGA 3ALLA 1QO8A 4H4TA 3GD3A 4CBQA 1VRQB 2XFUA 2YG3A 4C3YA 4Y4NA 1YKJA 1TDNA 3GYXA 1MO9A 3FG2P 3PVCA 3QFBA 4NEWA 4DSHA 3AE5A 5KOWA 3CGDA 4D03A 4UP3A 1EL7A 4JNQA 5EB4A 4Z25A 3SZ0A 3RNMA 3HYVA 2X99A 1GRHA 4GDEA 4KPRA 3BI4A 3COXA 1H83A 2ARDA 2QA2A 1IUWA 1FECA 4GR1A 3ZDNA 2IIDA 2VRMA 3QSSA 1PXCA 1BWCA 3NKSA 3NYEA 2ZZBA 3GMCA 1RSGA 3O0HA 2AAQA 2I0ZA 3M13A 1HYUA 3S61A 4J2WA 1GNDA 4J33A 5ER0A 4K5RA 2XFQA 4H7UA 5LV9A 3SM8A 4TM3A 1F6MA 1E1KA 1H7XA 1Y56B 4I59A 4H4QA 4J57A 1B4VA 3NHOX 1E6EA 1GSNA 1XHCA 1FEBA 3I3LA 3AE4A 1IJHA 1Y0PA 3ISHA 3L1RA 3UKLA 3KU9A 4IA6A 3AE8A 2FJDA 1NAAA 2XFNA 2Y6RA 4LIIA 4TM1A 3UOYA 4Z44A 3AEFA 4JN9A 4G73A 2B9WA 4CY6A 4X9MA 2B7RA 3AEGA 4AOSA 1GV4A 1CJ3A 2RGHA 1N4VA 5C3JA 1XANA 3WE0A 3CNSA 3E1TA 2EQ7A 3AYIA 4EQWA 1GRTA 2B7SA 3SQPA 2TPRA 5KXJA 2GMJA 4WX1A 1ZKQA 4YTNA 3CPJG 3L8KA 1NEKA 3NK2X 4EM3A 4G6GA 2WOIA 1S3EA 3NGCX 4A6NA 2BC0A 1BKWA 2EQ9A 1D4CA 3QFAA 2R4EA 4NWZA 4JY2A 3T0KA 4E0VA 4DSGA 4Z43A 1H82A 3DJDA 2GH5A 5JCIA 1S2YA 2CDUA 4ADWA 4JQ9A 4IV9A 4H4PA 1D5TA 2X8HA 1TYTA 3C4AA 4C5OA 3NN0X 5M0ZA 4CNJA 1CBOA 4EMWA 3CIRA 4LA1A 3ATRA 2WQYA 2XLPA 1FCDA 1FEAA 4Z2TA 2XLUA 4OVIA 4EQSA 1K0JA 4B69A 2YWLA 3CMMA 4B67A 4U2TA 4B1BA 1FL2A 2A8XA 3S5WA 4A9WA 2GR3A 2A87A 4H4VA 4YSZA 3M12A 1GRBA 4PAAA 3DJGX 3IHMA 4FDCB 4H2PA 4H4YA 3HYXA 4IA5A 4JNAA 1EL9A 1CC6A 2YLTA 3FMWA 2RABA 3AE3A 2BRYA 1Z6LA 3UP5A 1DOBA 2XDOA 3KVEA 2H89A 4Z2UA 3ALMA 2AQJA 4UDRA 3BI5A 3VR9A 1W4XA 2R4JA 2WDVA 4JY3A 1GTHA 3BNMA 4Z24A 3SYIA 2ZBWA 2GR1A 3SX6A 2JB1A 3AEEA 1X31B 2X50A 1NENA 2BS2A 5EOWA 1ZY8A 1P2EA 3T2YA 2Z5YA 5CQFA 1P2HA 1PXAA 3CGCA 2W0HA 4C77A 3NYCA 3UKKA 3VQRA 1PHHA 3DA1A 2B9YA 5FS6A 1GESA 1K0LA 3NLCA 4C74A 2JB3A 1F3PA 2GQWA 4II3A 4XWRA 3ATQA 3AD9B 3GSIA 4U2SA 3SZCA 3T14A 3NT6A 4BURA 2XFOA 2BK5A 4J31A 1MXTA 2H88A 5IPYA 1O5WA 2C3DA 2GV8A 2R9ZA 3BI2A 1OJTA 1Q1WA 1EBDA 1EL5A 1JRZA 5FS7A 1ZDLA 3QVRA 1CHUA 2VVMA 2YLRA 3H8IA 5U25A 1O95A 3T37A 1JOAA 2C73A 2WPFA 4CNKA 3NTDA 1F8WA 1ZMCA 2WP9A 2YLZA 5KMRA 4A5LA 2GB0A 4B68A 2R0GA 5IQ1A 3SFDA 1SEZA 3AEBA 1H6VA 3HZLA 1UKVG 1Q9IA 5KRQA 3CPHG 1GPEA 2PHHA 2C7GA 4APNA 4YKGA 2VOUA 3CPIG 1LTXR 2GQFA 2FBWA 1PBCA 4KX6A 2TMDA 4DNAA 5U63A 4CRTA 1PN0A 2NVKX 3PS9A 4U8OA 4EIQA 3UKFA 2RGOA 4X4JA 2WESA 1GRAA 3R9UA 1OJCA 4NEVA 4B63A 2JKCA 4RG3A 1NHSA 3AEAA 1ONFA 2V3BA 3HYWA 3GYIA 2GVCA 3B6DA 2UZZA 5KMSA 4GAVA 2WP5A 2EQ6A 3NYFA 4XWZA 1AOGA 1REOA 4PABA 1NG4A 2JBVA 2VVLA 3G5QA 3OC4A 4K22A 4U2LA 2BCPA 2YR5A 2R0PA 5BUKA 3LADA 2OA1A 4H2QA 2WDRA 3KA7A 3URHA 2BA9A 4H4SA 3UOXA 1PXBA 3EAOA 4I58A 2WBAA 3SZWA 3GRTA 3AD8B 2X8GA 3D1CA 3SXIA 1NHQA 2JB2A 5BVAA 2V60A 4Y4MA 1IUSA 3AYLA 4X9NA 5GSNA 1DNCA 3QVPA 3AE9A 3CGBA 1E1MA 1LJ1A 3ADAB 1NG3A 3F8RA 3CGEA 1D7YA 3M0OA 2YG4A 3Q9TA 2FJBA 3UP4A 1JNZA 3UOVA 2C76A 3UTEA 4EMJA 1NHRA 4GUVA 3SGLA 5BRTA 1GERA 1ZX9A 4M52A 1ZP0A 5DBJA 1CC4A 1D4DA 2ZZCA 1L9EA 3UCLA 5KMPA 4TM0A 4FK1C 1GT8A 1YQ4A 2E4GA 2YVGA 1ZOYA 4OCGA 3FIMB 1PJ7A 3VRBA 1K4QA 1VG9A 2OLOA 2XLTA 1RYIA 2GMHA 2XVHA 4YXDA 2BXRA 2Q7VA 4HB9A 4A99A 3NH3X 3NG7X 2RGJA 2YM2A 3G5SA 5KVIA 4BV6A 1DJNA 1GOSA 2YAUA 5HHFA 1PBDA 2GR0A 4NTEA 2DKHA 3CNPA 2GAGB 4IVOB 1GREA 2GR2A 3REDA 3UKAA 3DK9A 1PBFA 4USQA 4A65A 2WETA 2BACA 1Q1RA 2CVJA 2YVFA 1D7LA 2V5ZA 3GWDA 4UDQA 2V61A 2YQUA 3F8DA 4H2RA 4U8LA 4YWOA 1JNRA 2XVEA 3RP7A 3FPZA 4U8MA 3AE6A 3ABVA 1H86A 3NK0X 3P4SA 1GTEA 3BHKA 1GRFA 5FS8A 2B76A 1IUVA 1L9CA 2XVJA 1TDOA 4RSLA 2ZZ0A 2QA1A 4UDPA 1F8RA 3K30A 4OPGA 4TLZA 2WU5A 2XLRA 1OJ9A 4HA6A 5CKUA 5EBKA 3UOZA 4ECHA 1ELIA 2B9XA 4U8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GRT A;  4TM4 A;  2WDQ A;  3SFE A;  1CF3 A;  3AWI A;  3DGZ A;  1GXF A;  2WEU A;  4XXG A;  5GRT A;  5L46 A;  3OZ2 A;  4CCQ A;  1E1L A;  2FJA A;  1CC2 A;  3KPF A;  3RP6 A;  3AD7 B;  3C96 A;  1V59 A;  4GDP A;  3ZYX A;  1ZK7 A;  3IF9 A;  4B65 A;  1M64 A;  4AP3 A;  1PBB A;  2WP6 A;  2Q0K A;  3D8X A;  3UKP A;  3UTF A;  2BS3 A;  2C3C A;  4U8K A;  5C2T A;  2YR6 A;  1GAL A;  1DJQ A;  3ICS A;  3ALJ A;  4OPC A;  1DOE A;  4BJZ A;  1NDA A;  1PS9 A;  1VG0 A;  2E1M A;  3JSK A;  2GAH B;  4O5Q A;  4GCM A;  2HQM A;  4H4U A;  4BK2 A;  2IVE A;  4OPT A;  4OPI A;  1JU2 A;  2JAE A;  2AR8 A;  4H4X A;  4RG4 A;  1E39 A;  3Q6J A;  1XPQ A;  2XVI A;  2BC1 A;  4EIP A;  4AT2 A;  2XFP A;  2WPC A;  3IC9 A;  2X3N A;  4EM4 A;  1PBE A;  4ICY A;  3BNU A;  3AXB A;  1H7W A;  3AYJ A;  5HXI A;  4EQR A;  1L0V A;  2J3N A;  1LQU A;  1O94 A;  4FK1 A;  4Z2R A;  3CND A;  5KVH A;  2VVL G;  4REK A;  4D04 A;  1PJ6 A;  2VZ2 A;  2Q6U A;  4K5S A;  3LZX A;  4AT0 A;  4CY8 A;  4YTP A;  2YG6 A;  2V6O A;  3KD9 A;  4A6N B;  2ACZ A;  4U8I A;  5FS9 A;  3GDN A;  2BK4 A;  1DOD A;  3NIX A;  2C70 A;  4USR A;  3QSE A;  1ZOV A;  1GEU A;  3RHA A;  4YSH A;  3AB1 A;  1JRY A;  1KFY A;  3KLJ A;  4A7A A;  3AE7 A;  2DKI A;  3P1W A;  3IHG A;  2V3A A;  3NRN A;  4LU6 A;  3AE1 A;  1JEH A;  2XYO A;  1PJ5 A;  5IQ4 A;  2C66 A;  1KNP A;  1B8S A;  4K8D A;  5J60 A;  1NPX A;  1IUT A;  3LJP A;  3AEC A;  2QAE A;  1VQW A;  4C3X A;  4B66 A;  1QJD A;  3UTG A;  3NTA A;  1YY5 A;  1CJC A;  2QCU A;  2VRL A;  1XDI A;  3VR8 A;  2BS4 A;  1DXL A;  2XVF A;  2A89 A;  2GF3 A;  4WCT A;  4AP1 A;  5JCM A;  1BF3 A;  4YKF A;  2R45 A;  4U8P A;  5KOX A;  2OAM A;  4H4W A;  2YM1 A;  3LZW A;  1TDE A;  1GRG A;  3KKJ A;  4ZCC A;  4YSY A;  1YQZ A;  4YTM A;  4J36 A;  4GF7 A;  1M6I A;  4K2X A;  2BYB A;  1VDC A;  2YG7 A;  1F8S A;  3K7M X;  1LPF A;  2CUL A;  3DJE A;  3DK8 A;  3RP8 A;  4J56 A;  3DK4 A;  5KWF A;  1BGN A;  3GWF A;  1GET A;  4NZH A;  2C65 A;  4B64 A;  3CN8 A;  3EPT A;  3GD4 A;  2WU2 A;  5TR3 A;  1CJ4 A;  1KNR A;  2C75 A;  2CFY A;  2XLS A;  4U8J A;  2E5V A;  3II4 A;  1KF6 A;  2Z5X A;  1YQ3 A;  2BK3 A;  4BK1 A;  4YT0 A;  4JDR A;  1D4E A;  3P4P A;  3UKH A;  2F5Z A;  2WPE A;  3V3N A;  4NTC A;  5HYM A;  1N1P A;  1OJA A;  4ZN0 A;  2YLX A;  3I6D A;  2VQB A;  1MOK A;  1K0I A;  1CJ2 A;  2YLW A;  1RP0 A;  3ITJ A;  2WOW A;  1DOC A;  1KSS A;  5BUL A;  5JCN A;  2GRT A;  2APG A;  3DH9 A;  2WHD A;  5JCK A;  1LV0 A;  1BGJ A;  4OPL A;  3LXD A;  3NNE A;  2Y6Q A;  3NN6 X;  3ICT A;  4ZCD A;  1NHP A;  4K7Z A;  5M10 A;  2XCG A;  1B37 A;  3B3R A;  3H4K A;  3DME A;  3BHF A;  1IUU A;  1N4W A;  2OAL A;  3P4R A;  1BZL A;  1CL0 A;  3CNJ A;  1QLB A;  4DGK A;  5U1O A;  2R0C A;  5JCL A;  3AE2 A;  5EB5 A;  3GYJ A;  3P9U A;  4AOX A;  5HY5 A;  1TDK A;  1H81 A;  3GRS A;  4CCR A;  1E1N A;  4OPD A;  2YG5 A;  1LQT A;  3GMB A;  2IVD A;  4BJY A;  2Q0L A;  4OPU A;  4TLX A;  3DJJ A;  3NK1 X;  4N9X A;  2FJE A;  2YR4 A;  2YLS A;  4O5U A;  4EQX A;  3LB8 A;  1Y56 A;  3LOV A;  1L9D A;  5J7X A;  4NTD A;  3K7Q X;  4FX9 A;  1H84 A;  1LVL A;  3AED A;  3F8P A;  4J34 A;  1IUX A;  1TRB A;  3VRA A;  4H2N A;  2EQ8 A;  2C67 A;  4H4R A;  3G5R A;  3CNT A;  2WS3 A;  2GEW A;  2BAB A;  3FBS A;  2BXS A;  2BCG G;  3C4N A;  2O9Z A;  4MJW A;  2NPX A;  2YVJ A;  3PO7 A;  3QSM A;  2X8C A;  3DGH A;  3IWA A;  2WOV A;  4P9S A;  2JK6 A;  3GDP A;  3EF6 A;  3UKQ A;  2PYX A;  2R46 A;  1ZMD A;  3EAN A;  1N4U A;  1OJD A;  3CTY A;  2C72 A;  3P4Q A;  1TYP A;  3VRD B;  4H4Z A;  1EL8 A;  3QJ4 A;  1S3B A;  1TDF A;  1B5Q A;  1S2Q A;  3V3O A;  4Z26 A;  3H8L A;  1PDH A;  5FMH A;  1JRX A;  4BK3 A;  1COY A;  1E7P A;  4EMI A;  2C64 A;  3ICR A;  4H50 A;  4A79 A;  1FOH A;  3V76 A;  4YSX A;  3K7T A;  4IVM B;  3UTH A;  4Y4L A;  2VQ7 A;  1KSU A;  2OLN A;  1KDG A;  3ALL A;  1QO8 A;  4H4T A;  3GD3 A;  4CBQ A;  1VRQ B;  2XFU A;  2YG3 A;  4C3Y A;  4Y4N A;  1YKJ A;  1TDN A;  3PVC A;  1MO9 A;  3FG2 P;  3QFB A;  4NEW A;  4DSH A;  3AE5 A;  5KOW A;  3CGD A;  4D03 A;  4UP3 A;  1EL7 A;  4JNQ A;  5EB4 A;  4Z25 A;  3RNM A;  2X99 A;  1GRH A;  4GDE A;  4KPR A;  3BI4 A;  3COX A;  1H83 A;  2ARD A;  2QA2 A;  1IUW A;  1FEC A;  4GR1 A;  3ZDN A;  2IID A;  2VRM A;  3QSS A;  1PXC A;  1BWC A;  3NKS A;  3NYE A;  2ZZB A;  3GMC A;  1RSG A;  3O0H A;  2AAQ A;  2I0Z A;  3M13 A;  1HYU A;  3S61 A;  4J2W A;  1GND A;  4J33 A;  5ER0 A;  4K5R A;  2XFQ A;  4H7U A;  5LV9 A;  3SM8 A;  4TM3 A;  1F6M A;  1E1K A;  1H7X A;  1Y56 B;  4I59 A;  4H4Q A;  4J57 A;  1B4V A;  3NHO X;  1E6E A;  1GSN A;  1XHC A;  1FEB A;  3I3L A;  3AE4 A;  1IJH A;  1Y0P A;  3ISH A;  3L1R A;  3UKL A;  3KU9 A;  4IA6 A;  3AE8 A;  2FJD A;  1NAA A;  2XFN A;  2Y6R A;  4LII A;  4TM1 A;  3UOY A;  4Z44 A;  3AEF A;  4JN9 A;  4CY6 A;  2B9W A;  4X9M A;  2B7R A;  3AEG A;  4AOS A;  1GV4 A;  1CJ3 A;  2RGH A;  1N4V A;  5C3J A;  1XAN A;  3WE0 A;  3CNS A;  3E1T A;  2EQ7 A;  3AYI A;  4EQW A;  1GRT A;  2B7S A;  3SQP A;  2TPR A;  5KXJ A;  2GMJ A;  4WX1 A;  1ZKQ A;  4YTN A;  3CPJ G;  3L8K A;  1NEK A;  3NK2 X;  4EM3 A;  2WOI A;  1S3E A;  3NGC X;  4A6N A;  2BC0 A;  1BKW A;  2EQ9 A;  1D4C A;  3QFA A;  2R4E A;  4Z43 A;  4JY2 A;  4E0V A;  4DSG A;  1H82 A;  3DJD A;  2GH5 A;  5JCI A;  1S2Y A;  2CDU A;  4ADW A;  4JQ9 A;  4IV9 A;  4H4P A;  1D5T A;  2X8H A;  1TYT A;  3C4A A;  4C5O A;  3NN0 X;  5M0Z A;  4CNJ A;  1CBO A;  4EMW A;  3CIR A;  4LA1 A;  3ATR A;  2WQY A;  2XLP A;  1FCD A;  1FEA A;  4Z2T A;  2XLU A;  4OVI A;  4EQS A;  1K0J A;  4B69 A;  2YWL A;  4B67 A;  4U2T A;  4B1B A;  1FL2 A;  2A8X A;  3S5W A;  4A9W A;  2GR3 A;  2A87 A;  4H4V A;  4YSZ A;  3M12 A;  1GRB A;  4PAA A;  3DJG X;  3IHM A;  4FDC B;  4H2P A;  4H4Y A;  4IA5 A;  4JNA A;  1EL9 A;  1CC6 A;  2YLT A;  3FMW A;  2RAB A;  3AE3 A;  1Z6L A;  3UP5 A;  1DOB A;  2XDO A;  3KVE A;  2H89 A;  4Z2U A;  3ALM A;  2AQJ A;  4UDR A;  3BI5 A;  3VR9 A;  1W4X A;  2R4J A;  2WDV A;  4JY3 A;  1GTH A;  3BNM A;  4Z24 A;  2ZBW A;  2GR1 A;  2JB1 A;  3AEE A;  1X31 B;  2X50 A;  1NEN A;  2BS2 A;  5EOW A;  1ZY8 A;  1P2E A;  2Z5Y A;  5CQF A;  1P2H A;  1PXA A;  3CGC A;  2W0H A;  4C77 A;  3NYC A;  3UKK A;  3VQR A;  1PHH A;  3DA1 A;  2B9Y A;  5FS6 A;  1GES A;  1K0L A;  3NLC A;  4C74 A;  2JB3 A;  1F3P A;  2GQW A;  4XWR A;  3ATQ A;  3AD9 B;  3GSI A;  4U2S A;  3NT6 A;  4BUR A;  2XFO A;  2BK5 A;  4J31 A;  1MXT A;  2H88 A;  5IPY A;  1O5W A;  2C3D A;  2GV8 A;  2R9Z A;  3BI2 A;  1OJT A;  1Q1W A;  1EBD A;  1EL5 A;  1JRZ A;  5FS7 A;  1ZDL A;  3QVR A;  1CHU A;  2VVM A;  2YLR A;  3H8I A;  5U25 A;  1O95 A;  3T37 A;  1JOA A;  2C73 A;  2WPF A;  4CNK A;  3NTD A;  1F8W A;  1ZMC A;  2WP9 A;  2YLZ A;  4A5L A;  2GB0 A;  4B68 A;  2R0G A;  5IQ1 A;  3SFD A;  1SEZ A;  3AEB A;  1H6V A;  3HZL A;  1UKV G;  1Q9I A;  5KRQ A;  3CPH G;  1GPE A;  2PHH A;  2C7G A;  4APN A;  4YKG A;  2VOU A;  3CPI G;  1LTX R;  2GQF A;  2FBW A;  1PBC A;  4KX6 A;  2TMD A;  4DNA A;  5U63 A;  4CRT A;  1PN0 A;  2NVK X;  3PS9 A;  4U8O A;  4EIQ A;  3UKF A;  2RGO A;  4X4J A;  2WES A;  1GRA A;  3R9U A;  1OJC A;  4NEV A;  4B63 A;  2JKC A;  4RG3 A;  1NHS A;  3AEA A;  1ONF A;  2V3B A;  3GYI A;  2GVC A;  3B6D A;  2UZZ A;  2WP5 A;  2EQ6 A;  3NYF A;  4XWZ A;  1AOG A;  1REO A;  4PAB A;  1NG4 A;  2JBV A;  2VVL A;  3G5Q A;  3OC4 A;  4K22 A;  4U2L A;  2BCP A;  2YR5 A;  2R0P A;  5BUK A;  3LAD A;  2OA1 A;  4H2Q A;  2WDR A;  3KA7 A;  3URH A;  2BA9 A;  4H4S A;  3UOX A;  1PXB A;  3EAO A;  4I58 A;  2WBA A;  3GRT A;  3AD8 B;  2X8G A;  3D1C A;  1NHQ A;  2JB2 A;  5BVA A;  2V60 A;  4Y4M A;  1IUS A;  3AYL A;  4X9N A;  5GSN A;  1DNC A;  3QVP A;  3AE9 A;  3CGB A;  1E1M A;  1LJ1 A;  3ADA B;  1NG3 A;  3F8R A;  3CGE A;  1D7Y A;  3M0O A;  2YG4 A;  3Q9T A;  2FJB A;  3UP4 A;  1JNZ A;  3UOV A;  2C76 A;  3UTE A;  4EMJ A;  1NHR A;  4GUV A;  3SGL A;  5BRT A;  1GER A;  1ZX9 A;  4M52 A;  1ZP0 A;  5DBJ A;  1CC4 A;  1D4D A;  2ZZC A;  1L9E A;  3UCL A;  4TM0 A;  4FK1 C;  1GT8 A;  1YQ4 A;  2E4G A;  2YVG A;  1ZOY A;  4OCG A;  3FIM B;  1PJ7 A;  3VRB A;  1K4Q A;  1VG9 A;  2OLO A;  2XLT A;  1RYI A;  2GMH A;  2XVH A;  4YXD A;  2BXR A;  2Q7V A;  4HB9 A;  4A99 A;  3NH3 X;  3NG7 X;  2RGJ A;  2YM2 A;  3G5S A;  5KVI A;  4BV6 A;  1DJN A;  1GOS A;  2YAU A;  5HHF A;  1PBD A;  2GR0 A;  4NTE A;  2DKH A;  3CNP A;  2GAG B;  4IVO B;  1GRE A;  2GR2 A;  3RED A;  3UKA A;  3DK9 A;  1PBF A;  4USQ A;  4A65 A;  2WET A;  2BAC A;  1Q1R A;  2CVJ A;  2YVF A;  1D7L A;  2V5Z A;  3GWD A;  4UDQ A;  2V61 A;  2YQU A;  3F8D A;  4H2R A;  4U8L A;  4YWO A;  1JNR A;  2XVE A;  3RP7 A;  3FPZ A;  4U8M A;  3AE6 A;  3ABV A;  1H86 A;  3NK0 X;  3P4S A;  1GTE A;  3BHK A;  1GRF A;  5FS8 A;  2B76 A;  1IUV A;  1L9C A;  2XVJ A;  1TDO A;  4RSL A;  2ZZ0 A;  2QA1 A;  4UDP A;  1F8R A;  3K30 A;  4OPG A;  4TLZ A;  2WU5 A;  2XLR A;  1OJ9 A;  4HA6 A;  5CKU A;  5EBK A;  3UOZ A;  4ECH A;  1ELI A;  2B9X A;  4U8N A; 
#chains in the Genus database with same CATH topology
 4GRT A;  4TM4 A;  2WDQ A;  3SFE A;  1CF3 A;  3AWI A;  3DGZ A;  1GXF A;  2WEU A;  4XXG A;  5GRT A;  5L46 A;  3OZ2 A;  4CCQ A;  1E1L A;  2FJA A;  1CC2 A;  3KPF A;  3RP6 A;  3AD7 B;  3C96 A;  1V59 A;  4GDP A;  3ZYX A;  1ZK7 A;  3IF9 A;  4B65 A;  1M64 A;  4AP3 A;  1PBB A;  2WP6 A;  2Q0K A;  3D8X A;  3UKP A;  3UTF A;  2BS3 A;  2C3C A;  4U8K A;  5C2T A;  2YR6 A;  1GAL A;  1DJQ A;  3ICS A;  3ALJ A;  4OPC A;  1DOE A;  4BJZ A;  1NDA A;  1PS9 A;  1VG0 A;  2E1M A;  3JSK A;  2GAH B;  4O5Q A;  4GCM A;  2HQM A;  4H4U A;  4BK2 A;  2IVE A;  4OPT A;  4OPI A;  1JU2 A;  2JAE A;  2AR8 A;  4H4X A;  4RG4 A;  1E39 A;  5KNL A;  3Q6J A;  1XPQ A;  2XVI A;  2BC1 A;  4EIP A;  4AT2 A;  2XFP A;  2WPC A;  3IC9 A;  2X3N A;  4EM4 A;  1PBE A;  4ICY A;  3BNU A;  3AXB A;  1H7W A;  3AYJ A;  5HXI A;  4EQR A;  4G6H A;  1L0V A;  2J3N A;  1LQU A;  1O94 A;  4FK1 A;  4Z2R A;  3CND A;  5KVH A;  2VVL G;  4REK A;  4D04 A;  1PJ6 A;  2VZ2 A;  2Q6U A;  4K5S A;  3LZX A;  4AT0 A;  4CY8 A;  4YTP A;  2YG6 A;  2V6O A;  3KD9 A;  4A6N B;  2ACZ A;  4U8I A;  5FS9 A;  3GDN A;  2BK4 A;  1DOD A;  3NIX A;  2C70 A;  4USR A;  3QSE A;  1ZOV A;  1GEU A;  3RHA A;  4YSH A;  3AB1 A;  1JRY A;  1KFY A;  3KLJ A;  4A7A A;  3AE7 A;  2DKI A;  3P1W A;  3IHG A;  2V3A A;  3KPK A;  3NRN A;  4LU6 A;  3AE1 A;  1JEH A;  2XYO A;  1PJ5 A;  5IQ4 A;  2C66 A;  1KNP A;  1B8S A;  4K8D A;  5J60 A;  1NPX A;  1IUT A;  3LJP A;  3AEC A;  2QAE A;  1VQW A;  4C3X A;  4B66 A;  1QJD A;  3UTG A;  3NTA A;  1YY5 A;  1CJC A;  2QCU A;  2VRL A;  1XDI A;  3VR8 A;  2BS4 A;  1DXL A;  2XVF A;  2A89 A;  2GF3 A;  4WCT A;  4AP1 A;  5JCM A;  1BF3 A;  4YKF A;  2R45 A;  4U8P A;  5KOX A;  2OAM A;  4H4W A;  2YM1 A;  3LZW A;  1TDE A;  1GRG A;  3KKJ A;  4ZCC A;  3T2Z A;  4YSY A;  1YQZ A;  4YTM A;  4J36 A;  4GF7 A;  1M6I A;  4K2X A;  2BYB A;  1VDC A;  2YG7 A;  1F8S A;  3K7M X;  1LPF A;  2CUL A;  3DJE A;  3DK8 A;  3RP8 A;  4J56 A;  3DK4 A;  4II2 A;  5KWF A;  1BGN A;  3GWF A;  1GET A;  4NZH A;  2C65 A;  4B64 A;  3CN8 A;  3EPT A;  3GD4 A;  2WU2 A;  5TR3 A;  1CJ4 A;  1KNR A;  2C75 A;  2CFY A;  2XLS A;  4U8J A;  2E5V A;  3II4 A;  1KF6 A;  2Z5X A;  1YQ3 A;  2BK3 A;  4BK1 A;  4YT0 A;  4JDR A;  1D4E A;  3P4P A;  5KMQ A;  3UKH A;  2F5Z A;  2WPE A;  3V3N A;  4NTC A;  5HYM A;  1N1P A;  1OJA A;  4ZN0 A;  2YLX A;  3I6D A;  2VQB A;  1MOK A;  1K0I A;  1CJ2 A;  2YLW A;  2C4C A;  1RP0 A;  3ITJ A;  2WOW A;  4G9K A;  1DOC A;  1KSS A;  5BUL A;  5JCN A;  2GRT A;  2APG A;  3DH9 A;  2WHD A;  5JCK A;  1LV0 A;  1BGJ A;  4OPL A;  3LXD A;  3NNE A;  2Y6Q A;  3NN6 X;  3ICT A;  4ZCD A;  1NHP A;  4K7Z A;  5M10 A;  2XCG A;  1B37 A;  3B3R A;  3H4K A;  3DME A;  3BHF A;  1IUU A;  1N4W A;  2OAL A;  3P4R A;  1BZL A;  1CL0 A;  3CNJ A;  1QLB A;  4DGK A;  5U1O A;  2R0C A;  5JCL A;  3AE2 A;  5EB5 A;  3GYJ A;  3P9U A;  4AOX A;  5HY5 A;  1TDK A;  1H81 A;  3GRS A;  4CCR A;  1E1N A;  2BRA A;  4OPD A;  2YG5 A;  1LQT A;  3GMB A;  2IVD A;  4BJY A;  2Q0L A;  4OPU A;  4TLX A;  3DJJ A;  3NK1 X;  4N9X A;  2FJE A;  2YR4 A;  2YLS A;  4O5U A;  4EQX A;  3LB8 A;  1Y56 A;  3LOV A;  1L9D A;  4G74 A;  5J7X A;  4NTD A;  3SY4 A;  3K7Q X;  4FX9 A;  1H84 A;  1LVL A;  3AED A;  4GAP A;  3F8P A;  4J34 A;  1IUX A;  1TRB A;  3T31 A;  3VRA A;  4H2N A;  2EQ8 A;  2C67 A;  4H4R A;  3G5R A;  3CNT A;  2WS3 A;  3T2K A;  2GEW A;  2BAB A;  3SZF A;  3FBS A;  2BXS A;  2BCG G;  3C4N A;  2O9Z A;  4MJW A;  2NPX A;  2YVJ A;  3PO7 A;  3QSM A;  2X8C A;  3DGH A;  3IWA A;  2WOV A;  4P9S A;  2JK6 A;  3GDP A;  3EF6 A;  3UKQ A;  2PYX A;  2R46 A;  1ZMD A;  3EAN A;  1N4U A;  4NNJ A;  1OJD A;  3CTY A;  2C72 A;  3P4Q A;  1TYP A;  3VRD B;  4H4Z A;  1EL8 A;  3QJ4 A;  1S3B A;  1TDF A;  1B5Q A;  1S2Q A;  3V3O A;  4Z26 A;  3H8L A;  1PDH A;  5FMH A;  1JRX A;  4BK3 A;  1COY A;  1E7P A;  4EMI A;  2C64 A;  3ICR A;  4H50 A;  4A79 A;  1FOH A;  3V76 A;  4YSX A;  3K7T A;  4IVM B;  3UTH A;  4Y4L A;  2VQ7 A;  1KSU A;  2OLN A;  1KDG A;  3ALL A;  1QO8 A;  4H4T A;  3GD3 A;  4CBQ A;  1VRQ B;  2XFU A;  2YG3 A;  4C3Y A;  4Y4N A;  1YKJ A;  1TDN A;  3GYX A;  1MO9 A;  3FG2 P;  3PVC A;  3QFB A;  4NEW A;  4DSH A;  3AE5 A;  5KOW A;  3CGD A;  4D03 A;  4UP3 A;  1EL7 A;  4JNQ A;  5EB4 A;  4Z25 A;  3SZ0 A;  3RNM A;  3HYV A;  2X99 A;  1GRH A;  4GDE A;  4KPR A;  3BI4 A;  3COX A;  1H83 A;  2ARD A;  2QA2 A;  1IUW A;  1FEC A;  4GR1 A;  3ZDN A;  2IID A;  2VRM A;  3QSS A;  1PXC A;  1BWC A;  3NKS A;  3NYE A;  2ZZB A;  3GMC A;  1RSG A;  3O0H A;  2AAQ A;  2I0Z A;  3M13 A;  1HYU A;  3S61 A;  4J2W A;  1GND A;  4J33 A;  5ER0 A;  4K5R A;  2XFQ A;  4H7U A;  5LV9 A;  3SM8 A;  4TM3 A;  1F6M A;  1E1K A;  1H7X A;  1Y56 B;  4I59 A;  4H4Q A;  4J57 A;  1B4V A;  3NHO X;  1E6E A;  1GSN A;  1XHC A;  1FEB A;  3I3L A;  3AE4 A;  1IJH A;  1Y0P A;  3ISH A;  3L1R A;  3UKL A;  3KU9 A;  4IA6 A;  3AE8 A;  2FJD A;  1NAA A;  2XFN A;  2Y6R A;  4LII A;  4TM1 A;  3UOY A;  4Z44 A;  3AEF A;  4JN9 A;  4G73 A;  2B9W A;  4CY6 A;  4X9M A;  2B7R A;  3AEG A;  4AOS A;  1GV4 A;  1CJ3 A;  2RGH A;  1N4V A;  5C3J A;  1XAN A;  3WE0 A;  3CNS A;  3E1T A;  2EQ7 A;  3AYI A;  4EQW A;  1GRT A;  2B7S A;  3SQP A;  2TPR A;  5KXJ A;  2GMJ A;  4WX1 A;  1ZKQ A;  4YTN A;  3CPJ G;  3L8K A;  1NEK A;  3NK2 X;  4EM3 A;  4G6G A;  2WOI A;  1S3E A;  3NGC X;  4A6N A;  2BC0 A;  1BKW A;  2EQ9 A;  1D4C A;  3QFA A;  2R4E A;  4NWZ A;  4JY2 A;  3T0K A;  4E0V A;  4DSG A;  4Z43 A;  1H82 A;  3DJD A;  2GH5 A;  5JCI A;  1S2Y A;  2CDU A;  4ADW A;  4JQ9 A;  4IV9 A;  4H4P A;  1D5T A;  2X8H A;  1TYT A;  3C4A A;  4C5O A;  3NN0 X;  5M0Z A;  4CNJ A;  1CBO A;  4EMW A;  3CIR A;  4LA1 A;  3ATR A;  2WQY A;  2XLP A;  1FCD A;  1FEA A;  4Z2T A;  2XLU A;  4OVI A;  4EQS A;  1K0J A;  4B69 A;  2YWL A;  3CMM A;  4B67 A;  4U2T A;  4B1B A;  1FL2 A;  2A8X A;  3S5W A;  4A9W A;  2GR3 A;  2A87 A;  4H4V A;  4YSZ A;  3M12 A;  1GRB A;  4PAA A;  3DJG X;  3IHM A;  4FDC B;  4H2P A;  4H4Y A;  3HYX A;  4IA5 A;  4JNA A;  1EL9 A;  1CC6 A;  2YLT A;  3FMW A;  2RAB A;  3AE3 A;  2BRY A;  1Z6L A;  3UP5 A;  1DOB A;  2XDO A;  3KVE A;  2H89 A;  4Z2U A;  3ALM A;  2AQJ A;  4UDR A;  3BI5 A;  3VR9 A;  1W4X A;  2R4J A;  2WDV A;  4JY3 A;  1GTH A;  3BNM A;  4Z24 A;  3SYI A;  2ZBW A;  2GR1 A;  3SX6 A;  2JB1 A;  3AEE A;  1X31 B;  2X50 A;  1NEN A;  2BS2 A;  5EOW A;  1ZY8 A;  1P2E A;  3T2Y A;  2Z5Y A;  5CQF A;  1P2H A;  1PXA A;  3CGC A;  2W0H A;  4C77 A;  3NYC A;  3UKK A;  3VQR A;  1PHH A;  3DA1 A;  2B9Y A;  5FS6 A;  1GES A;  1K0L A;  3NLC A;  4C74 A;  2JB3 A;  1F3P A;  2GQW A;  4II3 A;  4XWR A;  3ATQ A;  3AD9 B;  3GSI A;  4U2S A;  3SZC A;  3T14 A;  3NT6 A;  4BUR A;  2XFO A;  2BK5 A;  4J31 A;  1MXT A;  2H88 A;  5IPY A;  1O5W A;  2C3D A;  2GV8 A;  2R9Z A;  3BI2 A;  1OJT A;  1Q1W A;  1EBD A;  1EL5 A;  1JRZ A;  5FS7 A;  1ZDL A;  3QVR A;  1CHU A;  2VVM A;  2YLR A;  3H8I A;  5U25 A;  1O95 A;  3T37 A;  1JOA A;  2C73 A;  2WPF A;  4CNK A;  3NTD A;  1F8W A;  1ZMC A;  2WP9 A;  2YLZ A;  5KMR A;  4A5L A;  2GB0 A;  4B68 A;  2R0G A;  5IQ1 A;  3SFD A;  1SEZ A;  3AEB A;  1H6V A;  3HZL A;  1UKV G;  1Q9I A;  5KRQ A;  3CPH G;  1GPE A;  2PHH A;  2C7G A;  4APN A;  4YKG A;  2VOU A;  3CPI G;  1LTX R;  2GQF A;  2FBW A;  1PBC A;  4KX6 A;  2TMD A;  4DNA A;  5U63 A;  4CRT A;  1PN0 A;  2NVK X;  3PS9 A;  4U8O A;  4EIQ A;  3UKF A;  2RGO A;  4X4J A;  2WES A;  1GRA A;  3R9U A;  1OJC A;  4NEV A;  4B63 A;  2JKC A;  4RG3 A;  1NHS A;  3AEA A;  1ONF A;  2V3B A;  3HYW A;  3GYI A;  2GVC A;  3B6D A;  2UZZ A;  5KMS A;  4GAV A;  2WP5 A;  2EQ6 A;  3NYF A;  4XWZ A;  1AOG A;  1REO A;  4PAB A;  1NG4 A;  2JBV A;  2VVL A;  3G5Q A;  3OC4 A;  4K22 A;  4U2L A;  2BCP A;  2YR5 A;  2R0P A;  5BUK A;  3LAD A;  2OA1 A;  4H2Q A;  2WDR A;  3KA7 A;  3URH A;  2BA9 A;  4H4S A;  3UOX A;  1PXB A;  3EAO A;  4I58 A;  2WBA A;  3SZW A;  3GRT A;  3AD8 B;  2X8G A;  3D1C A;  3SXI A;  1NHQ A;  2JB2 A;  5BVA A;  2V60 A;  4Y4M A;  1IUS A;  3AYL A;  4X9N A;  5GSN A;  1DNC A;  3QVP A;  3AE9 A;  3CGB A;  1E1M A;  1LJ1 A;  3ADA B;  1NG3 A;  3F8R A;  3CGE A;  1D7Y A;  3M0O A;  2YG4 A;  3Q9T A;  2FJB A;  3UP4 A;  1JNZ A;  3UOV A;  2C76 A;  3UTE A;  4EMJ A;  1NHR A;  4GUV A;  3SGL A;  5BRT A;  1GER A;  1ZX9 A;  4M52 A;  1ZP0 A;  5DBJ A;  1CC4 A;  1D4D A;  2ZZC A;  1L9E A;  3UCL A;  5KMP A;  4TM0 A;  4FK1 C;  1GT8 A;  1YQ4 A;  2E4G A;  2YVG A;  1ZOY A;  4OCG A;  3FIM B;  1PJ7 A;  3VRB A;  1K4Q A;  1VG9 A;  2OLO A;  2XLT A;  1RYI A;  2GMH A;  2XVH A;  4YXD A;  2BXR A;  2Q7V A;  4HB9 A;  4A99 A;  3NH3 X;  3NG7 X;  2RGJ A;  2YM2 A;  3G5S A;  5KVI A;  4BV6 A;  1DJN A;  1GOS A;  2YAU A;  5HHF A;  1PBD A;  2GR0 A;  4NTE A;  2DKH A;  3CNP A;  2GAG B;  4IVO B;  1GRE A;  2GR2 A;  3RED A;  3UKA A;  3DK9 A;  1PBF A;  4USQ A;  4A65 A;  2WET A;  2BAC A;  1Q1R A;  2CVJ A;  2YVF A;  1D7L A;  2V5Z A;  3GWD A;  4UDQ A;  2V61 A;  2YQU A;  3F8D A;  4H2R A;  4U8L A;  4YWO A;  1JNR A;  2XVE A;  3RP7 A;  3FPZ A;  4U8M A;  3AE6 A;  3ABV A;  1H86 A;  3NK0 X;  3P4S A;  1GTE A;  3BHK A;  1GRF A;  5FS8 A;  2B76 A;  1IUV A;  1L9C A;  2XVJ A;  1TDO A;  4RSL A;  2ZZ0 A;  2QA1 A;  4UDP A;  1F8R A;  3K30 A;  4OPG A;  4TLZ A;  2WU5 A;  2XLR A;  1OJ9 A;  4HA6 A;  5CKU A;  5EBK A;  3UOZ A;  4ECH A;  1ELI A;  2B9X A;  4U8N A; 
#chains in the Genus database with same CATH homology
 4GRT A;  4TM4 A;  2WDQ A;  3SFE A;  1CF3 A;  3AWI A;  3DGZ A;  1GXF A;  2WEU A;  4XXG A;  5GRT A;  5L46 A;  3OZ2 A;  4CCQ A;  1E1L A;  2FJA A;  1CC2 A;  3KPF A;  3RP6 A;  3AD7 B;  3C96 A;  1V59 A;  4GDP A;  3ZYX A;  1ZK7 A;  3IF9 A;  4B65 A;  1M64 A;  4AP3 A;  1PBB A;  2WP6 A;  2Q0K A;  3D8X A;  3UKP A;  3UTF A;  2BS3 A;  2C3C A;  4U8K A;  5C2T A;  2YR6 A;  1GAL A;  1DJQ A;  3ICS A;  3ALJ A;  4OPC A;  1DOE A;  4BJZ A;  1NDA A;  1PS9 A;  1VG0 A;  2E1M A;  3JSK A;  2GAH B;  4O5Q A;  4GCM A;  2HQM A;  4H4U A;  4BK2 A;  2IVE A;  4OPT A;  4OPI A;  1JU2 A;  2JAE A;  2AR8 A;  4H4X A;  4RG4 A;  1E39 A;  5KNL A;  3Q6J A;  1XPQ A;  2XVI A;  2BC1 A;  4EIP A;  4AT2 A;  2XFP A;  2WPC A;  3IC9 A;  2X3N A;  4EM4 A;  1PBE A;  4ICY A;  3BNU A;  3AXB A;  1H7W A;  3AYJ A;  5HXI A;  4EQR A;  4G6H A;  1L0V A;  2J3N A;  1LQU A;  1O94 A;  4FK1 A;  4Z2R A;  3CND A;  5KVH A;  2VVL G;  4REK A;  4D04 A;  1PJ6 A;  2VZ2 A;  2Q6U A;  4K5S A;  3LZX A;  4AT0 A;  4CY8 A;  4YTP A;  2YG6 A;  2V6O A;  3KD9 A;  4A6N B;  2ACZ A;  4U8I A;  5FS9 A;  3GDN A;  2BK4 A;  1DOD A;  3NIX A;  2C70 A;  4USR A;  3QSE A;  1ZOV A;  1GEU A;  3RHA A;  4YSH A;  3AB1 A;  1JRY A;  1KFY A;  3KLJ A;  4A7A A;  3AE7 A;  2DKI A;  3P1W A;  3IHG A;  2V3A A;  3KPK A;  3NRN A;  4LU6 A;  3AE1 A;  1JEH A;  2XYO A;  1PJ5 A;  5IQ4 A;  2C66 A;  1KNP A;  1B8S A;  4K8D A;  5J60 A;  1NPX A;  1IUT A;  3LJP A;  3AEC A;  2QAE A;  1VQW A;  4C3X A;  4B66 A;  1QJD A;  3UTG A;  3NTA A;  1YY5 A;  1CJC A;  2QCU A;  2VRL A;  1XDI A;  3VR8 A;  2BS4 A;  1DXL A;  2XVF A;  2A89 A;  2GF3 A;  4WCT A;  4AP1 A;  5JCM A;  1BF3 A;  4YKF A;  2R45 A;  4U8P A;  5KOX A;  2OAM A;  4H4W A;  2YM1 A;  3LZW A;  1TDE A;  1GRG A;  3KKJ A;  4ZCC A;  3T2Z A;  4YSY A;  1YQZ A;  4YTM A;  4J36 A;  4GF7 A;  1M6I A;  4K2X A;  2BYB A;  1VDC A;  2YG7 A;  1F8S A;  3K7M X;  1LPF A;  2CUL A;  3DJE A;  3DK8 A;  3RP8 A;  4J56 A;  3DK4 A;  4II2 A;  5KWF A;  1BGN A;  3GWF A;  1GET A;  4NZH A;  2C65 A;  4B64 A;  3CN8 A;  3EPT A;  3GD4 A;  2WU2 A;  5TR3 A;  1CJ4 A;  1KNR A;  2C75 A;  2CFY A;  2XLS A;  4U8J A;  2E5V A;  3II4 A;  1KF6 A;  2Z5X A;  1YQ3 A;  2BK3 A;  4BK1 A;  4YT0 A;  4JDR A;  1D4E A;  3P4P A;  5KMQ A;  3UKH A;  2F5Z A;  2WPE A;  3V3N A;  4NTC A;  5HYM A;  1N1P A;  1OJA A;  4ZN0 A;  2YLX A;  3I6D A;  2VQB A;  1MOK A;  1K0I A;  1CJ2 A;  2YLW A;  2C4C A;  1RP0 A;  3ITJ A;  2WOW A;  4G9K A;  1DOC A;  1KSS A;  5BUL A;  5JCN A;  2GRT A;  2APG A;  3DH9 A;  2WHD A;  5JCK A;  1LV0 A;  1BGJ A;  4OPL A;  3LXD A;  3NNE A;  2Y6Q A;  3NN6 X;  3ICT A;  4ZCD A;  1NHP A;  4K7Z A;  5M10 A;  2XCG A;  1B37 A;  3B3R A;  3H4K A;  3DME A;  3BHF A;  1IUU A;  1N4W A;  2OAL A;  3P4R A;  1BZL A;  1CL0 A;  3CNJ A;  1QLB A;  4DGK A;  5U1O A;  2R0C A;  5JCL A;  3AE2 A;  5EB5 A;  3GYJ A;  3P9U A;  4AOX A;  5HY5 A;  1TDK A;  1H81 A;  3GRS A;  4CCR A;  1E1N A;  2BRA A;  4OPD A;  2YG5 A;  1LQT A;  3GMB A;  2IVD A;  4BJY A;  2Q0L A;  4OPU A;  4TLX A;  3DJJ A;  3NK1 X;  4N9X A;  2FJE A;  2YR4 A;  2YLS A;  4O5U A;  4EQX A;  3LB8 A;  1Y56 A;  3LOV A;  1L9D A;  4G74 A;  5J7X A;  4NTD A;  3SY4 A;  3K7Q X;  4FX9 A;  1H84 A;  1LVL A;  3AED A;  4GAP A;  3F8P A;  4J34 A;  1IUX A;  1TRB A;  3T31 A;  3VRA A;  4H2N A;  2EQ8 A;  2C67 A;  4H4R A;  3G5R A;  3CNT A;  2WS3 A;  3T2K A;  2GEW A;  2BAB A;  3SZF A;  3FBS A;  2BXS A;  2BCG G;  3C4N A;  2O9Z A;  4MJW A;  2NPX A;  2YVJ A;  3PO7 A;  3QSM A;  2X8C A;  3DGH A;  3IWA A;  2WOV A;  4P9S A;  2JK6 A;  3GDP A;  3EF6 A;  3UKQ A;  2PYX A;  2R46 A;  1ZMD A;  3EAN A;  1N4U A;  4NNJ A;  1OJD A;  3CTY A;  2C72 A;  3P4Q A;  1TYP A;  3VRD B;  4H4Z A;  1EL8 A;  3QJ4 A;  1S3B A;  1TDF A;  1B5Q A;  1S2Q A;  3V3O A;  4Z26 A;  3H8L A;  1PDH A;  5FMH A;  1JRX A;  4BK3 A;  1COY A;  1E7P A;  4EMI A;  2C64 A;  3ICR A;  4H50 A;  4A79 A;  1FOH A;  3V76 A;  4YSX A;  3K7T A;  4IVM B;  3UTH A;  4Y4L A;  2VQ7 A;  1KSU A;  2OLN A;  1KDG A;  3ALL A;  1QO8 A;  4H4T A;  3GD3 A;  4CBQ A;  1VRQ B;  2XFU A;  2YG3 A;  4C3Y A;  4Y4N A;  1YKJ A;  1TDN A;  3GYX A;  1MO9 A;  3FG2 P;  3PVC A;  3QFB A;  4NEW A;  4DSH A;  3AE5 A;  5KOW A;  3CGD A;  4D03 A;  4UP3 A;  1EL7 A;  4JNQ A;  5EB4 A;  4Z25 A;  3SZ0 A;  3RNM A;  3HYV A;  2X99 A;  1GRH A;  4GDE A;  4KPR A;  3BI4 A;  3COX A;  1H83 A;  2ARD A;  2QA2 A;  1IUW A;  1FEC A;  4GR1 A;  3ZDN A;  2IID A;  2VRM A;  3QSS A;  1PXC A;  1BWC A;  3NKS A;  3NYE A;  2ZZB A;  3GMC A;  1RSG A;  3O0H A;  2AAQ A;  2I0Z A;  3M13 A;  1HYU A;  3S61 A;  4J2W A;  1GND A;  4J33 A;  5ER0 A;  4K5R A;  2XFQ A;  4H7U A;  5LV9 A;  3SM8 A;  4TM3 A;  1F6M A;  1E1K A;  1H7X A;  1Y56 B;  4I59 A;  4H4Q A;  4J57 A;  1B4V A;  3NHO X;  1E6E A;  1GSN A;  1XHC A;  1FEB A;  3I3L A;  3AE4 A;  1IJH A;  1Y0P A;  3ISH A;  3L1R A;  3UKL A;  3KU9 A;  4IA6 A;  3AE8 A;  2FJD A;  1NAA A;  2XFN A;  2Y6R A;  4LII A;  4TM1 A;  3UOY A;  4Z44 A;  3AEF A;  4JN9 A;  4G73 A;  2B9W A;  4CY6 A;  4X9M A;  2B7R A;  3AEG A;  4AOS A;  1GV4 A;  1CJ3 A;  2RGH A;  1N4V A;  5C3J A;  1XAN A;  3WE0 A;  3CNS A;  3E1T A;  2EQ7 A;  3AYI A;  4EQW A;  1GRT A;  2B7S A;  3SQP A;  2TPR A;  5KXJ A;  2GMJ A;  4WX1 A;  1ZKQ A;  4YTN A;  3CPJ G;  3L8K A;  1NEK A;  3NK2 X;  4EM3 A;  4G6G A;  2WOI A;  1S3E A;  3NGC X;  4A6N A;  2BC0 A;  1BKW A;  2EQ9 A;  1D4C A;  3QFA A;  2R4E A;  4NWZ A;  4JY2 A;  3T0K A;  4E0V A;  4DSG A;  4Z43 A;  1H82 A;  3DJD A;  2GH5 A;  5JCI A;  1S2Y A;  2CDU A;  4ADW A;  4JQ9 A;  4IV9 A;  4H4P A;  1D5T A;  2X8H A;  1TYT A;  3C4A A;  4C5O A;  3NN0 X;  5M0Z A;  4CNJ A;  1CBO A;  4EMW A;  3CIR A;  4LA1 A;  3ATR A;  2WQY A;  2XLP A;  1FCD A;  1FEA A;  4Z2T A;  2XLU A;  4OVI A;  4EQS A;  1K0J A;  4B69 A;  2YWL A;  3CMM A;  4B67 A;  4U2T A;  4B1B A;  1FL2 A;  2A8X A;  3S5W A;  4A9W A;  2GR3 A;  2A87 A;  4H4V A;  4YSZ A;  3M12 A;  1GRB A;  4PAA A;  3DJG X;  3IHM A;  4FDC B;  4H2P A;  4H4Y A;  3HYX A;  4IA5 A;  4JNA A;  1EL9 A;  1CC6 A;  2YLT A;  3FMW A;  2RAB A;  3AE3 A;  2BRY A;  1Z6L A;  3UP5 A;  1DOB A;  2XDO A;  3KVE A;  2H89 A;  4Z2U A;  3ALM A;  2AQJ A;  4UDR A;  3BI5 A;  3VR9 A;  1W4X A;  2R4J A;  2WDV A;  4JY3 A;  1GTH A;  3BNM A;  4Z24 A;  3SYI A;  2ZBW A;  2GR1 A;  3SX6 A;  2JB1 A;  3AEE A;  1X31 B;  2X50 A;  1NEN A;  2BS2 A;  5EOW A;  1ZY8 A;  1P2E A;  3T2Y A;  2Z5Y A;  5CQF A;  1P2H A;  1PXA A;  3CGC A;  2W0H A;  4C77 A;  3NYC A;  3UKK A;  3VQR A;  1PHH A;  3DA1 A;  2B9Y A;  5FS6 A;  1GES A;  1K0L A;  3NLC A;  4C74 A;  2JB3 A;  1F3P A;  2GQW A;  4II3 A;  4XWR A;  3ATQ A;  3AD9 B;  3GSI A;  4U2S A;  3SZC A;  3T14 A;  3NT6 A;  4BUR A;  2XFO A;  2BK5 A;  4J31 A;  1MXT A;  2H88 A;  5IPY A;  1O5W A;  2C3D A;  2GV8 A;  2R9Z A;  3BI2 A;  1OJT A;  1Q1W A;  1EBD A;  1EL5 A;  1JRZ A;  5FS7 A;  1ZDL A;  3QVR A;  1CHU A;  2VVM A;  2YLR A;  3H8I A;  5U25 A;  1O95 A;  3T37 A;  1JOA A;  2C73 A;  2WPF A;  4CNK A;  3NTD A;  1F8W A;  1ZMC A;  2WP9 A;  2YLZ A;  5KMR A;  4A5L A;  2GB0 A;  4B68 A;  2R0G A;  5IQ1 A;  3SFD A;  1SEZ A;  3AEB A;  1H6V A;  3HZL A;  1UKV G;  1Q9I A;  5KRQ A;  3CPH G;  1GPE A;  2PHH A;  2C7G A;  4APN A;  4YKG A;  2VOU A;  3CPI G;  1LTX R;  2GQF A;  2FBW A;  1PBC A;  4KX6 A;  2TMD A;  4DNA A;  5U63 A;  4CRT A;  1PN0 A;  2NVK X;  3PS9 A;  4U8O A;  4EIQ A;  3UKF A;  2RGO A;  4X4J A;  2WES A;  1GRA A;  3R9U A;  1OJC A;  4NEV A;  4B63 A;  2JKC A;  4RG3 A;  1NHS A;  3AEA A;  1ONF A;  2V3B A;  3HYW A;  3GYI A;  2GVC A;  3B6D A;  2UZZ A;  5KMS A;  4GAV A;  2WP5 A;  2EQ6 A;  3NYF A;  4XWZ A;  1AOG A;  1REO A;  4PAB A;  1NG4 A;  2JBV A;  2VVL A;  3G5Q A;  3OC4 A;  4K22 A;  4U2L A;  2BCP A;  2YR5 A;  2R0P A;  5BUK A;  3LAD A;  2OA1 A;  4H2Q A;  2WDR A;  3KA7 A;  3URH A;  2BA9 A;  4H4S A;  3UOX A;  1PXB A;  3EAO A;  4I58 A;  2WBA A;  3SZW A;  3GRT A;  3AD8 B;  2X8G A;  3D1C A;  3SXI A;  1NHQ A;  2JB2 A;  5BVA A;  2V60 A;  4Y4M A;  1IUS A;  3AYL A;  4X9N A;  5GSN A;  1DNC A;  3QVP A;  3AE9 A;  3CGB A;  1E1M A;  1LJ1 A;  3ADA B;  1NG3 A;  3F8R A;  3CGE A;  1D7Y A;  3M0O A;  2YG4 A;  3Q9T A;  2FJB A;  3UP4 A;  1JNZ A;  3UOV A;  2C76 A;  3UTE A;  4EMJ A;  1NHR A;  4GUV A;  3SGL A;  5BRT A;  1GER A;  1ZX9 A;  4M52 A;  1ZP0 A;  5DBJ A;  1CC4 A;  1D4D A;  2ZZC A;  1L9E A;  3UCL A;  5KMP A;  4TM0 A;  4FK1 C;  1GT8 A;  1YQ4 A;  2E4G A;  2YVG A;  1ZOY A;  4OCG A;  3FIM B;  1PJ7 A;  3VRB A;  1K4Q A;  1VG9 A;  2OLO A;  2XLT A;  1RYI A;  2GMH A;  2XVH A;  4YXD A;  2BXR A;  2Q7V A;  4HB9 A;  4A99 A;  3NH3 X;  3NG7 X;  2RGJ A;  2YM2 A;  3G5S A;  5KVI A;  4BV6 A;  1DJN A;  1GOS A;  2YAU A;  5HHF A;  1PBD A;  2GR0 A;  4NTE A;  2DKH A;  3CNP A;  2GAG B;  4IVO B;  1GRE A;  2GR2 A;  3RED A;  3UKA A;  3DK9 A;  1PBF A;  4USQ A;  4A65 A;  2WET A;  2BAC A;  1Q1R A;  2CVJ A;  2YVF A;  1D7L A;  2V5Z A;  3GWD A;  4UDQ A;  2V61 A;  2YQU A;  3F8D A;  4H2R A;  4U8L A;  4YWO A;  1JNR A;  2XVE A;  3RP7 A;  3FPZ A;  4U8M A;  3AE6 A;  3ABV A;  1H86 A;  3NK0 X;  3P4S A;  1GTE A;  3BHK A;  1GRF A;  5FS8 A;  2B76 A;  1IUV A;  1L9C A;  2XVJ A;  1TDO A;  4RSL A;  2ZZ0 A;  2QA1 A;  4UDP A;  1F8R A;  3K30 A;  4OPG A;  4TLZ A;  2WU5 A;  2XLR A;  1OJ9 A;  4HA6 A;  5CKU A;  5EBK A;  3UOZ A;  4ECH A;  1ELI A;  2B9X A;  4U8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...