3QJ4A

Crystal structure of human renalase (isoform 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
341
structure length
335
Chain Sequence
MAQVLIVGAGMTGSLCAALLRRQTGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTDVPWAGQYITSNPCIRFVSIDNKKRNIESSIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title FAD-binding site and NADP reactivity in human renalase: a new enzyme involved in blood pressure regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Renalase
total genus 89
structure length 335
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3qj4A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3qj4A02
2RABA 4X9NA 1NEKA 4CY8A 1CJ4A 1F8SA 1H7WA 3ITJA 5JCLA 2WP5A 3D8XA 3DJGX 1H6VA 2OAMA 1NHPA 3UKHA 3AEDA 3LZWA 3QJ4A 2WP9A 3AD8B 3UTHA 3CIRA 3AE9A 3QSEA 3AEAA 3VR8A 4D03A 4Z2RA 2BS3A 1GETA 2YR4A 3RNMA 3GYIA 3K7MX 4X4JA 2Y6QA 3G5SA 4ICYA 2B7SA 2C65A 3QFBA 3NG7X 4JNAA 3NYEA 4NEWA 4C74A 3SM8A 2FBWA 3NTDA 1GRAA 3URHA 2PHHA 3UOYA 1Y0PA 2R4EA 3PO7A 1F8WA 3CGEA 4PAAA 4AT2A 4Z25A 1IUUA 1DODA 3CNPA 3PVCA 1JU2A 2RGHA 2C73A 3CGDA 1NENA 3GD3A 4OPGA 4YKFA 5BVAA 5KWFA 4I58A 4NEVA 1CJ3A 1IUVA 5IQ1A 2ACZA 3R9UA 1OJ9A 1PS9A 5KOXA 2IVEA 2EQ9A 2EQ8A 2V61A 2WBAA 3AE2A 4HA6A 3DK8A 3NK2X 4U8MA 2A8XA 4B68A 4LU6A 2WETA 3UKKA 1CJ2A 4M52A 5GSNA 5JCMA 1K0IA 2GAGB 2WOWA 2JBVA 4B63A 1PBDA 1B5QA 1TRBA 2WQYA 1NAAA 1EL9A 1Y56A 4TM1A 4K5RA 1JOAA 3GYJA 4K7ZA 4YTMA 4ZCCA 1ZOYA 1YQZA 4H4ZA 5JCKA 2YG5A 4U8IA 1E1NA 3CGCA 3RP8A 2F5ZA 4OPTA 3CGBA 1VG0A 2JB1A 3EANA 4H4XA 4UDQA 4XWRA 3SFDA 1E6EA 4YTPA 3AEGA 2IVDA 1RSGA 3M12A 4IA5A 2YG3A 1D7LA 3AECA 2B9WA 2VZ2A 1BGJA 1YQ4A 2R45A 2JB2A 1GEUA 2XFUA 3AXBA 3P4RA 2OA1A 5FS8A 4BJYA 4Z2UA 1E1MA 3QVPA 2CFYA 2X8HA 2RGJA 2BK5A 3G5QA 5EBKA 2V3BA 3RP7A 1SEZA 4I59A 1PXCA 1D4EA 3RP6A 3PS9A 3SGLA 2Q0LA 1GRHA 1JRYA 1XDIA 4U2SA 4REKA 3GRTA 4TM3A 2VQ7A 1IUSA 1MO9A 1OJAA 1TYPA 2B76A 2QA1A 4JDRA 2DKHA 2BC0A 3IC9A 4BK2A 4GDPA 1TDEA 1PJ7A 2WDVA 2WPFA 4N9XA 3LOVA 4J36A 1OJDA 4K5SA 4YSHA 1F6MA 3P4PA 2ZZCA 2YLRA 1Q1RA 4TLZA 4NTDA 4CNJA 3GSIA 1UKVG 1Q9IA 2YG4A 4XXGA 4IVOB 4CBQA 1TYTA 3LADA 3IWAA 2Z5XA 1TDNA 2WP6A 1PJ6A 2VRLA 1BZLA 3Q9TA 2Y6RA 2BC1A 3AE5A 4DNAA 3VQRA 3L8KA 2UZZA 1Y56B 2GAHB 4KX6A 1B37A 3DK9A 4H2QA 4FDCB 1E1LA 3GMCA 1NG3A 4DSHA 5KXJA 4MJWA 4A65A 1GRGA 2YLXA 4GRTA 2GRTA 4C77A 2R0GA 4A7AA 3UOVA 1DJNA 3DGHA 4H2PA 1KNRA 1MXTA 3V3OA 3QSMA 3ATRA 2R0PA 1GRFA 3BI4A 4Z44A 2FJDA 4K8DA 4PABA 1GTEA 1K0LA 1N4WA 1N4UA 5C3JA 2X8GA 3NH3X 3AEBA 3GRSA 4IV9A 4LA1A 4Y4MA 1E7PA 2YR5A 4ADWA 4EIQA 4EQXA 1DOCA 3ZYXA 4FK1A 1CJCA 2QAEA 4YSXA 1NPXA 1CF3A 3QSSA 4J2WA 4B65A 3CNJA 4OPLA 3UP4A 2VOUA 3V76A 2AQJA 2AAQA 2RGOA 4EMWA 2XVJA 2C3CA 2YM2A 2FJBA 4WX1A 1GERA 1X31B 1EL7A 5FS7A 4AP3A 4TLXA 4BK3A 2Q0KA 2V5ZA 4OVIA 1YKJA 4H50A 4AOXA 1L0VA 3GWFA 1H7XA 4CCRA 1H84A 1P2HA 3C96A 2FJEA 3ZDNA 4CCQA 2WPEA 3NGCX 4O5UA 3WE0A 3AE6A 2B7RA 4YSZA 1QJDA 1VRQB 1H81A 3KLJA 3GD4A 5M10A 2XCGA 3AYIA 3UOZA 1E1KA 3B6DA 2E4GA 1L9CA 3LB8A 2XLTA 4GF7A 4EQSA 1VDCA 2C72A 1CL0A 2WU2A 3NN0X 2XFQA 1D7YA 2GR2A 2GR1A 1S2YA 5HHFA 1BGNA 4EM3A 2XLPA 4H7UA 1KF6A 2NVKX 4H4VA 3NK0X 4E0VA 2GV8A 2ARDA 4USRA 2GB0A 2APGA 2C67A 3UP5A 2YLZA 4Z2TA 2XLUA 2FJAA 1LJ1A 1ONFA 4UDPA 1LTXR 3II4A 4A5LA 3T37A 1LPFA 1GNDA 5J7XA 1DOEA 3VRBA 5KVIA 2X8CA 4TM4A 1TDKA 1TDFA 3ALLA 4EMIA 2YVJA 2YG6A 4OCGA 3KKJA 1ZY8A 1F8RA 2ZZ0A 3ALJA 5JCIA 3UKFA 2XDOA 2A87A 3ISHA 3P9UA 4OPDA 3DH9A 4USQA 2VVLA 4A99A 1IUTA 1D4DA 1KSSA 4C3YA 2BS2A 4JN9A 3KA7A 1E39A 3AE4A 2Q7VA 1GRTA 5JCNA 4AOSA 5KOWA 3NIXA 4Z24A 3GDNA 4OPUA 4B66A 1DJQA 4IVMB 5EOWA 2R46A 4K2XA 2X3NA 2YLSA 4YWOA 5TR3A 4A6NB 5LV9A 3DJDA 1EL8A 3NLCA 3CPHG 3H4KA 2C64A 4CNKA 4GDEA 3M0OA 2JK6A 2Q6UA 4RG4A 4A9WA 4BJZA 2XYOA 1NHSA 2W0HA 2BCGG 1AOGA 2O9ZA 1DNCA 2BCPA 1O94A 4WCTA 2WOIA 1DXLA 3AYLA 3ABVA 2NPXA 1ZDLA 2OLNA 3NRNA 1REOA 2XVHA 2XLRA 3NN6X 3DA1A 2GR3A 2GF3A 5HYMA 2GQWA 4JY3A 5GRTA 2I0ZA 2YAUA 2IIDA 2JKCA 3AWIA 1W4XA 4Z43A 1XPQA 1CC4A 3ICSA 3P1WA 1MOKA 1ZP0A 2GEWA 2BK3A 4ZCDA 3K7TA 3LXDA 1PXBA 3VRAA 2EQ6A 3CN8A 4J56A 4CY6A 3DMEA 4RSLA 1IJHA 1IUXA 3NHOX 3CPJG 4YTNA 2BS4A 3F8DA 3EF6A 3BHFA 4CRTA 4H4WA 2BABA 1KNPA 3QFAA 1GALA 3K7QX 4H4QA 1PBBA 4IA6A 1EBDA 1PN0A 3NYFA 3UCLA 4EMJA 3BHKA 1ZMCA 3AD7B 1FEAA 2CDUA 1GT8A 5FMHA 1GRBA 2WS3A 2VRMA 1Q1WA 4H4UA 5ER0A 3AD9B 3UTEA 3BI2A 1CBOA 4C5OA 5BRTA 2C7GA 1M64A 3GDPA 1LVLA 4H4RA 1NG4A 1L9EA 5J60A 2YR6A 4JQ9A 4O5QA 4AT0A 4EQWA 1N4VA 3NTAA 3UKPA 4OPIA 1EL5A 1CHUA 1COYA 2XFPA 4U8NA 5M0ZA 1FOHA 3CNTA 3DJJA 3KVEA 5CQFA 4A6NA 4UP3A 3FMWA 3VR9A 4U8JA 2C70A 1RYIA 2VQBA 3AE3A 4JNQA 3CPIG 1PHHA 3NYCA 3AEEA 4JY2A 3AB1A 3AEFA 1GESA 3FPZA 2YWLA 3GWDA 5BUKA 3ICTA 3IHMA 2YG7A 4DSGA 3KPFA 5U1OA 2TMDA 4NZHA 3LJPA 3ICRA 3I3LA 2XLSA 5KRQA 3VRDB 4U2TA 4ZN0A 3CTYA 4B1BA 4J33A 2GMJA 3UOXA 3UKQA 2WU5A 2XVEA 1JNRA 3NKSA 1H83A 4GR1A 2JAEA 2XVIA 1GPEA 1FECA 2DKIA 3NNEA 3IHGA 2HQMA 1NHQA 1YQ3A 3AE8A 3C4AA 3COXA 1JEHA 1GREA 3C4NA 4RG3A 5FS9A 4K22A 4YT0A 4U2LA 2V3AA 4J57A 4AP1A 2GVCA 1H82A 1FEBA 1CC2A 3CNDA 4TM0A 2VVMA 2X50A 3D1CA 3ADAB 2WEUA 1M6IA 3BI5A 2XFNA 3I6DA 3O0HA 4H4SA 3LZXA 4NTEA 1S3BA 2WHDA 2B9YA 1QO8A 1PBFA 1NHRA 5U25A 2H89A 4ECHA 3B3RA 4U8LA 1FCDA 1H86A 4DGKA 2CULA 2BYBA 4H4PA 3S61A 2XFOA 2CVJA 1B8SA 1BF3A 4U8PA 4Y4NA 5HY5A 2QCUA 1BKWA 1O5WA 2WESA 4FK1C 4FX9A 1XANA 5HXIA 1O95A 2R4JA 2BXSA 2AR8A 5FS6A 3UTGA 1K4QA 2E1MA 1CC6A 2JB3A 2YQUA 1B4VA 1XHCA 1NDAA 1PBEA 3OC4A 3KD9A 2H88A 4J34A 3BNUA 1BWCA 1JNZA 3AE7A 2V6OA 3K30A 3AYJA 2V60A 1OJCA 3CNSA 5L46A 2YLWA 4KPRA 4EM4A 5U63A 2GH5A 2R0CA 2Z5YA 3KU9A 1RP0A 2YVGA 3EAOA 3JSKA 4J31A 3S5WA 2BK4A 2E5VA 1GV4A 4X9MA 3H8LA 1ZK7A 3V3NA 2ZBWA 4D04A 1D5TA 3EPTA 3FIMB 2C75A 3OZ2A 4OPCA 1OJTA 4A79A 2C66A 1V59A 2VVLG 3ATQA 5EB5A 2BACA 4H2NA 2J3NA 1ZMDA 2WOVA 2C3DA 3NK1X 3NT6A 1Z6LA 1S3EA 2QA2A 1FL2A 1ZKQA 1LV0A 2R9ZA 3AE1A 4H2RA 1TDOA 1VG9A 4UDRA 3REDA 4NTCA 3F8PA 4HB9A 4C3XA 4BK1A 2X99A 5BULA 1PJ5A 5CKUA 1DOBA 5KVHA 3GMBA 3SFEA 1PBCA 3BNMA 1IUWA 2ZZBA 3DK4A 3FG2P 3G5RA 4U8KA 4BV6A 2YM1A 2GQFA 3P4QA 2BA9A 1F3PA 3F8RA 3RHAA 3FBSA 1GXFA 2WDRA 4BURA 1K0JA 1PDHA 2B9XA 1PXAA 1KFYA 1S2QA 2GR0A 2XVFA 2C76A 3H8IA 5IPYA 3QVRA 2BXRA 1QLBA 2GMHA 3HZLA 4U8OA 5C2TA 4H4TA 1JRXA 4EIPA 4LIIA 1N1PA 4XWZA 2OALA 4B64A 4YKGA 4Z26A 3L1RA 1JRZA 2WDQA 4YSYA 4GCMA 2A89A 4H4YA 4B67A 3UKAA 3IF9A 4APNA 4YXDA 1VQWA 3DGZA 4B69A 5EB4A 1ELIA 3ALMA 4EQRA 2YLTA 1ZX9A 3DJEA 5DBJA 2YVFA 2PYXA 4GUVA 3P4SA 1D4CA 1HYUA 1ZOVA 1LQUA 3UKLA 1GSNA 3E1TA 3M13A 1GTHA 1L9DA 1P2EA 3SQPA 3UTFA 5IQ4A 1LQTA 2OLOA 4P9SA 1GOSA 2TPRA 2WPCA 3Q6JA 1YY5A 4Y4LA 1KDGA 2EQ7A 1KSUA
chains in the Genus database with same CATH superfamily
2RABA 4X9NA 1NEKA 4CY8A 1CJ4A 1F8SA 1H7WA 3ITJA 5JCLA 2WP5A 3D8XA 3DJGX 1H6VA 2OAMA 1NHPA 3UKHA 3AEDA 3GYXA 3LZWA 3QJ4A 2WP9A 3AD8B 3UTHA 3CIRA 3AE9A 3QSEA 3AEAA 4G74A 3SY4A 3VR8A 4D03A 4Z2RA 2BS3A 1GETA 2YR4A 3RNMA 3GYIA 3K7MX 4X4JA 2Y6QA 3G5SA 4ICYA 2B7SA 2C65A 3QFBA 3NG7X 4JNAA 3NYEA 4NEWA 4C74A 3SM8A 2FBWA 3NTDA 1GRAA 3URHA 2PHHA 3UOYA 1Y0PA 2R4EA 3PO7A 1F8WA 3CGEA 4PAAA 4AT2A 4Z25A 1IUUA 1DODA 3CNPA 3HYWA 3PVCA 1JU2A 2RGHA 2C73A 3CGDA 1NENA 3GD3A 4OPGA 4YKFA 5BVAA 5KWFA 4I58A 4NEVA 1CJ3A 1IUVA 5IQ1A 4G9KA 2ACZA 3R9UA 1OJ9A 1PS9A 5KOXA 2IVEA 2EQ9A 2EQ8A 2V61A 2WBAA 3AE2A 4HA6A 5KMPA 3DK8A 3NK2X 4U8MA 2A8XA 4B68A 4LU6A 2WETA 3UKKA 1CJ2A 4M52A 5GSNA 5JCMA 1K0IA 2GAGB 2WOWA 2JBVA 4B63A 1PBDA 1B5QA 1TRBA 2WQYA 1NAAA 1EL9A 1Y56A 4TM1A 4K5RA 1JOAA 3GYJA 4K7ZA 4YTMA 4ZCCA 1ZOYA 4II3A 1YQZA 4H4ZA 5JCKA 2YG5A 3T14A 4U8IA 1E1NA 3CGCA 3RP8A 2F5ZA 4OPTA 3CGBA 1VG0A 2JB1A 3EANA 4H4XA 4UDQA 4XWRA 3SFDA 1E6EA 4YTPA 3AEGA 2IVDA 1RSGA 3M12A 4IA5A 2YG3A 1D7LA 3AECA 2B9WA 2VZ2A 1BGJA 1YQ4A 2R45A 2JB2A 1GEUA 2XFUA 3AXBA 4GAPA 3P4RA 2OA1A 5FS8A 4BJYA 4Z2UA 1E1MA 3QVPA 2CFYA 2X8HA 2RGJA 2BK5A 3G5QA 5EBKA 2V3BA 3RP7A 1SEZA 4I59A 1PXCA 1D4EA 3RP6A 3PS9A 3SGLA 5KMSA 2Q0LA 1GRHA 1JRYA 1XDIA 3CMMA 4U2SA 4REKA 3GRTA 4TM3A 2VQ7A 1IUSA 1MO9A 1OJAA 1TYPA 2B76A 2QA1A 4JDRA 2DKHA 2BC0A 3IC9A 4BK2A 4GDPA 1TDEA 1PJ7A 2WDVA 2WPFA 4N9XA 3LOVA 4J36A 1OJDA 4K5SA 4YSHA 1F6MA 3P4PA 2ZZCA 2YLRA 1Q1RA 4TLZA 4NTDA 4CNJA 3GSIA 1UKVG 1Q9IA 2YG4A 4XXGA 4IVOB 4CBQA 1TYTA 3LADA 3IWAA 2Z5XA 1TDNA 2WP6A 1PJ6A 2VRLA 1BZLA 3Q9TA 3SZCA 2Y6RA 2BC1A 3AE5A 4DNAA 3VQRA 3L8KA 2UZZA 1Y56B 2GAHB 4KX6A 1B37A 3DK9A 4H2QA 4FDCB 1E1LA 3GMCA 1NG3A 4DSHA 3T2ZA 5KXJA 4MJWA 4A65A 1GRGA 2YLXA 4GRTA 2GRTA 4C77A 2R0GA 4A7AA 3UOVA 1DJNA 3DGHA 4H2PA 1KNRA 1MXTA 3V3OA 3QSMA 3ATRA 2R0PA 1GRFA 3BI4A 4Z44A 2FJDA 4K8DA 3SZ0A 4PABA 1GTEA 1K0LA 1N4WA 1N4UA 5C3JA 2X8GA 3NH3X 3AEBA 3GRSA 4IV9A 4LA1A 4Y4MA 1E7PA 2YR5A 4ADWA 4EIQA 4EQXA 1DOCA 3ZYXA 4FK1A 1CJCA 2QAEA 4YSXA 1NPXA 1CF3A 3QSSA 4J2WA 4B65A 3CNJA 4OPLA 3UP4A 2VOUA 3V76A 2AQJA 2AAQA 2RGOA 4EMWA 2XVJA 2C3CA 2YM2A 2FJBA 4WX1A 1GERA 1X31B 1EL7A 5FS7A 4AP3A 4TLXA 4BK3A 2Q0KA 2V5ZA 4OVIA 1YKJA 4H50A 4AOXA 1L0VA 3GWFA 1H7XA 4CCRA 1H84A 1P2HA 3C96A 2FJEA 3ZDNA 4CCQA 2WPEA 3NGCX 4O5UA 3WE0A 3AE6A 2B7RA 4YSZA 1QJDA 1VRQB 1H81A 3KLJA 3GD4A 5M10A 2XCGA 3AYIA 3UOZA 1E1KA 3B6DA 2E4GA 1L9CA 3LB8A 2XLTA 4GF7A 4EQSA 1VDCA 2C72A 1CL0A 2WU2A 3NN0X 2XFQA 1D7YA 2GR2A 2GR1A 1S2YA 5HHFA 1BGNA 4EM3A 2XLPA 4H7UA 1KF6A 2NVKX 4H4VA 3NK0X 4E0VA 2GV8A 2ARDA 4USRA 2GB0A 2APGA 2C67A 3UP5A 2YLZA 4Z2TA 2XLUA 2FJAA 1LJ1A 1ONFA 4UDPA 1LTXR 3II4A 4A5LA 3T37A 1LPFA 1GNDA 5J7XA 1DOEA 3VRBA 5KVIA 2X8CA 4TM4A 1TDKA 1TDFA 3ALLA 4EMIA 2YVJA 2YG6A 4OCGA 3KKJA 1ZY8A 1F8RA 2ZZ0A 3ALJA 5JCIA 3T2KA 3UKFA 2XDOA 2A87A 3ISHA 3P9UA 4G73A 3DH9A 4OPDA 4NNJA 4USQA 2VVLA 4A99A 1IUTA 1D4DA 1KSSA 4C3YA 2BS2A 4JN9A 3KA7A 1E39A 3AE4A 2Q7VA 1GRTA 5KMQA 5JCNA 4AOSA 4NWZA 5KOWA 3NIXA 4Z24A 3GDNA 4OPUA 4B66A 1DJQA 4IVMB 5EOWA 2R46A 4K2XA 2X3NA 2YLSA 4YWOA 5TR3A 4A6NB 5LV9A 3DJDA 1EL8A 3NLCA 3CPHG 3H4KA 2C64A 4CNKA 3HYVA 3M0OA 4GDEA 2JK6A 2Q6UA 4RG4A 4A9WA 4BJZA 2XYOA 1NHSA 2W0HA 2BCGG 1AOGA 2O9ZA 1DNCA 2BCPA 1O94A 4WCTA 2WOIA 1DXLA 3AYLA 3ABVA 2NPXA 1ZDLA 2OLNA 3NRNA 1REOA 2XVHA 2XLRA 3NN6X 3DA1A 2GR3A 2GF3A 5HYMA 2GQWA 4JY3A 5GRTA 2I0ZA 2YAUA 2IIDA 2JKCA 3AWIA 1W4XA 4Z43A 1XPQA 1CC4A 3ICSA 3P1WA 3T2YA 1MOKA 1ZP0A 2GEWA 2BK3A 4ZCDA 3K7TA 3LXDA 1PXBA 3VRAA 2EQ6A 3CN8A 4J56A 4CY6A 3DMEA 4RSLA 1IJHA 1IUXA 3NHOX 3CPJG 4YTNA 2BS4A 3F8DA 3EF6A 3BHFA 4CRTA 4II2A 4H4WA 2BABA 1KNPA 3QFAA 1GALA 3K7QX 4H4QA 1PBBA 4IA6A 1EBDA 1PN0A 3NYFA 3UCLA 4EMJA 3BHKA 1ZMCA 3AD7B 1FEAA 2CDUA 1GT8A 5FMHA 1GRBA 2WS3A 2VRMA 1Q1WA 4H4UA 5ER0A 3AD9B 3UTEA 3BI2A 4GAVA 1CBOA 4C5OA 5BRTA 2C7GA 1M64A 3GDPA 1LVLA 4H4RA 1NG4A 1L9EA 5J60A 2YR6A 4JQ9A 4O5QA 4AT0A 4EQWA 1N4VA 3NTAA 3UKPA 4OPIA 1EL5A 1CHUA 1COYA 2XFPA 4U8NA 5M0ZA 3SZFA 1FOHA 3CNTA 3DJJA 3KVEA 5CQFA 4A6NA 4UP3A 3FMWA 3VR9A 3HYXA 4U8JA 3SZWA 2C70A 1RYIA 2VQBA 3AE3A 4JNQA 3CPIG 4G6HA 1PHHA 3NYCA 3AEEA 4JY2A 3AB1A 3AEFA 1GESA 3FPZA 2YWLA 2BRAA 3GWDA 5BUKA 3ICTA 3IHMA 2YG7A 4DSGA 3KPFA 5U1OA 2TMDA 4NZHA 3LJPA 3ICRA 3I3LA 2XLSA 5KRQA 3VRDB 4U2TA 4ZN0A 3CTYA 4B1BA 4J33A 2GMJA 3UOXA 3UKQA 2WU5A 2XVEA 1JNRA 3NKSA 1H83A 4GR1A 2JAEA 2XVIA 1GPEA 1FECA 2DKIA 3NNEA 3IHGA 2HQMA 1NHQA 1YQ3A 3AE8A 3C4AA 3COXA 1JEHA 1GREA 3C4NA 4RG3A 3SYIA 5FS9A 4K22A 4YT0A 2C4CA 4U2LA 2V3AA 4J57A 4AP1A 2GVCA 5KMRA 1H82A 1FEBA 1CC2A 3CNDA 4TM0A 2VVMA 2X50A 3D1CA 3ADAB 2WEUA 1M6IA 3BI5A 2XFNA 3I6DA 3O0HA 4H4SA 3LZXA 4NTEA 1S3BA 2WHDA 2B9YA 1QO8A 1PBFA 1NHRA 5U25A 2H89A 4ECHA 3B3RA 4U8LA 1FCDA 1H86A 4DGKA 2CULA 2BYBA 4H4PA 3S61A 2XFOA 2CVJA 1B8SA 1BF3A 4U8PA 4Y4NA 5HY5A 2QCUA 1BKWA 1O5WA 2WESA 4FK1C 4FX9A 1XANA 5HXIA 1O95A 2R4JA 2BXSA 2AR8A 5FS6A 3UTGA 1K4QA 2E1MA 1CC6A 2JB3A 2YQUA 1B4VA 1XHCA 1NDAA 1PBEA 3OC4A 3KD9A 5KNLA 2H88A 4J34A 3BNUA 1BWCA 1JNZA 3AE7A 2V6OA 3K30A 3AYJA 2BRYA 1OJCA 2V60A 3CNSA 5L46A 2YLWA 4KPRA 4EM4A 5U63A 2GH5A 2R0CA 2Z5YA 3KU9A 1RP0A 2YVGA 3EAOA 3JSKA 4J31A 3S5WA 2BK4A 2E5VA 1GV4A 4X9MA 3H8LA 1ZK7A 3V3NA 2ZBWA 4D04A 1D5TA 4G6GA 3EPTA 3FIMB 2C75A 3OZ2A 4OPCA 1OJTA 4A79A 2C66A 1V59A 3T0KA 2VVLG 3ATQA 5EB5A 2BACA 4H2NA 2J3NA 1ZMDA 2WOVA 2C3DA 3NK1X 3NT6A 1Z6LA 1S3EA 2QA2A 1FL2A 1ZKQA 1LV0A 2R9ZA 3AE1A 4H2RA 1TDOA 1VG9A 4UDRA 3REDA 4NTCA 3F8PA 4HB9A 4C3XA 4BK1A 2X99A 5BULA 1PJ5A 5CKUA 1DOBA 5KVHA 3GMBA 3KPKA 3SFEA 1PBCA 3BNMA 1IUWA 2ZZBA 3DK4A 3FG2P 3G5RA 4U8KA 4BV6A 2YM1A 2GQFA 3P4QA 2BA9A 1F3PA 3F8RA 3RHAA 3FBSA 1GXFA 2WDRA 4BURA 1K0JA 1PDHA 2B9XA 1PXAA 1KFYA 1S2QA 2GR0A 2XVFA 2C76A 3H8IA 5IPYA 3QVRA 2BXRA 1QLBA 2GMHA 3HZLA 4U8OA 3SX6A 5C2TA 4H4TA 1JRXA 4EIPA 4LIIA 1N1PA 4XWZA 3T31A 2OALA 4B64A 4YKGA 4Z26A 3L1RA 1JRZA 2WDQA 4YSYA 4GCMA 2A89A 4H4YA 4B67A 3UKAA 3IF9A 4APNA 4YXDA 1VQWA 3DGZA 4B69A 5EB4A 1ELIA 3ALMA 4EQRA 2YLTA 1ZX9A 3DJEA 5DBJA 2YVFA 2PYXA 4GUVA 3P4SA 1D4CA 1HYUA 1ZOVA 1LQUA 3UKLA 1GSNA 3E1TA 3M13A 1GTHA 1L9DA 1P2EA 3SQPA 3UTFA 5IQ4A 1LQTA 3SXIA 2OLOA 4P9SA 1GOSA 2TPRA 2WPCA 3Q6JA 1YY5A 4Y4LA 1KDGA 2EQ7A 1KSUA
chains in the Genus database with same CATH topology
2RABA 4X9NA 1NEKA 4CY8A 1CJ4A 1F8SA 1H7WA 3ITJA 5JCLA 2WP5A 3D8XA 3DJGX 1H6VA 2OAMA 1NHPA 3UKHA 3AEDA 3GYXA 3LZWA 3QJ4A 2WP9A 3AD8B 3UTHA 3CIRA 3AE9A 3QSEA 3AEAA 4G74A 3SY4A 3VR8A 4D03A 4Z2RA 2BS3A 1GETA 2YR4A 3RNMA 3GYIA 3K7MX 4X4JA 2Y6QA 3G5SA 4ICYA 2B7SA 2C65A 3QFBA 3NG7X 4JNAA 3NYEA 4NEWA 4C74A 3SM8A 2FBWA 3NTDA 1GRAA 3URHA 2PHHA 3UOYA 1Y0PA 2R4EA 3PO7A 1F8WA 3CGEA 4PAAA 4AT2A 4Z25A 1IUUA 1DODA 3CNPA 3HYWA 3PVCA 1JU2A 2RGHA 2C73A 3CGDA 1NENA 3GD3A 4OPGA 4YKFA 5BVAA 5KWFA 4I58A 4NEVA 1CJ3A 1IUVA 5IQ1A 4G9KA 2ACZA 3R9UA 1OJ9A 1PS9A 5KOXA 2IVEA 2EQ9A 2EQ8A 2V61A 2WBAA 3AE2A 4HA6A 5KMPA 3DK8A 3NK2X 4U8MA 2A8XA 4B68A 4LU6A 2WETA 3UKKA 1CJ2A 4M52A 5GSNA 5JCMA 1K0IA 2GAGB 2WOWA 2JBVA 4B63A 1PBDA 1B5QA 1TRBA 2WQYA 1NAAA 1EL9A 1Y56A 4TM1A 4K5RA 1JOAA 3GYJA 4K7ZA 4YTMA 4ZCCA 1ZOYA 4II3A 1YQZA 4H4ZA 5JCKA 2YG5A 3T14A 4U8IA 1E1NA 3CGCA 3RP8A 2F5ZA 4OPTA 3CGBA 1VG0A 2JB1A 3EANA 4H4XA 4UDQA 4XWRA 3SFDA 1E6EA 4YTPA 3AEGA 2IVDA 1RSGA 3M12A 4IA5A 2YG3A 1D7LA 3AECA 2B9WA 2VZ2A 1BGJA 1YQ4A 2R45A 2JB2A 1GEUA 2XFUA 3AXBA 4GAPA 3P4RA 2OA1A 5FS8A 4BJYA 4Z2UA 1E1MA 3QVPA 2CFYA 2X8HA 2RGJA 2BK5A 3G5QA 5EBKA 2V3BA 3RP7A 1SEZA 4I59A 1PXCA 1D4EA 3RP6A 3PS9A 3SGLA 5KMSA 2Q0LA 1GRHA 1JRYA 1XDIA 3CMMA 4U2SA 4REKA 3GRTA 4TM3A 2VQ7A 1IUSA 1MO9A 1OJAA 1TYPA 2B76A 2QA1A 4JDRA 2DKHA 2BC0A 3IC9A 4BK2A 4GDPA 1TDEA 1PJ7A 2WDVA 2WPFA 4N9XA 3LOVA 4J36A 1OJDA 4K5SA 4YSHA 1F6MA 3P4PA 2ZZCA 2YLRA 1Q1RA 4TLZA 4NTDA 4CNJA 3GSIA 1UKVG 1Q9IA 2YG4A 4XXGA 4IVOB 4CBQA 1TYTA 3LADA 3IWAA 2Z5XA 1TDNA 2WP6A 1PJ6A 2VRLA 1BZLA 3Q9TA 3SZCA 2Y6RA 2BC1A 3AE5A 4DNAA 3VQRA 3L8KA 2UZZA 1Y56B 2GAHB 4KX6A 1B37A 3DK9A 4H2QA 4FDCB 1E1LA 3GMCA 1NG3A 4DSHA 3T2ZA 5KXJA 4MJWA 4A65A 1GRGA 2YLXA 4GRTA 2GRTA 4C77A 2R0GA 4A7AA 3UOVA 1DJNA 3DGHA 4H2PA 1KNRA 1MXTA 3V3OA 3QSMA 3ATRA 2R0PA 1GRFA 3BI4A 4Z44A 2FJDA 4K8DA 3SZ0A 4PABA 1GTEA 1K0LA 1N4WA 1N4UA 5C3JA 2X8GA 3NH3X 3AEBA 3GRSA 4IV9A 4LA1A 4Y4MA 1E7PA 2YR5A 4ADWA 4EIQA 4EQXA 1DOCA 3ZYXA 4FK1A 1CJCA 2QAEA 4YSXA 1NPXA 1CF3A 3QSSA 4J2WA 4B65A 3CNJA 4OPLA 3UP4A 2VOUA 3V76A 2AQJA 2AAQA 2RGOA 4EMWA 2XVJA 2C3CA 2YM2A 2FJBA 4WX1A 1GERA 1X31B 1EL7A 5FS7A 4AP3A 4TLXA 4BK3A 2Q0KA 2V5ZA 4OVIA 1YKJA 4H50A 4AOXA 1L0VA 3GWFA 1H7XA 4CCRA 1H84A 1P2HA 3C96A 2FJEA 3ZDNA 4CCQA 2WPEA 3NGCX 4O5UA 3WE0A 3AE6A 2B7RA 4YSZA 1QJDA 1VRQB 1H81A 3KLJA 3GD4A 5M10A 2XCGA 3AYIA 3UOZA 1E1KA 3B6DA 2E4GA 1L9CA 3LB8A 2XLTA 4GF7A 4EQSA 1VDCA 2C72A 1CL0A 2WU2A 3NN0X 2XFQA 1D7YA 2GR2A 2GR1A 1S2YA 5HHFA 1BGNA 4EM3A 2XLPA 4H7UA 1KF6A 2NVKX 4H4VA 3NK0X 4E0VA 2GV8A 2ARDA 4USRA 2GB0A 2APGA 2C67A 3UP5A 2YLZA 4Z2TA 2XLUA 2FJAA 1LJ1A 1ONFA 4UDPA 1LTXR 3II4A 4A5LA 3T37A 1LPFA 1GNDA 5J7XA 1DOEA 3VRBA 5KVIA 2X8CA 4TM4A 1TDKA 1TDFA 3ALLA 4EMIA 2YVJA 2YG6A 4OCGA 3KKJA 1ZY8A 1F8RA 2ZZ0A 3ALJA 5JCIA 3T2KA 3UKFA 2XDOA 2A87A 3ISHA 3P9UA 4G73A 3DH9A 4OPDA 4NNJA 4USQA 2VVLA 4A99A 1IUTA 1D4DA 1KSSA 4C3YA 2BS2A 4JN9A 3KA7A 1E39A 3AE4A 2Q7VA 1GRTA 5KMQA 5JCNA 4AOSA 4NWZA 5KOWA 3NIXA 4Z24A 3GDNA 4OPUA 4B66A 1DJQA 4IVMB 5EOWA 2R46A 4K2XA 2X3NA 2YLSA 4YWOA 5TR3A 4A6NB 5LV9A 3DJDA 1EL8A 3NLCA 3CPHG 3H4KA 2C64A 4CNKA 3HYVA 3M0OA 4GDEA 2JK6A 2Q6UA 4RG4A 4A9WA 4BJZA 2XYOA 1NHSA 2W0HA 2BCGG 1AOGA 2O9ZA 1DNCA 2BCPA 1O94A 4WCTA 2WOIA 1DXLA 3AYLA 3ABVA 2NPXA 1ZDLA 2OLNA 3NRNA 1REOA 2XVHA 2XLRA 3NN6X 3DA1A 2GR3A 2GF3A 5HYMA 2GQWA 4JY3A 5GRTA 2I0ZA 2YAUA 2IIDA 2JKCA 3AWIA 1W4XA 4Z43A 1XPQA 1CC4A 3ICSA 3P1WA 3T2YA 1MOKA 1ZP0A 2GEWA 2BK3A 4ZCDA 3K7TA 3LXDA 1PXBA 3VRAA 2EQ6A 3CN8A 4J56A 4CY6A 3DMEA 4RSLA 1IJHA 1IUXA 3NHOX 3CPJG 4YTNA 2BS4A 3F8DA 3EF6A 3BHFA 4CRTA 4II2A 4H4WA 2BABA 1KNPA 3QFAA 1GALA 3K7QX 4H4QA 1PBBA 4IA6A 1EBDA 1PN0A 3NYFA 3UCLA 4EMJA 3BHKA 1ZMCA 3AD7B 1FEAA 2CDUA 1GT8A 5FMHA 1GRBA 2WS3A 2VRMA 1Q1WA 4H4UA 5ER0A 3AD9B 3UTEA 3BI2A 4GAVA 1CBOA 4C5OA 5BRTA 2C7GA 1M64A 3GDPA 1LVLA 4H4RA 1NG4A 1L9EA 5J60A 2YR6A 4JQ9A 4O5QA 4AT0A 4EQWA 1N4VA 3NTAA 3UKPA 4OPIA 1EL5A 1CHUA 1COYA 2XFPA 4U8NA 5M0ZA 3SZFA 1FOHA 3CNTA 3DJJA 3KVEA 5CQFA 4A6NA 4UP3A 3FMWA 3VR9A 3HYXA 4U8JA 3SZWA 2C70A 1RYIA 2VQBA 3AE3A 4JNQA 3CPIG 4G6HA 1PHHA 3NYCA 3AEEA 4JY2A 3AB1A 3AEFA 1GESA 3FPZA 2YWLA 2BRAA 3GWDA 5BUKA 3ICTA 3IHMA 2YG7A 4DSGA 3KPFA 5U1OA 2TMDA 4NZHA 3LJPA 3ICRA 3I3LA 2XLSA 5KRQA 3VRDB 4U2TA 4ZN0A 3CTYA 4B1BA 4J33A 2GMJA 3UOXA 3UKQA 2WU5A 2XVEA 1JNRA 3NKSA 1H83A 4GR1A 2JAEA 2XVIA 1GPEA 1FECA 2DKIA 3NNEA 3IHGA 2HQMA 1NHQA 1YQ3A 3AE8A 3C4AA 3COXA 1JEHA 1GREA 3C4NA 4RG3A 3SYIA 5FS9A 4K22A 4YT0A 2C4CA 4U2LA 2V3AA 4J57A 4AP1A 2GVCA 5KMRA 1H82A 1FEBA 1CC2A 3CNDA 4TM0A 2VVMA 2X50A 3D1CA 3ADAB 2WEUA 1M6IA 3BI5A 2XFNA 3I6DA 3O0HA 4H4SA 3LZXA 4NTEA 1S3BA 2WHDA 2B9YA 1QO8A 1PBFA 1NHRA 5U25A 2H89A 4ECHA 3B3RA 4U8LA 1FCDA 1H86A 4DGKA 2CULA 2BYBA 4H4PA 3S61A 2XFOA 2CVJA 1B8SA 1BF3A 4U8PA 4Y4NA 5HY5A 2QCUA 1BKWA 1O5WA 2WESA 4FK1C 4FX9A 1XANA 5HXIA 1O95A 2R4JA 2BXSA 2AR8A 5FS6A 3UTGA 1K4QA 2E1MA 1CC6A 2JB3A 2YQUA 1B4VA 1XHCA 1NDAA 1PBEA 3OC4A 3KD9A 5KNLA 2H88A 4J34A 3BNUA 1BWCA 1JNZA 3AE7A 2V6OA 3K30A 3AYJA 2BRYA 1OJCA 2V60A 3CNSA 5L46A 2YLWA 4KPRA 4EM4A 5U63A 2GH5A 2R0CA 2Z5YA 3KU9A 1RP0A 2YVGA 3EAOA 3JSKA 4J31A 3S5WA 2BK4A 2E5VA 1GV4A 4X9MA 3H8LA 1ZK7A 3V3NA 2ZBWA 4D04A 1D5TA 4G6GA 3EPTA 3FIMB 2C75A 3OZ2A 4OPCA 1OJTA 4A79A 2C66A 1V59A 3T0KA 2VVLG 3ATQA 5EB5A 2BACA 4H2NA 2J3NA 1ZMDA 2WOVA 2C3DA 3NK1X 3NT6A 1Z6LA 1S3EA 2QA2A 1FL2A 1ZKQA 1LV0A 2R9ZA 3AE1A 4H2RA 1TDOA 1VG9A 4UDRA 3REDA 4NTCA 3F8PA 4HB9A 4C3XA 4BK1A 2X99A 5BULA 1PJ5A 5CKUA 1DOBA 5KVHA 3GMBA 3KPKA 3SFEA 1PBCA 3BNMA 1IUWA 2ZZBA 3DK4A 3FG2P 3G5RA 4U8KA 4BV6A 2YM1A 2GQFA 3P4QA 2BA9A 1F3PA 3F8RA 3RHAA 3FBSA 1GXFA 2WDRA 4BURA 1K0JA 1PDHA 2B9XA 1PXAA 1KFYA 1S2QA 2GR0A 2XVFA 2C76A 3H8IA 5IPYA 3QVRA 2BXRA 1QLBA 2GMHA 3HZLA 4U8OA 3SX6A 5C2TA 4H4TA 1JRXA 4EIPA 4LIIA 1N1PA 4XWZA 3T31A 2OALA 4B64A 4YKGA 4Z26A 3L1RA 1JRZA 2WDQA 4YSYA 4GCMA 2A89A 4H4YA 4B67A 3UKAA 3IF9A 4APNA 4YXDA 1VQWA 3DGZA 4B69A 5EB4A 1ELIA 3ALMA 4EQRA 2YLTA 1ZX9A 3DJEA 5DBJA 2YVFA 2PYXA 4GUVA 3P4SA 1D4CA 1HYUA 1ZOVA 1LQUA 3UKLA 1GSNA 3E1TA 3M13A 1GTHA 1L9DA 1P2EA 3SQPA 3UTFA 5IQ4A 1LQTA 3SXIA 2OLOA 4P9SA 1GOSA 2TPRA 2WPCA 3Q6JA 1YY5A 4Y4LA 1KDGA 2EQ7A 1KSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RAB A;  4X9N A;  1NEK A;  4CY8 A;  1CJ4 A;  1F8S A;  1H7W A;  3ITJ A;  5JCL A;  2WP5 A;  3D8X A;  3DJG X;  1H6V A;  2OAM A;  1NHP A;  3UKH A;  3AED A;  3LZW A;  3QJ4 A;  2WP9 A;  3AD8 B;  3UTH A;  3CIR A;  3AE9 A;  3QSE A;  3AEA A;  3VR8 A;  4D03 A;  4Z2R A;  2BS3 A;  1GET A;  2YR4 A;  3RNM A;  3GYI A;  3K7M X;  4X4J A;  2Y6Q A;  3G5S A;  4ICY A;  2B7S A;  2C65 A;  3QFB A;  3NG7 X;  4JNA A;  3NYE A;  4NEW A;  4C74 A;  3SM8 A;  2FBW A;  3NTD A;  1GRA A;  3URH A;  2PHH A;  3UOY A;  1Y0P A;  2R4E A;  3PO7 A;  1F8W A;  3CGE A;  4PAA A;  4AT2 A;  4Z25 A;  1IUU A;  1DOD A;  3CNP A;  3PVC A;  1JU2 A;  2RGH A;  2C73 A;  3CGD A;  1NEN A;  3GD3 A;  4OPG A;  4YKF A;  5BVA A;  5KWF A;  4I58 A;  4NEV A;  1CJ3 A;  1IUV A;  5IQ1 A;  2ACZ A;  3R9U A;  1OJ9 A;  1PS9 A;  5KOX A;  2IVE A;  2EQ9 A;  2EQ8 A;  2V61 A;  2WBA A;  3AE2 A;  4HA6 A;  3DK8 A;  3NK2 X;  4U8M A;  2A8X A;  4B68 A;  4LU6 A;  2WET A;  3UKK A;  1CJ2 A;  4M52 A;  5GSN A;  5JCM A;  1K0I A;  2GAG B;  2WOW A;  2JBV A;  4B63 A;  1PBD A;  1B5Q A;  1TRB A;  2WQY A;  1NAA A;  1EL9 A;  1Y56 A;  4TM1 A;  4K5R A;  1JOA A;  3GYJ A;  4K7Z A;  4YTM A;  4ZCC A;  1ZOY A;  1YQZ A;  4H4Z A;  5JCK A;  2YG5 A;  4U8I A;  1E1N A;  3CGC A;  3RP8 A;  2F5Z A;  4OPT A;  3CGB A;  1VG0 A;  2JB1 A;  3EAN A;  4H4X A;  4UDQ A;  4XWR A;  3SFD A;  1E6E A;  4YTP A;  3AEG A;  2IVD A;  1RSG A;  3M12 A;  4IA5 A;  2YG3 A;  1D7L A;  3AEC A;  2B9W A;  2VZ2 A;  1BGJ A;  1YQ4 A;  2R45 A;  2JB2 A;  1GEU A;  2XFU A;  3AXB A;  3P4R A;  2OA1 A;  5FS8 A;  4BJY A;  4Z2U A;  1E1M A;  3QVP A;  2CFY A;  2X8H A;  2RGJ A;  2BK5 A;  3G5Q A;  5EBK A;  2V3B A;  3RP7 A;  1SEZ A;  4I59 A;  1PXC A;  1D4E A;  3RP6 A;  3PS9 A;  3SGL A;  2Q0L A;  1GRH A;  1JRY A;  1XDI A;  4U2S A;  4REK A;  3GRT A;  4TM3 A;  2VQ7 A;  1IUS A;  1MO9 A;  1OJA A;  1TYP A;  2B76 A;  2QA1 A;  4JDR A;  2DKH A;  2BC0 A;  3IC9 A;  4BK2 A;  4GDP A;  1TDE A;  1PJ7 A;  2WDV A;  2WPF A;  4N9X A;  3LOV A;  4J36 A;  1OJD A;  4K5S A;  4YSH A;  1F6M A;  3P4P A;  2ZZC A;  2YLR A;  1Q1R A;  4TLZ A;  4NTD A;  4CNJ A;  3GSI A;  1UKV G;  1Q9I A;  2YG4 A;  4XXG A;  4IVO B;  4CBQ A;  1TYT A;  3LAD A;  3IWA A;  2Z5X A;  1TDN A;  2WP6 A;  1PJ6 A;  2VRL A;  1BZL A;  3Q9T A;  2Y6R A;  2BC1 A;  3AE5 A;  4DNA A;  3VQR A;  3L8K A;  2UZZ A;  1Y56 B;  2GAH B;  4KX6 A;  1B37 A;  3DK9 A;  4H2Q A;  4FDC B;  1E1L A;  3GMC A;  1NG3 A;  4DSH A;  5KXJ A;  4MJW A;  4A65 A;  1GRG A;  2YLX A;  4GRT A;  2GRT A;  4C77 A;  2R0G A;  4A7A A;  3UOV A;  1DJN A;  3DGH A;  4H2P A;  1KNR A;  1MXT A;  3V3O A;  3QSM A;  3ATR A;  2R0P A;  1GRF A;  3BI4 A;  4Z44 A;  2FJD A;  4K8D A;  4PAB A;  1GTE A;  1K0L A;  1N4W A;  1N4U A;  5C3J A;  2X8G A;  3NH3 X;  3AEB A;  3GRS A;  4IV9 A;  4LA1 A;  4Y4M A;  1E7P A;  2YR5 A;  4ADW A;  4EIQ A;  4EQX A;  1DOC A;  3ZYX A;  4FK1 A;  1CJC A;  2QAE A;  4YSX A;  1NPX A;  1CF3 A;  3QSS A;  4J2W A;  4B65 A;  3CNJ A;  4OPL A;  3UP4 A;  2VOU A;  3V76 A;  2AQJ A;  2AAQ A;  2RGO A;  4EMW A;  2XVJ A;  2C3C A;  2YM2 A;  2FJB A;  4WX1 A;  1GER A;  1X31 B;  1EL7 A;  5FS7 A;  4AP3 A;  4TLX A;  4BK3 A;  2Q0K A;  2V5Z A;  4OVI A;  1YKJ A;  4H50 A;  4AOX A;  1L0V A;  3GWF A;  1H7X A;  4CCR A;  1H84 A;  1P2H A;  3C96 A;  2FJE A;  3ZDN A;  4CCQ A;  2WPE A;  3NGC X;  4O5U A;  3WE0 A;  3AE6 A;  2B7R A;  4YSZ A;  1QJD A;  1VRQ B;  1H81 A;  3KLJ A;  3GD4 A;  5M10 A;  2XCG A;  3AYI A;  3UOZ A;  1E1K A;  3B6D A;  2E4G A;  1L9C A;  3LB8 A;  2XLT A;  4GF7 A;  4EQS A;  1VDC A;  2C72 A;  1CL0 A;  2WU2 A;  3NN0 X;  2XFQ A;  1D7Y A;  2GR2 A;  2GR1 A;  1S2Y A;  5HHF A;  1BGN A;  4EM3 A;  2XLP A;  4H7U A;  1KF6 A;  2NVK X;  4H4V A;  3NK0 X;  4E0V A;  2GV8 A;  2ARD A;  4USR A;  2GB0 A;  2APG A;  2C67 A;  3UP5 A;  2YLZ A;  4Z2T A;  2XLU A;  2FJA A;  1LJ1 A;  1ONF A;  4UDP A;  1LTX R;  3II4 A;  4A5L A;  3T37 A;  1LPF A;  1GND A;  5J7X A;  1DOE A;  3VRB A;  5KVI A;  2X8C A;  4TM4 A;  1TDK A;  1TDF A;  3ALL A;  4EMI A;  2YVJ A;  2YG6 A;  4OCG A;  3KKJ A;  1ZY8 A;  1F8R A;  2ZZ0 A;  3ALJ A;  5JCI A;  3UKF A;  2XDO A;  2A87 A;  3ISH A;  3P9U A;  4OPD A;  3DH9 A;  4USQ A;  2VVL A;  4A99 A;  1IUT A;  1D4D A;  1KSS A;  4C3Y A;  2BS2 A;  4JN9 A;  3KA7 A;  1E39 A;  3AE4 A;  2Q7V A;  1GRT A;  5JCN A;  4AOS A;  5KOW A;  3NIX A;  4Z24 A;  3GDN A;  4OPU A;  4B66 A;  1DJQ A;  4IVM B;  5EOW A;  2R46 A;  4K2X A;  2X3N A;  2YLS A;  4YWO A;  5TR3 A;  4A6N B;  5LV9 A;  3DJD A;  1EL8 A;  3NLC A;  3CPH G;  3H4K A;  2C64 A;  4CNK A;  4GDE A;  3M0O A;  2JK6 A;  2Q6U A;  4RG4 A;  4A9W A;  4BJZ A;  2XYO A;  1NHS A;  2W0H A;  2BCG G;  1AOG A;  2O9Z A;  1DNC A;  2BCP A;  1O94 A;  4WCT A;  2WOI A;  1DXL A;  3AYL A;  3ABV A;  2NPX A;  1ZDL A;  2OLN A;  3NRN A;  1REO A;  2XVH A;  2XLR A;  3NN6 X;  3DA1 A;  2GR3 A;  2GF3 A;  5HYM A;  2GQW A;  4JY3 A;  5GRT A;  2I0Z A;  2YAU A;  2IID A;  2JKC A;  3AWI A;  1W4X A;  4Z43 A;  1XPQ A;  1CC4 A;  3ICS A;  3P1W A;  1MOK A;  1ZP0 A;  2GEW A;  2BK3 A;  4ZCD A;  3K7T A;  3LXD A;  1PXB A;  3VRA A;  2EQ6 A;  3CN8 A;  4J56 A;  4CY6 A;  3DME A;  4RSL A;  1IJH A;  1IUX A;  3NHO X;  3CPJ G;  4YTN A;  2BS4 A;  3F8D A;  3EF6 A;  3BHF A;  4CRT A;  4H4W A;  2BAB A;  1KNP A;  3QFA A;  1GAL A;  3K7Q X;  4H4Q A;  1PBB A;  4IA6 A;  1EBD A;  1PN0 A;  3NYF A;  3UCL A;  4EMJ A;  3BHK A;  1ZMC A;  3AD7 B;  1FEA A;  2CDU A;  1GT8 A;  5FMH A;  1GRB A;  2WS3 A;  2VRM A;  1Q1W A;  4H4U A;  5ER0 A;  3AD9 B;  3UTE A;  3BI2 A;  1CBO A;  4C5O A;  5BRT A;  2C7G A;  1M64 A;  3GDP A;  1LVL A;  4H4R A;  1NG4 A;  1L9E A;  5J60 A;  2YR6 A;  4JQ9 A;  4O5Q A;  4AT0 A;  4EQW A;  1N4V A;  3NTA A;  3UKP A;  4OPI A;  1EL5 A;  1CHU A;  1COY A;  2XFP A;  4U8N A;  5M0Z A;  1FOH A;  3CNT A;  3DJJ A;  3KVE A;  5CQF A;  4A6N A;  4UP3 A;  3FMW A;  3VR9 A;  4U8J A;  2C70 A;  1RYI A;  2VQB A;  3AE3 A;  4JNQ A;  3CPI G;  1PHH A;  3NYC A;  3AEE A;  4JY2 A;  3AB1 A;  3AEF A;  1GES A;  3FPZ A;  2YWL A;  3GWD A;  5BUK A;  3ICT A;  3IHM A;  2YG7 A;  4DSG A;  3KPF A;  5U1O A;  2TMD A;  4NZH A;  3LJP A;  3ICR A;  3I3L A;  2XLS A;  5KRQ A;  3VRD B;  4U2T A;  4ZN0 A;  3CTY A;  4B1B A;  4J33 A;  2GMJ A;  3UOX A;  3UKQ A;  2WU5 A;  2XVE A;  1JNR A;  3NKS A;  1H83 A;  4GR1 A;  2JAE A;  2XVI A;  1GPE A;  1FEC A;  2DKI A;  3NNE A;  3IHG A;  2HQM A;  1NHQ A;  1YQ3 A;  3AE8 A;  3C4A A;  3COX A;  1JEH A;  1GRE A;  3C4N A;  4RG3 A;  5FS9 A;  4K22 A;  4YT0 A;  4U2L A;  2V3A A;  4J57 A;  4AP1 A;  2GVC A;  1H82 A;  1FEB A;  1CC2 A;  3CND A;  4TM0 A;  2VVM A;  2X50 A;  3D1C A;  3ADA B;  2WEU A;  1M6I A;  3BI5 A;  2XFN A;  3I6D A;  3O0H A;  4H4S A;  3LZX A;  4NTE A;  1S3B A;  2WHD A;  2B9Y A;  1QO8 A;  1PBF A;  1NHR A;  5U25 A;  2H89 A;  4ECH A;  3B3R A;  4U8L A;  1FCD A;  1H86 A;  4DGK A;  2CUL A;  2BYB A;  4H4P A;  3S61 A;  2XFO A;  2CVJ A;  1B8S A;  1BF3 A;  4U8P A;  4Y4N A;  5HY5 A;  2QCU A;  1BKW A;  1O5W A;  2WES A;  4FK1 C;  4FX9 A;  1XAN A;  5HXI A;  1O95 A;  2R4J A;  2BXS A;  2AR8 A;  5FS6 A;  3UTG A;  1K4Q A;  2E1M A;  1CC6 A;  2JB3 A;  2YQU A;  1B4V A;  1XHC A;  1NDA A;  1PBE A;  3OC4 A;  3KD9 A;  2H88 A;  4J34 A;  3BNU A;  1BWC A;  1JNZ A;  3AE7 A;  2V6O A;  3K30 A;  3AYJ A;  2V60 A;  1OJC A;  3CNS A;  5L46 A;  2YLW A;  4KPR A;  4EM4 A;  5U63 A;  2GH5 A;  2R0C A;  2Z5Y A;  3KU9 A;  1RP0 A;  2YVG A;  3EAO A;  3JSK A;  4J31 A;  3S5W A;  2BK4 A;  2E5V A;  1GV4 A;  4X9M A;  3H8L A;  1ZK7 A;  3V3N A;  2ZBW A;  4D04 A;  1D5T A;  3EPT A;  3FIM B;  2C75 A;  3OZ2 A;  4OPC A;  1OJT A;  4A79 A;  2C66 A;  1V59 A;  2VVL G;  3ATQ A;  5EB5 A;  2BAC A;  4H2N A;  2J3N A;  1ZMD A;  2WOV A;  2C3D A;  3NK1 X;  3NT6 A;  1Z6L A;  1S3E A;  2QA2 A;  1FL2 A;  1ZKQ A;  1LV0 A;  2R9Z A;  3AE1 A;  4H2R A;  1TDO A;  1VG9 A;  4UDR A;  3RED A;  4NTC A;  3F8P A;  4HB9 A;  4C3X A;  4BK1 A;  2X99 A;  5BUL A;  1PJ5 A;  5CKU A;  1DOB A;  5KVH A;  3GMB A;  3SFE A;  1PBC A;  3BNM A;  1IUW A;  2ZZB A;  3DK4 A;  3FG2 P;  3G5R A;  4U8K A;  4BV6 A;  2YM1 A;  2GQF A;  3P4Q A;  2BA9 A;  1F3P A;  3F8R A;  3RHA A;  3FBS A;  1GXF A;  2WDR A;  4BUR A;  1K0J A;  1PDH A;  2B9X A;  1PXA A;  1KFY A;  1S2Q A;  2GR0 A;  2XVF A;  2C76 A;  3H8I A;  5IPY A;  3QVR A;  2BXR A;  1QLB A;  2GMH A;  3HZL A;  4U8O A;  5C2T A;  4H4T A;  1JRX A;  4EIP A;  4LII A;  1N1P A;  4XWZ A;  2OAL A;  4B64 A;  4YKG A;  4Z26 A;  3L1R A;  1JRZ A;  2WDQ A;  4YSY A;  4GCM A;  2A89 A;  4H4Y A;  4B67 A;  3UKA A;  3IF9 A;  4APN A;  4YXD A;  1VQW A;  3DGZ A;  4B69 A;  5EB4 A;  1ELI A;  3ALM A;  4EQR A;  2YLT A;  1ZX9 A;  3DJE A;  5DBJ A;  2YVF A;  2PYX A;  4GUV A;  3P4S A;  1D4C A;  1HYU A;  1ZOV A;  1LQU A;  3UKL A;  1GSN A;  3E1T A;  3M13 A;  1GTH A;  1L9D A;  1P2E A;  3SQP A;  3UTF A;  5IQ4 A;  1LQT A;  2OLO A;  4P9S A;  1GOS A;  2TPR A;  2WPC A;  3Q6J A;  1YY5 A;  4Y4L A;  1KDG A;  2EQ7 A;  1KSU A; 
#chains in the Genus database with same CATH topology
 2RAB A;  4X9N A;  1NEK A;  4CY8 A;  1CJ4 A;  1F8S A;  1H7W A;  3ITJ A;  5JCL A;  2WP5 A;  3D8X A;  3DJG X;  1H6V A;  2OAM A;  1NHP A;  3UKH A;  3AED A;  3GYX A;  3LZW A;  3QJ4 A;  2WP9 A;  3AD8 B;  3UTH A;  3CIR A;  3AE9 A;  3QSE A;  3AEA A;  4G74 A;  3SY4 A;  3VR8 A;  4D03 A;  4Z2R A;  2BS3 A;  1GET A;  2YR4 A;  3RNM A;  3GYI A;  3K7M X;  4X4J A;  2Y6Q A;  3G5S A;  4ICY A;  2B7S A;  2C65 A;  3QFB A;  3NG7 X;  4JNA A;  3NYE A;  4NEW A;  4C74 A;  3SM8 A;  2FBW A;  3NTD A;  1GRA A;  3URH A;  2PHH A;  3UOY A;  1Y0P A;  2R4E A;  3PO7 A;  1F8W A;  3CGE A;  4PAA A;  4AT2 A;  4Z25 A;  1IUU A;  1DOD A;  3CNP A;  3HYW A;  3PVC A;  1JU2 A;  2RGH A;  2C73 A;  3CGD A;  1NEN A;  3GD3 A;  4OPG A;  4YKF A;  5BVA A;  5KWF A;  4I58 A;  4NEV A;  1CJ3 A;  1IUV A;  5IQ1 A;  4G9K A;  2ACZ A;  3R9U A;  1OJ9 A;  1PS9 A;  5KOX A;  2IVE A;  2EQ9 A;  2EQ8 A;  2V61 A;  2WBA A;  3AE2 A;  4HA6 A;  5KMP A;  3DK8 A;  3NK2 X;  4U8M A;  2A8X A;  4B68 A;  4LU6 A;  2WET A;  3UKK A;  1CJ2 A;  4M52 A;  5GSN A;  5JCM A;  1K0I A;  2GAG B;  2WOW A;  2JBV A;  4B63 A;  1PBD A;  1B5Q A;  1TRB A;  2WQY A;  1NAA A;  1EL9 A;  1Y56 A;  4TM1 A;  4K5R A;  1JOA A;  3GYJ A;  4K7Z A;  4YTM A;  4ZCC A;  1ZOY A;  4II3 A;  1YQZ A;  4H4Z A;  5JCK A;  2YG5 A;  3T14 A;  4U8I A;  1E1N A;  3CGC A;  3RP8 A;  2F5Z A;  4OPT A;  3CGB A;  1VG0 A;  2JB1 A;  3EAN A;  4H4X A;  4UDQ A;  4XWR A;  3SFD A;  1E6E A;  4YTP A;  3AEG A;  2IVD A;  1RSG A;  3M12 A;  4IA5 A;  2YG3 A;  1D7L A;  3AEC A;  2B9W A;  2VZ2 A;  1BGJ A;  1YQ4 A;  2R45 A;  2JB2 A;  1GEU A;  2XFU A;  3AXB A;  4GAP A;  3P4R A;  2OA1 A;  5FS8 A;  4BJY A;  4Z2U A;  1E1M A;  3QVP A;  2CFY A;  2X8H A;  2RGJ A;  2BK5 A;  3G5Q A;  5EBK A;  2V3B A;  3RP7 A;  1SEZ A;  4I59 A;  1PXC A;  1D4E A;  3RP6 A;  3PS9 A;  3SGL A;  5KMS A;  2Q0L A;  1GRH A;  1JRY A;  1XDI A;  3CMM A;  4U2S A;  4REK A;  3GRT A;  4TM3 A;  2VQ7 A;  1IUS A;  1MO9 A;  1OJA A;  1TYP A;  2B76 A;  2QA1 A;  4JDR A;  2DKH A;  2BC0 A;  3IC9 A;  4BK2 A;  4GDP A;  1TDE A;  1PJ7 A;  2WDV A;  2WPF A;  4N9X A;  3LOV A;  4J36 A;  1OJD A;  4K5S A;  4YSH A;  1F6M A;  3P4P A;  2ZZC A;  2YLR A;  1Q1R A;  4TLZ A;  4NTD A;  4CNJ A;  3GSI A;  1UKV G;  1Q9I A;  2YG4 A;  4XXG A;  4IVO B;  4CBQ A;  1TYT A;  3LAD A;  3IWA A;  2Z5X A;  1TDN A;  2WP6 A;  1PJ6 A;  2VRL A;  1BZL A;  3Q9T A;  3SZC A;  2Y6R A;  2BC1 A;  3AE5 A;  4DNA A;  3VQR A;  3L8K A;  2UZZ A;  1Y56 B;  2GAH B;  4KX6 A;  1B37 A;  3DK9 A;  4H2Q A;  4FDC B;  1E1L A;  3GMC A;  1NG3 A;  4DSH A;  3T2Z A;  5KXJ A;  4MJW A;  4A65 A;  1GRG A;  2YLX A;  4GRT A;  2GRT A;  4C77 A;  2R0G A;  4A7A A;  3UOV A;  1DJN A;  3DGH A;  4H2P A;  1KNR A;  1MXT A;  3V3O A;  3QSM A;  3ATR A;  2R0P A;  1GRF A;  3BI4 A;  4Z44 A;  2FJD A;  4K8D A;  3SZ0 A;  4PAB A;  1GTE A;  1K0L A;  1N4W A;  1N4U A;  5C3J A;  2X8G A;  3NH3 X;  3AEB A;  3GRS A;  4IV9 A;  4LA1 A;  4Y4M A;  1E7P A;  2YR5 A;  4ADW A;  4EIQ A;  4EQX A;  1DOC A;  3ZYX A;  4FK1 A;  1CJC A;  2QAE A;  4YSX A;  1NPX A;  1CF3 A;  3QSS A;  4J2W A;  4B65 A;  3CNJ A;  4OPL A;  3UP4 A;  2VOU A;  3V76 A;  2AQJ A;  2AAQ A;  2RGO A;  4EMW A;  2XVJ A;  2C3C A;  2YM2 A;  2FJB A;  4WX1 A;  1GER A;  1X31 B;  1EL7 A;  5FS7 A;  4AP3 A;  4TLX A;  4BK3 A;  2Q0K A;  2V5Z A;  4OVI A;  1YKJ A;  4H50 A;  4AOX A;  1L0V A;  3GWF A;  1H7X A;  4CCR A;  1H84 A;  1P2H A;  3C96 A;  2FJE A;  3ZDN A;  4CCQ A;  2WPE A;  3NGC X;  4O5U A;  3WE0 A;  3AE6 A;  2B7R A;  4YSZ A;  1QJD A;  1VRQ B;  1H81 A;  3KLJ A;  3GD4 A;  5M10 A;  2XCG A;  3AYI A;  3UOZ A;  1E1K A;  3B6D A;  2E4G A;  1L9C A;  3LB8 A;  2XLT A;  4GF7 A;  4EQS A;  1VDC A;  2C72 A;  1CL0 A;  2WU2 A;  3NN0 X;  2XFQ A;  1D7Y A;  2GR2 A;  2GR1 A;  1S2Y A;  5HHF A;  1BGN A;  4EM3 A;  2XLP A;  4H7U A;  1KF6 A;  2NVK X;  4H4V A;  3NK0 X;  4E0V A;  2GV8 A;  2ARD A;  4USR A;  2GB0 A;  2APG A;  2C67 A;  3UP5 A;  2YLZ A;  4Z2T A;  2XLU A;  2FJA A;  1LJ1 A;  1ONF A;  4UDP A;  1LTX R;  3II4 A;  4A5L A;  3T37 A;  1LPF A;  1GND A;  5J7X A;  1DOE A;  3VRB A;  5KVI A;  2X8C A;  4TM4 A;  1TDK A;  1TDF A;  3ALL A;  4EMI A;  2YVJ A;  2YG6 A;  4OCG A;  3KKJ A;  1ZY8 A;  1F8R A;  2ZZ0 A;  3ALJ A;  5JCI A;  3T2K A;  3UKF A;  2XDO A;  2A87 A;  3ISH A;  3P9U A;  4G73 A;  3DH9 A;  4OPD A;  4NNJ A;  4USQ A;  2VVL A;  4A99 A;  1IUT A;  1D4D A;  1KSS A;  4C3Y A;  2BS2 A;  4JN9 A;  3KA7 A;  1E39 A;  3AE4 A;  2Q7V A;  1GRT A;  5KMQ A;  5JCN A;  4AOS A;  4NWZ A;  5KOW A;  3NIX A;  4Z24 A;  3GDN A;  4OPU A;  4B66 A;  1DJQ A;  4IVM B;  5EOW A;  2R46 A;  4K2X A;  2X3N A;  2YLS A;  4YWO A;  5TR3 A;  4A6N B;  5LV9 A;  3DJD A;  1EL8 A;  3NLC A;  3CPH G;  3H4K A;  2C64 A;  4CNK A;  3HYV A;  3M0O A;  4GDE A;  2JK6 A;  2Q6U A;  4RG4 A;  4A9W A;  4BJZ A;  2XYO A;  1NHS A;  2W0H A;  2BCG G;  1AOG A;  2O9Z A;  1DNC A;  2BCP A;  1O94 A;  4WCT A;  2WOI A;  1DXL A;  3AYL A;  3ABV A;  2NPX A;  1ZDL A;  2OLN A;  3NRN A;  1REO A;  2XVH A;  2XLR A;  3NN6 X;  3DA1 A;  2GR3 A;  2GF3 A;  5HYM A;  2GQW A;  4JY3 A;  5GRT A;  2I0Z A;  2YAU A;  2IID A;  2JKC A;  3AWI A;  1W4X A;  4Z43 A;  1XPQ A;  1CC4 A;  3ICS A;  3P1W A;  3T2Y A;  1MOK A;  1ZP0 A;  2GEW A;  2BK3 A;  4ZCD A;  3K7T A;  3LXD A;  1PXB A;  3VRA A;  2EQ6 A;  3CN8 A;  4J56 A;  4CY6 A;  3DME A;  4RSL A;  1IJH A;  1IUX A;  3NHO X;  3CPJ G;  4YTN A;  2BS4 A;  3F8D A;  3EF6 A;  3BHF A;  4CRT A;  4II2 A;  4H4W A;  2BAB A;  1KNP A;  3QFA A;  1GAL A;  3K7Q X;  4H4Q A;  1PBB A;  4IA6 A;  1EBD A;  1PN0 A;  3NYF A;  3UCL A;  4EMJ A;  3BHK A;  1ZMC A;  3AD7 B;  1FEA A;  2CDU A;  1GT8 A;  5FMH A;  1GRB A;  2WS3 A;  2VRM A;  1Q1W A;  4H4U A;  5ER0 A;  3AD9 B;  3UTE A;  3BI2 A;  4GAV A;  1CBO A;  4C5O A;  5BRT A;  2C7G A;  1M64 A;  3GDP A;  1LVL A;  4H4R A;  1NG4 A;  1L9E A;  5J60 A;  2YR6 A;  4JQ9 A;  4O5Q A;  4AT0 A;  4EQW A;  1N4V A;  3NTA A;  3UKP A;  4OPI A;  1EL5 A;  1CHU A;  1COY A;  2XFP A;  4U8N A;  5M0Z A;  3SZF A;  1FOH A;  3CNT A;  3DJJ A;  3KVE A;  5CQF A;  4A6N A;  4UP3 A;  3FMW A;  3VR9 A;  3HYX A;  4U8J A;  3SZW A;  2C70 A;  1RYI A;  2VQB A;  3AE3 A;  4JNQ A;  3CPI G;  4G6H A;  1PHH A;  3NYC A;  3AEE A;  4JY2 A;  3AB1 A;  3AEF A;  1GES A;  3FPZ A;  2YWL A;  2BRA A;  3GWD A;  5BUK A;  3ICT A;  3IHM A;  2YG7 A;  4DSG A;  3KPF A;  5U1O A;  2TMD A;  4NZH A;  3LJP A;  3ICR A;  3I3L A;  2XLS A;  5KRQ A;  3VRD B;  4U2T A;  4ZN0 A;  3CTY A;  4B1B A;  4J33 A;  2GMJ A;  3UOX A;  3UKQ A;  2WU5 A;  2XVE A;  1JNR A;  3NKS A;  1H83 A;  4GR1 A;  2JAE A;  2XVI A;  1GPE A;  1FEC A;  2DKI A;  3NNE A;  3IHG A;  2HQM A;  1NHQ A;  1YQ3 A;  3AE8 A;  3C4A A;  3COX A;  1JEH A;  1GRE A;  3C4N A;  4RG3 A;  3SYI A;  5FS9 A;  4K22 A;  4YT0 A;  2C4C A;  4U2L A;  2V3A A;  4J57 A;  4AP1 A;  2GVC A;  5KMR A;  1H82 A;  1FEB A;  1CC2 A;  3CND A;  4TM0 A;  2VVM A;  2X50 A;  3D1C A;  3ADA B;  2WEU A;  1M6I A;  3BI5 A;  2XFN A;  3I6D A;  3O0H A;  4H4S A;  3LZX A;  4NTE A;  1S3B A;  2WHD A;  2B9Y A;  1QO8 A;  1PBF A;  1NHR A;  5U25 A;  2H89 A;  4ECH A;  3B3R A;  4U8L A;  1FCD A;  1H86 A;  4DGK A;  2CUL A;  2BYB A;  4H4P A;  3S61 A;  2XFO A;  2CVJ A;  1B8S A;  1BF3 A;  4U8P A;  4Y4N A;  5HY5 A;  2QCU A;  1BKW A;  1O5W A;  2WES A;  4FK1 C;  4FX9 A;  1XAN A;  5HXI A;  1O95 A;  2R4J A;  2BXS A;  2AR8 A;  5FS6 A;  3UTG A;  1K4Q A;  2E1M A;  1CC6 A;  2JB3 A;  2YQU A;  1B4V A;  1XHC A;  1NDA A;  1PBE A;  3OC4 A;  3KD9 A;  5KNL A;  2H88 A;  4J34 A;  3BNU A;  1BWC A;  1JNZ A;  3AE7 A;  2V6O A;  3K30 A;  3AYJ A;  2BRY A;  1OJC A;  2V60 A;  3CNS A;  5L46 A;  2YLW A;  4KPR A;  4EM4 A;  5U63 A;  2GH5 A;  2R0C A;  2Z5Y A;  3KU9 A;  1RP0 A;  2YVG A;  3EAO A;  3JSK A;  4J31 A;  3S5W A;  2BK4 A;  2E5V A;  1GV4 A;  4X9M A;  3H8L A;  1ZK7 A;  3V3N A;  2ZBW A;  4D04 A;  1D5T A;  4G6G A;  3EPT A;  3FIM B;  2C75 A;  3OZ2 A;  4OPC A;  1OJT A;  4A79 A;  2C66 A;  1V59 A;  3T0K A;  2VVL G;  3ATQ A;  5EB5 A;  2BAC A;  4H2N A;  2J3N A;  1ZMD A;  2WOV A;  2C3D A;  3NK1 X;  3NT6 A;  1Z6L A;  1S3E A;  2QA2 A;  1FL2 A;  1ZKQ A;  1LV0 A;  2R9Z A;  3AE1 A;  4H2R A;  1TDO A;  1VG9 A;  4UDR A;  3RED A;  4NTC A;  3F8P A;  4HB9 A;  4C3X A;  4BK1 A;  2X99 A;  5BUL A;  1PJ5 A;  5CKU A;  1DOB A;  5KVH A;  3GMB A;  3KPK A;  3SFE A;  1PBC A;  3BNM A;  1IUW A;  2ZZB A;  3DK4 A;  3FG2 P;  3G5R A;  4U8K A;  4BV6 A;  2YM1 A;  2GQF A;  3P4Q A;  2BA9 A;  1F3P A;  3F8R A;  3RHA A;  3FBS A;  1GXF A;  2WDR A;  4BUR A;  1K0J A;  1PDH A;  2B9X A;  1PXA A;  1KFY A;  1S2Q A;  2GR0 A;  2XVF A;  2C76 A;  3H8I A;  5IPY A;  3QVR A;  2BXR A;  1QLB A;  2GMH A;  3HZL A;  4U8O A;  3SX6 A;  5C2T A;  4H4T A;  1JRX A;  4EIP A;  4LII A;  1N1P A;  4XWZ A;  3T31 A;  2OAL A;  4B64 A;  4YKG A;  4Z26 A;  3L1R A;  1JRZ A;  2WDQ A;  4YSY A;  4GCM A;  2A89 A;  4H4Y A;  4B67 A;  3UKA A;  3IF9 A;  4APN A;  4YXD A;  1VQW A;  3DGZ A;  4B69 A;  5EB4 A;  1ELI A;  3ALM A;  4EQR A;  2YLT A;  1ZX9 A;  3DJE A;  5DBJ A;  2YVF A;  2PYX A;  4GUV A;  3P4S A;  1D4C A;  1HYU A;  1ZOV A;  1LQU A;  3UKL A;  1GSN A;  3E1T A;  3M13 A;  1GTH A;  1L9D A;  1P2E A;  3SQP A;  3UTF A;  5IQ4 A;  1LQT A;  3SXI A;  2OLO A;  4P9S A;  1GOS A;  2TPR A;  2WPC A;  3Q6J A;  1YY5 A;  4Y4L A;  1KDG A;  2EQ7 A;  1KSU A; 
#chains in the Genus database with same CATH homology
 2RAB A;  4X9N A;  1NEK A;  4CY8 A;  1CJ4 A;  1F8S A;  1H7W A;  3ITJ A;  5JCL A;  2WP5 A;  3D8X A;  3DJG X;  1H6V A;  2OAM A;  1NHP A;  3UKH A;  3AED A;  3GYX A;  3LZW A;  3QJ4 A;  2WP9 A;  3AD8 B;  3UTH A;  3CIR A;  3AE9 A;  3QSE A;  3AEA A;  4G74 A;  3SY4 A;  3VR8 A;  4D03 A;  4Z2R A;  2BS3 A;  1GET A;  2YR4 A;  3RNM A;  3GYI A;  3K7M X;  4X4J A;  2Y6Q A;  3G5S A;  4ICY A;  2B7S A;  2C65 A;  3QFB A;  3NG7 X;  4JNA A;  3NYE A;  4NEW A;  4C74 A;  3SM8 A;  2FBW A;  3NTD A;  1GRA A;  3URH A;  2PHH A;  3UOY A;  1Y0P A;  2R4E A;  3PO7 A;  1F8W A;  3CGE A;  4PAA A;  4AT2 A;  4Z25 A;  1IUU A;  1DOD A;  3CNP A;  3HYW A;  3PVC A;  1JU2 A;  2RGH A;  2C73 A;  3CGD A;  1NEN A;  3GD3 A;  4OPG A;  4YKF A;  5BVA A;  5KWF A;  4I58 A;  4NEV A;  1CJ3 A;  1IUV A;  5IQ1 A;  4G9K A;  2ACZ A;  3R9U A;  1OJ9 A;  1PS9 A;  5KOX A;  2IVE A;  2EQ9 A;  2EQ8 A;  2V61 A;  2WBA A;  3AE2 A;  4HA6 A;  5KMP A;  3DK8 A;  3NK2 X;  4U8M A;  2A8X A;  4B68 A;  4LU6 A;  2WET A;  3UKK A;  1CJ2 A;  4M52 A;  5GSN A;  5JCM A;  1K0I A;  2GAG B;  2WOW A;  2JBV A;  4B63 A;  1PBD A;  1B5Q A;  1TRB A;  2WQY A;  1NAA A;  1EL9 A;  1Y56 A;  4TM1 A;  4K5R A;  1JOA A;  3GYJ A;  4K7Z A;  4YTM A;  4ZCC A;  1ZOY A;  4II3 A;  1YQZ A;  4H4Z A;  5JCK A;  2YG5 A;  3T14 A;  4U8I A;  1E1N A;  3CGC A;  3RP8 A;  2F5Z A;  4OPT A;  3CGB A;  1VG0 A;  2JB1 A;  3EAN A;  4H4X A;  4UDQ A;  4XWR A;  3SFD A;  1E6E A;  4YTP A;  3AEG A;  2IVD A;  1RSG A;  3M12 A;  4IA5 A;  2YG3 A;  1D7L A;  3AEC A;  2B9W A;  2VZ2 A;  1BGJ A;  1YQ4 A;  2R45 A;  2JB2 A;  1GEU A;  2XFU A;  3AXB A;  4GAP A;  3P4R A;  2OA1 A;  5FS8 A;  4BJY A;  4Z2U A;  1E1M A;  3QVP A;  2CFY A;  2X8H A;  2RGJ A;  2BK5 A;  3G5Q A;  5EBK A;  2V3B A;  3RP7 A;  1SEZ A;  4I59 A;  1PXC A;  1D4E A;  3RP6 A;  3PS9 A;  3SGL A;  5KMS A;  2Q0L A;  1GRH A;  1JRY A;  1XDI A;  3CMM A;  4U2S A;  4REK A;  3GRT A;  4TM3 A;  2VQ7 A;  1IUS A;  1MO9 A;  1OJA A;  1TYP A;  2B76 A;  2QA1 A;  4JDR A;  2DKH A;  2BC0 A;  3IC9 A;  4BK2 A;  4GDP A;  1TDE A;  1PJ7 A;  2WDV A;  2WPF A;  4N9X A;  3LOV A;  4J36 A;  1OJD A;  4K5S A;  4YSH A;  1F6M A;  3P4P A;  2ZZC A;  2YLR A;  1Q1R A;  4TLZ A;  4NTD A;  4CNJ A;  3GSI A;  1UKV G;  1Q9I A;  2YG4 A;  4XXG A;  4IVO B;  4CBQ A;  1TYT A;  3LAD A;  3IWA A;  2Z5X A;  1TDN A;  2WP6 A;  1PJ6 A;  2VRL A;  1BZL A;  3Q9T A;  3SZC A;  2Y6R A;  2BC1 A;  3AE5 A;  4DNA A;  3VQR A;  3L8K A;  2UZZ A;  1Y56 B;  2GAH B;  4KX6 A;  1B37 A;  3DK9 A;  4H2Q A;  4FDC B;  1E1L A;  3GMC A;  1NG3 A;  4DSH A;  3T2Z A;  5KXJ A;  4MJW A;  4A65 A;  1GRG A;  2YLX A;  4GRT A;  2GRT A;  4C77 A;  2R0G A;  4A7A A;  3UOV A;  1DJN A;  3DGH A;  4H2P A;  1KNR A;  1MXT A;  3V3O A;  3QSM A;  3ATR A;  2R0P A;  1GRF A;  3BI4 A;  4Z44 A;  2FJD A;  4K8D A;  3SZ0 A;  4PAB A;  1GTE A;  1K0L A;  1N4W A;  1N4U A;  5C3J A;  2X8G A;  3NH3 X;  3AEB A;  3GRS A;  4IV9 A;  4LA1 A;  4Y4M A;  1E7P A;  2YR5 A;  4ADW A;  4EIQ A;  4EQX A;  1DOC A;  3ZYX A;  4FK1 A;  1CJC A;  2QAE A;  4YSX A;  1NPX A;  1CF3 A;  3QSS A;  4J2W A;  4B65 A;  3CNJ A;  4OPL A;  3UP4 A;  2VOU A;  3V76 A;  2AQJ A;  2AAQ A;  2RGO A;  4EMW A;  2XVJ A;  2C3C A;  2YM2 A;  2FJB A;  4WX1 A;  1GER A;  1X31 B;  1EL7 A;  5FS7 A;  4AP3 A;  4TLX A;  4BK3 A;  2Q0K A;  2V5Z A;  4OVI A;  1YKJ A;  4H50 A;  4AOX A;  1L0V A;  3GWF A;  1H7X A;  4CCR A;  1H84 A;  1P2H A;  3C96 A;  2FJE A;  3ZDN A;  4CCQ A;  2WPE A;  3NGC X;  4O5U A;  3WE0 A;  3AE6 A;  2B7R A;  4YSZ A;  1QJD A;  1VRQ B;  1H81 A;  3KLJ A;  3GD4 A;  5M10 A;  2XCG A;  3AYI A;  3UOZ A;  1E1K A;  3B6D A;  2E4G A;  1L9C A;  3LB8 A;  2XLT A;  4GF7 A;  4EQS A;  1VDC A;  2C72 A;  1CL0 A;  2WU2 A;  3NN0 X;  2XFQ A;  1D7Y A;  2GR2 A;  2GR1 A;  1S2Y A;  5HHF A;  1BGN A;  4EM3 A;  2XLP A;  4H7U A;  1KF6 A;  2NVK X;  4H4V A;  3NK0 X;  4E0V A;  2GV8 A;  2ARD A;  4USR A;  2GB0 A;  2APG A;  2C67 A;  3UP5 A;  2YLZ A;  4Z2T A;  2XLU A;  2FJA A;  1LJ1 A;  1ONF A;  4UDP A;  1LTX R;  3II4 A;  4A5L A;  3T37 A;  1LPF A;  1GND A;  5J7X A;  1DOE A;  3VRB A;  5KVI A;  2X8C A;  4TM4 A;  1TDK A;  1TDF A;  3ALL A;  4EMI A;  2YVJ A;  2YG6 A;  4OCG A;  3KKJ A;  1ZY8 A;  1F8R A;  2ZZ0 A;  3ALJ A;  5JCI A;  3T2K A;  3UKF A;  2XDO A;  2A87 A;  3ISH A;  3P9U A;  4G73 A;  3DH9 A;  4OPD A;  4NNJ A;  4USQ A;  2VVL A;  4A99 A;  1IUT A;  1D4D A;  1KSS A;  4C3Y A;  2BS2 A;  4JN9 A;  3KA7 A;  1E39 A;  3AE4 A;  2Q7V A;  1GRT A;  5KMQ A;  5JCN A;  4AOS A;  4NWZ A;  5KOW A;  3NIX A;  4Z24 A;  3GDN A;  4OPU A;  4B66 A;  1DJQ A;  4IVM B;  5EOW A;  2R46 A;  4K2X A;  2X3N A;  2YLS A;  4YWO A;  5TR3 A;  4A6N B;  5LV9 A;  3DJD A;  1EL8 A;  3NLC A;  3CPH G;  3H4K A;  2C64 A;  4CNK A;  3HYV A;  3M0O A;  4GDE A;  2JK6 A;  2Q6U A;  4RG4 A;  4A9W A;  4BJZ A;  2XYO A;  1NHS A;  2W0H A;  2BCG G;  1AOG A;  2O9Z A;  1DNC A;  2BCP A;  1O94 A;  4WCT A;  2WOI A;  1DXL A;  3AYL A;  3ABV A;  2NPX A;  1ZDL A;  2OLN A;  3NRN A;  1REO A;  2XVH A;  2XLR A;  3NN6 X;  3DA1 A;  2GR3 A;  2GF3 A;  5HYM A;  2GQW A;  4JY3 A;  5GRT A;  2I0Z A;  2YAU A;  2IID A;  2JKC A;  3AWI A;  1W4X A;  4Z43 A;  1XPQ A;  1CC4 A;  3ICS A;  3P1W A;  3T2Y A;  1MOK A;  1ZP0 A;  2GEW A;  2BK3 A;  4ZCD A;  3K7T A;  3LXD A;  1PXB A;  3VRA A;  2EQ6 A;  3CN8 A;  4J56 A;  4CY6 A;  3DME A;  4RSL A;  1IJH A;  1IUX A;  3NHO X;  3CPJ G;  4YTN A;  2BS4 A;  3F8D A;  3EF6 A;  3BHF A;  4CRT A;  4II2 A;  4H4W A;  2BAB A;  1KNP A;  3QFA A;  1GAL A;  3K7Q X;  4H4Q A;  1PBB A;  4IA6 A;  1EBD A;  1PN0 A;  3NYF A;  3UCL A;  4EMJ A;  3BHK A;  1ZMC A;  3AD7 B;  1FEA A;  2CDU A;  1GT8 A;  5FMH A;  1GRB A;  2WS3 A;  2VRM A;  1Q1W A;  4H4U A;  5ER0 A;  3AD9 B;  3UTE A;  3BI2 A;  4GAV A;  1CBO A;  4C5O A;  5BRT A;  2C7G A;  1M64 A;  3GDP A;  1LVL A;  4H4R A;  1NG4 A;  1L9E A;  5J60 A;  2YR6 A;  4JQ9 A;  4O5Q A;  4AT0 A;  4EQW A;  1N4V A;  3NTA A;  3UKP A;  4OPI A;  1EL5 A;  1CHU A;  1COY A;  2XFP A;  4U8N A;  5M0Z A;  3SZF A;  1FOH A;  3CNT A;  3DJJ A;  3KVE A;  5CQF A;  4A6N A;  4UP3 A;  3FMW A;  3VR9 A;  3HYX A;  4U8J A;  3SZW A;  2C70 A;  1RYI A;  2VQB A;  3AE3 A;  4JNQ A;  3CPI G;  4G6H A;  1PHH A;  3NYC A;  3AEE A;  4JY2 A;  3AB1 A;  3AEF A;  1GES A;  3FPZ A;  2YWL A;  2BRA A;  3GWD A;  5BUK A;  3ICT A;  3IHM A;  2YG7 A;  4DSG A;  3KPF A;  5U1O A;  2TMD A;  4NZH A;  3LJP A;  3ICR A;  3I3L A;  2XLS A;  5KRQ A;  3VRD B;  4U2T A;  4ZN0 A;  3CTY A;  4B1B A;  4J33 A;  2GMJ A;  3UOX A;  3UKQ A;  2WU5 A;  2XVE A;  1JNR A;  3NKS A;  1H83 A;  4GR1 A;  2JAE A;  2XVI A;  1GPE A;  1FEC A;  2DKI A;  3NNE A;  3IHG A;  2HQM A;  1NHQ A;  1YQ3 A;  3AE8 A;  3C4A A;  3COX A;  1JEH A;  1GRE A;  3C4N A;  4RG3 A;  3SYI A;  5FS9 A;  4K22 A;  4YT0 A;  2C4C A;  4U2L A;  2V3A A;  4J57 A;  4AP1 A;  2GVC A;  5KMR A;  1H82 A;  1FEB A;  1CC2 A;  3CND A;  4TM0 A;  2VVM A;  2X50 A;  3D1C A;  3ADA B;  2WEU A;  1M6I A;  3BI5 A;  2XFN A;  3I6D A;  3O0H A;  4H4S A;  3LZX A;  4NTE A;  1S3B A;  2WHD A;  2B9Y A;  1QO8 A;  1PBF A;  1NHR A;  5U25 A;  2H89 A;  4ECH A;  3B3R A;  4U8L A;  1FCD A;  1H86 A;  4DGK A;  2CUL A;  2BYB A;  4H4P A;  3S61 A;  2XFO A;  2CVJ A;  1B8S A;  1BF3 A;  4U8P A;  4Y4N A;  5HY5 A;  2QCU A;  1BKW A;  1O5W A;  2WES A;  4FK1 C;  4FX9 A;  1XAN A;  5HXI A;  1O95 A;  2R4J A;  2BXS A;  2AR8 A;  5FS6 A;  3UTG A;  1K4Q A;  2E1M A;  1CC6 A;  2JB3 A;  2YQU A;  1B4V A;  1XHC A;  1NDA A;  1PBE A;  3OC4 A;  3KD9 A;  5KNL A;  2H88 A;  4J34 A;  3BNU A;  1BWC A;  1JNZ A;  3AE7 A;  2V6O A;  3K30 A;  3AYJ A;  2BRY A;  1OJC A;  2V60 A;  3CNS A;  5L46 A;  2YLW A;  4KPR A;  4EM4 A;  5U63 A;  2GH5 A;  2R0C A;  2Z5Y A;  3KU9 A;  1RP0 A;  2YVG A;  3EAO A;  3JSK A;  4J31 A;  3S5W A;  2BK4 A;  2E5V A;  1GV4 A;  4X9M A;  3H8L A;  1ZK7 A;  3V3N A;  2ZBW A;  4D04 A;  1D5T A;  4G6G A;  3EPT A;  3FIM B;  2C75 A;  3OZ2 A;  4OPC A;  1OJT A;  4A79 A;  2C66 A;  1V59 A;  3T0K A;  2VVL G;  3ATQ A;  5EB5 A;  2BAC A;  4H2N A;  2J3N A;  1ZMD A;  2WOV A;  2C3D A;  3NK1 X;  3NT6 A;  1Z6L A;  1S3E A;  2QA2 A;  1FL2 A;  1ZKQ A;  1LV0 A;  2R9Z A;  3AE1 A;  4H2R A;  1TDO A;  1VG9 A;  4UDR A;  3RED A;  4NTC A;  3F8P A;  4HB9 A;  4C3X A;  4BK1 A;  2X99 A;  5BUL A;  1PJ5 A;  5CKU A;  1DOB A;  5KVH A;  3GMB A;  3KPK A;  3SFE A;  1PBC A;  3BNM A;  1IUW A;  2ZZB A;  3DK4 A;  3FG2 P;  3G5R A;  4U8K A;  4BV6 A;  2YM1 A;  2GQF A;  3P4Q A;  2BA9 A;  1F3P A;  3F8R A;  3RHA A;  3FBS A;  1GXF A;  2WDR A;  4BUR A;  1K0J A;  1PDH A;  2B9X A;  1PXA A;  1KFY A;  1S2Q A;  2GR0 A;  2XVF A;  2C76 A;  3H8I A;  5IPY A;  3QVR A;  2BXR A;  1QLB A;  2GMH A;  3HZL A;  4U8O A;  3SX6 A;  5C2T A;  4H4T A;  1JRX A;  4EIP A;  4LII A;  1N1P A;  4XWZ A;  3T31 A;  2OAL A;  4B64 A;  4YKG A;  4Z26 A;  3L1R A;  1JRZ A;  2WDQ A;  4YSY A;  4GCM A;  2A89 A;  4H4Y A;  4B67 A;  3UKA A;  3IF9 A;  4APN A;  4YXD A;  1VQW A;  3DGZ A;  4B69 A;  5EB4 A;  1ELI A;  3ALM A;  4EQR A;  2YLT A;  1ZX9 A;  3DJE A;  5DBJ A;  2YVF A;  2PYX A;  4GUV A;  3P4S A;  1D4C A;  1HYU A;  1ZOV A;  1LQU A;  3UKL A;  1GSN A;  3E1T A;  3M13 A;  1GTH A;  1L9D A;  1P2E A;  3SQP A;  3UTF A;  5IQ4 A;  1LQT A;  3SXI A;  2OLO A;  4P9S A;  1GOS A;  2TPR A;  2WPC A;  3Q6J A;  1YY5 A;  4Y4L A;  1KDG A;  2EQ7 A;  1KSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...