2XLTA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with 3-acetylpyridine adenine dinucleotide phosphate (apadp)
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xltA02
3F8RA 1PXBA 2YR4A 4TLXA 4H7UA 3UKHA 4J36A 4CCRA 3AEGA 4U2TA 3ICTA 4TM3A 1LQUA 2C3DA 3ATQA 1PBFA 2NVKX 2Q0KA 3ITJA 1QJDA 2GR3A 4AT2A 4B65A 3NTDA 4JNQA 3CGBA 3EAOA 2C64A 4P9SA 4D03A 2AR8A 5BUKA 4O5UA 3P4QA 4LU6A 4H2NA 2JB3A 4USRA 2B7SA 1GT8A 2R4EA 1TDEA 3KU9A 3AYIA 2FBWA 2C3CA 4UP3A 4USQA 3UKAA 2WDQA 4K22A 4AOSA 5JCMA 1NDAA 1O94A 3CNPA 4PABA 3P1WA 4BJYA 1K0JA 3P4PA 1EL5A 1DOBA 4FK1A 5FS7A 3V76A 2BCPA 3AE7A 2H89A 4DSGA 2EQ6A 1GTHA 2VQ7A 3WE0A 2A87A 1NHRA 3BI2A 3NNEA 1E1NA 3VR9A 4YKGA 3DK8A 1JNRA 3GD3A 2CULA 3AE9A 2YQUA 4NTDA 5CKUA 1P2EA 3QSEA 1D7LA 3C4AA 1N4VA 2Y6QA 3BHFA 2EQ7A 4EMIA 2J3NA 2FJAA 1MOKA 4M52A 1ZY8A 4YSXA 3BHKA 1F8RA 1PJ5A 2FJDA 4H2RA 4YKFA 4OPUA 3AYJA 1VG0A 3NT6A 1EL9A 3ICSA 4JDRA 2BA9A 5C3JA 2BC0A 3QJ4A 2C72A 5JCKA 4Y4NA 1YQ4A 1E1KA 4LIIA 1PBDA 1PBBA 3UKPA 3NYCA 5EBKA 3UCLA 3V3OA 4H4PA 4ECHA 1TRBA 3GMBA 1NG3A 4A79A 3Q6JA 5CQFA 3DJDA 4B67A 1L9DA 1GTEA 1ZOYA 3P4SA 5GRTA 3UOYA 4WX1A 2BACA 3NKSA 3RP7A 1KSUA 2GR1A 4O5QA 5ER0A 1IUUA 3ABVA 2RGJA 1CJ2A 2RGOA 2VVMA 3NK2X 4CNJA 3DA1A 4BK2A 1B37A 1NAAA 3JSKA 4IVMB 4YTNA 3II4A 3ZDNA 5KRQA 1TDFA 4AOXA 3EPTA 1H82A 2OA1A 2WDRA 3AECA 2BXRA 4K8DA 2YLRA 3AD9B 3UKKA 3FIMB 2X8HA 1QLBA 2XFNA 5HYMA 4AP1A 1GOSA 3KA7A 4IA6A 3IF9A 1PN0A 1CHUA 1CJ4A 4JQ9A 2XFUA 3QSSA 1CC2A 2C7GA 1GPEA 2X8GA 4ICYA 1JU2A 1E1LA 4OCGA 1K0LA 2B7RA 2BCGG 1ELIA 1YQ3A 4D04A 5LV9A 5KVHA 2XLRA 4I59A 4BK3A 4BJZA 4NEVA 4ZCDA 4UDQA 2O9ZA 3AE1A 4H4VA 3K7MX 1JEHA 1Y56B 3L8KA 5KXJA 1CJCA 4GRTA 3UOXA 2BABA 3NN6X 3NRNA 3ATRA 5IPYA 2PYXA 2C70A 5L46A 4YSHA 1GRBA 1LPFA 1ZMDA 3PS9A 1DOCA 2GH5A 2WESA 2A8XA 4BK1A 1DJQA 1O95A 4ZN0A 3NYFA 4AP3A 2WQYA 3OC4A 4GDEA 4A7AA 2RABA 1FCDA 5U1OA 4ADWA 2YLTA 1D4DA 2WPCA 1N4UA 1M6IA 1D4EA 1V59A 2IIDA 2YWLA 2R46A 3DMEA 2BK3A 1TDNA 2GF3A 3UKFA 1TYTA 2GMJA 4H4RA 4U2LA 3QVRA 1BGJA 3UTGA 4C5OA 3COXA 1GRFA 2BS4A 3M13A 1N4WA 2V61A 4YXDA 1W4XA 3DH9A 2BK4A 4NZHA 1ZKQA 2A89A 4CCQA 2X8CA 4CY8A 1PXCA 3KPFA 3CNSA 4CRTA 3AEDA 2VOUA 3M0OA 4NTCA 4RG4A 5BRTA 2OALA 3Q9TA 1F8SA 2X99A 4UDPA 2WETA 3I6DA 3NH3X 3C4NA 4X4JA 4OPDA 1Y0PA 1H7XA 1BGNA 1HYUA 2RGHA 2X3NA 4I58A 2GQWA 1B8SA 1EL8A 1PXAA 1ZDLA 3QFBA 2TPRA 1IUXA 2WP5A 1GV4A 2XYOA 5J60A 3V3NA 3IWAA 1JRXA 2B9XA 4DSHA 3LXDA 1PJ7A 1LJ1A 4OPLA 2Q0LA 2GMHA 2BXSA 1L0VA 4NTEA 1IUTA 5DBJA 3BNUA 1S3EA 3O0HA 4H4XA 5GSNA 2HQMA 2YG4A 4X9NA 3GWDA 1NENA 2VZ2A 3D1CA 3AE5A 2V60A 2R0CA 5JCIA 4C77A 3CGEA 2XFOA 3IC9A 2R9ZA 3RP8A 2FJEA 4EQWA 3UOZA 3DJGX 2YVJA 2V6OA 3T37A 1EL7A 4TM0A 1SEZA 4J33A 3S5WA 3REDA 3F8DA 1GALA 3QVPA 4C74A 4EQRA 1F3PA 4TM4A 2B9WA 2WHDA 3NN0X 1NG4A 1H84A 3G5QA 5EOWA 2XDOA 3AWIA 1X31B 2XVIA 3LOVA 1K4QA 3LADA 5HY5A 4H2QA 2IVEA 4YSZA 2UZZA 4JY2A 1AOGA 2E1MA 3CNTA 1GRHA 4YSYA 1CC6A 1PS9A 2H88A 2XLPA 4K5SA 3DGZA 4J34A 1O5WA 3HZLA 2XVHA 1PHHA 3SFDA 2ACZA 1IUVA 1REOA 3G5RA 1LTXR 1CC4A 1JRYA 1L9EA 1QO8A 1Q9IA 2Q7VA 2WPEA 1Q1WA 3P9UA 4EIQA 1XDIA 1OJDA 3CN8A 3K7TA 5J7XA 3SM8A 1BZLA 2WEUA 2FJBA 1YQZA 1NHSA 1RSGA 1S2QA 5HXIA 1DXLA 4LA1A 2YM1A 3K7QX 5HHFA 5KWFA 3AE3A 1BWCA 4A6NA 1ZX9A 1RYIA 2C66A 2GAGB 2YG6A 4B1BA 3CTYA 2WOWA 4U8IA 2AQJA 3UP5A 2BC1A 3S61A 4EQSA 2YM2A 3KD9A 4YTPA 4BURA 4U8MA 1B5QA 3BI4A 1LVLA 3VRBA 3FBSA 1F6MA 1H86A 1B4VA 1GREA 2CFYA 2YG5A 3KVEA 5FS8A 5M10A 2Z5YA 4OVIA 1VG9A 1ZMCA 4EMJA 4JN9A 4C3YA 1GESA 3GWFA 4FDCB 2BS3A 4Z2TA 1XANA 3NK0X 1CL0A 3E1TA 3ZYXA 4DNAA 1DOEA 4XWZA 2QA2A 2YLZA 4B68A 4U8PA 1CJ3A 1GNDA 2WU2A 3DK9A 2OAMA 4FX9A 3R9UA 1ONFA 2V3BA 4IVOB 1ZK7A 2CVJA 3NIXA 3DJJA 3RP6A 2B9YA 3AEBA 3ALMA 1OJTA 3I3LA 1TDOA 1H7WA 2YG7A 3B6DA 1KSSA 1MXTA 2XLSA 1NPXA 1NEKA 2WP9A 2XFQA 2YR6A 3UTHA 1VDCA 4Y4MA 1TDKA 3UKLA 3K30A 2C75A 1E39A 2Q6UA 2YVGA 1GXFA 2YAUA 1DODA 2YR5A 3CIRA 4YT0A 4GCMA 4U8JA 4U8NA 2C76A 2JKCA 4JNAA 1BKWA 3FG2P 4CBQA 3DGHA 2WDVA 4J31A 1OJCA 2XLUA 2GR2A 2YLXA 2EQ9A 4J2WA 4APNA 4E0VA 4CY6A 2E5VA 2Z5XA 1ZP0A 2WPFA 3GYJA 4U2SA 3AE2A 3UKQA 3NYEA 3BNMA 2GB0A 3GSIA 1F8WA 1KF6A 1COYA 1UKVG 2ZZBA 4HA6A 3KLJA 2R0PA 2BS2A 1BF3A 4OPTA 3QSMA 1GSNA 4U8KA 4Z44A 4B66A 4GUVA 2PHHA 4OPCA 5U63A 1LV0A 2GR0A 3SQPA 1KNPA 4ZCCA 1D4CA 3FPZA 2GAHB 3AD8B 4EMWA 4C3XA 3ISHA 1S3BA 1FECA 3B3RA 3F8PA 2ZBWA 4A99A 3NHOX 3IHGA 5FS9A 4Z24A 2XVEA 2XVFA 2R0GA 2XCGA 1MO9A 1YY5A 2X50A 3VRAA 1N1PA 5EB4A 3PO7A 1P2HA 5KOXA 1IUWA 3NGCX 3LZWA 4Z25A 1S2YA 2VRMA 4K5RA 3LB8A 5U25A 3UTEA 2WOVA 4GR1A 3UOVA 4UDRA 4H4WA 2VQBA 4WCTA 2NPXA 4RSLA 2VVLA 3AE4A 2JB1A 4TM1A 4B64A 3LZXA 3AE6A 3GRTA 2C65A 2DKHA 2GRTA 2Y6RA 4A5LA 2GEWA 4H4SA 1JOAA 2QAEA 3H8LA 4H50A 2XFPA 3ICRA 1VRQB 4N9XA 1E7PA 4FK1C 2JK6A 3DK4A 3VRDB 1E1MA 4EM4A 2YVFA 3C96A 3H4KA 1XHCA 1YKJA 2B76A 2F5ZA 2WU5A 2AAQA 1CF3A 3BI5A 3GDPA 3RHAA 2QA1A 3CPJG 1PBCA 5BULA 4X9MA 4RG3A 2OLNA 3UP4A 4A65A 2I0ZA 4Z2UA 1H83A 4PAAA 3AEEA 1GERA 1PJ6A 1Q1RA 2APGA 5JCLA 1E6EA 4REKA 4EM3A 2JB2A 1XPQA 1PBEA 2DKIA 2C67A 4K7ZA 1KFYA 3LJPA 2V3AA 4YWOA 4GDPA 2BYBA 4H4ZA 5IQ1A 3GMCA 3SGLA 3CPHG 1IUSA 3NG7X 2IVDA 4XXGA 2GQFA 3FMWA 1H81A 1M64A 1RP0A 3GRSA 4GF7A 2R4JA 5BVAA 3L1RA 4NEWA 2ARDA 4K2XA 5EB5A 3VQRA 2W0HA 1JRZA 2XLTA 2XVJA 2YLSA 3SFEA 1DNCA 4Y4LA 5JCNA 3M12A 2EQ8A 3NK1X 2ZZ0A 3QFAA 4A9WA 3VR8A 1TYPA 2WBAA 2BK5A 4Z43A 1GETA 1GRGA 3CGDA 1JNZA 3NLCA 2WS3A 2GV8A 4KX6A 4TLZA 1D5TA 1Y56A 3D8XA 5C2TA 1FL2A 2QCUA 4OPIA 4EIPA 1VQWA 3KKJA 4YTMA 5IQ4A 2R45A 5M0ZA 2JAEA 2TMDA 3AB1A 4H4QA 3OZ2A 3AEFA 3CGCA 2VRLA 2CDUA 3EANA 4KPRA 3AEAA 3URHA 2V5ZA 3CPIG 4A6NB 4XWRA 4CNKA 4EQXA 3ALLA 5KVIA 1FEAA 3H8IA 3UTFA 2E4GA 4HB9A 1K0IA 3ADAB 2C73A 4Z2RA 4H4TA 2OLOA 4MJWA 3GYIA 1D7YA 1OJ9A 4H4UA 1LQTA 4OPGA 3EF6A 4JY3A 3G5SA 3AXBA 4B69A 4Z26A 1KDGA 4BV6A 3AE8A 3NTAA 3DJEA 1PDHA 4U8LA 4J56A 2YLWA 1DJNA 3P4RA 5TR3A 5FS6A 1GRTA 4H2PA 4H4YA 1OJAA 1CBOA 3AD7B 2WP6A 3GDNA 2GVCA 3IHMA 4J57A 3RNMA 3GD4A 1GEUA 2WOIA 1Z6LA 1NHQA 1GRAA 2ZZCA 4B63A 3ALJA 1NHPA 5FMHA 1FOHA 4IA5A 1EBDA 1H6VA 2VVLG 4DGKA 1ZOVA 1IJHA 3AYLA 3CNJA 4AT0A 2YG3A 1L9CA 2JBVA 3CNDA 3PVCA 4U8OA 5KOWA 4IV9A 1FEBA 1KNRA
chains in the Genus database with same CATH superfamily
3F8RA 1PXBA 2YR4A 4TLXA 4H7UA 3UKHA 4J36A 4CCRA 3AEGA 4U2TA 3ICTA 4TM3A 1LQUA 2C3DA 3ATQA 1PBFA 2NVKX 2Q0KA 3ITJA 1QJDA 2GR3A 4AT2A 4B65A 3NTDA 4JNQA 3CGBA 3EAOA 2C64A 4P9SA 4D03A 2AR8A 5BUKA 2BRAA 4O5UA 3P4QA 4LU6A 4H2NA 4GAVA 2JB3A 4USRA 2B7SA 1GT8A 2R4EA 1TDEA 3KU9A 3AYIA 2FBWA 2C3CA 4UP3A 4USQA 3UKAA 2WDQA 4K22A 4AOSA 5JCMA 1NDAA 1O94A 3CNPA 4PABA 3P1WA 4BJYA 3T14A 1K0JA 3P4PA 1EL5A 1DOBA 4FK1A 5FS7A 3T2ZA 2BCPA 3AE7A 2H89A 3V76A 3T2KA 4DSGA 2EQ6A 1GTHA 2VQ7A 3WE0A 2A87A 1NHRA 3BI2A 3NNEA 1E1NA 3VR9A 4YKGA 3DK8A 1JNRA 3GD3A 2CULA 3AE9A 2YQUA 4NTDA 5CKUA 1P2EA 3QSEA 1D7LA 3C4AA 1N4VA 2Y6QA 3BHFA 2EQ7A 4EMIA 2J3NA 2FJAA 1MOKA 4M52A 1ZY8A 4YSXA 3BHKA 1F8RA 1PJ5A 2FJDA 4H2RA 4YKFA 4OPUA 3AYJA 1VG0A 3NT6A 1EL9A 3ICSA 4JDRA 2BA9A 5C3JA 2BC0A 3QJ4A 2C72A 5JCKA 4Y4NA 1YQ4A 1E1KA 4LIIA 1PBDA 1PBBA 3UKPA 3NYCA 5EBKA 3UCLA 3V3OA 4H4PA 4ECHA 1TRBA 3GMBA 1NG3A 3SZCA 4A79A 3Q6JA 5CQFA 3DJDA 4B67A 5KMSA 1L9DA 4G6GA 1GTEA 1ZOYA 3P4SA 5GRTA 3UOYA 4WX1A 2BACA 3NKSA 3RP7A 1KSUA 2GR1A 4O5QA 5ER0A 1IUUA 3ABVA 2RGJA 1CJ2A 2RGOA 2VVMA 3NK2X 4CNJA 3DA1A 4BK2A 1B37A 1NAAA 3JSKA 4IVMB 4YTNA 3II4A 3ZDNA 5KRQA 1TDFA 4G73A 3EPTA 4AOXA 1H82A 4NNJA 2OA1A 2WDRA 3AECA 2BXRA 3HYVA 4K8DA 2YLRA 3AD9B 3UKKA 3FIMB 2X8HA 1QLBA 2XFNA 5HYMA 4AP1A 4G74A 1GOSA 3KA7A 4IA6A 3IF9A 1PN0A 1CHUA 1CJ4A 4JQ9A 2XFUA 3QSSA 1CC2A 2C7GA 1GPEA 2X8GA 4ICYA 1JU2A 1E1LA 4OCGA 1K0LA 2B7RA 2BCGG 1ELIA 1YQ3A 4D04A 5LV9A 5KVHA 2XLRA 4I59A 4BK3A 4BJZA 4G6HA 4NEVA 4ZCDA 4UDQA 2O9ZA 3AE1A 4H4VA 3K7MX 1JEHA 1Y56B 3L8KA 3SX6A 1CJCA 4GRTA 5KXJA 3UOXA 2BABA 3NN6X 3NRNA 3ATRA 5IPYA 2PYXA 2C70A 5L46A 4YSHA 1GRBA 1LPFA 1ZMDA 3PS9A 1DOCA 2GH5A 2WESA 2A8XA 4BK1A 1DJQA 1O95A 4ZN0A 3NYFA 4AP3A 2WQYA 3OC4A 4GDEA 4A7AA 2RABA 1FCDA 5U1OA 4ADWA 2YLTA 1D4DA 2WPCA 1N4UA 1M6IA 1D4EA 1V59A 2IIDA 2BRYA 2YWLA 2R46A 3DMEA 2BK3A 1TDNA 2GF3A 3UKFA 1TYTA 2GMJA 4H4RA 4U2LA 3QVRA 1BGJA 3UTGA 4C5OA 3COXA 1GRFA 2BS4A 3HYWA 1N4WA 2V61A 3M13A 4II3A 4YXDA 1W4XA 3DH9A 2BK4A 4NZHA 1ZKQA 2A89A 4CCQA 2X8CA 4CY8A 1PXCA 3KPFA 4NWZA 3CNSA 4CRTA 3AEDA 2VOUA 3M0OA 4NTCA 4RG4A 5BRTA 2OALA 3Q9TA 1F8SA 2X99A 4UDPA 2WETA 3I6DA 3NH3X 3C4NA 4X4JA 4OPDA 1Y0PA 4GAPA 1H7XA 1BGNA 1HYUA 3T31A 2RGHA 2X3NA 4I58A 2GQWA 4II2A 1B8SA 1EL8A 1PXAA 1ZDLA 3QFBA 2TPRA 1IUXA 2WP5A 1GV4A 2XYOA 5J60A 3V3NA 3IWAA 1JRXA 2B9XA 4DSHA 3LXDA 1PJ7A 1LJ1A 4OPLA 2Q0LA 2GMHA 2BXSA 1L0VA 4NTEA 1IUTA 5DBJA 3BNUA 1S3EA 3O0HA 4H4XA 5GSNA 2HQMA 2YG4A 4X9NA 3GWDA 1NENA 2VZ2A 3D1CA 3AE5A 2V60A 2R0CA 5JCIA 4C77A 3CGEA 2XFOA 3IC9A 2R9ZA 3RP8A 2FJEA 4EQWA 3UOZA 3DJGX 2YVJA 2V6OA 3T37A 1EL7A 4TM0A 1SEZA 4J33A 3S5WA 3REDA 3F8DA 1GALA 3QVPA 4C74A 4EQRA 1F3PA 4TM4A 2B9WA 2WHDA 3NN0X 1NG4A 1H84A 3G5QA 5EOWA 2XDOA 3AWIA 1X31B 2XVIA 3LOVA 1K4QA 3LADA 5HY5A 4H2QA 3SYIA 2IVEA 4YSZA 2UZZA 4JY2A 1AOGA 2E1MA 3CNTA 1GRHA 4YSYA 1CC6A 1PS9A 2H88A 2XLPA 4K5SA 3DGZA 4J34A 1O5WA 3HZLA 2XVHA 1PHHA 3SFDA 2ACZA 1IUVA 1REOA 3G5RA 1LTXR 1CC4A 1JRYA 1L9EA 1QO8A 1Q9IA 2Q7VA 2WPEA 1Q1WA 3P9UA 4G9KA 4EIQA 1XDIA 1OJDA 3CN8A 3K7TA 5J7XA 3SM8A 1BZLA 2WEUA 2FJBA 1YQZA 1NHSA 1RSGA 1S2QA 5HXIA 1DXLA 4LA1A 2YM1A 3K7QX 5HHFA 5KWFA 3AE3A 3HYXA 3T0KA 1BWCA 4A6NA 1ZX9A 1RYIA 2C66A 2GAGB 2YG6A 4B1BA 3CTYA 2WOWA 4U8IA 2AQJA 3UP5A 2BC1A 3S61A 4EQSA 2YM2A 3KD9A 5KMQA 4YTPA 4BURA 4U8MA 1B5QA 3BI4A 1LVLA 3VRBA 3CMMA 3FBSA 1F6MA 1H86A 1B4VA 1GREA 2CFYA 2YG5A 3KVEA 5FS8A 5M10A 2Z5YA 4OVIA 1VG9A 1ZMCA 4EMJA 4JN9A 4C3YA 1GESA 3GWFA 4FDCB 2BS3A 4Z2TA 1XANA 3NK0X 1CL0A 3E1TA 3ZYXA 4DNAA 1DOEA 5KMRA 4XWZA 2QA2A 2YLZA 4B68A 4U8PA 1CJ3A 1GNDA 2WU2A 3DK9A 2OAMA 4FX9A 3R9UA 1ONFA 2V3BA 4IVOB 1ZK7A 2CVJA 3NIXA 3DJJA 3RP6A 2B9YA 3AEBA 3ALMA 1OJTA 3I3LA 1TDOA 1H7WA 2YG7A 3B6DA 1KSSA 1MXTA 2XLSA 1NPXA 1NEKA 2WP9A 2XFQA 2YR6A 3UTHA 1VDCA 4Y4MA 1TDKA 3UKLA 3K30A 2C75A 1E39A 2Q6UA 2YVGA 1GXFA 2YAUA 1DODA 2YR5A 3CIRA 3KPKA 4YT0A 4GCMA 4U8JA 4U8NA 2C76A 2JKCA 4JNAA 1BKWA 3FG2P 4CBQA 3DGHA 2WDVA 4J31A 1OJCA 2XLUA 2GR2A 2YLXA 2EQ9A 4J2WA 4APNA 4E0VA 4CY6A 2E5VA 2Z5XA 1ZP0A 2WPFA 3GYJA 4U2SA 3AE2A 3UKQA 3NYEA 3BNMA 2GB0A 3GSIA 1F8WA 1KF6A 1COYA 1UKVG 2ZZBA 4HA6A 3KLJA 2R0PA 2BS2A 1BF3A 4OPTA 3QSMA 1GSNA 4U8KA 4Z44A 4B66A 4GUVA 2PHHA 4OPCA 5U63A 1LV0A 2GR0A 3SQPA 1KNPA 4ZCCA 1D4CA 3FPZA 2GAHB 3AD8B 3T2YA 4EMWA 4C3XA 3ISHA 3SZ0A 1S3BA 1FECA 3B3RA 3F8PA 2ZBWA 4A99A 3NHOX 3IHGA 5FS9A 4Z24A 2XVEA 2XVFA 2R0GA 2XCGA 1MO9A 1YY5A 2X50A 3VRAA 1N1PA 5EB4A 3PO7A 3SZFA 1P2HA 5KOXA 1IUWA 3NGCX 3LZWA 4Z25A 1S2YA 2VRMA 4K5RA 3LB8A 3SZWA 5U25A 3UTEA 2WOVA 4GR1A 3UOVA 4UDRA 4H4WA 2VQBA 4WCTA 2NPXA 4RSLA 2VVLA 3AE4A 2JB1A 4TM1A 4B64A 3LZXA 3AE6A 3GRTA 2C65A 2DKHA 2GRTA 2Y6RA 4A5LA 2GEWA 4H4SA 1JOAA 2QAEA 3H8LA 4H50A 2XFPA 3ICRA 1VRQB 4N9XA 1E7PA 4FK1C 2JK6A 3DK4A 3VRDB 1E1MA 4EM4A 2YVFA 3C96A 3H4KA 1XHCA 1YKJA 2B76A 2F5ZA 2WU5A 2AAQA 1CF3A 3BI5A 3GDPA 3RHAA 2QA1A 3CPJG 1PBCA 5BULA 3GYXA 4X9MA 4RG3A 2OLNA 3UP4A 4A65A 2I0ZA 4Z2UA 1H83A 4PAAA 3AEEA 1GERA 1PJ6A 1Q1RA 2APGA 5JCLA 1E6EA 4REKA 4EM3A 2JB2A 1XPQA 1PBEA 2DKIA 2C67A 4K7ZA 1KFYA 3LJPA 2V3AA 4YWOA 4GDPA 2BYBA 4H4ZA 5IQ1A 3GMCA 3SGLA 3CPHG 1IUSA 3NG7X 2IVDA 4XXGA 2GQFA 3FMWA 1H81A 1M64A 1RP0A 3GRSA 4GF7A 2R4JA 5BVAA 3L1RA 4NEWA 2ARDA 4K2XA 5EB5A 3VQRA 2W0HA 1JRZA 3SXIA 2XLTA 2XVJA 2YLSA 3SFEA 1DNCA 4Y4LA 5JCNA 3M12A 2EQ8A 3NK1X 2ZZ0A 3QFAA 4A9WA 3VR8A 1TYPA 2WBAA 2BK5A 4Z43A 1GETA 1GRGA 3CGDA 1JNZA 3NLCA 2WS3A 2GV8A 4KX6A 4TLZA 1D5TA 1Y56A 3D8XA 5C2TA 1FL2A 2QCUA 4OPIA 4EIPA 1VQWA 3KKJA 4YTMA 5IQ4A 2R45A 5M0ZA 2JAEA 2TMDA 3AB1A 4H4QA 3OZ2A 3AEFA 3CGCA 2VRLA 2CDUA 3EANA 4KPRA 3AEAA 3URHA 2V5ZA 3CPIG 4A6NB 2C4CA 4XWRA 4CNKA 4EQXA 3ALLA 5KVIA 1FEAA 3H8IA 3UTFA 2E4GA 4HB9A 5KNLA 1K0IA 3ADAB 2C73A 4Z2RA 4H4TA 2OLOA 4MJWA 3GYIA 1D7YA 1OJ9A 4H4UA 1LQTA 5KMPA 4OPGA 3EF6A 4JY3A 3G5SA 3AXBA 4B69A 4Z26A 1KDGA 4BV6A 3AE8A 3NTAA 3DJEA 1PDHA 4U8LA 4J56A 2YLWA 1DJNA 3P4RA 3SY4A 5TR3A 5FS6A 1GRTA 4H2PA 4H4YA 1OJAA 1CBOA 3AD7B 2WP6A 3GDNA 2GVCA 3IHMA 4J57A 3RNMA 3GD4A 1GEUA 2WOIA 1Z6LA 1NHQA 1GRAA 2ZZCA 4B63A 3ALJA 1NHPA 5FMHA 1FOHA 4IA5A 1EBDA 1H6VA 2VVLG 4DGKA 1ZOVA 1IJHA 3AYLA 3CNJA 4AT0A 2YG3A 1L9CA 2JBVA 3CNDA 3PVCA 4U8OA 5KOWA 4IV9A 1FEBA 1KNRA
chains in the Genus database with same CATH topology
3F8RA 1PXBA 2YR4A 4TLXA 4H7UA 3UKHA 4J36A 4CCRA 3AEGA 4U2TA 3ICTA 4TM3A 1LQUA 2C3DA 3ATQA 1PBFA 2NVKX 2Q0KA 3ITJA 1QJDA 2GR3A 4AT2A 4B65A 3NTDA 4JNQA 3CGBA 3EAOA 2C64A 4P9SA 4D03A 2AR8A 5BUKA 2BRAA 4O5UA 3P4QA 4LU6A 4H2NA 4GAVA 2JB3A 4USRA 2B7SA 1GT8A 2R4EA 1TDEA 3KU9A 3AYIA 2FBWA 2C3CA 4UP3A 4USQA 3UKAA 2WDQA 4K22A 4AOSA 5JCMA 1NDAA 1O94A 3CNPA 4PABA 3P1WA 4BJYA 3T14A 1K0JA 3P4PA 1EL5A 1DOBA 4FK1A 5FS7A 3T2ZA 2BCPA 3AE7A 2H89A 3V76A 3T2KA 4DSGA 2EQ6A 1GTHA 2VQ7A 3WE0A 2A87A 1NHRA 3BI2A 3NNEA 1E1NA 3VR9A 4YKGA 3DK8A 1JNRA 3GD3A 2CULA 3AE9A 2YQUA 4NTDA 5CKUA 1P2EA 3QSEA 1D7LA 3C4AA 1N4VA 2Y6QA 3BHFA 2EQ7A 4EMIA 2J3NA 2FJAA 1MOKA 4M52A 1ZY8A 4YSXA 3BHKA 1F8RA 1PJ5A 2FJDA 4H2RA 4YKFA 4OPUA 3AYJA 1VG0A 3NT6A 1EL9A 3ICSA 4JDRA 2BA9A 5C3JA 2BC0A 3QJ4A 2C72A 5JCKA 4Y4NA 1YQ4A 1E1KA 4LIIA 1PBDA 1PBBA 3UKPA 3NYCA 5EBKA 3UCLA 3V3OA 4H4PA 4ECHA 1TRBA 3GMBA 1NG3A 3SZCA 4A79A 3Q6JA 5CQFA 3DJDA 4B67A 5KMSA 1L9DA 4G6GA 1GTEA 1ZOYA 3P4SA 5GRTA 3UOYA 4WX1A 2BACA 3NKSA 3RP7A 1KSUA 2GR1A 4O5QA 5ER0A 1IUUA 3ABVA 2RGJA 1CJ2A 2RGOA 2VVMA 3NK2X 4CNJA 3DA1A 4BK2A 1B37A 1NAAA 3JSKA 4IVMB 4YTNA 3II4A 3ZDNA 5KRQA 1TDFA 4G73A 3EPTA 4AOXA 1H82A 4NNJA 2OA1A 2WDRA 3AECA 2BXRA 3HYVA 4K8DA 2YLRA 3AD9B 3UKKA 3FIMB 2X8HA 1QLBA 2XFNA 5HYMA 4AP1A 4G74A 1GOSA 3KA7A 4IA6A 3IF9A 1PN0A 1CHUA 1CJ4A 4JQ9A 2XFUA 3QSSA 1CC2A 2C7GA 1GPEA 2X8GA 4ICYA 1JU2A 1E1LA 4OCGA 1K0LA 2B7RA 2BCGG 1ELIA 1YQ3A 4D04A 5LV9A 5KVHA 2XLRA 4I59A 4BK3A 4BJZA 4G6HA 4NEVA 4ZCDA 4UDQA 2O9ZA 3AE1A 4H4VA 3K7MX 1JEHA 1Y56B 3L8KA 3SX6A 1CJCA 4GRTA 5KXJA 3UOXA 2BABA 3NN6X 3NRNA 3ATRA 5IPYA 2PYXA 2C70A 5L46A 4YSHA 1GRBA 1LPFA 1ZMDA 3PS9A 1DOCA 2GH5A 2WESA 2A8XA 4BK1A 1DJQA 1O95A 4ZN0A 3NYFA 4AP3A 2WQYA 3OC4A 4GDEA 4A7AA 2RABA 1FCDA 5U1OA 4ADWA 2YLTA 1D4DA 2WPCA 1N4UA 1M6IA 1D4EA 1V59A 2IIDA 2BRYA 2YWLA 2R46A 3DMEA 2BK3A 1TDNA 2GF3A 3UKFA 1TYTA 2GMJA 4H4RA 4U2LA 3QVRA 1BGJA 3UTGA 4C5OA 3COXA 1GRFA 2BS4A 3HYWA 1N4WA 2V61A 3M13A 4II3A 4YXDA 1W4XA 3DH9A 2BK4A 4NZHA 1ZKQA 2A89A 4CCQA 2X8CA 4CY8A 1PXCA 3KPFA 4NWZA 3CNSA 4CRTA 3AEDA 2VOUA 3M0OA 4NTCA 4RG4A 5BRTA 2OALA 3Q9TA 1F8SA 2X99A 4UDPA 2WETA 3I6DA 3NH3X 3C4NA 4X4JA 4OPDA 1Y0PA 4GAPA 1H7XA 1BGNA 1HYUA 3T31A 2RGHA 2X3NA 4I58A 2GQWA 4II2A 1B8SA 1EL8A 1PXAA 1ZDLA 3QFBA 2TPRA 1IUXA 2WP5A 1GV4A 2XYOA 5J60A 3V3NA 3IWAA 1JRXA 2B9XA 4DSHA 3LXDA 1PJ7A 1LJ1A 4OPLA 2Q0LA 2GMHA 2BXSA 1L0VA 4NTEA 1IUTA 5DBJA 3BNUA 1S3EA 3O0HA 4H4XA 5GSNA 2HQMA 2YG4A 4X9NA 3GWDA 1NENA 2VZ2A 3D1CA 3AE5A 2V60A 2R0CA 5JCIA 4C77A 3CGEA 2XFOA 3IC9A 2R9ZA 3RP8A 2FJEA 4EQWA 3UOZA 3DJGX 2YVJA 2V6OA 3T37A 1EL7A 4TM0A 1SEZA 4J33A 3S5WA 3REDA 3F8DA 1GALA 3QVPA 4C74A 4EQRA 1F3PA 4TM4A 2B9WA 2WHDA 3NN0X 1NG4A 1H84A 3G5QA 5EOWA 2XDOA 3AWIA 1X31B 2XVIA 3LOVA 1K4QA 3LADA 5HY5A 4H2QA 3SYIA 2IVEA 4YSZA 2UZZA 4JY2A 1AOGA 2E1MA 3CNTA 1GRHA 4YSYA 1CC6A 1PS9A 2H88A 2XLPA 4K5SA 3DGZA 4J34A 1O5WA 3HZLA 2XVHA 1PHHA 3SFDA 2ACZA 1IUVA 1REOA 3G5RA 1LTXR 1CC4A 1JRYA 1L9EA 1QO8A 1Q9IA 2Q7VA 2WPEA 1Q1WA 3P9UA 4G9KA 4EIQA 1XDIA 1OJDA 3CN8A 3K7TA 5J7XA 3SM8A 1BZLA 2WEUA 2FJBA 1YQZA 1NHSA 1RSGA 1S2QA 5HXIA 1DXLA 4LA1A 2YM1A 3K7QX 5HHFA 5KWFA 3AE3A 3HYXA 3T0KA 1BWCA 4A6NA 1ZX9A 1RYIA 2C66A 2GAGB 2YG6A 4B1BA 3CTYA 2WOWA 4U8IA 2AQJA 3UP5A 2BC1A 3S61A 4EQSA 2YM2A 3KD9A 5KMQA 4YTPA 4BURA 4U8MA 1B5QA 3BI4A 1LVLA 3VRBA 3CMMA 3FBSA 1F6MA 1H86A 1B4VA 1GREA 2CFYA 2YG5A 3KVEA 5FS8A 5M10A 2Z5YA 4OVIA 1VG9A 1ZMCA 4EMJA 4JN9A 4C3YA 1GESA 3GWFA 4FDCB 2BS3A 4Z2TA 1XANA 3NK0X 1CL0A 3E1TA 3ZYXA 4DNAA 1DOEA 5KMRA 4XWZA 2QA2A 2YLZA 4B68A 4U8PA 1CJ3A 1GNDA 2WU2A 3DK9A 2OAMA 4FX9A 3R9UA 1ONFA 2V3BA 4IVOB 1ZK7A 2CVJA 3NIXA 3DJJA 3RP6A 2B9YA 3AEBA 3ALMA 1OJTA 3I3LA 1TDOA 1H7WA 2YG7A 3B6DA 1KSSA 1MXTA 2XLSA 1NPXA 1NEKA 2WP9A 2XFQA 2YR6A 3UTHA 1VDCA 4Y4MA 1TDKA 3UKLA 3K30A 2C75A 1E39A 2Q6UA 2YVGA 1GXFA 2YAUA 1DODA 2YR5A 3CIRA 3KPKA 4YT0A 4GCMA 4U8JA 4U8NA 2C76A 2JKCA 4JNAA 1BKWA 3FG2P 4CBQA 3DGHA 2WDVA 4J31A 1OJCA 2XLUA 2GR2A 2YLXA 2EQ9A 4J2WA 4APNA 4E0VA 4CY6A 2E5VA 2Z5XA 1ZP0A 2WPFA 3GYJA 4U2SA 3AE2A 3UKQA 3NYEA 3BNMA 2GB0A 3GSIA 1F8WA 1KF6A 1COYA 1UKVG 2ZZBA 4HA6A 3KLJA 2R0PA 2BS2A 1BF3A 4OPTA 3QSMA 1GSNA 4U8KA 4Z44A 4B66A 4GUVA 2PHHA 4OPCA 5U63A 1LV0A 2GR0A 3SQPA 1KNPA 4ZCCA 1D4CA 3FPZA 2GAHB 3AD8B 3T2YA 4EMWA 4C3XA 3ISHA 3SZ0A 1S3BA 1FECA 3B3RA 3F8PA 2ZBWA 4A99A 3NHOX 3IHGA 5FS9A 4Z24A 2XVEA 2XVFA 2R0GA 2XCGA 1MO9A 1YY5A 2X50A 3VRAA 1N1PA 5EB4A 3PO7A 3SZFA 1P2HA 5KOXA 1IUWA 3NGCX 3LZWA 4Z25A 1S2YA 2VRMA 4K5RA 3LB8A 3SZWA 5U25A 3UTEA 2WOVA 4GR1A 3UOVA 4UDRA 4H4WA 2VQBA 4WCTA 2NPXA 4RSLA 2VVLA 3AE4A 2JB1A 4TM1A 4B64A 3LZXA 3AE6A 3GRTA 2C65A 2DKHA 2GRTA 2Y6RA 4A5LA 2GEWA 4H4SA 1JOAA 2QAEA 3H8LA 4H50A 2XFPA 3ICRA 1VRQB 4N9XA 1E7PA 4FK1C 2JK6A 3DK4A 3VRDB 1E1MA 4EM4A 2YVFA 3C96A 3H4KA 1XHCA 1YKJA 2B76A 2F5ZA 2WU5A 2AAQA 1CF3A 3BI5A 3GDPA 3RHAA 2QA1A 3CPJG 1PBCA 5BULA 3GYXA 4X9MA 4RG3A 2OLNA 3UP4A 4A65A 2I0ZA 4Z2UA 1H83A 4PAAA 3AEEA 1GERA 1PJ6A 1Q1RA 2APGA 5JCLA 1E6EA 4REKA 4EM3A 2JB2A 1XPQA 1PBEA 2DKIA 2C67A 4K7ZA 1KFYA 3LJPA 2V3AA 4YWOA 4GDPA 2BYBA 4H4ZA 5IQ1A 3GMCA 3SGLA 3CPHG 1IUSA 3NG7X 2IVDA 4XXGA 2GQFA 3FMWA 1H81A 1M64A 1RP0A 3GRSA 4GF7A 2R4JA 5BVAA 3L1RA 4NEWA 2ARDA 4K2XA 5EB5A 3VQRA 2W0HA 1JRZA 3SXIA 2XLTA 2XVJA 2YLSA 3SFEA 1DNCA 4Y4LA 5JCNA 3M12A 2EQ8A 3NK1X 2ZZ0A 3QFAA 4A9WA 3VR8A 1TYPA 2WBAA 2BK5A 4Z43A 1GETA 1GRGA 3CGDA 1JNZA 3NLCA 2WS3A 2GV8A 4KX6A 4TLZA 1D5TA 1Y56A 3D8XA 5C2TA 1FL2A 2QCUA 4OPIA 4EIPA 1VQWA 3KKJA 4YTMA 5IQ4A 2R45A 5M0ZA 2JAEA 2TMDA 3AB1A 4H4QA 3OZ2A 3AEFA 3CGCA 2VRLA 2CDUA 3EANA 4KPRA 3AEAA 3URHA 2V5ZA 3CPIG 4A6NB 2C4CA 4XWRA 4CNKA 4EQXA 3ALLA 5KVIA 1FEAA 3H8IA 3UTFA 2E4GA 4HB9A 5KNLA 1K0IA 3ADAB 2C73A 4Z2RA 4H4TA 2OLOA 4MJWA 3GYIA 1D7YA 1OJ9A 4H4UA 1LQTA 5KMPA 4OPGA 3EF6A 4JY3A 3G5SA 3AXBA 4B69A 4Z26A 1KDGA 4BV6A 3AE8A 3NTAA 3DJEA 1PDHA 4U8LA 4J56A 2YLWA 1DJNA 3P4RA 3SY4A 5TR3A 5FS6A 1GRTA 4H2PA 4H4YA 1OJAA 1CBOA 3AD7B 2WP6A 3GDNA 2GVCA 3IHMA 4J57A 3RNMA 3GD4A 1GEUA 2WOIA 1Z6LA 1NHQA 1GRAA 2ZZCA 4B63A 3ALJA 1NHPA 5FMHA 1FOHA 4IA5A 1EBDA 1H6VA 2VVLG 4DGKA 1ZOVA 1IJHA 3AYLA 3CNJA 4AT0A 2YG3A 1L9CA 2JBVA 3CNDA 3PVCA 4U8OA 5KOWA 4IV9A 1FEBA 1KNRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8R A;  1PXB A;  2YR4 A;  4TLX A;  4H7U A;  3UKH A;  4J36 A;  4CCR A;  3AEG A;  4U2T A;  3ICT A;  4TM3 A;  1LQU A;  2C3D A;  3ATQ A;  1PBF A;  2NVK X;  2Q0K A;  3ITJ A;  1QJD A;  2GR3 A;  4AT2 A;  4B65 A;  3NTD A;  4JNQ A;  3CGB A;  3EAO A;  2C64 A;  4P9S A;  4D03 A;  2AR8 A;  5BUK A;  4O5U A;  3P4Q A;  4LU6 A;  4H2N A;  2JB3 A;  4USR A;  2B7S A;  1GT8 A;  2R4E A;  1TDE A;  3KU9 A;  3AYI A;  2FBW A;  2C3C A;  4UP3 A;  4USQ A;  3UKA A;  2WDQ A;  4K22 A;  4AOS A;  5JCM A;  1NDA A;  1O94 A;  3CNP A;  4PAB A;  3P1W A;  4BJY A;  1K0J A;  3P4P A;  1EL5 A;  1DOB A;  4FK1 A;  5FS7 A;  3V76 A;  2BCP A;  3AE7 A;  2H89 A;  4DSG A;  2EQ6 A;  1GTH A;  2VQ7 A;  3WE0 A;  2A87 A;  1NHR A;  3BI2 A;  3NNE A;  1E1N A;  3VR9 A;  4YKG A;  3DK8 A;  1JNR A;  3GD3 A;  2CUL A;  3AE9 A;  2YQU A;  4NTD A;  5CKU A;  1P2E A;  3QSE A;  1D7L A;  3C4A A;  1N4V A;  2Y6Q A;  3BHF A;  2EQ7 A;  4EMI A;  2J3N A;  2FJA A;  1MOK A;  4M52 A;  1ZY8 A;  4YSX A;  3BHK A;  1F8R A;  1PJ5 A;  2FJD A;  4H2R A;  4YKF A;  4OPU A;  3AYJ A;  1VG0 A;  3NT6 A;  1EL9 A;  3ICS A;  4JDR A;  2BA9 A;  5C3J A;  2BC0 A;  3QJ4 A;  2C72 A;  5JCK A;  4Y4N A;  1YQ4 A;  1E1K A;  4LII A;  1PBD A;  1PBB A;  3UKP A;  3NYC A;  5EBK A;  3UCL A;  3V3O A;  4H4P A;  4ECH A;  1TRB A;  3GMB A;  1NG3 A;  4A79 A;  3Q6J A;  5CQF A;  3DJD A;  4B67 A;  1L9D A;  1GTE A;  1ZOY A;  3P4S A;  5GRT A;  3UOY A;  4WX1 A;  2BAC A;  3NKS A;  3RP7 A;  1KSU A;  2GR1 A;  4O5Q A;  5ER0 A;  1IUU A;  3ABV A;  2RGJ A;  1CJ2 A;  2RGO A;  2VVM A;  3NK2 X;  4CNJ A;  3DA1 A;  4BK2 A;  1B37 A;  1NAA A;  3JSK A;  4IVM B;  4YTN A;  3II4 A;  3ZDN A;  5KRQ A;  1TDF A;  4AOX A;  3EPT A;  1H82 A;  2OA1 A;  2WDR A;  3AEC A;  2BXR A;  4K8D A;  2YLR A;  3AD9 B;  3UKK A;  3FIM B;  2X8H A;  1QLB A;  2XFN A;  5HYM A;  4AP1 A;  1GOS A;  3KA7 A;  4IA6 A;  3IF9 A;  1PN0 A;  1CHU A;  1CJ4 A;  4JQ9 A;  2XFU A;  3QSS A;  1CC2 A;  2C7G A;  1GPE A;  2X8G A;  4ICY A;  1JU2 A;  1E1L A;  4OCG A;  1K0L A;  2B7R A;  2BCG G;  1ELI A;  1YQ3 A;  4D04 A;  5LV9 A;  5KVH A;  2XLR A;  4I59 A;  4BK3 A;  4BJZ A;  4NEV A;  4ZCD A;  4UDQ A;  2O9Z A;  3AE1 A;  4H4V A;  3K7M X;  1JEH A;  1Y56 B;  3L8K A;  5KXJ A;  1CJC A;  4GRT A;  3UOX A;  2BAB A;  3NN6 X;  3NRN A;  3ATR A;  5IPY A;  2PYX A;  2C70 A;  5L46 A;  4YSH A;  1GRB A;  1LPF A;  1ZMD A;  3PS9 A;  1DOC A;  2GH5 A;  2WES A;  2A8X A;  4BK1 A;  1DJQ A;  1O95 A;  4ZN0 A;  3NYF A;  4AP3 A;  2WQY A;  3OC4 A;  4GDE A;  4A7A A;  2RAB A;  1FCD A;  5U1O A;  4ADW A;  2YLT A;  1D4D A;  2WPC A;  1N4U A;  1M6I A;  1D4E A;  1V59 A;  2IID A;  2YWL A;  2R46 A;  3DME A;  2BK3 A;  1TDN A;  2GF3 A;  3UKF A;  1TYT A;  2GMJ A;  4H4R A;  4U2L A;  3QVR A;  1BGJ A;  3UTG A;  4C5O A;  3COX A;  1GRF A;  2BS4 A;  3M13 A;  1N4W A;  2V61 A;  4YXD A;  1W4X A;  3DH9 A;  2BK4 A;  4NZH A;  1ZKQ A;  2A89 A;  4CCQ A;  2X8C A;  4CY8 A;  1PXC A;  3KPF A;  3CNS A;  4CRT A;  3AED A;  2VOU A;  3M0O A;  4NTC A;  4RG4 A;  5BRT A;  2OAL A;  3Q9T A;  1F8S A;  2X99 A;  4UDP A;  2WET A;  3I6D A;  3NH3 X;  3C4N A;  4X4J A;  4OPD A;  1Y0P A;  1H7X A;  1BGN A;  1HYU A;  2RGH A;  2X3N A;  4I58 A;  2GQW A;  1B8S A;  1EL8 A;  1PXA A;  1ZDL A;  3QFB A;  2TPR A;  1IUX A;  2WP5 A;  1GV4 A;  2XYO A;  5J60 A;  3V3N A;  3IWA A;  1JRX A;  2B9X A;  4DSH A;  3LXD A;  1PJ7 A;  1LJ1 A;  4OPL A;  2Q0L A;  2GMH A;  2BXS A;  1L0V A;  4NTE A;  1IUT A;  5DBJ A;  3BNU A;  1S3E A;  3O0H A;  4H4X A;  5GSN A;  2HQM A;  2YG4 A;  4X9N A;  3GWD A;  1NEN A;  2VZ2 A;  3D1C A;  3AE5 A;  2V60 A;  2R0C A;  5JCI A;  4C77 A;  3CGE A;  2XFO A;  3IC9 A;  2R9Z A;  3RP8 A;  2FJE A;  4EQW A;  3UOZ A;  3DJG X;  2YVJ A;  2V6O A;  3T37 A;  1EL7 A;  4TM0 A;  1SEZ A;  4J33 A;  3S5W A;  3RED A;  3F8D A;  1GAL A;  3QVP A;  4C74 A;  4EQR A;  1F3P A;  4TM4 A;  2B9W A;  2WHD A;  3NN0 X;  1NG4 A;  1H84 A;  3G5Q A;  5EOW A;  2XDO A;  3AWI A;  1X31 B;  2XVI A;  3LOV A;  1K4Q A;  3LAD A;  5HY5 A;  4H2Q A;  2IVE A;  4YSZ A;  2UZZ A;  4JY2 A;  1AOG A;  2E1M A;  3CNT A;  1GRH A;  4YSY A;  1CC6 A;  1PS9 A;  2H88 A;  2XLP A;  4K5S A;  3DGZ A;  4J34 A;  1O5W A;  3HZL A;  2XVH A;  1PHH A;  3SFD A;  2ACZ A;  1IUV A;  1REO A;  3G5R A;  1LTX R;  1CC4 A;  1JRY A;  1L9E A;  1QO8 A;  1Q9I A;  2Q7V A;  2WPE A;  1Q1W A;  3P9U A;  4EIQ A;  1XDI A;  1OJD A;  3CN8 A;  3K7T A;  5J7X A;  3SM8 A;  1BZL A;  2WEU A;  2FJB A;  1YQZ A;  1NHS A;  1RSG A;  1S2Q A;  5HXI A;  1DXL A;  4LA1 A;  2YM1 A;  3K7Q X;  5HHF A;  5KWF A;  3AE3 A;  1BWC A;  4A6N A;  1ZX9 A;  1RYI A;  2C66 A;  2GAG B;  2YG6 A;  4B1B A;  3CTY A;  2WOW A;  4U8I A;  2AQJ A;  3UP5 A;  2BC1 A;  3S61 A;  4EQS A;  2YM2 A;  3KD9 A;  4YTP A;  4BUR A;  4U8M A;  1B5Q A;  3BI4 A;  1LVL A;  3VRB A;  3FBS A;  1F6M A;  1H86 A;  1B4V A;  1GRE A;  2CFY A;  2YG5 A;  3KVE A;  5FS8 A;  5M10 A;  2Z5Y A;  4OVI A;  1VG9 A;  1ZMC A;  4EMJ A;  4JN9 A;  4C3Y A;  1GES A;  3GWF A;  4FDC B;  2BS3 A;  4Z2T A;  1XAN A;  3NK0 X;  1CL0 A;  3E1T A;  3ZYX A;  4DNA A;  1DOE A;  4XWZ A;  2QA2 A;  2YLZ A;  4B68 A;  4U8P A;  1CJ3 A;  1GND A;  2WU2 A;  3DK9 A;  2OAM A;  4FX9 A;  3R9U A;  1ONF A;  2V3B A;  4IVO B;  1ZK7 A;  2CVJ A;  3NIX A;  3DJJ A;  3RP6 A;  2B9Y A;  3AEB A;  3ALM A;  1OJT A;  3I3L A;  1TDO A;  1H7W A;  2YG7 A;  3B6D A;  1KSS A;  1MXT A;  2XLS A;  1NPX A;  1NEK A;  2WP9 A;  2XFQ A;  2YR6 A;  3UTH A;  1VDC A;  4Y4M A;  1TDK A;  3UKL A;  3K30 A;  2C75 A;  1E39 A;  2Q6U A;  2YVG A;  1GXF A;  2YAU A;  1DOD A;  2YR5 A;  3CIR A;  4YT0 A;  4GCM A;  4U8J A;  4U8N A;  2C76 A;  2JKC A;  4JNA A;  1BKW A;  3FG2 P;  4CBQ A;  3DGH A;  2WDV A;  4J31 A;  1OJC A;  2XLU A;  2GR2 A;  2YLX A;  2EQ9 A;  4J2W A;  4APN A;  4E0V A;  4CY6 A;  2E5V A;  2Z5X A;  1ZP0 A;  2WPF A;  3GYJ A;  4U2S A;  3AE2 A;  3UKQ A;  3NYE A;  3BNM A;  2GB0 A;  3GSI A;  1F8W A;  1KF6 A;  1COY A;  1UKV G;  2ZZB A;  4HA6 A;  3KLJ A;  2R0P A;  2BS2 A;  1BF3 A;  4OPT A;  3QSM A;  1GSN A;  4U8K A;  4Z44 A;  4B66 A;  4GUV A;  2PHH A;  4OPC A;  5U63 A;  1LV0 A;  2GR0 A;  3SQP A;  1KNP A;  4ZCC A;  1D4C A;  3FPZ A;  2GAH B;  3AD8 B;  4EMW A;  4C3X A;  3ISH A;  1S3B A;  1FEC A;  3B3R A;  3F8P A;  2ZBW A;  4A99 A;  3NHO X;  3IHG A;  5FS9 A;  4Z24 A;  2XVE A;  2XVF A;  2R0G A;  2XCG A;  1MO9 A;  1YY5 A;  2X50 A;  3VRA A;  1N1P A;  5EB4 A;  3PO7 A;  1P2H A;  5KOX A;  1IUW A;  3NGC X;  3LZW A;  4Z25 A;  1S2Y A;  2VRM A;  4K5R A;  3LB8 A;  5U25 A;  3UTE A;  2WOV A;  4GR1 A;  3UOV A;  4UDR A;  4H4W A;  2VQB A;  4WCT A;  2NPX A;  4RSL A;  2VVL A;  3AE4 A;  2JB1 A;  4TM1 A;  4B64 A;  3LZX A;  3AE6 A;  3GRT A;  2C65 A;  2DKH A;  2GRT A;  2Y6R A;  4A5L A;  2GEW A;  4H4S A;  1JOA A;  2QAE A;  3H8L A;  4H50 A;  2XFP A;  3ICR A;  1VRQ B;  4N9X A;  1E7P A;  4FK1 C;  2JK6 A;  3DK4 A;  3VRD B;  1E1M A;  4EM4 A;  2YVF A;  3C96 A;  3H4K A;  1XHC A;  1YKJ A;  2B76 A;  2F5Z A;  2WU5 A;  2AAQ A;  1CF3 A;  3BI5 A;  3GDP A;  3RHA A;  2QA1 A;  3CPJ G;  1PBC A;  5BUL A;  4X9M A;  4RG3 A;  2OLN A;  3UP4 A;  4A65 A;  2I0Z A;  4Z2U A;  1H83 A;  4PAA A;  3AEE A;  1GER A;  1PJ6 A;  1Q1R A;  2APG A;  5JCL A;  1E6E A;  4REK A;  4EM3 A;  2JB2 A;  1XPQ A;  1PBE A;  2DKI A;  2C67 A;  4K7Z A;  1KFY A;  3LJP A;  2V3A A;  4YWO A;  4GDP A;  2BYB A;  4H4Z A;  5IQ1 A;  3GMC A;  3SGL A;  3CPH G;  1IUS A;  3NG7 X;  2IVD A;  4XXG A;  2GQF A;  3FMW A;  1H81 A;  1M64 A;  1RP0 A;  3GRS A;  4GF7 A;  2R4J A;  5BVA A;  3L1R A;  4NEW A;  2ARD A;  4K2X A;  5EB5 A;  3VQR A;  2W0H A;  1JRZ A;  2XLT A;  2XVJ A;  2YLS A;  3SFE A;  1DNC A;  4Y4L A;  5JCN A;  3M12 A;  2EQ8 A;  3NK1 X;  2ZZ0 A;  3QFA A;  4A9W A;  3VR8 A;  1TYP A;  2WBA A;  2BK5 A;  4Z43 A;  1GET A;  1GRG A;  3CGD A;  1JNZ A;  3NLC A;  2WS3 A;  2GV8 A;  4KX6 A;  4TLZ A;  1D5T A;  1Y56 A;  3D8X A;  5C2T A;  1FL2 A;  2QCU A;  4OPI A;  4EIP A;  1VQW A;  3KKJ A;  4YTM A;  5IQ4 A;  2R45 A;  5M0Z A;  2JAE A;  2TMD A;  3AB1 A;  4H4Q A;  3OZ2 A;  3AEF A;  3CGC A;  2VRL A;  2CDU A;  3EAN A;  4KPR A;  3AEA A;  3URH A;  2V5Z A;  3CPI G;  4A6N B;  4XWR A;  4CNK A;  4EQX A;  3ALL A;  5KVI A;  1FEA A;  3H8I A;  3UTF A;  2E4G A;  4HB9 A;  1K0I A;  3ADA B;  2C73 A;  4Z2R A;  4H4T A;  2OLO A;  4MJW A;  3GYI A;  1D7Y A;  1OJ9 A;  4H4U A;  1LQT A;  4OPG A;  3EF6 A;  4JY3 A;  3G5S A;  3AXB A;  4B69 A;  4Z26 A;  1KDG A;  4BV6 A;  3AE8 A;  3NTA A;  3DJE A;  1PDH A;  4U8L A;  4J56 A;  2YLW A;  1DJN A;  3P4R A;  5TR3 A;  5FS6 A;  1GRT A;  4H2P A;  4H4Y A;  1OJA A;  1CBO A;  3AD7 B;  2WP6 A;  3GDN A;  2GVC A;  3IHM A;  4J57 A;  3RNM A;  3GD4 A;  1GEU A;  2WOI A;  1Z6L A;  1NHQ A;  1GRA A;  2ZZC A;  4B63 A;  3ALJ A;  1NHP A;  5FMH A;  1FOH A;  4IA5 A;  1EBD A;  1H6V A;  2VVL G;  4DGK A;  1ZOV A;  1IJH A;  3AYL A;  3CNJ A;  4AT0 A;  2YG3 A;  1L9C A;  2JBV A;  3CND A;  3PVC A;  4U8O A;  5KOW A;  4IV9 A;  1FEB A;  1KNR A; 
#chains in the Genus database with same CATH topology
 3F8R A;  1PXB A;  2YR4 A;  4TLX A;  4H7U A;  3UKH A;  4J36 A;  4CCR A;  3AEG A;  4U2T A;  3ICT A;  4TM3 A;  1LQU A;  2C3D A;  3ATQ A;  1PBF A;  2NVK X;  2Q0K A;  3ITJ A;  1QJD A;  2GR3 A;  4AT2 A;  4B65 A;  3NTD A;  4JNQ A;  3CGB A;  3EAO A;  2C64 A;  4P9S A;  4D03 A;  2AR8 A;  5BUK A;  2BRA A;  4O5U A;  3P4Q A;  4LU6 A;  4H2N A;  4GAV A;  2JB3 A;  4USR A;  2B7S A;  1GT8 A;  2R4E A;  1TDE A;  3KU9 A;  3AYI A;  2FBW A;  2C3C A;  4UP3 A;  4USQ A;  3UKA A;  2WDQ A;  4K22 A;  4AOS A;  5JCM A;  1NDA A;  1O94 A;  3CNP A;  4PAB A;  3P1W A;  4BJY A;  3T14 A;  1K0J A;  3P4P A;  1EL5 A;  1DOB A;  4FK1 A;  5FS7 A;  3T2Z A;  2BCP A;  3AE7 A;  2H89 A;  3V76 A;  3T2K A;  4DSG A;  2EQ6 A;  1GTH A;  2VQ7 A;  3WE0 A;  2A87 A;  1NHR A;  3BI2 A;  3NNE A;  1E1N A;  3VR9 A;  4YKG A;  3DK8 A;  1JNR A;  3GD3 A;  2CUL A;  3AE9 A;  2YQU A;  4NTD A;  5CKU A;  1P2E A;  3QSE A;  1D7L A;  3C4A A;  1N4V A;  2Y6Q A;  3BHF A;  2EQ7 A;  4EMI A;  2J3N A;  2FJA A;  1MOK A;  4M52 A;  1ZY8 A;  4YSX A;  3BHK A;  1F8R A;  1PJ5 A;  2FJD A;  4H2R A;  4YKF A;  4OPU A;  3AYJ A;  1VG0 A;  3NT6 A;  1EL9 A;  3ICS A;  4JDR A;  2BA9 A;  5C3J A;  2BC0 A;  3QJ4 A;  2C72 A;  5JCK A;  4Y4N A;  1YQ4 A;  1E1K A;  4LII A;  1PBD A;  1PBB A;  3UKP A;  3NYC A;  5EBK A;  3UCL A;  3V3O A;  4H4P A;  4ECH A;  1TRB A;  3GMB A;  1NG3 A;  3SZC A;  4A79 A;  3Q6J A;  5CQF A;  3DJD A;  4B67 A;  5KMS A;  1L9D A;  4G6G A;  1GTE A;  1ZOY A;  3P4S A;  5GRT A;  3UOY A;  4WX1 A;  2BAC A;  3NKS A;  3RP7 A;  1KSU A;  2GR1 A;  4O5Q A;  5ER0 A;  1IUU A;  3ABV A;  2RGJ A;  1CJ2 A;  2RGO A;  2VVM A;  3NK2 X;  4CNJ A;  3DA1 A;  4BK2 A;  1B37 A;  1NAA A;  3JSK A;  4IVM B;  4YTN A;  3II4 A;  3ZDN A;  5KRQ A;  1TDF A;  4G73 A;  3EPT A;  4AOX A;  1H82 A;  4NNJ A;  2OA1 A;  2WDR A;  3AEC A;  2BXR A;  3HYV A;  4K8D A;  2YLR A;  3AD9 B;  3UKK A;  3FIM B;  2X8H A;  1QLB A;  2XFN A;  5HYM A;  4AP1 A;  4G74 A;  1GOS A;  3KA7 A;  4IA6 A;  3IF9 A;  1PN0 A;  1CHU A;  1CJ4 A;  4JQ9 A;  2XFU A;  3QSS A;  1CC2 A;  2C7G A;  1GPE A;  2X8G A;  4ICY A;  1JU2 A;  1E1L A;  4OCG A;  1K0L A;  2B7R A;  2BCG G;  1ELI A;  1YQ3 A;  4D04 A;  5LV9 A;  5KVH A;  2XLR A;  4I59 A;  4BK3 A;  4BJZ A;  4G6H A;  4NEV A;  4ZCD A;  4UDQ A;  2O9Z A;  3AE1 A;  4H4V A;  3K7M X;  1JEH A;  1Y56 B;  3L8K A;  3SX6 A;  1CJC A;  4GRT A;  5KXJ A;  3UOX A;  2BAB A;  3NN6 X;  3NRN A;  3ATR A;  5IPY A;  2PYX A;  2C70 A;  5L46 A;  4YSH A;  1GRB A;  1LPF A;  1ZMD A;  3PS9 A;  1DOC A;  2GH5 A;  2WES A;  2A8X A;  4BK1 A;  1DJQ A;  1O95 A;  4ZN0 A;  3NYF A;  4AP3 A;  2WQY A;  3OC4 A;  4GDE A;  4A7A A;  2RAB A;  1FCD A;  5U1O A;  4ADW A;  2YLT A;  1D4D A;  2WPC A;  1N4U A;  1M6I A;  1D4E A;  1V59 A;  2IID A;  2BRY A;  2YWL A;  2R46 A;  3DME A;  2BK3 A;  1TDN A;  2GF3 A;  3UKF A;  1TYT A;  2GMJ A;  4H4R A;  4U2L A;  3QVR A;  1BGJ A;  3UTG A;  4C5O A;  3COX A;  1GRF A;  2BS4 A;  3HYW A;  1N4W A;  2V61 A;  3M13 A;  4II3 A;  4YXD A;  1W4X A;  3DH9 A;  2BK4 A;  4NZH A;  1ZKQ A;  2A89 A;  4CCQ A;  2X8C A;  4CY8 A;  1PXC A;  3KPF A;  4NWZ A;  3CNS A;  4CRT A;  3AED A;  2VOU A;  3M0O A;  4NTC A;  4RG4 A;  5BRT A;  2OAL A;  3Q9T A;  1F8S A;  2X99 A;  4UDP A;  2WET A;  3I6D A;  3NH3 X;  3C4N A;  4X4J A;  4OPD A;  1Y0P A;  4GAP A;  1H7X A;  1BGN A;  1HYU A;  3T31 A;  2RGH A;  2X3N A;  4I58 A;  2GQW A;  4II2 A;  1B8S A;  1EL8 A;  1PXA A;  1ZDL A;  3QFB A;  2TPR A;  1IUX A;  2WP5 A;  1GV4 A;  2XYO A;  5J60 A;  3V3N A;  3IWA A;  1JRX A;  2B9X A;  4DSH A;  3LXD A;  1PJ7 A;  1LJ1 A;  4OPL A;  2Q0L A;  2GMH A;  2BXS A;  1L0V A;  4NTE A;  1IUT A;  5DBJ A;  3BNU A;  1S3E A;  3O0H A;  4H4X A;  5GSN A;  2HQM A;  2YG4 A;  4X9N A;  3GWD A;  1NEN A;  2VZ2 A;  3D1C A;  3AE5 A;  2V60 A;  2R0C A;  5JCI A;  4C77 A;  3CGE A;  2XFO A;  3IC9 A;  2R9Z A;  3RP8 A;  2FJE A;  4EQW A;  3UOZ A;  3DJG X;  2YVJ A;  2V6O A;  3T37 A;  1EL7 A;  4TM0 A;  1SEZ A;  4J33 A;  3S5W A;  3RED A;  3F8D A;  1GAL A;  3QVP A;  4C74 A;  4EQR A;  1F3P A;  4TM4 A;  2B9W A;  2WHD A;  3NN0 X;  1NG4 A;  1H84 A;  3G5Q A;  5EOW A;  2XDO A;  3AWI A;  1X31 B;  2XVI A;  3LOV A;  1K4Q A;  3LAD A;  5HY5 A;  4H2Q A;  3SYI A;  2IVE A;  4YSZ A;  2UZZ A;  4JY2 A;  1AOG A;  2E1M A;  3CNT A;  1GRH A;  4YSY A;  1CC6 A;  1PS9 A;  2H88 A;  2XLP A;  4K5S A;  3DGZ A;  4J34 A;  1O5W A;  3HZL A;  2XVH A;  1PHH A;  3SFD A;  2ACZ A;  1IUV A;  1REO A;  3G5R A;  1LTX R;  1CC4 A;  1JRY A;  1L9E A;  1QO8 A;  1Q9I A;  2Q7V A;  2WPE A;  1Q1W A;  3P9U A;  4G9K A;  4EIQ A;  1XDI A;  1OJD A;  3CN8 A;  3K7T A;  5J7X A;  3SM8 A;  1BZL A;  2WEU A;  2FJB A;  1YQZ A;  1NHS A;  1RSG A;  1S2Q A;  5HXI A;  1DXL A;  4LA1 A;  2YM1 A;  3K7Q X;  5HHF A;  5KWF A;  3AE3 A;  3HYX A;  3T0K A;  1BWC A;  4A6N A;  1ZX9 A;  1RYI A;  2C66 A;  2GAG B;  2YG6 A;  4B1B A;  3CTY A;  2WOW A;  4U8I A;  2AQJ A;  3UP5 A;  2BC1 A;  3S61 A;  4EQS A;  2YM2 A;  3KD9 A;  5KMQ A;  4YTP A;  4BUR A;  4U8M A;  1B5Q A;  3BI4 A;  1LVL A;  3VRB A;  3CMM A;  3FBS A;  1F6M A;  1H86 A;  1B4V A;  1GRE A;  2CFY A;  2YG5 A;  3KVE A;  5FS8 A;  5M10 A;  2Z5Y A;  4OVI A;  1VG9 A;  1ZMC A;  4EMJ A;  4JN9 A;  4C3Y A;  1GES A;  3GWF A;  4FDC B;  2BS3 A;  4Z2T A;  1XAN A;  3NK0 X;  1CL0 A;  3E1T A;  3ZYX A;  4DNA A;  1DOE A;  5KMR A;  4XWZ A;  2QA2 A;  2YLZ A;  4B68 A;  4U8P A;  1CJ3 A;  1GND A;  2WU2 A;  3DK9 A;  2OAM A;  4FX9 A;  3R9U A;  1ONF A;  2V3B A;  4IVO B;  1ZK7 A;  2CVJ A;  3NIX A;  3DJJ A;  3RP6 A;  2B9Y A;  3AEB A;  3ALM A;  1OJT A;  3I3L A;  1TDO A;  1H7W A;  2YG7 A;  3B6D A;  1KSS A;  1MXT A;  2XLS A;  1NPX A;  1NEK A;  2WP9 A;  2XFQ A;  2YR6 A;  3UTH A;  1VDC A;  4Y4M A;  1TDK A;  3UKL A;  3K30 A;  2C75 A;  1E39 A;  2Q6U A;  2YVG A;  1GXF A;  2YAU A;  1DOD A;  2YR5 A;  3CIR A;  3KPK A;  4YT0 A;  4GCM A;  4U8J A;  4U8N A;  2C76 A;  2JKC A;  4JNA A;  1BKW A;  3FG2 P;  4CBQ A;  3DGH A;  2WDV A;  4J31 A;  1OJC A;  2XLU A;  2GR2 A;  2YLX A;  2EQ9 A;  4J2W A;  4APN A;  4E0V A;  4CY6 A;  2E5V A;  2Z5X A;  1ZP0 A;  2WPF A;  3GYJ A;  4U2S A;  3AE2 A;  3UKQ A;  3NYE A;  3BNM A;  2GB0 A;  3GSI A;  1F8W A;  1KF6 A;  1COY A;  1UKV G;  2ZZB A;  4HA6 A;  3KLJ A;  2R0P A;  2BS2 A;  1BF3 A;  4OPT A;  3QSM A;  1GSN A;  4U8K A;  4Z44 A;  4B66 A;  4GUV A;  2PHH A;  4OPC A;  5U63 A;  1LV0 A;  2GR0 A;  3SQP A;  1KNP A;  4ZCC A;  1D4C A;  3FPZ A;  2GAH B;  3AD8 B;  3T2Y A;  4EMW A;  4C3X A;  3ISH A;  3SZ0 A;  1S3B A;  1FEC A;  3B3R A;  3F8P A;  2ZBW A;  4A99 A;  3NHO X;  3IHG A;  5FS9 A;  4Z24 A;  2XVE A;  2XVF A;  2R0G A;  2XCG A;  1MO9 A;  1YY5 A;  2X50 A;  3VRA A;  1N1P A;  5EB4 A;  3PO7 A;  3SZF A;  1P2H A;  5KOX A;  1IUW A;  3NGC X;  3LZW A;  4Z25 A;  1S2Y A;  2VRM A;  4K5R A;  3LB8 A;  3SZW A;  5U25 A;  3UTE A;  2WOV A;  4GR1 A;  3UOV A;  4UDR A;  4H4W A;  2VQB A;  4WCT A;  2NPX A;  4RSL A;  2VVL A;  3AE4 A;  2JB1 A;  4TM1 A;  4B64 A;  3LZX A;  3AE6 A;  3GRT A;  2C65 A;  2DKH A;  2GRT A;  2Y6R A;  4A5L A;  2GEW A;  4H4S A;  1JOA A;  2QAE A;  3H8L A;  4H50 A;  2XFP A;  3ICR A;  1VRQ B;  4N9X A;  1E7P A;  4FK1 C;  2JK6 A;  3DK4 A;  3VRD B;  1E1M A;  4EM4 A;  2YVF A;  3C96 A;  3H4K A;  1XHC A;  1YKJ A;  2B76 A;  2F5Z A;  2WU5 A;  2AAQ A;  1CF3 A;  3BI5 A;  3GDP A;  3RHA A;  2QA1 A;  3CPJ G;  1PBC A;  5BUL A;  3GYX A;  4X9M A;  4RG3 A;  2OLN A;  3UP4 A;  4A65 A;  2I0Z A;  4Z2U A;  1H83 A;  4PAA A;  3AEE A;  1GER A;  1PJ6 A;  1Q1R A;  2APG A;  5JCL A;  1E6E A;  4REK A;  4EM3 A;  2JB2 A;  1XPQ A;  1PBE A;  2DKI A;  2C67 A;  4K7Z A;  1KFY A;  3LJP A;  2V3A A;  4YWO A;  4GDP A;  2BYB A;  4H4Z A;  5IQ1 A;  3GMC A;  3SGL A;  3CPH G;  1IUS A;  3NG7 X;  2IVD A;  4XXG A;  2GQF A;  3FMW A;  1H81 A;  1M64 A;  1RP0 A;  3GRS A;  4GF7 A;  2R4J A;  5BVA A;  3L1R A;  4NEW A;  2ARD A;  4K2X A;  5EB5 A;  3VQR A;  2W0H A;  1JRZ A;  3SXI A;  2XLT A;  2XVJ A;  2YLS A;  3SFE A;  1DNC A;  4Y4L A;  5JCN A;  3M12 A;  2EQ8 A;  3NK1 X;  2ZZ0 A;  3QFA A;  4A9W A;  3VR8 A;  1TYP A;  2WBA A;  2BK5 A;  4Z43 A;  1GET A;  1GRG A;  3CGD A;  1JNZ A;  3NLC A;  2WS3 A;  2GV8 A;  4KX6 A;  4TLZ A;  1D5T A;  1Y56 A;  3D8X A;  5C2T A;  1FL2 A;  2QCU A;  4OPI A;  4EIP A;  1VQW A;  3KKJ A;  4YTM A;  5IQ4 A;  2R45 A;  5M0Z A;  2JAE A;  2TMD A;  3AB1 A;  4H4Q A;  3OZ2 A;  3AEF A;  3CGC A;  2VRL A;  2CDU A;  3EAN A;  4KPR A;  3AEA A;  3URH A;  2V5Z A;  3CPI G;  4A6N B;  2C4C A;  4XWR A;  4CNK A;  4EQX A;  3ALL A;  5KVI A;  1FEA A;  3H8I A;  3UTF A;  2E4G A;  4HB9 A;  5KNL A;  1K0I A;  3ADA B;  2C73 A;  4Z2R A;  4H4T A;  2OLO A;  4MJW A;  3GYI A;  1D7Y A;  1OJ9 A;  4H4U A;  1LQT A;  5KMP A;  4OPG A;  3EF6 A;  4JY3 A;  3G5S A;  3AXB A;  4B69 A;  4Z26 A;  1KDG A;  4BV6 A;  3AE8 A;  3NTA A;  3DJE A;  1PDH A;  4U8L A;  4J56 A;  2YLW A;  1DJN A;  3P4R A;  3SY4 A;  5TR3 A;  5FS6 A;  1GRT A;  4H2P A;  4H4Y A;  1OJA A;  1CBO A;  3AD7 B;  2WP6 A;  3GDN A;  2GVC A;  3IHM A;  4J57 A;  3RNM A;  3GD4 A;  1GEU A;  2WOI A;  1Z6L A;  1NHQ A;  1GRA A;  2ZZC A;  4B63 A;  3ALJ A;  1NHP A;  5FMH A;  1FOH A;  4IA5 A;  1EBD A;  1H6V A;  2VVL G;  4DGK A;  1ZOV A;  1IJH A;  3AYL A;  3CNJ A;  4AT0 A;  2YG3 A;  1L9C A;  2JBV A;  3CND A;  3PVC A;  4U8O A;  5KOW A;  4IV9 A;  1FEB A;  1KNR A; 
#chains in the Genus database with same CATH homology
 3F8R A;  1PXB A;  2YR4 A;  4TLX A;  4H7U A;  3UKH A;  4J36 A;  4CCR A;  3AEG A;  4U2T A;  3ICT A;  4TM3 A;  1LQU A;  2C3D A;  3ATQ A;  1PBF A;  2NVK X;  2Q0K A;  3ITJ A;  1QJD A;  2GR3 A;  4AT2 A;  4B65 A;  3NTD A;  4JNQ A;  3CGB A;  3EAO A;  2C64 A;  4P9S A;  4D03 A;  2AR8 A;  5BUK A;  2BRA A;  4O5U A;  3P4Q A;  4LU6 A;  4H2N A;  4GAV A;  2JB3 A;  4USR A;  2B7S A;  1GT8 A;  2R4E A;  1TDE A;  3KU9 A;  3AYI A;  2FBW A;  2C3C A;  4UP3 A;  4USQ A;  3UKA A;  2WDQ A;  4K22 A;  4AOS A;  5JCM A;  1NDA A;  1O94 A;  3CNP A;  4PAB A;  3P1W A;  4BJY A;  3T14 A;  1K0J A;  3P4P A;  1EL5 A;  1DOB A;  4FK1 A;  5FS7 A;  3T2Z A;  2BCP A;  3AE7 A;  2H89 A;  3V76 A;  3T2K A;  4DSG A;  2EQ6 A;  1GTH A;  2VQ7 A;  3WE0 A;  2A87 A;  1NHR A;  3BI2 A;  3NNE A;  1E1N A;  3VR9 A;  4YKG A;  3DK8 A;  1JNR A;  3GD3 A;  2CUL A;  3AE9 A;  2YQU A;  4NTD A;  5CKU A;  1P2E A;  3QSE A;  1D7L A;  3C4A A;  1N4V A;  2Y6Q A;  3BHF A;  2EQ7 A;  4EMI A;  2J3N A;  2FJA A;  1MOK A;  4M52 A;  1ZY8 A;  4YSX A;  3BHK A;  1F8R A;  1PJ5 A;  2FJD A;  4H2R A;  4YKF A;  4OPU A;  3AYJ A;  1VG0 A;  3NT6 A;  1EL9 A;  3ICS A;  4JDR A;  2BA9 A;  5C3J A;  2BC0 A;  3QJ4 A;  2C72 A;  5JCK A;  4Y4N A;  1YQ4 A;  1E1K A;  4LII A;  1PBD A;  1PBB A;  3UKP A;  3NYC A;  5EBK A;  3UCL A;  3V3O A;  4H4P A;  4ECH A;  1TRB A;  3GMB A;  1NG3 A;  3SZC A;  4A79 A;  3Q6J A;  5CQF A;  3DJD A;  4B67 A;  5KMS A;  1L9D A;  4G6G A;  1GTE A;  1ZOY A;  3P4S A;  5GRT A;  3UOY A;  4WX1 A;  2BAC A;  3NKS A;  3RP7 A;  1KSU A;  2GR1 A;  4O5Q A;  5ER0 A;  1IUU A;  3ABV A;  2RGJ A;  1CJ2 A;  2RGO A;  2VVM A;  3NK2 X;  4CNJ A;  3DA1 A;  4BK2 A;  1B37 A;  1NAA A;  3JSK A;  4IVM B;  4YTN A;  3II4 A;  3ZDN A;  5KRQ A;  1TDF A;  4G73 A;  3EPT A;  4AOX A;  1H82 A;  4NNJ A;  2OA1 A;  2WDR A;  3AEC A;  2BXR A;  3HYV A;  4K8D A;  2YLR A;  3AD9 B;  3UKK A;  3FIM B;  2X8H A;  1QLB A;  2XFN A;  5HYM A;  4AP1 A;  4G74 A;  1GOS A;  3KA7 A;  4IA6 A;  3IF9 A;  1PN0 A;  1CHU A;  1CJ4 A;  4JQ9 A;  2XFU A;  3QSS A;  1CC2 A;  2C7G A;  1GPE A;  2X8G A;  4ICY A;  1JU2 A;  1E1L A;  4OCG A;  1K0L A;  2B7R A;  2BCG G;  1ELI A;  1YQ3 A;  4D04 A;  5LV9 A;  5KVH A;  2XLR A;  4I59 A;  4BK3 A;  4BJZ A;  4G6H A;  4NEV A;  4ZCD A;  4UDQ A;  2O9Z A;  3AE1 A;  4H4V A;  3K7M X;  1JEH A;  1Y56 B;  3L8K A;  3SX6 A;  1CJC A;  4GRT A;  5KXJ A;  3UOX A;  2BAB A;  3NN6 X;  3NRN A;  3ATR A;  5IPY A;  2PYX A;  2C70 A;  5L46 A;  4YSH A;  1GRB A;  1LPF A;  1ZMD A;  3PS9 A;  1DOC A;  2GH5 A;  2WES A;  2A8X A;  4BK1 A;  1DJQ A;  1O95 A;  4ZN0 A;  3NYF A;  4AP3 A;  2WQY A;  3OC4 A;  4GDE A;  4A7A A;  2RAB A;  1FCD A;  5U1O A;  4ADW A;  2YLT A;  1D4D A;  2WPC A;  1N4U A;  1M6I A;  1D4E A;  1V59 A;  2IID A;  2BRY A;  2YWL A;  2R46 A;  3DME A;  2BK3 A;  1TDN A;  2GF3 A;  3UKF A;  1TYT A;  2GMJ A;  4H4R A;  4U2L A;  3QVR A;  1BGJ A;  3UTG A;  4C5O A;  3COX A;  1GRF A;  2BS4 A;  3HYW A;  1N4W A;  2V61 A;  3M13 A;  4II3 A;  4YXD A;  1W4X A;  3DH9 A;  2BK4 A;  4NZH A;  1ZKQ A;  2A89 A;  4CCQ A;  2X8C A;  4CY8 A;  1PXC A;  3KPF A;  4NWZ A;  3CNS A;  4CRT A;  3AED A;  2VOU A;  3M0O A;  4NTC A;  4RG4 A;  5BRT A;  2OAL A;  3Q9T A;  1F8S A;  2X99 A;  4UDP A;  2WET A;  3I6D A;  3NH3 X;  3C4N A;  4X4J A;  4OPD A;  1Y0P A;  4GAP A;  1H7X A;  1BGN A;  1HYU A;  3T31 A;  2RGH A;  2X3N A;  4I58 A;  2GQW A;  4II2 A;  1B8S A;  1EL8 A;  1PXA A;  1ZDL A;  3QFB A;  2TPR A;  1IUX A;  2WP5 A;  1GV4 A;  2XYO A;  5J60 A;  3V3N A;  3IWA A;  1JRX A;  2B9X A;  4DSH A;  3LXD A;  1PJ7 A;  1LJ1 A;  4OPL A;  2Q0L A;  2GMH A;  2BXS A;  1L0V A;  4NTE A;  1IUT A;  5DBJ A;  3BNU A;  1S3E A;  3O0H A;  4H4X A;  5GSN A;  2HQM A;  2YG4 A;  4X9N A;  3GWD A;  1NEN A;  2VZ2 A;  3D1C A;  3AE5 A;  2V60 A;  2R0C A;  5JCI A;  4C77 A;  3CGE A;  2XFO A;  3IC9 A;  2R9Z A;  3RP8 A;  2FJE A;  4EQW A;  3UOZ A;  3DJG X;  2YVJ A;  2V6O A;  3T37 A;  1EL7 A;  4TM0 A;  1SEZ A;  4J33 A;  3S5W A;  3RED A;  3F8D A;  1GAL A;  3QVP A;  4C74 A;  4EQR A;  1F3P A;  4TM4 A;  2B9W A;  2WHD A;  3NN0 X;  1NG4 A;  1H84 A;  3G5Q A;  5EOW A;  2XDO A;  3AWI A;  1X31 B;  2XVI A;  3LOV A;  1K4Q A;  3LAD A;  5HY5 A;  4H2Q A;  3SYI A;  2IVE A;  4YSZ A;  2UZZ A;  4JY2 A;  1AOG A;  2E1M A;  3CNT A;  1GRH A;  4YSY A;  1CC6 A;  1PS9 A;  2H88 A;  2XLP A;  4K5S A;  3DGZ A;  4J34 A;  1O5W A;  3HZL A;  2XVH A;  1PHH A;  3SFD A;  2ACZ A;  1IUV A;  1REO A;  3G5R A;  1LTX R;  1CC4 A;  1JRY A;  1L9E A;  1QO8 A;  1Q9I A;  2Q7V A;  2WPE A;  1Q1W A;  3P9U A;  4G9K A;  4EIQ A;  1XDI A;  1OJD A;  3CN8 A;  3K7T A;  5J7X A;  3SM8 A;  1BZL A;  2WEU A;  2FJB A;  1YQZ A;  1NHS A;  1RSG A;  1S2Q A;  5HXI A;  1DXL A;  4LA1 A;  2YM1 A;  3K7Q X;  5HHF A;  5KWF A;  3AE3 A;  3HYX A;  3T0K A;  1BWC A;  4A6N A;  1ZX9 A;  1RYI A;  2C66 A;  2GAG B;  2YG6 A;  4B1B A;  3CTY A;  2WOW A;  4U8I A;  2AQJ A;  3UP5 A;  2BC1 A;  3S61 A;  4EQS A;  2YM2 A;  3KD9 A;  5KMQ A;  4YTP A;  4BUR A;  4U8M A;  1B5Q A;  3BI4 A;  1LVL A;  3VRB A;  3CMM A;  3FBS A;  1F6M A;  1H86 A;  1B4V A;  1GRE A;  2CFY A;  2YG5 A;  3KVE A;  5FS8 A;  5M10 A;  2Z5Y A;  4OVI A;  1VG9 A;  1ZMC A;  4EMJ A;  4JN9 A;  4C3Y A;  1GES A;  3GWF A;  4FDC B;  2BS3 A;  4Z2T A;  1XAN A;  3NK0 X;  1CL0 A;  3E1T A;  3ZYX A;  4DNA A;  1DOE A;  5KMR A;  4XWZ A;  2QA2 A;  2YLZ A;  4B68 A;  4U8P A;  1CJ3 A;  1GND A;  2WU2 A;  3DK9 A;  2OAM A;  4FX9 A;  3R9U A;  1ONF A;  2V3B A;  4IVO B;  1ZK7 A;  2CVJ A;  3NIX A;  3DJJ A;  3RP6 A;  2B9Y A;  3AEB A;  3ALM A;  1OJT A;  3I3L A;  1TDO A;  1H7W A;  2YG7 A;  3B6D A;  1KSS A;  1MXT A;  2XLS A;  1NPX A;  1NEK A;  2WP9 A;  2XFQ A;  2YR6 A;  3UTH A;  1VDC A;  4Y4M A;  1TDK A;  3UKL A;  3K30 A;  2C75 A;  1E39 A;  2Q6U A;  2YVG A;  1GXF A;  2YAU A;  1DOD A;  2YR5 A;  3CIR A;  3KPK A;  4YT0 A;  4GCM A;  4U8J A;  4U8N A;  2C76 A;  2JKC A;  4JNA A;  1BKW A;  3FG2 P;  4CBQ A;  3DGH A;  2WDV A;  4J31 A;  1OJC A;  2XLU A;  2GR2 A;  2YLX A;  2EQ9 A;  4J2W A;  4APN A;  4E0V A;  4CY6 A;  2E5V A;  2Z5X A;  1ZP0 A;  2WPF A;  3GYJ A;  4U2S A;  3AE2 A;  3UKQ A;  3NYE A;  3BNM A;  2GB0 A;  3GSI A;  1F8W A;  1KF6 A;  1COY A;  1UKV G;  2ZZB A;  4HA6 A;  3KLJ A;  2R0P A;  2BS2 A;  1BF3 A;  4OPT A;  3QSM A;  1GSN A;  4U8K A;  4Z44 A;  4B66 A;  4GUV A;  2PHH A;  4OPC A;  5U63 A;  1LV0 A;  2GR0 A;  3SQP A;  1KNP A;  4ZCC A;  1D4C A;  3FPZ A;  2GAH B;  3AD8 B;  3T2Y A;  4EMW A;  4C3X A;  3ISH A;  3SZ0 A;  1S3B A;  1FEC A;  3B3R A;  3F8P A;  2ZBW A;  4A99 A;  3NHO X;  3IHG A;  5FS9 A;  4Z24 A;  2XVE A;  2XVF A;  2R0G A;  2XCG A;  1MO9 A;  1YY5 A;  2X50 A;  3VRA A;  1N1P A;  5EB4 A;  3PO7 A;  3SZF A;  1P2H A;  5KOX A;  1IUW A;  3NGC X;  3LZW A;  4Z25 A;  1S2Y A;  2VRM A;  4K5R A;  3LB8 A;  3SZW A;  5U25 A;  3UTE A;  2WOV A;  4GR1 A;  3UOV A;  4UDR A;  4H4W A;  2VQB A;  4WCT A;  2NPX A;  4RSL A;  2VVL A;  3AE4 A;  2JB1 A;  4TM1 A;  4B64 A;  3LZX A;  3AE6 A;  3GRT A;  2C65 A;  2DKH A;  2GRT A;  2Y6R A;  4A5L A;  2GEW A;  4H4S A;  1JOA A;  2QAE A;  3H8L A;  4H50 A;  2XFP A;  3ICR A;  1VRQ B;  4N9X A;  1E7P A;  4FK1 C;  2JK6 A;  3DK4 A;  3VRD B;  1E1M A;  4EM4 A;  2YVF A;  3C96 A;  3H4K A;  1XHC A;  1YKJ A;  2B76 A;  2F5Z A;  2WU5 A;  2AAQ A;  1CF3 A;  3BI5 A;  3GDP A;  3RHA A;  2QA1 A;  3CPJ G;  1PBC A;  5BUL A;  3GYX A;  4X9M A;  4RG3 A;  2OLN A;  3UP4 A;  4A65 A;  2I0Z A;  4Z2U A;  1H83 A;  4PAA A;  3AEE A;  1GER A;  1PJ6 A;  1Q1R A;  2APG A;  5JCL A;  1E6E A;  4REK A;  4EM3 A;  2JB2 A;  1XPQ A;  1PBE A;  2DKI A;  2C67 A;  4K7Z A;  1KFY A;  3LJP A;  2V3A A;  4YWO A;  4GDP A;  2BYB A;  4H4Z A;  5IQ1 A;  3GMC A;  3SGL A;  3CPH G;  1IUS A;  3NG7 X;  2IVD A;  4XXG A;  2GQF A;  3FMW A;  1H81 A;  1M64 A;  1RP0 A;  3GRS A;  4GF7 A;  2R4J A;  5BVA A;  3L1R A;  4NEW A;  2ARD A;  4K2X A;  5EB5 A;  3VQR A;  2W0H A;  1JRZ A;  3SXI A;  2XLT A;  2XVJ A;  2YLS A;  3SFE A;  1DNC A;  4Y4L A;  5JCN A;  3M12 A;  2EQ8 A;  3NK1 X;  2ZZ0 A;  3QFA A;  4A9W A;  3VR8 A;  1TYP A;  2WBA A;  2BK5 A;  4Z43 A;  1GET A;  1GRG A;  3CGD A;  1JNZ A;  3NLC A;  2WS3 A;  2GV8 A;  4KX6 A;  4TLZ A;  1D5T A;  1Y56 A;  3D8X A;  5C2T A;  1FL2 A;  2QCU A;  4OPI A;  4EIP A;  1VQW A;  3KKJ A;  4YTM A;  5IQ4 A;  2R45 A;  5M0Z A;  2JAE A;  2TMD A;  3AB1 A;  4H4Q A;  3OZ2 A;  3AEF A;  3CGC A;  2VRL A;  2CDU A;  3EAN A;  4KPR A;  3AEA A;  3URH A;  2V5Z A;  3CPI G;  4A6N B;  2C4C A;  4XWR A;  4CNK A;  4EQX A;  3ALL A;  5KVI A;  1FEA A;  3H8I A;  3UTF A;  2E4G A;  4HB9 A;  5KNL A;  1K0I A;  3ADA B;  2C73 A;  4Z2R A;  4H4T A;  2OLO A;  4MJW A;  3GYI A;  1D7Y A;  1OJ9 A;  4H4U A;  1LQT A;  5KMP A;  4OPG A;  3EF6 A;  4JY3 A;  3G5S A;  3AXB A;  4B69 A;  4Z26 A;  1KDG A;  4BV6 A;  3AE8 A;  3NTA A;  3DJE A;  1PDH A;  4U8L A;  4J56 A;  2YLW A;  1DJN A;  3P4R A;  3SY4 A;  5TR3 A;  5FS6 A;  1GRT A;  4H2P A;  4H4Y A;  1OJA A;  1CBO A;  3AD7 B;  2WP6 A;  3GDN A;  2GVC A;  3IHM A;  4J57 A;  3RNM A;  3GD4 A;  1GEU A;  2WOI A;  1Z6L A;  1NHQ A;  1GRA A;  2ZZC A;  4B63 A;  3ALJ A;  1NHP A;  5FMH A;  1FOH A;  4IA5 A;  1EBD A;  1H6V A;  2VVL G;  4DGK A;  1ZOV A;  1IJH A;  3AYL A;  3CNJ A;  4AT0 A;  2YG3 A;  1L9C A;  2JBV A;  3CND A;  3PVC A;  4U8O A;  5KOW A;  4IV9 A;  1FEB A;  1KNR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...