3QJ4A

Crystal structure of human renalase (isoform 1)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
341
structure length
335
Chain Sequence
MAQVLIVGAGMTGSLCAALLRRQTGPLYLAVWDKADDSGGRMTTACSPHNPQCTADLGAQYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMGDCNFVAPQGISSIIKHYLKESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISECQRQQLEAVSYSSRYALGLFYEAGTDVPWAGQYITSNPCIRFVSIDNKKRNIESSIGPSLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANCPGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Renalase
publication title FAD-binding site and NADP reactivity in human renalase: a new enzyme involved in blood pressure regulation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 89
structure length 335
sequence length 341
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2011-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3qj4A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3qj4A02
2RGHA 1YQZA 2GH5A 2XDOA 4RG4A 2GR1A 5BRTA 2FJAA 1QO8A 3Q6JA 5EB4A 1PXBA 2EQ8A 2WU5A 3BI5A 1D7YA 3IWAA 2GEWA 4Z2TA 4FX9A 1H81A 3S5WA 4M52A 1EL9A 3NTDA 3UKLA 3CNDA 1B37A 4CNJA 3CIRA 1GPEA 4IVOB 1LJ1A 3UTEA 4CBQA 4GCMA 2VOUA 2TPRA 1KDGA 4D04A 3IHGA 4U8IA 2ZZ0A 3II4A 2YLTA 4KPRA 3KVEA 2GVCA 3DK4A 3C96A 3LOVA 3AEAA 2WOWA 2Q0KA 3FG2P 2WEUA 3P1WA 5M0ZA 4NTCA 4TM0A 1RSGA 4JN9A 2X99A 2Z5YA 3GD4A 2C7GA 1DJNA 3NKSA 1GRTA 1O5WA 3GYJA 3UCLA 4LU6A 3OC4A 1ZX9A 1Y56B 3B3RA 2C72A 2QA1A 1HYUA 3ICSA 3NLCA 2X50A 4NEWA 4B66A 1F6MA 3RHAA 3NGCX 3ZDNA 4H2QA 3F8RA 4USRA 3CNJA 1GALA 3CNTA 2Y6RA 1OJTA 3S61A 5FS9A 2GRTA 3SFEA 1VDCA 1P2EA 3CPHG 3P4SA 1CC4A 2YG6A 5BULA 4LIIA 2WBAA 1FEBA 1PXAA 4NEVA 3ISHA 1NENA 3AD7B 4C5OA 1D7LA 2B7SA 2IVEA 2JB3A 4U8NA 4WCTA 4EMIA 3LZXA 1EL7A 4H7UA 3C4AA 5U63A 2XVJA 2WPCA 2RABA 4U2LA 5FS6A 4EM3A 2WDVA 1REOA 2XFQA 3G5RA 1D4EA 4X9NA 2F5ZA 1IUXA 2GF3A 4BJYA 3H8IA 4FDCB 2ZBWA 4TM3A 3SM8A 1K0IA 2GMJA 2R46A 3ALLA 2V6OA 3IHMA 4H4YA 4B64A 1E7PA 2R45A 4A6NA 2C3DA 4OPDA 3LZWA 3UTFA 3UOYA 2BCPA 2GQWA 2YM2A 2XLSA 1K0LA 1PS9A 4OPUA 1L9EA 3EPTA 4K5SA 4DNAA 2Q0LA 3AYIA 3B6DA 3NN6X 3CTYA 1GT8A 1E1MA 3AE7A 4Y4LA 2C3CA 2APGA 1TDNA 3ICRA 1DXLA 2V3AA 2B9YA 1GNDA 1LTXR 5KXJA 4ZCCA 5JCNA 1TYTA 4X4JA 3UKHA 4JY3A 1DOCA 4CCQA 5KRQA 1H7XA 1W4XA 4RG3A 1GRGA 1GTHA 4I58A 3K7QX 5FMHA 2YG4A 2YLSA 4YT0A 2ARDA 4USQA 4J34A 2PYXA 3GWFA 2FJDA 4GR1A 4TLZA 5JCLA 4H4TA 3BI4A 1KF6A 4YXDA 3T37A 3SGLA 5IQ1A 1YY5A 4AOXA 3EF6A 4EIQA 5ER0A 2ZZCA 3GD3A 2BXSA 3GYIA 2C66A 1ZOVA 2BC0A 4IA6A 4A7AA 4O5UA 4Z26A 4B68A 5HXIA 2OA1A 4B65A 2Q6UA 1BKWA 1H83A 1GRHA 1N1PA 4MJWA 1S2QA 3GSIA 1NDAA 2R4JA 2VRLA 1MO9A 4A65A 2XVEA 3UOZA 4B67A 1EL5A 1ZDLA 4U8LA 1GV4A 1BGJA 1IUVA 1ZKQA 2XFPA 3CGBA 3DK9A 3NYEA 2A87A 3VRAA 4YTPA 1IUWA 1CHUA 1GEUA 4LA1A 3UKKA 2OALA 2YLXA 1E1LA 2B7RA 2V3BA 1IJHA 3ATRA 4BK3A 2YR4A 4E0VA 2QA2A 3GMCA 4APNA 2R4EA 4DGKA 3CGEA 3KKJA 4Z2UA 3LB8A 2YLRA 1N4VA 2YWLA 2GR2A 2FJBA 1P2HA 1NG4A 1KNPA 5KWFA 4K8DA 1E39A 2C64A 4EQWA 1OJ9A 4K2XA 4OPGA 2AAQA 1ZY8A 2JBVA 3AEEA 3FIMB 2X3NA 3K7TA 2YVFA 2GAHB 3EAOA 4O5QA 2WHDA 2Z5XA 2E5VA 1D4DA 2FBWA 3NNEA 3NT6A 3QFAA 4A99A 1DJQA 4YSYA 2XLRA 2HQMA 1TDEA 3REDA 4B1BA 4UP3A 5TR3A 1LQUA 5EBKA 1F3PA 1NHSA 2QCUA 2WESA 2XVHA 3SQPA 1GOSA 2OAMA 4TLXA 1YQ3A 2XVIA 1CBOA 5CQFA 1L9CA 1PHHA 1CC6A 3ALJA 3DGHA 3P4RA 1CJ2A 1VQWA 1KSSA 3PO7A 4GDPA 1S3EA 1O95A 4ICYA 1GSNA 1LV0A 3CGDA 1FOHA 3KPFA 1XPQA 2WDQA 2A89A 1COYA 1EL8A 4FK1C 1VG9A 2GV8A 4XWZA 1FL2A 2YQUA 3PS9A 1QJDA 4JDRA 1Q1WA 3AEFA 4OPIA 2WDRA 4C74A 2R0CA 4AT2A 5GRTA 1AOGA 5KVHA 3PVCA 1XANA 2CDUA 2Y6QA 3FBSA 1CJ4A 4C3XA 3CPJG 1H7WA 3LADA 3NH3X 1IUSA 2O9ZA 3BI2A 1PBFA 1TRBA 1CL0A 1X31B 3F8PA 2YR6A 2BK4A 4XXGA 2AR8A 4UDQA 5GSNA 5KOXA 4KX6A 2ZZBA 3RP7A 2I0ZA 1SEZA 3GRSA 3NTAA 4CRTA 2XLUA 4BJZA 4GRTA 4RSLA 5KOWA 2BXRA 4NTDA 1F8RA 4YWOA 4J2WA 4J56A 5HYMA 4IV9A 2CULA 4H4WA 4ZCDA 2WOVA 3ICTA 2IIDA 1VG0A 4UDPA 1CJCA 3CNSA 3QVPA 5FS8A 1NPXA 2V5ZA 1E6EA 2VVLG 2YR5A 3CNPA 1TDKA 4JNQA 4H4UA 1NHQA 4AP3A 1E1KA 3ATQA 4B69A 5M10A 4H2NA 3BHFA 2C70A 3AE5A 4REKA 4ZN0A 3QFBA 4K7ZA 4Y4NA 2EQ9A 2B76A 1F8SA 4A6NB 1YKJA 4EMJA 1DODA 5U25A 3V3NA 2XVFA 2WPEA 3CN8A 3I3LA 1OJDA 2VVMA 2X8CA 3JSKA 2GR3A 3E1TA 3KLJA 5HHFA 3UKQA 2C73A 3G5SA 3VQRA 4H4QA 4X9MA 4EMWA 5C3JA 1UKVG 4C77A 2BYBA 5BVAA 4U8PA 1BZLA 1JRXA 2GMHA 1JOAA 1TDOA 1ZP0A 2R0PA 2VQBA 2X8GA 3DK8A 1L9DA 2XLTA 1YQ4A 3Q9TA 3NYFA 1XDIA 3AE6A 3QJ4A 3CGCA 1IUTA 2JKCA 3COXA 4AP1A 1CF3A 2BABA 3ABVA 4UDRA 2VVLA 1H84A 1PBEA 3K7MX 1NHPA 4H4ZA 2DKIA 2JK6A 3L8KA 3NK2X 1JNZA 2NPXA 1GRBA 4U2SA 2JB2A 3AEBA 4EQRA 1QLBA 1CC2A 3M12A 2YLWA 1N4UA 1KFYA 1BWCA 2YG5A 3O0HA 3F8DA 1FECA 1B5QA 3C4NA 3AE4A 3H4KA 2IVDA 4HA6A 4J31A 4ADWA 2YAUA 1M64A 2XYOA 4Z2RA 5JCKA 1GERA 3AB1A 3AECA 1GRAA 1D5TA 3KA7A 1L0VA 3QSMA 1PN0A 1PJ5A 3BNMA 3NIXA 2XLPA 3QVRA 3VR8A 3AYJA 3FMWA 1GXFA 3KU9A 4OPLA 3IF9A 4EIPA 2BK3A 2YG7A 4BV6A 5KVIA 3DH9A 5J7XA 3UKPA 3UOXA 2OLOA 3G5QA 5JCMA 4Z24A 2XFOA 3AWIA 3ALMA 5IPYA 2GB0A 3NN0X 4GF7A 1FCDA 4YKFA 1VRQB 3DJEA 2CVJA 3AD9B 1PBCA 4GUVA 4A9WA 1PBBA 1RYIA 3DJGX 4JNAA 2WU2A 2YLZA 4XWRA 3DA1A 2B9XA 4CCRA 1H82A 2DKHA 2C67A 2B9WA 4P9SA 1Q9IA 3M13A 3VRBA 4U8OA 3NRNA 4B63A 4A79A 4K5RA 2R0GA 2PHHA 4C3YA 4CY6A 3R9UA 2WETA 1EBDA 4BK2A 4H4SA 2A8XA 2GQFA 1GREA 3VRDB 1GRFA 3P4PA 4IVMB 3RP8A 3NK1X 1RP0A 4J33A 3UTGA 2EQ7A 1IUUA 4OCGA 5FS7A 2JB1A 1Y56A 2WS3A 4EQSA 2R9ZA 3WE0A 5LV9A 3NYCA 3UTHA 1F8WA 3H8LA 4H2RA 4NTEA 3AE1A 1PDHA 1M6IA 3UP4A 4U2TA 4Z44A 3UKAA 4Y4MA 5HY5A 4N9XA 4H4XA 2WP5A 2RGJA 4CNKA 2VZ2A 3QSEA 3CPIG 1OJCA 1PJ7A 2H89A 4A5LA 4YSXA 1GETA 3AE3A 1Q1RA 3LJPA 1LPFA 1S2YA 2WP9A 1XHCA 2YG3A 2WQYA 1E1NA 3QSSA 5U1OA 2BA9A 2XFNA 5IQ4A 1JRZA 3UOVA 3NHOX 4CY8A 3AEGA 4U8KA 3DJDA 2BACA 2E4GA 3BHKA 5EB5A 4IA5A 1B4VA 2VRMA 1ZMDA 2UZZA 5DBJA 4I59A 1TDFA 3ADAB 2W0HA 3AD8B 3GDNA 2C75A 2J3NA 4H4RA 3AXBA 4BK1A 4U8JA 2E1MA 1Y0PA 2YM1A 4H4VA 1S3BA 1PBDA 2WP6A 3DJJA 4J57A 4PABA 1NHRA 4J36A 4YSHA 2Q7VA 1DOEA 2EQ6A 4TM4A 3GWDA 1N4WA 1GESA 1ONFA 2BCGG 4H2PA 2YVGA 3AYLA 3M0OA 3P4QA 4JQ9A 3AEDA 2TMDA 3EANA 2RGOA 1NG3A 2YVJA 2GAGB 3RNMA 2V61A 4Z25A 2WPFA 1O94A 1DNCA 2BS3A 1NAAA 4HB9A 2WOIA 4NZHA 4YTMA 1FEAA 2QAEA 4JY2A 3UKFA 4DSHA 3V76A 3D8XA 4EQXA 2VQ7A 1Z6LA 4U8MA 4WX1A 3NK0X 4DSGA 4D03A 2C65A 3RP6A 3ITJA 3D1CA 4YSZA 2AQJA 1PXCA 2ACZA 1DOBA 1KSUA 1ZMCA 4OPTA 1D4CA 4H4PA 5BUKA 3URHA 3AE9A 3KD9A 1JNRA 4OVIA 3HZLA 1V59A 1H6VA 4YTNA 3L1RA 1B8SA 1LQTA 4OPCA 4BURA 3VR9A 1K0JA 3GRTA 3IC9A 2XFUA 3DMEA 4AOSA 4FK1A 3OZ2A 3K30A 5J60A 3LXDA 1BF3A 3SFDA 2V60A 4H50A 1K4QA 2GR0A 5JCIA 1ZK7A 1H86A 2XCGA 1PJ6A 2BS2A 4Z43A 3FPZA 2C76A 4ECHA 4GDEA 3ZYXA 3V3OA 1ELIA 3GDPA 5L46A 3BNUA 1ZOYA 1JU2A 4PAAA 1OJAA 1LVLA 1CJ3A 1MXTA 3DGZA 3I6DA 5EOWA 3AE8A 5CKUA 1TYPA 3P9UA 4TM1A 4YKGA 2CFYA 2BC1A 1KNRA 4K22A 3UP5A 1JEHA 1MOKA 2X8HA 2OLNA 3AE2A 3NG7X 4AT0A 4EM4A 2JAEA 2FJEA 2BS4A 1NEKA 2BK5A 2H88A 1GTEA 5C2TA 1JRYA 3GMBA 2NVKX 1BGNA
chains in the Genus database with same CATH superfamily
2RGHA 1YQZA 2GH5A 2XDOA 4RG4A 2GR1A 5BRTA 2FJAA 1QO8A 3Q6JA 5EB4A 1PXBA 2EQ8A 2WU5A 3BI5A 1D7YA 3IWAA 2GEWA 4Z2TA 5KNLA 4FX9A 1H81A 3S5WA 4M52A 1EL9A 3NTDA 3UKLA 3CNDA 1B37A 4CNJA 3CIRA 1GPEA 4IVOB 1LJ1A 3UTEA 4CBQA 4GCMA 2VOUA 2TPRA 1KDGA 4D04A 4G6GA 3IHGA 4U8IA 4II2A 2ZZ0A 3II4A 3SX6A 2YLTA 4KPRA 3KVEA 2GVCA 3DK4A 3C96A 3LOVA 3AEAA 2WOWA 2Q0KA 3FG2P 2WEUA 3P1WA 5M0ZA 3SZ0A 4NTCA 4TM0A 1RSGA 4JN9A 2X99A 2Z5YA 4G74A 3GD4A 2C7GA 1DJNA 3NKSA 1GRTA 1O5WA 3GYJA 3HYVA 3UCLA 4LU6A 3OC4A 1ZX9A 1Y56B 3B3RA 2C72A 2QA1A 1HYUA 3ICSA 3NLCA 2X50A 4NEWA 4B66A 1F6MA 3RHAA 3NGCX 3ZDNA 4H2QA 3F8RA 4USRA 3CNJA 1GALA 3CNTA 2Y6RA 1OJTA 3S61A 5FS9A 2GRTA 3SFEA 1VDCA 1P2EA 3CPHG 3P4SA 1CC4A 2YG6A 5BULA 4LIIA 2WBAA 1FEBA 1PXAA 4NEVA 3ISHA 1NENA 3AD7B 4C5OA 1D7LA 2B7SA 3T2KA 4G73A 2IVEA 2JB3A 4U8NA 4WCTA 4EMIA 3LZXA 1EL7A 4H7UA 3C4AA 5U63A 2XVJA 3T2ZA 2WPCA 2RABA 4U2LA 3SYIA 5FS6A 4EM3A 2WDVA 1REOA 2XFQA 3G5RA 1D4EA 4X9NA 2F5ZA 1IUXA 2GF3A 4BJYA 3H8IA 4FDCB 2ZBWA 4TM3A 3SM8A 1K0IA 2GMJA 2R46A 3ALLA 2V6OA 3IHMA 4H4YA 4B64A 1E7PA 2R45A 4A6NA 2C3DA 4OPDA 3LZWA 3UTFA 3UOYA 2BCPA 2GQWA 2YM2A 2XLSA 1K0LA 1PS9A 4OPUA 5KMSA 1L9EA 3EPTA 4K5SA 4DNAA 2Q0LA 3AYIA 3B6DA 3NN6X 3CTYA 1GT8A 1E1MA 3AE7A 4Y4LA 2C3CA 2APGA 1TDNA 3ICRA 1DXLA 2V3AA 2B9YA 1GNDA 1LTXR 5KXJA 4ZCCA 5JCNA 1TYTA 4X4JA 3UKHA 4JY3A 1DOCA 4CCQA 5KRQA 1H7XA 1W4XA 4RG3A 1GRGA 1GTHA 4I58A 3K7QX 5FMHA 3SZFA 2YG4A 2YLSA 4YT0A 2ARDA 4USQA 4J34A 2PYXA 3GWFA 2FJDA 4GR1A 4TLZA 5JCLA 4H4TA 3BI4A 1KF6A 4YXDA 3T37A 3SGLA 5IQ1A 1YY5A 4AOXA 3EF6A 4EIQA 5ER0A 2ZZCA 3GD3A 2BXSA 3GYIA 2C66A 1ZOVA 2BC0A 4IA6A 4A7AA 4O5UA 4Z26A 4B68A 5HXIA 2OA1A 4B65A 2Q6UA 1BKWA 1H83A 1GRHA 1N1PA 4MJWA 1S2QA 3GSIA 1NDAA 2R4JA 2VRLA 1MO9A 4A65A 2XVEA 3UOZA 4B67A 1EL5A 1ZDLA 4U8LA 1GV4A 1BGJA 1IUVA 1ZKQA 2XFPA 3CGBA 3DK9A 3NYEA 2A87A 3VRAA 4YTPA 1IUWA 1CHUA 1GEUA 4II3A 4LA1A 3UKKA 2OALA 2YLXA 1E1LA 2B7RA 2V3BA 1IJHA 3ATRA 4BK3A 2YR4A 4E0VA 2QA2A 3GMCA 4APNA 2R4EA 4DGKA 3CMMA 3CGEA 3KKJA 4Z2UA 3LB8A 2YLRA 1N4VA 2YWLA 2GR2A 2FJBA 1P2HA 1NG4A 1KNPA 5KWFA 4K8DA 1E39A 2C64A 4EQWA 1OJ9A 4K2XA 4OPGA 2AAQA 1ZY8A 2JBVA 3AEEA 3FIMB 2X3NA 3K7TA 2YVFA 2GAHB 3EAOA 4O5QA 3SY4A 4G9KA 2WHDA 2Z5XA 2E5VA 1D4DA 2FBWA 3NNEA 3NT6A 3QFAA 4A99A 1DJQA 4YSYA 2XLRA 2HQMA 1TDEA 3REDA 4B1BA 4UP3A 5TR3A 1LQUA 5EBKA 1F3PA 1NHSA 2QCUA 2WESA 2XVHA 3SQPA 1GOSA 3SZCA 2OAMA 4TLXA 3T14A 1YQ3A 2XVIA 4GAPA 1CBOA 5CQFA 1L9CA 1PHHA 1CC6A 3ALJA 3DGHA 3P4RA 1CJ2A 1VQWA 1KSSA 3PO7A 4GDPA 1S3EA 1O95A 4ICYA 1GSNA 1LV0A 3CGDA 1FOHA 3KPFA 1XPQA 2WDQA 2A89A 1COYA 1EL8A 4FK1C 1VG9A 2GV8A 4XWZA 1FL2A 2YQUA 3PS9A 1QJDA 4JDRA 1Q1WA 3AEFA 4OPIA 2WDRA 4C74A 2R0CA 4AT2A 5GRTA 1AOGA 5KVHA 3PVCA 1XANA 3T2YA 2CDUA 2Y6QA 3FBSA 1CJ4A 4C3XA 3CPJG 1H7WA 3LADA 3NH3X 1IUSA 2O9ZA 3BI2A 1PBFA 1TRBA 1CL0A 1X31B 3F8PA 2YR6A 2BK4A 4XXGA 2AR8A 4UDQA 5GSNA 5KOXA 4KX6A 2ZZBA 3RP7A 2I0ZA 1SEZA 3GRSA 3NTAA 4CRTA 2XLUA 4BJZA 4GRTA 4RSLA 3SZWA 5KOWA 2BXRA 4NTDA 1F8RA 4YWOA 4J2WA 4J56A 5HYMA 4IV9A 2CULA 4H4WA 4ZCDA 2WOVA 3ICTA 2IIDA 1VG0A 4UDPA 1CJCA 3CNSA 3QVPA 5FS8A 1NPXA 2V5ZA 1E6EA 2VVLG 2YR5A 3CNPA 1TDKA 4JNQA 4H4UA 2BRAA 1NHQA 4AP3A 1E1KA 3ATQA 4B69A 5M10A 4H2NA 3BHFA 2C70A 3T31A 3AE5A 4REKA 4ZN0A 3QFBA 3HYXA 2BRYA 4K7ZA 4Y4NA 2EQ9A 2B76A 1F8SA 4A6NB 1YKJA 4EMJA 1DODA 5U25A 3V3NA 2XVFA 2WPEA 3CN8A 3I3LA 1OJDA 2VVMA 2X8CA 3JSKA 2GR3A 3E1TA 3KLJA 5HHFA 5KMQA 3UKQA 2C73A 3G5SA 3VQRA 4H4QA 4X9MA 2C4CA 4EMWA 5C3JA 1UKVG 4C77A 2BYBA 5BVAA 4U8PA 1BZLA 1JRXA 2GMHA 1JOAA 1TDOA 1ZP0A 2R0PA 2VQBA 2X8GA 3DK8A 1L9DA 2XLTA 1YQ4A 3Q9TA 3NYFA 1XDIA 3AE6A 3QJ4A 3CGCA 1IUTA 2JKCA 3COXA 4AP1A 1CF3A 2BABA 3ABVA 4UDRA 2VVLA 1H84A 1PBEA 3K7MX 1NHPA 4H4ZA 2DKIA 2JK6A 3L8KA 3NK2X 1JNZA 2NPXA 1GRBA 4U2SA 2JB2A 3AEBA 4EQRA 1QLBA 1CC2A 3M12A 2YLWA 1N4UA 1KFYA 1BWCA 2YG5A 3O0HA 3F8DA 1FECA 1B5QA 3C4NA 3AE4A 3H4KA 2IVDA 4HA6A 4J31A 4ADWA 2YAUA 1M64A 2XYOA 3KPKA 4Z2RA 5JCKA 1GERA 3AB1A 3AECA 1GRAA 1D5TA 3KA7A 1L0VA 3QSMA 1PN0A 1PJ5A 3BNMA 3NIXA 2XLPA 3QVRA 3VR8A 3AYJA 3FMWA 1GXFA 3KU9A 4OPLA 3IF9A 4EIPA 2BK3A 2YG7A 4BV6A 5KVIA 3DH9A 5J7XA 3UKPA 3UOXA 2OLOA 3G5QA 5JCMA 4Z24A 2XFOA 3AWIA 3ALMA 5IPYA 3T0KA 2GB0A 3NN0X 4GF7A 1FCDA 4NWZA 4YKFA 1VRQB 3DJEA 2CVJA 3AD9B 1PBCA 4GUVA 4A9WA 1PBBA 1RYIA 3DJGX 4JNAA 2WU2A 2YLZA 4XWRA 3DA1A 2B9XA 4CCRA 1H82A 2DKHA 2C67A 2B9WA 4P9SA 1Q9IA 3SXIA 3M13A 3VRBA 4U8OA 3NRNA 4B63A 4A79A 4K5RA 2R0GA 2PHHA 4C3YA 4CY6A 3R9UA 2WETA 1EBDA 4BK2A 4H4SA 2A8XA 2GQFA 1GREA 3VRDB 1GRFA 3P4PA 4IVMB 3RP8A 5KMPA 3NK1X 1RP0A 4J33A 3UTGA 2EQ7A 1IUUA 4OCGA 5FS7A 2JB1A 1Y56A 2WS3A 4EQSA 2R9ZA 4NNJA 3WE0A 5LV9A 4GAVA 3NYCA 3UTHA 1F8WA 3H8LA 4H2RA 4NTEA 3AE1A 1PDHA 1M6IA 3UP4A 4U2TA 4Z44A 3UKAA 4Y4MA 5HY5A 4N9XA 4H4XA 2WP5A 2RGJA 4CNKA 2VZ2A 3QSEA 3CPIG 1OJCA 1PJ7A 2H89A 4A5LA 4YSXA 1GETA 3AE3A 1Q1RA 3LJPA 1LPFA 1S2YA 2WP9A 1XHCA 2YG3A 2WQYA 1E1NA 3QSSA 5U1OA 2BA9A 2XFNA 5IQ4A 1JRZA 3UOVA 3NHOX 4CY8A 3AEGA 4U8KA 3DJDA 2BACA 2E4GA 3BHKA 5EB5A 4IA5A 1B4VA 2VRMA 1ZMDA 2UZZA 5DBJA 4I59A 1TDFA 3ADAB 2W0HA 3AD8B 3GDNA 2C75A 2J3NA 4H4RA 3AXBA 4BK1A 4U8JA 2E1MA 1Y0PA 2YM1A 4H4VA 1S3BA 1PBDA 2WP6A 3DJJA 4J57A 4PABA 1NHRA 4J36A 4YSHA 2Q7VA 1DOEA 2EQ6A 4TM4A 3GWDA 1N4WA 1GESA 1ONFA 2BCGG 4H2PA 2YVGA 3AYLA 3M0OA 3P4QA 4JQ9A 3AEDA 2TMDA 3EANA 2RGOA 1NG3A 2YVJA 2GAGB 3RNMA 2V61A 4Z25A 2WPFA 1O94A 1DNCA 2BS3A 1NAAA 4HB9A 2WOIA 4NZHA 4YTMA 1FEAA 2QAEA 4JY2A 3UKFA 4DSHA 3V76A 3D8XA 4EQXA 2VQ7A 1Z6LA 4U8MA 4WX1A 3NK0X 4DSGA 4D03A 2C65A 3RP6A 3ITJA 3D1CA 4YSZA 2AQJA 1PXCA 2ACZA 1DOBA 1KSUA 3HYWA 1ZMCA 4OPTA 1D4CA 4H4PA 5BUKA 3URHA 3AE9A 3KD9A 1JNRA 4OVIA 3GYXA 3HZLA 1V59A 1H6VA 4YTNA 3L1RA 1B8SA 1LQTA 4OPCA 4BURA 3VR9A 1K0JA 3GRTA 3IC9A 2XFUA 3DMEA 4AOSA 4FK1A 3OZ2A 3K30A 5J60A 3LXDA 1BF3A 3SFDA 2V60A 4H50A 1K4QA 2GR0A 5JCIA 1ZK7A 1H86A 2XCGA 1PJ6A 2BS2A 4Z43A 3FPZA 2C76A 4ECHA 4GDEA 3ZYXA 3V3OA 1ELIA 3GDPA 5L46A 3BNUA 1ZOYA 1JU2A 4PAAA 1OJAA 1LVLA 1CJ3A 1MXTA 3DGZA 3I6DA 5EOWA 3AE8A 5CKUA 1TYPA 3P9UA 4TM1A 4YKGA 2CFYA 2BC1A 1KNRA 4K22A 3UP5A 1JEHA 1MOKA 2X8HA 2OLNA 3AE2A 3NG7X 4G6HA 4AT0A 4EM4A 2JAEA 2FJEA 2BS4A 1NEKA 2BK5A 2H88A 1GTEA 5C2TA 5KMRA 1JRYA 3GMBA 2NVKX 1BGNA
chains in the Genus database with same CATH topology
2RGHA 1YQZA 2GH5A 2XDOA 4RG4A 2GR1A 5BRTA 2FJAA 1QO8A 3Q6JA 5EB4A 1PXBA 2EQ8A 2WU5A 3BI5A 1D7YA 3IWAA 2GEWA 4Z2TA 5KNLA 4FX9A 1H81A 3S5WA 4M52A 1EL9A 3NTDA 3UKLA 3CNDA 1B37A 4CNJA 3CIRA 1GPEA 4IVOB 1LJ1A 3UTEA 4CBQA 4GCMA 2VOUA 2TPRA 1KDGA 4D04A 4G6GA 3IHGA 4U8IA 4II2A 2ZZ0A 3II4A 3SX6A 2YLTA 4KPRA 3KVEA 2GVCA 3DK4A 3C96A 3LOVA 3AEAA 2WOWA 2Q0KA 3FG2P 2WEUA 3P1WA 5M0ZA 3SZ0A 4NTCA 4TM0A 1RSGA 4JN9A 2X99A 2Z5YA 4G74A 3GD4A 2C7GA 1DJNA 3NKSA 1GRTA 1O5WA 3GYJA 3HYVA 3UCLA 4LU6A 3OC4A 1ZX9A 1Y56B 3B3RA 2C72A 2QA1A 1HYUA 3ICSA 3NLCA 2X50A 4NEWA 4B66A 1F6MA 3RHAA 3NGCX 3ZDNA 4H2QA 3F8RA 4USRA 3CNJA 1GALA 3CNTA 2Y6RA 1OJTA 3S61A 5FS9A 2GRTA 3SFEA 1VDCA 1P2EA 3CPHG 3P4SA 1CC4A 2YG6A 5BULA 4LIIA 2WBAA 1FEBA 1PXAA 4NEVA 3ISHA 1NENA 3AD7B 4C5OA 1D7LA 2B7SA 3T2KA 4G73A 2IVEA 2JB3A 4U8NA 4WCTA 4EMIA 3LZXA 1EL7A 4H7UA 3C4AA 5U63A 2XVJA 3T2ZA 2WPCA 2RABA 4U2LA 3SYIA 5FS6A 4EM3A 2WDVA 1REOA 2XFQA 3G5RA 1D4EA 4X9NA 2F5ZA 1IUXA 2GF3A 4BJYA 3H8IA 4FDCB 2ZBWA 4TM3A 3SM8A 1K0IA 2GMJA 2R46A 3ALLA 2V6OA 3IHMA 4H4YA 4B64A 1E7PA 2R45A 4A6NA 2C3DA 4OPDA 3LZWA 3UTFA 3UOYA 2BCPA 2GQWA 2YM2A 2XLSA 1K0LA 1PS9A 4OPUA 5KMSA 1L9EA 3EPTA 4K5SA 4DNAA 2Q0LA 3AYIA 3B6DA 3NN6X 3CTYA 1GT8A 1E1MA 3AE7A 4Y4LA 2C3CA 2APGA 1TDNA 3ICRA 1DXLA 2V3AA 2B9YA 1GNDA 1LTXR 5KXJA 4ZCCA 5JCNA 1TYTA 4X4JA 3UKHA 4JY3A 1DOCA 4CCQA 5KRQA 1H7XA 1W4XA 4RG3A 1GRGA 1GTHA 4I58A 3K7QX 5FMHA 3SZFA 2YG4A 2YLSA 4YT0A 2ARDA 4USQA 4J34A 2PYXA 3GWFA 2FJDA 4GR1A 4TLZA 5JCLA 4H4TA 3BI4A 1KF6A 4YXDA 3T37A 3SGLA 5IQ1A 1YY5A 4AOXA 3EF6A 4EIQA 5ER0A 2ZZCA 3GD3A 2BXSA 3GYIA 2C66A 1ZOVA 2BC0A 4IA6A 4A7AA 4O5UA 4Z26A 4B68A 5HXIA 2OA1A 4B65A 2Q6UA 1BKWA 1H83A 1GRHA 1N1PA 4MJWA 1S2QA 3GSIA 1NDAA 2R4JA 2VRLA 1MO9A 4A65A 2XVEA 3UOZA 4B67A 1EL5A 1ZDLA 4U8LA 1GV4A 1BGJA 1IUVA 1ZKQA 2XFPA 3CGBA 3DK9A 3NYEA 2A87A 3VRAA 4YTPA 1IUWA 1CHUA 1GEUA 4II3A 4LA1A 3UKKA 2OALA 2YLXA 1E1LA 2B7RA 2V3BA 1IJHA 3ATRA 4BK3A 2YR4A 4E0VA 2QA2A 3GMCA 4APNA 2R4EA 4DGKA 3CMMA 3CGEA 3KKJA 4Z2UA 3LB8A 2YLRA 1N4VA 2YWLA 2GR2A 2FJBA 1P2HA 1NG4A 1KNPA 5KWFA 4K8DA 1E39A 2C64A 4EQWA 1OJ9A 4K2XA 4OPGA 2AAQA 1ZY8A 2JBVA 3AEEA 3FIMB 2X3NA 3K7TA 2YVFA 2GAHB 3EAOA 4O5QA 3SY4A 4G9KA 2WHDA 2Z5XA 2E5VA 1D4DA 2FBWA 3NNEA 3NT6A 3QFAA 4A99A 1DJQA 4YSYA 2XLRA 2HQMA 1TDEA 3REDA 4B1BA 4UP3A 5TR3A 1LQUA 5EBKA 1F3PA 1NHSA 2QCUA 2WESA 2XVHA 3SQPA 1GOSA 3SZCA 2OAMA 4TLXA 3T14A 1YQ3A 2XVIA 4GAPA 1CBOA 5CQFA 1L9CA 1PHHA 1CC6A 3ALJA 3DGHA 3P4RA 1CJ2A 1VQWA 1KSSA 3PO7A 4GDPA 1S3EA 1O95A 4ICYA 1GSNA 1LV0A 3CGDA 1FOHA 3KPFA 1XPQA 2WDQA 2A89A 1COYA 1EL8A 4FK1C 1VG9A 2GV8A 4XWZA 1FL2A 2YQUA 3PS9A 1QJDA 4JDRA 1Q1WA 3AEFA 4OPIA 2WDRA 4C74A 2R0CA 4AT2A 5GRTA 1AOGA 5KVHA 3PVCA 1XANA 3T2YA 2CDUA 2Y6QA 3FBSA 1CJ4A 4C3XA 3CPJG 1H7WA 3LADA 3NH3X 1IUSA 2O9ZA 3BI2A 1PBFA 1TRBA 1CL0A 1X31B 3F8PA 2YR6A 2BK4A 4XXGA 2AR8A 4UDQA 5GSNA 5KOXA 4KX6A 2ZZBA 3RP7A 2I0ZA 1SEZA 3GRSA 3NTAA 4CRTA 2XLUA 4BJZA 4GRTA 4RSLA 3SZWA 5KOWA 2BXRA 4NTDA 1F8RA 4YWOA 4J2WA 4J56A 5HYMA 4IV9A 2CULA 4H4WA 4ZCDA 2WOVA 3ICTA 2IIDA 1VG0A 4UDPA 1CJCA 3CNSA 3QVPA 5FS8A 1NPXA 2V5ZA 1E6EA 2VVLG 2YR5A 3CNPA 1TDKA 4JNQA 4H4UA 2BRAA 1NHQA 4AP3A 1E1KA 3ATQA 4B69A 5M10A 4H2NA 3BHFA 2C70A 3T31A 3AE5A 4REKA 4ZN0A 3QFBA 3HYXA 2BRYA 4K7ZA 4Y4NA 2EQ9A 2B76A 1F8SA 4A6NB 1YKJA 4EMJA 1DODA 5U25A 3V3NA 2XVFA 2WPEA 3CN8A 3I3LA 1OJDA 2VVMA 2X8CA 3JSKA 2GR3A 3E1TA 3KLJA 5HHFA 5KMQA 3UKQA 2C73A 3G5SA 3VQRA 4H4QA 4X9MA 2C4CA 4EMWA 5C3JA 1UKVG 4C77A 2BYBA 5BVAA 4U8PA 1BZLA 1JRXA 2GMHA 1JOAA 1TDOA 1ZP0A 2R0PA 2VQBA 2X8GA 3DK8A 1L9DA 2XLTA 1YQ4A 3Q9TA 3NYFA 1XDIA 3AE6A 3QJ4A 3CGCA 1IUTA 2JKCA 3COXA 4AP1A 1CF3A 2BABA 3ABVA 4UDRA 2VVLA 1H84A 1PBEA 3K7MX 1NHPA 4H4ZA 2DKIA 2JK6A 3L8KA 3NK2X 1JNZA 2NPXA 1GRBA 4U2SA 2JB2A 3AEBA 4EQRA 1QLBA 1CC2A 3M12A 2YLWA 1N4UA 1KFYA 1BWCA 2YG5A 3O0HA 3F8DA 1FECA 1B5QA 3C4NA 3AE4A 3H4KA 2IVDA 4HA6A 4J31A 4ADWA 2YAUA 1M64A 2XYOA 3KPKA 4Z2RA 5JCKA 1GERA 3AB1A 3AECA 1GRAA 1D5TA 3KA7A 1L0VA 3QSMA 1PN0A 1PJ5A 3BNMA 3NIXA 2XLPA 3QVRA 3VR8A 3AYJA 3FMWA 1GXFA 3KU9A 4OPLA 3IF9A 4EIPA 2BK3A 2YG7A 4BV6A 5KVIA 3DH9A 5J7XA 3UKPA 3UOXA 2OLOA 3G5QA 5JCMA 4Z24A 2XFOA 3AWIA 3ALMA 5IPYA 3T0KA 2GB0A 3NN0X 4GF7A 1FCDA 4NWZA 4YKFA 1VRQB 3DJEA 2CVJA 3AD9B 1PBCA 4GUVA 4A9WA 1PBBA 1RYIA 3DJGX 4JNAA 2WU2A 2YLZA 4XWRA 3DA1A 2B9XA 4CCRA 1H82A 2DKHA 2C67A 2B9WA 4P9SA 1Q9IA 3SXIA 3M13A 3VRBA 4U8OA 3NRNA 4B63A 4A79A 4K5RA 2R0GA 2PHHA 4C3YA 4CY6A 3R9UA 2WETA 1EBDA 4BK2A 4H4SA 2A8XA 2GQFA 1GREA 3VRDB 1GRFA 3P4PA 4IVMB 3RP8A 5KMPA 3NK1X 1RP0A 4J33A 3UTGA 2EQ7A 1IUUA 4OCGA 5FS7A 2JB1A 1Y56A 2WS3A 4EQSA 2R9ZA 4NNJA 3WE0A 5LV9A 4GAVA 3NYCA 3UTHA 1F8WA 3H8LA 4H2RA 4NTEA 3AE1A 1PDHA 1M6IA 3UP4A 4U2TA 4Z44A 3UKAA 4Y4MA 5HY5A 4N9XA 4H4XA 2WP5A 2RGJA 4CNKA 2VZ2A 3QSEA 3CPIG 1OJCA 1PJ7A 2H89A 4A5LA 4YSXA 1GETA 3AE3A 1Q1RA 3LJPA 1LPFA 1S2YA 2WP9A 1XHCA 2YG3A 2WQYA 1E1NA 3QSSA 5U1OA 2BA9A 2XFNA 5IQ4A 1JRZA 3UOVA 3NHOX 4CY8A 3AEGA 4U8KA 3DJDA 2BACA 2E4GA 3BHKA 5EB5A 4IA5A 1B4VA 2VRMA 1ZMDA 2UZZA 5DBJA 4I59A 1TDFA 3ADAB 2W0HA 3AD8B 3GDNA 2C75A 2J3NA 4H4RA 3AXBA 4BK1A 4U8JA 2E1MA 1Y0PA 2YM1A 4H4VA 1S3BA 1PBDA 2WP6A 3DJJA 4J57A 4PABA 1NHRA 4J36A 4YSHA 2Q7VA 1DOEA 2EQ6A 4TM4A 3GWDA 1N4WA 1GESA 1ONFA 2BCGG 4H2PA 2YVGA 3AYLA 3M0OA 3P4QA 4JQ9A 3AEDA 2TMDA 3EANA 2RGOA 1NG3A 2YVJA 2GAGB 3RNMA 2V61A 4Z25A 2WPFA 1O94A 1DNCA 2BS3A 1NAAA 4HB9A 2WOIA 4NZHA 4YTMA 1FEAA 2QAEA 4JY2A 3UKFA 4DSHA 3V76A 3D8XA 4EQXA 2VQ7A 1Z6LA 4U8MA 4WX1A 3NK0X 4DSGA 4D03A 2C65A 3RP6A 3ITJA 3D1CA 4YSZA 2AQJA 1PXCA 2ACZA 1DOBA 1KSUA 3HYWA 1ZMCA 4OPTA 1D4CA 4H4PA 5BUKA 3URHA 3AE9A 3KD9A 1JNRA 4OVIA 3GYXA 3HZLA 1V59A 1H6VA 4YTNA 3L1RA 1B8SA 1LQTA 4OPCA 4BURA 3VR9A 1K0JA 3GRTA 3IC9A 2XFUA 3DMEA 4AOSA 4FK1A 3OZ2A 3K30A 5J60A 3LXDA 1BF3A 3SFDA 2V60A 4H50A 1K4QA 2GR0A 5JCIA 1ZK7A 1H86A 2XCGA 1PJ6A 2BS2A 4Z43A 3FPZA 2C76A 4ECHA 4GDEA 3ZYXA 3V3OA 1ELIA 3GDPA 5L46A 3BNUA 1ZOYA 1JU2A 4PAAA 1OJAA 1LVLA 1CJ3A 1MXTA 3DGZA 3I6DA 5EOWA 3AE8A 5CKUA 1TYPA 3P9UA 4TM1A 4YKGA 2CFYA 2BC1A 1KNRA 4K22A 3UP5A 1JEHA 1MOKA 2X8HA 2OLNA 3AE2A 3NG7X 4G6HA 4AT0A 4EM4A 2JAEA 2FJEA 2BS4A 1NEKA 2BK5A 2H88A 1GTEA 5C2TA 5KMRA 1JRYA 3GMBA 2NVKX 1BGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RGH A;  1YQZ A;  2GH5 A;  2XDO A;  4RG4 A;  2GR1 A;  5BRT A;  2FJA A;  1QO8 A;  3Q6J A;  5EB4 A;  1PXB A;  2EQ8 A;  2WU5 A;  3BI5 A;  1D7Y A;  3IWA A;  2GEW A;  4Z2T A;  4FX9 A;  1H81 A;  3S5W A;  4M52 A;  1EL9 A;  3NTD A;  3UKL A;  3CND A;  1B37 A;  4CNJ A;  3CIR A;  1GPE A;  4IVO B;  1LJ1 A;  3UTE A;  4CBQ A;  4GCM A;  2VOU A;  2TPR A;  1KDG A;  4D04 A;  3IHG A;  4U8I A;  2ZZ0 A;  3II4 A;  2YLT A;  4KPR A;  3KVE A;  2GVC A;  3DK4 A;  3C96 A;  3LOV A;  3AEA A;  2WOW A;  2Q0K A;  3FG2 P;  2WEU A;  3P1W A;  5M0Z A;  4NTC A;  4TM0 A;  1RSG A;  4JN9 A;  2X99 A;  2Z5Y A;  3GD4 A;  2C7G A;  1DJN A;  3NKS A;  1GRT A;  1O5W A;  3GYJ A;  3UCL A;  4LU6 A;  3OC4 A;  1ZX9 A;  1Y56 B;  3B3R A;  2C72 A;  2QA1 A;  1HYU A;  3ICS A;  3NLC A;  2X50 A;  4NEW A;  4B66 A;  1F6M A;  3RHA A;  3NGC X;  3ZDN A;  4H2Q A;  3F8R A;  4USR A;  3CNJ A;  1GAL A;  3CNT A;  2Y6R A;  1OJT A;  3S61 A;  5FS9 A;  2GRT A;  3SFE A;  1VDC A;  1P2E A;  3CPH G;  3P4S A;  1CC4 A;  2YG6 A;  5BUL A;  4LII A;  2WBA A;  1FEB A;  1PXA A;  4NEV A;  3ISH A;  1NEN A;  3AD7 B;  4C5O A;  1D7L A;  2B7S A;  2IVE A;  2JB3 A;  4U8N A;  4WCT A;  4EMI A;  3LZX A;  1EL7 A;  4H7U A;  3C4A A;  5U63 A;  2XVJ A;  2WPC A;  2RAB A;  4U2L A;  5FS6 A;  4EM3 A;  2WDV A;  1REO A;  2XFQ A;  3G5R A;  1D4E A;  4X9N A;  2F5Z A;  1IUX A;  2GF3 A;  4BJY A;  3H8I A;  4FDC B;  2ZBW A;  4TM3 A;  3SM8 A;  1K0I A;  2GMJ A;  2R46 A;  3ALL A;  2V6O A;  3IHM A;  4H4Y A;  4B64 A;  1E7P A;  2R45 A;  4A6N A;  2C3D A;  4OPD A;  3LZW A;  3UTF A;  3UOY A;  2BCP A;  2GQW A;  2YM2 A;  2XLS A;  1K0L A;  1PS9 A;  4OPU A;  1L9E A;  3EPT A;  4K5S A;  4DNA A;  2Q0L A;  3AYI A;  3B6D A;  3NN6 X;  3CTY A;  1GT8 A;  1E1M A;  3AE7 A;  4Y4L A;  2C3C A;  2APG A;  1TDN A;  3ICR A;  1DXL A;  2V3A A;  2B9Y A;  1GND A;  1LTX R;  5KXJ A;  4ZCC A;  5JCN A;  1TYT A;  4X4J A;  3UKH A;  4JY3 A;  1DOC A;  4CCQ A;  5KRQ A;  1H7X A;  1W4X A;  4RG3 A;  1GRG A;  1GTH A;  4I58 A;  3K7Q X;  5FMH A;  2YG4 A;  2YLS A;  4YT0 A;  2ARD A;  4USQ A;  4J34 A;  2PYX A;  3GWF A;  2FJD A;  4GR1 A;  4TLZ A;  5JCL A;  4H4T A;  3BI4 A;  1KF6 A;  4YXD A;  3T37 A;  3SGL A;  5IQ1 A;  1YY5 A;  4AOX A;  3EF6 A;  4EIQ A;  5ER0 A;  2ZZC A;  3GD3 A;  2BXS A;  3GYI A;  2C66 A;  1ZOV A;  2BC0 A;  4IA6 A;  4A7A A;  4O5U A;  4Z26 A;  4B68 A;  5HXI A;  2OA1 A;  4B65 A;  2Q6U A;  1BKW A;  1H83 A;  1GRH A;  1N1P A;  4MJW A;  1S2Q A;  3GSI A;  1NDA A;  2R4J A;  2VRL A;  1MO9 A;  4A65 A;  2XVE A;  3UOZ A;  4B67 A;  1EL5 A;  1ZDL A;  4U8L A;  1GV4 A;  1BGJ A;  1IUV A;  1ZKQ A;  2XFP A;  3CGB A;  3DK9 A;  3NYE A;  2A87 A;  3VRA A;  4YTP A;  1IUW A;  1CHU A;  1GEU A;  4LA1 A;  3UKK A;  2OAL A;  2YLX A;  1E1L A;  2B7R A;  2V3B A;  1IJH A;  3ATR A;  4BK3 A;  2YR4 A;  4E0V A;  2QA2 A;  3GMC A;  4APN A;  2R4E A;  4DGK A;  3CGE A;  3KKJ A;  4Z2U A;  3LB8 A;  2YLR A;  1N4V A;  2YWL A;  2GR2 A;  2FJB A;  1P2H A;  1NG4 A;  1KNP A;  5KWF A;  4K8D A;  1E39 A;  2C64 A;  4EQW A;  1OJ9 A;  4K2X A;  4OPG A;  2AAQ A;  1ZY8 A;  2JBV A;  3AEE A;  3FIM B;  2X3N A;  3K7T A;  2YVF A;  2GAH B;  3EAO A;  4O5Q A;  2WHD A;  2Z5X A;  2E5V A;  1D4D A;  2FBW A;  3NNE A;  3NT6 A;  3QFA A;  4A99 A;  1DJQ A;  4YSY A;  2XLR A;  2HQM A;  1TDE A;  3RED A;  4B1B A;  4UP3 A;  5TR3 A;  1LQU A;  5EBK A;  1F3P A;  1NHS A;  2QCU A;  2WES A;  2XVH A;  3SQP A;  1GOS A;  2OAM A;  4TLX A;  1YQ3 A;  2XVI A;  1CBO A;  5CQF A;  1L9C A;  1PHH A;  1CC6 A;  3ALJ A;  3DGH A;  3P4R A;  1CJ2 A;  1VQW A;  1KSS A;  3PO7 A;  4GDP A;  1S3E A;  1O95 A;  4ICY A;  1GSN A;  1LV0 A;  3CGD A;  1FOH A;  3KPF A;  1XPQ A;  2WDQ A;  2A89 A;  1COY A;  1EL8 A;  4FK1 C;  1VG9 A;  2GV8 A;  4XWZ A;  1FL2 A;  2YQU A;  3PS9 A;  1QJD A;  4JDR A;  1Q1W A;  3AEF A;  4OPI A;  2WDR A;  4C74 A;  2R0C A;  4AT2 A;  5GRT A;  1AOG A;  5KVH A;  3PVC A;  1XAN A;  2CDU A;  2Y6Q A;  3FBS A;  1CJ4 A;  4C3X A;  3CPJ G;  1H7W A;  3LAD A;  3NH3 X;  1IUS A;  2O9Z A;  3BI2 A;  1PBF A;  1TRB A;  1CL0 A;  1X31 B;  3F8P A;  2YR6 A;  2BK4 A;  4XXG A;  2AR8 A;  4UDQ A;  5GSN A;  5KOX A;  4KX6 A;  2ZZB A;  3RP7 A;  2I0Z A;  1SEZ A;  3GRS A;  3NTA A;  4CRT A;  2XLU A;  4BJZ A;  4GRT A;  4RSL A;  5KOW A;  2BXR A;  4NTD A;  1F8R A;  4YWO A;  4J2W A;  4J56 A;  5HYM A;  4IV9 A;  2CUL A;  4H4W A;  4ZCD A;  2WOV A;  3ICT A;  2IID A;  1VG0 A;  4UDP A;  1CJC A;  3CNS A;  3QVP A;  5FS8 A;  1NPX A;  2V5Z A;  1E6E A;  2VVL G;  2YR5 A;  3CNP A;  1TDK A;  4JNQ A;  4H4U A;  1NHQ A;  4AP3 A;  1E1K A;  3ATQ A;  4B69 A;  5M10 A;  4H2N A;  3BHF A;  2C70 A;  3AE5 A;  4REK A;  4ZN0 A;  3QFB A;  4K7Z A;  4Y4N A;  2EQ9 A;  2B76 A;  1F8S A;  4A6N B;  1YKJ A;  4EMJ A;  1DOD A;  5U25 A;  3V3N A;  2XVF A;  2WPE A;  3CN8 A;  3I3L A;  1OJD A;  2VVM A;  2X8C A;  3JSK A;  2GR3 A;  3E1T A;  3KLJ A;  5HHF A;  3UKQ A;  2C73 A;  3G5S A;  3VQR A;  4H4Q A;  4X9M A;  4EMW A;  5C3J A;  1UKV G;  4C77 A;  2BYB A;  5BVA A;  4U8P A;  1BZL A;  1JRX A;  2GMH A;  1JOA A;  1TDO A;  1ZP0 A;  2R0P A;  2VQB A;  2X8G A;  3DK8 A;  1L9D A;  2XLT A;  1YQ4 A;  3Q9T A;  3NYF A;  1XDI A;  3AE6 A;  3QJ4 A;  3CGC A;  1IUT A;  2JKC A;  3COX A;  4AP1 A;  1CF3 A;  2BAB A;  3ABV A;  4UDR A;  2VVL A;  1H84 A;  1PBE A;  3K7M X;  1NHP A;  4H4Z A;  2DKI A;  2JK6 A;  3L8K A;  3NK2 X;  1JNZ A;  2NPX A;  1GRB A;  4U2S A;  2JB2 A;  3AEB A;  4EQR A;  1QLB A;  1CC2 A;  3M12 A;  2YLW A;  1N4U A;  1KFY A;  1BWC A;  2YG5 A;  3O0H A;  3F8D A;  1FEC A;  1B5Q A;  3C4N A;  3AE4 A;  3H4K A;  2IVD A;  4HA6 A;  4J31 A;  4ADW A;  2YAU A;  1M64 A;  2XYO A;  4Z2R A;  5JCK A;  1GER A;  3AB1 A;  3AEC A;  1GRA A;  1D5T A;  3KA7 A;  1L0V A;  3QSM A;  1PN0 A;  1PJ5 A;  3BNM A;  3NIX A;  2XLP A;  3QVR A;  3VR8 A;  3AYJ A;  3FMW A;  1GXF A;  3KU9 A;  4OPL A;  3IF9 A;  4EIP A;  2BK3 A;  2YG7 A;  4BV6 A;  5KVI A;  3DH9 A;  5J7X A;  3UKP A;  3UOX A;  2OLO A;  3G5Q A;  5JCM A;  4Z24 A;  2XFO A;  3AWI A;  3ALM A;  5IPY A;  2GB0 A;  3NN0 X;  4GF7 A;  1FCD A;  4YKF A;  1VRQ B;  3DJE A;  2CVJ A;  3AD9 B;  1PBC A;  4GUV A;  4A9W A;  1PBB A;  1RYI A;  3DJG X;  4JNA A;  2WU2 A;  2YLZ A;  4XWR A;  3DA1 A;  2B9X A;  4CCR A;  1H82 A;  2DKH A;  2C67 A;  2B9W A;  4P9S A;  1Q9I A;  3M13 A;  3VRB A;  4U8O A;  3NRN A;  4B63 A;  4A79 A;  4K5R A;  2R0G A;  2PHH A;  4C3Y A;  4CY6 A;  3R9U A;  2WET A;  1EBD A;  4BK2 A;  4H4S A;  2A8X A;  2GQF A;  1GRE A;  3VRD B;  1GRF A;  3P4P A;  4IVM B;  3RP8 A;  3NK1 X;  1RP0 A;  4J33 A;  3UTG A;  2EQ7 A;  1IUU A;  4OCG A;  5FS7 A;  2JB1 A;  1Y56 A;  2WS3 A;  4EQS A;  2R9Z A;  3WE0 A;  5LV9 A;  3NYC A;  3UTH A;  1F8W A;  3H8L A;  4H2R A;  4NTE A;  3AE1 A;  1PDH A;  1M6I A;  3UP4 A;  4U2T A;  4Z44 A;  3UKA A;  4Y4M A;  5HY5 A;  4N9X A;  4H4X A;  2WP5 A;  2RGJ A;  4CNK A;  2VZ2 A;  3QSE A;  3CPI G;  1OJC A;  1PJ7 A;  2H89 A;  4A5L A;  4YSX A;  1GET A;  3AE3 A;  1Q1R A;  3LJP A;  1LPF A;  1S2Y A;  2WP9 A;  1XHC A;  2YG3 A;  2WQY A;  1E1N A;  3QSS A;  5U1O A;  2BA9 A;  2XFN A;  5IQ4 A;  1JRZ A;  3UOV A;  3NHO X;  4CY8 A;  3AEG A;  4U8K A;  3DJD A;  2BAC A;  2E4G A;  3BHK A;  5EB5 A;  4IA5 A;  1B4V A;  2VRM A;  1ZMD A;  2UZZ A;  5DBJ A;  4I59 A;  1TDF A;  3ADA B;  2W0H A;  3AD8 B;  3GDN A;  2C75 A;  2J3N A;  4H4R A;  3AXB A;  4BK1 A;  4U8J A;  2E1M A;  1Y0P A;  2YM1 A;  4H4V A;  1S3B A;  1PBD A;  2WP6 A;  3DJJ A;  4J57 A;  4PAB A;  1NHR A;  4J36 A;  4YSH A;  2Q7V A;  1DOE A;  2EQ6 A;  4TM4 A;  3GWD A;  1N4W A;  1GES A;  1ONF A;  2BCG G;  4H2P A;  2YVG A;  3AYL A;  3M0O A;  3P4Q A;  4JQ9 A;  3AED A;  2TMD A;  3EAN A;  2RGO A;  1NG3 A;  2YVJ A;  2GAG B;  3RNM A;  2V61 A;  4Z25 A;  2WPF A;  1O94 A;  1DNC A;  2BS3 A;  1NAA A;  4HB9 A;  2WOI A;  4NZH A;  4YTM A;  1FEA A;  2QAE A;  4JY2 A;  3UKF A;  4DSH A;  3V76 A;  3D8X A;  4EQX A;  2VQ7 A;  1Z6L A;  4U8M A;  4WX1 A;  3NK0 X;  4DSG A;  4D03 A;  2C65 A;  3RP6 A;  3ITJ A;  3D1C A;  4YSZ A;  2AQJ A;  1PXC A;  2ACZ A;  1DOB A;  1KSU A;  1ZMC A;  4OPT A;  1D4C A;  4H4P A;  5BUK A;  3URH A;  3AE9 A;  3KD9 A;  1JNR A;  4OVI A;  3HZL A;  1V59 A;  1H6V A;  4YTN A;  3L1R A;  1B8S A;  1LQT A;  4OPC A;  4BUR A;  3VR9 A;  1K0J A;  3GRT A;  3IC9 A;  2XFU A;  3DME A;  4AOS A;  4FK1 A;  3OZ2 A;  3K30 A;  5J60 A;  3LXD A;  1BF3 A;  3SFD A;  2V60 A;  4H50 A;  1K4Q A;  2GR0 A;  5JCI A;  1ZK7 A;  1H86 A;  2XCG A;  1PJ6 A;  2BS2 A;  4Z43 A;  3FPZ A;  2C76 A;  4ECH A;  4GDE A;  3ZYX A;  3V3O A;  1ELI A;  3GDP A;  5L46 A;  3BNU A;  1ZOY A;  1JU2 A;  4PAA A;  1OJA A;  1LVL A;  1CJ3 A;  1MXT A;  3DGZ A;  3I6D A;  5EOW A;  3AE8 A;  5CKU A;  1TYP A;  3P9U A;  4TM1 A;  4YKG A;  2CFY A;  2BC1 A;  1KNR A;  4K22 A;  3UP5 A;  1JEH A;  1MOK A;  2X8H A;  2OLN A;  3AE2 A;  3NG7 X;  4AT0 A;  4EM4 A;  2JAE A;  2FJE A;  2BS4 A;  1NEK A;  2BK5 A;  2H88 A;  1GTE A;  5C2T A;  1JRY A;  3GMB A;  2NVK X;  1BGN A; 
#chains in the Genus database with same CATH topology
 2RGH A;  1YQZ A;  2GH5 A;  2XDO A;  4RG4 A;  2GR1 A;  5BRT A;  2FJA A;  1QO8 A;  3Q6J A;  5EB4 A;  1PXB A;  2EQ8 A;  2WU5 A;  3BI5 A;  1D7Y A;  3IWA A;  2GEW A;  4Z2T A;  5KNL A;  4FX9 A;  1H81 A;  3S5W A;  4M52 A;  1EL9 A;  3NTD A;  3UKL A;  3CND A;  1B37 A;  4CNJ A;  3CIR A;  1GPE A;  4IVO B;  1LJ1 A;  3UTE A;  4CBQ A;  4GCM A;  2VOU A;  2TPR A;  1KDG A;  4D04 A;  4G6G A;  3IHG A;  4U8I A;  4II2 A;  2ZZ0 A;  3II4 A;  3SX6 A;  2YLT A;  4KPR A;  3KVE A;  2GVC A;  3DK4 A;  3C96 A;  3LOV A;  3AEA A;  2WOW A;  2Q0K A;  3FG2 P;  2WEU A;  3P1W A;  5M0Z A;  3SZ0 A;  4NTC A;  4TM0 A;  1RSG A;  4JN9 A;  2X99 A;  2Z5Y A;  4G74 A;  3GD4 A;  2C7G A;  1DJN A;  3NKS A;  1GRT A;  1O5W A;  3GYJ A;  3HYV A;  3UCL A;  4LU6 A;  3OC4 A;  1ZX9 A;  1Y56 B;  3B3R A;  2C72 A;  2QA1 A;  1HYU A;  3ICS A;  3NLC A;  2X50 A;  4NEW A;  4B66 A;  1F6M A;  3RHA A;  3NGC X;  3ZDN A;  4H2Q A;  3F8R A;  4USR A;  3CNJ A;  1GAL A;  3CNT A;  2Y6R A;  1OJT A;  3S61 A;  5FS9 A;  2GRT A;  3SFE A;  1VDC A;  1P2E A;  3CPH G;  3P4S A;  1CC4 A;  2YG6 A;  5BUL A;  4LII A;  2WBA A;  1FEB A;  1PXA A;  4NEV A;  3ISH A;  1NEN A;  3AD7 B;  4C5O A;  1D7L A;  2B7S A;  3T2K A;  4G73 A;  2IVE A;  2JB3 A;  4U8N A;  4WCT A;  4EMI A;  3LZX A;  1EL7 A;  4H7U A;  3C4A A;  5U63 A;  2XVJ A;  3T2Z A;  2WPC A;  2RAB A;  4U2L A;  3SYI A;  5FS6 A;  4EM3 A;  2WDV A;  1REO A;  2XFQ A;  3G5R A;  1D4E A;  4X9N A;  2F5Z A;  1IUX A;  2GF3 A;  4BJY A;  3H8I A;  4FDC B;  2ZBW A;  4TM3 A;  3SM8 A;  1K0I A;  2GMJ A;  2R46 A;  3ALL A;  2V6O A;  3IHM A;  4H4Y A;  4B64 A;  1E7P A;  2R45 A;  4A6N A;  2C3D A;  4OPD A;  3LZW A;  3UTF A;  3UOY A;  2BCP A;  2GQW A;  2YM2 A;  2XLS A;  1K0L A;  1PS9 A;  4OPU A;  5KMS A;  1L9E A;  3EPT A;  4K5S A;  4DNA A;  2Q0L A;  3AYI A;  3B6D A;  3NN6 X;  3CTY A;  1GT8 A;  1E1M A;  3AE7 A;  4Y4L A;  2C3C A;  2APG A;  1TDN A;  3ICR A;  1DXL A;  2V3A A;  2B9Y A;  1GND A;  1LTX R;  5KXJ A;  4ZCC A;  5JCN A;  1TYT A;  4X4J A;  3UKH A;  4JY3 A;  1DOC A;  4CCQ A;  5KRQ A;  1H7X A;  1W4X A;  4RG3 A;  1GRG A;  1GTH A;  4I58 A;  3K7Q X;  5FMH A;  3SZF A;  2YG4 A;  2YLS A;  4YT0 A;  2ARD A;  4USQ A;  4J34 A;  2PYX A;  3GWF A;  2FJD A;  4GR1 A;  4TLZ A;  5JCL A;  4H4T A;  3BI4 A;  1KF6 A;  4YXD A;  3T37 A;  3SGL A;  5IQ1 A;  1YY5 A;  4AOX A;  3EF6 A;  4EIQ A;  5ER0 A;  2ZZC A;  3GD3 A;  2BXS A;  3GYI A;  2C66 A;  1ZOV A;  2BC0 A;  4IA6 A;  4A7A A;  4O5U A;  4Z26 A;  4B68 A;  5HXI A;  2OA1 A;  4B65 A;  2Q6U A;  1BKW A;  1H83 A;  1GRH A;  1N1P A;  4MJW A;  1S2Q A;  3GSI A;  1NDA A;  2R4J A;  2VRL A;  1MO9 A;  4A65 A;  2XVE A;  3UOZ A;  4B67 A;  1EL5 A;  1ZDL A;  4U8L A;  1GV4 A;  1BGJ A;  1IUV A;  1ZKQ A;  2XFP A;  3CGB A;  3DK9 A;  3NYE A;  2A87 A;  3VRA A;  4YTP A;  1IUW A;  1CHU A;  1GEU A;  4II3 A;  4LA1 A;  3UKK A;  2OAL A;  2YLX A;  1E1L A;  2B7R A;  2V3B A;  1IJH A;  3ATR A;  4BK3 A;  2YR4 A;  4E0V A;  2QA2 A;  3GMC A;  4APN A;  2R4E A;  4DGK A;  3CMM A;  3CGE A;  3KKJ A;  4Z2U A;  3LB8 A;  2YLR A;  1N4V A;  2YWL A;  2GR2 A;  2FJB A;  1P2H A;  1NG4 A;  1KNP A;  5KWF A;  4K8D A;  1E39 A;  2C64 A;  4EQW A;  1OJ9 A;  4K2X A;  4OPG A;  2AAQ A;  1ZY8 A;  2JBV A;  3AEE A;  3FIM B;  2X3N A;  3K7T A;  2YVF A;  2GAH B;  3EAO A;  4O5Q A;  3SY4 A;  4G9K A;  2WHD A;  2Z5X A;  2E5V A;  1D4D A;  2FBW A;  3NNE A;  3NT6 A;  3QFA A;  4A99 A;  1DJQ A;  4YSY A;  2XLR A;  2HQM A;  1TDE A;  3RED A;  4B1B A;  4UP3 A;  5TR3 A;  1LQU A;  5EBK A;  1F3P A;  1NHS A;  2QCU A;  2WES A;  2XVH A;  3SQP A;  1GOS A;  3SZC A;  2OAM A;  4TLX A;  3T14 A;  1YQ3 A;  2XVI A;  4GAP A;  1CBO A;  5CQF A;  1L9C A;  1PHH A;  1CC6 A;  3ALJ A;  3DGH A;  3P4R A;  1CJ2 A;  1VQW A;  1KSS A;  3PO7 A;  4GDP A;  1S3E A;  1O95 A;  4ICY A;  1GSN A;  1LV0 A;  3CGD A;  1FOH A;  3KPF A;  1XPQ A;  2WDQ A;  2A89 A;  1COY A;  1EL8 A;  4FK1 C;  1VG9 A;  2GV8 A;  4XWZ A;  1FL2 A;  2YQU A;  3PS9 A;  1QJD A;  4JDR A;  1Q1W A;  3AEF A;  4OPI A;  2WDR A;  4C74 A;  2R0C A;  4AT2 A;  5GRT A;  1AOG A;  5KVH A;  3PVC A;  1XAN A;  3T2Y A;  2CDU A;  2Y6Q A;  3FBS A;  1CJ4 A;  4C3X A;  3CPJ G;  1H7W A;  3LAD A;  3NH3 X;  1IUS A;  2O9Z A;  3BI2 A;  1PBF A;  1TRB A;  1CL0 A;  1X31 B;  3F8P A;  2YR6 A;  2BK4 A;  4XXG A;  2AR8 A;  4UDQ A;  5GSN A;  5KOX A;  4KX6 A;  2ZZB A;  3RP7 A;  2I0Z A;  1SEZ A;  3GRS A;  3NTA A;  4CRT A;  2XLU A;  4BJZ A;  4GRT A;  4RSL A;  3SZW A;  5KOW A;  2BXR A;  4NTD A;  1F8R A;  4YWO A;  4J2W A;  4J56 A;  5HYM A;  4IV9 A;  2CUL A;  4H4W A;  4ZCD A;  2WOV A;  3ICT A;  2IID A;  1VG0 A;  4UDP A;  1CJC A;  3CNS A;  3QVP A;  5FS8 A;  1NPX A;  2V5Z A;  1E6E A;  2VVL G;  2YR5 A;  3CNP A;  1TDK A;  4JNQ A;  4H4U A;  2BRA A;  1NHQ A;  4AP3 A;  1E1K A;  3ATQ A;  4B69 A;  5M10 A;  4H2N A;  3BHF A;  2C70 A;  3T31 A;  3AE5 A;  4REK A;  4ZN0 A;  3QFB A;  3HYX A;  2BRY A;  4K7Z A;  4Y4N A;  2EQ9 A;  2B76 A;  1F8S A;  4A6N B;  1YKJ A;  4EMJ A;  1DOD A;  5U25 A;  3V3N A;  2XVF A;  2WPE A;  3CN8 A;  3I3L A;  1OJD A;  2VVM A;  2X8C A;  3JSK A;  2GR3 A;  3E1T A;  3KLJ A;  5HHF A;  5KMQ A;  3UKQ A;  2C73 A;  3G5S A;  3VQR A;  4H4Q A;  4X9M A;  2C4C A;  4EMW A;  5C3J A;  1UKV G;  4C77 A;  2BYB A;  5BVA A;  4U8P A;  1BZL A;  1JRX A;  2GMH A;  1JOA A;  1TDO A;  1ZP0 A;  2R0P A;  2VQB A;  2X8G A;  3DK8 A;  1L9D A;  2XLT A;  1YQ4 A;  3Q9T A;  3NYF A;  1XDI A;  3AE6 A;  3QJ4 A;  3CGC A;  1IUT A;  2JKC A;  3COX A;  4AP1 A;  1CF3 A;  2BAB A;  3ABV A;  4UDR A;  2VVL A;  1H84 A;  1PBE A;  3K7M X;  1NHP A;  4H4Z A;  2DKI A;  2JK6 A;  3L8K A;  3NK2 X;  1JNZ A;  2NPX A;  1GRB A;  4U2S A;  2JB2 A;  3AEB A;  4EQR A;  1QLB A;  1CC2 A;  3M12 A;  2YLW A;  1N4U A;  1KFY A;  1BWC A;  2YG5 A;  3O0H A;  3F8D A;  1FEC A;  1B5Q A;  3C4N A;  3AE4 A;  3H4K A;  2IVD A;  4HA6 A;  4J31 A;  4ADW A;  2YAU A;  1M64 A;  2XYO A;  3KPK A;  4Z2R A;  5JCK A;  1GER A;  3AB1 A;  3AEC A;  1GRA A;  1D5T A;  3KA7 A;  1L0V A;  3QSM A;  1PN0 A;  1PJ5 A;  3BNM A;  3NIX A;  2XLP A;  3QVR A;  3VR8 A;  3AYJ A;  3FMW A;  1GXF A;  3KU9 A;  4OPL A;  3IF9 A;  4EIP A;  2BK3 A;  2YG7 A;  4BV6 A;  5KVI A;  3DH9 A;  5J7X A;  3UKP A;  3UOX A;  2OLO A;  3G5Q A;  5JCM A;  4Z24 A;  2XFO A;  3AWI A;  3ALM A;  5IPY A;  3T0K A;  2GB0 A;  3NN0 X;  4GF7 A;  1FCD A;  4NWZ A;  4YKF A;  1VRQ B;  3DJE A;  2CVJ A;  3AD9 B;  1PBC A;  4GUV A;  4A9W A;  1PBB A;  1RYI A;  3DJG X;  4JNA A;  2WU2 A;  2YLZ A;  4XWR A;  3DA1 A;  2B9X A;  4CCR A;  1H82 A;  2DKH A;  2C67 A;  2B9W A;  4P9S A;  1Q9I A;  3SXI A;  3M13 A;  3VRB A;  4U8O A;  3NRN A;  4B63 A;  4A79 A;  4K5R A;  2R0G A;  2PHH A;  4C3Y A;  4CY6 A;  3R9U A;  2WET A;  1EBD A;  4BK2 A;  4H4S A;  2A8X A;  2GQF A;  1GRE A;  3VRD B;  1GRF A;  3P4P A;  4IVM B;  3RP8 A;  5KMP A;  3NK1 X;  1RP0 A;  4J33 A;  3UTG A;  2EQ7 A;  1IUU A;  4OCG A;  5FS7 A;  2JB1 A;  1Y56 A;  2WS3 A;  4EQS A;  2R9Z A;  4NNJ A;  3WE0 A;  5LV9 A;  4GAV A;  3NYC A;  3UTH A;  1F8W A;  3H8L A;  4H2R A;  4NTE A;  3AE1 A;  1PDH A;  1M6I A;  3UP4 A;  4U2T A;  4Z44 A;  3UKA A;  4Y4M A;  5HY5 A;  4N9X A;  4H4X A;  2WP5 A;  2RGJ A;  4CNK A;  2VZ2 A;  3QSE A;  3CPI G;  1OJC A;  1PJ7 A;  2H89 A;  4A5L A;  4YSX A;  1GET A;  3AE3 A;  1Q1R A;  3LJP A;  1LPF A;  1S2Y A;  2WP9 A;  1XHC A;  2YG3 A;  2WQY A;  1E1N A;  3QSS A;  5U1O A;  2BA9 A;  2XFN A;  5IQ4 A;  1JRZ A;  3UOV A;  3NHO X;  4CY8 A;  3AEG A;  4U8K A;  3DJD A;  2BAC A;  2E4G A;  3BHK A;  5EB5 A;  4IA5 A;  1B4V A;  2VRM A;  1ZMD A;  2UZZ A;  5DBJ A;  4I59 A;  1TDF A;  3ADA B;  2W0H A;  3AD8 B;  3GDN A;  2C75 A;  2J3N A;  4H4R A;  3AXB A;  4BK1 A;  4U8J A;  2E1M A;  1Y0P A;  2YM1 A;  4H4V A;  1S3B A;  1PBD A;  2WP6 A;  3DJJ A;  4J57 A;  4PAB A;  1NHR A;  4J36 A;  4YSH A;  2Q7V A;  1DOE A;  2EQ6 A;  4TM4 A;  3GWD A;  1N4W A;  1GES A;  1ONF A;  2BCG G;  4H2P A;  2YVG A;  3AYL A;  3M0O A;  3P4Q A;  4JQ9 A;  3AED A;  2TMD A;  3EAN A;  2RGO A;  1NG3 A;  2YVJ A;  2GAG B;  3RNM A;  2V61 A;  4Z25 A;  2WPF A;  1O94 A;  1DNC A;  2BS3 A;  1NAA A;  4HB9 A;  2WOI A;  4NZH A;  4YTM A;  1FEA A;  2QAE A;  4JY2 A;  3UKF A;  4DSH A;  3V76 A;  3D8X A;  4EQX A;  2VQ7 A;  1Z6L A;  4U8M A;  4WX1 A;  3NK0 X;  4DSG A;  4D03 A;  2C65 A;  3RP6 A;  3ITJ A;  3D1C A;  4YSZ A;  2AQJ A;  1PXC A;  2ACZ A;  1DOB A;  1KSU A;  3HYW A;  1ZMC A;  4OPT A;  1D4C A;  4H4P A;  5BUK A;  3URH A;  3AE9 A;  3KD9 A;  1JNR A;  4OVI A;  3GYX A;  3HZL A;  1V59 A;  1H6V A;  4YTN A;  3L1R A;  1B8S A;  1LQT A;  4OPC A;  4BUR A;  3VR9 A;  1K0J A;  3GRT A;  3IC9 A;  2XFU A;  3DME A;  4AOS A;  4FK1 A;  3OZ2 A;  3K30 A;  5J60 A;  3LXD A;  1BF3 A;  3SFD A;  2V60 A;  4H50 A;  1K4Q A;  2GR0 A;  5JCI A;  1ZK7 A;  1H86 A;  2XCG A;  1PJ6 A;  2BS2 A;  4Z43 A;  3FPZ A;  2C76 A;  4ECH A;  4GDE A;  3ZYX A;  3V3O A;  1ELI A;  3GDP A;  5L46 A;  3BNU A;  1ZOY A;  1JU2 A;  4PAA A;  1OJA A;  1LVL A;  1CJ3 A;  1MXT A;  3DGZ A;  3I6D A;  5EOW A;  3AE8 A;  5CKU A;  1TYP A;  3P9U A;  4TM1 A;  4YKG A;  2CFY A;  2BC1 A;  1KNR A;  4K22 A;  3UP5 A;  1JEH A;  1MOK A;  2X8H A;  2OLN A;  3AE2 A;  3NG7 X;  4G6H A;  4AT0 A;  4EM4 A;  2JAE A;  2FJE A;  2BS4 A;  1NEK A;  2BK5 A;  2H88 A;  1GTE A;  5C2T A;  5KMR A;  1JRY A;  3GMB A;  2NVK X;  1BGN A; 
#chains in the Genus database with same CATH homology
 2RGH A;  1YQZ A;  2GH5 A;  2XDO A;  4RG4 A;  2GR1 A;  5BRT A;  2FJA A;  1QO8 A;  3Q6J A;  5EB4 A;  1PXB A;  2EQ8 A;  2WU5 A;  3BI5 A;  1D7Y A;  3IWA A;  2GEW A;  4Z2T A;  5KNL A;  4FX9 A;  1H81 A;  3S5W A;  4M52 A;  1EL9 A;  3NTD A;  3UKL A;  3CND A;  1B37 A;  4CNJ A;  3CIR A;  1GPE A;  4IVO B;  1LJ1 A;  3UTE A;  4CBQ A;  4GCM A;  2VOU A;  2TPR A;  1KDG A;  4D04 A;  4G6G A;  3IHG A;  4U8I A;  4II2 A;  2ZZ0 A;  3II4 A;  3SX6 A;  2YLT A;  4KPR A;  3KVE A;  2GVC A;  3DK4 A;  3C96 A;  3LOV A;  3AEA A;  2WOW A;  2Q0K A;  3FG2 P;  2WEU A;  3P1W A;  5M0Z A;  3SZ0 A;  4NTC A;  4TM0 A;  1RSG A;  4JN9 A;  2X99 A;  2Z5Y A;  4G74 A;  3GD4 A;  2C7G A;  1DJN A;  3NKS A;  1GRT A;  1O5W A;  3GYJ A;  3HYV A;  3UCL A;  4LU6 A;  3OC4 A;  1ZX9 A;  1Y56 B;  3B3R A;  2C72 A;  2QA1 A;  1HYU A;  3ICS A;  3NLC A;  2X50 A;  4NEW A;  4B66 A;  1F6M A;  3RHA A;  3NGC X;  3ZDN A;  4H2Q A;  3F8R A;  4USR A;  3CNJ A;  1GAL A;  3CNT A;  2Y6R A;  1OJT A;  3S61 A;  5FS9 A;  2GRT A;  3SFE A;  1VDC A;  1P2E A;  3CPH G;  3P4S A;  1CC4 A;  2YG6 A;  5BUL A;  4LII A;  2WBA A;  1FEB A;  1PXA A;  4NEV A;  3ISH A;  1NEN A;  3AD7 B;  4C5O A;  1D7L A;  2B7S A;  3T2K A;  4G73 A;  2IVE A;  2JB3 A;  4U8N A;  4WCT A;  4EMI A;  3LZX A;  1EL7 A;  4H7U A;  3C4A A;  5U63 A;  2XVJ A;  3T2Z A;  2WPC A;  2RAB A;  4U2L A;  3SYI A;  5FS6 A;  4EM3 A;  2WDV A;  1REO A;  2XFQ A;  3G5R A;  1D4E A;  4X9N A;  2F5Z A;  1IUX A;  2GF3 A;  4BJY A;  3H8I A;  4FDC B;  2ZBW A;  4TM3 A;  3SM8 A;  1K0I A;  2GMJ A;  2R46 A;  3ALL A;  2V6O A;  3IHM A;  4H4Y A;  4B64 A;  1E7P A;  2R45 A;  4A6N A;  2C3D A;  4OPD A;  3LZW A;  3UTF A;  3UOY A;  2BCP A;  2GQW A;  2YM2 A;  2XLS A;  1K0L A;  1PS9 A;  4OPU A;  5KMS A;  1L9E A;  3EPT A;  4K5S A;  4DNA A;  2Q0L A;  3AYI A;  3B6D A;  3NN6 X;  3CTY A;  1GT8 A;  1E1M A;  3AE7 A;  4Y4L A;  2C3C A;  2APG A;  1TDN A;  3ICR A;  1DXL A;  2V3A A;  2B9Y A;  1GND A;  1LTX R;  5KXJ A;  4ZCC A;  5JCN A;  1TYT A;  4X4J A;  3UKH A;  4JY3 A;  1DOC A;  4CCQ A;  5KRQ A;  1H7X A;  1W4X A;  4RG3 A;  1GRG A;  1GTH A;  4I58 A;  3K7Q X;  5FMH A;  3SZF A;  2YG4 A;  2YLS A;  4YT0 A;  2ARD A;  4USQ A;  4J34 A;  2PYX A;  3GWF A;  2FJD A;  4GR1 A;  4TLZ A;  5JCL A;  4H4T A;  3BI4 A;  1KF6 A;  4YXD A;  3T37 A;  3SGL A;  5IQ1 A;  1YY5 A;  4AOX A;  3EF6 A;  4EIQ A;  5ER0 A;  2ZZC A;  3GD3 A;  2BXS A;  3GYI A;  2C66 A;  1ZOV A;  2BC0 A;  4IA6 A;  4A7A A;  4O5U A;  4Z26 A;  4B68 A;  5HXI A;  2OA1 A;  4B65 A;  2Q6U A;  1BKW A;  1H83 A;  1GRH A;  1N1P A;  4MJW A;  1S2Q A;  3GSI A;  1NDA A;  2R4J A;  2VRL A;  1MO9 A;  4A65 A;  2XVE A;  3UOZ A;  4B67 A;  1EL5 A;  1ZDL A;  4U8L A;  1GV4 A;  1BGJ A;  1IUV A;  1ZKQ A;  2XFP A;  3CGB A;  3DK9 A;  3NYE A;  2A87 A;  3VRA A;  4YTP A;  1IUW A;  1CHU A;  1GEU A;  4II3 A;  4LA1 A;  3UKK A;  2OAL A;  2YLX A;  1E1L A;  2B7R A;  2V3B A;  1IJH A;  3ATR A;  4BK3 A;  2YR4 A;  4E0V A;  2QA2 A;  3GMC A;  4APN A;  2R4E A;  4DGK A;  3CMM A;  3CGE A;  3KKJ A;  4Z2U A;  3LB8 A;  2YLR A;  1N4V A;  2YWL A;  2GR2 A;  2FJB A;  1P2H A;  1NG4 A;  1KNP A;  5KWF A;  4K8D A;  1E39 A;  2C64 A;  4EQW A;  1OJ9 A;  4K2X A;  4OPG A;  2AAQ A;  1ZY8 A;  2JBV A;  3AEE A;  3FIM B;  2X3N A;  3K7T A;  2YVF A;  2GAH B;  3EAO A;  4O5Q A;  3SY4 A;  4G9K A;  2WHD A;  2Z5X A;  2E5V A;  1D4D A;  2FBW A;  3NNE A;  3NT6 A;  3QFA A;  4A99 A;  1DJQ A;  4YSY A;  2XLR A;  2HQM A;  1TDE A;  3RED A;  4B1B A;  4UP3 A;  5TR3 A;  1LQU A;  5EBK A;  1F3P A;  1NHS A;  2QCU A;  2WES A;  2XVH A;  3SQP A;  1GOS A;  3SZC A;  2OAM A;  4TLX A;  3T14 A;  1YQ3 A;  2XVI A;  4GAP A;  1CBO A;  5CQF A;  1L9C A;  1PHH A;  1CC6 A;  3ALJ A;  3DGH A;  3P4R A;  1CJ2 A;  1VQW A;  1KSS A;  3PO7 A;  4GDP A;  1S3E A;  1O95 A;  4ICY A;  1GSN A;  1LV0 A;  3CGD A;  1FOH A;  3KPF A;  1XPQ A;  2WDQ A;  2A89 A;  1COY A;  1EL8 A;  4FK1 C;  1VG9 A;  2GV8 A;  4XWZ A;  1FL2 A;  2YQU A;  3PS9 A;  1QJD A;  4JDR A;  1Q1W A;  3AEF A;  4OPI A;  2WDR A;  4C74 A;  2R0C A;  4AT2 A;  5GRT A;  1AOG A;  5KVH A;  3PVC A;  1XAN A;  3T2Y A;  2CDU A;  2Y6Q A;  3FBS A;  1CJ4 A;  4C3X A;  3CPJ G;  1H7W A;  3LAD A;  3NH3 X;  1IUS A;  2O9Z A;  3BI2 A;  1PBF A;  1TRB A;  1CL0 A;  1X31 B;  3F8P A;  2YR6 A;  2BK4 A;  4XXG A;  2AR8 A;  4UDQ A;  5GSN A;  5KOX A;  4KX6 A;  2ZZB A;  3RP7 A;  2I0Z A;  1SEZ A;  3GRS A;  3NTA A;  4CRT A;  2XLU A;  4BJZ A;  4GRT A;  4RSL A;  3SZW A;  5KOW A;  2BXR A;  4NTD A;  1F8R A;  4YWO A;  4J2W A;  4J56 A;  5HYM A;  4IV9 A;  2CUL A;  4H4W A;  4ZCD A;  2WOV A;  3ICT A;  2IID A;  1VG0 A;  4UDP A;  1CJC A;  3CNS A;  3QVP A;  5FS8 A;  1NPX A;  2V5Z A;  1E6E A;  2VVL G;  2YR5 A;  3CNP A;  1TDK A;  4JNQ A;  4H4U A;  2BRA A;  1NHQ A;  4AP3 A;  1E1K A;  3ATQ A;  4B69 A;  5M10 A;  4H2N A;  3BHF A;  2C70 A;  3T31 A;  3AE5 A;  4REK A;  4ZN0 A;  3QFB A;  3HYX A;  2BRY A;  4K7Z A;  4Y4N A;  2EQ9 A;  2B76 A;  1F8S A;  4A6N B;  1YKJ A;  4EMJ A;  1DOD A;  5U25 A;  3V3N A;  2XVF A;  2WPE A;  3CN8 A;  3I3L A;  1OJD A;  2VVM A;  2X8C A;  3JSK A;  2GR3 A;  3E1T A;  3KLJ A;  5HHF A;  5KMQ A;  3UKQ A;  2C73 A;  3G5S A;  3VQR A;  4H4Q A;  4X9M A;  2C4C A;  4EMW A;  5C3J A;  1UKV G;  4C77 A;  2BYB A;  5BVA A;  4U8P A;  1BZL A;  1JRX A;  2GMH A;  1JOA A;  1TDO A;  1ZP0 A;  2R0P A;  2VQB A;  2X8G A;  3DK8 A;  1L9D A;  2XLT A;  1YQ4 A;  3Q9T A;  3NYF A;  1XDI A;  3AE6 A;  3QJ4 A;  3CGC A;  1IUT A;  2JKC A;  3COX A;  4AP1 A;  1CF3 A;  2BAB A;  3ABV A;  4UDR A;  2VVL A;  1H84 A;  1PBE A;  3K7M X;  1NHP A;  4H4Z A;  2DKI A;  2JK6 A;  3L8K A;  3NK2 X;  1JNZ A;  2NPX A;  1GRB A;  4U2S A;  2JB2 A;  3AEB A;  4EQR A;  1QLB A;  1CC2 A;  3M12 A;  2YLW A;  1N4U A;  1KFY A;  1BWC A;  2YG5 A;  3O0H A;  3F8D A;  1FEC A;  1B5Q A;  3C4N A;  3AE4 A;  3H4K A;  2IVD A;  4HA6 A;  4J31 A;  4ADW A;  2YAU A;  1M64 A;  2XYO A;  3KPK A;  4Z2R A;  5JCK A;  1GER A;  3AB1 A;  3AEC A;  1GRA A;  1D5T A;  3KA7 A;  1L0V A;  3QSM A;  1PN0 A;  1PJ5 A;  3BNM A;  3NIX A;  2XLP A;  3QVR A;  3VR8 A;  3AYJ A;  3FMW A;  1GXF A;  3KU9 A;  4OPL A;  3IF9 A;  4EIP A;  2BK3 A;  2YG7 A;  4BV6 A;  5KVI A;  3DH9 A;  5J7X A;  3UKP A;  3UOX A;  2OLO A;  3G5Q A;  5JCM A;  4Z24 A;  2XFO A;  3AWI A;  3ALM A;  5IPY A;  3T0K A;  2GB0 A;  3NN0 X;  4GF7 A;  1FCD A;  4NWZ A;  4YKF A;  1VRQ B;  3DJE A;  2CVJ A;  3AD9 B;  1PBC A;  4GUV A;  4A9W A;  1PBB A;  1RYI A;  3DJG X;  4JNA A;  2WU2 A;  2YLZ A;  4XWR A;  3DA1 A;  2B9X A;  4CCR A;  1H82 A;  2DKH A;  2C67 A;  2B9W A;  4P9S A;  1Q9I A;  3SXI A;  3M13 A;  3VRB A;  4U8O A;  3NRN A;  4B63 A;  4A79 A;  4K5R A;  2R0G A;  2PHH A;  4C3Y A;  4CY6 A;  3R9U A;  2WET A;  1EBD A;  4BK2 A;  4H4S A;  2A8X A;  2GQF A;  1GRE A;  3VRD B;  1GRF A;  3P4P A;  4IVM B;  3RP8 A;  5KMP A;  3NK1 X;  1RP0 A;  4J33 A;  3UTG A;  2EQ7 A;  1IUU A;  4OCG A;  5FS7 A;  2JB1 A;  1Y56 A;  2WS3 A;  4EQS A;  2R9Z A;  4NNJ A;  3WE0 A;  5LV9 A;  4GAV A;  3NYC A;  3UTH A;  1F8W A;  3H8L A;  4H2R A;  4NTE A;  3AE1 A;  1PDH A;  1M6I A;  3UP4 A;  4U2T A;  4Z44 A;  3UKA A;  4Y4M A;  5HY5 A;  4N9X A;  4H4X A;  2WP5 A;  2RGJ A;  4CNK A;  2VZ2 A;  3QSE A;  3CPI G;  1OJC A;  1PJ7 A;  2H89 A;  4A5L A;  4YSX A;  1GET A;  3AE3 A;  1Q1R A;  3LJP A;  1LPF A;  1S2Y A;  2WP9 A;  1XHC A;  2YG3 A;  2WQY A;  1E1N A;  3QSS A;  5U1O A;  2BA9 A;  2XFN A;  5IQ4 A;  1JRZ A;  3UOV A;  3NHO X;  4CY8 A;  3AEG A;  4U8K A;  3DJD A;  2BAC A;  2E4G A;  3BHK A;  5EB5 A;  4IA5 A;  1B4V A;  2VRM A;  1ZMD A;  2UZZ A;  5DBJ A;  4I59 A;  1TDF A;  3ADA B;  2W0H A;  3AD8 B;  3GDN A;  2C75 A;  2J3N A;  4H4R A;  3AXB A;  4BK1 A;  4U8J A;  2E1M A;  1Y0P A;  2YM1 A;  4H4V A;  1S3B A;  1PBD A;  2WP6 A;  3DJJ A;  4J57 A;  4PAB A;  1NHR A;  4J36 A;  4YSH A;  2Q7V A;  1DOE A;  2EQ6 A;  4TM4 A;  3GWD A;  1N4W A;  1GES A;  1ONF A;  2BCG G;  4H2P A;  2YVG A;  3AYL A;  3M0O A;  3P4Q A;  4JQ9 A;  3AED A;  2TMD A;  3EAN A;  2RGO A;  1NG3 A;  2YVJ A;  2GAG B;  3RNM A;  2V61 A;  4Z25 A;  2WPF A;  1O94 A;  1DNC A;  2BS3 A;  1NAA A;  4HB9 A;  2WOI A;  4NZH A;  4YTM A;  1FEA A;  2QAE A;  4JY2 A;  3UKF A;  4DSH A;  3V76 A;  3D8X A;  4EQX A;  2VQ7 A;  1Z6L A;  4U8M A;  4WX1 A;  3NK0 X;  4DSG A;  4D03 A;  2C65 A;  3RP6 A;  3ITJ A;  3D1C A;  4YSZ A;  2AQJ A;  1PXC A;  2ACZ A;  1DOB A;  1KSU A;  3HYW A;  1ZMC A;  4OPT A;  1D4C A;  4H4P A;  5BUK A;  3URH A;  3AE9 A;  3KD9 A;  1JNR A;  4OVI A;  3GYX A;  3HZL A;  1V59 A;  1H6V A;  4YTN A;  3L1R A;  1B8S A;  1LQT A;  4OPC A;  4BUR A;  3VR9 A;  1K0J A;  3GRT A;  3IC9 A;  2XFU A;  3DME A;  4AOS A;  4FK1 A;  3OZ2 A;  3K30 A;  5J60 A;  3LXD A;  1BF3 A;  3SFD A;  2V60 A;  4H50 A;  1K4Q A;  2GR0 A;  5JCI A;  1ZK7 A;  1H86 A;  2XCG A;  1PJ6 A;  2BS2 A;  4Z43 A;  3FPZ A;  2C76 A;  4ECH A;  4GDE A;  3ZYX A;  3V3O A;  1ELI A;  3GDP A;  5L46 A;  3BNU A;  1ZOY A;  1JU2 A;  4PAA A;  1OJA A;  1LVL A;  1CJ3 A;  1MXT A;  3DGZ A;  3I6D A;  5EOW A;  3AE8 A;  5CKU A;  1TYP A;  3P9U A;  4TM1 A;  4YKG A;  2CFY A;  2BC1 A;  1KNR A;  4K22 A;  3UP5 A;  1JEH A;  1MOK A;  2X8H A;  2OLN A;  3AE2 A;  3NG7 X;  4G6H A;  4AT0 A;  4EM4 A;  2JAE A;  2FJE A;  2BS4 A;  1NEK A;  2BK5 A;  2H88 A;  1GTE A;  5C2T A;  5KMR A;  1JRY A;  3GMB A;  2NVK X;  1BGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...