2XLTA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with 3-acetylpyridine adenine dinucleotide phosphate (apadp)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA02
2YQUA 3D1CA 2APGA 1JNZA 1B4VA 4EMWA 1BF3A 2QAEA 4GRTA 2C70A 3UKPA 4H4YA 1E1MA 4NTEA 2C3DA 1GTEA 1D7YA 2R0PA 1P2EA 4H4VA 4X9MA 3V3OA 3DGHA 3T37A 3KKJA 1PDHA 2C75A 2GQFA 2WP5A 1FEBA 1GRBA 1PXCA 1ZP0A 1TDFA 3QJ4A 2TMDA 5GSNA 4BJZA 1LQUA 4AOXA 2X3NA 3IWAA 5IQ4A 2EQ6A 2UZZA 3P4RA 4I58A 4ZN0A 4K22A 3E1TA 4KX6A 3VR9A 3BNUA 3CPIG 4J31A 3ICRA 3GYJA 4Z2UA 3UOZA 3Q9TA 3CPJG 3ISHA 3BI2A 5FS6A 1GRGA 1IUWA 1PXAA 3DJDA 1GALA 1KNRA 2C64A 1IUUA 3NYFA 2ACZA 3AE5A 2F5ZA 2CDUA 2R4EA 1RP0A 2C72A 3RNMA 2J3NA 3UKAA 3AE3A 3AECA 2GMJA 2VVLA 2BA9A 1GSNA 4H50A 1DJNA 1Q1WA 5JCNA 3BI5A 1YQ4A 2YLWA 4A6NB 2QA2A 4J57A 2YM2A 1CF3A 1HYUA 2YLXA 2GEWA 1E1KA 1EL5A 1CC6A 3NYCA 4H4SA 1NPXA 4EQRA 4YXDA 1Y56A 4C77A 1VG9A 5TR3A 1IUXA 1JRZA 1NHQA 1Y0PA 3O0HA 1GNDA 4A79A 2R9ZA 3K7QX 2V3BA 3DK9A 3UP4A 4DSHA 1COYA 2BC0A 2YG6A 5C3JA 2XVEA 1PJ5A 3BHKA 3UCLA 2XLTA 1CJCA 4TLXA 2A8XA 5GRTA 2Y6QA 2V60A 2GV8A 4USQA 4J36A 4Z24A 4D04A 1PBCA 1JRXA 5JCMA 1NG3A 1LPFA 4OPUA 2V61A 1K0IA 3AD7B 1E7PA 5EB5A 4AOSA 1D4CA 1ZMDA 1ZY8A 2X8CA 1SEZA 4TM0A 4FK1C 1ZOVA 2HQMA 2WHDA 1GRFA 3ADAB 4H4QA 3VR8A 4U8MA 4ADWA 4OPDA 3KLJA 2WQYA 3AB1A 4CY8A 5BULA 4NTDA 3ICSA 5C2TA 3AYLA 4BK1A 3GDNA 2JB2A 2C66A 2VQ7A 4J56A 3UKQA 2YLRA 3UTEA 3CIRA 5FS9A 3AE9A 3RP7A 2VRMA 3EAOA 3AD9B 3BI4A 3ATQA 1XPQA 2AAQA 4LA1A 4U8JA 3LADA 4B1BA 4B64A 2B9XA 2A87A 1TDKA 1ZK7A 5FMHA 4H4RA 1YY5A 3G5SA 2YG7A 4JNQA 3F8PA 1F8SA 4OVIA 4YT0A 4OPCA 5U63A 3FIMB 3AYIA 4A99A 1Q9IA 4TM3A 3C96A 4EQXA 2Z5YA 3ATRA 2GVCA 4Y4NA 1LJ1A 1GV4A 3QSMA 2R0CA 5KRQA 2BK4A 2YWLA 5KVHA 2OLOA 1MXTA 2A89A 2XCGA 4H4WA 3IF9A 1TRBA 1S2YA 2YVJA 1F3PA 2YLZA 4H4TA 1BGJA 4OPTA 4FX9A 1ZMCA 3QVRA 1LTXR 1BZLA 3NN6X 4YSXA 3FPZA 3F8DA 2GRTA 1TDNA 1TYPA 3V3NA 2H88A 2E4GA 2C3CA 1OJ9A 1ONFA 4IV9A 5IPYA 3SM8A 3ITJA 1P2HA 5FS7A 5KOXA 3SFDA 4NEVA 3AE4A 1OJTA 4ZCDA 4LU6A 2BABA 2VOUA 2ZZCA 4RSLA 3H4KA 3NYEA 1NDAA 5HXIA 2DKIA 2X99A 1XDIA 1FOHA 3ZDNA 5L46A 1PBEA 2GAGB 2RGHA 3RHAA 3AEAA 1N4WA 4GDPA 1L9DA 1KSUA 5IQ1A 1KNPA 2Q0LA 2NPXA 2QA1A 3FMWA 4OPIA 3JSKA 3EANA 1PBFA 5LV9A 4PABA 4YKFA 1N4VA 3QSSA 3P4QA 3NT6A 4XXGA 1VG0A 4E0VA 4YSZA 1L9EA 2BCGG 4H7UA 1NHSA 3NLCA 1H6VA 1N1PA 3BHFA 2GH5A 4TM1A 4X4JA 2BC1A 2BCPA 2VVLG 4H2NA 1QLBA 4EQWA 1PXBA 2RGOA 2VZ2A 4Z2TA 3R9UA 1OJCA 2R0GA 2WEUA 4CCRA 4C3YA 2YR4A 2BS4A 2NVKX 3RP8A 1E1LA 1ZX9A 1GETA 1GEUA 4M52A 5BRTA 2JBVA 3QSEA 1JRYA 2BYBA 2XFOA 3L8KA 2XVIA 3UOVA 3P1WA 4K5RA 4DGKA 5EOWA 4WCTA 1EL8A 4IA5A 1FL2A 4TM4A 4AT0A 1ZDLA 1FCDA 3KPFA 1O95A 2GR2A 1S2QA 2WPFA 3PO7A 2O9ZA 4CRTA 1OJAA 3NK0X 1QO8A 1DOCA 3H8LA 1Z6LA 1LVLA 1PHHA 2WOIA 4I59A 2JKCA 1NAAA 4USRA 3EF6A 3NGCX 5U1OA 2W0HA 4XWRA 4Z26A 1TDEA 1VDCA 3REDA 4J33A 4J34A 1CHUA 1IUVA 1W4XA 1DXLA 2YLTA 4BJYA 2DKHA 1L9CA 1LQTA 4U2SA 1K4QA 3AWIA 5KVIA 2JB3A 4K8DA 4UP3A 2YG5A 2WDQA 3CPHG 1OJDA 3CNPA 1DOBA 1DNCA 3VRDB 4J2WA 3CGCA 3B6DA 4BV6A 2GB0A 2WPCA 1EBDA 3B3RA 4APNA 2YR6A 1YQ3A 3DH9A 3GWFA 2JB1A 2QCUA 2VRLA 3KU9A 3LJPA 4CNJA 1KF6A 4JDRA 5EB4A 4B67A 4GDEA 2XFNA 3KD9A 1CC4A 4U8IA 3ALJA 3DK8A 1JOAA 2B76A 1K0LA 1GXFA 4K5SA 1GT8A 3AEGA 4K7ZA 4OPGA 4GUVA 1PN0A 2EQ8A 1NHPA 2FJDA 3GDPA 3M0OA 4H4UA 3V76A 1N4UA 1CL0A 1GRHA 1FECA 2XFPA 3IC9A 4JY3A 4X9NA 2PYXA 4B65A 1KFYA 2WOVA 3LZWA 5M0ZA 2BK3A 4C5OA 2YVGA 1H84A 4H4PA 1CJ4A 3I3LA 4A5LA 1H81A 4AP3A 1EL7A 2R4JA 4U8NA 1IJHA 4A6NA 1NENA 3GMBA 4CCQA 2RGJA 3OZ2A 2XVFA 3IHGA 3ZYXA 4C3XA 1XANA 4B63A 1REOA 3UKLA 2B7SA 4Y4LA 2CULA 2B9WA 2B7RA 3II4A 4REKA 3SGLA 4Z25A 2WU5A 1CBOA 5KOWA 4YSYA 2ZBWA 2C76A 5J60A 3LZXA 2C73A 3IHMA 5JCLA 3AEEA 4U8PA 2FJEA 4ZCCA 3LB8A 3QFBA 3QFAA 5HYMA 2EQ9A 4Z43A 3WE0A 3UOYA 2R46A 3AXBA 4JN9A 2YG4A 4U2TA 3KVEA 2OLNA 2WOWA 4JNAA 3ALLA 3GWDA 4PAAA 1KDGA 1Q1RA 4XWZA 5KXJA 2V6OA 2CFYA 2YG3A 3NN0X 5J7XA 1ZKQA 4IA6A 5U25A 4EMIA 2C65A 2PHHA 2WS3A 3ALMA 4ICYA 2IIDA 3GMCA 1NG4A 3LOVA 1GREA 4DNAA 3GSIA 2EQ7A 2WBAA 3UOXA 4JY2A 3K7MX 3QVPA 3DJGX 1NHRA 1JNRA 3CN8A 1BGNA 2TPRA 1DOEA 4EIQA 2BS3A 3NK2X 3NHOX 2E1MA 4NTCA 4HA6A 2WETA 4KPRA 3D8XA 4O5QA 1Y56B 3EPTA 1AOGA 1D4DA 4P9SA 5ER0A 3AE6A 1E39A 2OALA 3NTDA 3SQPA 2I0ZA 4EM4A 2YAUA 4UDRA 1PBDA 1FEAA 4B69A 4BURA 2Q6UA 2GF3A 2WU2A 2WP6A 3COXA 4NZHA 3K30A 1O5WA 4AP1A 2ZZBA 1MOKA 4BK2A 3FBSA 1E1NA 1IUSA 2GR0A 3AE1A 4O5UA 4YSHA 3VQRA 2XLSA 2X8GA 3AEDA 1LV0A 5BVAA 2E5VA 2OAMA 3DMEA 2X50A 2XVJA 4NEWA 4GR1A 5M10A 5EBKA 1X31B 3VRBA 4BK3A 3NG7X 3F8RA 4C74A 2YVFA 5JCIA 3UKKA 1M6IA 2GAHB 3GYIA 1TDOA 3CGEA 4TLZA 1KSSA 3ICTA 2AQJA 3G5RA 1UKVG 1JEHA 2WDVA 4ECHA 4GCMA 2B9YA 2XLUA 1JU2A 2V5ZA 3GRTA 3LXDA 5CQFA 4B66A 4B68A 4EQSA 2IVEA 4H2RA 1TYTA 4YKGA 3P9UA 3KA7A 2BS2A 3RP6A 1D5TA 3DA1A 2ZZ0A 2WP9A 1ELIA 1H82A 3NIXA 1GRTA 1GOSA 2RABA 4FK1A 2Q0KA 3UKHA 2XLRA 1EL9A 3I6DA 3P4SA 4U8OA 1IUTA 2XVHA 3AEBA 1VQWA 2YR5A 3C4AA 3DJJA 4YTPA 4Z44A 2AR8A 1PS9A 4WX1A 3DJEA 4AT2A 2FBWA 3PS9A 5BUKA 5KWFA 1E6EA 3Q6JA 1DODA 3M13A 2CVJA 3UTFA 3AE7A 3ABVA 4MJWA 3UP5A 3VRAA 3CNTA 3CNDA 4OCGA 4CY6A 3CNJA 1CC2A 1RYIA 4UDPA 3GD4A 1MO9A 3AE8A 4GF7A 2C7GA 1RSGA 4RG4A 1B8SA 3OC4A 3URHA 1F8WA 2ARDA 3S5WA 1M64A 2GMHA 3CTYA 4UDQA 2WPEA 1CJ2A 2Y6RA 2Z5XA 2BACA 3H8IA 3K7TA 3NH3X 4RG3A 4H4XA 5FS8A 2YLSA 1NEKA 3AEFA 4OPLA 5DBJA 1QJDA 3AD8B 3FG2P 2VVMA 4H2QA 3NKSA 1O94A 1YQZA 2Q7VA 3P4PA 2X8HA 4DSGA 1H7XA 1DJQA 4IVMB 4YWOA 2GQWA 2OA1A 2WDRA 2XDOA 1F8RA 1ZOYA 3BNMA 4K2XA 2FJBA 4CNKA 1B5QA 3C4NA 2WESA 1CJ3A 3S61A 1V59A 1D7LA 3AYJA 1XHCA 4Z2RA 2GR1A 2BK5A 4LIIA 4A9WA 4YTMA 2VQBA 2XFUA 3M12A 2H89A 2FJAA 1H86A 2XFQA 3CGDA 3GD3A 4U2LA 2XYOA 5HHFA 1L0VA 5JCKA 2GR3A 4EMJA 1GRAA 1BWCA 2R45A 3G5QA 3L1RA 5HY5A 4CBQA 2IVDA 1GTHA 4D03A 4EM3A 1D4EA 1GPEA 2JK6A 4Y4MA 3DGZA 4FDCB 3DK4A 3AE2A 3HZLA 1S3EA 1F6MA 3NK1X 4H4ZA 2BXSA 4A65A 1H83A 3CNSA 1S3BA 3NRNA 2YM1A 4YTNA 3GRSA 5CKUA 4EIPA 2JAEA 3CGBA 1PJ6A 4H2PA 1K0JA 1YKJA 2C67A 4HB9A 4IVOB 1PJ7A 4JQ9A 4N9XA 4U8KA 4U8LA 3SFEA 1BKWA 3UKFA 3NTAA 2V3AA 3NNEA 3UTHA 1PBBA 3PVCA 1GERA 4A7AA 2XLPA 2BXRA 1GESA 3UTGA 1H7WA 1B37A 1VRQB
chains in the Genus database with same CATH superfamily
2YQUA 3D1CA 2APGA 1JNZA 1B4VA 4EMWA 1BF3A 2QAEA 4GRTA 2C70A 3UKPA 2BRYA 4H4YA 1E1MA 3HYVA 4NTEA 2C3DA 1GTEA 1D7YA 2R0PA 1P2EA 4H4VA 4X9MA 3V3OA 3DGHA 3T37A 3KKJA 1PDHA 2C75A 2GQFA 2WP5A 1FEBA 1GRBA 1PXCA 1ZP0A 1TDFA 3QJ4A 2TMDA 5GSNA 4BJZA 1LQUA 4AOXA 2X3NA 3IWAA 3GYXA 5IQ4A 2EQ6A 2UZZA 3P4RA 4I58A 4ZN0A 4K22A 5KMSA 3HYWA 3E1TA 4KX6A 3VR9A 3BNUA 3CPIG 4J31A 3ICRA 3GYJA 2C4CA 4Z2UA 3UOZA 3Q9TA 3CPJG 3ISHA 3BI2A 3SZCA 5FS6A 1GRGA 1IUWA 1PXAA 3DJDA 1GALA 1KNRA 2C64A 1IUUA 3NYFA 2ACZA 3AE5A 2F5ZA 2CDUA 2R4EA 1RP0A 2C72A 3RNMA 2J3NA 3UKAA 3AE3A 3AECA 2GMJA 2VVLA 3SZWA 2BA9A 1GSNA 4H50A 1DJNA 1Q1WA 5JCNA 3BI5A 1YQ4A 2YLWA 4A6NB 2QA2A 4J57A 2YM2A 1CF3A 1HYUA 2YLXA 2GEWA 1E1KA 1EL5A 1CC6A 3NYCA 4H4SA 1NPXA 4EQRA 4YXDA 1Y56A 4C77A 1VG9A 5TR3A 1IUXA 1JRZA 1NHQA 1Y0PA 3O0HA 1GNDA 4A79A 2R9ZA 3K7QX 2V3BA 3DK9A 3UP4A 4DSHA 1COYA 2BC0A 2YG6A 5C3JA 2XVEA 1PJ5A 3BHKA 3UCLA 2XLTA 1CJCA 4TLXA 2A8XA 5GRTA 3SY4A 2Y6QA 2V60A 2GV8A 4USQA 4J36A 4Z24A 4D04A 1PBCA 1JRXA 5JCMA 1NG3A 1LPFA 4OPUA 2V61A 1K0IA 3AD7B 1E7PA 5EB5A 4AOSA 3T0KA 1D4CA 1ZMDA 1ZY8A 4NWZA 2X8CA 1SEZA 4TM0A 4FK1C 1ZOVA 2HQMA 2WHDA 1GRFA 3ADAB 4H4QA 3VR8A 4U8MA 4ADWA 4OPDA 3KLJA 2WQYA 3AB1A 4CY8A 4EIPA 4NTDA 3ICSA 5BULA 3AYLA 4BK1A 5C2TA 3GDNA 2JB2A 2C66A 2VQ7A 4J56A 3UKQA 4GAPA 2YLRA 3UTEA 3CIRA 5FS9A 3AE9A 3RP7A 2VRMA 3EAOA 3AD9B 3BI4A 3ATQA 1XPQA 2AAQA 4LA1A 4U8JA 3LADA 4B1BA 4B64A 2B9XA 2A87A 1TDKA 1ZK7A 5FMHA 4H4RA 1YY5A 3G5SA 2YG7A 4JNQA 3F8PA 1F8SA 4OVIA 4YT0A 4OPCA 5U63A 3FIMB 3AYIA 4A99A 1Q9IA 4TM3A 3C96A 4EQXA 2Z5YA 3ATRA 2GVCA 4Y4NA 1LJ1A 1GV4A 3QSMA 2R0CA 5KRQA 2BK4A 2YWLA 5KVHA 2OLOA 1MXTA 2A89A 2XCGA 4H4WA 3IF9A 1TRBA 1S2YA 3SX6A 2YVJA 1F3PA 2YLZA 4H4TA 1BGJA 4II3A 4OPTA 4FX9A 1ZMCA 3QVRA 1LTXR 1BZLA 3NN6X 4YSXA 3FPZA 3F8DA 2GRTA 1TDNA 1TYPA 3V3NA 2H88A 2E4GA 2C3CA 1OJ9A 1ONFA 4IV9A 5IPYA 3SM8A 3ITJA 1P2HA 5FS7A 5KOXA 3SFDA 4NEVA 3AE4A 1OJTA 4ZCDA 4LU6A 2BABA 2VOUA 2ZZCA 4RSLA 3H4KA 3SYIA 3NYEA 1NDAA 5HXIA 2DKIA 2X99A 1XDIA 1FOHA 4G6HA 3ZDNA 5L46A 4G6GA 1PBEA 2GAGB 2RGHA 3RHAA 3AEAA 1N4WA 4GDPA 1L9DA 1KSUA 5IQ1A 1KNPA 2Q0LA 2NPXA 2QA1A 3FMWA 4OPIA 3JSKA 3EANA 1PBFA 5LV9A 4PABA 4YKFA 1N4VA 3QSSA 3P4QA 3NT6A 4XXGA 1VG0A 4E0VA 4YSZA 1L9EA 2BCGG 4H7UA 1NHSA 3NLCA 1H6VA 1N1PA 3BHFA 2GH5A 4TM1A 4X4JA 2BC1A 2BCPA 2VVLG 4H2NA 1QLBA 4EQWA 1PXBA 2RGOA 2VZ2A 4Z2TA 3R9UA 1OJCA 2R0GA 2WEUA 4CCRA 4C3YA 2YR4A 2BS4A 2NVKX 3RP8A 1E1LA 1ZX9A 1GETA 1GEUA 4M52A 5BRTA 2JBVA 3QSEA 1JRYA 2BYBA 2XFOA 3L8KA 2XVIA 3UOVA 3P1WA 4K5RA 4DGKA 5EOWA 4WCTA 1EL8A 4IA5A 1FL2A 4TM4A 4AT0A 1ZDLA 1FCDA 3KPFA 1O95A 2GR2A 1S2QA 2WPFA 3PO7A 2O9ZA 4CRTA 1OJAA 3NK0X 1QO8A 1DOCA 3H8LA 1Z6LA 1LVLA 1PHHA 2WOIA 4I59A 2JKCA 1NAAA 4USRA 3EF6A 3NGCX 5U1OA 2W0HA 4XWRA 4Z26A 1TDEA 1VDCA 3REDA 4J33A 3SZFA 4J34A 1CHUA 1IUVA 1W4XA 1DXLA 2YLTA 4BJYA 2DKHA 1L9CA 1LQTA 4U2SA 1K4QA 3AWIA 5KVIA 2JB3A 4K8DA 4UP3A 2YG5A 2WDQA 3CPHG 1OJDA 3CNPA 1DOBA 1DNCA 3VRDB 4J2WA 3CGCA 3B6DA 4BV6A 2GB0A 2WPCA 1EBDA 3B3RA 4APNA 2YR6A 1YQ3A 3DH9A 3GWFA 2JB1A 2QCUA 2VRLA 3KU9A 3LJPA 4CNJA 1KF6A 4JDRA 5EB4A 4B67A 4GDEA 2XFNA 3KD9A 1CC4A 4U8IA 3ALJA 3DK8A 1JOAA 2B76A 1K0LA 1GXFA 4K5SA 1GT8A 3AEGA 4K7ZA 4OPGA 4GUVA 1PN0A 2EQ8A 1NHPA 2FJDA 3GDPA 3M0OA 4H4UA 3V76A 1N4UA 1CL0A 1GRHA 1FECA 2XFPA 3IC9A 4JY3A 4X9NA 2PYXA 4B65A 4G73A 1KFYA 2WOVA 3LZWA 4II2A 2BK3A 5M0ZA 4C5OA 2YVGA 1H84A 4H4PA 1CJ4A 3I3LA 4A5LA 1H81A 4AP3A 4NNJA 1EL7A 2R4JA 4U8NA 1IJHA 4A6NA 1NENA 3GMBA 4CCQA 2RGJA 3OZ2A 2XVFA 3IHGA 3ZYXA 4C3XA 1XANA 4B63A 1REOA 3UKLA 2B7SA 3CMMA 4Y4LA 2CULA 2B9WA 2B7RA 3II4A 4REKA 3SGLA 4Z25A 2WU5A 1CBOA 5KOWA 4YSYA 2ZBWA 2C76A 5J60A 3LZXA 2C73A 3IHMA 5JCLA 3AEEA 4U8PA 2FJEA 4ZCCA 3LB8A 3QFBA 3QFAA 5HYMA 2EQ9A 4Z43A 3WE0A 3UOYA 2R46A 3AXBA 4JN9A 2YG4A 4U2TA 3KVEA 2OLNA 2WOWA 4JNAA 3ALLA 3GWDA 4PAAA 1KDGA 1Q1RA 4XWZA 5KXJA 2V6OA 2CFYA 2YG3A 3NN0X 5J7XA 1ZKQA 4IA6A 5U25A 4EMIA 2C65A 2PHHA 2WS3A 3ALMA 4ICYA 2IIDA 3GMCA 3T2YA 1NG4A 3LOVA 1GREA 4DNAA 3GSIA 2BRAA 2EQ7A 2WBAA 3UOXA 4JY2A 3K7MX 3QVPA 3DJGX 1NHRA 1JNRA 3CN8A 1BGNA 2TPRA 1DOEA 4EIQA 2BS3A 3NK2X 3NHOX 2E1MA 4NTCA 4HA6A 2WETA 4KPRA 3D8XA 4O5QA 1Y56B 3EPTA 3T2KA 1AOGA 1D4DA 4P9SA 5ER0A 3AE6A 1E39A 2OALA 3NTDA 3SQPA 2I0ZA 4EM4A 2YAUA 4UDRA 1PBDA 1FEAA 4B69A 3T2ZA 4BURA 2Q6UA 2GF3A 2WU2A 2WP6A 3COXA 4NZHA 3K30A 3SXIA 1O5WA 4AP1A 2ZZBA 1MOKA 4BK2A 3FBSA 1E1NA 1IUSA 2GR0A 3AE1A 4O5UA 4YSHA 3VQRA 2XLSA 2X8GA 3AEDA 1LV0A 5BVAA 2E5VA 2OAMA 3DMEA 3T14A 2X50A 2XVJA 5KNLA 4NEWA 4GR1A 5M10A 5EBKA 1X31B 3VRBA 4BK3A 3NG7X 3F8RA 4C74A 2YVFA 5KMQA 5JCIA 3UKKA 1M6IA 2GAHB 3GYIA 1TDOA 3CGEA 4TLZA 3SZ0A 1KSSA 3ICTA 2AQJA 3G5RA 1UKVG 1JEHA 2WDVA 4ECHA 4GCMA 2B9YA 2XLUA 1JU2A 2V5ZA 3GRTA 3LXDA 5CQFA 4B66A 4B68A 4EQSA 4G74A 2IVEA 4H2RA 1TYTA 4YKGA 3P9UA 3KA7A 2BS2A 3RP6A 1D5TA 3DA1A 2ZZ0A 2WP9A 1ELIA 1H82A 3HYXA 3NIXA 1GRTA 1GOSA 2RABA 4FK1A 2Q0KA 3UKHA 2XLRA 1EL9A 3I6DA 3P4SA 4U8OA 1IUTA 2XVHA 3AEBA 1VQWA 2YR5A 3C4AA 3DJJA 4YTPA 4Z44A 2AR8A 1PS9A 4WX1A 3DJEA 4AT2A 2FBWA 3PS9A 5BUKA 5KWFA 1E6EA 3Q6JA 1DODA 3M13A 2CVJA 3UTFA 3AE7A 3ABVA 4MJWA 3UP5A 3VRAA 3CNTA 3CNDA 4OCGA 4CY6A 3CNJA 1CC2A 1RYIA 4UDPA 3GD4A 1MO9A 3AE8A 4GF7A 2C7GA 1RSGA 4RG4A 1B8SA 3OC4A 3URHA 1F8WA 5KMPA 2ARDA 3S5WA 1M64A 5KMRA 2GMHA 3CTYA 4UDQA 2WPEA 1CJ2A 2Y6RA 2Z5XA 2BACA 3H8IA 3K7TA 3NH3X 4RG3A 4H4XA 5FS8A 3KPKA 2YLSA 1NEKA 3AEFA 4OPLA 5DBJA 1QJDA 3AD8B 3FG2P 2VVMA 4H2QA 3NKSA 4G9KA 1O94A 1YQZA 2Q7VA 3P4PA 2X8HA 4DSGA 1H7XA 1DJQA 4IVMB 4YWOA 2GQWA 2OA1A 2WDRA 2XDOA 1F8RA 1ZOYA 3BNMA 4K2XA 2FJBA 4CNKA 1B5QA 3C4NA 2WESA 1CJ3A 3S61A 1V59A 1D7LA 3AYJA 1XHCA 4Z2RA 2GR1A 2BK5A 4LIIA 4A9WA 4YTMA 2VQBA 2XFUA 3M12A 2H89A 2FJAA 1H86A 2XFQA 3CGDA 3GD3A 4U2LA 2XYOA 5HHFA 1L0VA 5JCKA 2GR3A 4EMJA 1GRAA 1BWCA 2R45A 3G5QA 3L1RA 5HY5A 4CBQA 2IVDA 1GTHA 4D03A 4EM3A 1D4EA 1GPEA 2JK6A 4Y4MA 3DGZA 4FDCB 3DK4A 3AE2A 3HZLA 1S3EA 1F6MA 3NK1X 4H4ZA 2BXSA 4A65A 1H83A 3CNSA 1S3BA 3NRNA 2YM1A 4YTNA 3GRSA 4GAVA 5CKUA 2JAEA 3CGBA 1PJ6A 4H2PA 1K0JA 1YKJA 2C67A 4HB9A 4IVOB 1PJ7A 4JQ9A 4N9XA 4U8KA 4U8LA 3SFEA 3T31A 1BKWA 3UKFA 3NTAA 2V3AA 3NNEA 3UTHA 1PBBA 3PVCA 1GERA 4A7AA 2XLPA 2BXRA 1GESA 3UTGA 1H7WA 1B37A 1VRQB
chains in the Genus database with same CATH topology
2YQUA 3D1CA 2APGA 1JNZA 1B4VA 4EMWA 1BF3A 2QAEA 4GRTA 2C70A 3UKPA 2BRYA 4H4YA 1E1MA 3HYVA 4NTEA 2C3DA 1GTEA 1D7YA 2R0PA 1P2EA 4H4VA 4X9MA 3V3OA 3DGHA 3T37A 3KKJA 1PDHA 2C75A 2GQFA 2WP5A 1FEBA 1GRBA 1PXCA 1ZP0A 1TDFA 3QJ4A 2TMDA 5GSNA 4BJZA 1LQUA 4AOXA 2X3NA 3IWAA 3GYXA 5IQ4A 2EQ6A 2UZZA 3P4RA 4I58A 4ZN0A 4K22A 5KMSA 3HYWA 3E1TA 4KX6A 3VR9A 3BNUA 3CPIG 4J31A 3ICRA 3GYJA 2C4CA 4Z2UA 3UOZA 3Q9TA 3CPJG 3ISHA 3BI2A 3SZCA 5FS6A 1GRGA 1IUWA 1PXAA 3DJDA 1GALA 1KNRA 2C64A 1IUUA 3NYFA 2ACZA 3AE5A 2F5ZA 2CDUA 2R4EA 1RP0A 2C72A 3RNMA 2J3NA 3UKAA 3AE3A 3AECA 2GMJA 2VVLA 3SZWA 2BA9A 1GSNA 4H50A 1DJNA 1Q1WA 5JCNA 3BI5A 1YQ4A 2YLWA 4A6NB 2QA2A 4J57A 2YM2A 1CF3A 1HYUA 2YLXA 2GEWA 1E1KA 1EL5A 1CC6A 3NYCA 4H4SA 1NPXA 4EQRA 4YXDA 1Y56A 4C77A 1VG9A 5TR3A 1IUXA 1JRZA 1NHQA 1Y0PA 3O0HA 1GNDA 4A79A 2R9ZA 3K7QX 2V3BA 3DK9A 3UP4A 4DSHA 1COYA 2BC0A 2YG6A 5C3JA 2XVEA 1PJ5A 3BHKA 3UCLA 2XLTA 1CJCA 4TLXA 2A8XA 5GRTA 3SY4A 2Y6QA 2V60A 2GV8A 4USQA 4J36A 4Z24A 4D04A 1PBCA 1JRXA 5JCMA 1NG3A 1LPFA 4OPUA 2V61A 1K0IA 3AD7B 1E7PA 5EB5A 4AOSA 3T0KA 1D4CA 1ZMDA 1ZY8A 4NWZA 2X8CA 1SEZA 4TM0A 4FK1C 1ZOVA 2HQMA 2WHDA 1GRFA 3ADAB 4H4QA 3VR8A 4U8MA 4ADWA 4OPDA 3KLJA 2WQYA 3AB1A 4CY8A 4EIPA 4NTDA 3ICSA 5BULA 3AYLA 4BK1A 5C2TA 3GDNA 2JB2A 2C66A 2VQ7A 4J56A 3UKQA 4GAPA 2YLRA 3UTEA 3CIRA 5FS9A 3AE9A 3RP7A 2VRMA 3EAOA 3AD9B 3BI4A 3ATQA 1XPQA 2AAQA 4LA1A 4U8JA 3LADA 4B1BA 4B64A 2B9XA 2A87A 1TDKA 1ZK7A 5FMHA 4H4RA 1YY5A 3G5SA 2YG7A 4JNQA 3F8PA 1F8SA 4OVIA 4YT0A 4OPCA 5U63A 3FIMB 3AYIA 4A99A 1Q9IA 4TM3A 3C96A 4EQXA 2Z5YA 3ATRA 2GVCA 4Y4NA 1LJ1A 1GV4A 3QSMA 2R0CA 5KRQA 2BK4A 2YWLA 5KVHA 2OLOA 1MXTA 2A89A 2XCGA 4H4WA 3IF9A 1TRBA 1S2YA 3SX6A 2YVJA 1F3PA 2YLZA 4H4TA 1BGJA 4II3A 4OPTA 4FX9A 1ZMCA 3QVRA 1LTXR 1BZLA 3NN6X 4YSXA 3FPZA 3F8DA 2GRTA 1TDNA 1TYPA 3V3NA 2H88A 2E4GA 2C3CA 1OJ9A 1ONFA 4IV9A 5IPYA 3SM8A 3ITJA 1P2HA 5FS7A 5KOXA 3SFDA 4NEVA 3AE4A 1OJTA 4ZCDA 4LU6A 2BABA 2VOUA 2ZZCA 4RSLA 3H4KA 3SYIA 3NYEA 1NDAA 5HXIA 2DKIA 2X99A 1XDIA 1FOHA 4G6HA 3ZDNA 5L46A 4G6GA 1PBEA 2GAGB 2RGHA 3RHAA 3AEAA 1N4WA 4GDPA 1L9DA 1KSUA 5IQ1A 1KNPA 2Q0LA 2NPXA 2QA1A 3FMWA 4OPIA 3JSKA 3EANA 1PBFA 5LV9A 4PABA 4YKFA 1N4VA 3QSSA 3P4QA 3NT6A 4XXGA 1VG0A 4E0VA 4YSZA 1L9EA 2BCGG 4H7UA 1NHSA 3NLCA 1H6VA 1N1PA 3BHFA 2GH5A 4TM1A 4X4JA 2BC1A 2BCPA 2VVLG 4H2NA 1QLBA 4EQWA 1PXBA 2RGOA 2VZ2A 4Z2TA 3R9UA 1OJCA 2R0GA 2WEUA 4CCRA 4C3YA 2YR4A 2BS4A 2NVKX 3RP8A 1E1LA 1ZX9A 1GETA 1GEUA 4M52A 5BRTA 2JBVA 3QSEA 1JRYA 2BYBA 2XFOA 3L8KA 2XVIA 3UOVA 3P1WA 4K5RA 4DGKA 5EOWA 4WCTA 1EL8A 4IA5A 1FL2A 4TM4A 4AT0A 1ZDLA 1FCDA 3KPFA 1O95A 2GR2A 1S2QA 2WPFA 3PO7A 2O9ZA 4CRTA 1OJAA 3NK0X 1QO8A 1DOCA 3H8LA 1Z6LA 1LVLA 1PHHA 2WOIA 4I59A 2JKCA 1NAAA 4USRA 3EF6A 3NGCX 5U1OA 2W0HA 4XWRA 4Z26A 1TDEA 1VDCA 3REDA 4J33A 3SZFA 4J34A 1CHUA 1IUVA 1W4XA 1DXLA 2YLTA 4BJYA 2DKHA 1L9CA 1LQTA 4U2SA 1K4QA 3AWIA 5KVIA 2JB3A 4K8DA 4UP3A 2YG5A 2WDQA 3CPHG 1OJDA 3CNPA 1DOBA 1DNCA 3VRDB 4J2WA 3CGCA 3B6DA 4BV6A 2GB0A 2WPCA 1EBDA 3B3RA 4APNA 2YR6A 1YQ3A 3DH9A 3GWFA 2JB1A 2QCUA 2VRLA 3KU9A 3LJPA 4CNJA 1KF6A 4JDRA 5EB4A 4B67A 4GDEA 2XFNA 3KD9A 1CC4A 4U8IA 3ALJA 3DK8A 1JOAA 2B76A 1K0LA 1GXFA 4K5SA 1GT8A 3AEGA 4K7ZA 4OPGA 4GUVA 1PN0A 2EQ8A 1NHPA 2FJDA 3GDPA 3M0OA 4H4UA 3V76A 1N4UA 1CL0A 1GRHA 1FECA 2XFPA 3IC9A 4JY3A 4X9NA 2PYXA 4B65A 4G73A 1KFYA 2WOVA 3LZWA 4II2A 2BK3A 5M0ZA 4C5OA 2YVGA 1H84A 4H4PA 1CJ4A 3I3LA 4A5LA 1H81A 4AP3A 4NNJA 1EL7A 2R4JA 4U8NA 1IJHA 4A6NA 1NENA 3GMBA 4CCQA 2RGJA 3OZ2A 2XVFA 3IHGA 3ZYXA 4C3XA 1XANA 4B63A 1REOA 3UKLA 2B7SA 3CMMA 4Y4LA 2CULA 2B9WA 2B7RA 3II4A 4REKA 3SGLA 4Z25A 2WU5A 1CBOA 5KOWA 4YSYA 2ZBWA 2C76A 5J60A 3LZXA 2C73A 3IHMA 5JCLA 3AEEA 4U8PA 2FJEA 4ZCCA 3LB8A 3QFBA 3QFAA 5HYMA 2EQ9A 4Z43A 3WE0A 3UOYA 2R46A 3AXBA 4JN9A 2YG4A 4U2TA 3KVEA 2OLNA 2WOWA 4JNAA 3ALLA 3GWDA 4PAAA 1KDGA 1Q1RA 4XWZA 5KXJA 2V6OA 2CFYA 2YG3A 3NN0X 5J7XA 1ZKQA 4IA6A 5U25A 4EMIA 2C65A 2PHHA 2WS3A 3ALMA 4ICYA 2IIDA 3GMCA 3T2YA 1NG4A 3LOVA 1GREA 4DNAA 3GSIA 2BRAA 2EQ7A 2WBAA 3UOXA 4JY2A 3K7MX 3QVPA 3DJGX 1NHRA 1JNRA 3CN8A 1BGNA 2TPRA 1DOEA 4EIQA 2BS3A 3NK2X 3NHOX 2E1MA 4NTCA 4HA6A 2WETA 4KPRA 3D8XA 4O5QA 1Y56B 3EPTA 3T2KA 1AOGA 1D4DA 4P9SA 5ER0A 3AE6A 1E39A 2OALA 3NTDA 3SQPA 2I0ZA 4EM4A 2YAUA 4UDRA 1PBDA 1FEAA 4B69A 3T2ZA 4BURA 2Q6UA 2GF3A 2WU2A 2WP6A 3COXA 4NZHA 3K30A 3SXIA 1O5WA 4AP1A 2ZZBA 1MOKA 4BK2A 3FBSA 1E1NA 1IUSA 2GR0A 3AE1A 4O5UA 4YSHA 3VQRA 2XLSA 2X8GA 3AEDA 1LV0A 5BVAA 2E5VA 2OAMA 3DMEA 3T14A 2X50A 2XVJA 5KNLA 4NEWA 4GR1A 5M10A 5EBKA 1X31B 3VRBA 4BK3A 3NG7X 3F8RA 4C74A 2YVFA 5KMQA 5JCIA 3UKKA 1M6IA 2GAHB 3GYIA 1TDOA 3CGEA 4TLZA 3SZ0A 1KSSA 3ICTA 2AQJA 3G5RA 1UKVG 1JEHA 2WDVA 4ECHA 4GCMA 2B9YA 2XLUA 1JU2A 2V5ZA 3GRTA 3LXDA 5CQFA 4B66A 4B68A 4EQSA 4G74A 2IVEA 4H2RA 1TYTA 4YKGA 3P9UA 3KA7A 2BS2A 3RP6A 1D5TA 3DA1A 2ZZ0A 2WP9A 1ELIA 1H82A 3HYXA 3NIXA 1GRTA 1GOSA 2RABA 4FK1A 2Q0KA 3UKHA 2XLRA 1EL9A 3I6DA 3P4SA 4U8OA 1IUTA 2XVHA 3AEBA 1VQWA 2YR5A 3C4AA 3DJJA 4YTPA 4Z44A 2AR8A 1PS9A 4WX1A 3DJEA 4AT2A 2FBWA 3PS9A 5BUKA 5KWFA 1E6EA 3Q6JA 1DODA 3M13A 2CVJA 3UTFA 3AE7A 3ABVA 4MJWA 3UP5A 3VRAA 3CNTA 3CNDA 4OCGA 4CY6A 3CNJA 1CC2A 1RYIA 4UDPA 3GD4A 1MO9A 3AE8A 4GF7A 2C7GA 1RSGA 4RG4A 1B8SA 3OC4A 3URHA 1F8WA 5KMPA 2ARDA 3S5WA 1M64A 5KMRA 2GMHA 3CTYA 4UDQA 2WPEA 1CJ2A 2Y6RA 2Z5XA 2BACA 3H8IA 3K7TA 3NH3X 4RG3A 4H4XA 5FS8A 3KPKA 2YLSA 1NEKA 3AEFA 4OPLA 5DBJA 1QJDA 3AD8B 3FG2P 2VVMA 4H2QA 3NKSA 4G9KA 1O94A 1YQZA 2Q7VA 3P4PA 2X8HA 4DSGA 1H7XA 1DJQA 4IVMB 4YWOA 2GQWA 2OA1A 2WDRA 2XDOA 1F8RA 1ZOYA 3BNMA 4K2XA 2FJBA 4CNKA 1B5QA 3C4NA 2WESA 1CJ3A 3S61A 1V59A 1D7LA 3AYJA 1XHCA 4Z2RA 2GR1A 2BK5A 4LIIA 4A9WA 4YTMA 2VQBA 2XFUA 3M12A 2H89A 2FJAA 1H86A 2XFQA 3CGDA 3GD3A 4U2LA 2XYOA 5HHFA 1L0VA 5JCKA 2GR3A 4EMJA 1GRAA 1BWCA 2R45A 3G5QA 3L1RA 5HY5A 4CBQA 2IVDA 1GTHA 4D03A 4EM3A 1D4EA 1GPEA 2JK6A 4Y4MA 3DGZA 4FDCB 3DK4A 3AE2A 3HZLA 1S3EA 1F6MA 3NK1X 4H4ZA 2BXSA 4A65A 1H83A 3CNSA 1S3BA 3NRNA 2YM1A 4YTNA 3GRSA 4GAVA 5CKUA 2JAEA 3CGBA 1PJ6A 4H2PA 1K0JA 1YKJA 2C67A 4HB9A 4IVOB 1PJ7A 4JQ9A 4N9XA 4U8KA 4U8LA 3SFEA 3T31A 1BKWA 3UKFA 3NTAA 2V3AA 3NNEA 3UTHA 1PBBA 3PVCA 1GERA 4A7AA 2XLPA 2BXRA 1GESA 3UTGA 1H7WA 1B37A 1VRQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQU A;  3D1C A;  2APG A;  1JNZ A;  1B4V A;  4EMW A;  1BF3 A;  2QAE A;  4GRT A;  2C70 A;  3UKP A;  4H4Y A;  1E1M A;  4NTE A;  2C3D A;  1GTE A;  1D7Y A;  2R0P A;  1P2E A;  4H4V A;  4X9M A;  3V3O A;  3DGH A;  3T37 A;  3KKJ A;  1PDH A;  2C75 A;  2GQF A;  2WP5 A;  1FEB A;  1GRB A;  1PXC A;  1ZP0 A;  1TDF A;  3QJ4 A;  2TMD A;  5GSN A;  4BJZ A;  1LQU A;  4AOX A;  2X3N A;  3IWA A;  5IQ4 A;  2EQ6 A;  2UZZ A;  3P4R A;  4I58 A;  4ZN0 A;  4K22 A;  3E1T A;  4KX6 A;  3VR9 A;  3BNU A;  3CPI G;  4J31 A;  3ICR A;  3GYJ A;  4Z2U A;  3UOZ A;  3Q9T A;  3CPJ G;  3ISH A;  3BI2 A;  5FS6 A;  1GRG A;  1IUW A;  1PXA A;  3DJD A;  1GAL A;  1KNR A;  2C64 A;  1IUU A;  3NYF A;  2ACZ A;  3AE5 A;  2F5Z A;  2CDU A;  2R4E A;  1RP0 A;  2C72 A;  3RNM A;  2J3N A;  3UKA A;  3AE3 A;  3AEC A;  2GMJ A;  2VVL A;  2BA9 A;  1GSN A;  4H50 A;  1DJN A;  1Q1W A;  5JCN A;  3BI5 A;  1YQ4 A;  2YLW A;  4A6N B;  2QA2 A;  4J57 A;  2YM2 A;  1CF3 A;  1HYU A;  2YLX A;  2GEW A;  1E1K A;  1EL5 A;  1CC6 A;  3NYC A;  4H4S A;  1NPX A;  4EQR A;  4YXD A;  1Y56 A;  4C77 A;  1VG9 A;  5TR3 A;  1IUX A;  1JRZ A;  1NHQ A;  1Y0P A;  3O0H A;  1GND A;  4A79 A;  2R9Z A;  3K7Q X;  2V3B A;  3DK9 A;  3UP4 A;  4DSH A;  1COY A;  2BC0 A;  2YG6 A;  5C3J A;  2XVE A;  1PJ5 A;  3BHK A;  3UCL A;  2XLT A;  1CJC A;  4TLX A;  2A8X A;  5GRT A;  2Y6Q A;  2V60 A;  2GV8 A;  4USQ A;  4J36 A;  4Z24 A;  4D04 A;  1PBC A;  1JRX A;  5JCM A;  1NG3 A;  1LPF A;  4OPU A;  2V61 A;  1K0I A;  3AD7 B;  1E7P A;  5EB5 A;  4AOS A;  1D4C A;  1ZMD A;  1ZY8 A;  2X8C A;  1SEZ A;  4TM0 A;  4FK1 C;  1ZOV A;  2HQM A;  2WHD A;  1GRF A;  3ADA B;  4H4Q A;  3VR8 A;  4U8M A;  4ADW A;  4OPD A;  3KLJ A;  2WQY A;  3AB1 A;  4CY8 A;  5BUL A;  4NTD A;  3ICS A;  5C2T A;  3AYL A;  4BK1 A;  3GDN A;  2JB2 A;  2C66 A;  2VQ7 A;  4J56 A;  3UKQ A;  2YLR A;  3UTE A;  3CIR A;  5FS9 A;  3AE9 A;  3RP7 A;  2VRM A;  3EAO A;  3AD9 B;  3BI4 A;  3ATQ A;  1XPQ A;  2AAQ A;  4LA1 A;  4U8J A;  3LAD A;  4B1B A;  4B64 A;  2B9X A;  2A87 A;  1TDK A;  1ZK7 A;  5FMH A;  4H4R A;  1YY5 A;  3G5S A;  2YG7 A;  4JNQ A;  3F8P A;  1F8S A;  4OVI A;  4YT0 A;  4OPC A;  5U63 A;  3FIM B;  3AYI A;  4A99 A;  1Q9I A;  4TM3 A;  3C96 A;  4EQX A;  2Z5Y A;  3ATR A;  2GVC A;  4Y4N A;  1LJ1 A;  1GV4 A;  3QSM A;  2R0C A;  5KRQ A;  2BK4 A;  2YWL A;  5KVH A;  2OLO A;  1MXT A;  2A89 A;  2XCG A;  4H4W A;  3IF9 A;  1TRB A;  1S2Y A;  2YVJ A;  1F3P A;  2YLZ A;  4H4T A;  1BGJ A;  4OPT A;  4FX9 A;  1ZMC A;  3QVR A;  1LTX R;  1BZL A;  3NN6 X;  4YSX A;  3FPZ A;  3F8D A;  2GRT A;  1TDN A;  1TYP A;  3V3N A;  2H88 A;  2E4G A;  2C3C A;  1OJ9 A;  1ONF A;  4IV9 A;  5IPY A;  3SM8 A;  3ITJ A;  1P2H A;  5FS7 A;  5KOX A;  3SFD A;  4NEV A;  3AE4 A;  1OJT A;  4ZCD A;  4LU6 A;  2BAB A;  2VOU A;  2ZZC A;  4RSL A;  3H4K A;  3NYE A;  1NDA A;  5HXI A;  2DKI A;  2X99 A;  1XDI A;  1FOH A;  3ZDN A;  5L46 A;  1PBE A;  2GAG B;  2RGH A;  3RHA A;  3AEA A;  1N4W A;  4GDP A;  1L9D A;  1KSU A;  5IQ1 A;  1KNP A;  2Q0L A;  2NPX A;  2QA1 A;  3FMW A;  4OPI A;  3JSK A;  3EAN A;  1PBF A;  5LV9 A;  4PAB A;  4YKF A;  1N4V A;  3QSS A;  3P4Q A;  3NT6 A;  4XXG A;  1VG0 A;  4E0V A;  4YSZ A;  1L9E A;  2BCG G;  4H7U A;  1NHS A;  3NLC A;  1H6V A;  1N1P A;  3BHF A;  2GH5 A;  4TM1 A;  4X4J A;  2BC1 A;  2BCP A;  2VVL G;  4H2N A;  1QLB A;  4EQW A;  1PXB A;  2RGO A;  2VZ2 A;  4Z2T A;  3R9U A;  1OJC A;  2R0G A;  2WEU A;  4CCR A;  4C3Y A;  2YR4 A;  2BS4 A;  2NVK X;  3RP8 A;  1E1L A;  1ZX9 A;  1GET A;  1GEU A;  4M52 A;  5BRT A;  2JBV A;  3QSE A;  1JRY A;  2BYB A;  2XFO A;  3L8K A;  2XVI A;  3UOV A;  3P1W A;  4K5R A;  4DGK A;  5EOW A;  4WCT A;  1EL8 A;  4IA5 A;  1FL2 A;  4TM4 A;  4AT0 A;  1ZDL A;  1FCD A;  3KPF A;  1O95 A;  2GR2 A;  1S2Q A;  2WPF A;  3PO7 A;  2O9Z A;  4CRT A;  1OJA A;  3NK0 X;  1QO8 A;  1DOC A;  3H8L A;  1Z6L A;  1LVL A;  1PHH A;  2WOI A;  4I59 A;  2JKC A;  1NAA A;  4USR A;  3EF6 A;  3NGC X;  5U1O A;  2W0H A;  4XWR A;  4Z26 A;  1TDE A;  1VDC A;  3RED A;  4J33 A;  4J34 A;  1CHU A;  1IUV A;  1W4X A;  1DXL A;  2YLT A;  4BJY A;  2DKH A;  1L9C A;  1LQT A;  4U2S A;  1K4Q A;  3AWI A;  5KVI A;  2JB3 A;  4K8D A;  4UP3 A;  2YG5 A;  2WDQ A;  3CPH G;  1OJD A;  3CNP A;  1DOB A;  1DNC A;  3VRD B;  4J2W A;  3CGC A;  3B6D A;  4BV6 A;  2GB0 A;  2WPC A;  1EBD A;  3B3R A;  4APN A;  2YR6 A;  1YQ3 A;  3DH9 A;  3GWF A;  2JB1 A;  2QCU A;  2VRL A;  3KU9 A;  3LJP A;  4CNJ A;  1KF6 A;  4JDR A;  5EB4 A;  4B67 A;  4GDE A;  2XFN A;  3KD9 A;  1CC4 A;  4U8I A;  3ALJ A;  3DK8 A;  1JOA A;  2B76 A;  1K0L A;  1GXF A;  4K5S A;  1GT8 A;  3AEG A;  4K7Z A;  4OPG A;  4GUV A;  1PN0 A;  2EQ8 A;  1NHP A;  2FJD A;  3GDP A;  3M0O A;  4H4U A;  3V76 A;  1N4U A;  1CL0 A;  1GRH A;  1FEC A;  2XFP A;  3IC9 A;  4JY3 A;  4X9N A;  2PYX A;  4B65 A;  1KFY A;  2WOV A;  3LZW A;  5M0Z A;  2BK3 A;  4C5O A;  2YVG A;  1H84 A;  4H4P A;  1CJ4 A;  3I3L A;  4A5L A;  1H81 A;  4AP3 A;  1EL7 A;  2R4J A;  4U8N A;  1IJH A;  4A6N A;  1NEN A;  3GMB A;  4CCQ A;  2RGJ A;  3OZ2 A;  2XVF A;  3IHG A;  3ZYX A;  4C3X A;  1XAN A;  4B63 A;  1REO A;  3UKL A;  2B7S A;  4Y4L A;  2CUL A;  2B9W A;  2B7R A;  3II4 A;  4REK A;  3SGL A;  4Z25 A;  2WU5 A;  1CBO A;  5KOW A;  4YSY A;  2ZBW A;  2C76 A;  5J60 A;  3LZX A;  2C73 A;  3IHM A;  5JCL A;  3AEE A;  4U8P A;  2FJE A;  4ZCC A;  3LB8 A;  3QFB A;  3QFA A;  5HYM A;  2EQ9 A;  4Z43 A;  3WE0 A;  3UOY A;  2R46 A;  3AXB A;  4JN9 A;  2YG4 A;  4U2T A;  3KVE A;  2OLN A;  2WOW A;  4JNA A;  3ALL A;  3GWD A;  4PAA A;  1KDG A;  1Q1R A;  4XWZ A;  5KXJ A;  2V6O A;  2CFY A;  2YG3 A;  3NN0 X;  5J7X A;  1ZKQ A;  4IA6 A;  5U25 A;  4EMI A;  2C65 A;  2PHH A;  2WS3 A;  3ALM A;  4ICY A;  2IID A;  3GMC A;  1NG4 A;  3LOV A;  1GRE A;  4DNA A;  3GSI A;  2EQ7 A;  2WBA A;  3UOX A;  4JY2 A;  3K7M X;  3QVP A;  3DJG X;  1NHR A;  1JNR A;  3CN8 A;  1BGN A;  2TPR A;  1DOE A;  4EIQ A;  2BS3 A;  3NK2 X;  3NHO X;  2E1M A;  4NTC A;  4HA6 A;  2WET A;  4KPR A;  3D8X A;  4O5Q A;  1Y56 B;  3EPT A;  1AOG A;  1D4D A;  4P9S A;  5ER0 A;  3AE6 A;  1E39 A;  2OAL A;  3NTD A;  3SQP A;  2I0Z A;  4EM4 A;  2YAU A;  4UDR A;  1PBD A;  1FEA A;  4B69 A;  4BUR A;  2Q6U A;  2GF3 A;  2WU2 A;  2WP6 A;  3COX A;  4NZH A;  3K30 A;  1O5W A;  4AP1 A;  2ZZB A;  1MOK A;  4BK2 A;  3FBS A;  1E1N A;  1IUS A;  2GR0 A;  3AE1 A;  4O5U A;  4YSH A;  3VQR A;  2XLS A;  2X8G A;  3AED A;  1LV0 A;  5BVA A;  2E5V A;  2OAM A;  3DME A;  2X50 A;  2XVJ A;  4NEW A;  4GR1 A;  5M10 A;  5EBK A;  1X31 B;  3VRB A;  4BK3 A;  3NG7 X;  3F8R A;  4C74 A;  2YVF A;  5JCI A;  3UKK A;  1M6I A;  2GAH B;  3GYI A;  1TDO A;  3CGE A;  4TLZ A;  1KSS A;  3ICT A;  2AQJ A;  3G5R A;  1UKV G;  1JEH A;  2WDV A;  4ECH A;  4GCM A;  2B9Y A;  2XLU A;  1JU2 A;  2V5Z A;  3GRT A;  3LXD A;  5CQF A;  4B66 A;  4B68 A;  4EQS A;  2IVE A;  4H2R A;  1TYT A;  4YKG A;  3P9U A;  3KA7 A;  2BS2 A;  3RP6 A;  1D5T A;  3DA1 A;  2ZZ0 A;  2WP9 A;  1ELI A;  1H82 A;  3NIX A;  1GRT A;  1GOS A;  2RAB A;  4FK1 A;  2Q0K A;  3UKH A;  2XLR A;  1EL9 A;  3I6D A;  3P4S A;  4U8O A;  1IUT A;  2XVH A;  3AEB A;  1VQW A;  2YR5 A;  3C4A A;  3DJJ A;  4YTP A;  4Z44 A;  2AR8 A;  1PS9 A;  4WX1 A;  3DJE A;  4AT2 A;  2FBW A;  3PS9 A;  5BUK A;  5KWF A;  1E6E A;  3Q6J A;  1DOD A;  3M13 A;  2CVJ A;  3UTF A;  3AE7 A;  3ABV A;  4MJW A;  3UP5 A;  3VRA A;  3CNT A;  3CND A;  4OCG A;  4CY6 A;  3CNJ A;  1CC2 A;  1RYI A;  4UDP A;  3GD4 A;  1MO9 A;  3AE8 A;  4GF7 A;  2C7G A;  1RSG A;  4RG4 A;  1B8S A;  3OC4 A;  3URH A;  1F8W A;  2ARD A;  3S5W A;  1M64 A;  2GMH A;  3CTY A;  4UDQ A;  2WPE A;  1CJ2 A;  2Y6R A;  2Z5X A;  2BAC A;  3H8I A;  3K7T A;  3NH3 X;  4RG3 A;  4H4X A;  5FS8 A;  2YLS A;  1NEK A;  3AEF A;  4OPL A;  5DBJ A;  1QJD A;  3AD8 B;  3FG2 P;  2VVM A;  4H2Q A;  3NKS A;  1O94 A;  1YQZ A;  2Q7V A;  3P4P A;  2X8H A;  4DSG A;  1H7X A;  1DJQ A;  4IVM B;  4YWO A;  2GQW A;  2OA1 A;  2WDR A;  2XDO A;  1F8R A;  1ZOY A;  3BNM A;  4K2X A;  2FJB A;  4CNK A;  1B5Q A;  3C4N A;  2WES A;  1CJ3 A;  3S61 A;  1V59 A;  1D7L A;  3AYJ A;  1XHC A;  4Z2R A;  2GR1 A;  2BK5 A;  4LII A;  4A9W A;  4YTM A;  2VQB A;  2XFU A;  3M12 A;  2H89 A;  2FJA A;  1H86 A;  2XFQ A;  3CGD A;  3GD3 A;  4U2L A;  2XYO A;  5HHF A;  1L0V A;  5JCK A;  2GR3 A;  4EMJ A;  1GRA A;  1BWC A;  2R45 A;  3G5Q A;  3L1R A;  5HY5 A;  4CBQ A;  2IVD A;  1GTH A;  4D03 A;  4EM3 A;  1D4E A;  1GPE A;  2JK6 A;  4Y4M A;  3DGZ A;  4FDC B;  3DK4 A;  3AE2 A;  3HZL A;  1S3E A;  1F6M A;  3NK1 X;  4H4Z A;  2BXS A;  4A65 A;  1H83 A;  3CNS A;  1S3B A;  3NRN A;  2YM1 A;  4YTN A;  3GRS A;  5CKU A;  4EIP A;  2JAE A;  3CGB A;  1PJ6 A;  4H2P A;  1K0J A;  1YKJ A;  2C67 A;  4HB9 A;  4IVO B;  1PJ7 A;  4JQ9 A;  4N9X A;  4U8K A;  4U8L A;  3SFE A;  1BKW A;  3UKF A;  3NTA A;  2V3A A;  3NNE A;  3UTH A;  1PBB A;  3PVC A;  1GER A;  4A7A A;  2XLP A;  2BXR A;  1GES A;  3UTG A;  1H7W A;  1B37 A;  1VRQ B; 
#chains in the Genus database with same CATH topology
 2YQU A;  3D1C A;  2APG A;  1JNZ A;  1B4V A;  4EMW A;  1BF3 A;  2QAE A;  4GRT A;  2C70 A;  3UKP A;  2BRY A;  4H4Y A;  1E1M A;  3HYV A;  4NTE A;  2C3D A;  1GTE A;  1D7Y A;  2R0P A;  1P2E A;  4H4V A;  4X9M A;  3V3O A;  3DGH A;  3T37 A;  3KKJ A;  1PDH A;  2C75 A;  2GQF A;  2WP5 A;  1FEB A;  1GRB A;  1PXC A;  1ZP0 A;  1TDF A;  3QJ4 A;  2TMD A;  5GSN A;  4BJZ A;  1LQU A;  4AOX A;  2X3N A;  3IWA A;  3GYX A;  5IQ4 A;  2EQ6 A;  2UZZ A;  3P4R A;  4I58 A;  4ZN0 A;  4K22 A;  5KMS A;  3HYW A;  3E1T A;  4KX6 A;  3VR9 A;  3BNU A;  3CPI G;  4J31 A;  3ICR A;  3GYJ A;  2C4C A;  4Z2U A;  3UOZ A;  3Q9T A;  3CPJ G;  3ISH A;  3BI2 A;  3SZC A;  5FS6 A;  1GRG A;  1IUW A;  1PXA A;  3DJD A;  1GAL A;  1KNR A;  2C64 A;  1IUU A;  3NYF A;  2ACZ A;  3AE5 A;  2F5Z A;  2CDU A;  2R4E A;  1RP0 A;  2C72 A;  3RNM A;  2J3N A;  3UKA A;  3AE3 A;  3AEC A;  2GMJ A;  2VVL A;  3SZW A;  2BA9 A;  1GSN A;  4H50 A;  1DJN A;  1Q1W A;  5JCN A;  3BI5 A;  1YQ4 A;  2YLW A;  4A6N B;  2QA2 A;  4J57 A;  2YM2 A;  1CF3 A;  1HYU A;  2YLX A;  2GEW A;  1E1K A;  1EL5 A;  1CC6 A;  3NYC A;  4H4S A;  1NPX A;  4EQR A;  4YXD A;  1Y56 A;  4C77 A;  1VG9 A;  5TR3 A;  1IUX A;  1JRZ A;  1NHQ A;  1Y0P A;  3O0H A;  1GND A;  4A79 A;  2R9Z A;  3K7Q X;  2V3B A;  3DK9 A;  3UP4 A;  4DSH A;  1COY A;  2BC0 A;  2YG6 A;  5C3J A;  2XVE A;  1PJ5 A;  3BHK A;  3UCL A;  2XLT A;  1CJC A;  4TLX A;  2A8X A;  5GRT A;  3SY4 A;  2Y6Q A;  2V60 A;  2GV8 A;  4USQ A;  4J36 A;  4Z24 A;  4D04 A;  1PBC A;  1JRX A;  5JCM A;  1NG3 A;  1LPF A;  4OPU A;  2V61 A;  1K0I A;  3AD7 B;  1E7P A;  5EB5 A;  4AOS A;  3T0K A;  1D4C A;  1ZMD A;  1ZY8 A;  4NWZ A;  2X8C A;  1SEZ A;  4TM0 A;  4FK1 C;  1ZOV A;  2HQM A;  2WHD A;  1GRF A;  3ADA B;  4H4Q A;  3VR8 A;  4U8M A;  4ADW A;  4OPD A;  3KLJ A;  2WQY A;  3AB1 A;  4CY8 A;  4EIP A;  4NTD A;  3ICS A;  5BUL A;  3AYL A;  4BK1 A;  5C2T A;  3GDN A;  2JB2 A;  2C66 A;  2VQ7 A;  4J56 A;  3UKQ A;  4GAP A;  2YLR A;  3UTE A;  3CIR A;  5FS9 A;  3AE9 A;  3RP7 A;  2VRM A;  3EAO A;  3AD9 B;  3BI4 A;  3ATQ A;  1XPQ A;  2AAQ A;  4LA1 A;  4U8J A;  3LAD A;  4B1B A;  4B64 A;  2B9X A;  2A87 A;  1TDK A;  1ZK7 A;  5FMH A;  4H4R A;  1YY5 A;  3G5S A;  2YG7 A;  4JNQ A;  3F8P A;  1F8S A;  4OVI A;  4YT0 A;  4OPC A;  5U63 A;  3FIM B;  3AYI A;  4A99 A;  1Q9I A;  4TM3 A;  3C96 A;  4EQX A;  2Z5Y A;  3ATR A;  2GVC A;  4Y4N A;  1LJ1 A;  1GV4 A;  3QSM A;  2R0C A;  5KRQ A;  2BK4 A;  2YWL A;  5KVH A;  2OLO A;  1MXT A;  2A89 A;  2XCG A;  4H4W A;  3IF9 A;  1TRB A;  1S2Y A;  3SX6 A;  2YVJ A;  1F3P A;  2YLZ A;  4H4T A;  1BGJ A;  4II3 A;  4OPT A;  4FX9 A;  1ZMC A;  3QVR A;  1LTX R;  1BZL A;  3NN6 X;  4YSX A;  3FPZ A;  3F8D A;  2GRT A;  1TDN A;  1TYP A;  3V3N A;  2H88 A;  2E4G A;  2C3C A;  1OJ9 A;  1ONF A;  4IV9 A;  5IPY A;  3SM8 A;  3ITJ A;  1P2H A;  5FS7 A;  5KOX A;  3SFD A;  4NEV A;  3AE4 A;  1OJT A;  4ZCD A;  4LU6 A;  2BAB A;  2VOU A;  2ZZC A;  4RSL A;  3H4K A;  3SYI A;  3NYE A;  1NDA A;  5HXI A;  2DKI A;  2X99 A;  1XDI A;  1FOH A;  4G6H A;  3ZDN A;  5L46 A;  4G6G A;  1PBE A;  2GAG B;  2RGH A;  3RHA A;  3AEA A;  1N4W A;  4GDP A;  1L9D A;  1KSU A;  5IQ1 A;  1KNP A;  2Q0L A;  2NPX A;  2QA1 A;  3FMW A;  4OPI A;  3JSK A;  3EAN A;  1PBF A;  5LV9 A;  4PAB A;  4YKF A;  1N4V A;  3QSS A;  3P4Q A;  3NT6 A;  4XXG A;  1VG0 A;  4E0V A;  4YSZ A;  1L9E A;  2BCG G;  4H7U A;  1NHS A;  3NLC A;  1H6V A;  1N1P A;  3BHF A;  2GH5 A;  4TM1 A;  4X4J A;  2BC1 A;  2BCP A;  2VVL G;  4H2N A;  1QLB A;  4EQW A;  1PXB A;  2RGO A;  2VZ2 A;  4Z2T A;  3R9U A;  1OJC A;  2R0G A;  2WEU A;  4CCR A;  4C3Y A;  2YR4 A;  2BS4 A;  2NVK X;  3RP8 A;  1E1L A;  1ZX9 A;  1GET A;  1GEU A;  4M52 A;  5BRT A;  2JBV A;  3QSE A;  1JRY A;  2BYB A;  2XFO A;  3L8K A;  2XVI A;  3UOV A;  3P1W A;  4K5R A;  4DGK A;  5EOW A;  4WCT A;  1EL8 A;  4IA5 A;  1FL2 A;  4TM4 A;  4AT0 A;  1ZDL A;  1FCD A;  3KPF A;  1O95 A;  2GR2 A;  1S2Q A;  2WPF A;  3PO7 A;  2O9Z A;  4CRT A;  1OJA A;  3NK0 X;  1QO8 A;  1DOC A;  3H8L A;  1Z6L A;  1LVL A;  1PHH A;  2WOI A;  4I59 A;  2JKC A;  1NAA A;  4USR A;  3EF6 A;  3NGC X;  5U1O A;  2W0H A;  4XWR A;  4Z26 A;  1TDE A;  1VDC A;  3RED A;  4J33 A;  3SZF A;  4J34 A;  1CHU A;  1IUV A;  1W4X A;  1DXL A;  2YLT A;  4BJY A;  2DKH A;  1L9C A;  1LQT A;  4U2S A;  1K4Q A;  3AWI A;  5KVI A;  2JB3 A;  4K8D A;  4UP3 A;  2YG5 A;  2WDQ A;  3CPH G;  1OJD A;  3CNP A;  1DOB A;  1DNC A;  3VRD B;  4J2W A;  3CGC A;  3B6D A;  4BV6 A;  2GB0 A;  2WPC A;  1EBD A;  3B3R A;  4APN A;  2YR6 A;  1YQ3 A;  3DH9 A;  3GWF A;  2JB1 A;  2QCU A;  2VRL A;  3KU9 A;  3LJP A;  4CNJ A;  1KF6 A;  4JDR A;  5EB4 A;  4B67 A;  4GDE A;  2XFN A;  3KD9 A;  1CC4 A;  4U8I A;  3ALJ A;  3DK8 A;  1JOA A;  2B76 A;  1K0L A;  1GXF A;  4K5S A;  1GT8 A;  3AEG A;  4K7Z A;  4OPG A;  4GUV A;  1PN0 A;  2EQ8 A;  1NHP A;  2FJD A;  3GDP A;  3M0O A;  4H4U A;  3V76 A;  1N4U A;  1CL0 A;  1GRH A;  1FEC A;  2XFP A;  3IC9 A;  4JY3 A;  4X9N A;  2PYX A;  4B65 A;  4G73 A;  1KFY A;  2WOV A;  3LZW A;  4II2 A;  2BK3 A;  5M0Z A;  4C5O A;  2YVG A;  1H84 A;  4H4P A;  1CJ4 A;  3I3L A;  4A5L A;  1H81 A;  4AP3 A;  4NNJ A;  1EL7 A;  2R4J A;  4U8N A;  1IJH A;  4A6N A;  1NEN A;  3GMB A;  4CCQ A;  2RGJ A;  3OZ2 A;  2XVF A;  3IHG A;  3ZYX A;  4C3X A;  1XAN A;  4B63 A;  1REO A;  3UKL A;  2B7S A;  3CMM A;  4Y4L A;  2CUL A;  2B9W A;  2B7R A;  3II4 A;  4REK A;  3SGL A;  4Z25 A;  2WU5 A;  1CBO A;  5KOW A;  4YSY A;  2ZBW A;  2C76 A;  5J60 A;  3LZX A;  2C73 A;  3IHM A;  5JCL A;  3AEE A;  4U8P A;  2FJE A;  4ZCC A;  3LB8 A;  3QFB A;  3QFA A;  5HYM A;  2EQ9 A;  4Z43 A;  3WE0 A;  3UOY A;  2R46 A;  3AXB A;  4JN9 A;  2YG4 A;  4U2T A;  3KVE A;  2OLN A;  2WOW A;  4JNA A;  3ALL A;  3GWD A;  4PAA A;  1KDG A;  1Q1R A;  4XWZ A;  5KXJ A;  2V6O A;  2CFY A;  2YG3 A;  3NN0 X;  5J7X A;  1ZKQ A;  4IA6 A;  5U25 A;  4EMI A;  2C65 A;  2PHH A;  2WS3 A;  3ALM A;  4ICY A;  2IID A;  3GMC A;  3T2Y A;  1NG4 A;  3LOV A;  1GRE A;  4DNA A;  3GSI A;  2BRA A;  2EQ7 A;  2WBA A;  3UOX A;  4JY2 A;  3K7M X;  3QVP A;  3DJG X;  1NHR A;  1JNR A;  3CN8 A;  1BGN A;  2TPR A;  1DOE A;  4EIQ A;  2BS3 A;  3NK2 X;  3NHO X;  2E1M A;  4NTC A;  4HA6 A;  2WET A;  4KPR A;  3D8X A;  4O5Q A;  1Y56 B;  3EPT A;  3T2K A;  1AOG A;  1D4D A;  4P9S A;  5ER0 A;  3AE6 A;  1E39 A;  2OAL A;  3NTD A;  3SQP A;  2I0Z A;  4EM4 A;  2YAU A;  4UDR A;  1PBD A;  1FEA A;  4B69 A;  3T2Z A;  4BUR A;  2Q6U A;  2GF3 A;  2WU2 A;  2WP6 A;  3COX A;  4NZH A;  3K30 A;  3SXI A;  1O5W A;  4AP1 A;  2ZZB A;  1MOK A;  4BK2 A;  3FBS A;  1E1N A;  1IUS A;  2GR0 A;  3AE1 A;  4O5U A;  4YSH A;  3VQR A;  2XLS A;  2X8G A;  3AED A;  1LV0 A;  5BVA A;  2E5V A;  2OAM A;  3DME A;  3T14 A;  2X50 A;  2XVJ A;  5KNL A;  4NEW A;  4GR1 A;  5M10 A;  5EBK A;  1X31 B;  3VRB A;  4BK3 A;  3NG7 X;  3F8R A;  4C74 A;  2YVF A;  5KMQ A;  5JCI A;  3UKK A;  1M6I A;  2GAH B;  3GYI A;  1TDO A;  3CGE A;  4TLZ A;  3SZ0 A;  1KSS A;  3ICT A;  2AQJ A;  3G5R A;  1UKV G;  1JEH A;  2WDV A;  4ECH A;  4GCM A;  2B9Y A;  2XLU A;  1JU2 A;  2V5Z A;  3GRT A;  3LXD A;  5CQF A;  4B66 A;  4B68 A;  4EQS A;  4G74 A;  2IVE A;  4H2R A;  1TYT A;  4YKG A;  3P9U A;  3KA7 A;  2BS2 A;  3RP6 A;  1D5T A;  3DA1 A;  2ZZ0 A;  2WP9 A;  1ELI A;  1H82 A;  3HYX A;  3NIX A;  1GRT A;  1GOS A;  2RAB A;  4FK1 A;  2Q0K A;  3UKH A;  2XLR A;  1EL9 A;  3I6D A;  3P4S A;  4U8O A;  1IUT A;  2XVH A;  3AEB A;  1VQW A;  2YR5 A;  3C4A A;  3DJJ A;  4YTP A;  4Z44 A;  2AR8 A;  1PS9 A;  4WX1 A;  3DJE A;  4AT2 A;  2FBW A;  3PS9 A;  5BUK A;  5KWF A;  1E6E A;  3Q6J A;  1DOD A;  3M13 A;  2CVJ A;  3UTF A;  3AE7 A;  3ABV A;  4MJW A;  3UP5 A;  3VRA A;  3CNT A;  3CND A;  4OCG A;  4CY6 A;  3CNJ A;  1CC2 A;  1RYI A;  4UDP A;  3GD4 A;  1MO9 A;  3AE8 A;  4GF7 A;  2C7G A;  1RSG A;  4RG4 A;  1B8S A;  3OC4 A;  3URH A;  1F8W A;  5KMP A;  2ARD A;  3S5W A;  1M64 A;  5KMR A;  2GMH A;  3CTY A;  4UDQ A;  2WPE A;  1CJ2 A;  2Y6R A;  2Z5X A;  2BAC A;  3H8I A;  3K7T A;  3NH3 X;  4RG3 A;  4H4X A;  5FS8 A;  3KPK A;  2YLS A;  1NEK A;  3AEF A;  4OPL A;  5DBJ A;  1QJD A;  3AD8 B;  3FG2 P;  2VVM A;  4H2Q A;  3NKS A;  4G9K A;  1O94 A;  1YQZ A;  2Q7V A;  3P4P A;  2X8H A;  4DSG A;  1H7X A;  1DJQ A;  4IVM B;  4YWO A;  2GQW A;  2OA1 A;  2WDR A;  2XDO A;  1F8R A;  1ZOY A;  3BNM A;  4K2X A;  2FJB A;  4CNK A;  1B5Q A;  3C4N A;  2WES A;  1CJ3 A;  3S61 A;  1V59 A;  1D7L A;  3AYJ A;  1XHC A;  4Z2R A;  2GR1 A;  2BK5 A;  4LII A;  4A9W A;  4YTM A;  2VQB A;  2XFU A;  3M12 A;  2H89 A;  2FJA A;  1H86 A;  2XFQ A;  3CGD A;  3GD3 A;  4U2L A;  2XYO A;  5HHF A;  1L0V A;  5JCK A;  2GR3 A;  4EMJ A;  1GRA A;  1BWC A;  2R45 A;  3G5Q A;  3L1R A;  5HY5 A;  4CBQ A;  2IVD A;  1GTH A;  4D03 A;  4EM3 A;  1D4E A;  1GPE A;  2JK6 A;  4Y4M A;  3DGZ A;  4FDC B;  3DK4 A;  3AE2 A;  3HZL A;  1S3E A;  1F6M A;  3NK1 X;  4H4Z A;  2BXS A;  4A65 A;  1H83 A;  3CNS A;  1S3B A;  3NRN A;  2YM1 A;  4YTN A;  3GRS A;  4GAV A;  5CKU A;  2JAE A;  3CGB A;  1PJ6 A;  4H2P A;  1K0J A;  1YKJ A;  2C67 A;  4HB9 A;  4IVO B;  1PJ7 A;  4JQ9 A;  4N9X A;  4U8K A;  4U8L A;  3SFE A;  3T31 A;  1BKW A;  3UKF A;  3NTA A;  2V3A A;  3NNE A;  3UTH A;  1PBB A;  3PVC A;  1GER A;  4A7A A;  2XLP A;  2BXR A;  1GES A;  3UTG A;  1H7W A;  1B37 A;  1VRQ B; 
#chains in the Genus database with same CATH homology
 2YQU A;  3D1C A;  2APG A;  1JNZ A;  1B4V A;  4EMW A;  1BF3 A;  2QAE A;  4GRT A;  2C70 A;  3UKP A;  2BRY A;  4H4Y A;  1E1M A;  3HYV A;  4NTE A;  2C3D A;  1GTE A;  1D7Y A;  2R0P A;  1P2E A;  4H4V A;  4X9M A;  3V3O A;  3DGH A;  3T37 A;  3KKJ A;  1PDH A;  2C75 A;  2GQF A;  2WP5 A;  1FEB A;  1GRB A;  1PXC A;  1ZP0 A;  1TDF A;  3QJ4 A;  2TMD A;  5GSN A;  4BJZ A;  1LQU A;  4AOX A;  2X3N A;  3IWA A;  3GYX A;  5IQ4 A;  2EQ6 A;  2UZZ A;  3P4R A;  4I58 A;  4ZN0 A;  4K22 A;  5KMS A;  3HYW A;  3E1T A;  4KX6 A;  3VR9 A;  3BNU A;  3CPI G;  4J31 A;  3ICR A;  3GYJ A;  2C4C A;  4Z2U A;  3UOZ A;  3Q9T A;  3CPJ G;  3ISH A;  3BI2 A;  3SZC A;  5FS6 A;  1GRG A;  1IUW A;  1PXA A;  3DJD A;  1GAL A;  1KNR A;  2C64 A;  1IUU A;  3NYF A;  2ACZ A;  3AE5 A;  2F5Z A;  2CDU A;  2R4E A;  1RP0 A;  2C72 A;  3RNM A;  2J3N A;  3UKA A;  3AE3 A;  3AEC A;  2GMJ A;  2VVL A;  3SZW A;  2BA9 A;  1GSN A;  4H50 A;  1DJN A;  1Q1W A;  5JCN A;  3BI5 A;  1YQ4 A;  2YLW A;  4A6N B;  2QA2 A;  4J57 A;  2YM2 A;  1CF3 A;  1HYU A;  2YLX A;  2GEW A;  1E1K A;  1EL5 A;  1CC6 A;  3NYC A;  4H4S A;  1NPX A;  4EQR A;  4YXD A;  1Y56 A;  4C77 A;  1VG9 A;  5TR3 A;  1IUX A;  1JRZ A;  1NHQ A;  1Y0P A;  3O0H A;  1GND A;  4A79 A;  2R9Z A;  3K7Q X;  2V3B A;  3DK9 A;  3UP4 A;  4DSH A;  1COY A;  2BC0 A;  2YG6 A;  5C3J A;  2XVE A;  1PJ5 A;  3BHK A;  3UCL A;  2XLT A;  1CJC A;  4TLX A;  2A8X A;  5GRT A;  3SY4 A;  2Y6Q A;  2V60 A;  2GV8 A;  4USQ A;  4J36 A;  4Z24 A;  4D04 A;  1PBC A;  1JRX A;  5JCM A;  1NG3 A;  1LPF A;  4OPU A;  2V61 A;  1K0I A;  3AD7 B;  1E7P A;  5EB5 A;  4AOS A;  3T0K A;  1D4C A;  1ZMD A;  1ZY8 A;  4NWZ A;  2X8C A;  1SEZ A;  4TM0 A;  4FK1 C;  1ZOV A;  2HQM A;  2WHD A;  1GRF A;  3ADA B;  4H4Q A;  3VR8 A;  4U8M A;  4ADW A;  4OPD A;  3KLJ A;  2WQY A;  3AB1 A;  4CY8 A;  4EIP A;  4NTD A;  3ICS A;  5BUL A;  3AYL A;  4BK1 A;  5C2T A;  3GDN A;  2JB2 A;  2C66 A;  2VQ7 A;  4J56 A;  3UKQ A;  4GAP A;  2YLR A;  3UTE A;  3CIR A;  5FS9 A;  3AE9 A;  3RP7 A;  2VRM A;  3EAO A;  3AD9 B;  3BI4 A;  3ATQ A;  1XPQ A;  2AAQ A;  4LA1 A;  4U8J A;  3LAD A;  4B1B A;  4B64 A;  2B9X A;  2A87 A;  1TDK A;  1ZK7 A;  5FMH A;  4H4R A;  1YY5 A;  3G5S A;  2YG7 A;  4JNQ A;  3F8P A;  1F8S A;  4OVI A;  4YT0 A;  4OPC A;  5U63 A;  3FIM B;  3AYI A;  4A99 A;  1Q9I A;  4TM3 A;  3C96 A;  4EQX A;  2Z5Y A;  3ATR A;  2GVC A;  4Y4N A;  1LJ1 A;  1GV4 A;  3QSM A;  2R0C A;  5KRQ A;  2BK4 A;  2YWL A;  5KVH A;  2OLO A;  1MXT A;  2A89 A;  2XCG A;  4H4W A;  3IF9 A;  1TRB A;  1S2Y A;  3SX6 A;  2YVJ A;  1F3P A;  2YLZ A;  4H4T A;  1BGJ A;  4II3 A;  4OPT A;  4FX9 A;  1ZMC A;  3QVR A;  1LTX R;  1BZL A;  3NN6 X;  4YSX A;  3FPZ A;  3F8D A;  2GRT A;  1TDN A;  1TYP A;  3V3N A;  2H88 A;  2E4G A;  2C3C A;  1OJ9 A;  1ONF A;  4IV9 A;  5IPY A;  3SM8 A;  3ITJ A;  1P2H A;  5FS7 A;  5KOX A;  3SFD A;  4NEV A;  3AE4 A;  1OJT A;  4ZCD A;  4LU6 A;  2BAB A;  2VOU A;  2ZZC A;  4RSL A;  3H4K A;  3SYI A;  3NYE A;  1NDA A;  5HXI A;  2DKI A;  2X99 A;  1XDI A;  1FOH A;  4G6H A;  3ZDN A;  5L46 A;  4G6G A;  1PBE A;  2GAG B;  2RGH A;  3RHA A;  3AEA A;  1N4W A;  4GDP A;  1L9D A;  1KSU A;  5IQ1 A;  1KNP A;  2Q0L A;  2NPX A;  2QA1 A;  3FMW A;  4OPI A;  3JSK A;  3EAN A;  1PBF A;  5LV9 A;  4PAB A;  4YKF A;  1N4V A;  3QSS A;  3P4Q A;  3NT6 A;  4XXG A;  1VG0 A;  4E0V A;  4YSZ A;  1L9E A;  2BCG G;  4H7U A;  1NHS A;  3NLC A;  1H6V A;  1N1P A;  3BHF A;  2GH5 A;  4TM1 A;  4X4J A;  2BC1 A;  2BCP A;  2VVL G;  4H2N A;  1QLB A;  4EQW A;  1PXB A;  2RGO A;  2VZ2 A;  4Z2T A;  3R9U A;  1OJC A;  2R0G A;  2WEU A;  4CCR A;  4C3Y A;  2YR4 A;  2BS4 A;  2NVK X;  3RP8 A;  1E1L A;  1ZX9 A;  1GET A;  1GEU A;  4M52 A;  5BRT A;  2JBV A;  3QSE A;  1JRY A;  2BYB A;  2XFO A;  3L8K A;  2XVI A;  3UOV A;  3P1W A;  4K5R A;  4DGK A;  5EOW A;  4WCT A;  1EL8 A;  4IA5 A;  1FL2 A;  4TM4 A;  4AT0 A;  1ZDL A;  1FCD A;  3KPF A;  1O95 A;  2GR2 A;  1S2Q A;  2WPF A;  3PO7 A;  2O9Z A;  4CRT A;  1OJA A;  3NK0 X;  1QO8 A;  1DOC A;  3H8L A;  1Z6L A;  1LVL A;  1PHH A;  2WOI A;  4I59 A;  2JKC A;  1NAA A;  4USR A;  3EF6 A;  3NGC X;  5U1O A;  2W0H A;  4XWR A;  4Z26 A;  1TDE A;  1VDC A;  3RED A;  4J33 A;  3SZF A;  4J34 A;  1CHU A;  1IUV A;  1W4X A;  1DXL A;  2YLT A;  4BJY A;  2DKH A;  1L9C A;  1LQT A;  4U2S A;  1K4Q A;  3AWI A;  5KVI A;  2JB3 A;  4K8D A;  4UP3 A;  2YG5 A;  2WDQ A;  3CPH G;  1OJD A;  3CNP A;  1DOB A;  1DNC A;  3VRD B;  4J2W A;  3CGC A;  3B6D A;  4BV6 A;  2GB0 A;  2WPC A;  1EBD A;  3B3R A;  4APN A;  2YR6 A;  1YQ3 A;  3DH9 A;  3GWF A;  2JB1 A;  2QCU A;  2VRL A;  3KU9 A;  3LJP A;  4CNJ A;  1KF6 A;  4JDR A;  5EB4 A;  4B67 A;  4GDE A;  2XFN A;  3KD9 A;  1CC4 A;  4U8I A;  3ALJ A;  3DK8 A;  1JOA A;  2B76 A;  1K0L A;  1GXF A;  4K5S A;  1GT8 A;  3AEG A;  4K7Z A;  4OPG A;  4GUV A;  1PN0 A;  2EQ8 A;  1NHP A;  2FJD A;  3GDP A;  3M0O A;  4H4U A;  3V76 A;  1N4U A;  1CL0 A;  1GRH A;  1FEC A;  2XFP A;  3IC9 A;  4JY3 A;  4X9N A;  2PYX A;  4B65 A;  4G73 A;  1KFY A;  2WOV A;  3LZW A;  4II2 A;  2BK3 A;  5M0Z A;  4C5O A;  2YVG A;  1H84 A;  4H4P A;  1CJ4 A;  3I3L A;  4A5L A;  1H81 A;  4AP3 A;  4NNJ A;  1EL7 A;  2R4J A;  4U8N A;  1IJH A;  4A6N A;  1NEN A;  3GMB A;  4CCQ A;  2RGJ A;  3OZ2 A;  2XVF A;  3IHG A;  3ZYX A;  4C3X A;  1XAN A;  4B63 A;  1REO A;  3UKL A;  2B7S A;  3CMM A;  4Y4L A;  2CUL A;  2B9W A;  2B7R A;  3II4 A;  4REK A;  3SGL A;  4Z25 A;  2WU5 A;  1CBO A;  5KOW A;  4YSY A;  2ZBW A;  2C76 A;  5J60 A;  3LZX A;  2C73 A;  3IHM A;  5JCL A;  3AEE A;  4U8P A;  2FJE A;  4ZCC A;  3LB8 A;  3QFB A;  3QFA A;  5HYM A;  2EQ9 A;  4Z43 A;  3WE0 A;  3UOY A;  2R46 A;  3AXB A;  4JN9 A;  2YG4 A;  4U2T A;  3KVE A;  2OLN A;  2WOW A;  4JNA A;  3ALL A;  3GWD A;  4PAA A;  1KDG A;  1Q1R A;  4XWZ A;  5KXJ A;  2V6O A;  2CFY A;  2YG3 A;  3NN0 X;  5J7X A;  1ZKQ A;  4IA6 A;  5U25 A;  4EMI A;  2C65 A;  2PHH A;  2WS3 A;  3ALM A;  4ICY A;  2IID A;  3GMC A;  3T2Y A;  1NG4 A;  3LOV A;  1GRE A;  4DNA A;  3GSI A;  2BRA A;  2EQ7 A;  2WBA A;  3UOX A;  4JY2 A;  3K7M X;  3QVP A;  3DJG X;  1NHR A;  1JNR A;  3CN8 A;  1BGN A;  2TPR A;  1DOE A;  4EIQ A;  2BS3 A;  3NK2 X;  3NHO X;  2E1M A;  4NTC A;  4HA6 A;  2WET A;  4KPR A;  3D8X A;  4O5Q A;  1Y56 B;  3EPT A;  3T2K A;  1AOG A;  1D4D A;  4P9S A;  5ER0 A;  3AE6 A;  1E39 A;  2OAL A;  3NTD A;  3SQP A;  2I0Z A;  4EM4 A;  2YAU A;  4UDR A;  1PBD A;  1FEA A;  4B69 A;  3T2Z A;  4BUR A;  2Q6U A;  2GF3 A;  2WU2 A;  2WP6 A;  3COX A;  4NZH A;  3K30 A;  3SXI A;  1O5W A;  4AP1 A;  2ZZB A;  1MOK A;  4BK2 A;  3FBS A;  1E1N A;  1IUS A;  2GR0 A;  3AE1 A;  4O5U A;  4YSH A;  3VQR A;  2XLS A;  2X8G A;  3AED A;  1LV0 A;  5BVA A;  2E5V A;  2OAM A;  3DME A;  3T14 A;  2X50 A;  2XVJ A;  5KNL A;  4NEW A;  4GR1 A;  5M10 A;  5EBK A;  1X31 B;  3VRB A;  4BK3 A;  3NG7 X;  3F8R A;  4C74 A;  2YVF A;  5KMQ A;  5JCI A;  3UKK A;  1M6I A;  2GAH B;  3GYI A;  1TDO A;  3CGE A;  4TLZ A;  3SZ0 A;  1KSS A;  3ICT A;  2AQJ A;  3G5R A;  1UKV G;  1JEH A;  2WDV A;  4ECH A;  4GCM A;  2B9Y A;  2XLU A;  1JU2 A;  2V5Z A;  3GRT A;  3LXD A;  5CQF A;  4B66 A;  4B68 A;  4EQS A;  4G74 A;  2IVE A;  4H2R A;  1TYT A;  4YKG A;  3P9U A;  3KA7 A;  2BS2 A;  3RP6 A;  1D5T A;  3DA1 A;  2ZZ0 A;  2WP9 A;  1ELI A;  1H82 A;  3HYX A;  3NIX A;  1GRT A;  1GOS A;  2RAB A;  4FK1 A;  2Q0K A;  3UKH A;  2XLR A;  1EL9 A;  3I6D A;  3P4S A;  4U8O A;  1IUT A;  2XVH A;  3AEB A;  1VQW A;  2YR5 A;  3C4A A;  3DJJ A;  4YTP A;  4Z44 A;  2AR8 A;  1PS9 A;  4WX1 A;  3DJE A;  4AT2 A;  2FBW A;  3PS9 A;  5BUK A;  5KWF A;  1E6E A;  3Q6J A;  1DOD A;  3M13 A;  2CVJ A;  3UTF A;  3AE7 A;  3ABV A;  4MJW A;  3UP5 A;  3VRA A;  3CNT A;  3CND A;  4OCG A;  4CY6 A;  3CNJ A;  1CC2 A;  1RYI A;  4UDP A;  3GD4 A;  1MO9 A;  3AE8 A;  4GF7 A;  2C7G A;  1RSG A;  4RG4 A;  1B8S A;  3OC4 A;  3URH A;  1F8W A;  5KMP A;  2ARD A;  3S5W A;  1M64 A;  5KMR A;  2GMH A;  3CTY A;  4UDQ A;  2WPE A;  1CJ2 A;  2Y6R A;  2Z5X A;  2BAC A;  3H8I A;  3K7T A;  3NH3 X;  4RG3 A;  4H4X A;  5FS8 A;  3KPK A;  2YLS A;  1NEK A;  3AEF A;  4OPL A;  5DBJ A;  1QJD A;  3AD8 B;  3FG2 P;  2VVM A;  4H2Q A;  3NKS A;  4G9K A;  1O94 A;  1YQZ A;  2Q7V A;  3P4P A;  2X8H A;  4DSG A;  1H7X A;  1DJQ A;  4IVM B;  4YWO A;  2GQW A;  2OA1 A;  2WDR A;  2XDO A;  1F8R A;  1ZOY A;  3BNM A;  4K2X A;  2FJB A;  4CNK A;  1B5Q A;  3C4N A;  2WES A;  1CJ3 A;  3S61 A;  1V59 A;  1D7L A;  3AYJ A;  1XHC A;  4Z2R A;  2GR1 A;  2BK5 A;  4LII A;  4A9W A;  4YTM A;  2VQB A;  2XFU A;  3M12 A;  2H89 A;  2FJA A;  1H86 A;  2XFQ A;  3CGD A;  3GD3 A;  4U2L A;  2XYO A;  5HHF A;  1L0V A;  5JCK A;  2GR3 A;  4EMJ A;  1GRA A;  1BWC A;  2R45 A;  3G5Q A;  3L1R A;  5HY5 A;  4CBQ A;  2IVD A;  1GTH A;  4D03 A;  4EM3 A;  1D4E A;  1GPE A;  2JK6 A;  4Y4M A;  3DGZ A;  4FDC B;  3DK4 A;  3AE2 A;  3HZL A;  1S3E A;  1F6M A;  3NK1 X;  4H4Z A;  2BXS A;  4A65 A;  1H83 A;  3CNS A;  1S3B A;  3NRN A;  2YM1 A;  4YTN A;  3GRS A;  4GAV A;  5CKU A;  2JAE A;  3CGB A;  1PJ6 A;  4H2P A;  1K0J A;  1YKJ A;  2C67 A;  4HB9 A;  4IVO B;  1PJ7 A;  4JQ9 A;  4N9X A;  4U8K A;  4U8L A;  3SFE A;  3T31 A;  1BKW A;  3UKF A;  3NTA A;  2V3A A;  3NNE A;  3UTH A;  1PBB A;  3PVC A;  1GER A;  4A7A A;  2XLP A;  2BXR A;  1GES A;  3UTG A;  1H7W A;  1B37 A;  1VRQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...