3NYCA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 126
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nycA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nycA01
5GRTA 2BK3A 4UP3A 4Z24A 4EMWA 3DJGX 1NG3A 3BNMA 5FS6A 2WPCA 2XLUA 4CNKA 2DU8A 2WHDA 2WBAA 1GNDA 2GMJA 3F8RA 5KWFA 1O5WA 3BI2A 4KPRA 5J7XA 2C70A 1M6IA 4A65A 4H4VA 3UKQA 2XCGA 3JSKA 3P1WA 4YT0A 5EB4A 1K0IA 4USRA 2JB2A 4OCGA 4U2TA 2YQUA 2YR6A 5JCIA 5IQ1A 2TMDA 4U8OA 1PXCA 2YVGA 1KSSA 2XLTA 4JNQA 5FS7A 5KXJA 3V3NA 1EL8A 4I59A 5JCMA 3S61A 1ZK7A 5IPYA 5L46A 1TRBA 4XXGA 3FBSA 5JCNA 2A89A 4YSYA 4NEWA 1CC4A 4OPIA 2B76A 2VQ7A 2WU5A 3B6DA 3LZXA 4YJHA 2XFQA 3LZWA 2YVFA 1PS9A 3I3LA 1NHSA 1E1NA 4LA1A 1PBBA 4GF7A 2XLRA 5M0ZA 4BK2A 2BS2A 5CQFA 2E82A 3AEEA 2VQBA 3C4AA 3IHGA 3VR8A 3GDPA 2X8GA 3NLCA 4GRTA 1NPXA 4EM4A 3QVRA 1PBEA 2BS4A 2YLWA 4JQ9A 4JDRA 4A79A 4YKGA 1FL2A 3QSSA 2C65A 1OJCA 4Z2RA 1EL7A 2C3DA 4C5OA 2WESA 4J33A 4FK1C 4GR1A 4JN9A 4D04A 2R46A 4IA6A 1H6VA 1CJCA 3D1CA 3AE9A 3K7MX 1JNZA 1EVIA 3NN0X 1RYIA 1F8SA 4U2SA 2BCGG 4LIIA 1VG0A 4CCQA 4BK3A 1PXAA 1Q1WA 1GERA 4J2WA 3DA1A 4J31A 2GR3A 1PBFA 2XVIA 1DDOA 3V76A 1GOSA 2OAMA 5EBKA 1E6EA 1GRBA 4YTNA 4EIPA 3R9UA 2QCUA 1E1LA 4U8JA 3SFDA 2Q0KA 4U8NA 2J3NA 4H7UA 4U8IA 2C7GA 3AYIA 3CN8A 3ZNPA 2B9XA 2V60A 3K30A 3DGZA 4GDEA 3NN6X 4OPUA 3VR9A 2RGHA 5U1OA 2VZ2A 2CDUA 3HZLA 2BC1A 3CNSA 4TLZA 3E1TA 3KVEA 4B65A 1EBDA 4Z2TA 3EAOA 1GETA 2Q7VA 2E49A 3CNDA 3UKFA 1OJ9A 2C67A 3SGLA 1NDAA 3IHMA 2H88A 2OLOA 1H7XA 1GEUA 4J56A 1FECA 3AEGA 3AEDA 1BKWA 4Z2UA 4Z25A 5IQ4A 1D7LA 1IUXA 2E4GA 2ACZA 4K5SA 2B9YA 4A6NA 1RSGA 4HB9A 5C2TA 3COXA 1PHHA 2QA1A 1L9EA 3ALMA 4EMJA 4A9WA 2X8CA 3LOVA 1SEZA 2XVEA 1B4VA 4J57A 1H83A 2C3CA 3VRDB 3LB8A 4USQA 1DJQA 1PJ5A 4AP3A 3RP6A 4U8MA 3EANA 1YKJA 3NK2X 5ER0A 1P2EA 1UKVG 4QFDA 1GRAA 1NENA 3Q9TA 4YKFA 1LVLA 3BI4A 4REKA 2V6OA 1D7YA 2WOVA 2XFUA 2ZZ0A 3NIXA 4H4SA 4IV9A 3NKSA 2R0CA 3URHA 4EQSA 3ZYXA 4U8KA 1VQWA 2DKIA 3EPTA 3WGTA 4AP1A 1OJAA 2ZBWA 3QVPA 3FIMB 4GUVA 2PYXA 5JCLA 1NEKA 2A8XA 3QJ4A 2WOIA 4JY3A 1VRQB 4OPLA 4EM3A 3ICSA 1XDIA 1EL5A 1NAAA 2R9ZA 3AE4A 3ATQA 2GR0A 3DK4A 3UKHA 3ZNOA 4BV6A 3GWFA 3NYFA 1GTHA 1YQ3A 4WCTA 3NGCX 3CPHG 2QAEA 2WDVA 4ZCDA 5KOWA 1CF3A 3KKJA 4H2PA 3UP5A 3ADAB 1B37A 4H4XA 5LV9A 1KF6A 1DNCA 1PBCA 2OALA 2B9WA 3GMBA 1S3EA 4B69A 2VOUA 2YLRA 1TDEA 3CPJG 3VQRA 4GDPA 2IVDA 1AN9A 3AYLA 1F3PA 5HXIA 2VRLA 1BF3A 2WDQA 1C0PA 2BC0A 2B7RA 1S3BA 3AB1A 3AE8A 4Z44A 3UKKA 4KX6A 1EL9A 1IJHA 2RABA 5U63A 2I0ZA 1HYUA 4ECHA 2XLPA 3FG2P 1GPEA 1BWCA 1PXBA 5KRQA 1IUTA 2YM2A 3UKPA 1GV4A 1DAOA 2Q0LA 3ALJA 1RP0A 5FMHA 2B7SA 3AEAA 4YTMA 2E4AA 1NHPA 3UOYA 4Y4LA 1S2YA 1CHUA 2Z5XA 1IUUA 2X50A 1E1KA 3ZNNA 2R4EA 3CGBA 3H8LA 2NVKX 4JY2A 3CGCA 3C4NA 4H4PA 1GREA 1H82A 2XVJA 1D5TA 4P9SA 3BI5A 4APNA 2XFPA 2AAQA 2XYOA 4YJHB 1GTEA 1CJ3A 4B64A 4H4TA 3ICTA 1BZLA 1Y56A 1B8SA 4C3YA 4A5LA 5BVAA 3G5QA 4FK1A 2FJAA 4RSLA 4FDCB 2QA2A 4B1BA 1S2QA 4YSXA 2E48A 2X99A 3L8KA 3KU9A 2R4JA 3S5WA 1JRYA 1DODA 4YJGA 1FEAA 3RNMA 3M13A 1NG4A 1XPQA 2ZZBA 4J36A 4I58A 3UCLA 1H81A 3SM8A 3KPFA 2OA1A 3GWDA 4H2RA 3I6DA 4H2NA 4J34A 3CPIG 4TM0A 3ALLA 1BGNA 3UTFA 3GDNA 3AE7A 2OLNA 2E5VA 1W4XA 3GYIA 1TYPA 3NNEA 4EQRA 3K7TA 4EQXA 3AECA 1QO8A 1JRZA 5C3JA 1V59A 2CFYA 3VRBA 1DOBA 2BYBA 2GMHA 4IVMB 1COYA 1AOGA 2YG3A 1Q1RA 3W4IA 1E1MA 4CNJA 2GR2A 4X9NA 1LTXR 1F8RA 3AE3A 2BXRA 2E1MA 3B3RA 3DH9A 4RG3A 2EQ8A 2BK5A 2C66A 2WU2A 2FBWA 3QFBA 3KLJA 3CTYA 5FS8A 2DKHA 3P9UA 4N9XA 4B68A 3II4A 1CJ4A 4H2QA 1N4VA 4AT2A 1LQUA 2Y6QA 4Y4NA 3T37A 1PN0A 4CCRA 1N4WA 4AOSA 5JCKA 2YVJA 2IVEA 1DJNA 4C77A 3NYEA 3CIRA 3GRSA 3BHKA 4CRTA 1KIFA 3ITJA 5FS9A 1CL0A 5DBJA 1IUVA 1LV0A 2V5ZA 4TM3A 3VRAA 4DNAA 1Z6LA 1ZMDA 2BACA 2V3BA 2ZZCA 1B5QA 2WQYA 3CGDA 3AEFA 2C64A 5CKUA 3ABVA 1ZMCA 3FPZA 2RGOA 5EB5A 4UDQA 3AE1A 3NK0X 4A6NB 2W0HA 4B67A 1N4UA 4E0VA 2JBVA 1TDKA 3DJEA 2Q6UA 2GEWA 5HYMA 4H4ZA 3H8IA 2AQJA 3QFAA 2YG6A 2YLSA 3OC4A 3QSMA 1CC2A 2XLSA 2BA9A 1D4CA 3AYJA 3CNPA 4NZHA 2C73A 1IUSA 4B63A 3CGEA 4H4QA 3UTEA 3UTHA 1PBDA 1ONFA 1YQ4A 3F8DA 3LJPA 1PJ6A 3IF9A 4A99A 3P4QA 1L9CA 2VRMA 2XFNA 5J60A 2GQWA 4YJFA 2YLTA 3AE5A 3DK9A 3G5SA 4FX9A 5TR3A 2C76A 2R45A 1GSNA 1VG9A 1K0LA 1MO9A 3H4KA 3DJDA 3PS9A 1P2HA 2GF3A 1E39A 2A87A 2BK4A 2C72A 1CBOA 4H50A 1MXTA 3DMEA 4XWZA 1ZDLA 3NT6A 2YG4A 2XDOA 4AT0A 2VVMA 1C0KA 3QSEA 2YR4A 2ARDA 4YJFB 2GQFA 1NHRA 1LPFA 5U25A 4K8DA 4YJDA 3DK8A 1KDGA 5GSNA 1F6MA 4H4UA 2VVLG 1CJ2A 4WX1A 2XFOA 2NPXA 2WETA 3NRNA 3IC9A 4AOXA 3AEBA 2R0GA 2Y6RA 1M64A 1H84A 4U8LA 4YWOA 1KNRA 3WE0A 2WP6A 5BUKA 2GAGB 4ICYA 4LU6A 5M10A 4NTEA 3UOXA 1QJDA 4CY6A 4NTCA 1Q9IA 2JKCA 4OPTA 4X4JA 1L0VA 1JRXA 1ZY8A 4Y4MA 1PJ7A 2WDRA 3GD3A 3GYJA 4OPCA 3IWAA 3P4RA 2O9ZA 4O5QA 4DSHA 2FJEA 2EQ9A 1KNPA 3C96A 1ZOYA 1ZKQA 2V3AA 4PAAA 3BNUA 4TM1A 5KVIA 2BXSA 1K4QA 4EQWA 1YY5A 2CVJA 2JB3A 5HHFA 4D03A 2JK6A 2WP5A 4IA5A 4BK1A 3REDA 3M0OA 2AR8A 4B66A 5EOWA 3P4SA 1XHCA 4CBQA 1O94A 2YG7A 4X9MA 2GRTA 4TM4A 4EIQA 5HY5A 3PO7A 4UDPA 1Y56B 2HQMA 2YLXA 3SFEA 2R0PA 3AWIA 1JU2A 3EF6A 1GXFA 3GSIA 1XANA 3CNTA 4EMIA 5BULA 1REOA 1GRGA 4C3XA 2RGJA 1O95A 1N1PA 3Q6JA 4PABA 1L9DA 1TDFA 4YJGB 2VVLA 2YM1A 1GRTA 3AD8B 3BHFA 1LJ1A 3UKLA 1VDCA 4QFCA 2BCPA 3P4PA 3OZ2A 3ATRA 3FMWA 3GRTA 3NK1X 4C74A 2EQ6A 4OPDA 4U2LA 1ELIA 2GB0A 3UKAA 2PHHA 2GR1A 2JB1A 1JNRA 3LADA 4NTDA 1H86A 3UOZA 4ZN0A 1IUWA 1PDHA 3GMCA 2F5ZA 4NEVA 3O0HA 4TLXA 3CNJA 4ADWA 1CC6A 1GRFA 1GT8A 3V3OA 1OJDA 2WPFA 1YQZA 5KOXA 1ZP0A 5KVHA 3L1RA 4GCMA 3NG7X 4MJWA 4YTPA 1C0LA 1JEHA 1Y0PA 2GH5A 2WOWA 3LXDA 2V61A 2YAUA 4RG4A 4ZCCA 3UP4A 1X31B 4BJYA 3F8PA 2IIDA 2BS3A 4UDRA 1E7PA 1BGJA 3W4KA 2FJDA 2WEUA 1TDOA 2WS3A 2Z5YA 1FCDA 4YXDA 3GD4A 3ISHA 3AXBA 3RHAA 2JAEA 3M12A 2GAHB 3SQPA 5BRTA 4YSHA 1D4EA 1GRHA 2YG5A 4H4YA 4BURA 3NYCA 1FEBA 4H4RA 2X3NA 4XWRA 1KFYA 2X8HA 3KD9A 2BABA 4K5RA 2EQ7A 3ICRA 4Z43A 2C75A 4HA6A 3AE2A 1ZOVA 4M52A 2APGA 2GVCA 4DSGA 1NHQA 4U8PA 4YSZA 1OJTA 3DJJA 3NTDA 1FOHA 1K0JA 2GV8A 3NTAA 4DGKA 1GALA 3NH3X 3ZNQA 1DXLA 3RP7A 4A7AA 4O5UA 4BJZA 3D8XA 2H89A 2XVHA 2CULA 1D4DA 1VE9A 1JOAA 3UOVA 2YWLA 3CUKA 3DGHA 1LQTA 4OPGA 1KSUA 3NHOX 3RP8A 2XVFA 1MOKA 2TPRA 1F8WA 1DOEA 3PVCA 4OVIA 4K22A 3AD7B 4K2XA 2YLZA 4H4WA 1C0IA 3AD9B 1GESA 2FJBA 1TYTA 1QLBA 3G5RA 2WPEA 3AE6A 2UZZA 1TDNA 3K7QX 3G3EA 3KA7A 2YR5A 4K7ZA 3ZDNA 3W4JA 4JNAA 4IVOB 4CY8A 2WP9A 1H7WA 3UTGA 4Z26A 1ZX9A 1DOCA
chains in the Genus database with same CATH superfamily
5GRTA 2BK3A 4UP3A 4Z24A 4EMWA 3DJGX 1NG3A 3BNMA 5FS6A 2WPCA 2XLUA 4CNKA 2DU8A 2WHDA 2WBAA 2GMJA 1GNDA 3F8RA 5KWFA 1O5WA 3BI2A 4KPRA 5J7XA 3T2ZA 2C70A 1M6IA 4A65A 4H4VA 3UKQA 2XCGA 3JSKA 3P1WA 4YT0A 3GYXA 5EB4A 1K0IA 4USRA 3T14A 2JB2A 4OCGA 4U2TA 2YQUA 2YR6A 5JCIA 5IQ1A 2TMDA 4U8OA 1PXCA 2YVGA 1KSSA 2XLTA 4JNQA 5FS7A 5KXJA 3V3NA 1EL8A 4I59A 5JCMA 3S61A 1ZK7A 5IPYA 5L46A 1TRBA 4XXGA 3FBSA 5JCNA 2A89A 5KMQA 4YSYA 3SZFA 4NEWA 1CC4A 4OPIA 2B76A 2VQ7A 2WU5A 3KPKA 3B6DA 3LZXA 4YJHA 2XFQA 3LZWA 2YVFA 1PS9A 3I3LA 1NHSA 1E1NA 4LA1A 1PBBA 4GF7A 2XLRA 5M0ZA 4BK2A 2BS2A 5CQFA 2E82A 3AEEA 3C4AA 3IHGA 2VQBA 3VR8A 3GDPA 2X8GA 3NLCA 4GRTA 1NPXA 4EM4A 3QVRA 1PBEA 2BS4A 2YLWA 4JQ9A 4JDRA 4A79A 4YKGA 1FL2A 3QSSA 2C65A 1OJCA 4Z2RA 1EL7A 2C3DA 4C5OA 2WESA 4J33A 4FK1C 4GR1A 4JN9A 4D04A 2R46A 4IA6A 1H6VA 1CJCA 3D1CA 3AE9A 3K7MX 4G6HA 1JNZA 1EVIA 3NN0X 1RYIA 1F8SA 4U2SA 2BCGG 4LIIA 1VG0A 4CCQA 4BK3A 4YXDA 1PXAA 1Q1WA 1GERA 4J2WA 3DA1A 4J31A 2GR3A 1PBFA 2XVIA 1DDOA 3V76A 1GOSA 2OAMA 5EBKA 1E6EA 1GRBA 4YTNA 4EIPA 3R9UA 2QCUA 1E1LA 4U8JA 3SFDA 2Q0KA 4U8NA 2J3NA 4H7UA 4U8IA 2C7GA 3AYIA 3CN8A 3ZNPA 2B9XA 2V60A 3K30A 3DGZA 4GDEA 3NN6X 4OPUA 3VR9A 2RGHA 5U1OA 2VZ2A 2CDUA 3HZLA 2BC1A 3CNSA 4TLZA 3E1TA 3KVEA 4B65A 1EBDA 4Z2TA 3EAOA 1GETA 2Q7VA 2E49A 3CNDA 4NNJA 3UKFA 1OJ9A 2C67A 3IHMA 3SGLA 1NDAA 2H88A 2OLOA 1H7XA 1GEUA 4J56A 1FECA 3AEGA 3AEDA 1BKWA 4Z2UA 4Z25A 5IQ4A 1D7LA 1IUXA 2E4GA 2ACZA 4K5SA 2B9YA 4A6NA 1RSGA 3SYIA 4HB9A 5C2TA 3COXA 1PHHA 2QA1A 1L9EA 3ALMA 4EMJA 4A9WA 2X8CA 3LOVA 1SEZA 2XVEA 3T31A 1B4VA 4J57A 1H83A 2C3CA 3VRDB 3LB8A 4USQA 1DJQA 1PJ5A 4AP3A 3RP6A 4U8MA 3EANA 1YKJA 3NK2X 5ER0A 1P2EA 1UKVG 4QFDA 1GRAA 2BRYA 1NENA 3Q9TA 4YKFA 5KMRA 1LVLA 3BI4A 4REKA 2V6OA 1D7YA 2WOVA 2XFUA 2ZZ0A 3NIXA 4H4SA 4IV9A 3NKSA 2R0CA 3URHA 4EQSA 3ZYXA 4U8KA 2DKIA 1VQWA 3EPTA 3WGTA 4AP1A 1OJAA 2ZBWA 3QVPA 3FIMB 3T2YA 4GUVA 2PYXA 5JCLA 1NEKA 2A8XA 4JY3A 2WOIA 3QJ4A 1VRQB 4OPLA 4EM3A 3ICSA 1XDIA 1EL5A 1NAAA 2R9ZA 3AE4A 3ATQA 2GR0A 3DK4A 3UKHA 3ZNOA 4BV6A 3GWFA 3NYFA 1GTHA 1YQ3A 4WCTA 3NGCX 3CPHG 2QAEA 2WDVA 4ZCDA 5KOWA 1CF3A 3KKJA 4H2PA 3UP5A 3ADAB 1B37A 4H4XA 5LV9A 1KF6A 1DNCA 1PBCA 3GMBA 2B9WA 2OALA 1S3EA 4B69A 2VOUA 2YLRA 1TDEA 3CPJG 3VQRA 4GDPA 2IVDA 1AN9A 3AYLA 1F3PA 5HXIA 2VRLA 1BF3A 2WDQA 1C0PA 2BC0A 2B7RA 1S3BA 3AB1A 3AE8A 4Z44A 3UKKA 4KX6A 1EL9A 1IJHA 2RABA 5U63A 2I0ZA 1HYUA 4ECHA 2XLPA 3FG2P 1GPEA 1BWCA 1PXBA 2BRAA 5KRQA 1IUTA 2YM2A 3UKPA 1GV4A 1DAOA 2Q0LA 3ALJA 1RP0A 5FMHA 2B7SA 3AEAA 4YTMA 2E4AA 1NHPA 3UOYA 4Y4LA 1S2YA 1CHUA 2Z5XA 1IUUA 2X50A 1E1KA 3ZNNA 2R4EA 4JY2A 3CGBA 2NVKX 3H8LA 3CGCA 3C4NA 4H4PA 1GREA 1H82A 2XVJA 1D5TA 4P9SA 3BI5A 4APNA 2XFPA 2AAQA 2XYOA 4YJHB 1GTEA 1CJ3A 4B64A 4H4TA 3ICTA 1BZLA 1Y56A 1B8SA 4C3YA 4A5LA 5BVAA 3G5QA 4FK1A 2FJAA 4RSLA 4FDCB 5KMSA 2QA2A 4B1BA 1S2QA 4YSXA 2E48A 2X99A 3HYVA 3L8KA 3KU9A 2R4JA 3S5WA 1JRYA 1DODA 4YJGA 1FEAA 3RNMA 3M13A 1NG4A 1XPQA 2ZZBA 4J36A 4I58A 3UCLA 1H81A 3SM8A 4H2RA 2OA1A 3GWDA 3KPFA 3I6DA 4H2NA 4J34A 3CPIG 4TM0A 3ALLA 1BGNA 3UTFA 3GDNA 3AE7A 2OLNA 2E5VA 1W4XA 3GYIA 1TYPA 3NNEA 4EQRA 3K7TA 4EQXA 3AECA 1QO8A 1JRZA 5C3JA 1V59A 2CFYA 3VRBA 1DOBA 2BYBA 2GMHA 4IVMB 1COYA 1AOGA 2YG3A 1Q1RA 3W4IA 1E1MA 4CNJA 2GR2A 4X9NA 1LTXR 1F8RA 3AE3A 2BXRA 2E1MA 3B3RA 4G74A 3DH9A 4RG3A 2EQ8A 2BK5A 2C66A 2WU2A 2FBWA 3QFBA 5KMPA 3KLJA 3CTYA 5FS8A 2DKHA 3P9UA 4N9XA 4B68A 4H2QA 1CJ4A 3II4A 1N4VA 4AT2A 1LQUA 2Y6QA 4Y4NA 3SY4A 1PN0A 3T37A 4CCRA 1N4WA 4AOSA 4G73A 2YVJA 2IVEA 1DJNA 4C77A 3NYEA 3CIRA 3GRSA 3BHKA 4CRTA 1KIFA 3ITJA 5FS9A 1CL0A 5DBJA 1IUVA 2C4CA 1LV0A 2V5ZA 4TM3A 3VRAA 4DNAA 1Z6LA 1ZMDA 2BACA 2V3BA 2ZZCA 1B5QA 2WQYA 3CGDA 4II2A 3SZCA 3AEFA 2C64A 5CKUA 3ABVA 1ZMCA 3FPZA 2RGOA 5EB5A 4UDQA 3AE1A 3NK0X 4A6NB 2W0HA 4B67A 1N4UA 4E0VA 2JBVA 1TDKA 3DJEA 2Q6UA 2GEWA 5HYMA 4H4ZA 3H8IA 2AQJA 3QFAA 2YG6A 2YLSA 3OC4A 3QSMA 1CC2A 2XLSA 2BA9A 1D4CA 3AYJA 3CNPA 4NZHA 2C73A 1IUSA 4B63A 3CGEA 4H4QA 3UTEA 3UTHA 1PBDA 1ONFA 1YQ4A 3F8DA 3LJPA 1PJ6A 3IF9A 4A99A 3P4QA 1L9CA 2VRMA 2XFNA 5J60A 2GQWA 4YJFA 2YLTA 3AE5A 3DK9A 3G5SA 4FX9A 5TR3A 2C76A 2R45A 1GSNA 1K0LA 1MO9A 1VG9A 3H4KA 3DJDA 3PS9A 1P2HA 2GF3A 1E39A 2A87A 2BK4A 2C72A 1CBOA 4H50A 1MXTA 3SZ0A 3DMEA 4XWZA 1ZDLA 3NT6A 2YG4A 2XDOA 3CMMA 4AT0A 2VVMA 1C0KA 3QSEA 2YR4A 2ARDA 4YJFB 2GQFA 1NHRA 1LPFA 5U25A 4K8DA 4YJDA 3DK8A 1KDGA 5GSNA 1F6MA 4H4UA 2VVLG 1CJ2A 4WX1A 2XFOA 2NPXA 2WETA 3NRNA 3IC9A 3SZWA 4AOXA 3AEBA 2R0GA 2Y6RA 1M64A 1H84A 4U8LA 4YWOA 1KNRA 3WE0A 2WP6A 5BUKA 2GAGB 4ICYA 4LU6A 5M10A 4NTEA 3UOXA 1QJDA 4CY6A 4NTCA 1Q9IA 2JKCA 4OPTA 4X4JA 1L0VA 1JRXA 1ZY8A 4Y4MA 4G9KA 1PJ7A 2WDRA 3GD3A 3GYJA 4OPCA 3IWAA 3P4RA 2O9ZA 4O5QA 4DSHA 2FJEA 2EQ9A 3C96A 1KNPA 1ZOYA 3T0KA 1ZKQA 2V3AA 4PAAA 3BNUA 4TM1A 5KVIA 2BXSA 1K4QA 4EQWA 1YY5A 2CVJA 2JB3A 5HHFA 4D03A 2JK6A 2WP5A 4IA5A 4BK1A 3REDA 5JCKA 3M0OA 2AR8A 4B66A 5EOWA 3P4SA 1XHCA 4CBQA 1O94A 4EIQA 4X9MA 2GRTA 2YG7A 4TM4A 5HY5A 3PO7A 4UDPA 1Y56B 2HQMA 2YLXA 4G6GA 3SFEA 2R0PA 3AWIA 1JU2A 3EF6A 1GXFA 3GSIA 1XANA 3CNTA 3SX6A 4EMIA 5BULA 1REOA 1GRGA 4C3XA 2RGJA 1O95A 1N1PA 3Q6JA 4PABA 1L9DA 1TDFA 4YJGB 2VVLA 2YM1A 1GRTA 3AD8B 3BHFA 1LJ1A 3UKLA 1VDCA 4QFCA 2BCPA 3P4PA 3OZ2A 3ATRA 3FMWA 3GRTA 3NK1X 4C74A 2EQ6A 4OPDA 4U2LA 1ELIA 2GB0A 3UKAA 2PHHA 2GR1A 4GAPA 2JB1A 1JNRA 3LADA 4NTDA 1H86A 3UOZA 4ZN0A 1IUWA 1PDHA 3GMCA 2F5ZA 4NEVA 3SXIA 3O0HA 4TLXA 3CNJA 4ADWA 1CC6A 1GRFA 1GT8A 3V3OA 1OJDA 2WPFA 1YQZA 3T2KA 1ZP0A 5KOXA 3L1RA 5KVHA 4GCMA 3NG7X 4MJWA 4YTPA 1C0LA 1JEHA 1Y0PA 2GH5A 2WOWA 3LXDA 2V61A 2YAUA 4RG4A 4BJYA 4ZCCA 1X31B 3UP4A 3F8PA 2IIDA 2BS3A 4UDRA 1E7PA 1BGJA 3W4KA 2FJDA 2WEUA 1TDOA 2WS3A 2Z5YA 1FCDA 4GAVA 3GD4A 3ISHA 3AXBA 3RHAA 2JAEA 3M12A 2GAHB 3SQPA 5BRTA 4YSHA 1D4EA 1GRHA 2YG5A 4H4YA 4BURA 3NYCA 1FEBA 4H4RA 2X3NA 4XWRA 1KFYA 2X8HA 3KD9A 2BABA 4K5RA 2EQ7A 3ICRA 4Z43A 2C75A 4HA6A 3AE2A 1ZOVA 4M52A 2APGA 2GVCA 4DSGA 1NHQA 4U8PA 4YSZA 1OJTA 3DJJA 3NTDA 1FOHA 1K0JA 2GV8A 3NTAA 4DGKA 5KNLA 4NWZA 1GALA 3NH3X 3ZNQA 1DXLA 3RP7A 4A7AA 4O5UA 4BJZA 3D8XA 2H89A 2XVHA 2CULA 1D4DA 1VE9A 1JOAA 3UOVA 3HYXA 2YWLA 3CUKA 3DGHA 1LQTA 4OPGA 1KSUA 3NHOX 3RP8A 2XVFA 1MOKA 2TPRA 1F8WA 1DOEA 3PVCA 4OVIA 4K22A 3AD7B 4K2XA 2YLZA 4H4WA 4II3A 1C0IA 3AD9B 1GESA 2FJBA 1TYTA 1QLBA 3G5RA 2WPEA 3HYWA 3AE6A 2UZZA 1TDNA 3K7QX 3G3EA 3KA7A 2YR5A 4K7ZA 3ZDNA 3W4JA 4JNAA 4IVOB 4CY8A 2WP9A 1H7WA 3UTGA 4Z26A 1ZX9A 1DOCA
chains in the Genus database with same CATH topology
5GRTA 2BK3A 4UP3A 4Z24A 4EMWA 3DJGX 1NG3A 3BNMA 5FS6A 2WPCA 2XLUA 4CNKA 2DU8A 2WHDA 2WBAA 1GNDA 2GMJA 3F8RA 5KWFA 1O5WA 3BI2A 4KPRA 5J7XA 3T2ZA 2C70A 1M6IA 4A65A 4H4VA 3UKQA 2XCGA 3JSKA 3P1WA 4YT0A 3GYXA 5EB4A 1K0IA 4USRA 3T14A 2JB2A 4OCGA 4U2TA 2YQUA 2YR6A 5JCIA 5IQ1A 2TMDA 4U8OA 1PXCA 2YVGA 1KSSA 2XLTA 4JNQA 5FS7A 5KXJA 3V3NA 1EL8A 4I59A 5JCMA 3S61A 1ZK7A 5IPYA 5L46A 1TRBA 4XXGA 3FBSA 5JCNA 2A89A 5KMQA 4YSYA 3SZFA 4NEWA 1CC4A 4OPIA 2B76A 2VQ7A 2WU5A 3KPKA 3B6DA 3LZXA 4YJHA 2XFQA 3LZWA 2YVFA 1PS9A 3I3LA 1NHSA 1E1NA 4LA1A 1PBBA 4GF7A 2XLRA 5M0ZA 4BK2A 2BS2A 5CQFA 2E82A 3AEEA 2VQBA 3C4AA 3IHGA 3VR8A 3GDPA 2X8GA 3NLCA 4GRTA 1NPXA 4EM4A 3QVRA 1PBEA 2BS4A 2YLWA 4JQ9A 4JDRA 4A79A 4YKGA 1FL2A 3QSSA 2C65A 1OJCA 4Z2RA 1EL7A 2C3DA 4C5OA 2WESA 4J33A 4FK1C 4GR1A 4JN9A 4D04A 2R46A 4IA6A 1H6VA 1CJCA 3D1CA 3AE9A 3K7MX 4G6HA 1JNZA 1EVIA 3NN0X 1RYIA 1F8SA 4U2SA 2BCGG 4LIIA 1VG0A 4CCQA 4BK3A 4YXDA 1PXAA 1Q1WA 1GERA 4J2WA 3DA1A 4J31A 2GR3A 1PBFA 2XVIA 1DDOA 3V76A 1GOSA 2OAMA 5EBKA 1E6EA 1GRBA 4YTNA 4EIPA 3R9UA 2QCUA 1E1LA 4U8JA 3SFDA 2Q0KA 4U8NA 2J3NA 4H7UA 4U8IA 2C7GA 3AYIA 3CN8A 3ZNPA 2B9XA 2V60A 3K30A 3DGZA 4GDEA 3NN6X 4OPUA 3VR9A 2RGHA 5U1OA 2VZ2A 2CDUA 3HZLA 2BC1A 3CNSA 4TLZA 3E1TA 3KVEA 4B65A 1EBDA 4Z2TA 3EAOA 1GETA 2Q7VA 2E49A 3CNDA 4NNJA 3UKFA 1OJ9A 2C67A 3SGLA 1NDAA 3IHMA 2H88A 2OLOA 1H7XA 1GEUA 4J56A 1FECA 3AEGA 3AEDA 1BKWA 4Z2UA 4Z25A 5IQ4A 1D7LA 1IUXA 2E4GA 2ACZA 4K5SA 2B9YA 4A6NA 1RSGA 3SYIA 4HB9A 5C2TA 3COXA 1PHHA 2QA1A 1L9EA 3ALMA 4EMJA 4A9WA 2X8CA 3LOVA 1SEZA 2XVEA 3T31A 1B4VA 4J57A 1H83A 2C3CA 3VRDB 3LB8A 4USQA 1DJQA 1PJ5A 4AP3A 3RP6A 4U8MA 3EANA 1YKJA 3NK2X 5ER0A 1P2EA 1UKVG 4QFDA 1GRAA 2BRYA 1NENA 3Q9TA 4YKFA 5KMRA 1LVLA 3BI4A 4REKA 2V6OA 1D7YA 2WOVA 2XFUA 2ZZ0A 3NIXA 4H4SA 4IV9A 3NKSA 2R0CA 3URHA 4EQSA 3ZYXA 4U8KA 1VQWA 2DKIA 3EPTA 3WGTA 4AP1A 1OJAA 2ZBWA 3QVPA 3FIMB 3T2YA 4GUVA 2PYXA 5JCLA 1NEKA 2A8XA 3QJ4A 2WOIA 4JY3A 1VRQB 4OPLA 4EM3A 3ICSA 1XDIA 1EL5A 1NAAA 2R9ZA 3AE4A 3ATQA 2GR0A 3DK4A 3UKHA 3ZNOA 4BV6A 3GWFA 3NYFA 1GTHA 1YQ3A 4WCTA 3NGCX 3CPHG 2QAEA 2WDVA 4ZCDA 5KOWA 1CF3A 3KKJA 4H2PA 3UP5A 3ADAB 1B37A 4H4XA 5LV9A 1KF6A 1DNCA 1PBCA 2OALA 2B9WA 3GMBA 1S3EA 4B69A 2VOUA 2YLRA 1TDEA 3CPJG 3VQRA 4GDPA 2IVDA 1AN9A 3AYLA 1F3PA 5HXIA 2VRLA 1BF3A 2WDQA 1C0PA 2BC0A 2B7RA 1S3BA 3AB1A 3AE8A 4Z44A 3UKKA 4KX6A 1EL9A 1IJHA 2RABA 5U63A 2I0ZA 1HYUA 4ECHA 2XLPA 3FG2P 1GPEA 1BWCA 1PXBA 2BRAA 5KRQA 1IUTA 2YM2A 3UKPA 1GV4A 1DAOA 2Q0LA 3ALJA 1RP0A 5FMHA 2B7SA 3AEAA 4YTMA 2E4AA 1NHPA 3UOYA 4Y4LA 1S2YA 1CHUA 2Z5XA 1IUUA 2X50A 1E1KA 3ZNNA 2R4EA 3CGBA 3H8LA 2NVKX 4JY2A 3CGCA 3C4NA 4H4PA 1GREA 1H82A 2XVJA 1D5TA 4P9SA 3BI5A 4APNA 2XFPA 2AAQA 2XYOA 4YJHB 1GTEA 1CJ3A 4B64A 4H4TA 3ICTA 1BZLA 1Y56A 1B8SA 4C3YA 4A5LA 5BVAA 3G5QA 4FK1A 2FJAA 4RSLA 4FDCB 5KMSA 2QA2A 4B1BA 1S2QA 4YSXA 2E48A 2X99A 3HYVA 3L8KA 3KU9A 2R4JA 3S5WA 1JRYA 1DODA 4YJGA 1FEAA 3RNMA 3M13A 1NG4A 1XPQA 2ZZBA 4J36A 4I58A 3UCLA 1H81A 3SM8A 3KPFA 2OA1A 3GWDA 4H2RA 3I6DA 4H2NA 4J34A 3CPIG 4TM0A 3ALLA 1BGNA 3UTFA 3GDNA 3AE7A 2OLNA 2E5VA 1W4XA 3GYIA 1TYPA 3NNEA 4EQRA 3K7TA 4EQXA 3AECA 1QO8A 1JRZA 5C3JA 1V59A 2CFYA 3VRBA 1DOBA 2BYBA 2GMHA 4IVMB 1COYA 1AOGA 2YG3A 1Q1RA 3W4IA 1E1MA 4CNJA 2GR2A 4X9NA 1LTXR 1F8RA 3AE3A 2BXRA 2E1MA 3B3RA 4G74A 3DH9A 4RG3A 2EQ8A 2BK5A 2C66A 2WU2A 2FBWA 3QFBA 5KMPA 3KLJA 3CTYA 5FS8A 2DKHA 3P9UA 4N9XA 4B68A 3II4A 1CJ4A 4H2QA 1N4VA 4AT2A 1LQUA 2Y6QA 4Y4NA 3SY4A 1PN0A 3T37A 4CCRA 1N4WA 4AOSA 4G73A 2YVJA 2IVEA 1DJNA 4C77A 3NYEA 3CIRA 3GRSA 3BHKA 4CRTA 1KIFA 3ITJA 5FS9A 1CL0A 5DBJA 1IUVA 2C4CA 1LV0A 2V5ZA 4TM3A 3VRAA 4DNAA 1Z6LA 1ZMDA 2BACA 2V3BA 2ZZCA 1B5QA 2WQYA 3CGDA 4II2A 3SZCA 3AEFA 2C64A 5CKUA 3ABVA 1ZMCA 3FPZA 2RGOA 5EB5A 4UDQA 3AE1A 3NK0X 4A6NB 2W0HA 4B67A 1N4UA 4E0VA 2JBVA 1TDKA 3DJEA 2Q6UA 2GEWA 5HYMA 4H4ZA 3H8IA 2AQJA 3QFAA 2YG6A 2YLSA 3OC4A 3QSMA 1CC2A 2XLSA 2BA9A 1D4CA 3AYJA 3CNPA 4NZHA 2C73A 1IUSA 4B63A 3CGEA 4H4QA 3UTEA 3UTHA 1PBDA 1ONFA 1YQ4A 3F8DA 3LJPA 1PJ6A 3IF9A 4A99A 3P4QA 1L9CA 2VRMA 2XFNA 5J60A 2GQWA 4YJFA 2YLTA 3AE5A 3DK9A 3G5SA 4FX9A 5TR3A 2C76A 2R45A 1GSNA 1VG9A 1K0LA 1MO9A 3H4KA 3DJDA 3PS9A 1P2HA 2GF3A 1E39A 2A87A 2BK4A 2C72A 1CBOA 4H50A 1MXTA 3SZ0A 3DMEA 4XWZA 1ZDLA 3NT6A 2YG4A 2XDOA 3CMMA 4AT0A 2VVMA 1C0KA 3QSEA 2YR4A 2ARDA 4YJFB 2GQFA 1NHRA 1LPFA 5U25A 4K8DA 4YJDA 3DK8A 1KDGA 5GSNA 1F6MA 4H4UA 2VVLG 1CJ2A 4WX1A 2XFOA 2NPXA 2WETA 3NRNA 3IC9A 3SZWA 4AOXA 3AEBA 2R0GA 2Y6RA 1M64A 1H84A 4U8LA 4YWOA 1KNRA 3WE0A 2WP6A 5BUKA 2GAGB 4ICYA 4LU6A 5M10A 4NTEA 3UOXA 1QJDA 4CY6A 4NTCA 1Q9IA 2JKCA 4OPTA 4X4JA 1L0VA 1JRXA 1ZY8A 4Y4MA 4G9KA 1PJ7A 2WDRA 3GD3A 3GYJA 4OPCA 3IWAA 3P4RA 2O9ZA 4O5QA 4DSHA 2FJEA 2EQ9A 1KNPA 3C96A 1ZOYA 3T0KA 1ZKQA 2V3AA 4PAAA 3BNUA 4TM1A 5KVIA 2BXSA 1K4QA 4EQWA 1YY5A 2CVJA 2JB3A 5HHFA 4D03A 2JK6A 2WP5A 4IA5A 4BK1A 3REDA 5JCKA 3M0OA 2AR8A 4B66A 5EOWA 3P4SA 1XHCA 4CBQA 1O94A 2YG7A 4X9MA 2GRTA 4TM4A 4EIQA 5HY5A 3PO7A 4UDPA 1Y56B 2HQMA 2YLXA 4G6GA 3SFEA 2R0PA 3AWIA 1JU2A 3EF6A 1GXFA 3GSIA 1XANA 3CNTA 3SX6A 4EMIA 5BULA 1REOA 1GRGA 4C3XA 2RGJA 1O95A 1N1PA 3Q6JA 4PABA 1L9DA 1TDFA 4YJGB 2VVLA 2YM1A 1GRTA 3AD8B 3BHFA 1LJ1A 3UKLA 1VDCA 4QFCA 2BCPA 3P4PA 3OZ2A 3ATRA 3FMWA 3GRTA 3NK1X 4C74A 2EQ6A 4OPDA 4U2LA 1ELIA 2GB0A 3UKAA 2PHHA 2GR1A 4GAPA 2JB1A 1JNRA 3LADA 4NTDA 1H86A 3UOZA 4ZN0A 1IUWA 1PDHA 3GMCA 2F5ZA 4NEVA 3SXIA 3O0HA 4TLXA 3CNJA 4ADWA 1CC6A 1GRFA 1GT8A 3V3OA 1OJDA 2WPFA 1YQZA 3T2KA 1ZP0A 5KOXA 3L1RA 5KVHA 4GCMA 3NG7X 4MJWA 4YTPA 1C0LA 1JEHA 1Y0PA 2GH5A 2WOWA 3LXDA 2V61A 2YAUA 4RG4A 4ZCCA 3UP4A 1X31B 4BJYA 3F8PA 2IIDA 2BS3A 4UDRA 1E7PA 1BGJA 3W4KA 2FJDA 2WEUA 1TDOA 2WS3A 2Z5YA 1FCDA 4GAVA 3GD4A 3ISHA 3AXBA 3RHAA 2JAEA 3M12A 2GAHB 3SQPA 5BRTA 4YSHA 1D4EA 1GRHA 2YG5A 4H4YA 4BURA 3NYCA 1FEBA 4H4RA 2X3NA 4XWRA 1KFYA 2X8HA 3KD9A 2BABA 4K5RA 2EQ7A 3ICRA 4Z43A 2C75A 4HA6A 3AE2A 1ZOVA 4M52A 2APGA 2GVCA 4DSGA 1NHQA 4U8PA 4YSZA 1OJTA 3DJJA 3NTDA 1FOHA 1K0JA 2GV8A 3NTAA 4DGKA 5KNLA 4NWZA 1GALA 3NH3X 3ZNQA 1DXLA 3RP7A 4A7AA 4O5UA 4BJZA 3D8XA 2H89A 2XVHA 2CULA 1D4DA 1VE9A 1JOAA 3UOVA 3HYXA 2YWLA 3CUKA 3DGHA 1LQTA 4OPGA 1KSUA 3NHOX 3RP8A 2XVFA 1MOKA 2TPRA 1F8WA 1DOEA 3PVCA 4OVIA 4K22A 3AD7B 4K2XA 2YLZA 4H4WA 4II3A 1C0IA 3AD9B 1GESA 2FJBA 1TYTA 1QLBA 3G5RA 2WPEA 3HYWA 3AE6A 2UZZA 1TDNA 3K7QX 3G3EA 3KA7A 2YR5A 4K7ZA 3ZDNA 3W4JA 4JNAA 4IVOB 4CY8A 2WP9A 1H7WA 3UTGA 4Z26A 1ZX9A 1DOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GRT A;  2BK3 A;  4UP3 A;  4Z24 A;  4EMW A;  3DJG X;  1NG3 A;  3BNM A;  5FS6 A;  2WPC A;  2XLU A;  4CNK A;  2DU8 A;  2WHD A;  2WBA A;  1GND A;  2GMJ A;  3F8R A;  5KWF A;  1O5W A;  3BI2 A;  4KPR A;  5J7X A;  2C70 A;  1M6I A;  4A65 A;  4H4V A;  3UKQ A;  2XCG A;  3JSK A;  3P1W A;  4YT0 A;  5EB4 A;  1K0I A;  4USR A;  2JB2 A;  4OCG A;  4U2T A;  2YQU A;  2YR6 A;  5JCI A;  5IQ1 A;  2TMD A;  4U8O A;  1PXC A;  2YVG A;  1KSS A;  2XLT A;  4JNQ A;  5FS7 A;  5KXJ A;  3V3N A;  1EL8 A;  4I59 A;  5JCM A;  3S61 A;  1ZK7 A;  5IPY A;  5L46 A;  1TRB A;  4XXG A;  3FBS A;  5JCN A;  2A89 A;  4YSY A;  4NEW A;  1CC4 A;  4OPI A;  2B76 A;  2VQ7 A;  2WU5 A;  3B6D A;  3LZX A;  4YJH A;  2XFQ A;  3LZW A;  2YVF A;  1PS9 A;  3I3L A;  1NHS A;  1E1N A;  4LA1 A;  1PBB A;  4GF7 A;  2XLR A;  5M0Z A;  4BK2 A;  2BS2 A;  5CQF A;  2E82 A;  3AEE A;  2VQB A;  3C4A A;  3IHG A;  3VR8 A;  3GDP A;  2X8G A;  3NLC A;  4GRT A;  1NPX A;  4EM4 A;  3QVR A;  1PBE A;  2BS4 A;  2YLW A;  4JQ9 A;  4JDR A;  4A79 A;  4YKG A;  1FL2 A;  3QSS A;  2C65 A;  1OJC A;  4Z2R A;  1EL7 A;  2C3D A;  4C5O A;  2WES A;  4J33 A;  4FK1 C;  4GR1 A;  4JN9 A;  4D04 A;  2R46 A;  4IA6 A;  1H6V A;  1CJC A;  3D1C A;  3AE9 A;  3K7M X;  1JNZ A;  1EVI A;  3NN0 X;  1RYI A;  1F8S A;  4U2S A;  2BCG G;  4LII A;  1VG0 A;  4CCQ A;  4BK3 A;  1PXA A;  1Q1W A;  1GER A;  4J2W A;  3DA1 A;  4J31 A;  2GR3 A;  1PBF A;  2XVI A;  1DDO A;  3V76 A;  1GOS A;  2OAM A;  5EBK A;  1E6E A;  1GRB A;  4YTN A;  4EIP A;  3R9U A;  2QCU A;  1E1L A;  4U8J A;  3SFD A;  2Q0K A;  4U8N A;  2J3N A;  4H7U A;  4U8I A;  2C7G A;  3AYI A;  3CN8 A;  3ZNP A;  2B9X A;  2V60 A;  3K30 A;  3DGZ A;  4GDE A;  3NN6 X;  4OPU A;  3VR9 A;  2RGH A;  5U1O A;  2VZ2 A;  2CDU A;  3HZL A;  2BC1 A;  3CNS A;  4TLZ A;  3E1T A;  3KVE A;  4B65 A;  1EBD A;  4Z2T A;  3EAO A;  1GET A;  2Q7V A;  2E49 A;  3CND A;  3UKF A;  1OJ9 A;  2C67 A;  3SGL A;  1NDA A;  3IHM A;  2H88 A;  2OLO A;  1H7X A;  1GEU A;  4J56 A;  1FEC A;  3AEG A;  3AED A;  1BKW A;  4Z2U A;  4Z25 A;  5IQ4 A;  1D7L A;  1IUX A;  2E4G A;  2ACZ A;  4K5S A;  2B9Y A;  4A6N A;  1RSG A;  4HB9 A;  5C2T A;  3COX A;  1PHH A;  2QA1 A;  1L9E A;  3ALM A;  4EMJ A;  4A9W A;  2X8C A;  3LOV A;  1SEZ A;  2XVE A;  1B4V A;  4J57 A;  1H83 A;  2C3C A;  3VRD B;  3LB8 A;  4USQ A;  1DJQ A;  1PJ5 A;  4AP3 A;  3RP6 A;  4U8M A;  3EAN A;  1YKJ A;  3NK2 X;  5ER0 A;  1P2E A;  1UKV G;  4QFD A;  1GRA A;  1NEN A;  3Q9T A;  4YKF A;  1LVL A;  3BI4 A;  4REK A;  2V6O A;  1D7Y A;  2WOV A;  2XFU A;  2ZZ0 A;  3NIX A;  4H4S A;  4IV9 A;  3NKS A;  2R0C A;  3URH A;  4EQS A;  3ZYX A;  4U8K A;  1VQW A;  2DKI A;  3EPT A;  3WGT A;  4AP1 A;  1OJA A;  2ZBW A;  3QVP A;  3FIM B;  4GUV A;  2PYX A;  5JCL A;  1NEK A;  2A8X A;  3QJ4 A;  2WOI A;  4JY3 A;  1VRQ B;  4OPL A;  4EM3 A;  3ICS A;  1XDI A;  1EL5 A;  1NAA A;  2R9Z A;  3AE4 A;  3ATQ A;  2GR0 A;  3DK4 A;  3UKH A;  3ZNO A;  4BV6 A;  3GWF A;  3NYF A;  1GTH A;  1YQ3 A;  4WCT A;  3NGC X;  3CPH G;  2QAE A;  2WDV A;  4ZCD A;  5KOW A;  1CF3 A;  3KKJ A;  4H2P A;  3UP5 A;  3ADA B;  1B37 A;  4H4X A;  5LV9 A;  1KF6 A;  1DNC A;  1PBC A;  2OAL A;  2B9W A;  3GMB A;  1S3E A;  4B69 A;  2VOU A;  2YLR A;  1TDE A;  3CPJ G;  3VQR A;  4GDP A;  2IVD A;  1AN9 A;  3AYL A;  1F3P A;  5HXI A;  2VRL A;  1BF3 A;  2WDQ A;  1C0P A;  2BC0 A;  2B7R A;  1S3B A;  3AB1 A;  3AE8 A;  4Z44 A;  3UKK A;  4KX6 A;  1EL9 A;  1IJH A;  2RAB A;  5U63 A;  2I0Z A;  1HYU A;  4ECH A;  2XLP A;  3FG2 P;  1GPE A;  1BWC A;  1PXB A;  5KRQ A;  1IUT A;  2YM2 A;  3UKP A;  1GV4 A;  1DAO A;  2Q0L A;  3ALJ A;  1RP0 A;  5FMH A;  2B7S A;  3AEA A;  4YTM A;  2E4A A;  1NHP A;  3UOY A;  4Y4L A;  1S2Y A;  1CHU A;  2Z5X A;  1IUU A;  2X50 A;  1E1K A;  3ZNN A;  2R4E A;  3CGB A;  3H8L A;  2NVK X;  4JY2 A;  3CGC A;  3C4N A;  4H4P A;  1GRE A;  1H82 A;  2XVJ A;  1D5T A;  4P9S A;  3BI5 A;  4APN A;  2XFP A;  2AAQ A;  2XYO A;  4YJH B;  1GTE A;  1CJ3 A;  4B64 A;  4H4T A;  3ICT A;  1BZL A;  1Y56 A;  1B8S A;  4C3Y A;  4A5L A;  5BVA A;  3G5Q A;  4FK1 A;  2FJA A;  4RSL A;  4FDC B;  2QA2 A;  4B1B A;  1S2Q A;  4YSX A;  2E48 A;  2X99 A;  3L8K A;  3KU9 A;  2R4J A;  3S5W A;  1JRY A;  1DOD A;  4YJG A;  1FEA A;  3RNM A;  3M13 A;  1NG4 A;  1XPQ A;  2ZZB A;  4J36 A;  4I58 A;  3UCL A;  1H81 A;  3SM8 A;  3KPF A;  2OA1 A;  3GWD A;  4H2R A;  3I6D A;  4H2N A;  4J34 A;  3CPI G;  4TM0 A;  3ALL A;  1BGN A;  3UTF A;  3GDN A;  3AE7 A;  2OLN A;  2E5V A;  1W4X A;  3GYI A;  1TYP A;  3NNE A;  4EQR A;  3K7T A;  4EQX A;  3AEC A;  1QO8 A;  1JRZ A;  5C3J A;  1V59 A;  2CFY A;  3VRB A;  1DOB A;  2BYB A;  2GMH A;  4IVM B;  1COY A;  1AOG A;  2YG3 A;  1Q1R A;  3W4I A;  1E1M A;  4CNJ A;  2GR2 A;  4X9N A;  1LTX R;  1F8R A;  3AE3 A;  2BXR A;  2E1M A;  3B3R A;  3DH9 A;  4RG3 A;  2EQ8 A;  2BK5 A;  2C66 A;  2WU2 A;  2FBW A;  3QFB A;  3KLJ A;  3CTY A;  5FS8 A;  2DKH A;  3P9U A;  4N9X A;  4B68 A;  3II4 A;  1CJ4 A;  4H2Q A;  1N4V A;  4AT2 A;  1LQU A;  2Y6Q A;  4Y4N A;  3T37 A;  1PN0 A;  4CCR A;  1N4W A;  4AOS A;  5JCK A;  2YVJ A;  2IVE A;  1DJN A;  4C77 A;  3NYE A;  3CIR A;  3GRS A;  3BHK A;  4CRT A;  1KIF A;  3ITJ A;  5FS9 A;  1CL0 A;  5DBJ A;  1IUV A;  1LV0 A;  2V5Z A;  4TM3 A;  3VRA A;  4DNA A;  1Z6L A;  1ZMD A;  2BAC A;  2V3B A;  2ZZC A;  1B5Q A;  2WQY A;  3CGD A;  3AEF A;  2C64 A;  5CKU A;  3ABV A;  1ZMC A;  3FPZ A;  2RGO A;  5EB5 A;  4UDQ A;  3AE1 A;  3NK0 X;  4A6N B;  2W0H A;  4B67 A;  1N4U A;  4E0V A;  2JBV A;  1TDK A;  3DJE A;  2Q6U A;  2GEW A;  5HYM A;  4H4Z A;  3H8I A;  2AQJ A;  3QFA A;  2YG6 A;  2YLS A;  3OC4 A;  3QSM A;  1CC2 A;  2XLS A;  2BA9 A;  1D4C A;  3AYJ A;  3CNP A;  4NZH A;  2C73 A;  1IUS A;  4B63 A;  3CGE A;  4H4Q A;  3UTE A;  3UTH A;  1PBD A;  1ONF A;  1YQ4 A;  3F8D A;  3LJP A;  1PJ6 A;  3IF9 A;  4A99 A;  3P4Q A;  1L9C A;  2VRM A;  2XFN A;  5J60 A;  2GQW A;  4YJF A;  2YLT A;  3AE5 A;  3DK9 A;  3G5S A;  4FX9 A;  5TR3 A;  2C76 A;  2R45 A;  1GSN A;  1VG9 A;  1K0L A;  1MO9 A;  3H4K A;  3DJD A;  3PS9 A;  1P2H A;  2GF3 A;  1E39 A;  2A87 A;  2BK4 A;  2C72 A;  1CBO A;  4H50 A;  1MXT A;  3DME A;  4XWZ A;  1ZDL A;  3NT6 A;  2YG4 A;  2XDO A;  4AT0 A;  2VVM A;  1C0K A;  3QSE A;  2YR4 A;  2ARD A;  4YJF B;  2GQF A;  1NHR A;  1LPF A;  5U25 A;  4K8D A;  4YJD A;  3DK8 A;  1KDG A;  5GSN A;  1F6M A;  4H4U A;  2VVL G;  1CJ2 A;  4WX1 A;  2XFO A;  2NPX A;  2WET A;  3NRN A;  3IC9 A;  4AOX A;  3AEB A;  2R0G A;  2Y6R A;  1M64 A;  1H84 A;  4U8L A;  4YWO A;  1KNR A;  3WE0 A;  2WP6 A;  5BUK A;  2GAG B;  4ICY A;  4LU6 A;  5M10 A;  4NTE A;  3UOX A;  1QJD A;  4CY6 A;  4NTC A;  1Q9I A;  2JKC A;  4OPT A;  4X4J A;  1L0V A;  1JRX A;  1ZY8 A;  4Y4M A;  1PJ7 A;  2WDR A;  3GD3 A;  3GYJ A;  4OPC A;  3IWA A;  3P4R A;  2O9Z A;  4O5Q A;  4DSH A;  2FJE A;  2EQ9 A;  1KNP A;  3C96 A;  1ZOY A;  1ZKQ A;  2V3A A;  4PAA A;  3BNU A;  4TM1 A;  5KVI A;  2BXS A;  1K4Q A;  4EQW A;  1YY5 A;  2CVJ A;  2JB3 A;  5HHF A;  4D03 A;  2JK6 A;  2WP5 A;  4IA5 A;  4BK1 A;  3RED A;  3M0O A;  2AR8 A;  4B66 A;  5EOW A;  3P4S A;  1XHC A;  4CBQ A;  1O94 A;  2YG7 A;  4X9M A;  2GRT A;  4TM4 A;  4EIQ A;  5HY5 A;  3PO7 A;  4UDP A;  1Y56 B;  2HQM A;  2YLX A;  3SFE A;  2R0P A;  3AWI A;  1JU2 A;  3EF6 A;  1GXF A;  3GSI A;  1XAN A;  3CNT A;  4EMI A;  5BUL A;  1REO A;  1GRG A;  4C3X A;  2RGJ A;  1O95 A;  1N1P A;  3Q6J A;  4PAB A;  1L9D A;  1TDF A;  4YJG B;  2VVL A;  2YM1 A;  1GRT A;  3AD8 B;  3BHF A;  1LJ1 A;  3UKL A;  1VDC A;  4QFC A;  2BCP A;  3P4P A;  3OZ2 A;  3ATR A;  3FMW A;  3GRT A;  3NK1 X;  4C74 A;  2EQ6 A;  4OPD A;  4U2L A;  1ELI A;  2GB0 A;  3UKA A;  2PHH A;  2GR1 A;  2JB1 A;  1JNR A;  3LAD A;  4NTD A;  1H86 A;  3UOZ A;  4ZN0 A;  1IUW A;  1PDH A;  3GMC A;  2F5Z A;  4NEV A;  3O0H A;  4TLX A;  3CNJ A;  4ADW A;  1CC6 A;  1GRF A;  1GT8 A;  3V3O A;  1OJD A;  2WPF A;  1YQZ A;  5KOX A;  1ZP0 A;  5KVH A;  3L1R A;  4GCM A;  3NG7 X;  4MJW A;  4YTP A;  1C0L A;  1JEH A;  1Y0P A;  2GH5 A;  2WOW A;  3LXD A;  2V61 A;  2YAU A;  4RG4 A;  4ZCC A;  3UP4 A;  1X31 B;  4BJY A;  3F8P A;  2IID A;  2BS3 A;  4UDR A;  1E7P A;  1BGJ A;  3W4K A;  2FJD A;  2WEU A;  1TDO A;  2WS3 A;  2Z5Y A;  1FCD A;  4YXD A;  3GD4 A;  3ISH A;  3AXB A;  3RHA A;  2JAE A;  3M12 A;  2GAH B;  3SQP A;  5BRT A;  4YSH A;  1D4E A;  1GRH A;  2YG5 A;  4H4Y A;  4BUR A;  3NYC A;  1FEB A;  4H4R A;  2X3N A;  4XWR A;  1KFY A;  2X8H A;  3KD9 A;  2BAB A;  4K5R A;  2EQ7 A;  3ICR A;  4Z43 A;  2C75 A;  4HA6 A;  3AE2 A;  1ZOV A;  4M52 A;  2APG A;  2GVC A;  4DSG A;  1NHQ A;  4U8P A;  4YSZ A;  1OJT A;  3DJJ A;  3NTD A;  1FOH A;  1K0J A;  2GV8 A;  3NTA A;  4DGK A;  1GAL A;  3NH3 X;  3ZNQ A;  1DXL A;  3RP7 A;  4A7A A;  4O5U A;  4BJZ A;  3D8X A;  2H89 A;  2XVH A;  2CUL A;  1D4D A;  1VE9 A;  1JOA A;  3UOV A;  2YWL A;  3CUK A;  3DGH A;  1LQT A;  4OPG A;  1KSU A;  3NHO X;  3RP8 A;  2XVF A;  1MOK A;  2TPR A;  1F8W A;  1DOE A;  3PVC A;  4OVI A;  4K22 A;  3AD7 B;  4K2X A;  2YLZ A;  4H4W A;  1C0I A;  3AD9 B;  1GES A;  2FJB A;  1TYT A;  1QLB A;  3G5R A;  2WPE A;  3AE6 A;  2UZZ A;  1TDN A;  3K7Q X;  3G3E A;  3KA7 A;  2YR5 A;  4K7Z A;  3ZDN A;  3W4J A;  4JNA A;  4IVO B;  4CY8 A;  2WP9 A;  1H7W A;  3UTG A;  4Z26 A;  1ZX9 A;  1DOC A; 
#chains in the Genus database with same CATH topology
 5GRT A;  2BK3 A;  4UP3 A;  4Z24 A;  4EMW A;  3DJG X;  1NG3 A;  3BNM A;  5FS6 A;  2WPC A;  2XLU A;  4CNK A;  2DU8 A;  2WHD A;  2WBA A;  2GMJ A;  1GND A;  3F8R A;  5KWF A;  1O5W A;  3BI2 A;  4KPR A;  5J7X A;  3T2Z A;  2C70 A;  1M6I A;  4A65 A;  4H4V A;  3UKQ A;  2XCG A;  3JSK A;  3P1W A;  4YT0 A;  3GYX A;  5EB4 A;  1K0I A;  4USR A;  3T14 A;  2JB2 A;  4OCG A;  4U2T A;  2YQU A;  2YR6 A;  5JCI A;  5IQ1 A;  2TMD A;  4U8O A;  1PXC A;  2YVG A;  1KSS A;  2XLT A;  4JNQ A;  5FS7 A;  5KXJ A;  3V3N A;  1EL8 A;  4I59 A;  5JCM A;  3S61 A;  1ZK7 A;  5IPY A;  5L46 A;  1TRB A;  4XXG A;  3FBS A;  5JCN A;  2A89 A;  5KMQ A;  4YSY A;  3SZF A;  4NEW A;  1CC4 A;  4OPI A;  2B76 A;  2VQ7 A;  2WU5 A;  3KPK A;  3B6D A;  3LZX A;  4YJH A;  2XFQ A;  3LZW A;  2YVF A;  1PS9 A;  3I3L A;  1NHS A;  1E1N A;  4LA1 A;  1PBB A;  4GF7 A;  2XLR A;  5M0Z A;  4BK2 A;  2BS2 A;  5CQF A;  2E82 A;  3AEE A;  3C4A A;  3IHG A;  2VQB A;  3VR8 A;  3GDP A;  2X8G A;  3NLC A;  4GRT A;  1NPX A;  4EM4 A;  3QVR A;  1PBE A;  2BS4 A;  2YLW A;  4JQ9 A;  4JDR A;  4A79 A;  4YKG A;  1FL2 A;  3QSS A;  2C65 A;  1OJC A;  4Z2R A;  1EL7 A;  2C3D A;  4C5O A;  2WES A;  4J33 A;  4FK1 C;  4GR1 A;  4JN9 A;  4D04 A;  2R46 A;  4IA6 A;  1H6V A;  1CJC A;  3D1C A;  3AE9 A;  3K7M X;  4G6H A;  1JNZ A;  1EVI A;  3NN0 X;  1RYI A;  1F8S A;  4U2S A;  2BCG G;  4LII A;  1VG0 A;  4CCQ A;  4BK3 A;  4YXD A;  1PXA A;  1Q1W A;  1GER A;  4J2W A;  3DA1 A;  4J31 A;  2GR3 A;  1PBF A;  2XVI A;  1DDO A;  3V76 A;  1GOS A;  2OAM A;  5EBK A;  1E6E A;  1GRB A;  4YTN A;  4EIP A;  3R9U A;  2QCU A;  1E1L A;  4U8J A;  3SFD A;  2Q0K A;  4U8N A;  2J3N A;  4H7U A;  4U8I A;  2C7G A;  3AYI A;  3CN8 A;  3ZNP A;  2B9X A;  2V60 A;  3K30 A;  3DGZ A;  4GDE A;  3NN6 X;  4OPU A;  3VR9 A;  2RGH A;  5U1O A;  2VZ2 A;  2CDU A;  3HZL A;  2BC1 A;  3CNS A;  4TLZ A;  3E1T A;  3KVE A;  4B65 A;  1EBD A;  4Z2T A;  3EAO A;  1GET A;  2Q7V A;  2E49 A;  3CND A;  4NNJ A;  3UKF A;  1OJ9 A;  2C67 A;  3IHM A;  3SGL A;  1NDA A;  2H88 A;  2OLO A;  1H7X A;  1GEU A;  4J56 A;  1FEC A;  3AEG A;  3AED A;  1BKW A;  4Z2U A;  4Z25 A;  5IQ4 A;  1D7L A;  1IUX A;  2E4G A;  2ACZ A;  4K5S A;  2B9Y A;  4A6N A;  1RSG A;  3SYI A;  4HB9 A;  5C2T A;  3COX A;  1PHH A;  2QA1 A;  1L9E A;  3ALM A;  4EMJ A;  4A9W A;  2X8C A;  3LOV A;  1SEZ A;  2XVE A;  3T31 A;  1B4V A;  4J57 A;  1H83 A;  2C3C A;  3VRD B;  3LB8 A;  4USQ A;  1DJQ A;  1PJ5 A;  4AP3 A;  3RP6 A;  4U8M A;  3EAN A;  1YKJ A;  3NK2 X;  5ER0 A;  1P2E A;  1UKV G;  4QFD A;  1GRA A;  2BRY A;  1NEN A;  3Q9T A;  4YKF A;  5KMR A;  1LVL A;  3BI4 A;  4REK A;  2V6O A;  1D7Y A;  2WOV A;  2XFU A;  2ZZ0 A;  3NIX A;  4H4S A;  4IV9 A;  3NKS A;  2R0C A;  3URH A;  4EQS A;  3ZYX A;  4U8K A;  2DKI A;  1VQW A;  3EPT A;  3WGT A;  4AP1 A;  1OJA A;  2ZBW A;  3QVP A;  3FIM B;  3T2Y A;  4GUV A;  2PYX A;  5JCL A;  1NEK A;  2A8X A;  4JY3 A;  2WOI A;  3QJ4 A;  1VRQ B;  4OPL A;  4EM3 A;  3ICS A;  1XDI A;  1EL5 A;  1NAA A;  2R9Z A;  3AE4 A;  3ATQ A;  2GR0 A;  3DK4 A;  3UKH A;  3ZNO A;  4BV6 A;  3GWF A;  3NYF A;  1GTH A;  1YQ3 A;  4WCT A;  3NGC X;  3CPH G;  2QAE A;  2WDV A;  4ZCD A;  5KOW A;  1CF3 A;  3KKJ A;  4H2P A;  3UP5 A;  3ADA B;  1B37 A;  4H4X A;  5LV9 A;  1KF6 A;  1DNC A;  1PBC A;  3GMB A;  2B9W A;  2OAL A;  1S3E A;  4B69 A;  2VOU A;  2YLR A;  1TDE A;  3CPJ G;  3VQR A;  4GDP A;  2IVD A;  1AN9 A;  3AYL A;  1F3P A;  5HXI A;  2VRL A;  1BF3 A;  2WDQ A;  1C0P A;  2BC0 A;  2B7R A;  1S3B A;  3AB1 A;  3AE8 A;  4Z44 A;  3UKK A;  4KX6 A;  1EL9 A;  1IJH A;  2RAB A;  5U63 A;  2I0Z A;  1HYU A;  4ECH A;  2XLP A;  3FG2 P;  1GPE A;  1BWC A;  1PXB A;  2BRA A;  5KRQ A;  1IUT A;  2YM2 A;  3UKP A;  1GV4 A;  1DAO A;  2Q0L A;  3ALJ A;  1RP0 A;  5FMH A;  2B7S A;  3AEA A;  4YTM A;  2E4A A;  1NHP A;  3UOY A;  4Y4L A;  1S2Y A;  1CHU A;  2Z5X A;  1IUU A;  2X50 A;  1E1K A;  3ZNN A;  2R4E A;  4JY2 A;  3CGB A;  2NVK X;  3H8L A;  3CGC A;  3C4N A;  4H4P A;  1GRE A;  1H82 A;  2XVJ A;  1D5T A;  4P9S A;  3BI5 A;  4APN A;  2XFP A;  2AAQ A;  2XYO A;  4YJH B;  1GTE A;  1CJ3 A;  4B64 A;  4H4T A;  3ICT A;  1BZL A;  1Y56 A;  1B8S A;  4C3Y A;  4A5L A;  5BVA A;  3G5Q A;  4FK1 A;  2FJA A;  4RSL A;  4FDC B;  5KMS A;  2QA2 A;  4B1B A;  1S2Q A;  4YSX A;  2E48 A;  2X99 A;  3HYV A;  3L8K A;  3KU9 A;  2R4J A;  3S5W A;  1JRY A;  1DOD A;  4YJG A;  1FEA A;  3RNM A;  3M13 A;  1NG4 A;  1XPQ A;  2ZZB A;  4J36 A;  4I58 A;  3UCL A;  1H81 A;  3SM8 A;  4H2R A;  2OA1 A;  3GWD A;  3KPF A;  3I6D A;  4H2N A;  4J34 A;  3CPI G;  4TM0 A;  3ALL A;  1BGN A;  3UTF A;  3GDN A;  3AE7 A;  2OLN A;  2E5V A;  1W4X A;  3GYI A;  1TYP A;  3NNE A;  4EQR A;  3K7T A;  4EQX A;  3AEC A;  1QO8 A;  1JRZ A;  5C3J A;  1V59 A;  2CFY A;  3VRB A;  1DOB A;  2BYB A;  2GMH A;  4IVM B;  1COY A;  1AOG A;  2YG3 A;  1Q1R A;  3W4I A;  1E1M A;  4CNJ A;  2GR2 A;  4X9N A;  1LTX R;  1F8R A;  3AE3 A;  2BXR A;  2E1M A;  3B3R A;  4G74 A;  3DH9 A;  4RG3 A;  2EQ8 A;  2BK5 A;  2C66 A;  2WU2 A;  2FBW A;  3QFB A;  5KMP A;  3KLJ A;  3CTY A;  5FS8 A;  2DKH A;  3P9U A;  4N9X A;  4B68 A;  4H2Q A;  1CJ4 A;  3II4 A;  1N4V A;  4AT2 A;  1LQU A;  2Y6Q A;  4Y4N A;  3SY4 A;  1PN0 A;  3T37 A;  4CCR A;  1N4W A;  4AOS A;  4G73 A;  2YVJ A;  2IVE A;  1DJN A;  4C77 A;  3NYE A;  3CIR A;  3GRS A;  3BHK A;  4CRT A;  1KIF A;  3ITJ A;  5FS9 A;  1CL0 A;  5DBJ A;  1IUV A;  2C4C A;  1LV0 A;  2V5Z A;  4TM3 A;  3VRA A;  4DNA A;  1Z6L A;  1ZMD A;  2BAC A;  2V3B A;  2ZZC A;  1B5Q A;  2WQY A;  3CGD A;  4II2 A;  3SZC A;  3AEF A;  2C64 A;  5CKU A;  3ABV A;  1ZMC A;  3FPZ A;  2RGO A;  5EB5 A;  4UDQ A;  3AE1 A;  3NK0 X;  4A6N B;  2W0H A;  4B67 A;  1N4U A;  4E0V A;  2JBV A;  1TDK A;  3DJE A;  2Q6U A;  2GEW A;  5HYM A;  4H4Z A;  3H8I A;  2AQJ A;  3QFA A;  2YG6 A;  2YLS A;  3OC4 A;  3QSM A;  1CC2 A;  2XLS A;  2BA9 A;  1D4C A;  3AYJ A;  3CNP A;  4NZH A;  2C73 A;  1IUS A;  4B63 A;  3CGE A;  4H4Q A;  3UTE A;  3UTH A;  1PBD A;  1ONF A;  1YQ4 A;  3F8D A;  3LJP A;  1PJ6 A;  3IF9 A;  4A99 A;  3P4Q A;  1L9C A;  2VRM A;  2XFN A;  5J60 A;  2GQW A;  4YJF A;  2YLT A;  3AE5 A;  3DK9 A;  3G5S A;  4FX9 A;  5TR3 A;  2C76 A;  2R45 A;  1GSN A;  1K0L A;  1MO9 A;  1VG9 A;  3H4K A;  3DJD A;  3PS9 A;  1P2H A;  2GF3 A;  1E39 A;  2A87 A;  2BK4 A;  2C72 A;  1CBO A;  4H50 A;  1MXT A;  3SZ0 A;  3DME A;  4XWZ A;  1ZDL A;  3NT6 A;  2YG4 A;  2XDO A;  3CMM A;  4AT0 A;  2VVM A;  1C0K A;  3QSE A;  2YR4 A;  2ARD A;  4YJF B;  2GQF A;  1NHR A;  1LPF A;  5U25 A;  4K8D A;  4YJD A;  3DK8 A;  1KDG A;  5GSN A;  1F6M A;  4H4U A;  2VVL G;  1CJ2 A;  4WX1 A;  2XFO A;  2NPX A;  2WET A;  3NRN A;  3IC9 A;  3SZW A;  4AOX A;  3AEB A;  2R0G A;  2Y6R A;  1M64 A;  1H84 A;  4U8L A;  4YWO A;  1KNR A;  3WE0 A;  2WP6 A;  5BUK A;  2GAG B;  4ICY A;  4LU6 A;  5M10 A;  4NTE A;  3UOX A;  1QJD A;  4CY6 A;  4NTC A;  1Q9I A;  2JKC A;  4OPT A;  4X4J A;  1L0V A;  1JRX A;  1ZY8 A;  4Y4M A;  4G9K A;  1PJ7 A;  2WDR A;  3GD3 A;  3GYJ A;  4OPC A;  3IWA A;  3P4R A;  2O9Z A;  4O5Q A;  4DSH A;  2FJE A;  2EQ9 A;  3C96 A;  1KNP A;  1ZOY A;  3T0K A;  1ZKQ A;  2V3A A;  4PAA A;  3BNU A;  4TM1 A;  5KVI A;  2BXS A;  1K4Q A;  4EQW A;  1YY5 A;  2CVJ A;  2JB3 A;  5HHF A;  4D03 A;  2JK6 A;  2WP5 A;  4IA5 A;  4BK1 A;  3RED A;  5JCK A;  3M0O A;  2AR8 A;  4B66 A;  5EOW A;  3P4S A;  1XHC A;  4CBQ A;  1O94 A;  4EIQ A;  4X9M A;  2GRT A;  2YG7 A;  4TM4 A;  5HY5 A;  3PO7 A;  4UDP A;  1Y56 B;  2HQM A;  2YLX A;  4G6G A;  3SFE A;  2R0P A;  3AWI A;  1JU2 A;  3EF6 A;  1GXF A;  3GSI A;  1XAN A;  3CNT A;  3SX6 A;  4EMI A;  5BUL A;  1REO A;  1GRG A;  4C3X A;  2RGJ A;  1O95 A;  1N1P A;  3Q6J A;  4PAB A;  1L9D A;  1TDF A;  4YJG B;  2VVL A;  2YM1 A;  1GRT A;  3AD8 B;  3BHF A;  1LJ1 A;  3UKL A;  1VDC A;  4QFC A;  2BCP A;  3P4P A;  3OZ2 A;  3ATR A;  3FMW A;  3GRT A;  3NK1 X;  4C74 A;  2EQ6 A;  4OPD A;  4U2L A;  1ELI A;  2GB0 A;  3UKA A;  2PHH A;  2GR1 A;  4GAP A;  2JB1 A;  1JNR A;  3LAD A;  4NTD A;  1H86 A;  3UOZ A;  4ZN0 A;  1IUW A;  1PDH A;  3GMC A;  2F5Z A;  4NEV A;  3SXI A;  3O0H A;  4TLX A;  3CNJ A;  4ADW A;  1CC6 A;  1GRF A;  1GT8 A;  3V3O A;  1OJD A;  2WPF A;  1YQZ A;  3T2K A;  1ZP0 A;  5KOX A;  3L1R A;  5KVH A;  4GCM A;  3NG7 X;  4MJW A;  4YTP A;  1C0L A;  1JEH A;  1Y0P A;  2GH5 A;  2WOW A;  3LXD A;  2V61 A;  2YAU A;  4RG4 A;  4BJY A;  4ZCC A;  1X31 B;  3UP4 A;  3F8P A;  2IID A;  2BS3 A;  4UDR A;  1E7P A;  1BGJ A;  3W4K A;  2FJD A;  2WEU A;  1TDO A;  2WS3 A;  2Z5Y A;  1FCD A;  4GAV A;  3GD4 A;  3ISH A;  3AXB A;  3RHA A;  2JAE A;  3M12 A;  2GAH B;  3SQP A;  5BRT A;  4YSH A;  1D4E A;  1GRH A;  2YG5 A;  4H4Y A;  4BUR A;  3NYC A;  1FEB A;  4H4R A;  2X3N A;  4XWR A;  1KFY A;  2X8H A;  3KD9 A;  2BAB A;  4K5R A;  2EQ7 A;  3ICR A;  4Z43 A;  2C75 A;  4HA6 A;  3AE2 A;  1ZOV A;  4M52 A;  2APG A;  2GVC A;  4DSG A;  1NHQ A;  4U8P A;  4YSZ A;  1OJT A;  3DJJ A;  3NTD A;  1FOH A;  1K0J A;  2GV8 A;  3NTA A;  4DGK A;  5KNL A;  4NWZ A;  1GAL A;  3NH3 X;  3ZNQ A;  1DXL A;  3RP7 A;  4A7A A;  4O5U A;  4BJZ A;  3D8X A;  2H89 A;  2XVH A;  2CUL A;  1D4D A;  1VE9 A;  1JOA A;  3UOV A;  3HYX A;  2YWL A;  3CUK A;  3DGH A;  1LQT A;  4OPG A;  1KSU A;  3NHO X;  3RP8 A;  2XVF A;  1MOK A;  2TPR A;  1F8W A;  1DOE A;  3PVC A;  4OVI A;  4K22 A;  3AD7 B;  4K2X A;  2YLZ A;  4H4W A;  4II3 A;  1C0I A;  3AD9 B;  1GES A;  2FJB A;  1TYT A;  1QLB A;  3G5R A;  2WPE A;  3HYW A;  3AE6 A;  2UZZ A;  1TDN A;  3K7Q X;  3G3E A;  3KA7 A;  2YR5 A;  4K7Z A;  3ZDN A;  3W4J A;  4JNA A;  4IVO B;  4CY8 A;  2WP9 A;  1H7W A;  3UTG A;  4Z26 A;  1ZX9 A;  1DOC A; 
#chains in the Genus database with same CATH homology
 5GRT A;  2BK3 A;  4UP3 A;  4Z24 A;  4EMW A;  3DJG X;  1NG3 A;  3BNM A;  5FS6 A;  2WPC A;  2XLU A;  4CNK A;  2DU8 A;  2WHD A;  2WBA A;  1GND A;  2GMJ A;  3F8R A;  5KWF A;  1O5W A;  3BI2 A;  4KPR A;  5J7X A;  3T2Z A;  2C70 A;  1M6I A;  4A65 A;  4H4V A;  3UKQ A;  2XCG A;  3JSK A;  3P1W A;  4YT0 A;  3GYX A;  5EB4 A;  1K0I A;  4USR A;  3T14 A;  2JB2 A;  4OCG A;  4U2T A;  2YQU A;  2YR6 A;  5JCI A;  5IQ1 A;  2TMD A;  4U8O A;  1PXC A;  2YVG A;  1KSS A;  2XLT A;  4JNQ A;  5FS7 A;  5KXJ A;  3V3N A;  1EL8 A;  4I59 A;  5JCM A;  3S61 A;  1ZK7 A;  5IPY A;  5L46 A;  1TRB A;  4XXG A;  3FBS A;  5JCN A;  2A89 A;  5KMQ A;  4YSY A;  3SZF A;  4NEW A;  1CC4 A;  4OPI A;  2B76 A;  2VQ7 A;  2WU5 A;  3KPK A;  3B6D A;  3LZX A;  4YJH A;  2XFQ A;  3LZW A;  2YVF A;  1PS9 A;  3I3L A;  1NHS A;  1E1N A;  4LA1 A;  1PBB A;  4GF7 A;  2XLR A;  5M0Z A;  4BK2 A;  2BS2 A;  5CQF A;  2E82 A;  3AEE A;  2VQB A;  3C4A A;  3IHG A;  3VR8 A;  3GDP A;  2X8G A;  3NLC A;  4GRT A;  1NPX A;  4EM4 A;  3QVR A;  1PBE A;  2BS4 A;  2YLW A;  4JQ9 A;  4JDR A;  4A79 A;  4YKG A;  1FL2 A;  3QSS A;  2C65 A;  1OJC A;  4Z2R A;  1EL7 A;  2C3D A;  4C5O A;  2WES A;  4J33 A;  4FK1 C;  4GR1 A;  4JN9 A;  4D04 A;  2R46 A;  4IA6 A;  1H6V A;  1CJC A;  3D1C A;  3AE9 A;  3K7M X;  4G6H A;  1JNZ A;  1EVI A;  3NN0 X;  1RYI A;  1F8S A;  4U2S A;  2BCG G;  4LII A;  1VG0 A;  4CCQ A;  4BK3 A;  4YXD A;  1PXA A;  1Q1W A;  1GER A;  4J2W A;  3DA1 A;  4J31 A;  2GR3 A;  1PBF A;  2XVI A;  1DDO A;  3V76 A;  1GOS A;  2OAM A;  5EBK A;  1E6E A;  1GRB A;  4YTN A;  4EIP A;  3R9U A;  2QCU A;  1E1L A;  4U8J A;  3SFD A;  2Q0K A;  4U8N A;  2J3N A;  4H7U A;  4U8I A;  2C7G A;  3AYI A;  3CN8 A;  3ZNP A;  2B9X A;  2V60 A;  3K30 A;  3DGZ A;  4GDE A;  3NN6 X;  4OPU A;  3VR9 A;  2RGH A;  5U1O A;  2VZ2 A;  2CDU A;  3HZL A;  2BC1 A;  3CNS A;  4TLZ A;  3E1T A;  3KVE A;  4B65 A;  1EBD A;  4Z2T A;  3EAO A;  1GET A;  2Q7V A;  2E49 A;  3CND A;  4NNJ A;  3UKF A;  1OJ9 A;  2C67 A;  3SGL A;  1NDA A;  3IHM A;  2H88 A;  2OLO A;  1H7X A;  1GEU A;  4J56 A;  1FEC A;  3AEG A;  3AED A;  1BKW A;  4Z2U A;  4Z25 A;  5IQ4 A;  1D7L A;  1IUX A;  2E4G A;  2ACZ A;  4K5S A;  2B9Y A;  4A6N A;  1RSG A;  3SYI A;  4HB9 A;  5C2T A;  3COX A;  1PHH A;  2QA1 A;  1L9E A;  3ALM A;  4EMJ A;  4A9W A;  2X8C A;  3LOV A;  1SEZ A;  2XVE A;  3T31 A;  1B4V A;  4J57 A;  1H83 A;  2C3C A;  3VRD B;  3LB8 A;  4USQ A;  1DJQ A;  1PJ5 A;  4AP3 A;  3RP6 A;  4U8M A;  3EAN A;  1YKJ A;  3NK2 X;  5ER0 A;  1P2E A;  1UKV G;  4QFD A;  1GRA A;  2BRY A;  1NEN A;  3Q9T A;  4YKF A;  5KMR A;  1LVL A;  3BI4 A;  4REK A;  2V6O A;  1D7Y A;  2WOV A;  2XFU A;  2ZZ0 A;  3NIX A;  4H4S A;  4IV9 A;  3NKS A;  2R0C A;  3URH A;  4EQS A;  3ZYX A;  4U8K A;  1VQW A;  2DKI A;  3EPT A;  3WGT A;  4AP1 A;  1OJA A;  2ZBW A;  3QVP A;  3FIM B;  3T2Y A;  4GUV A;  2PYX A;  5JCL A;  1NEK A;  2A8X A;  3QJ4 A;  2WOI A;  4JY3 A;  1VRQ B;  4OPL A;  4EM3 A;  3ICS A;  1XDI A;  1EL5 A;  1NAA A;  2R9Z A;  3AE4 A;  3ATQ A;  2GR0 A;  3DK4 A;  3UKH A;  3ZNO A;  4BV6 A;  3GWF A;  3NYF A;  1GTH A;  1YQ3 A;  4WCT A;  3NGC X;  3CPH G;  2QAE A;  2WDV A;  4ZCD A;  5KOW A;  1CF3 A;  3KKJ A;  4H2P A;  3UP5 A;  3ADA B;  1B37 A;  4H4X A;  5LV9 A;  1KF6 A;  1DNC A;  1PBC A;  2OAL A;  2B9W A;  3GMB A;  1S3E A;  4B69 A;  2VOU A;  2YLR A;  1TDE A;  3CPJ G;  3VQR A;  4GDP A;  2IVD A;  1AN9 A;  3AYL A;  1F3P A;  5HXI A;  2VRL A;  1BF3 A;  2WDQ A;  1C0P A;  2BC0 A;  2B7R A;  1S3B A;  3AB1 A;  3AE8 A;  4Z44 A;  3UKK A;  4KX6 A;  1EL9 A;  1IJH A;  2RAB A;  5U63 A;  2I0Z A;  1HYU A;  4ECH A;  2XLP A;  3FG2 P;  1GPE A;  1BWC A;  1PXB A;  2BRA A;  5KRQ A;  1IUT A;  2YM2 A;  3UKP A;  1GV4 A;  1DAO A;  2Q0L A;  3ALJ A;  1RP0 A;  5FMH A;  2B7S A;  3AEA A;  4YTM A;  2E4A A;  1NHP A;  3UOY A;  4Y4L A;  1S2Y A;  1CHU A;  2Z5X A;  1IUU A;  2X50 A;  1E1K A;  3ZNN A;  2R4E A;  3CGB A;  3H8L A;  2NVK X;  4JY2 A;  3CGC A;  3C4N A;  4H4P A;  1GRE A;  1H82 A;  2XVJ A;  1D5T A;  4P9S A;  3BI5 A;  4APN A;  2XFP A;  2AAQ A;  2XYO A;  4YJH B;  1GTE A;  1CJ3 A;  4B64 A;  4H4T A;  3ICT A;  1BZL A;  1Y56 A;  1B8S A;  4C3Y A;  4A5L A;  5BVA A;  3G5Q A;  4FK1 A;  2FJA A;  4RSL A;  4FDC B;  5KMS A;  2QA2 A;  4B1B A;  1S2Q A;  4YSX A;  2E48 A;  2X99 A;  3HYV A;  3L8K A;  3KU9 A;  2R4J A;  3S5W A;  1JRY A;  1DOD A;  4YJG A;  1FEA A;  3RNM A;  3M13 A;  1NG4 A;  1XPQ A;  2ZZB A;  4J36 A;  4I58 A;  3UCL A;  1H81 A;  3SM8 A;  3KPF A;  2OA1 A;  3GWD A;  4H2R A;  3I6D A;  4H2N A;  4J34 A;  3CPI G;  4TM0 A;  3ALL A;  1BGN A;  3UTF A;  3GDN A;  3AE7 A;  2OLN A;  2E5V A;  1W4X A;  3GYI A;  1TYP A;  3NNE A;  4EQR A;  3K7T A;  4EQX A;  3AEC A;  1QO8 A;  1JRZ A;  5C3J A;  1V59 A;  2CFY A;  3VRB A;  1DOB A;  2BYB A;  2GMH A;  4IVM B;  1COY A;  1AOG A;  2YG3 A;  1Q1R A;  3W4I A;  1E1M A;  4CNJ A;  2GR2 A;  4X9N A;  1LTX R;  1F8R A;  3AE3 A;  2BXR A;  2E1M A;  3B3R A;  4G74 A;  3DH9 A;  4RG3 A;  2EQ8 A;  2BK5 A;  2C66 A;  2WU2 A;  2FBW A;  3QFB A;  5KMP A;  3KLJ A;  3CTY A;  5FS8 A;  2DKH A;  3P9U A;  4N9X A;  4B68 A;  3II4 A;  1CJ4 A;  4H2Q A;  1N4V A;  4AT2 A;  1LQU A;  2Y6Q A;  4Y4N A;  3SY4 A;  1PN0 A;  3T37 A;  4CCR A;  1N4W A;  4AOS A;  4G73 A;  2YVJ A;  2IVE A;  1DJN A;  4C77 A;  3NYE A;  3CIR A;  3GRS A;  3BHK A;  4CRT A;  1KIF A;  3ITJ A;  5FS9 A;  1CL0 A;  5DBJ A;  1IUV A;  2C4C A;  1LV0 A;  2V5Z A;  4TM3 A;  3VRA A;  4DNA A;  1Z6L A;  1ZMD A;  2BAC A;  2V3B A;  2ZZC A;  1B5Q A;  2WQY A;  3CGD A;  4II2 A;  3SZC A;  3AEF A;  2C64 A;  5CKU A;  3ABV A;  1ZMC A;  3FPZ A;  2RGO A;  5EB5 A;  4UDQ A;  3AE1 A;  3NK0 X;  4A6N B;  2W0H A;  4B67 A;  1N4U A;  4E0V A;  2JBV A;  1TDK A;  3DJE A;  2Q6U A;  2GEW A;  5HYM A;  4H4Z A;  3H8I A;  2AQJ A;  3QFA A;  2YG6 A;  2YLS A;  3OC4 A;  3QSM A;  1CC2 A;  2XLS A;  2BA9 A;  1D4C A;  3AYJ A;  3CNP A;  4NZH A;  2C73 A;  1IUS A;  4B63 A;  3CGE A;  4H4Q A;  3UTE A;  3UTH A;  1PBD A;  1ONF A;  1YQ4 A;  3F8D A;  3LJP A;  1PJ6 A;  3IF9 A;  4A99 A;  3P4Q A;  1L9C A;  2VRM A;  2XFN A;  5J60 A;  2GQW A;  4YJF A;  2YLT A;  3AE5 A;  3DK9 A;  3G5S A;  4FX9 A;  5TR3 A;  2C76 A;  2R45 A;  1GSN A;  1VG9 A;  1K0L A;  1MO9 A;  3H4K A;  3DJD A;  3PS9 A;  1P2H A;  2GF3 A;  1E39 A;  2A87 A;  2BK4 A;  2C72 A;  1CBO A;  4H50 A;  1MXT A;  3SZ0 A;  3DME A;  4XWZ A;  1ZDL A;  3NT6 A;  2YG4 A;  2XDO A;  3CMM A;  4AT0 A;  2VVM A;  1C0K A;  3QSE A;  2YR4 A;  2ARD A;  4YJF B;  2GQF A;  1NHR A;  1LPF A;  5U25 A;  4K8D A;  4YJD A;  3DK8 A;  1KDG A;  5GSN A;  1F6M A;  4H4U A;  2VVL G;  1CJ2 A;  4WX1 A;  2XFO A;  2NPX A;  2WET A;  3NRN A;  3IC9 A;  3SZW A;  4AOX A;  3AEB A;  2R0G A;  2Y6R A;  1M64 A;  1H84 A;  4U8L A;  4YWO A;  1KNR A;  3WE0 A;  2WP6 A;  5BUK A;  2GAG B;  4ICY A;  4LU6 A;  5M10 A;  4NTE A;  3UOX A;  1QJD A;  4CY6 A;  4NTC A;  1Q9I A;  2JKC A;  4OPT A;  4X4J A;  1L0V A;  1JRX A;  1ZY8 A;  4Y4M A;  4G9K A;  1PJ7 A;  2WDR A;  3GD3 A;  3GYJ A;  4OPC A;  3IWA A;  3P4R A;  2O9Z A;  4O5Q A;  4DSH A;  2FJE A;  2EQ9 A;  1KNP A;  3C96 A;  1ZOY A;  3T0K A;  1ZKQ A;  2V3A A;  4PAA A;  3BNU A;  4TM1 A;  5KVI A;  2BXS A;  1K4Q A;  4EQW A;  1YY5 A;  2CVJ A;  2JB3 A;  5HHF A;  4D03 A;  2JK6 A;  2WP5 A;  4IA5 A;  4BK1 A;  3RED A;  5JCK A;  3M0O A;  2AR8 A;  4B66 A;  5EOW A;  3P4S A;  1XHC A;  4CBQ A;  1O94 A;  2YG7 A;  4X9M A;  2GRT A;  4TM4 A;  4EIQ A;  5HY5 A;  3PO7 A;  4UDP A;  1Y56 B;  2HQM A;  2YLX A;  4G6G A;  3SFE A;  2R0P A;  3AWI A;  1JU2 A;  3EF6 A;  1GXF A;  3GSI A;  1XAN A;  3CNT A;  3SX6 A;  4EMI A;  5BUL A;  1REO A;  1GRG A;  4C3X A;  2RGJ A;  1O95 A;  1N1P A;  3Q6J A;  4PAB A;  1L9D A;  1TDF A;  4YJG B;  2VVL A;  2YM1 A;  1GRT A;  3AD8 B;  3BHF A;  1LJ1 A;  3UKL A;  1VDC A;  4QFC A;  2BCP A;  3P4P A;  3OZ2 A;  3ATR A;  3FMW A;  3GRT A;  3NK1 X;  4C74 A;  2EQ6 A;  4OPD A;  4U2L A;  1ELI A;  2GB0 A;  3UKA A;  2PHH A;  2GR1 A;  4GAP A;  2JB1 A;  1JNR A;  3LAD A;  4NTD A;  1H86 A;  3UOZ A;  4ZN0 A;  1IUW A;  1PDH A;  3GMC A;  2F5Z A;  4NEV A;  3SXI A;  3O0H A;  4TLX A;  3CNJ A;  4ADW A;  1CC6 A;  1GRF A;  1GT8 A;  3V3O A;  1OJD A;  2WPF A;  1YQZ A;  3T2K A;  1ZP0 A;  5KOX A;  3L1R A;  5KVH A;  4GCM A;  3NG7 X;  4MJW A;  4YTP A;  1C0L A;  1JEH A;  1Y0P A;  2GH5 A;  2WOW A;  3LXD A;  2V61 A;  2YAU A;  4RG4 A;  4ZCC A;  3UP4 A;  1X31 B;  4BJY A;  3F8P A;  2IID A;  2BS3 A;  4UDR A;  1E7P A;  1BGJ A;  3W4K A;  2FJD A;  2WEU A;  1TDO A;  2WS3 A;  2Z5Y A;  1FCD A;  4GAV A;  3GD4 A;  3ISH A;  3AXB A;  3RHA A;  2JAE A;  3M12 A;  2GAH B;  3SQP A;  5BRT A;  4YSH A;  1D4E A;  1GRH A;  2YG5 A;  4H4Y A;  4BUR A;  3NYC A;  1FEB A;  4H4R A;  2X3N A;  4XWR A;  1KFY A;  2X8H A;  3KD9 A;  2BAB A;  4K5R A;  2EQ7 A;  3ICR A;  4Z43 A;  2C75 A;  4HA6 A;  3AE2 A;  1ZOV A;  4M52 A;  2APG A;  2GVC A;  4DSG A;  1NHQ A;  4U8P A;  4YSZ A;  1OJT A;  3DJJ A;  3NTD A;  1FOH A;  1K0J A;  2GV8 A;  3NTA A;  4DGK A;  5KNL A;  4NWZ A;  1GAL A;  3NH3 X;  3ZNQ A;  1DXL A;  3RP7 A;  4A7A A;  4O5U A;  4BJZ A;  3D8X A;  2H89 A;  2XVH A;  2CUL A;  1D4D A;  1VE9 A;  1JOA A;  3UOV A;  3HYX A;  2YWL A;  3CUK A;  3DGH A;  1LQT A;  4OPG A;  1KSU A;  3NHO X;  3RP8 A;  2XVF A;  1MOK A;  2TPR A;  1F8W A;  1DOE A;  3PVC A;  4OVI A;  4K22 A;  3AD7 B;  4K2X A;  2YLZ A;  4H4W A;  4II3 A;  1C0I A;  3AD9 B;  1GES A;  2FJB A;  1TYT A;  1QLB A;  3G5R A;  2WPE A;  3HYW A;  3AE6 A;  2UZZ A;  1TDN A;  3K7Q X;  3G3E A;  3KA7 A;  2YR5 A;  4K7Z A;  3ZDN A;  3W4J A;  4JNA A;  4IVO B;  4CY8 A;  2WP9 A;  1H7W A;  3UTG A;  4Z26 A;  1ZX9 A;  1DOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...