2XLTA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with 3-acetylpyridine adenine dinucleotide phosphate (apadp)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
b'ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA02
3SFDA 1IUWA 1PHHA 3F8RA 3LXDA 4H2QA 1CJ2A 1VG0A 4UDQA 4CY6A 3CTYA 1HYUA 1K4QA 3ADAB 4MJWA 2QA2A 3P1WA 4B64A 2APGA 2C65A 1PXAA 1OJTA 2JB1A 3KLJA 4AOXA 4U8LA 1VQWA 3UKFA 4O5QA 2YR4A 2WU2A 3CIRA 3JSKA 1L9CA 3DK8A 3OZ2A 2EQ9A 4FX9A 4TLZA 3LZXA 3AECA 2VQ7A 3UTGA 2ZZBA 2WOVA 4TM0A 3AYIA 1ZMCA 2GMHA 4X4JA 4B66A 1TDEA 2CFYA 1ZOYA 5KWFA 3DJEA 1KF6A 2WEUA 2OLOA 2V61A 3AD7B 2C75A 2WP5A 2XCGA 4GDEA 5JCKA 1KSUA 4CCRA 2WP9A 3V3OA 3DJGX 3C4AA 1DOBA 2XLRA 3UCLA 3VR9A 3AE1A 4EIQA 2BCPA 4H4YA 4U2SA 3M12A 4JQ9A 3S61A 4IVOB 3AE8A 5M10A 1GRTA 5ER0A 2PHHA 4K8DA 1Z6LA 1PBFA 1W4XA 3ISHA 1NHRA 3AYLA 4Y4NA 1REOA 3SQPA 2BS4A 1AOGA 4AT0A 4NTEA 4D04A 4UP3A 1D4CA 1L9DA 4OPIA 2AR8A 2BABA 2Q7VA 3AD8B 1KNRA 1FEBA 4WX1A 2C76A 2GH5A 3V3NA 1N4UA 4A65A 4BV6A 1B5QA 1MOKA 4EM3A 2OALA 3QVRA 3RP8A 2NPXA 1D5TA 1GRAA 1PJ6A 2YG6A 1CC2A 3NN6X 4U8JA 1GESA 3SFEA 3BI4A 1EL5A 3UKPA 3DA1A 1PBDA 1TRBA 2YLZA 1YQ3A 2JK6A 1BGJA 3AXBA 4GR1A 1O95A 3S5WA 2X8GA 1ZP0A 2W0HA 2YLWA 1GEUA 4U8KA 3LADA 1E6EA 1LQTA 3QVPA 1H82A 1PJ7A 5U63A 3ICRA 1DXLA 4IVMB 3BHKA 3PO7A 4RG3A 3GYIA 3SM8A 5EOWA 4OPGA 5JCNA 5CKUA 2E5VA 5HHFA 1VG9A 3CN8A 4B65A 4EQXA 3RP7A 4H4XA 2VVLG 3DMEA 2JBVA 1NEKA 1NENA 3BNMA 3D1CA 2OA1A 5GSNA 4Y4LA 3AE4A 4CNKA 4O5UA 1E39A 4X9NA 1OJDA 3BHFA 5DBJA 1L0VA 5TR3A 1F3PA 1LJ1A 4NEWA 2YM1A 3LZWA 2JAEA 3QJ4A 2JB3A 3DH9A 4U8IA 5KVIA 4B69A 3CGDA 1JNZA 1FCDA 1F8RA 2C66A 4EQWA 2R4JA 2VQBA 5FS7A 3P4SA 4HB9A 1DJQA 2C3CA 2BK3A 1KDGA 2V3AA 4BK3A 1K0IA 1IJHA 2YG3A 3F8PA 2HQMA 2C3DA 1Y56B 1D7YA 1K0LA 4FDCB 3NRNA 1XHCA 3LJPA 1XANA 4U8PA 3HZLA 2XVJA 3P4RA 4DNAA 1X31B 4GDPA 4DGKA 2BS3A 1E1MA 2B9YA 3NYEA 2EQ8A 2JKCA 2FJBA 4U2TA 4USQA 3K30A 4YSXA 3AEBA 3CNDA 3T37A 4C77A 1EL9A 1LVLA 1YY5A 2XVEA 3AEAA 1PBBA 2BACA 2R4EA 3AYJA 2YWLA 2XLPA 3PVCA 1NPXA 2WETA 2X8HA 4RSLA 3VRDB 1GXFA 1YQZA 3UKQA 2GQFA 2V6OA 1B37A 2GEWA 1PS9A 4LU6A 3KD9A 4RG4A 3AE7A 2C67A 5IQ1A 2ZZCA 4J2WA 4KX6A 3G5QA 4LIIA 2YG5A 3FG2P 1NHPA 2WESA 4A6NB 4H2RA 4OPDA 2XLUA 3AEFA 3KA7A 2EQ7A 5IQ4A 5KOWA 1BGNA 1FOHA 3AE9A 3D8XA 3ICTA 4H4ZA 4H4SA 2YLXA 4EM4A 2YLRA 1PXBA 4U8NA 2WPEA 2WP6A 1ZY8A 1DOCA 3REDA 4BK2A 3FPZA 5HXIA 4ZCDA 3QSEA 3IC9A 1VRQB 4FK1A 1S2QA 2FBWA 2AQJA 4IA6A 4NTDA 4TM1A 4GCMA 1JU2A 4A99A 4B68A 5BVAA 4N9XA 1E1LA 3QFBA 2BCGG 4ECHA 4ADWA 4YSZA 5C2TA 1GOSA 4K5RA 3UTHA 1NHQA 1RSGA 2VOUA 3ICSA 3NK1X 2XFUA 3V76A 4J57A 1GERA 3CGEA 3EAOA 1ZDLA 2C70A 4AOSA 1IUVA 1ONFA 2C64A 2C7GA 1N4WA 2PYXA 4YKGA 3CNSA 3P4PA 1GTHA 3LB8A 4Z26A 4OPCA 3URHA 2IIDA 3CPJG 1Y56A 2Q0KA 1SEZA 3K7MX 3ALLA 4YWOA 4C3YA 1GALA 2RGOA 4ICYA 2OAMA 4Z43A 2FJDA 1JRYA 2WS3A 3Q9TA 4J33A 1CJ4A 4AP1A 4BJZA 2EQ6A 3F8DA 3GSIA 1D7LA 5L46A 2GMJA 1PJ5A 3M13A 2VZ2A 3CGCA 3ALJA 3GMBA 1O94A 3ITJA 2QA1A 2VRLA 4K22A 1DODA 3B6DA 4IV9A 4JY3A 1Y0PA 2WDQA 4A7AA 4H4UA 1PN0A 2C73A 3KPFA 3CPIG 3UOYA 4DSGA 4XWRA 5EBKA 3VRAA 2XFQA 1GRBA 1ZOVA 4ZCCA 2B7RA 4Z2UA 5IPYA 5U25A 2X3NA 4JNAA 4OPTA 2WOIA 1P2HA 1QO8A 2TMDA 4NEVA 3WE0A 4WCTA 5GRTA 4BURA 4B63A 1DOEA 3ZDNA 1CHUA 4TM4A 3BNUA 3FIMB 5FS9A 3UKLA 4PAAA 2YM2A 3QSSA 1YQ4A 3GWFA 2FJAA 4H4VA 3AE5A 3AEGA 4NZHA 2XVHA 2B9XA 5U1OA 3RNMA 1GRHA 2B7SA 1GTEA 2WDRA 3NKSA 1JNRA 4OCGA 2BXSA 2QCUA 5CQFA 4H4RA 1CC6A 4BK1A 1NG3A 3II4A 4IA5A 1H7XA 3NK2X 2V3BA 4C74A 3KKJA 3OC4A 4GF7A 5FS8A 3IHGA 3GD4A 3DK4A 1TYTA 4CBQA 3NK0X 1QJDA 2YQUA 3GDPA 1UKVG 4Z44A 3UOZA 4OVIA 1TDNA 4JY2A 4ZN0A 1P2EA 1MO9A 3COXA 4U8MA 2Q6UA 1CBOA 2XFOA 4AP3A 2A87A 1M6IA 1S2YA 3NHOX 3UKHA 2YR5A 2GAGB 2R45A 4E0VA 1E7PA 3PS9A 3RHAA 4M52A 4YSYA 4Y4MA 4CRTA 2ACZA 4A9WA 3UP5A 2R9ZA 1L9EA 2XVIA 1H84A 3CNJA 3H4KA 1ZKQA 2XVFA 4H2NA 4HA6A 2GR3A 2YVGA 3O0HA 5EB5A 1BKWA 2WQYA 1BWCA 1OJ9A 3DK9A 3L8KA 2IVDA 4EQRA 3UKKA 3L1RA 2H88A 4KPRA 1CJCA 5BULA 4H50A 5JCMA 1PBCA 3DJDA 2X8CA 1TDKA 2GR2A 4EQSA 4Z25A 5BUKA 3DJJA 1GPEA 1ZX9A 4YSHA 3FBSA 4Z2RA 2A89A 4K5SA 2WBAA 2OLNA 2GRTA 2X50A 5KXJA 3H8IA 1FL2A 1RYIA 2QAEA 3FMWA 3GWDA 3NN0X 1YKJA 3GYJA 3UP4A 5KOXA 3NYFA 1M64A 2AAQA 2BC1A 2Y6QA 3IF9A 4I58A 1V59A 1F6MA 4XXGA 5KVHA 4EMIA 4K7ZA 4Z24A 1DNCA 2R0GA 4OPLA 3R9UA 1D4DA 2Z5XA 1NG4A 4Z2TA 1JRZA 2BYBA 2CULA 2WHDA 1GNDA 1GREA 2YG4A 3AEDA 4I59A 2WPFA 3AE2A 2B76A 1EL7A 2E4GA 4BJYA 1NAAA 1EBDA 2E1MA 3BI5A 1MXTA 3CPHG 1FECA 2VVMA 3IHMA 2BC0A 3P9UA 2YR6A 4H2PA 3RP6A 5JCLA 4A79A 3ATRA 1E1NA 2F5ZA 3M0OA 5HYMA 3IWAA 2ZZ0A 4PABA 1E1KA 2NVKX 4USRA 3QSMA 1OJCA 4FK1C 2XLSA 2J3NA 2FJEA 2XFPA 2YVFA 1GETA 3CNTA 1OJAA 3GDNA 3CGBA 1B8SA 2Z5YA 2RGHA 3VR8A 4JN9A 4NTCA 2IVEA 4GUVA 2XLTA 4H4WA 1K0JA 4J34A 1CC4A 2GR0A 2WU5A 5FS6A 2BK5A 4K2XA 1IUXA 4U2LA 2BXRA 2GVCA 2WPCA 2RABA 3E1TA 3VRBA 4YTNA 5JCIA 4CY8A 1H81A 1H83A 1QLBA 3BI2A 4H4QA 3C96A 1GRGA 1GRFA 1LTXR 2Y6RA 1DJNA 3GMCA 3GRTA 1Q1RA 3DGZA 4CNJA 2YAUA 3NLCA 1H86A 3QFAA 2R0CA 4YTPA 5FMHA 5J7XA 4A5LA 2Q0LA 4JDRA 3AB1A 1GSNA 2XDOA 1H7WA 2V5ZA 3UTFA 2GB0A 1PDHA 3UTEA 2YLTA 4H4PA 4LA1A 1IUSA 1S3EA 1ZK7A 2BA9A 3GD3A 1EL8A 3NGCX 5J60A 1KSSA 3K7TA 2XFNA 1IUTA 4A6NA 4CCQA 3I3LA 3ABVA 2BS2A 5EB4A 4YT0A 4DSHA 2GR1A 1F8SA 3H8LA 3KU9A 4EMWA 1XDIA 3UKAA 2RGJA 4B67A 1JOAA 1GT8A 5C3JA 4H4TA 2BK4A 3NG7X 2WDVA 3G5SA 1GV4A 2GQWA 1NDAA 1TDFA 1TDOA 2H89A 3VQRA 4TM3A 5M0ZA 2JB2A 2YLSA 3AE3A 5BRTA 1KFYA 3CNPA 1H6VA 1N1PA 4AT2A 4OPUA 3NTAA 4H7UA 2X99A 1KNPA 4APNA 2ARDA 3ALMA 2I0ZA 2ZBWA 2UZZA 4P9SA 3EANA 1RP0A 4TLXA 3EPTA 3Q6JA 1ELIA 1LQUA 2GF3A 2V60A 1LPFA 1S3BA 2DKIA 3UOXA 1PXCA 2DKHA 3AEEA 2A8XA 3NT6A 2VRMA 4JNQA 1NHSA 3NNEA 4REKA 1IUUA 3B3RA 2C72A 1ZMDA 1CJ3A 4EMJA 3NTDA 4UDPA 1XPQA 1CF3A 1JRXA 3GRSA 3UOVA 1BF3A 2GAHB 3I6DA 2R46A 1D4EA 2CDUA 3ZYXA 1PBEA 1F8WA 4J36A 4YTMA 5KRQA 1Q9IA 3P4QA 1B4VA 2WOWA 4YKFA 3SGLA 1Q1WA 3EF6A 3AD9B 1LV0A 3G5RA 4B1BA 1FEAA 1TYPA 3ATQA 3LOVA 4D03A 5LV9A 2XYOA 4C3XA 2YG7A 3C4NA 2YVJA 3K7QX 1JEHA 3NIXA 1BZLA 4GRTA 1CL0A 4C5OA 2GV8A 2B9WA 5HY5A 3AWIA 4YXDA 3AE6A 4J56A 1VDCA 3NYCA 4EIPA 4J31A 3KVEA 2VVLA 3DGHA 1N4VA 4XWZA 1COYA 2TPRA 2CVJA 3NH3X 4U8OA 1O5WA 2R0PA 4UDRA 4X9MA 2O9ZA
chains in the Genus database with same CATH superfamily
3SFDA 1IUWA 1PHHA 3F8RA 3LXDA 4H2QA 1CJ2A 1VG0A 4UDQA 4CY6A 3CTYA 1HYUA 1K4QA 3ADAB 4MJWA 2QA2A 3P1WA 4GAPA 4B64A 2APGA 2C65A 1PXAA 1OJTA 2JB1A 3KLJA 4AOXA 4U8LA 1VQWA 3UKFA 4O5QA 2YR4A 2WU2A 3CIRA 3JSKA 1L9CA 3DK8A 3OZ2A 2EQ9A 4FX9A 4TLZA 3LZXA 3AECA 2VQ7A 3UTGA 2ZZBA 2WOVA 4TM0A 3AYIA 1ZMCA 2GMHA 4X4JA 4B66A 1TDEA 2CFYA 1ZOYA 5KWFA 3DJEA 1KF6A 2WEUA 2OLOA 2V61A 3AD7B 2C75A 2WP5A 2XCGA 4GDEA 5JCKA 1KSUA 4CCRA 2WP9A 3V3OA 3DJGX 3C4AA 1DOBA 2XLRA 3UCLA 3VR9A 3AE1A 4EIQA 2BCPA 4H4YA 4U2SA 3M12A 4JQ9A 3S61A 4IVOB 3AE8A 5M10A 1GRTA 5ER0A 2PHHA 4K8DA 1Z6LA 1PBFA 1W4XA 3ISHA 1NHRA 3AYLA 4Y4NA 1REOA 3SQPA 2BS4A 1AOGA 4AT0A 4NTEA 4D04A 4UP3A 1D4CA 1L9DA 4OPIA 2AR8A 2BABA 2BRYA 2Q7VA 4G73A 3AD8B 5KMSA 1KNRA 1FEBA 4WX1A 2C76A 2GH5A 3V3NA 1N4UA 4A65A 4BV6A 3KPKA 1B5QA 1MOKA 4EM3A 2OALA 3QVRA 3RP8A 2NPXA 1D5TA 1GRAA 1PJ6A 2YG6A 1CC2A 3NN6X 4U8JA 1GESA 3SFEA 3SYIA 3HYWA 3BI4A 1EL5A 3UKPA 2BRAA 3DA1A 1PBDA 1TRBA 2YLZA 1YQ3A 2JK6A 1BGJA 3T14A 3AXBA 4GR1A 1O95A 3S5WA 2X8GA 1ZP0A 2W0HA 2YLWA 1GEUA 4U8KA 3LADA 1E6EA 1LQTA 3QVPA 1H82A 1PJ7A 5U63A 3ICRA 1DXLA 4IVMB 3BHKA 3PO7A 4RG3A 3GYIA 3SM8A 5EOWA 4OPGA 5JCNA 5CKUA 2E5VA 5HHFA 1VG9A 3CN8A 4B65A 4EQXA 3RP7A 4H4XA 2VVLG 3DMEA 2JBVA 1NEKA 1NENA 3BNMA 3D1CA 2OA1A 5GSNA 4Y4LA 3AE4A 4CNKA 4O5UA 1E39A 4X9NA 1OJDA 3BHFA 5DBJA 4II2A 5TR3A 1L0VA 1F3PA 1LJ1A 4NEWA 2YM1A 3LZWA 2JAEA 3QJ4A 2JB3A 3DH9A 4U8IA 5KVIA 4B69A 3CGDA 1JNZA 1FCDA 5KMPA 1F8RA 2C66A 4EQWA 2R4JA 2VQBA 5FS7A 3P4SA 4HB9A 1DJQA 2C3CA 2BK3A 1KDGA 2V3AA 4BK3A 1K0IA 1IJHA 2YG3A 3F8PA 2HQMA 2C3DA 1Y56B 1D7YA 1K0LA 4FDCB 3NRNA 1XHCA 3LJPA 1XANA 4U8PA 3HZLA 2XVJA 5KMRA 3P4RA 4DNAA 1X31B 4G74A 4GDPA 4DGKA 2BS3A 1E1MA 2B9YA 3NYEA 2EQ8A 2JKCA 2FJBA 4U2TA 4USQA 3K30A 4YSXA 3AEBA 3CNDA 3T37A 4C77A 5KMQA 1EL9A 1LVLA 1YY5A 2XVEA 3AEAA 1PBBA 2BACA 2R4EA 3AYJA 2YWLA 2XLPA 3PVCA 1NPXA 3T0KA 2WETA 2X8HA 4RSLA 3VRDB 1GXFA 1YQZA 3UKQA 2GQFA 2V6OA 1B37A 2GEWA 1PS9A 4LU6A 3KD9A 4RG4A 3AE7A 2C67A 5IQ1A 2ZZCA 4J2WA 4KX6A 3G5QA 4LIIA 2YG5A 3FG2P 1NHPA 2WESA 4A6NB 4H2RA 4OPDA 4NNJA 2XLUA 3AEFA 3KA7A 2EQ7A 5IQ4A 5KOWA 1BGNA 1FOHA 3AE9A 3D8XA 3ICTA 4H4ZA 4H4SA 2YLXA 4EM4A 2YLRA 3GYXA 1PXBA 4U8NA 2WPEA 2WP6A 1ZY8A 1DOCA 3REDA 4BK2A 3FPZA 5HXIA 4ZCDA 3QSEA 3IC9A 1VRQB 4FK1A 1S2QA 2FBWA 2AQJA 4IA6A 4NTDA 4TM1A 4GCMA 1JU2A 4A99A 4B68A 5BVAA 4N9XA 1E1LA 3QFBA 2BCGG 4ECHA 4ADWA 4YSZA 2C4CA 5C2TA 1GOSA 4K5RA 3UTHA 1NHQA 1RSGA 2VOUA 3ICSA 3NK1X 2XFUA 3V76A 4J57A 1GERA 3CGEA 3EAOA 1ZDLA 2C70A 4AOSA 1IUVA 1ONFA 2C64A 2C7GA 1N4WA 2PYXA 4YKGA 3CNSA 3P4PA 1GTHA 3LB8A 4Z26A 4OPCA 3URHA 2IIDA 3CPJG 1Y56A 2Q0KA 1SEZA 3K7MX 3ALLA 4YWOA 4C3YA 1GALA 2RGOA 4ICYA 2OAMA 4Z43A 2FJDA 1JRYA 2WS3A 3Q9TA 4J33A 1CJ4A 4AP1A 4BJZA 2EQ6A 3F8DA 3GSIA 1D7LA 5L46A 2GMJA 1PJ5A 3M13A 2VZ2A 3CGCA 3ALJA 3GMBA 1O94A 3ITJA 2QA1A 2VRLA 4K22A 1DODA 3B6DA 4IV9A 4JY3A 1Y0PA 2WDQA 4A7AA 4H4UA 1PN0A 2C73A 3KPFA 3CPIG 3UOYA 4DSGA 4XWRA 5EBKA 3T2KA 2XFQA 1GRBA 1ZOVA 4ZCCA 2B7RA 3VRAA 4Z2UA 5U25A 5IPYA 2X3NA 4JNAA 4OPTA 2WOIA 1P2HA 1QO8A 2TMDA 4NEVA 3WE0A 4WCTA 5GRTA 4BURA 4B63A 1DOEA 3ZDNA 1CHUA 4TM4A 3BNUA 3FIMB 5FS9A 3UKLA 4PAAA 2YM2A 3QSSA 1YQ4A 3GWFA 2FJAA 4H4VA 3AE5A 3AEGA 4NZHA 2XVHA 2B9XA 5U1OA 3RNMA 1GRHA 2B7SA 1GTEA 2WDRA 3NKSA 1JNRA 4OCGA 2BXSA 2QCUA 5CQFA 4H4RA 1CC6A 4BK1A 1NG3A 3II4A 4IA5A 1H7XA 3NK2X 2V3BA 4C74A 3KKJA 3OC4A 4GF7A 5FS8A 3IHGA 3GD4A 5KRQA 3DK4A 1TYTA 4CBQA 5KNLA 3NK0X 1QJDA 2YQUA 3GDPA 1UKVG 4Z44A 3UOZA 4OVIA 1TDNA 4JY2A 4ZN0A 1P2EA 1MO9A 3COXA 4U8MA 2Q6UA 1CBOA 2XFOA 4AP3A 4GAVA 2A87A 1M6IA 1S2YA 3NHOX 3UKHA 2YR5A 2GAGB 2R45A 4E0VA 1E7PA 3PS9A 3RHAA 4M52A 4YSYA 4Y4MA 3SZ0A 4CRTA 2ACZA 4II3A 4A9WA 3UP5A 2R9ZA 1L9EA 2XVIA 1H84A 3CNJA 3H4KA 1ZKQA 2XVFA 4H2NA 4HA6A 2GR3A 2YVGA 3O0HA 5EB5A 1BKWA 2WQYA 1BWCA 1OJ9A 3DK9A 3L8KA 2IVDA 4EQRA 3UKKA 3L1RA 2H88A 4KPRA 1CJCA 5BULA 4H50A 5JCMA 1PBCA 3DJDA 2X8CA 1TDKA 2GR2A 4EQSA 4Z25A 5BUKA 3DJJA 1GPEA 1ZX9A 4YSHA 3FBSA 4Z2RA 2A89A 4K5SA 2WBAA 2OLNA 2GRTA 2X50A 3HYVA 5KXJA 3H8IA 1FL2A 1RYIA 2QAEA 3FMWA 3GWDA 3NN0X 1YKJA 3GYJA 3UP4A 5KOXA 3NYFA 1M64A 2AAQA 2BC1A 2Y6QA 3IF9A 4I58A 3SX6A 1V59A 1F6MA 4XXGA 5KVHA 4EMIA 4K7ZA 4Z24A 1DNCA 2R0GA 4OPLA 3R9UA 1D4DA 2Z5XA 1NG4A 4G9KA 4Z2TA 1JRZA 2BYBA 2CULA 2WHDA 1GNDA 1GREA 2YG4A 3AEDA 4I59A 2WPFA 3AE2A 2B76A 1EL7A 2E4GA 4BJYA 1NAAA 1EBDA 2E1MA 3BI5A 1MXTA 3CPHG 1FECA 2VVMA 3IHMA 2BC0A 3P9UA 2YR6A 4H2PA 3RP6A 5JCLA 4A79A 3ATRA 1E1NA 2F5ZA 3M0OA 5HYMA 3IWAA 2ZZ0A 4PABA 1E1KA 2NVKX 4USRA 3QSMA 1OJCA 3SXIA 4FK1C 2XLSA 2J3NA 2FJEA 2XFPA 2YVFA 1GETA 3CNTA 1OJAA 3GDNA 3CGBA 1B8SA 2Z5YA 2RGHA 3VR8A 4G6HA 4JN9A 4NTCA 2IVEA 4GUVA 2XLTA 4H4WA 1K0JA 4J34A 1CC4A 2GR0A 2WU5A 5FS6A 2BK5A 4K2XA 1IUXA 4U2LA 2BXRA 2GVCA 2WPCA 2RABA 3E1TA 3VRBA 4YTNA 5JCIA 4CY8A 1H81A 1H83A 1QLBA 3BI2A 4H4QA 3C96A 1GRGA 1GRFA 1LTXR 2Y6RA 1DJNA 3GMCA 3GRTA 1Q1RA 3DGZA 4CNJA 2YAUA 3NLCA 1H86A 3QFAA 2R0CA 4YTPA 5FMHA 5J7XA 3SZWA 4A5LA 2Q0LA 4JDRA 3AB1A 1GSNA 2XDOA 1H7WA 2V5ZA 3UTFA 2GB0A 1PDHA 3UTEA 2YLTA 4H4PA 4LA1A 1IUSA 1S3EA 1ZK7A 2BA9A 3GD3A 1EL8A 3T31A 3NGCX 5J60A 1KSSA 3K7TA 4NWZA 2XFNA 1IUTA 4A6NA 4CCQA 3I3LA 3ABVA 2BS2A 5EB4A 4YT0A 4DSHA 2GR1A 1F8SA 3H8LA 3KU9A 4EMWA 1XDIA 3UKAA 2RGJA 4B67A 1JOAA 1GT8A 5C3JA 4H4TA 2BK4A 3NG7X 2WDVA 3G5SA 1GV4A 2GQWA 3CMMA 1NDAA 1TDFA 1TDOA 2H89A 3VQRA 4TM3A 5M0ZA 2JB2A 2YLSA 3AE3A 5BRTA 1KFYA 3CNPA 1H6VA 1N1PA 4AT2A 4OPUA 3NTAA 4H7UA 2X99A 1KNPA 4APNA 2ARDA 3ALMA 2I0ZA 2ZBWA 2UZZA 4P9SA 3EANA 1RP0A 4TLXA 3EPTA 3Q6JA 2GF3A 1ELIA 1LQUA 2V60A 1LPFA 2DKIA 1S3BA 3UOXA 1PXCA 2DKHA 3AEEA 2A8XA 3T2YA 3NT6A 2VRMA 4JNQA 1NHSA 3NNEA 3T2ZA 4REKA 1IUUA 3B3RA 2C72A 1ZMDA 1CJ3A 4EMJA 3NTDA 4UDPA 1XPQA 3SZFA 1CF3A 1JRXA 3GRSA 3UOVA 1BF3A 2GAHB 3I6DA 2R46A 1D4EA 2CDUA 3ZYXA 1PBEA 1F8WA 4J36A 4YTMA 3SY4A 1Q9IA 3P4QA 1B4VA 2WOWA 4YKFA 3SGLA 1Q1WA 3EF6A 3AD9B 1LV0A 3G5RA 3HYXA 4B1BA 1FEAA 1TYPA 3ATQA 3LOVA 4G6GA 4D03A 5LV9A 2XYOA 4C3XA 2YG7A 3C4NA 2YVJA 3K7QX 1JEHA 3NIXA 1BZLA 4GRTA 1CL0A 4C5OA 2GV8A 3SZCA 2B9WA 5HY5A 3AWIA 4YXDA 3AE6A 4J56A 1VDCA 3NYCA 4EIPA 4J31A 3KVEA 2VVLA 3DGHA 1N4VA 4XWZA 1COYA 2TPRA 2CVJA 3NH3X 4U8OA 1O5WA 2R0PA 4UDRA 4X9MA 2O9ZA
chains in the Genus database with same CATH topology
3SFDA 1IUWA 1PHHA 3F8RA 3LXDA 4H2QA 1CJ2A 1VG0A 4UDQA 4CY6A 3CTYA 1HYUA 1K4QA 3ADAB 4MJWA 2QA2A 3P1WA 4GAPA 4B64A 2APGA 2C65A 1PXAA 1OJTA 2JB1A 3KLJA 4AOXA 4U8LA 1VQWA 3UKFA 4O5QA 2YR4A 2WU2A 3CIRA 3JSKA 1L9CA 3DK8A 3OZ2A 2EQ9A 4FX9A 4TLZA 3LZXA 3AECA 2VQ7A 3UTGA 2ZZBA 2WOVA 4TM0A 3AYIA 1ZMCA 2GMHA 4X4JA 4B66A 1TDEA 2CFYA 1ZOYA 5KWFA 3DJEA 1KF6A 2WEUA 2OLOA 2V61A 3AD7B 2C75A 2WP5A 2XCGA 4GDEA 5JCKA 1KSUA 4CCRA 2WP9A 3V3OA 3DJGX 3C4AA 1DOBA 2XLRA 3UCLA 3VR9A 3AE1A 4EIQA 2BCPA 4H4YA 4U2SA 3M12A 4JQ9A 3S61A 4IVOB 3AE8A 5M10A 1GRTA 5ER0A 2PHHA 4K8DA 1Z6LA 1PBFA 1W4XA 3ISHA 1NHRA 3AYLA 4Y4NA 1REOA 3SQPA 2BS4A 1AOGA 4AT0A 4NTEA 4D04A 4UP3A 1D4CA 1L9DA 4OPIA 2AR8A 2BABA 2BRYA 2Q7VA 4G73A 3AD8B 5KMSA 1KNRA 1FEBA 4WX1A 2C76A 2GH5A 3V3NA 1N4UA 4A65A 4BV6A 3KPKA 1B5QA 1MOKA 4EM3A 2OALA 3QVRA 3RP8A 2NPXA 1D5TA 1GRAA 1PJ6A 2YG6A 1CC2A 3NN6X 4U8JA 1GESA 3SFEA 3SYIA 3HYWA 3BI4A 1EL5A 3UKPA 2BRAA 3DA1A 1PBDA 1TRBA 2YLZA 1YQ3A 2JK6A 1BGJA 3T14A 3AXBA 4GR1A 1O95A 3S5WA 2X8GA 1ZP0A 2W0HA 2YLWA 1GEUA 4U8KA 3LADA 1E6EA 1LQTA 3QVPA 1H82A 1PJ7A 5U63A 3ICRA 1DXLA 4IVMB 3BHKA 3PO7A 4RG3A 3GYIA 3SM8A 5EOWA 4OPGA 5JCNA 5CKUA 2E5VA 5HHFA 1VG9A 3CN8A 4B65A 4EQXA 3RP7A 4H4XA 2VVLG 3DMEA 2JBVA 1NEKA 1NENA 3BNMA 3D1CA 2OA1A 5GSNA 4Y4LA 3AE4A 4CNKA 4O5UA 1E39A 4X9NA 1OJDA 3BHFA 5DBJA 4II2A 5TR3A 1L0VA 1F3PA 1LJ1A 4NEWA 2YM1A 3LZWA 2JAEA 3QJ4A 2JB3A 3DH9A 4U8IA 5KVIA 4B69A 3CGDA 1JNZA 1FCDA 5KMPA 1F8RA 2C66A 4EQWA 2R4JA 2VQBA 5FS7A 3P4SA 4HB9A 1DJQA 2C3CA 2BK3A 1KDGA 2V3AA 4BK3A 1K0IA 1IJHA 2YG3A 3F8PA 2HQMA 2C3DA 1Y56B 1D7YA 1K0LA 4FDCB 3NRNA 1XHCA 3LJPA 1XANA 4U8PA 3HZLA 2XVJA 5KMRA 3P4RA 4DNAA 1X31B 4G74A 4GDPA 4DGKA 2BS3A 1E1MA 2B9YA 3NYEA 2EQ8A 2JKCA 2FJBA 4U2TA 4USQA 3K30A 4YSXA 3AEBA 3CNDA 3T37A 4C77A 5KMQA 1EL9A 1LVLA 1YY5A 2XVEA 3AEAA 1PBBA 2BACA 2R4EA 3AYJA 2YWLA 2XLPA 3PVCA 1NPXA 3T0KA 2WETA 2X8HA 4RSLA 3VRDB 1GXFA 1YQZA 3UKQA 2GQFA 2V6OA 1B37A 2GEWA 1PS9A 4LU6A 3KD9A 4RG4A 3AE7A 2C67A 5IQ1A 2ZZCA 4J2WA 4KX6A 3G5QA 4LIIA 2YG5A 3FG2P 1NHPA 2WESA 4A6NB 4H2RA 4OPDA 4NNJA 2XLUA 3AEFA 3KA7A 2EQ7A 5IQ4A 5KOWA 1BGNA 1FOHA 3AE9A 3D8XA 3ICTA 4H4ZA 4H4SA 2YLXA 4EM4A 2YLRA 3GYXA 1PXBA 4U8NA 2WPEA 2WP6A 1ZY8A 1DOCA 3REDA 4BK2A 3FPZA 5HXIA 4ZCDA 3QSEA 3IC9A 1VRQB 4FK1A 1S2QA 2FBWA 2AQJA 4IA6A 4NTDA 4TM1A 4GCMA 1JU2A 4A99A 4B68A 5BVAA 4N9XA 1E1LA 3QFBA 2BCGG 4ECHA 4ADWA 4YSZA 2C4CA 5C2TA 1GOSA 4K5RA 3UTHA 1NHQA 1RSGA 2VOUA 3ICSA 3NK1X 2XFUA 3V76A 4J57A 1GERA 3CGEA 3EAOA 1ZDLA 2C70A 4AOSA 1IUVA 1ONFA 2C64A 2C7GA 1N4WA 2PYXA 4YKGA 3CNSA 3P4PA 1GTHA 3LB8A 4Z26A 4OPCA 3URHA 2IIDA 3CPJG 1Y56A 2Q0KA 1SEZA 3K7MX 3ALLA 4YWOA 4C3YA 1GALA 2RGOA 4ICYA 2OAMA 4Z43A 2FJDA 1JRYA 2WS3A 3Q9TA 4J33A 1CJ4A 4AP1A 4BJZA 2EQ6A 3F8DA 3GSIA 1D7LA 5L46A 2GMJA 1PJ5A 3M13A 2VZ2A 3CGCA 3ALJA 3GMBA 1O94A 3ITJA 2QA1A 2VRLA 4K22A 1DODA 3B6DA 4IV9A 4JY3A 1Y0PA 2WDQA 4A7AA 4H4UA 1PN0A 2C73A 3KPFA 3CPIG 3UOYA 4DSGA 4XWRA 5EBKA 3T2KA 2XFQA 1GRBA 1ZOVA 4ZCCA 2B7RA 3VRAA 4Z2UA 5U25A 5IPYA 2X3NA 4JNAA 4OPTA 2WOIA 1P2HA 1QO8A 2TMDA 4NEVA 3WE0A 4WCTA 5GRTA 4BURA 4B63A 1DOEA 3ZDNA 1CHUA 4TM4A 3BNUA 3FIMB 5FS9A 3UKLA 4PAAA 2YM2A 3QSSA 1YQ4A 3GWFA 2FJAA 4H4VA 3AE5A 3AEGA 4NZHA 2XVHA 2B9XA 5U1OA 3RNMA 1GRHA 2B7SA 1GTEA 2WDRA 3NKSA 1JNRA 4OCGA 2BXSA 2QCUA 5CQFA 4H4RA 1CC6A 4BK1A 1NG3A 3II4A 4IA5A 1H7XA 3NK2X 2V3BA 4C74A 3KKJA 3OC4A 4GF7A 5FS8A 3IHGA 3GD4A 5KRQA 3DK4A 1TYTA 4CBQA 5KNLA 3NK0X 1QJDA 2YQUA 3GDPA 1UKVG 4Z44A 3UOZA 4OVIA 1TDNA 4JY2A 4ZN0A 1P2EA 1MO9A 3COXA 4U8MA 2Q6UA 1CBOA 2XFOA 4AP3A 4GAVA 2A87A 1M6IA 1S2YA 3NHOX 3UKHA 2YR5A 2GAGB 2R45A 4E0VA 1E7PA 3PS9A 3RHAA 4M52A 4YSYA 4Y4MA 3SZ0A 4CRTA 2ACZA 4II3A 4A9WA 3UP5A 2R9ZA 1L9EA 2XVIA 1H84A 3CNJA 3H4KA 1ZKQA 2XVFA 4H2NA 4HA6A 2GR3A 2YVGA 3O0HA 5EB5A 1BKWA 2WQYA 1BWCA 1OJ9A 3DK9A 3L8KA 2IVDA 4EQRA 3UKKA 3L1RA 2H88A 4KPRA 1CJCA 5BULA 4H50A 5JCMA 1PBCA 3DJDA 2X8CA 1TDKA 2GR2A 4EQSA 4Z25A 5BUKA 3DJJA 1GPEA 1ZX9A 4YSHA 3FBSA 4Z2RA 2A89A 4K5SA 2WBAA 2OLNA 2GRTA 2X50A 3HYVA 5KXJA 3H8IA 1FL2A 1RYIA 2QAEA 3FMWA 3GWDA 3NN0X 1YKJA 3GYJA 3UP4A 5KOXA 3NYFA 1M64A 2AAQA 2BC1A 2Y6QA 3IF9A 4I58A 3SX6A 1V59A 1F6MA 4XXGA 5KVHA 4EMIA 4K7ZA 4Z24A 1DNCA 2R0GA 4OPLA 3R9UA 1D4DA 2Z5XA 1NG4A 4G9KA 4Z2TA 1JRZA 2BYBA 2CULA 2WHDA 1GNDA 1GREA 2YG4A 3AEDA 4I59A 2WPFA 3AE2A 2B76A 1EL7A 2E4GA 4BJYA 1NAAA 1EBDA 2E1MA 3BI5A 1MXTA 3CPHG 1FECA 2VVMA 3IHMA 2BC0A 3P9UA 2YR6A 4H2PA 3RP6A 5JCLA 4A79A 3ATRA 1E1NA 2F5ZA 3M0OA 5HYMA 3IWAA 2ZZ0A 4PABA 1E1KA 2NVKX 4USRA 3QSMA 1OJCA 3SXIA 4FK1C 2XLSA 2J3NA 2FJEA 2XFPA 2YVFA 1GETA 3CNTA 1OJAA 3GDNA 3CGBA 1B8SA 2Z5YA 2RGHA 3VR8A 4G6HA 4JN9A 4NTCA 2IVEA 4GUVA 2XLTA 4H4WA 1K0JA 4J34A 1CC4A 2GR0A 2WU5A 5FS6A 2BK5A 4K2XA 1IUXA 4U2LA 2BXRA 2GVCA 2WPCA 2RABA 3E1TA 3VRBA 4YTNA 5JCIA 4CY8A 1H81A 1H83A 1QLBA 3BI2A 4H4QA 3C96A 1GRGA 1GRFA 1LTXR 2Y6RA 1DJNA 3GMCA 3GRTA 1Q1RA 3DGZA 4CNJA 2YAUA 3NLCA 1H86A 3QFAA 2R0CA 4YTPA 5FMHA 5J7XA 3SZWA 4A5LA 2Q0LA 4JDRA 3AB1A 1GSNA 2XDOA 1H7WA 2V5ZA 3UTFA 2GB0A 1PDHA 3UTEA 2YLTA 4H4PA 4LA1A 1IUSA 1S3EA 1ZK7A 2BA9A 3GD3A 1EL8A 3T31A 3NGCX 5J60A 1KSSA 3K7TA 4NWZA 2XFNA 1IUTA 4A6NA 4CCQA 3I3LA 3ABVA 2BS2A 5EB4A 4YT0A 4DSHA 2GR1A 1F8SA 3H8LA 3KU9A 4EMWA 1XDIA 3UKAA 2RGJA 4B67A 1JOAA 1GT8A 5C3JA 4H4TA 2BK4A 3NG7X 2WDVA 3G5SA 1GV4A 2GQWA 3CMMA 1NDAA 1TDFA 1TDOA 2H89A 3VQRA 4TM3A 5M0ZA 2JB2A 2YLSA 3AE3A 5BRTA 1KFYA 3CNPA 1H6VA 1N1PA 4AT2A 4OPUA 3NTAA 4H7UA 2X99A 1KNPA 4APNA 2ARDA 3ALMA 2I0ZA 2ZBWA 2UZZA 4P9SA 3EANA 1RP0A 4TLXA 3EPTA 3Q6JA 2GF3A 1ELIA 1LQUA 2V60A 1LPFA 2DKIA 1S3BA 3UOXA 1PXCA 2DKHA 3AEEA 2A8XA 3T2YA 3NT6A 2VRMA 4JNQA 1NHSA 3NNEA 3T2ZA 4REKA 1IUUA 3B3RA 2C72A 1ZMDA 1CJ3A 4EMJA 3NTDA 4UDPA 1XPQA 3SZFA 1CF3A 1JRXA 3GRSA 3UOVA 1BF3A 2GAHB 3I6DA 2R46A 1D4EA 2CDUA 3ZYXA 1PBEA 1F8WA 4J36A 4YTMA 3SY4A 1Q9IA 3P4QA 1B4VA 2WOWA 4YKFA 3SGLA 1Q1WA 3EF6A 3AD9B 1LV0A 3G5RA 3HYXA 4B1BA 1FEAA 1TYPA 3ATQA 3LOVA 4G6GA 4D03A 5LV9A 2XYOA 4C3XA 2YG7A 3C4NA 2YVJA 3K7QX 1JEHA 3NIXA 1BZLA 4GRTA 1CL0A 4C5OA 2GV8A 3SZCA 2B9WA 5HY5A 3AWIA 4YXDA 3AE6A 4J56A 1VDCA 3NYCA 4EIPA 4J31A 3KVEA 2VVLA 3DGHA 1N4VA 4XWZA 1COYA 2TPRA 2CVJA 3NH3X 4U8OA 1O5WA 2R0PA 4UDRA 4X9MA 2O9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFD A;  1IUW A;  1PHH A;  3F8R A;  3LXD A;  4H2Q A;  1CJ2 A;  1VG0 A;  4UDQ A;  4CY6 A;  3CTY A;  1HYU A;  1K4Q A;  3ADA B;  4MJW A;  2QA2 A;  3P1W A;  4B64 A;  2APG A;  2C65 A;  1PXA A;  1OJT A;  2JB1 A;  3KLJ A;  4AOX A;  4U8L A;  1VQW A;  3UKF A;  4O5Q A;  2YR4 A;  2WU2 A;  3CIR A;  3JSK A;  1L9C A;  3DK8 A;  3OZ2 A;  2EQ9 A;  4FX9 A;  4TLZ A;  3LZX A;  3AEC A;  2VQ7 A;  3UTG A;  2ZZB A;  2WOV A;  4TM0 A;  3AYI A;  1ZMC A;  2GMH A;  4X4J A;  4B66 A;  1TDE A;  2CFY A;  1ZOY A;  5KWF A;  3DJE A;  1KF6 A;  2WEU A;  2OLO A;  2V61 A;  3AD7 B;  2C75 A;  2WP5 A;  2XCG A;  4GDE A;  5JCK A;  1KSU A;  4CCR A;  2WP9 A;  3V3O A;  3DJG X;  3C4A A;  1DOB A;  2XLR A;  3UCL A;  3VR9 A;  3AE1 A;  4EIQ A;  2BCP A;  4H4Y A;  4U2S A;  3M12 A;  4JQ9 A;  3S61 A;  4IVO B;  3AE8 A;  5M10 A;  1GRT A;  5ER0 A;  2PHH A;  4K8D A;  1Z6L A;  1PBF A;  1W4X A;  3ISH A;  1NHR A;  3AYL A;  4Y4N A;  1REO A;  3SQP A;  2BS4 A;  1AOG A;  4AT0 A;  4NTE A;  4D04 A;  4UP3 A;  1D4C A;  1L9D A;  4OPI A;  2AR8 A;  2BAB A;  2Q7V A;  3AD8 B;  1KNR A;  1FEB A;  4WX1 A;  2C76 A;  2GH5 A;  3V3N A;  1N4U A;  4A65 A;  4BV6 A;  1B5Q A;  1MOK A;  4EM3 A;  2OAL A;  3QVR A;  3RP8 A;  2NPX A;  1D5T A;  1GRA A;  1PJ6 A;  2YG6 A;  1CC2 A;  3NN6 X;  4U8J A;  1GES A;  3SFE A;  3BI4 A;  1EL5 A;  3UKP A;  3DA1 A;  1PBD A;  1TRB A;  2YLZ A;  1YQ3 A;  2JK6 A;  1BGJ A;  3AXB A;  4GR1 A;  1O95 A;  3S5W A;  2X8G A;  1ZP0 A;  2W0H A;  2YLW A;  1GEU A;  4U8K A;  3LAD A;  1E6E A;  1LQT A;  3QVP A;  1H82 A;  1PJ7 A;  5U63 A;  3ICR A;  1DXL A;  4IVM B;  3BHK A;  3PO7 A;  4RG3 A;  3GYI A;  3SM8 A;  5EOW A;  4OPG A;  5JCN A;  5CKU A;  2E5V A;  5HHF A;  1VG9 A;  3CN8 A;  4B65 A;  4EQX A;  3RP7 A;  4H4X A;  2VVL G;  3DME A;  2JBV A;  1NEK A;  1NEN A;  3BNM A;  3D1C A;  2OA1 A;  5GSN A;  4Y4L A;  3AE4 A;  4CNK A;  4O5U A;  1E39 A;  4X9N A;  1OJD A;  3BHF A;  5DBJ A;  1L0V A;  5TR3 A;  1F3P A;  1LJ1 A;  4NEW A;  2YM1 A;  3LZW A;  2JAE A;  3QJ4 A;  2JB3 A;  3DH9 A;  4U8I A;  5KVI A;  4B69 A;  3CGD A;  1JNZ A;  1FCD A;  1F8R A;  2C66 A;  4EQW A;  2R4J A;  2VQB A;  5FS7 A;  3P4S A;  4HB9 A;  1DJQ A;  2C3C A;  2BK3 A;  1KDG A;  2V3A A;  4BK3 A;  1K0I A;  1IJH A;  2YG3 A;  3F8P A;  2HQM A;  2C3D A;  1Y56 B;  1D7Y A;  1K0L A;  4FDC B;  3NRN A;  1XHC A;  3LJP A;  1XAN A;  4U8P A;  3HZL A;  2XVJ A;  3P4R A;  4DNA A;  1X31 B;  4GDP A;  4DGK A;  2BS3 A;  1E1M A;  2B9Y A;  3NYE A;  2EQ8 A;  2JKC A;  2FJB A;  4U2T A;  4USQ A;  3K30 A;  4YSX A;  3AEB A;  3CND A;  3T37 A;  4C77 A;  1EL9 A;  1LVL A;  1YY5 A;  2XVE A;  3AEA A;  1PBB A;  2BAC A;  2R4E A;  3AYJ A;  2YWL A;  2XLP A;  3PVC A;  1NPX A;  2WET A;  2X8H A;  4RSL A;  3VRD B;  1GXF A;  1YQZ A;  3UKQ A;  2GQF A;  2V6O A;  1B37 A;  2GEW A;  1PS9 A;  4LU6 A;  3KD9 A;  4RG4 A;  3AE7 A;  2C67 A;  5IQ1 A;  2ZZC A;  4J2W A;  4KX6 A;  3G5Q A;  4LII A;  2YG5 A;  3FG2 P;  1NHP A;  2WES A;  4A6N B;  4H2R A;  4OPD A;  2XLU A;  3AEF A;  3KA7 A;  2EQ7 A;  5IQ4 A;  5KOW A;  1BGN A;  1FOH A;  3AE9 A;  3D8X A;  3ICT A;  4H4Z A;  4H4S A;  2YLX A;  4EM4 A;  2YLR A;  1PXB A;  4U8N A;  2WPE A;  2WP6 A;  1ZY8 A;  1DOC A;  3RED A;  4BK2 A;  3FPZ A;  5HXI A;  4ZCD A;  3QSE A;  3IC9 A;  1VRQ B;  4FK1 A;  1S2Q A;  2FBW A;  2AQJ A;  4IA6 A;  4NTD A;  4TM1 A;  4GCM A;  1JU2 A;  4A99 A;  4B68 A;  5BVA A;  4N9X A;  1E1L A;  3QFB A;  2BCG G;  4ECH A;  4ADW A;  4YSZ A;  5C2T A;  1GOS A;  4K5R A;  3UTH A;  1NHQ A;  1RSG A;  2VOU A;  3ICS A;  3NK1 X;  2XFU A;  3V76 A;  4J57 A;  1GER A;  3CGE A;  3EAO A;  1ZDL A;  2C70 A;  4AOS A;  1IUV A;  1ONF A;  2C64 A;  2C7G A;  1N4W A;  2PYX A;  4YKG A;  3CNS A;  3P4P A;  1GTH A;  3LB8 A;  4Z26 A;  4OPC A;  3URH A;  2IID A;  3CPJ G;  1Y56 A;  2Q0K A;  1SEZ A;  3K7M X;  3ALL A;  4YWO A;  4C3Y A;  1GAL A;  2RGO A;  4ICY A;  2OAM A;  4Z43 A;  2FJD A;  1JRY A;  2WS3 A;  3Q9T A;  4J33 A;  1CJ4 A;  4AP1 A;  4BJZ A;  2EQ6 A;  3F8D A;  3GSI A;  1D7L A;  5L46 A;  2GMJ A;  1PJ5 A;  3M13 A;  2VZ2 A;  3CGC A;  3ALJ A;  3GMB A;  1O94 A;  3ITJ A;  2QA1 A;  2VRL A;  4K22 A;  1DOD A;  3B6D A;  4IV9 A;  4JY3 A;  1Y0P A;  2WDQ A;  4A7A A;  4H4U A;  1PN0 A;  2C73 A;  3KPF A;  3CPI G;  3UOY A;  4DSG A;  4XWR A;  5EBK A;  3VRA A;  2XFQ A;  1GRB A;  1ZOV A;  4ZCC A;  2B7R A;  4Z2U A;  5IPY A;  5U25 A;  2X3N A;  4JNA A;  4OPT A;  2WOI A;  1P2H A;  1QO8 A;  2TMD A;  4NEV A;  3WE0 A;  4WCT A;  5GRT A;  4BUR A;  4B63 A;  1DOE A;  3ZDN A;  1CHU A;  4TM4 A;  3BNU A;  3FIM B;  5FS9 A;  3UKL A;  4PAA A;  2YM2 A;  3QSS A;  1YQ4 A;  3GWF A;  2FJA A;  4H4V A;  3AE5 A;  3AEG A;  4NZH A;  2XVH A;  2B9X A;  5U1O A;  3RNM A;  1GRH A;  2B7S A;  1GTE A;  2WDR A;  3NKS A;  1JNR A;  4OCG A;  2BXS A;  2QCU A;  5CQF A;  4H4R A;  1CC6 A;  4BK1 A;  1NG3 A;  3II4 A;  4IA5 A;  1H7X A;  3NK2 X;  2V3B A;  4C74 A;  3KKJ A;  3OC4 A;  4GF7 A;  5FS8 A;  3IHG A;  3GD4 A;  3DK4 A;  1TYT A;  4CBQ A;  3NK0 X;  1QJD A;  2YQU A;  3GDP A;  1UKV G;  4Z44 A;  3UOZ A;  4OVI A;  1TDN A;  4JY2 A;  4ZN0 A;  1P2E A;  1MO9 A;  3COX A;  4U8M A;  2Q6U A;  1CBO A;  2XFO A;  4AP3 A;  2A87 A;  1M6I A;  1S2Y A;  3NHO X;  3UKH A;  2YR5 A;  2GAG B;  2R45 A;  4E0V A;  1E7P A;  3PS9 A;  3RHA A;  4M52 A;  4YSY A;  4Y4M A;  4CRT A;  2ACZ A;  4A9W A;  3UP5 A;  2R9Z A;  1L9E A;  2XVI A;  1H84 A;  3CNJ A;  3H4K A;  1ZKQ A;  2XVF A;  4H2N A;  4HA6 A;  2GR3 A;  2YVG A;  3O0H A;  5EB5 A;  1BKW A;  2WQY A;  1BWC A;  1OJ9 A;  3DK9 A;  3L8K A;  2IVD A;  4EQR A;  3UKK A;  3L1R A;  2H88 A;  4KPR A;  1CJC A;  5BUL A;  4H50 A;  5JCM A;  1PBC A;  3DJD A;  2X8C A;  1TDK A;  2GR2 A;  4EQS A;  4Z25 A;  5BUK A;  3DJJ A;  1GPE A;  1ZX9 A;  4YSH A;  3FBS A;  4Z2R A;  2A89 A;  4K5S A;  2WBA A;  2OLN A;  2GRT A;  2X50 A;  5KXJ A;  3H8I A;  1FL2 A;  1RYI A;  2QAE A;  3FMW A;  3GWD A;  3NN0 X;  1YKJ A;  3GYJ A;  3UP4 A;  5KOX A;  3NYF A;  1M64 A;  2AAQ A;  2BC1 A;  2Y6Q A;  3IF9 A;  4I58 A;  1V59 A;  1F6M A;  4XXG A;  5KVH A;  4EMI A;  4K7Z A;  4Z24 A;  1DNC A;  2R0G A;  4OPL A;  3R9U A;  1D4D A;  2Z5X A;  1NG4 A;  4Z2T A;  1JRZ A;  2BYB A;  2CUL A;  2WHD A;  1GND A;  1GRE A;  2YG4 A;  3AED A;  4I59 A;  2WPF A;  3AE2 A;  2B76 A;  1EL7 A;  2E4G A;  4BJY A;  1NAA A;  1EBD A;  2E1M A;  3BI5 A;  1MXT A;  3CPH G;  1FEC A;  2VVM A;  3IHM A;  2BC0 A;  3P9U A;  2YR6 A;  4H2P A;  3RP6 A;  5JCL A;  4A79 A;  3ATR A;  1E1N A;  2F5Z A;  3M0O A;  5HYM A;  3IWA A;  2ZZ0 A;  4PAB A;  1E1K A;  2NVK X;  4USR A;  3QSM A;  1OJC A;  4FK1 C;  2XLS A;  2J3N A;  2FJE A;  2XFP A;  2YVF A;  1GET A;  3CNT A;  1OJA A;  3GDN A;  3CGB A;  1B8S A;  2Z5Y A;  2RGH A;  3VR8 A;  4JN9 A;  4NTC A;  2IVE A;  4GUV A;  2XLT A;  4H4W A;  1K0J A;  4J34 A;  1CC4 A;  2GR0 A;  2WU5 A;  5FS6 A;  2BK5 A;  4K2X A;  1IUX A;  4U2L A;  2BXR A;  2GVC A;  2WPC A;  2RAB A;  3E1T A;  3VRB A;  4YTN A;  5JCI A;  4CY8 A;  1H81 A;  1H83 A;  1QLB A;  3BI2 A;  4H4Q A;  3C96 A;  1GRG A;  1GRF A;  1LTX R;  2Y6R A;  1DJN A;  3GMC A;  3GRT A;  1Q1R A;  3DGZ A;  4CNJ A;  2YAU A;  3NLC A;  1H86 A;  3QFA A;  2R0C A;  4YTP A;  5FMH A;  5J7X A;  4A5L A;  2Q0L A;  4JDR A;  3AB1 A;  1GSN A;  2XDO A;  1H7W A;  2V5Z A;  3UTF A;  2GB0 A;  1PDH A;  3UTE A;  2YLT A;  4H4P A;  4LA1 A;  1IUS A;  1S3E A;  1ZK7 A;  2BA9 A;  3GD3 A;  1EL8 A;  3NGC X;  5J60 A;  1KSS A;  3K7T A;  2XFN A;  1IUT A;  4A6N A;  4CCQ A;  3I3L A;  3ABV A;  2BS2 A;  5EB4 A;  4YT0 A;  4DSH A;  2GR1 A;  1F8S A;  3H8L A;  3KU9 A;  4EMW A;  1XDI A;  3UKA A;  2RGJ A;  4B67 A;  1JOA A;  1GT8 A;  5C3J A;  4H4T A;  2BK4 A;  3NG7 X;  2WDV A;  3G5S A;  1GV4 A;  2GQW A;  1NDA A;  1TDF A;  1TDO A;  2H89 A;  3VQR A;  4TM3 A;  5M0Z A;  2JB2 A;  2YLS A;  3AE3 A;  5BRT A;  1KFY A;  3CNP A;  1H6V A;  1N1P A;  4AT2 A;  4OPU A;  3NTA A;  4H7U A;  2X99 A;  1KNP A;  4APN A;  2ARD A;  3ALM A;  2I0Z A;  2ZBW A;  2UZZ A;  4P9S A;  3EAN A;  1RP0 A;  4TLX A;  3EPT A;  3Q6J A;  1ELI A;  1LQU A;  2GF3 A;  2V60 A;  1LPF A;  1S3B A;  2DKI A;  3UOX A;  1PXC A;  2DKH A;  3AEE A;  2A8X A;  3NT6 A;  2VRM A;  4JNQ A;  1NHS A;  3NNE A;  4REK A;  1IUU A;  3B3R A;  2C72 A;  1ZMD A;  1CJ3 A;  4EMJ A;  3NTD A;  4UDP A;  1XPQ A;  1CF3 A;  1JRX A;  3GRS A;  3UOV A;  1BF3 A;  2GAH B;  3I6D A;  2R46 A;  1D4E A;  2CDU A;  3ZYX A;  1PBE A;  1F8W A;  4J36 A;  4YTM A;  5KRQ A;  1Q9I A;  3P4Q A;  1B4V A;  2WOW A;  4YKF A;  3SGL A;  1Q1W A;  3EF6 A;  3AD9 B;  1LV0 A;  3G5R A;  4B1B A;  1FEA A;  1TYP A;  3ATQ A;  3LOV A;  4D03 A;  5LV9 A;  2XYO A;  4C3X A;  2YG7 A;  3C4N A;  2YVJ A;  3K7Q X;  1JEH A;  3NIX A;  1BZL A;  4GRT A;  1CL0 A;  4C5O A;  2GV8 A;  2B9W A;  5HY5 A;  3AWI A;  4YXD A;  3AE6 A;  4J56 A;  1VDC A;  3NYC A;  4EIP A;  4J31 A;  3KVE A;  2VVL A;  3DGH A;  1N4V A;  4XWZ A;  1COY A;  2TPR A;  2CVJ A;  3NH3 X;  4U8O A;  1O5W A;  2R0P A;  4UDR A;  4X9M A;  2O9Z A; 
#chains in the Genus database with same CATH topology
 3SFD A;  1IUW A;  1PHH A;  3F8R A;  3LXD A;  4H2Q A;  1CJ2 A;  1VG0 A;  4UDQ A;  4CY6 A;  3CTY A;  1HYU A;  1K4Q A;  3ADA B;  4MJW A;  2QA2 A;  3P1W A;  4GAP A;  4B64 A;  2APG A;  2C65 A;  1PXA A;  1OJT A;  2JB1 A;  3KLJ A;  4AOX A;  4U8L A;  1VQW A;  3UKF A;  4O5Q A;  2YR4 A;  2WU2 A;  3CIR A;  3JSK A;  1L9C A;  3DK8 A;  3OZ2 A;  2EQ9 A;  4FX9 A;  4TLZ A;  3LZX A;  3AEC A;  2VQ7 A;  3UTG A;  2ZZB A;  2WOV A;  4TM0 A;  3AYI A;  1ZMC A;  2GMH A;  4X4J A;  4B66 A;  1TDE A;  2CFY A;  1ZOY A;  5KWF A;  3DJE A;  1KF6 A;  2WEU A;  2OLO A;  2V61 A;  3AD7 B;  2C75 A;  2WP5 A;  2XCG A;  4GDE A;  5JCK A;  1KSU A;  4CCR A;  2WP9 A;  3V3O A;  3DJG X;  3C4A A;  1DOB A;  2XLR A;  3UCL A;  3VR9 A;  3AE1 A;  4EIQ A;  2BCP A;  4H4Y A;  4U2S A;  3M12 A;  4JQ9 A;  3S61 A;  4IVO B;  3AE8 A;  5M10 A;  1GRT A;  5ER0 A;  2PHH A;  4K8D A;  1Z6L A;  1PBF A;  1W4X A;  3ISH A;  1NHR A;  3AYL A;  4Y4N A;  1REO A;  3SQP A;  2BS4 A;  1AOG A;  4AT0 A;  4NTE A;  4D04 A;  4UP3 A;  1D4C A;  1L9D A;  4OPI A;  2AR8 A;  2BAB A;  2BRY A;  2Q7V A;  4G73 A;  3AD8 B;  5KMS A;  1KNR A;  1FEB A;  4WX1 A;  2C76 A;  2GH5 A;  3V3N A;  1N4U A;  4A65 A;  4BV6 A;  3KPK A;  1B5Q A;  1MOK A;  4EM3 A;  2OAL A;  3QVR A;  3RP8 A;  2NPX A;  1D5T A;  1GRA A;  1PJ6 A;  2YG6 A;  1CC2 A;  3NN6 X;  4U8J A;  1GES A;  3SFE A;  3SYI A;  3HYW A;  3BI4 A;  1EL5 A;  3UKP A;  2BRA A;  3DA1 A;  1PBD A;  1TRB A;  2YLZ A;  1YQ3 A;  2JK6 A;  1BGJ A;  3T14 A;  3AXB A;  4GR1 A;  1O95 A;  3S5W A;  2X8G A;  1ZP0 A;  2W0H A;  2YLW A;  1GEU A;  4U8K A;  3LAD A;  1E6E A;  1LQT A;  3QVP A;  1H82 A;  1PJ7 A;  5U63 A;  3ICR A;  1DXL A;  4IVM B;  3BHK A;  3PO7 A;  4RG3 A;  3GYI A;  3SM8 A;  5EOW A;  4OPG A;  5JCN A;  5CKU A;  2E5V A;  5HHF A;  1VG9 A;  3CN8 A;  4B65 A;  4EQX A;  3RP7 A;  4H4X A;  2VVL G;  3DME A;  2JBV A;  1NEK A;  1NEN A;  3BNM A;  3D1C A;  2OA1 A;  5GSN A;  4Y4L A;  3AE4 A;  4CNK A;  4O5U A;  1E39 A;  4X9N A;  1OJD A;  3BHF A;  5DBJ A;  4II2 A;  5TR3 A;  1L0V A;  1F3P A;  1LJ1 A;  4NEW A;  2YM1 A;  3LZW A;  2JAE A;  3QJ4 A;  2JB3 A;  3DH9 A;  4U8I A;  5KVI A;  4B69 A;  3CGD A;  1JNZ A;  1FCD A;  5KMP A;  1F8R A;  2C66 A;  4EQW A;  2R4J A;  2VQB A;  5FS7 A;  3P4S A;  4HB9 A;  1DJQ A;  2C3C A;  2BK3 A;  1KDG A;  2V3A A;  4BK3 A;  1K0I A;  1IJH A;  2YG3 A;  3F8P A;  2HQM A;  2C3D A;  1Y56 B;  1D7Y A;  1K0L A;  4FDC B;  3NRN A;  1XHC A;  3LJP A;  1XAN A;  4U8P A;  3HZL A;  2XVJ A;  5KMR A;  3P4R A;  4DNA A;  1X31 B;  4G74 A;  4GDP A;  4DGK A;  2BS3 A;  1E1M A;  2B9Y A;  3NYE A;  2EQ8 A;  2JKC A;  2FJB A;  4U2T A;  4USQ A;  3K30 A;  4YSX A;  3AEB A;  3CND A;  3T37 A;  4C77 A;  5KMQ A;  1EL9 A;  1LVL A;  1YY5 A;  2XVE A;  3AEA A;  1PBB A;  2BAC A;  2R4E A;  3AYJ A;  2YWL A;  2XLP A;  3PVC A;  1NPX A;  3T0K A;  2WET A;  2X8H A;  4RSL A;  3VRD B;  1GXF A;  1YQZ A;  3UKQ A;  2GQF A;  2V6O A;  1B37 A;  2GEW A;  1PS9 A;  4LU6 A;  3KD9 A;  4RG4 A;  3AE7 A;  2C67 A;  5IQ1 A;  2ZZC A;  4J2W A;  4KX6 A;  3G5Q A;  4LII A;  2YG5 A;  3FG2 P;  1NHP A;  2WES A;  4A6N B;  4H2R A;  4OPD A;  4NNJ A;  2XLU A;  3AEF A;  3KA7 A;  2EQ7 A;  5IQ4 A;  5KOW A;  1BGN A;  1FOH A;  3AE9 A;  3D8X A;  3ICT A;  4H4Z A;  4H4S A;  2YLX A;  4EM4 A;  2YLR A;  3GYX A;  1PXB A;  4U8N A;  2WPE A;  2WP6 A;  1ZY8 A;  1DOC A;  3RED A;  4BK2 A;  3FPZ A;  5HXI A;  4ZCD A;  3QSE A;  3IC9 A;  1VRQ B;  4FK1 A;  1S2Q A;  2FBW A;  2AQJ A;  4IA6 A;  4NTD A;  4TM1 A;  4GCM A;  1JU2 A;  4A99 A;  4B68 A;  5BVA A;  4N9X A;  1E1L A;  3QFB A;  2BCG G;  4ECH A;  4ADW A;  4YSZ A;  2C4C A;  5C2T A;  1GOS A;  4K5R A;  3UTH A;  1NHQ A;  1RSG A;  2VOU A;  3ICS A;  3NK1 X;  2XFU A;  3V76 A;  4J57 A;  1GER A;  3CGE A;  3EAO A;  1ZDL A;  2C70 A;  4AOS A;  1IUV A;  1ONF A;  2C64 A;  2C7G A;  1N4W A;  2PYX A;  4YKG A;  3CNS A;  3P4P A;  1GTH A;  3LB8 A;  4Z26 A;  4OPC A;  3URH A;  2IID A;  3CPJ G;  1Y56 A;  2Q0K A;  1SEZ A;  3K7M X;  3ALL A;  4YWO A;  4C3Y A;  1GAL A;  2RGO A;  4ICY A;  2OAM A;  4Z43 A;  2FJD A;  1JRY A;  2WS3 A;  3Q9T A;  4J33 A;  1CJ4 A;  4AP1 A;  4BJZ A;  2EQ6 A;  3F8D A;  3GSI A;  1D7L A;  5L46 A;  2GMJ A;  1PJ5 A;  3M13 A;  2VZ2 A;  3CGC A;  3ALJ A;  3GMB A;  1O94 A;  3ITJ A;  2QA1 A;  2VRL A;  4K22 A;  1DOD A;  3B6D A;  4IV9 A;  4JY3 A;  1Y0P A;  2WDQ A;  4A7A A;  4H4U A;  1PN0 A;  2C73 A;  3KPF A;  3CPI G;  3UOY A;  4DSG A;  4XWR A;  5EBK A;  3T2K A;  2XFQ A;  1GRB A;  1ZOV A;  4ZCC A;  2B7R A;  3VRA A;  4Z2U A;  5U25 A;  5IPY A;  2X3N A;  4JNA A;  4OPT A;  2WOI A;  1P2H A;  1QO8 A;  2TMD A;  4NEV A;  3WE0 A;  4WCT A;  5GRT A;  4BUR A;  4B63 A;  1DOE A;  3ZDN A;  1CHU A;  4TM4 A;  3BNU A;  3FIM B;  5FS9 A;  3UKL A;  4PAA A;  2YM2 A;  3QSS A;  1YQ4 A;  3GWF A;  2FJA A;  4H4V A;  3AE5 A;  3AEG A;  4NZH A;  2XVH A;  2B9X A;  5U1O A;  3RNM A;  1GRH A;  2B7S A;  1GTE A;  2WDR A;  3NKS A;  1JNR A;  4OCG A;  2BXS A;  2QCU A;  5CQF A;  4H4R A;  1CC6 A;  4BK1 A;  1NG3 A;  3II4 A;  4IA5 A;  1H7X A;  3NK2 X;  2V3B A;  4C74 A;  3KKJ A;  3OC4 A;  4GF7 A;  5FS8 A;  3IHG A;  3GD4 A;  5KRQ A;  3DK4 A;  1TYT A;  4CBQ A;  5KNL A;  3NK0 X;  1QJD A;  2YQU A;  3GDP A;  1UKV G;  4Z44 A;  3UOZ A;  4OVI A;  1TDN A;  4JY2 A;  4ZN0 A;  1P2E A;  1MO9 A;  3COX A;  4U8M A;  2Q6U A;  1CBO A;  2XFO A;  4AP3 A;  4GAV A;  2A87 A;  1M6I A;  1S2Y A;  3NHO X;  3UKH A;  2YR5 A;  2GAG B;  2R45 A;  4E0V A;  1E7P A;  3PS9 A;  3RHA A;  4M52 A;  4YSY A;  4Y4M A;  3SZ0 A;  4CRT A;  2ACZ A;  4II3 A;  4A9W A;  3UP5 A;  2R9Z A;  1L9E A;  2XVI A;  1H84 A;  3CNJ A;  3H4K A;  1ZKQ A;  2XVF A;  4H2N A;  4HA6 A;  2GR3 A;  2YVG A;  3O0H A;  5EB5 A;  1BKW A;  2WQY A;  1BWC A;  1OJ9 A;  3DK9 A;  3L8K A;  2IVD A;  4EQR A;  3UKK A;  3L1R A;  2H88 A;  4KPR A;  1CJC A;  5BUL A;  4H50 A;  5JCM A;  1PBC A;  3DJD A;  2X8C A;  1TDK A;  2GR2 A;  4EQS A;  4Z25 A;  5BUK A;  3DJJ A;  1GPE A;  1ZX9 A;  4YSH A;  3FBS A;  4Z2R A;  2A89 A;  4K5S A;  2WBA A;  2OLN A;  2GRT A;  2X50 A;  3HYV A;  5KXJ A;  3H8I A;  1FL2 A;  1RYI A;  2QAE A;  3FMW A;  3GWD A;  3NN0 X;  1YKJ A;  3GYJ A;  3UP4 A;  5KOX A;  3NYF A;  1M64 A;  2AAQ A;  2BC1 A;  2Y6Q A;  3IF9 A;  4I58 A;  3SX6 A;  1V59 A;  1F6M A;  4XXG A;  5KVH A;  4EMI A;  4K7Z A;  4Z24 A;  1DNC A;  2R0G A;  4OPL A;  3R9U A;  1D4D A;  2Z5X A;  1NG4 A;  4G9K A;  4Z2T A;  1JRZ A;  2BYB A;  2CUL A;  2WHD A;  1GND A;  1GRE A;  2YG4 A;  3AED A;  4I59 A;  2WPF A;  3AE2 A;  2B76 A;  1EL7 A;  2E4G A;  4BJY A;  1NAA A;  1EBD A;  2E1M A;  3BI5 A;  1MXT A;  3CPH G;  1FEC A;  2VVM A;  3IHM A;  2BC0 A;  3P9U A;  2YR6 A;  4H2P A;  3RP6 A;  5JCL A;  4A79 A;  3ATR A;  1E1N A;  2F5Z A;  3M0O A;  5HYM A;  3IWA A;  2ZZ0 A;  4PAB A;  1E1K A;  2NVK X;  4USR A;  3QSM A;  1OJC A;  3SXI A;  4FK1 C;  2XLS A;  2J3N A;  2FJE A;  2XFP A;  2YVF A;  1GET A;  3CNT A;  1OJA A;  3GDN A;  3CGB A;  1B8S A;  2Z5Y A;  2RGH A;  3VR8 A;  4G6H A;  4JN9 A;  4NTC A;  2IVE A;  4GUV A;  2XLT A;  4H4W A;  1K0J A;  4J34 A;  1CC4 A;  2GR0 A;  2WU5 A;  5FS6 A;  2BK5 A;  4K2X A;  1IUX A;  4U2L A;  2BXR A;  2GVC A;  2WPC A;  2RAB A;  3E1T A;  3VRB A;  4YTN A;  5JCI A;  4CY8 A;  1H81 A;  1H83 A;  1QLB A;  3BI2 A;  4H4Q A;  3C96 A;  1GRG A;  1GRF A;  1LTX R;  2Y6R A;  1DJN A;  3GMC A;  3GRT A;  1Q1R A;  3DGZ A;  4CNJ A;  2YAU A;  3NLC A;  1H86 A;  3QFA A;  2R0C A;  4YTP A;  5FMH A;  5J7X A;  3SZW A;  4A5L A;  2Q0L A;  4JDR A;  3AB1 A;  1GSN A;  2XDO A;  1H7W A;  2V5Z A;  3UTF A;  2GB0 A;  1PDH A;  3UTE A;  2YLT A;  4H4P A;  4LA1 A;  1IUS A;  1S3E A;  1ZK7 A;  2BA9 A;  3GD3 A;  1EL8 A;  3T31 A;  3NGC X;  5J60 A;  1KSS A;  3K7T A;  4NWZ A;  2XFN A;  1IUT A;  4A6N A;  4CCQ A;  3I3L A;  3ABV A;  2BS2 A;  5EB4 A;  4YT0 A;  4DSH A;  2GR1 A;  1F8S A;  3H8L A;  3KU9 A;  4EMW A;  1XDI A;  3UKA A;  2RGJ A;  4B67 A;  1JOA A;  1GT8 A;  5C3J A;  4H4T A;  2BK4 A;  3NG7 X;  2WDV A;  3G5S A;  1GV4 A;  2GQW A;  3CMM A;  1NDA A;  1TDF A;  1TDO A;  2H89 A;  3VQR A;  4TM3 A;  5M0Z A;  2JB2 A;  2YLS A;  3AE3 A;  5BRT A;  1KFY A;  3CNP A;  1H6V A;  1N1P A;  4AT2 A;  4OPU A;  3NTA A;  4H7U A;  2X99 A;  1KNP A;  4APN A;  2ARD A;  3ALM A;  2I0Z A;  2ZBW A;  2UZZ A;  4P9S A;  3EAN A;  1RP0 A;  4TLX A;  3EPT A;  3Q6J A;  2GF3 A;  1ELI A;  1LQU A;  2V60 A;  1LPF A;  2DKI A;  1S3B A;  3UOX A;  1PXC A;  2DKH A;  3AEE A;  2A8X A;  3T2Y A;  3NT6 A;  2VRM A;  4JNQ A;  1NHS A;  3NNE A;  3T2Z A;  4REK A;  1IUU A;  3B3R A;  2C72 A;  1ZMD A;  1CJ3 A;  4EMJ A;  3NTD A;  4UDP A;  1XPQ A;  3SZF A;  1CF3 A;  1JRX A;  3GRS A;  3UOV A;  1BF3 A;  2GAH B;  3I6D A;  2R46 A;  1D4E A;  2CDU A;  3ZYX A;  1PBE A;  1F8W A;  4J36 A;  4YTM A;  3SY4 A;  1Q9I A;  3P4Q A;  1B4V A;  2WOW A;  4YKF A;  3SGL A;  1Q1W A;  3EF6 A;  3AD9 B;  1LV0 A;  3G5R A;  3HYX A;  4B1B A;  1FEA A;  1TYP A;  3ATQ A;  3LOV A;  4G6G A;  4D03 A;  5LV9 A;  2XYO A;  4C3X A;  2YG7 A;  3C4N A;  2YVJ A;  3K7Q X;  1JEH A;  3NIX A;  1BZL A;  4GRT A;  1CL0 A;  4C5O A;  2GV8 A;  3SZC A;  2B9W A;  5HY5 A;  3AWI A;  4YXD A;  3AE6 A;  4J56 A;  1VDC A;  3NYC A;  4EIP A;  4J31 A;  3KVE A;  2VVL A;  3DGH A;  1N4V A;  4XWZ A;  1COY A;  2TPR A;  2CVJ A;  3NH3 X;  4U8O A;  1O5W A;  2R0P A;  4UDR A;  4X9M A;  2O9Z A; 
#chains in the Genus database with same CATH homology
 3SFD A;  1IUW A;  1PHH A;  3F8R A;  3LXD A;  4H2Q A;  1CJ2 A;  1VG0 A;  4UDQ A;  4CY6 A;  3CTY A;  1HYU A;  1K4Q A;  3ADA B;  4MJW A;  2QA2 A;  3P1W A;  4GAP A;  4B64 A;  2APG A;  2C65 A;  1PXA A;  1OJT A;  2JB1 A;  3KLJ A;  4AOX A;  4U8L A;  1VQW A;  3UKF A;  4O5Q A;  2YR4 A;  2WU2 A;  3CIR A;  3JSK A;  1L9C A;  3DK8 A;  3OZ2 A;  2EQ9 A;  4FX9 A;  4TLZ A;  3LZX A;  3AEC A;  2VQ7 A;  3UTG A;  2ZZB A;  2WOV A;  4TM0 A;  3AYI A;  1ZMC A;  2GMH A;  4X4J A;  4B66 A;  1TDE A;  2CFY A;  1ZOY A;  5KWF A;  3DJE A;  1KF6 A;  2WEU A;  2OLO A;  2V61 A;  3AD7 B;  2C75 A;  2WP5 A;  2XCG A;  4GDE A;  5JCK A;  1KSU A;  4CCR A;  2WP9 A;  3V3O A;  3DJG X;  3C4A A;  1DOB A;  2XLR A;  3UCL A;  3VR9 A;  3AE1 A;  4EIQ A;  2BCP A;  4H4Y A;  4U2S A;  3M12 A;  4JQ9 A;  3S61 A;  4IVO B;  3AE8 A;  5M10 A;  1GRT A;  5ER0 A;  2PHH A;  4K8D A;  1Z6L A;  1PBF A;  1W4X A;  3ISH A;  1NHR A;  3AYL A;  4Y4N A;  1REO A;  3SQP A;  2BS4 A;  1AOG A;  4AT0 A;  4NTE A;  4D04 A;  4UP3 A;  1D4C A;  1L9D A;  4OPI A;  2AR8 A;  2BAB A;  2BRY A;  2Q7V A;  4G73 A;  3AD8 B;  5KMS A;  1KNR A;  1FEB A;  4WX1 A;  2C76 A;  2GH5 A;  3V3N A;  1N4U A;  4A65 A;  4BV6 A;  3KPK A;  1B5Q A;  1MOK A;  4EM3 A;  2OAL A;  3QVR A;  3RP8 A;  2NPX A;  1D5T A;  1GRA A;  1PJ6 A;  2YG6 A;  1CC2 A;  3NN6 X;  4U8J A;  1GES A;  3SFE A;  3SYI A;  3HYW A;  3BI4 A;  1EL5 A;  3UKP A;  2BRA A;  3DA1 A;  1PBD A;  1TRB A;  2YLZ A;  1YQ3 A;  2JK6 A;  1BGJ A;  3T14 A;  3AXB A;  4GR1 A;  1O95 A;  3S5W A;  2X8G A;  1ZP0 A;  2W0H A;  2YLW A;  1GEU A;  4U8K A;  3LAD A;  1E6E A;  1LQT A;  3QVP A;  1H82 A;  1PJ7 A;  5U63 A;  3ICR A;  1DXL A;  4IVM B;  3BHK A;  3PO7 A;  4RG3 A;  3GYI A;  3SM8 A;  5EOW A;  4OPG A;  5JCN A;  5CKU A;  2E5V A;  5HHF A;  1VG9 A;  3CN8 A;  4B65 A;  4EQX A;  3RP7 A;  4H4X A;  2VVL G;  3DME A;  2JBV A;  1NEK A;  1NEN A;  3BNM A;  3D1C A;  2OA1 A;  5GSN A;  4Y4L A;  3AE4 A;  4CNK A;  4O5U A;  1E39 A;  4X9N A;  1OJD A;  3BHF A;  5DBJ A;  4II2 A;  5TR3 A;  1L0V A;  1F3P A;  1LJ1 A;  4NEW A;  2YM1 A;  3LZW A;  2JAE A;  3QJ4 A;  2JB3 A;  3DH9 A;  4U8I A;  5KVI A;  4B69 A;  3CGD A;  1JNZ A;  1FCD A;  5KMP A;  1F8R A;  2C66 A;  4EQW A;  2R4J A;  2VQB A;  5FS7 A;  3P4S A;  4HB9 A;  1DJQ A;  2C3C A;  2BK3 A;  1KDG A;  2V3A A;  4BK3 A;  1K0I A;  1IJH A;  2YG3 A;  3F8P A;  2HQM A;  2C3D A;  1Y56 B;  1D7Y A;  1K0L A;  4FDC B;  3NRN A;  1XHC A;  3LJP A;  1XAN A;  4U8P A;  3HZL A;  2XVJ A;  5KMR A;  3P4R A;  4DNA A;  1X31 B;  4G74 A;  4GDP A;  4DGK A;  2BS3 A;  1E1M A;  2B9Y A;  3NYE A;  2EQ8 A;  2JKC A;  2FJB A;  4U2T A;  4USQ A;  3K30 A;  4YSX A;  3AEB A;  3CND A;  3T37 A;  4C77 A;  5KMQ A;  1EL9 A;  1LVL A;  1YY5 A;  2XVE A;  3AEA A;  1PBB A;  2BAC A;  2R4E A;  3AYJ A;  2YWL A;  2XLP A;  3PVC A;  1NPX A;  3T0K A;  2WET A;  2X8H A;  4RSL A;  3VRD B;  1GXF A;  1YQZ A;  3UKQ A;  2GQF A;  2V6O A;  1B37 A;  2GEW A;  1PS9 A;  4LU6 A;  3KD9 A;  4RG4 A;  3AE7 A;  2C67 A;  5IQ1 A;  2ZZC A;  4J2W A;  4KX6 A;  3G5Q A;  4LII A;  2YG5 A;  3FG2 P;  1NHP A;  2WES A;  4A6N B;  4H2R A;  4OPD A;  4NNJ A;  2XLU A;  3AEF A;  3KA7 A;  2EQ7 A;  5IQ4 A;  5KOW A;  1BGN A;  1FOH A;  3AE9 A;  3D8X A;  3ICT A;  4H4Z A;  4H4S A;  2YLX A;  4EM4 A;  2YLR A;  3GYX A;  1PXB A;  4U8N A;  2WPE A;  2WP6 A;  1ZY8 A;  1DOC A;  3RED A;  4BK2 A;  3FPZ A;  5HXI A;  4ZCD A;  3QSE A;  3IC9 A;  1VRQ B;  4FK1 A;  1S2Q A;  2FBW A;  2AQJ A;  4IA6 A;  4NTD A;  4TM1 A;  4GCM A;  1JU2 A;  4A99 A;  4B68 A;  5BVA A;  4N9X A;  1E1L A;  3QFB A;  2BCG G;  4ECH A;  4ADW A;  4YSZ A;  2C4C A;  5C2T A;  1GOS A;  4K5R A;  3UTH A;  1NHQ A;  1RSG A;  2VOU A;  3ICS A;  3NK1 X;  2XFU A;  3V76 A;  4J57 A;  1GER A;  3CGE A;  3EAO A;  1ZDL A;  2C70 A;  4AOS A;  1IUV A;  1ONF A;  2C64 A;  2C7G A;  1N4W A;  2PYX A;  4YKG A;  3CNS A;  3P4P A;  1GTH A;  3LB8 A;  4Z26 A;  4OPC A;  3URH A;  2IID A;  3CPJ G;  1Y56 A;  2Q0K A;  1SEZ A;  3K7M X;  3ALL A;  4YWO A;  4C3Y A;  1GAL A;  2RGO A;  4ICY A;  2OAM A;  4Z43 A;  2FJD A;  1JRY A;  2WS3 A;  3Q9T A;  4J33 A;  1CJ4 A;  4AP1 A;  4BJZ A;  2EQ6 A;  3F8D A;  3GSI A;  1D7L A;  5L46 A;  2GMJ A;  1PJ5 A;  3M13 A;  2VZ2 A;  3CGC A;  3ALJ A;  3GMB A;  1O94 A;  3ITJ A;  2QA1 A;  2VRL A;  4K22 A;  1DOD A;  3B6D A;  4IV9 A;  4JY3 A;  1Y0P A;  2WDQ A;  4A7A A;  4H4U A;  1PN0 A;  2C73 A;  3KPF A;  3CPI G;  3UOY A;  4DSG A;  4XWR A;  5EBK A;  3T2K A;  2XFQ A;  1GRB A;  1ZOV A;  4ZCC A;  2B7R A;  3VRA A;  4Z2U A;  5U25 A;  5IPY A;  2X3N A;  4JNA A;  4OPT A;  2WOI A;  1P2H A;  1QO8 A;  2TMD A;  4NEV A;  3WE0 A;  4WCT A;  5GRT A;  4BUR A;  4B63 A;  1DOE A;  3ZDN A;  1CHU A;  4TM4 A;  3BNU A;  3FIM B;  5FS9 A;  3UKL A;  4PAA A;  2YM2 A;  3QSS A;  1YQ4 A;  3GWF A;  2FJA A;  4H4V A;  3AE5 A;  3AEG A;  4NZH A;  2XVH A;  2B9X A;  5U1O A;  3RNM A;  1GRH A;  2B7S A;  1GTE A;  2WDR A;  3NKS A;  1JNR A;  4OCG A;  2BXS A;  2QCU A;  5CQF A;  4H4R A;  1CC6 A;  4BK1 A;  1NG3 A;  3II4 A;  4IA5 A;  1H7X A;  3NK2 X;  2V3B A;  4C74 A;  3KKJ A;  3OC4 A;  4GF7 A;  5FS8 A;  3IHG A;  3GD4 A;  5KRQ A;  3DK4 A;  1TYT A;  4CBQ A;  5KNL A;  3NK0 X;  1QJD A;  2YQU A;  3GDP A;  1UKV G;  4Z44 A;  3UOZ A;  4OVI A;  1TDN A;  4JY2 A;  4ZN0 A;  1P2E A;  1MO9 A;  3COX A;  4U8M A;  2Q6U A;  1CBO A;  2XFO A;  4AP3 A;  4GAV A;  2A87 A;  1M6I A;  1S2Y A;  3NHO X;  3UKH A;  2YR5 A;  2GAG B;  2R45 A;  4E0V A;  1E7P A;  3PS9 A;  3RHA A;  4M52 A;  4YSY A;  4Y4M A;  3SZ0 A;  4CRT A;  2ACZ A;  4II3 A;  4A9W A;  3UP5 A;  2R9Z A;  1L9E A;  2XVI A;  1H84 A;  3CNJ A;  3H4K A;  1ZKQ A;  2XVF A;  4H2N A;  4HA6 A;  2GR3 A;  2YVG A;  3O0H A;  5EB5 A;  1BKW A;  2WQY A;  1BWC A;  1OJ9 A;  3DK9 A;  3L8K A;  2IVD A;  4EQR A;  3UKK A;  3L1R A;  2H88 A;  4KPR A;  1CJC A;  5BUL A;  4H50 A;  5JCM A;  1PBC A;  3DJD A;  2X8C A;  1TDK A;  2GR2 A;  4EQS A;  4Z25 A;  5BUK A;  3DJJ A;  1GPE A;  1ZX9 A;  4YSH A;  3FBS A;  4Z2R A;  2A89 A;  4K5S A;  2WBA A;  2OLN A;  2GRT A;  2X50 A;  3HYV A;  5KXJ A;  3H8I A;  1FL2 A;  1RYI A;  2QAE A;  3FMW A;  3GWD A;  3NN0 X;  1YKJ A;  3GYJ A;  3UP4 A;  5KOX A;  3NYF A;  1M64 A;  2AAQ A;  2BC1 A;  2Y6Q A;  3IF9 A;  4I58 A;  3SX6 A;  1V59 A;  1F6M A;  4XXG A;  5KVH A;  4EMI A;  4K7Z A;  4Z24 A;  1DNC A;  2R0G A;  4OPL A;  3R9U A;  1D4D A;  2Z5X A;  1NG4 A;  4G9K A;  4Z2T A;  1JRZ A;  2BYB A;  2CUL A;  2WHD A;  1GND A;  1GRE A;  2YG4 A;  3AED A;  4I59 A;  2WPF A;  3AE2 A;  2B76 A;  1EL7 A;  2E4G A;  4BJY A;  1NAA A;  1EBD A;  2E1M A;  3BI5 A;  1MXT A;  3CPH G;  1FEC A;  2VVM A;  3IHM A;  2BC0 A;  3P9U A;  2YR6 A;  4H2P A;  3RP6 A;  5JCL A;  4A79 A;  3ATR A;  1E1N A;  2F5Z A;  3M0O A;  5HYM A;  3IWA A;  2ZZ0 A;  4PAB A;  1E1K A;  2NVK X;  4USR A;  3QSM A;  1OJC A;  3SXI A;  4FK1 C;  2XLS A;  2J3N A;  2FJE A;  2XFP A;  2YVF A;  1GET A;  3CNT A;  1OJA A;  3GDN A;  3CGB A;  1B8S A;  2Z5Y A;  2RGH A;  3VR8 A;  4G6H A;  4JN9 A;  4NTC A;  2IVE A;  4GUV A;  2XLT A;  4H4W A;  1K0J A;  4J34 A;  1CC4 A;  2GR0 A;  2WU5 A;  5FS6 A;  2BK5 A;  4K2X A;  1IUX A;  4U2L A;  2BXR A;  2GVC A;  2WPC A;  2RAB A;  3E1T A;  3VRB A;  4YTN A;  5JCI A;  4CY8 A;  1H81 A;  1H83 A;  1QLB A;  3BI2 A;  4H4Q A;  3C96 A;  1GRG A;  1GRF A;  1LTX R;  2Y6R A;  1DJN A;  3GMC A;  3GRT A;  1Q1R A;  3DGZ A;  4CNJ A;  2YAU A;  3NLC A;  1H86 A;  3QFA A;  2R0C A;  4YTP A;  5FMH A;  5J7X A;  3SZW A;  4A5L A;  2Q0L A;  4JDR A;  3AB1 A;  1GSN A;  2XDO A;  1H7W A;  2V5Z A;  3UTF A;  2GB0 A;  1PDH A;  3UTE A;  2YLT A;  4H4P A;  4LA1 A;  1IUS A;  1S3E A;  1ZK7 A;  2BA9 A;  3GD3 A;  1EL8 A;  3T31 A;  3NGC X;  5J60 A;  1KSS A;  3K7T A;  4NWZ A;  2XFN A;  1IUT A;  4A6N A;  4CCQ A;  3I3L A;  3ABV A;  2BS2 A;  5EB4 A;  4YT0 A;  4DSH A;  2GR1 A;  1F8S A;  3H8L A;  3KU9 A;  4EMW A;  1XDI A;  3UKA A;  2RGJ A;  4B67 A;  1JOA A;  1GT8 A;  5C3J A;  4H4T A;  2BK4 A;  3NG7 X;  2WDV A;  3G5S A;  1GV4 A;  2GQW A;  3CMM A;  1NDA A;  1TDF A;  1TDO A;  2H89 A;  3VQR A;  4TM3 A;  5M0Z A;  2JB2 A;  2YLS A;  3AE3 A;  5BRT A;  1KFY A;  3CNP A;  1H6V A;  1N1P A;  4AT2 A;  4OPU A;  3NTA A;  4H7U A;  2X99 A;  1KNP A;  4APN A;  2ARD A;  3ALM A;  2I0Z A;  2ZBW A;  2UZZ A;  4P9S A;  3EAN A;  1RP0 A;  4TLX A;  3EPT A;  3Q6J A;  2GF3 A;  1ELI A;  1LQU A;  2V60 A;  1LPF A;  2DKI A;  1S3B A;  3UOX A;  1PXC A;  2DKH A;  3AEE A;  2A8X A;  3T2Y A;  3NT6 A;  2VRM A;  4JNQ A;  1NHS A;  3NNE A;  3T2Z A;  4REK A;  1IUU A;  3B3R A;  2C72 A;  1ZMD A;  1CJ3 A;  4EMJ A;  3NTD A;  4UDP A;  1XPQ A;  3SZF A;  1CF3 A;  1JRX A;  3GRS A;  3UOV A;  1BF3 A;  2GAH B;  3I6D A;  2R46 A;  1D4E A;  2CDU A;  3ZYX A;  1PBE A;  1F8W A;  4J36 A;  4YTM A;  3SY4 A;  1Q9I A;  3P4Q A;  1B4V A;  2WOW A;  4YKF A;  3SGL A;  1Q1W A;  3EF6 A;  3AD9 B;  1LV0 A;  3G5R A;  3HYX A;  4B1B A;  1FEA A;  1TYP A;  3ATQ A;  3LOV A;  4G6G A;  4D03 A;  5LV9 A;  2XYO A;  4C3X A;  2YG7 A;  3C4N A;  2YVJ A;  3K7Q X;  1JEH A;  3NIX A;  1BZL A;  4GRT A;  1CL0 A;  4C5O A;  2GV8 A;  3SZC A;  2B9W A;  5HY5 A;  3AWI A;  4YXD A;  3AE6 A;  4J56 A;  1VDC A;  3NYC A;  4EIP A;  4J31 A;  3KVE A;  2VVL A;  3DGH A;  1N4V A;  4XWZ A;  1COY A;  2TPR A;  2CVJ A;  3NH3 X;  4U8O A;  1O5W A;  2R0P A;  4UDR A;  4X9M A;  2O9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...