2XLTA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with 3-acetylpyridine adenine dinucleotide phosphate (apadp)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA02
4K5SA 2WU2A 1O94A 3C4NA 3VQRA 3VRDB 5KVHA 2Z5YA 3NNEA 2YM2A 3DK9A 3DH9A 4Z2RA 1PJ5A 3KVEA 1CC2A 2XVEA 3GRSA 4Z44A 3BI5A 4H4SA 4YKGA 3QFAA 4JY3A 5KOXA 2VQBA 3G5RA 1IUVA 4FK1C 3NN0X 4JDRA 2WOVA 3NIXA 4A99A 5J60A 2C67A 2DKHA 3CNPA 2A89A 4I59A 1XANA 3H8IA 4LU6A 2YG7A 3QJ4A 4H7UA 3CGEA 3LZWA 4NTEA 5HY5A 1NENA 1TDFA 2GB0A 3ICRA 3F8PA 3ITJA 2WPCA 4KX6A 1EL7A 4EIPA 3KLJA 2Q6UA 4H4PA 4X4JA 2JAEA 3QSSA 2TPRA 1K0JA 1N1PA 1VG9A 3AECA 1CJ2A 4NZHA 2XLPA 4LA1A 1Y56B 4U8MA 2YLXA 1B8SA 2IVDA 3LXDA 2JBVA 3BI2A 4D03A 4N9XA 2OAMA 4ZCDA 1GNDA 1IUUA 1FL2A 2JB2A 2XVFA 3UCLA 1JNRA 2V3AA 2BXSA 2GQWA 2WOIA 2VZ2A 1ZY8A 3BHKA 3DA1A 2X99A 1NDAA 2RABA 4IA6A 3M13A 4K7ZA 1PBDA 2GR0A 3HZLA 3IWAA 1SEZA 4U8PA 4A65A 4EMWA 1MOKA 1QO8A 3AE5A 2WDRA 4H4YA 4RG3A 1NEKA 2OA1A 1KDGA 3ICSA 4FK1A 5BRTA 1H7XA 4CY6A 1NG3A 3DJDA 1S3BA 4K5RA 3NH3X 2E1MA 2WPFA 3LOVA 3Q6JA 4AOXA 2BC0A 1E7PA 2BA9A 3AE9A 3AEBA 2Q0KA 3UKQA 3RP7A 2XFPA 5KWFA 4PABA 1D4CA 3C4AA 4H2NA 4UDPA 1GV4A 2WETA 4H50A 1LVLA 4DSHA 2C72A 3IC9A 4DNAA 3O0HA 3KU9A 5EB4A 1JEHA 5FS7A 4NTDA 1H83A 3ALMA 4K2XA 2WQYA 1VRQB 1GXFA 4NTCA 1OJAA 3DK4A 4OPDA 3CGDA 3AEFA 3UOVA 2CDUA 1DJNA 1GETA 4B65A 1DOEA 3REDA 4OVIA 4A6NA 4Z26A 4OPIA 2WPEA 1H81A 3FBSA 5JCMA 4BK2A 4OPTA 3AWIA 4H2RA 3NT6A 1YY5A 3DJGX 2C75A 1DNCA 3FIMB 2XLSA 4B63A 2V61A 2GR2A 3COXA 4U8JA 1PJ6A 2Y6RA 3CGCA 1NPXA 1N4WA 3DK8A 2OLNA 3CNSA 3M12A 3PS9A 2A87A 1ZKQA 1ONFA 1E1KA 2JB3A 5FMHA 2BACA 5EBKA 4RSLA 4CCRA 4CNJA 4B66A 3GD3A 3R9UA 2CFYA 1BZLA 4H4UA 4C77A 2GR3A 1ZDLA 2B9WA 1XDIA 3IF9A 2WS3A 3GYJA 1JOAA 4JNQA 1PXAA 2VVLG 2H89A 3AE7A 1CHUA 4YSZA 4EMJA 3AEAA 2WOWA 4J56A 3GDPA 3NKSA 4I58A 4CY8A 3K7MX 4H4RA 5J7XA 2WBAA 3BI4A 2XLTA 1EBDA 1OJ9A 4J31A 4Y4MA 2ARDA 4OPCA 2BCPA 3D8XA 3UKAA 3QSEA 5DBJA 2R4EA 2OALA 4U8IA 4WX1A 1JNZA 2QCUA 2WDQA 3URHA 1H6VA 2W0HA 1K0LA 3B6DA 3AYJA 2C64A 2YLWA 2PYXA 3NYCA 1EL8A 2JK6A 4H2QA 1Y56A 5CKUA 1PJ7A 3VR9A 2ACZA 1O5WA 4AP1A 1CJCA 3UKFA 5U1OA 4JNAA 2HQMA 5HYMA 2J3NA 1FCDA 2XFUA 5EOWA 3H4KA 2XVHA 1L0VA 3UOZA 3SFDA 1LQUA 2VRLA 1P2HA 2BABA 2OLOA 2BS4A 1F8SA 1YKJA 4H4ZA 4JQ9A 1OJDA 3KA7A 2Q0LA 2GV8A 1ZX9A 1GPEA 4HB9A 1VQWA 4TLZA 5GSNA 3RNMA 3T37A 1E1NA 3II4A 1N4VA 1QJDA 3LJPA 1GESA 4J33A 2WP9A 1L9EA 1W4XA 3P1WA 5CQFA 2EQ6A 4BK1A 4IA5A 4CRTA 2BC1A 5KRQA 2CVJA 2VRMA 2VVLA 3GYIA 3P4QA 2FJBA 4M52A 1CBOA 1GTEA 2XDOA 4GUVA 3NYEA 3CIRA 2YLTA 4JY2A 3KPFA 5GRTA 4GDEA 1TYPA 2R0CA 2YR5A 2FJEA 4PAAA 4LIIA 4U2TA 3S61A 2DKIA 3F8DA 3AXBA 1IUXA 3GWDA 1E39A 2XVIA 4GDPA 3CPHG 3AEGA 4K22A 3NN6X 1JRZA 1D7LA 2BYBA 3NK1X 1GRGA 4P9SA 5KVIA 4APNA 1XHCA 3NK2X 1K4QA 4NEWA 5U25A 1YQ3A 2WEUA 4YKFA 2YR6A 2NVKX 3I3LA 4C3YA 1PN0A 3AE8A 4Y4NA 3AYLA 3SGLA 1F8RA 2XFOA 1DJQA 4Z25A 4TM1A 2GRTA 5JCLA 3S5WA 5KOWA 5IQ1A 5BVAA 1PXBA 1D7YA 4B69A 4C5OA 1PBCA 2Q7VA 2C70A 3UTGA 2VOUA 3CNTA 2YLZA 3C96A 1KNRA 2WU5A 1PXCA 3AD7B 3P9UA 5JCKA 5M0ZA 3QVPA 3SM8A 4YT0A 3UKKA 2GAHB 1VDCA 1BGJA 4GF7A 2I0ZA 3UTHA 1S2YA 1CL0A 5C2TA 4AP3A 3BNUA 4H4XA 2FBWA 1AOGA 2AQJA 1HYUA 3UP5A 1BWCA 1V59A 5HXIA 4BJYA 3SFEA 3VRAA 2YWLA 4EM3A 3FMWA 3G5QA 1YQ4A 2YM1A 2R45A 3QSMA 3SQPA 1GRBA 1LQTA 1CJ3A 2YLRA 1K0IA 1IJHA 4E0VA 1H7WA 3CNDA 1OJTA 4D04A 2BXRA 2YVGA 4J34A 4IV9A 5TR3A 4ADWA 5JCNA 4A9WA 5IPYA 3K7TA 1E1MA 3NK0X 4FX9A 3VR8A 1GRHA 3GRTA 3GWFA 5ER0A 1TDOA 4RG4A 4TM4A 4YTPA 1RP0A 2JKCA 3H8LA 1ELIA 5FS6A 3V3OA 4C3XA 3KKJA 2TMDA 3P4PA 2GAGB 1GALA 1EL9A 4YTMA 4WCTA 2XLRA 4ZCCA 1PBFA 2B9YA 2YG4A 1GRTA 3FG2P 2V6OA 4UDRA 4XXGA 1GERA 3CPIG 3CN8A 2BK3A 4GRTA 2X8CA 2R9ZA 3AE6A 4Y4LA 3AYIA 1ZP0A 4DSGA 4EQSA 3NTDA 3B3RA 3D1CA 2C66A 1ZMDA 2QAEA 4C74A 3LZXA 4EIQA 3V76A 4J36A 5FS9A 4Z2UA 1GT8A 4GCMA 2QA1A 4BV6A 1BKWA 4X9NA 3CPJG 3E1TA 1D4EA 3UKPA 2ZBWA 4O5QA 3RP8A 5LV9A 2VQ7A 1BGNA 3GMBA 2XVJA 4CBQA 5BUKA 4Z43A 2B76A 1MXTA 3GMCA 2WHDA 3CGBA 1DXLA 1FECA 1B4VA 3UTFA 4B68A 4ECHA 2QA2A 4EM4A 2IVEA 1KSUA 2WP6A 2YR4A 1GRFA 3NRNA 1NHQA 4OPGA 2XCGA 2GF3A 2C3CA 3BNMA 4Z24A 3K7QX 4FDCB 5C3JA 4H2PA 1H82A 2IIDA 3PO7A 2X8HA 3CTYA 4ICYA 2C76A 4EQXA 1NHPA 4KPRA 3FPZA 3UKLA 3ALJA 1Z6LA 1Q1RA 3VRBA 2E5VA 2X3NA 2XFNA 1KFYA 3M0OA 1YQZA 3BHFA 1DOBA 1H84A 1L9DA 1GREA 2WESA 5L46A 1P2EA 3AE4A 3IHMA 4YSHA 1LV0A 1TRBA 2ZZCA 3UP4A 3JSKA 1XPQA 4MJWA 3OC4A 2PHHA 1MO9A 3WE0A 4EMIA 2YLSA 3GDNA 2A8XA 3Q9TA 4A7AA 1F3PA 2E4GA 2BS3A 2B7SA 3G5SA 1CJ4A 4U2SA 2R0GA 2CULA 1CF3A 5BULA 2GH5A 1TDEA 3AD9B 4U8NA 5KXJA 1F6MA 2H88A 1KF6A 2B9XA 2XYOA 4U8LA 2AR8A 4TM3A 2FJAA 1QLBA 4OCGA 1GSNA 1PHHA 1GOSA 3AEDA 2GR1A 3AEEA 1TYTA 3EAOA 1S3EA 4USQA 2FJDA 3LB8A 2RGOA 1ZMCA 4REKA 3ATRA 3NG7X 2WP5A 3EPTA 2GVCA 1COYA 1JRYA 4JN9A 1FOHA 3GSIA 2Y6QA 3DGHA 4IVOB 2V3BA 1IUWA 2C3DA 3ALLA 2YVFA 3NTAA 3UTEA 2RGHA 2YAUA 3K30A 1LJ1A 4H4QA 2GMJA 2JB1A 1H86A 3UKHA 1OJCA 4DGKA 1JRXA 3KD9A 4BJZA 4B64A 3IHGA 2YVJA 2BK4A 4A5LA 4ZN0A 3DMEA 2YG3A 1BF3A 2Z5XA 3AE3A 1M6IA 4U2LA 4BURA 4AT2A 1X31B 5M10A 3I6DA 3CNJA 4H4TA 4U8OA 2X50A 2GEWA 1ZOVA 4H4WA 4O5UA 1KNPA 4CNKA 4A79A 3DGZA 3AB1A 5FS8A 3LADA 2NPXA 2ZZ0A 2XLUA 2RGJA 2O9ZA 3ZYXA 3L1RA 1B5QA 3ATQA 1NHRA 1E6EA 1CC6A 1B37A 2C65A 2X8GA 3AE1A 3NHOX 3PVCA 4BK3A 5IQ4A 5U63A 3P4RA 1IUSA 1FEAA 1IUTA 1ZOYA 2XFQA 3RP6A 1NG4A 3ZDNA 1VG0A 1D5TA 2APGA 5EB5A 2ZZBA 1PBBA 4EQRA 2EQ9A 4YXDA 2BS2A 1REOA 3AD8B 1EL5A 1PBEA 3QFBA 4J57A 2BK5A 1L9CA 2R46A 4UP3A 4H4VA 3DJEA 1ZK7A 3QVRA 4B1BA 4YWOA 2WDVA 4NEVA 4B67A 3RHAA 3AE2A 2EQ8A 2YQUA 4U8KA 2VVMA 4USRA 4XWRA 1F8WA 3DJJA 3NYFA 3OZ2A 1Y0PA 3V3NA 1FEBA 1PDHA 2YG6A 2BCGG 4HA6A 4YSYA 3ISHA 1LPFA 1RSGA 1UKVG 4AT0A 1Q1WA 2R4JA 1S2QA 1DODA 1RYIA 2C73A 4GR1A 2GQFA 5JCIA 1GTHA 3GD4A 1Q9IA 1M64A 3NLCA 4AOSA 1DOCA 1N4UA 2R0PA 1LTXR 3NGCX 4CCQA 2EQ7A 4K8DA 2V5ZA 4J2WA 1TDNA 1O95A 4Z2TA 4TM0A 4OPLA 4A6NB 5HHFA 3UOXA 3ADAB 3EF6A 1E1LA 1TDKA 1CC4A 2YG5A 1KSSA 4OPUA 2B7RA 1JU2A 1GEUA 1NHSA 2GMHA 4IVMB 4YTNA 3UOYA 1PS9A 2AAQA 3ABVA 2F5ZA 3P4SA 4UDQA 3EANA 3L8KA 3F8RA 2C7GA 4X9MA 4EQWA 1D4DA 1NAAA 2V60A 4YSXA 3ICTA 4XWZA 1GRAA 2UZZA 4TLXA
chains in the Genus database with same CATH superfamily
4K5SA 2WU2A 1O94A 3C4NA 3VQRA 3VRDB 5KVHA 2Z5YA 3NNEA 2YM2A 3DK9A 3DH9A 4Z2RA 1PJ5A 3KVEA 1CC2A 2XVEA 3GRSA 4Z44A 3BI5A 4H4SA 4YKGA 3QFAA 4JY3A 5KOXA 5KMQA 2VQBA 3G5RA 1IUVA 4FK1C 3NN0X 4JDRA 2WOVA 3NIXA 4A99A 5J60A 2C67A 2DKHA 3CNPA 2A89A 4I59A 1XANA 4G74A 3SXIA 3H8IA 4LU6A 2YG7A 3QJ4A 4H7UA 3CGEA 3LZWA 4NTEA 3SZFA 5HY5A 1NENA 1TDFA 2GB0A 3ICRA 3F8PA 3ITJA 2WPCA 4KX6A 1EL7A 4EIPA 3KLJA 2Q6UA 4H4PA 4X4JA 2JAEA 3QSSA 2TPRA 1K0JA 1N1PA 1VG9A 3AECA 1CJ2A 4NZHA 2XLPA 4LA1A 1Y56B 4U8MA 2YLXA 1B8SA 2IVDA 3LXDA 2JBVA 3BI2A 4D03A 4N9XA 2OAMA 4ZCDA 1GNDA 1IUUA 1FL2A 2JB2A 2XVFA 3UCLA 1JNRA 2V3AA 2BXSA 2GQWA 2WOIA 2VZ2A 1ZY8A 3BHKA 3DA1A 2X99A 1NDAA 2RABA 4IA6A 3M13A 4K7ZA 1PBDA 2GR0A 3HZLA 3IWAA 1SEZA 4U8PA 4A65A 4EMWA 1MOKA 1QO8A 3AE5A 2WDRA 4H4YA 4RG3A 1NEKA 3HYVA 3SYIA 5KMRA 2OA1A 1KDGA 3ICSA 4FK1A 5BRTA 1H7XA 4CY6A 1NG3A 3DJDA 1S3BA 3KPKA 3NH3X 4K5RA 2E1MA 2WPFA 3LOVA 3Q6JA 4AOXA 2BC0A 1E7PA 2BA9A 3AE9A 3AEBA 2Q0KA 3UKQA 3RP7A 2XFPA 5KWFA 4PABA 1D4CA 3C4AA 3SZ0A 4H2NA 4UDPA 1GV4A 2WETA 4H50A 1LVLA 4DSHA 2C72A 3IC9A 4DNAA 3O0HA 3KU9A 5EB4A 1JEHA 5FS7A 4NTDA 1H83A 3ALMA 4K2XA 2WQYA 1VRQB 1GXFA 4NTCA 1OJAA 3DK4A 4OPDA 3CGDA 3AEFA 3UOVA 2CDUA 1DJNA 1GETA 4B65A 1DOEA 3REDA 4OVIA 4A6NA 4Z26A 4OPIA 2WPEA 1H81A 3FBSA 5JCMA 4BK2A 4OPTA 3AWIA 4H2RA 3NT6A 1YY5A 3T2KA 3DJGX 2C75A 1DNCA 3FIMB 2XLSA 4B63A 2V61A 2GR2A 3COXA 4U8JA 1PJ6A 2Y6RA 3CGCA 1NPXA 1N4WA 3DK8A 2OLNA 3CNSA 3M12A 3PS9A 2A87A 1ZKQA 1ONFA 1E1KA 2JB3A 5FMHA 2BACA 5EBKA 4RSLA 4CCRA 4CNJA 4B66A 3GD3A 3R9UA 2CFYA 1BZLA 4II2A 4H4UA 4C77A 2GR3A 1ZDLA 2B9WA 1XDIA 3IF9A 2WS3A 3GYJA 1JOAA 4JNQA 3T31A 1PXAA 2VVLG 2H89A 3AE7A 1CHUA 2BRAA 4YSZA 4EMJA 3AEAA 2WOWA 4J56A 3GDPA 3NKSA 4I58A 4CY8A 3K7MX 4H4RA 5J7XA 2WBAA 3BI4A 2XLTA 1EBDA 1OJ9A 4J31A 4Y4MA 2ARDA 4OPCA 2BCPA 3D8XA 3UKAA 3QSEA 5DBJA 2R4EA 2OALA 4U8IA 4WX1A 1JNZA 2QCUA 2WDQA 3URHA 1H6VA 2W0HA 1K0LA 3B6DA 3AYJA 2C64A 2YLWA 2PYXA 3NYCA 1EL8A 2JK6A 4H2QA 1Y56A 5CKUA 1PJ7A 3VR9A 2ACZA 1O5WA 4AP1A 1CJCA 3UKFA 5U1OA 4JNAA 2HQMA 5HYMA 2J3NA 1FCDA 4G6GA 2XFUA 5EOWA 3H4KA 2XVHA 3HYXA 1L0VA 3UOZA 3SFDA 1LQUA 2VRLA 1P2HA 2BABA 2OLOA 2BS4A 1F8SA 1YKJA 4H4ZA 4JQ9A 1OJDA 3KA7A 2Q0LA 2GV8A 1ZX9A 1GPEA 4HB9A 1VQWA 4TLZA 5GSNA 3RNMA 3T37A 1E1NA 3II4A 1N4VA 1QJDA 3LJPA 1GESA 4J33A 2WP9A 1L9EA 1W4XA 3P1WA 5CQFA 2EQ6A 4BK1A 4GAVA 2C4CA 4IA5A 2BC1A 4CRTA 5KRQA 5KNLA 2CVJA 2VRMA 2VVLA 3GYIA 3P4QA 2FJBA 4M52A 1CBOA 1GTEA 2XDOA 4GUVA 3NYEA 3CIRA 2YLTA 4JY2A 3KPFA 5GRTA 4GDEA 1TYPA 2R0CA 2YR5A 2FJEA 4PAAA 4LIIA 4U2TA 3S61A 2DKIA 3F8DA 3AXBA 1IUXA 3GWDA 1E39A 2XVIA 4GDPA 3CPHG 3AEGA 4K22A 3NN6X 1JRZA 1D7LA 2BYBA 3NK1X 1GRGA 4P9SA 5KVIA 4APNA 1XHCA 3NK2X 1K4QA 4NEWA 5U25A 1YQ3A 2WEUA 4YKFA 2YR6A 2NVKX 3I3LA 4C3YA 1PN0A 3AE8A 4Y4NA 3AYLA 3SGLA 1F8RA 2XFOA 1DJQA 4Z25A 4TM1A 2GRTA 5JCLA 3S5WA 5KOWA 5IQ1A 5BVAA 1PXBA 1D7YA 3SX6A 4B69A 4C5OA 1PBCA 2Q7VA 2C70A 3UTGA 2VOUA 3CNTA 2YLZA 3C96A 1KNRA 2WU5A 1PXCA 3AD7B 3P9UA 3T2ZA 5JCKA 5M0ZA 3QVPA 3SM8A 4YT0A 3UKKA 2GAHB 1VDCA 1BGJA 4GF7A 2I0ZA 3UTHA 1S2YA 1CL0A 5C2TA 4AP3A 3BNUA 4H4XA 2FBWA 1AOGA 2AQJA 1HYUA 3UP5A 1BWCA 1V59A 5HXIA 4BJYA 3SFEA 3VRAA 2YWLA 4EM3A 3FMWA 3G5QA 1YQ4A 2YM1A 2R45A 3QSMA 3SQPA 1GRBA 1LQTA 1CJ3A 2YLRA 1K0IA 1IJHA 4E0VA 1H7WA 3CNDA 1OJTA 4D04A 2BXRA 2YVGA 4J34A 4IV9A 5TR3A 4ADWA 5JCNA 4A9WA 5IPYA 3K7TA 1E1MA 3NK0X 4FX9A 3VR8A 1GRHA 3GRTA 3GWFA 5ER0A 1TDOA 4RG4A 4TM4A 4YTPA 1RP0A 2JKCA 3H8LA 1ELIA 4G6HA 5FS6A 3V3OA 4C3XA 3KKJA 2TMDA 3T14A 3P4PA 2GAGB 1GALA 1EL9A 4YTMA 4WCTA 2XLRA 4ZCCA 1PBFA 2B9YA 2YG4A 1GRTA 3FG2P 2V6OA 4UDRA 4GAPA 4XXGA 1GERA 3CPIG 3CN8A 2BK3A 4GRTA 2X8CA 4NWZA 2R9ZA 3AE6A 4Y4LA 3SZWA 3AYIA 1ZP0A 4DSGA 4EQSA 3NTDA 3SY4A 3B3RA 3D1CA 2C66A 1ZMDA 2QAEA 4C74A 3LZXA 4EIQA 3V76A 4J36A 5FS9A 4Z2UA 1GT8A 4GCMA 2QA1A 4BV6A 1BKWA 4X9NA 3CPJG 3E1TA 1D4EA 3UKPA 2ZBWA 4G73A 4O5QA 3RP8A 5LV9A 2VQ7A 1BGNA 3GMBA 2XVJA 4CBQA 5BUKA 4Z43A 2B76A 1MXTA 3GMCA 2WHDA 3CGBA 1DXLA 1FECA 1B4VA 3UTFA 4B68A 4ECHA 2QA2A 4EM4A 2IVEA 1KSUA 2WP6A 2YR4A 1GRFA 3NRNA 1NHQA 4OPGA 2XCGA 2GF3A 2C3CA 3BNMA 4Z24A 3K7QX 4FDCB 5C3JA 4H2PA 1H82A 2IIDA 3PO7A 2X8HA 5KMPA 3CTYA 4ICYA 2C76A 4EQXA 1NHPA 4KPRA 3FPZA 3UKLA 3ALJA 1Z6LA 1Q1RA 3VRBA 2E5VA 2X3NA 2XFNA 1KFYA 3M0OA 1YQZA 3BHFA 1DOBA 1H84A 3GYXA 1L9DA 1GREA 2WESA 5L46A 1P2EA 3AE4A 3IHMA 4YSHA 1LV0A 1TRBA 2ZZCA 3UP4A 3JSKA 1XPQA 4MJWA 3OC4A 2PHHA 1MO9A 3WE0A 4EMIA 2YLSA 3GDNA 2A8XA 3Q9TA 4A7AA 1F3PA 2E4GA 2BS3A 2B7SA 3G5SA 1CJ4A 4U2SA 2R0GA 2CULA 1CF3A 5BULA 2GH5A 1TDEA 3AD9B 4U8NA 5KXJA 1F6MA 2H88A 1KF6A 2B9XA 2XYOA 4U8LA 2AR8A 4TM3A 2FJAA 1QLBA 4OCGA 1GSNA 1PHHA 1GOSA 3AEDA 3SZCA 2GR1A 3AEEA 4NNJA 1TYTA 3EAOA 1S3EA 4USQA 2FJDA 3LB8A 2RGOA 1ZMCA 4REKA 3ATRA 3NG7X 2WP5A 4G9KA 3EPTA 2GVCA 1COYA 1JRYA 4JN9A 1FOHA 3GSIA 2Y6QA 3DGHA 4IVOB 2V3BA 1IUWA 2C3DA 3ALLA 2YVFA 3NTAA 3UTEA 2RGHA 2BRYA 2YAUA 3K30A 1LJ1A 4H4QA 2GMJA 2JB1A 1H86A 3UKHA 1OJCA 4DGKA 1JRXA 3KD9A 4BJZA 4B64A 3IHGA 2YVJA 2BK4A 4A5LA 4ZN0A 3DMEA 2YG3A 1BF3A 2Z5XA 3AE3A 1M6IA 4U2LA 4BURA 4AT2A 1X31B 5KMSA 5M10A 3I6DA 3CNJA 4H4TA 4U8OA 3HYWA 2X50A 2GEWA 1ZOVA 4H4WA 4O5UA 1KNPA 4CNKA 4A79A 3DGZA 3AB1A 5FS8A 3LADA 2NPXA 2ZZ0A 2XLUA 2RGJA 2O9ZA 3T0KA 3ZYXA 3L1RA 1B5QA 3ATQA 1NHRA 1E6EA 1CC6A 1B37A 2C65A 2X8GA 3AE1A 3NHOX 3PVCA 4BK3A 5IQ4A 5U63A 3P4RA 1IUSA 1FEAA 1IUTA 1ZOYA 2XFQA 3RP6A 1NG4A 3ZDNA 1VG0A 1D5TA 2APGA 5EB5A 2ZZBA 1PBBA 4EQRA 3T2YA 2EQ9A 4YXDA 2BS2A 1REOA 3AD8B 1EL5A 1PBEA 3QFBA 4J57A 2BK5A 1L9CA 2R46A 4UP3A 3CMMA 4H4VA 3DJEA 1ZK7A 3QVRA 4B1BA 4YWOA 2WDVA 4NEVA 4B67A 3RHAA 3AE2A 2EQ8A 2YQUA 4U8KA 2VVMA 4USRA 4XWRA 1F8WA 3DJJA 3NYFA 3OZ2A 1Y0PA 3V3NA 1FEBA 1PDHA 2YG6A 2BCGG 4HA6A 4YSYA 3ISHA 1LPFA 1RSGA 1UKVG 4AT0A 1Q1WA 2R4JA 1S2QA 1DODA 1RYIA 2C73A 4GR1A 2GQFA 5JCIA 1GTHA 3GD4A 1Q9IA 1M64A 3NLCA 4II3A 4AOSA 1DOCA 1N4UA 2R0PA 1LTXR 3NGCX 4CCQA 2EQ7A 4K8DA 2V5ZA 4J2WA 1TDNA 1O95A 4Z2TA 4TM0A 4OPLA 4A6NB 5HHFA 3UOXA 3ADAB 3EF6A 1E1LA 1TDKA 1CC4A 2YG5A 1KSSA 4OPUA 2B7RA 1JU2A 1GEUA 1NHSA 2GMHA 4IVMB 4YTNA 3UOYA 1PS9A 2AAQA 3ABVA 2F5ZA 3P4SA 4UDQA 3EANA 3L8KA 3F8RA 2C7GA 4X9MA 4EQWA 1D4DA 1NAAA 2V60A 4YSXA 3ICTA 4XWZA 1GRAA 2UZZA 4TLXA
chains in the Genus database with same CATH topology
4K5SA 2WU2A 1O94A 3C4NA 3VQRA 3VRDB 5KVHA 2Z5YA 3NNEA 2YM2A 3DK9A 3DH9A 4Z2RA 1PJ5A 3KVEA 1CC2A 2XVEA 3GRSA 4Z44A 3BI5A 4H4SA 4YKGA 3QFAA 4JY3A 5KOXA 5KMQA 2VQBA 3G5RA 1IUVA 4FK1C 3NN0X 4JDRA 2WOVA 3NIXA 4A99A 5J60A 2C67A 2DKHA 3CNPA 2A89A 4I59A 1XANA 4G74A 3SXIA 3H8IA 4LU6A 2YG7A 3QJ4A 4H7UA 3CGEA 3LZWA 4NTEA 3SZFA 5HY5A 1NENA 1TDFA 2GB0A 3ICRA 3F8PA 3ITJA 2WPCA 4KX6A 1EL7A 4EIPA 3KLJA 2Q6UA 4H4PA 4X4JA 2JAEA 3QSSA 2TPRA 1K0JA 1N1PA 1VG9A 3AECA 1CJ2A 4NZHA 2XLPA 4LA1A 1Y56B 4U8MA 2YLXA 1B8SA 2IVDA 3LXDA 2JBVA 3BI2A 4D03A 4N9XA 2OAMA 4ZCDA 1GNDA 1IUUA 1FL2A 2JB2A 2XVFA 3UCLA 1JNRA 2V3AA 2BXSA 2GQWA 2WOIA 2VZ2A 1ZY8A 3BHKA 3DA1A 2X99A 1NDAA 2RABA 4IA6A 3M13A 4K7ZA 1PBDA 2GR0A 3HZLA 3IWAA 1SEZA 4U8PA 4A65A 4EMWA 1MOKA 1QO8A 3AE5A 2WDRA 4H4YA 4RG3A 1NEKA 3HYVA 3SYIA 5KMRA 2OA1A 1KDGA 3ICSA 4FK1A 5BRTA 1H7XA 4CY6A 1NG3A 3DJDA 1S3BA 3KPKA 3NH3X 4K5RA 2E1MA 2WPFA 3LOVA 3Q6JA 4AOXA 2BC0A 1E7PA 2BA9A 3AE9A 3AEBA 2Q0KA 3UKQA 3RP7A 2XFPA 5KWFA 4PABA 1D4CA 3C4AA 3SZ0A 4H2NA 4UDPA 1GV4A 2WETA 4H50A 1LVLA 4DSHA 2C72A 3IC9A 4DNAA 3O0HA 3KU9A 5EB4A 1JEHA 5FS7A 4NTDA 1H83A 3ALMA 4K2XA 2WQYA 1VRQB 1GXFA 4NTCA 1OJAA 3DK4A 4OPDA 3CGDA 3AEFA 3UOVA 2CDUA 1DJNA 1GETA 4B65A 1DOEA 3REDA 4OVIA 4A6NA 4Z26A 4OPIA 2WPEA 1H81A 3FBSA 5JCMA 4BK2A 4OPTA 3AWIA 4H2RA 3NT6A 1YY5A 3T2KA 3DJGX 2C75A 1DNCA 3FIMB 2XLSA 4B63A 2V61A 2GR2A 3COXA 4U8JA 1PJ6A 2Y6RA 3CGCA 1NPXA 1N4WA 3DK8A 2OLNA 3CNSA 3M12A 3PS9A 2A87A 1ZKQA 1ONFA 1E1KA 2JB3A 5FMHA 2BACA 5EBKA 4RSLA 4CCRA 4CNJA 4B66A 3GD3A 3R9UA 2CFYA 1BZLA 4II2A 4H4UA 4C77A 2GR3A 1ZDLA 2B9WA 1XDIA 3IF9A 2WS3A 3GYJA 1JOAA 4JNQA 3T31A 1PXAA 2VVLG 2H89A 3AE7A 1CHUA 2BRAA 4YSZA 4EMJA 3AEAA 2WOWA 4J56A 3GDPA 3NKSA 4I58A 4CY8A 3K7MX 4H4RA 5J7XA 2WBAA 3BI4A 2XLTA 1EBDA 1OJ9A 4J31A 4Y4MA 2ARDA 4OPCA 2BCPA 3D8XA 3UKAA 3QSEA 5DBJA 2R4EA 2OALA 4U8IA 4WX1A 1JNZA 2QCUA 2WDQA 3URHA 1H6VA 2W0HA 1K0LA 3B6DA 3AYJA 2C64A 2YLWA 2PYXA 3NYCA 1EL8A 2JK6A 4H2QA 1Y56A 5CKUA 1PJ7A 3VR9A 2ACZA 1O5WA 4AP1A 1CJCA 3UKFA 5U1OA 4JNAA 2HQMA 5HYMA 2J3NA 1FCDA 4G6GA 2XFUA 5EOWA 3H4KA 2XVHA 3HYXA 1L0VA 3UOZA 3SFDA 1LQUA 2VRLA 1P2HA 2BABA 2OLOA 2BS4A 1F8SA 1YKJA 4H4ZA 4JQ9A 1OJDA 3KA7A 2Q0LA 2GV8A 1ZX9A 1GPEA 4HB9A 1VQWA 4TLZA 5GSNA 3RNMA 3T37A 1E1NA 3II4A 1N4VA 1QJDA 3LJPA 1GESA 4J33A 2WP9A 1L9EA 1W4XA 3P1WA 5CQFA 2EQ6A 4BK1A 4GAVA 2C4CA 4IA5A 2BC1A 4CRTA 5KRQA 5KNLA 2CVJA 2VRMA 2VVLA 3GYIA 3P4QA 2FJBA 4M52A 1CBOA 1GTEA 2XDOA 4GUVA 3NYEA 3CIRA 2YLTA 4JY2A 3KPFA 5GRTA 4GDEA 1TYPA 2R0CA 2YR5A 2FJEA 4PAAA 4LIIA 4U2TA 3S61A 2DKIA 3F8DA 3AXBA 1IUXA 3GWDA 1E39A 2XVIA 4GDPA 3CPHG 3AEGA 4K22A 3NN6X 1JRZA 1D7LA 2BYBA 3NK1X 1GRGA 4P9SA 5KVIA 4APNA 1XHCA 3NK2X 1K4QA 4NEWA 5U25A 1YQ3A 2WEUA 4YKFA 2YR6A 2NVKX 3I3LA 4C3YA 1PN0A 3AE8A 4Y4NA 3AYLA 3SGLA 1F8RA 2XFOA 1DJQA 4Z25A 4TM1A 2GRTA 5JCLA 3S5WA 5KOWA 5IQ1A 5BVAA 1PXBA 1D7YA 3SX6A 4B69A 4C5OA 1PBCA 2Q7VA 2C70A 3UTGA 2VOUA 3CNTA 2YLZA 3C96A 1KNRA 2WU5A 1PXCA 3AD7B 3P9UA 3T2ZA 5JCKA 5M0ZA 3QVPA 3SM8A 4YT0A 3UKKA 2GAHB 1VDCA 1BGJA 4GF7A 2I0ZA 3UTHA 1S2YA 1CL0A 5C2TA 4AP3A 3BNUA 4H4XA 2FBWA 1AOGA 2AQJA 1HYUA 3UP5A 1BWCA 1V59A 5HXIA 4BJYA 3SFEA 3VRAA 2YWLA 4EM3A 3FMWA 3G5QA 1YQ4A 2YM1A 2R45A 3QSMA 3SQPA 1GRBA 1LQTA 1CJ3A 2YLRA 1K0IA 1IJHA 4E0VA 1H7WA 3CNDA 1OJTA 4D04A 2BXRA 2YVGA 4J34A 4IV9A 5TR3A 4ADWA 5JCNA 4A9WA 5IPYA 3K7TA 1E1MA 3NK0X 4FX9A 3VR8A 1GRHA 3GRTA 3GWFA 5ER0A 1TDOA 4RG4A 4TM4A 4YTPA 1RP0A 2JKCA 3H8LA 1ELIA 4G6HA 5FS6A 3V3OA 4C3XA 3KKJA 2TMDA 3T14A 3P4PA 2GAGB 1GALA 1EL9A 4YTMA 4WCTA 2XLRA 4ZCCA 1PBFA 2B9YA 2YG4A 1GRTA 3FG2P 2V6OA 4UDRA 4GAPA 4XXGA 1GERA 3CPIG 3CN8A 2BK3A 4GRTA 2X8CA 4NWZA 2R9ZA 3AE6A 4Y4LA 3SZWA 3AYIA 1ZP0A 4DSGA 4EQSA 3NTDA 3SY4A 3B3RA 3D1CA 2C66A 1ZMDA 2QAEA 4C74A 3LZXA 4EIQA 3V76A 4J36A 5FS9A 4Z2UA 1GT8A 4GCMA 2QA1A 4BV6A 1BKWA 4X9NA 3CPJG 3E1TA 1D4EA 3UKPA 2ZBWA 4G73A 4O5QA 3RP8A 5LV9A 2VQ7A 1BGNA 3GMBA 2XVJA 4CBQA 5BUKA 4Z43A 2B76A 1MXTA 3GMCA 2WHDA 3CGBA 1DXLA 1FECA 1B4VA 3UTFA 4B68A 4ECHA 2QA2A 4EM4A 2IVEA 1KSUA 2WP6A 2YR4A 1GRFA 3NRNA 1NHQA 4OPGA 2XCGA 2GF3A 2C3CA 3BNMA 4Z24A 3K7QX 4FDCB 5C3JA 4H2PA 1H82A 2IIDA 3PO7A 2X8HA 5KMPA 3CTYA 4ICYA 2C76A 4EQXA 1NHPA 4KPRA 3FPZA 3UKLA 3ALJA 1Z6LA 1Q1RA 3VRBA 2E5VA 2X3NA 2XFNA 1KFYA 3M0OA 1YQZA 3BHFA 1DOBA 1H84A 3GYXA 1L9DA 1GREA 2WESA 5L46A 1P2EA 3AE4A 3IHMA 4YSHA 1LV0A 1TRBA 2ZZCA 3UP4A 3JSKA 1XPQA 4MJWA 3OC4A 2PHHA 1MO9A 3WE0A 4EMIA 2YLSA 3GDNA 2A8XA 3Q9TA 4A7AA 1F3PA 2E4GA 2BS3A 2B7SA 3G5SA 1CJ4A 4U2SA 2R0GA 2CULA 1CF3A 5BULA 2GH5A 1TDEA 3AD9B 4U8NA 5KXJA 1F6MA 2H88A 1KF6A 2B9XA 2XYOA 4U8LA 2AR8A 4TM3A 2FJAA 1QLBA 4OCGA 1GSNA 1PHHA 1GOSA 3AEDA 3SZCA 2GR1A 3AEEA 4NNJA 1TYTA 3EAOA 1S3EA 4USQA 2FJDA 3LB8A 2RGOA 1ZMCA 4REKA 3ATRA 3NG7X 2WP5A 4G9KA 3EPTA 2GVCA 1COYA 1JRYA 4JN9A 1FOHA 3GSIA 2Y6QA 3DGHA 4IVOB 2V3BA 1IUWA 2C3DA 3ALLA 2YVFA 3NTAA 3UTEA 2RGHA 2BRYA 2YAUA 3K30A 1LJ1A 4H4QA 2GMJA 2JB1A 1H86A 3UKHA 1OJCA 4DGKA 1JRXA 3KD9A 4BJZA 4B64A 3IHGA 2YVJA 2BK4A 4A5LA 4ZN0A 3DMEA 2YG3A 1BF3A 2Z5XA 3AE3A 1M6IA 4U2LA 4BURA 4AT2A 1X31B 5KMSA 5M10A 3I6DA 3CNJA 4H4TA 4U8OA 3HYWA 2X50A 2GEWA 1ZOVA 4H4WA 4O5UA 1KNPA 4CNKA 4A79A 3DGZA 3AB1A 5FS8A 3LADA 2NPXA 2ZZ0A 2XLUA 2RGJA 2O9ZA 3T0KA 3ZYXA 3L1RA 1B5QA 3ATQA 1NHRA 1E6EA 1CC6A 1B37A 2C65A 2X8GA 3AE1A 3NHOX 3PVCA 4BK3A 5IQ4A 5U63A 3P4RA 1IUSA 1FEAA 1IUTA 1ZOYA 2XFQA 3RP6A 1NG4A 3ZDNA 1VG0A 1D5TA 2APGA 5EB5A 2ZZBA 1PBBA 4EQRA 3T2YA 2EQ9A 4YXDA 2BS2A 1REOA 3AD8B 1EL5A 1PBEA 3QFBA 4J57A 2BK5A 1L9CA 2R46A 4UP3A 3CMMA 4H4VA 3DJEA 1ZK7A 3QVRA 4B1BA 4YWOA 2WDVA 4NEVA 4B67A 3RHAA 3AE2A 2EQ8A 2YQUA 4U8KA 2VVMA 4USRA 4XWRA 1F8WA 3DJJA 3NYFA 3OZ2A 1Y0PA 3V3NA 1FEBA 1PDHA 2YG6A 2BCGG 4HA6A 4YSYA 3ISHA 1LPFA 1RSGA 1UKVG 4AT0A 1Q1WA 2R4JA 1S2QA 1DODA 1RYIA 2C73A 4GR1A 2GQFA 5JCIA 1GTHA 3GD4A 1Q9IA 1M64A 3NLCA 4II3A 4AOSA 1DOCA 1N4UA 2R0PA 1LTXR 3NGCX 4CCQA 2EQ7A 4K8DA 2V5ZA 4J2WA 1TDNA 1O95A 4Z2TA 4TM0A 4OPLA 4A6NB 5HHFA 3UOXA 3ADAB 3EF6A 1E1LA 1TDKA 1CC4A 2YG5A 1KSSA 4OPUA 2B7RA 1JU2A 1GEUA 1NHSA 2GMHA 4IVMB 4YTNA 3UOYA 1PS9A 2AAQA 3ABVA 2F5ZA 3P4SA 4UDQA 3EANA 3L8KA 3F8RA 2C7GA 4X9MA 4EQWA 1D4DA 1NAAA 2V60A 4YSXA 3ICTA 4XWZA 1GRAA 2UZZA 4TLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5S A;  2WU2 A;  1O94 A;  3C4N A;  3VQR A;  3VRD B;  5KVH A;  2Z5Y A;  3NNE A;  2YM2 A;  3DK9 A;  3DH9 A;  4Z2R A;  1PJ5 A;  3KVE A;  1CC2 A;  2XVE A;  3GRS A;  4Z44 A;  3BI5 A;  4H4S A;  4YKG A;  3QFA A;  4JY3 A;  5KOX A;  2VQB A;  3G5R A;  1IUV A;  4FK1 C;  3NN0 X;  4JDR A;  2WOV A;  3NIX A;  4A99 A;  5J60 A;  2C67 A;  2DKH A;  3CNP A;  2A89 A;  4I59 A;  1XAN A;  3H8I A;  4LU6 A;  2YG7 A;  3QJ4 A;  4H7U A;  3CGE A;  3LZW A;  4NTE A;  5HY5 A;  1NEN A;  1TDF A;  2GB0 A;  3ICR A;  3F8P A;  3ITJ A;  2WPC A;  4KX6 A;  1EL7 A;  4EIP A;  3KLJ A;  2Q6U A;  4H4P A;  4X4J A;  2JAE A;  3QSS A;  2TPR A;  1K0J A;  1N1P A;  1VG9 A;  3AEC A;  1CJ2 A;  4NZH A;  2XLP A;  4LA1 A;  1Y56 B;  4U8M A;  2YLX A;  1B8S A;  2IVD A;  3LXD A;  2JBV A;  3BI2 A;  4D03 A;  4N9X A;  2OAM A;  4ZCD A;  1GND A;  1IUU A;  1FL2 A;  2JB2 A;  2XVF A;  3UCL A;  1JNR A;  2V3A A;  2BXS A;  2GQW A;  2WOI A;  2VZ2 A;  1ZY8 A;  3BHK A;  3DA1 A;  2X99 A;  1NDA A;  2RAB A;  4IA6 A;  3M13 A;  4K7Z A;  1PBD A;  2GR0 A;  3HZL A;  3IWA A;  1SEZ A;  4U8P A;  4A65 A;  4EMW A;  1MOK A;  1QO8 A;  3AE5 A;  2WDR A;  4H4Y A;  4RG3 A;  1NEK A;  2OA1 A;  1KDG A;  3ICS A;  4FK1 A;  5BRT A;  1H7X A;  4CY6 A;  1NG3 A;  3DJD A;  1S3B A;  4K5R A;  3NH3 X;  2E1M A;  2WPF A;  3LOV A;  3Q6J A;  4AOX A;  2BC0 A;  1E7P A;  2BA9 A;  3AE9 A;  3AEB A;  2Q0K A;  3UKQ A;  3RP7 A;  2XFP A;  5KWF A;  4PAB A;  1D4C A;  3C4A A;  4H2N A;  4UDP A;  1GV4 A;  2WET A;  4H50 A;  1LVL A;  4DSH A;  2C72 A;  3IC9 A;  4DNA A;  3O0H A;  3KU9 A;  5EB4 A;  1JEH A;  5FS7 A;  4NTD A;  1H83 A;  3ALM A;  4K2X A;  2WQY A;  1VRQ B;  1GXF A;  4NTC A;  1OJA A;  3DK4 A;  4OPD A;  3CGD A;  3AEF A;  3UOV A;  2CDU A;  1DJN A;  1GET A;  4B65 A;  1DOE A;  3RED A;  4OVI A;  4A6N A;  4Z26 A;  4OPI A;  2WPE A;  1H81 A;  3FBS A;  5JCM A;  4BK2 A;  4OPT A;  3AWI A;  4H2R A;  3NT6 A;  1YY5 A;  3DJG X;  2C75 A;  1DNC A;  3FIM B;  2XLS A;  4B63 A;  2V61 A;  2GR2 A;  3COX A;  4U8J A;  1PJ6 A;  2Y6R A;  3CGC A;  1NPX A;  1N4W A;  3DK8 A;  2OLN A;  3CNS A;  3M12 A;  3PS9 A;  2A87 A;  1ZKQ A;  1ONF A;  1E1K A;  2JB3 A;  5FMH A;  2BAC A;  5EBK A;  4RSL A;  4CCR A;  4CNJ A;  4B66 A;  3GD3 A;  3R9U A;  2CFY A;  1BZL A;  4H4U A;  4C77 A;  2GR3 A;  1ZDL A;  2B9W A;  1XDI A;  3IF9 A;  2WS3 A;  3GYJ A;  1JOA A;  4JNQ A;  1PXA A;  2VVL G;  2H89 A;  3AE7 A;  1CHU A;  4YSZ A;  4EMJ A;  3AEA A;  2WOW A;  4J56 A;  3GDP A;  3NKS A;  4I58 A;  4CY8 A;  3K7M X;  4H4R A;  5J7X A;  2WBA A;  3BI4 A;  2XLT A;  1EBD A;  1OJ9 A;  4J31 A;  4Y4M A;  2ARD A;  4OPC A;  2BCP A;  3D8X A;  3UKA A;  3QSE A;  5DBJ A;  2R4E A;  2OAL A;  4U8I A;  4WX1 A;  1JNZ A;  2QCU A;  2WDQ A;  3URH A;  1H6V A;  2W0H A;  1K0L A;  3B6D A;  3AYJ A;  2C64 A;  2YLW A;  2PYX A;  3NYC A;  1EL8 A;  2JK6 A;  4H2Q A;  1Y56 A;  5CKU A;  1PJ7 A;  3VR9 A;  2ACZ A;  1O5W A;  4AP1 A;  1CJC A;  3UKF A;  5U1O A;  4JNA A;  2HQM A;  5HYM A;  2J3N A;  1FCD A;  2XFU A;  5EOW A;  3H4K A;  2XVH A;  1L0V A;  3UOZ A;  3SFD A;  1LQU A;  2VRL A;  1P2H A;  2BAB A;  2OLO A;  2BS4 A;  1F8S A;  1YKJ A;  4H4Z A;  4JQ9 A;  1OJD A;  3KA7 A;  2Q0L A;  2GV8 A;  1ZX9 A;  1GPE A;  4HB9 A;  1VQW A;  4TLZ A;  5GSN A;  3RNM A;  3T37 A;  1E1N A;  3II4 A;  1N4V A;  1QJD A;  3LJP A;  1GES A;  4J33 A;  2WP9 A;  1L9E A;  1W4X A;  3P1W A;  5CQF A;  2EQ6 A;  4BK1 A;  4IA5 A;  4CRT A;  2BC1 A;  5KRQ A;  2CVJ A;  2VRM A;  2VVL A;  3GYI A;  3P4Q A;  2FJB A;  4M52 A;  1CBO A;  1GTE A;  2XDO A;  4GUV A;  3NYE A;  3CIR A;  2YLT A;  4JY2 A;  3KPF A;  5GRT A;  4GDE A;  1TYP A;  2R0C A;  2YR5 A;  2FJE A;  4PAA A;  4LII A;  4U2T A;  3S61 A;  2DKI A;  3F8D A;  3AXB A;  1IUX A;  3GWD A;  1E39 A;  2XVI A;  4GDP A;  3CPH G;  3AEG A;  4K22 A;  3NN6 X;  1JRZ A;  1D7L A;  2BYB A;  3NK1 X;  1GRG A;  4P9S A;  5KVI A;  4APN A;  1XHC A;  3NK2 X;  1K4Q A;  4NEW A;  5U25 A;  1YQ3 A;  2WEU A;  4YKF A;  2YR6 A;  2NVK X;  3I3L A;  4C3Y A;  1PN0 A;  3AE8 A;  4Y4N A;  3AYL A;  3SGL A;  1F8R A;  2XFO A;  1DJQ A;  4Z25 A;  4TM1 A;  2GRT A;  5JCL A;  3S5W A;  5KOW A;  5IQ1 A;  5BVA A;  1PXB A;  1D7Y A;  4B69 A;  4C5O A;  1PBC A;  2Q7V A;  2C70 A;  3UTG A;  2VOU A;  3CNT A;  2YLZ A;  3C96 A;  1KNR A;  2WU5 A;  1PXC A;  3AD7 B;  3P9U A;  5JCK A;  5M0Z A;  3QVP A;  3SM8 A;  4YT0 A;  3UKK A;  2GAH B;  1VDC A;  1BGJ A;  4GF7 A;  2I0Z A;  3UTH A;  1S2Y A;  1CL0 A;  5C2T A;  4AP3 A;  3BNU A;  4H4X A;  2FBW A;  1AOG A;  2AQJ A;  1HYU A;  3UP5 A;  1BWC A;  1V59 A;  5HXI A;  4BJY A;  3SFE A;  3VRA A;  2YWL A;  4EM3 A;  3FMW A;  3G5Q A;  1YQ4 A;  2YM1 A;  2R45 A;  3QSM A;  3SQP A;  1GRB A;  1LQT A;  1CJ3 A;  2YLR A;  1K0I A;  1IJH A;  4E0V A;  1H7W A;  3CND A;  1OJT A;  4D04 A;  2BXR A;  2YVG A;  4J34 A;  4IV9 A;  5TR3 A;  4ADW A;  5JCN A;  4A9W A;  5IPY A;  3K7T A;  1E1M A;  3NK0 X;  4FX9 A;  3VR8 A;  1GRH A;  3GRT A;  3GWF A;  5ER0 A;  1TDO A;  4RG4 A;  4TM4 A;  4YTP A;  1RP0 A;  2JKC A;  3H8L A;  1ELI A;  5FS6 A;  3V3O A;  4C3X A;  3KKJ A;  2TMD A;  3P4P A;  2GAG B;  1GAL A;  1EL9 A;  4YTM A;  4WCT A;  2XLR A;  4ZCC A;  1PBF A;  2B9Y A;  2YG4 A;  1GRT A;  3FG2 P;  2V6O A;  4UDR A;  4XXG A;  1GER A;  3CPI G;  3CN8 A;  2BK3 A;  4GRT A;  2X8C A;  2R9Z A;  3AE6 A;  4Y4L A;  3AYI A;  1ZP0 A;  4DSG A;  4EQS A;  3NTD A;  3B3R A;  3D1C A;  2C66 A;  1ZMD A;  2QAE A;  4C74 A;  3LZX A;  4EIQ A;  3V76 A;  4J36 A;  5FS9 A;  4Z2U A;  1GT8 A;  4GCM A;  2QA1 A;  4BV6 A;  1BKW A;  4X9N A;  3CPJ G;  3E1T A;  1D4E A;  3UKP A;  2ZBW A;  4O5Q A;  3RP8 A;  5LV9 A;  2VQ7 A;  1BGN A;  3GMB A;  2XVJ A;  4CBQ A;  5BUK A;  4Z43 A;  2B76 A;  1MXT A;  3GMC A;  2WHD A;  3CGB A;  1DXL A;  1FEC A;  1B4V A;  3UTF A;  4B68 A;  4ECH A;  2QA2 A;  4EM4 A;  2IVE A;  1KSU A;  2WP6 A;  2YR4 A;  1GRF A;  3NRN A;  1NHQ A;  4OPG A;  2XCG A;  2GF3 A;  2C3C A;  3BNM A;  4Z24 A;  3K7Q X;  4FDC B;  5C3J A;  4H2P A;  1H82 A;  2IID A;  3PO7 A;  2X8H A;  3CTY A;  4ICY A;  2C76 A;  4EQX A;  1NHP A;  4KPR A;  3FPZ A;  3UKL A;  3ALJ A;  1Z6L A;  1Q1R A;  3VRB A;  2E5V A;  2X3N A;  2XFN A;  1KFY A;  3M0O A;  1YQZ A;  3BHF A;  1DOB A;  1H84 A;  1L9D A;  1GRE A;  2WES A;  5L46 A;  1P2E A;  3AE4 A;  3IHM A;  4YSH A;  1LV0 A;  1TRB A;  2ZZC A;  3UP4 A;  3JSK A;  1XPQ A;  4MJW A;  3OC4 A;  2PHH A;  1MO9 A;  3WE0 A;  4EMI A;  2YLS A;  3GDN A;  2A8X A;  3Q9T A;  4A7A A;  1F3P A;  2E4G A;  2BS3 A;  2B7S A;  3G5S A;  1CJ4 A;  4U2S A;  2R0G A;  2CUL A;  1CF3 A;  5BUL A;  2GH5 A;  1TDE A;  3AD9 B;  4U8N A;  5KXJ A;  1F6M A;  2H88 A;  1KF6 A;  2B9X A;  2XYO A;  4U8L A;  2AR8 A;  4TM3 A;  2FJA A;  1QLB A;  4OCG A;  1GSN A;  1PHH A;  1GOS A;  3AED A;  2GR1 A;  3AEE A;  1TYT A;  3EAO A;  1S3E A;  4USQ A;  2FJD A;  3LB8 A;  2RGO A;  1ZMC A;  4REK A;  3ATR A;  3NG7 X;  2WP5 A;  3EPT A;  2GVC A;  1COY A;  1JRY A;  4JN9 A;  1FOH A;  3GSI A;  2Y6Q A;  3DGH A;  4IVO B;  2V3B A;  1IUW A;  2C3D A;  3ALL A;  2YVF A;  3NTA A;  3UTE A;  2RGH A;  2YAU A;  3K30 A;  1LJ1 A;  4H4Q A;  2GMJ A;  2JB1 A;  1H86 A;  3UKH A;  1OJC A;  4DGK A;  1JRX A;  3KD9 A;  4BJZ A;  4B64 A;  3IHG A;  2YVJ A;  2BK4 A;  4A5L A;  4ZN0 A;  3DME A;  2YG3 A;  1BF3 A;  2Z5X A;  3AE3 A;  1M6I A;  4U2L A;  4BUR A;  4AT2 A;  1X31 B;  5M10 A;  3I6D A;  3CNJ A;  4H4T A;  4U8O A;  2X50 A;  2GEW A;  1ZOV A;  4H4W A;  4O5U A;  1KNP A;  4CNK A;  4A79 A;  3DGZ A;  3AB1 A;  5FS8 A;  3LAD A;  2NPX A;  2ZZ0 A;  2XLU A;  2RGJ A;  2O9Z A;  3ZYX A;  3L1R A;  1B5Q A;  3ATQ A;  1NHR A;  1E6E A;  1CC6 A;  1B37 A;  2C65 A;  2X8G A;  3AE1 A;  3NHO X;  3PVC A;  4BK3 A;  5IQ4 A;  5U63 A;  3P4R A;  1IUS A;  1FEA A;  1IUT A;  1ZOY A;  2XFQ A;  3RP6 A;  1NG4 A;  3ZDN A;  1VG0 A;  1D5T A;  2APG A;  5EB5 A;  2ZZB A;  1PBB A;  4EQR A;  2EQ9 A;  4YXD A;  2BS2 A;  1REO A;  3AD8 B;  1EL5 A;  1PBE A;  3QFB A;  4J57 A;  2BK5 A;  1L9C A;  2R46 A;  4UP3 A;  4H4V A;  3DJE A;  1ZK7 A;  3QVR A;  4B1B A;  4YWO A;  2WDV A;  4NEV A;  4B67 A;  3RHA A;  3AE2 A;  2EQ8 A;  2YQU A;  4U8K A;  2VVM A;  4USR A;  4XWR A;  1F8W A;  3DJJ A;  3NYF A;  3OZ2 A;  1Y0P A;  3V3N A;  1FEB A;  1PDH A;  2YG6 A;  2BCG G;  4HA6 A;  4YSY A;  3ISH A;  1LPF A;  1RSG A;  1UKV G;  4AT0 A;  1Q1W A;  2R4J A;  1S2Q A;  1DOD A;  1RYI A;  2C73 A;  4GR1 A;  2GQF A;  5JCI A;  1GTH A;  3GD4 A;  1Q9I A;  1M64 A;  3NLC A;  4AOS A;  1DOC A;  1N4U A;  2R0P A;  1LTX R;  3NGC X;  4CCQ A;  2EQ7 A;  4K8D A;  2V5Z A;  4J2W A;  1TDN A;  1O95 A;  4Z2T A;  4TM0 A;  4OPL A;  4A6N B;  5HHF A;  3UOX A;  3ADA B;  3EF6 A;  1E1L A;  1TDK A;  1CC4 A;  2YG5 A;  1KSS A;  4OPU A;  2B7R A;  1JU2 A;  1GEU A;  1NHS A;  2GMH A;  4IVM B;  4YTN A;  3UOY A;  1PS9 A;  2AAQ A;  3ABV A;  2F5Z A;  3P4S A;  4UDQ A;  3EAN A;  3L8K A;  3F8R A;  2C7G A;  4X9M A;  4EQW A;  1D4D A;  1NAA A;  2V60 A;  4YSX A;  3ICT A;  4XWZ A;  1GRA A;  2UZZ A;  4TLX A; 
#chains in the Genus database with same CATH topology
 4K5S A;  2WU2 A;  1O94 A;  3C4N A;  3VQR A;  3VRD B;  5KVH A;  2Z5Y A;  3NNE A;  2YM2 A;  3DK9 A;  3DH9 A;  4Z2R A;  1PJ5 A;  3KVE A;  1CC2 A;  2XVE A;  3GRS A;  4Z44 A;  3BI5 A;  4H4S A;  4YKG A;  3QFA A;  4JY3 A;  5KOX A;  5KMQ A;  2VQB A;  3G5R A;  1IUV A;  4FK1 C;  3NN0 X;  4JDR A;  2WOV A;  3NIX A;  4A99 A;  5J60 A;  2C67 A;  2DKH A;  3CNP A;  2A89 A;  4I59 A;  1XAN A;  4G74 A;  3SXI A;  3H8I A;  4LU6 A;  2YG7 A;  3QJ4 A;  4H7U A;  3CGE A;  3LZW A;  4NTE A;  3SZF A;  5HY5 A;  1NEN A;  1TDF A;  2GB0 A;  3ICR A;  3F8P A;  3ITJ A;  2WPC A;  4KX6 A;  1EL7 A;  4EIP A;  3KLJ A;  2Q6U A;  4H4P A;  4X4J A;  2JAE A;  3QSS A;  2TPR A;  1K0J A;  1N1P A;  1VG9 A;  3AEC A;  1CJ2 A;  4NZH A;  2XLP A;  4LA1 A;  1Y56 B;  4U8M A;  2YLX A;  1B8S A;  2IVD A;  3LXD A;  2JBV A;  3BI2 A;  4D03 A;  4N9X A;  2OAM A;  4ZCD A;  1GND A;  1IUU A;  1FL2 A;  2JB2 A;  2XVF A;  3UCL A;  1JNR A;  2V3A A;  2BXS A;  2GQW A;  2WOI A;  2VZ2 A;  1ZY8 A;  3BHK A;  3DA1 A;  2X99 A;  1NDA A;  2RAB A;  4IA6 A;  3M13 A;  4K7Z A;  1PBD A;  2GR0 A;  3HZL A;  3IWA A;  1SEZ A;  4U8P A;  4A65 A;  4EMW A;  1MOK A;  1QO8 A;  3AE5 A;  2WDR A;  4H4Y A;  4RG3 A;  1NEK A;  3HYV A;  3SYI A;  5KMR A;  2OA1 A;  1KDG A;  3ICS A;  4FK1 A;  5BRT A;  1H7X A;  4CY6 A;  1NG3 A;  3DJD A;  1S3B A;  3KPK A;  3NH3 X;  4K5R A;  2E1M A;  2WPF A;  3LOV A;  3Q6J A;  4AOX A;  2BC0 A;  1E7P A;  2BA9 A;  3AE9 A;  3AEB A;  2Q0K A;  3UKQ A;  3RP7 A;  2XFP A;  5KWF A;  4PAB A;  1D4C A;  3C4A A;  3SZ0 A;  4H2N A;  4UDP A;  1GV4 A;  2WET A;  4H50 A;  1LVL A;  4DSH A;  2C72 A;  3IC9 A;  4DNA A;  3O0H A;  3KU9 A;  5EB4 A;  1JEH A;  5FS7 A;  4NTD A;  1H83 A;  3ALM A;  4K2X A;  2WQY A;  1VRQ B;  1GXF A;  4NTC A;  1OJA A;  3DK4 A;  4OPD A;  3CGD A;  3AEF A;  3UOV A;  2CDU A;  1DJN A;  1GET A;  4B65 A;  1DOE A;  3RED A;  4OVI A;  4A6N A;  4Z26 A;  4OPI A;  2WPE A;  1H81 A;  3FBS A;  5JCM A;  4BK2 A;  4OPT A;  3AWI A;  4H2R A;  3NT6 A;  1YY5 A;  3T2K A;  3DJG X;  2C75 A;  1DNC A;  3FIM B;  2XLS A;  4B63 A;  2V61 A;  2GR2 A;  3COX A;  4U8J A;  1PJ6 A;  2Y6R A;  3CGC A;  1NPX A;  1N4W A;  3DK8 A;  2OLN A;  3CNS A;  3M12 A;  3PS9 A;  2A87 A;  1ZKQ A;  1ONF A;  1E1K A;  2JB3 A;  5FMH A;  2BAC A;  5EBK A;  4RSL A;  4CCR A;  4CNJ A;  4B66 A;  3GD3 A;  3R9U A;  2CFY A;  1BZL A;  4II2 A;  4H4U A;  4C77 A;  2GR3 A;  1ZDL A;  2B9W A;  1XDI A;  3IF9 A;  2WS3 A;  3GYJ A;  1JOA A;  4JNQ A;  3T31 A;  1PXA A;  2VVL G;  2H89 A;  3AE7 A;  1CHU A;  2BRA A;  4YSZ A;  4EMJ A;  3AEA A;  2WOW A;  4J56 A;  3GDP A;  3NKS A;  4I58 A;  4CY8 A;  3K7M X;  4H4R A;  5J7X A;  2WBA A;  3BI4 A;  2XLT A;  1EBD A;  1OJ9 A;  4J31 A;  4Y4M A;  2ARD A;  4OPC A;  2BCP A;  3D8X A;  3UKA A;  3QSE A;  5DBJ A;  2R4E A;  2OAL A;  4U8I A;  4WX1 A;  1JNZ A;  2QCU A;  2WDQ A;  3URH A;  1H6V A;  2W0H A;  1K0L A;  3B6D A;  3AYJ A;  2C64 A;  2YLW A;  2PYX A;  3NYC A;  1EL8 A;  2JK6 A;  4H2Q A;  1Y56 A;  5CKU A;  1PJ7 A;  3VR9 A;  2ACZ A;  1O5W A;  4AP1 A;  1CJC A;  3UKF A;  5U1O A;  4JNA A;  2HQM A;  5HYM A;  2J3N A;  1FCD A;  4G6G A;  2XFU A;  5EOW A;  3H4K A;  2XVH A;  3HYX A;  1L0V A;  3UOZ A;  3SFD A;  1LQU A;  2VRL A;  1P2H A;  2BAB A;  2OLO A;  2BS4 A;  1F8S A;  1YKJ A;  4H4Z A;  4JQ9 A;  1OJD A;  3KA7 A;  2Q0L A;  2GV8 A;  1ZX9 A;  1GPE A;  4HB9 A;  1VQW A;  4TLZ A;  5GSN A;  3RNM A;  3T37 A;  1E1N A;  3II4 A;  1N4V A;  1QJD A;  3LJP A;  1GES A;  4J33 A;  2WP9 A;  1L9E A;  1W4X A;  3P1W A;  5CQF A;  2EQ6 A;  4BK1 A;  4GAV A;  2C4C A;  4IA5 A;  2BC1 A;  4CRT A;  5KRQ A;  5KNL A;  2CVJ A;  2VRM A;  2VVL A;  3GYI A;  3P4Q A;  2FJB A;  4M52 A;  1CBO A;  1GTE A;  2XDO A;  4GUV A;  3NYE A;  3CIR A;  2YLT A;  4JY2 A;  3KPF A;  5GRT A;  4GDE A;  1TYP A;  2R0C A;  2YR5 A;  2FJE A;  4PAA A;  4LII A;  4U2T A;  3S61 A;  2DKI A;  3F8D A;  3AXB A;  1IUX A;  3GWD A;  1E39 A;  2XVI A;  4GDP A;  3CPH G;  3AEG A;  4K22 A;  3NN6 X;  1JRZ A;  1D7L A;  2BYB A;  3NK1 X;  1GRG A;  4P9S A;  5KVI A;  4APN A;  1XHC A;  3NK2 X;  1K4Q A;  4NEW A;  5U25 A;  1YQ3 A;  2WEU A;  4YKF A;  2YR6 A;  2NVK X;  3I3L A;  4C3Y A;  1PN0 A;  3AE8 A;  4Y4N A;  3AYL A;  3SGL A;  1F8R A;  2XFO A;  1DJQ A;  4Z25 A;  4TM1 A;  2GRT A;  5JCL A;  3S5W A;  5KOW A;  5IQ1 A;  5BVA A;  1PXB A;  1D7Y A;  3SX6 A;  4B69 A;  4C5O A;  1PBC A;  2Q7V A;  2C70 A;  3UTG A;  2VOU A;  3CNT A;  2YLZ A;  3C96 A;  1KNR A;  2WU5 A;  1PXC A;  3AD7 B;  3P9U A;  3T2Z A;  5JCK A;  5M0Z A;  3QVP A;  3SM8 A;  4YT0 A;  3UKK A;  2GAH B;  1VDC A;  1BGJ A;  4GF7 A;  2I0Z A;  3UTH A;  1S2Y A;  1CL0 A;  5C2T A;  4AP3 A;  3BNU A;  4H4X A;  2FBW A;  1AOG A;  2AQJ A;  1HYU A;  3UP5 A;  1BWC A;  1V59 A;  5HXI A;  4BJY A;  3SFE A;  3VRA A;  2YWL A;  4EM3 A;  3FMW A;  3G5Q A;  1YQ4 A;  2YM1 A;  2R45 A;  3QSM A;  3SQP A;  1GRB A;  1LQT A;  1CJ3 A;  2YLR A;  1K0I A;  1IJH A;  4E0V A;  1H7W A;  3CND A;  1OJT A;  4D04 A;  2BXR A;  2YVG A;  4J34 A;  4IV9 A;  5TR3 A;  4ADW A;  5JCN A;  4A9W A;  5IPY A;  3K7T A;  1E1M A;  3NK0 X;  4FX9 A;  3VR8 A;  1GRH A;  3GRT A;  3GWF A;  5ER0 A;  1TDO A;  4RG4 A;  4TM4 A;  4YTP A;  1RP0 A;  2JKC A;  3H8L A;  1ELI A;  4G6H A;  5FS6 A;  3V3O A;  4C3X A;  3KKJ A;  2TMD A;  3T14 A;  3P4P A;  2GAG B;  1GAL A;  1EL9 A;  4YTM A;  4WCT A;  2XLR A;  4ZCC A;  1PBF A;  2B9Y A;  2YG4 A;  1GRT A;  3FG2 P;  2V6O A;  4UDR A;  4GAP A;  4XXG A;  1GER A;  3CPI G;  3CN8 A;  2BK3 A;  4GRT A;  2X8C A;  4NWZ A;  2R9Z A;  3AE6 A;  4Y4L A;  3SZW A;  3AYI A;  1ZP0 A;  4DSG A;  4EQS A;  3NTD A;  3SY4 A;  3B3R A;  3D1C A;  2C66 A;  1ZMD A;  2QAE A;  4C74 A;  3LZX A;  4EIQ A;  3V76 A;  4J36 A;  5FS9 A;  4Z2U A;  1GT8 A;  4GCM A;  2QA1 A;  4BV6 A;  1BKW A;  4X9N A;  3CPJ G;  3E1T A;  1D4E A;  3UKP A;  2ZBW A;  4G73 A;  4O5Q A;  3RP8 A;  5LV9 A;  2VQ7 A;  1BGN A;  3GMB A;  2XVJ A;  4CBQ A;  5BUK A;  4Z43 A;  2B76 A;  1MXT A;  3GMC A;  2WHD A;  3CGB A;  1DXL A;  1FEC A;  1B4V A;  3UTF A;  4B68 A;  4ECH A;  2QA2 A;  4EM4 A;  2IVE A;  1KSU A;  2WP6 A;  2YR4 A;  1GRF A;  3NRN A;  1NHQ A;  4OPG A;  2XCG A;  2GF3 A;  2C3C A;  3BNM A;  4Z24 A;  3K7Q X;  4FDC B;  5C3J A;  4H2P A;  1H82 A;  2IID A;  3PO7 A;  2X8H A;  5KMP A;  3CTY A;  4ICY A;  2C76 A;  4EQX A;  1NHP A;  4KPR A;  3FPZ A;  3UKL A;  3ALJ A;  1Z6L A;  1Q1R A;  3VRB A;  2E5V A;  2X3N A;  2XFN A;  1KFY A;  3M0O A;  1YQZ A;  3BHF A;  1DOB A;  1H84 A;  3GYX A;  1L9D A;  1GRE A;  2WES A;  5L46 A;  1P2E A;  3AE4 A;  3IHM A;  4YSH A;  1LV0 A;  1TRB A;  2ZZC A;  3UP4 A;  3JSK A;  1XPQ A;  4MJW A;  3OC4 A;  2PHH A;  1MO9 A;  3WE0 A;  4EMI A;  2YLS A;  3GDN A;  2A8X A;  3Q9T A;  4A7A A;  1F3P A;  2E4G A;  2BS3 A;  2B7S A;  3G5S A;  1CJ4 A;  4U2S A;  2R0G A;  2CUL A;  1CF3 A;  5BUL A;  2GH5 A;  1TDE A;  3AD9 B;  4U8N A;  5KXJ A;  1F6M A;  2H88 A;  1KF6 A;  2B9X A;  2XYO A;  4U8L A;  2AR8 A;  4TM3 A;  2FJA A;  1QLB A;  4OCG A;  1GSN A;  1PHH A;  1GOS A;  3AED A;  3SZC A;  2GR1 A;  3AEE A;  4NNJ A;  1TYT A;  3EAO A;  1S3E A;  4USQ A;  2FJD A;  3LB8 A;  2RGO A;  1ZMC A;  4REK A;  3ATR A;  3NG7 X;  2WP5 A;  4G9K A;  3EPT A;  2GVC A;  1COY A;  1JRY A;  4JN9 A;  1FOH A;  3GSI A;  2Y6Q A;  3DGH A;  4IVO B;  2V3B A;  1IUW A;  2C3D A;  3ALL A;  2YVF A;  3NTA A;  3UTE A;  2RGH A;  2BRY A;  2YAU A;  3K30 A;  1LJ1 A;  4H4Q A;  2GMJ A;  2JB1 A;  1H86 A;  3UKH A;  1OJC A;  4DGK A;  1JRX A;  3KD9 A;  4BJZ A;  4B64 A;  3IHG A;  2YVJ A;  2BK4 A;  4A5L A;  4ZN0 A;  3DME A;  2YG3 A;  1BF3 A;  2Z5X A;  3AE3 A;  1M6I A;  4U2L A;  4BUR A;  4AT2 A;  1X31 B;  5KMS A;  5M10 A;  3I6D A;  3CNJ A;  4H4T A;  4U8O A;  3HYW A;  2X50 A;  2GEW A;  1ZOV A;  4H4W A;  4O5U A;  1KNP A;  4CNK A;  4A79 A;  3DGZ A;  3AB1 A;  5FS8 A;  3LAD A;  2NPX A;  2ZZ0 A;  2XLU A;  2RGJ A;  2O9Z A;  3T0K A;  3ZYX A;  3L1R A;  1B5Q A;  3ATQ A;  1NHR A;  1E6E A;  1CC6 A;  1B37 A;  2C65 A;  2X8G A;  3AE1 A;  3NHO X;  3PVC A;  4BK3 A;  5IQ4 A;  5U63 A;  3P4R A;  1IUS A;  1FEA A;  1IUT A;  1ZOY A;  2XFQ A;  3RP6 A;  1NG4 A;  3ZDN A;  1VG0 A;  1D5T A;  2APG A;  5EB5 A;  2ZZB A;  1PBB A;  4EQR A;  3T2Y A;  2EQ9 A;  4YXD A;  2BS2 A;  1REO A;  3AD8 B;  1EL5 A;  1PBE A;  3QFB A;  4J57 A;  2BK5 A;  1L9C A;  2R46 A;  4UP3 A;  3CMM A;  4H4V A;  3DJE A;  1ZK7 A;  3QVR A;  4B1B A;  4YWO A;  2WDV A;  4NEV A;  4B67 A;  3RHA A;  3AE2 A;  2EQ8 A;  2YQU A;  4U8K A;  2VVM A;  4USR A;  4XWR A;  1F8W A;  3DJJ A;  3NYF A;  3OZ2 A;  1Y0P A;  3V3N A;  1FEB A;  1PDH A;  2YG6 A;  2BCG G;  4HA6 A;  4YSY A;  3ISH A;  1LPF A;  1RSG A;  1UKV G;  4AT0 A;  1Q1W A;  2R4J A;  1S2Q A;  1DOD A;  1RYI A;  2C73 A;  4GR1 A;  2GQF A;  5JCI A;  1GTH A;  3GD4 A;  1Q9I A;  1M64 A;  3NLC A;  4II3 A;  4AOS A;  1DOC A;  1N4U A;  2R0P A;  1LTX R;  3NGC X;  4CCQ A;  2EQ7 A;  4K8D A;  2V5Z A;  4J2W A;  1TDN A;  1O95 A;  4Z2T A;  4TM0 A;  4OPL A;  4A6N B;  5HHF A;  3UOX A;  3ADA B;  3EF6 A;  1E1L A;  1TDK A;  1CC4 A;  2YG5 A;  1KSS A;  4OPU A;  2B7R A;  1JU2 A;  1GEU A;  1NHS A;  2GMH A;  4IVM B;  4YTN A;  3UOY A;  1PS9 A;  2AAQ A;  3ABV A;  2F5Z A;  3P4S A;  4UDQ A;  3EAN A;  3L8K A;  3F8R A;  2C7G A;  4X9M A;  4EQW A;  1D4D A;  1NAA A;  2V60 A;  4YSX A;  3ICT A;  4XWZ A;  1GRA A;  2UZZ A;  4TLX A; 
#chains in the Genus database with same CATH homology
 4K5S A;  2WU2 A;  1O94 A;  3C4N A;  3VQR A;  3VRD B;  5KVH A;  2Z5Y A;  3NNE A;  2YM2 A;  3DK9 A;  3DH9 A;  4Z2R A;  1PJ5 A;  3KVE A;  1CC2 A;  2XVE A;  3GRS A;  4Z44 A;  3BI5 A;  4H4S A;  4YKG A;  3QFA A;  4JY3 A;  5KOX A;  5KMQ A;  2VQB A;  3G5R A;  1IUV A;  4FK1 C;  3NN0 X;  4JDR A;  2WOV A;  3NIX A;  4A99 A;  5J60 A;  2C67 A;  2DKH A;  3CNP A;  2A89 A;  4I59 A;  1XAN A;  4G74 A;  3SXI A;  3H8I A;  4LU6 A;  2YG7 A;  3QJ4 A;  4H7U A;  3CGE A;  3LZW A;  4NTE A;  3SZF A;  5HY5 A;  1NEN A;  1TDF A;  2GB0 A;  3ICR A;  3F8P A;  3ITJ A;  2WPC A;  4KX6 A;  1EL7 A;  4EIP A;  3KLJ A;  2Q6U A;  4H4P A;  4X4J A;  2JAE A;  3QSS A;  2TPR A;  1K0J A;  1N1P A;  1VG9 A;  3AEC A;  1CJ2 A;  4NZH A;  2XLP A;  4LA1 A;  1Y56 B;  4U8M A;  2YLX A;  1B8S A;  2IVD A;  3LXD A;  2JBV A;  3BI2 A;  4D03 A;  4N9X A;  2OAM A;  4ZCD A;  1GND A;  1IUU A;  1FL2 A;  2JB2 A;  2XVF A;  3UCL A;  1JNR A;  2V3A A;  2BXS A;  2GQW A;  2WOI A;  2VZ2 A;  1ZY8 A;  3BHK A;  3DA1 A;  2X99 A;  1NDA A;  2RAB A;  4IA6 A;  3M13 A;  4K7Z A;  1PBD A;  2GR0 A;  3HZL A;  3IWA A;  1SEZ A;  4U8P A;  4A65 A;  4EMW A;  1MOK A;  1QO8 A;  3AE5 A;  2WDR A;  4H4Y A;  4RG3 A;  1NEK A;  3HYV A;  3SYI A;  5KMR A;  2OA1 A;  1KDG A;  3ICS A;  4FK1 A;  5BRT A;  1H7X A;  4CY6 A;  1NG3 A;  3DJD A;  1S3B A;  3KPK A;  3NH3 X;  4K5R A;  2E1M A;  2WPF A;  3LOV A;  3Q6J A;  4AOX A;  2BC0 A;  1E7P A;  2BA9 A;  3AE9 A;  3AEB A;  2Q0K A;  3UKQ A;  3RP7 A;  2XFP A;  5KWF A;  4PAB A;  1D4C A;  3C4A A;  3SZ0 A;  4H2N A;  4UDP A;  1GV4 A;  2WET A;  4H50 A;  1LVL A;  4DSH A;  2C72 A;  3IC9 A;  4DNA A;  3O0H A;  3KU9 A;  5EB4 A;  1JEH A;  5FS7 A;  4NTD A;  1H83 A;  3ALM A;  4K2X A;  2WQY A;  1VRQ B;  1GXF A;  4NTC A;  1OJA A;  3DK4 A;  4OPD A;  3CGD A;  3AEF A;  3UOV A;  2CDU A;  1DJN A;  1GET A;  4B65 A;  1DOE A;  3RED A;  4OVI A;  4A6N A;  4Z26 A;  4OPI A;  2WPE A;  1H81 A;  3FBS A;  5JCM A;  4BK2 A;  4OPT A;  3AWI A;  4H2R A;  3NT6 A;  1YY5 A;  3T2K A;  3DJG X;  2C75 A;  1DNC A;  3FIM B;  2XLS A;  4B63 A;  2V61 A;  2GR2 A;  3COX A;  4U8J A;  1PJ6 A;  2Y6R A;  3CGC A;  1NPX A;  1N4W A;  3DK8 A;  2OLN A;  3CNS A;  3M12 A;  3PS9 A;  2A87 A;  1ZKQ A;  1ONF A;  1E1K A;  2JB3 A;  5FMH A;  2BAC A;  5EBK A;  4RSL A;  4CCR A;  4CNJ A;  4B66 A;  3GD3 A;  3R9U A;  2CFY A;  1BZL A;  4II2 A;  4H4U A;  4C77 A;  2GR3 A;  1ZDL A;  2B9W A;  1XDI A;  3IF9 A;  2WS3 A;  3GYJ A;  1JOA A;  4JNQ A;  3T31 A;  1PXA A;  2VVL G;  2H89 A;  3AE7 A;  1CHU A;  2BRA A;  4YSZ A;  4EMJ A;  3AEA A;  2WOW A;  4J56 A;  3GDP A;  3NKS A;  4I58 A;  4CY8 A;  3K7M X;  4H4R A;  5J7X A;  2WBA A;  3BI4 A;  2XLT A;  1EBD A;  1OJ9 A;  4J31 A;  4Y4M A;  2ARD A;  4OPC A;  2BCP A;  3D8X A;  3UKA A;  3QSE A;  5DBJ A;  2R4E A;  2OAL A;  4U8I A;  4WX1 A;  1JNZ A;  2QCU A;  2WDQ A;  3URH A;  1H6V A;  2W0H A;  1K0L A;  3B6D A;  3AYJ A;  2C64 A;  2YLW A;  2PYX A;  3NYC A;  1EL8 A;  2JK6 A;  4H2Q A;  1Y56 A;  5CKU A;  1PJ7 A;  3VR9 A;  2ACZ A;  1O5W A;  4AP1 A;  1CJC A;  3UKF A;  5U1O A;  4JNA A;  2HQM A;  5HYM A;  2J3N A;  1FCD A;  4G6G A;  2XFU A;  5EOW A;  3H4K A;  2XVH A;  3HYX A;  1L0V A;  3UOZ A;  3SFD A;  1LQU A;  2VRL A;  1P2H A;  2BAB A;  2OLO A;  2BS4 A;  1F8S A;  1YKJ A;  4H4Z A;  4JQ9 A;  1OJD A;  3KA7 A;  2Q0L A;  2GV8 A;  1ZX9 A;  1GPE A;  4HB9 A;  1VQW A;  4TLZ A;  5GSN A;  3RNM A;  3T37 A;  1E1N A;  3II4 A;  1N4V A;  1QJD A;  3LJP A;  1GES A;  4J33 A;  2WP9 A;  1L9E A;  1W4X A;  3P1W A;  5CQF A;  2EQ6 A;  4BK1 A;  4GAV A;  2C4C A;  4IA5 A;  2BC1 A;  4CRT A;  5KRQ A;  5KNL A;  2CVJ A;  2VRM A;  2VVL A;  3GYI A;  3P4Q A;  2FJB A;  4M52 A;  1CBO A;  1GTE A;  2XDO A;  4GUV A;  3NYE A;  3CIR A;  2YLT A;  4JY2 A;  3KPF A;  5GRT A;  4GDE A;  1TYP A;  2R0C A;  2YR5 A;  2FJE A;  4PAA A;  4LII A;  4U2T A;  3S61 A;  2DKI A;  3F8D A;  3AXB A;  1IUX A;  3GWD A;  1E39 A;  2XVI A;  4GDP A;  3CPH G;  3AEG A;  4K22 A;  3NN6 X;  1JRZ A;  1D7L A;  2BYB A;  3NK1 X;  1GRG A;  4P9S A;  5KVI A;  4APN A;  1XHC A;  3NK2 X;  1K4Q A;  4NEW A;  5U25 A;  1YQ3 A;  2WEU A;  4YKF A;  2YR6 A;  2NVK X;  3I3L A;  4C3Y A;  1PN0 A;  3AE8 A;  4Y4N A;  3AYL A;  3SGL A;  1F8R A;  2XFO A;  1DJQ A;  4Z25 A;  4TM1 A;  2GRT A;  5JCL A;  3S5W A;  5KOW A;  5IQ1 A;  5BVA A;  1PXB A;  1D7Y A;  3SX6 A;  4B69 A;  4C5O A;  1PBC A;  2Q7V A;  2C70 A;  3UTG A;  2VOU A;  3CNT A;  2YLZ A;  3C96 A;  1KNR A;  2WU5 A;  1PXC A;  3AD7 B;  3P9U A;  3T2Z A;  5JCK A;  5M0Z A;  3QVP A;  3SM8 A;  4YT0 A;  3UKK A;  2GAH B;  1VDC A;  1BGJ A;  4GF7 A;  2I0Z A;  3UTH A;  1S2Y A;  1CL0 A;  5C2T A;  4AP3 A;  3BNU A;  4H4X A;  2FBW A;  1AOG A;  2AQJ A;  1HYU A;  3UP5 A;  1BWC A;  1V59 A;  5HXI A;  4BJY A;  3SFE A;  3VRA A;  2YWL A;  4EM3 A;  3FMW A;  3G5Q A;  1YQ4 A;  2YM1 A;  2R45 A;  3QSM A;  3SQP A;  1GRB A;  1LQT A;  1CJ3 A;  2YLR A;  1K0I A;  1IJH A;  4E0V A;  1H7W A;  3CND A;  1OJT A;  4D04 A;  2BXR A;  2YVG A;  4J34 A;  4IV9 A;  5TR3 A;  4ADW A;  5JCN A;  4A9W A;  5IPY A;  3K7T A;  1E1M A;  3NK0 X;  4FX9 A;  3VR8 A;  1GRH A;  3GRT A;  3GWF A;  5ER0 A;  1TDO A;  4RG4 A;  4TM4 A;  4YTP A;  1RP0 A;  2JKC A;  3H8L A;  1ELI A;  4G6H A;  5FS6 A;  3V3O A;  4C3X A;  3KKJ A;  2TMD A;  3T14 A;  3P4P A;  2GAG B;  1GAL A;  1EL9 A;  4YTM A;  4WCT A;  2XLR A;  4ZCC A;  1PBF A;  2B9Y A;  2YG4 A;  1GRT A;  3FG2 P;  2V6O A;  4UDR A;  4GAP A;  4XXG A;  1GER A;  3CPI G;  3CN8 A;  2BK3 A;  4GRT A;  2X8C A;  4NWZ A;  2R9Z A;  3AE6 A;  4Y4L A;  3SZW A;  3AYI A;  1ZP0 A;  4DSG A;  4EQS A;  3NTD A;  3SY4 A;  3B3R A;  3D1C A;  2C66 A;  1ZMD A;  2QAE A;  4C74 A;  3LZX A;  4EIQ A;  3V76 A;  4J36 A;  5FS9 A;  4Z2U A;  1GT8 A;  4GCM A;  2QA1 A;  4BV6 A;  1BKW A;  4X9N A;  3CPJ G;  3E1T A;  1D4E A;  3UKP A;  2ZBW A;  4G73 A;  4O5Q A;  3RP8 A;  5LV9 A;  2VQ7 A;  1BGN A;  3GMB A;  2XVJ A;  4CBQ A;  5BUK A;  4Z43 A;  2B76 A;  1MXT A;  3GMC A;  2WHD A;  3CGB A;  1DXL A;  1FEC A;  1B4V A;  3UTF A;  4B68 A;  4ECH A;  2QA2 A;  4EM4 A;  2IVE A;  1KSU A;  2WP6 A;  2YR4 A;  1GRF A;  3NRN A;  1NHQ A;  4OPG A;  2XCG A;  2GF3 A;  2C3C A;  3BNM A;  4Z24 A;  3K7Q X;  4FDC B;  5C3J A;  4H2P A;  1H82 A;  2IID A;  3PO7 A;  2X8H A;  5KMP A;  3CTY A;  4ICY A;  2C76 A;  4EQX A;  1NHP A;  4KPR A;  3FPZ A;  3UKL A;  3ALJ A;  1Z6L A;  1Q1R A;  3VRB A;  2E5V A;  2X3N A;  2XFN A;  1KFY A;  3M0O A;  1YQZ A;  3BHF A;  1DOB A;  1H84 A;  3GYX A;  1L9D A;  1GRE A;  2WES A;  5L46 A;  1P2E A;  3AE4 A;  3IHM A;  4YSH A;  1LV0 A;  1TRB A;  2ZZC A;  3UP4 A;  3JSK A;  1XPQ A;  4MJW A;  3OC4 A;  2PHH A;  1MO9 A;  3WE0 A;  4EMI A;  2YLS A;  3GDN A;  2A8X A;  3Q9T A;  4A7A A;  1F3P A;  2E4G A;  2BS3 A;  2B7S A;  3G5S A;  1CJ4 A;  4U2S A;  2R0G A;  2CUL A;  1CF3 A;  5BUL A;  2GH5 A;  1TDE A;  3AD9 B;  4U8N A;  5KXJ A;  1F6M A;  2H88 A;  1KF6 A;  2B9X A;  2XYO A;  4U8L A;  2AR8 A;  4TM3 A;  2FJA A;  1QLB A;  4OCG A;  1GSN A;  1PHH A;  1GOS A;  3AED A;  3SZC A;  2GR1 A;  3AEE A;  4NNJ A;  1TYT A;  3EAO A;  1S3E A;  4USQ A;  2FJD A;  3LB8 A;  2RGO A;  1ZMC A;  4REK A;  3ATR A;  3NG7 X;  2WP5 A;  4G9K A;  3EPT A;  2GVC A;  1COY A;  1JRY A;  4JN9 A;  1FOH A;  3GSI A;  2Y6Q A;  3DGH A;  4IVO B;  2V3B A;  1IUW A;  2C3D A;  3ALL A;  2YVF A;  3NTA A;  3UTE A;  2RGH A;  2BRY A;  2YAU A;  3K30 A;  1LJ1 A;  4H4Q A;  2GMJ A;  2JB1 A;  1H86 A;  3UKH A;  1OJC A;  4DGK A;  1JRX A;  3KD9 A;  4BJZ A;  4B64 A;  3IHG A;  2YVJ A;  2BK4 A;  4A5L A;  4ZN0 A;  3DME A;  2YG3 A;  1BF3 A;  2Z5X A;  3AE3 A;  1M6I A;  4U2L A;  4BUR A;  4AT2 A;  1X31 B;  5KMS A;  5M10 A;  3I6D A;  3CNJ A;  4H4T A;  4U8O A;  3HYW A;  2X50 A;  2GEW A;  1ZOV A;  4H4W A;  4O5U A;  1KNP A;  4CNK A;  4A79 A;  3DGZ A;  3AB1 A;  5FS8 A;  3LAD A;  2NPX A;  2ZZ0 A;  2XLU A;  2RGJ A;  2O9Z A;  3T0K A;  3ZYX A;  3L1R A;  1B5Q A;  3ATQ A;  1NHR A;  1E6E A;  1CC6 A;  1B37 A;  2C65 A;  2X8G A;  3AE1 A;  3NHO X;  3PVC A;  4BK3 A;  5IQ4 A;  5U63 A;  3P4R A;  1IUS A;  1FEA A;  1IUT A;  1ZOY A;  2XFQ A;  3RP6 A;  1NG4 A;  3ZDN A;  1VG0 A;  1D5T A;  2APG A;  5EB5 A;  2ZZB A;  1PBB A;  4EQR A;  3T2Y A;  2EQ9 A;  4YXD A;  2BS2 A;  1REO A;  3AD8 B;  1EL5 A;  1PBE A;  3QFB A;  4J57 A;  2BK5 A;  1L9C A;  2R46 A;  4UP3 A;  3CMM A;  4H4V A;  3DJE A;  1ZK7 A;  3QVR A;  4B1B A;  4YWO A;  2WDV A;  4NEV A;  4B67 A;  3RHA A;  3AE2 A;  2EQ8 A;  2YQU A;  4U8K A;  2VVM A;  4USR A;  4XWR A;  1F8W A;  3DJJ A;  3NYF A;  3OZ2 A;  1Y0P A;  3V3N A;  1FEB A;  1PDH A;  2YG6 A;  2BCG G;  4HA6 A;  4YSY A;  3ISH A;  1LPF A;  1RSG A;  1UKV G;  4AT0 A;  1Q1W A;  2R4J A;  1S2Q A;  1DOD A;  1RYI A;  2C73 A;  4GR1 A;  2GQF A;  5JCI A;  1GTH A;  3GD4 A;  1Q9I A;  1M64 A;  3NLC A;  4II3 A;  4AOS A;  1DOC A;  1N4U A;  2R0P A;  1LTX R;  3NGC X;  4CCQ A;  2EQ7 A;  4K8D A;  2V5Z A;  4J2W A;  1TDN A;  1O95 A;  4Z2T A;  4TM0 A;  4OPL A;  4A6N B;  5HHF A;  3UOX A;  3ADA B;  3EF6 A;  1E1L A;  1TDK A;  1CC4 A;  2YG5 A;  1KSS A;  4OPU A;  2B7R A;  1JU2 A;  1GEU A;  1NHS A;  2GMH A;  4IVM B;  4YTN A;  3UOY A;  1PS9 A;  2AAQ A;  3ABV A;  2F5Z A;  3P4S A;  4UDQ A;  3EAN A;  3L8K A;  3F8R A;  2C7G A;  4X9M A;  4EQW A;  1D4D A;  1NAA A;  2V60 A;  4YSX A;  3ICT A;  4XWZ A;  1GRA A;  2UZZ A;  4TLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...