3NYCA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords D-Arginine Dehydrogenase
total genus 126
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nycA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nycA01
4JNAA 4AT2A 3GSIA 3DJJA 2RGJA 3LZWA 2XVHA 4OPTA 5GRTA 4YTPA 2ZZ0A 2V61A 3ITJA 4D04A 1D7LA 3AE8A 1E1KA 1GREA 3EF6A 1C0IA 2RABA 3F8PA 3ZDNA 4ZN0A 4A5LA 3IF9A 4NEVA 4A6NA 1JRXA 4YJDA 4UDQA 2Q0LA 2WOIA 1CF3A 4QFCA 4BJZA 2GV8A 3UOVA 1K4QA 3WGTA 2B7SA 1TDOA 1KSSA 3GD4A 3S5WA 2DKHA 3V3OA 3GMBA 2VRLA 1GV4A 5FS9A 2QAEA 3AXBA 2WOWA 4U8NA 5CKUA 4H4QA 2WESA 3Q9TA 4O5UA 3PO7A 4JY3A 5EBKA 3DMEA 4Z2UA 2C65A 1JRYA 1KNPA 1PXAA 1GRTA 3KD9A 4JDRA 3GYIA 3Q6JA 3I6DA 1UKVG 3NN6X 3DH9A 3BI2A 1S3BA 3VQRA 5GSNA 3DK8A 4BJYA 3FMWA 3ALJA 2PYXA 2I0ZA 4TM3A 1E1LA 1FECA 2JB2A 4Z2RA 2B76A 4H4ZA 1LVLA 3JSKA 5J7XA 2V3BA 4GDEA 1L0VA 4D03A 3RP6A 4Y4LA 3QSMA 4GR1A 4OPUA 1GTHA 2C67A 3AE9A 5EB4A 1YY5A 2WDVA 4U2LA 1H86A 1P2HA 1TYPA 1GPEA 2AR8A 1PBEA 1NENA 3NRNA 2IVEA 3COXA 1M64A 3AD9B 2XLSA 3AEBA 1CJ2A 1D5TA 2YG6A 3ZNPA 2YLSA 2DU8A 4CY8A 1D7YA 2W0HA 4B66A 1B5QA 4J36A 4DNAA 3W4KA 3NIXA 4IVMB 4I58A 1GERA 2FJDA 3OC4A 4YSYA 3CGDA 5JCIA 3HZLA 3AE7A 4FK1C 3UKQA 3VRBA 4BK1A 3CGEA 3PS9A 5JCLA 1DXLA 1JU2A 4GF7A 3CNDA 1QJDA 3VRDB 1XPQA 1YQZA 2WETA 3NLCA 4U2TA 1CC4A 2AQJA 4RSLA 2VZ2A 3AYIA 1TRBA 4O5QA 4CCQA 1GOSA 1KFYA 1EBDA 4TM4A 4XXGA 4OPCA 2CULA 2YVJA 4B64A 3BHKA 4B65A 2WPFA 1JRZA 2XFQA 1NG4A 1K0IA 1E1MA 1TDEA 3AE4A 2VOUA 3E1TA 4UDPA 4YKGA 2EQ7A 2OALA 4A65A 2TPRA 2VVLA 4N9XA 2WOVA 5KVHA 1FEAA 2YR4A 2V60A 2R0PA 4FK1A 1LTXR 3LOVA 3IHGA 3QJ4A 2Q0KA 3LXDA 4K5RA 2GEWA 2BACA 2BS4A 3KLJA 1NG3A 3KVEA 3G5SA 5ER0A 4EMIA 3AE3A 4NTCA 1LV0A 3UCLA 5KRQA 3UTEA 1DJQA 2VRMA 4YSHA 2QCUA 3IWAA 3L1RA 2C70A 2E1MA 2YLZA 3NK0X 1C0LA 1RYIA 1OJTA 2X8CA 2XDOA 3BHFA 3II4A 3ALLA 1DODA 4H4YA 5U25A 1BZLA 3KKJA 2EQ6A 2WHDA 4C3YA 2YLXA 1L9EA 3BI5A 1JNRA 2NVKX 4H2PA 4K8DA 2IVDA 2WS3A 1MO9A 1ZP0A 3IC9A 4IVOB 4CY6A 1BF3A 4ECHA 1E6EA 2F5ZA 1FCDA 2WQYA 3NYEA 1Q1WA 4OPIA 3DJDA 3G5RA 3VR9A 2GQWA 1YKJA 2BABA 3LZXA 1GSNA 3QFAA 4YJFB 4B69A 3GMCA 5JCMA 2JB3A 3NTDA 3CUKA 1GRGA 1BGJA 2B9YA 3ICSA 2VQ7A 2FBWA 2DKIA 3AE2A 2WP9A 3ATRA 1F8WA 4IA6A 3P4QA 3VRAA 2A8XA 2GVCA 1NDAA 3ATQA 3QVPA 4H50A 4A7AA 4EIQA 4U8LA 1IJHA 2Q6UA 1XDIA 1DOBA 4Y4MA 2YQUA 3ZNQA 2FJEA 1PHHA 5BRTA 3CGCA 4U8JA 2E48A 2GR1A 2B9WA 2BYBA 2YLTA 1GALA 5BUKA 3QSSA 4X9NA 3DGHA 1EL5A 3GD3A 1PBCA 1TDNA 1SEZA 1PBFA 2JBVA 3AYLA 3CNPA 1L9DA 2YG3A 3G5QA 3M12A 1B4VA 3AD8B 1RP0A 2Q7VA 1O94A 3UTGA 5C3JA 1DDOA 3DA1A 1V59A 3URHA 3UTHA 3CN8A 1LJ1A 3G3EA 1ONFA 4H7UA 3GWFA 3BNMA 1O95A 2C72A 2OA1A 4H4WA 1BKWA 2RGHA 3AD7B 1VRQB 1TDFA 2WU2A 1ZX9A 2A89A 3AYJA 4U8KA 3T37A 2BC1A 2A87A 1IUTA 5KOWA 3DJEA 3UKPA 4EQXA 3GRTA 4YJHB 1H82A 4B1BA 1GT8A 2WEUA 2H89A 4REKA 4BK3A 2XVIA 3NH3X 5EOWA 1S3EA 2XLTA 2YR6A 3CPIG 1EL9A 3M13A 2XVJA 1NHQA 1IUUA 3RNMA 1M6IA 4QFDA 3B3RA 1N4UA 4ZCDA 1XHCA 2C76A 4FX9A 3P4PA 3UP5A 4ZCCA 1CBOA 4GRTA 3K7TA 5M0ZA 4A9WA 3RHAA 4Z44A 1GTEA 2GMHA 3CNJA 2BK4A 1P2EA 1H84A 2B7RA 1B37A 2C3CA 3NK1X 3K7QX 2GAHB 4YTMA 1NHRA 1VG0A 4K2XA 4EQSA 3AEAA 1TDKA 3QSEA 1OJ9A 2Z5XA 3LB8A 4U8PA 1NPXA 3AE1A 4ICYA 2XLRA 3NYFA 3AEEA 3LJPA 3NNEA 1ELIA 1KNRA 2ZZBA 4YJFA 1GRHA 1LQTA 1NAAA 2XLUA 4NTEA 1NHPA 4H4TA 1COYA 1F8RA 2JAEA 2WP6A 1OJDA 1VDCA 4CNKA 4LIIA 1F8SA 1JOAA 2BS2A 2APGA 2HQMA 1IUSA 2V5ZA 3K7MX 3AECA 2OLOA 2YR5A 3F8RA 2VVLG 1NEKA 3NN0X 2WPEA 3NT6A 5HHFA 3GYJA 1YQ4A 2UZZA 4TM0A 4H4UA 4WCTA 1GRAA 2YLRA 2IIDA 5BVAA 1C0PA 1IUWA 3FBSA 1GNDA 1MOKA 4KPRA 4DSHA 2E49A 1PXBA 1CC2A 4H4PA 1H83A 5J60A 1PN0A 4M52A 4YJGA 1BWCA 3ALMA 5JCKA 4PAAA 3AEGA 1Y0PA 3SGLA 3SM8A 1Y56B 1JNZA 4EM3A 3OZ2A 1LPFA 3UKLA 1ZY8A 4JN9A 4JNQA 5DBJA 3SFDA 1CHUA 1QO8A 1ZOVA 3NG7X 3AE6A 4KX6A 2WP5A 3NKSA 1CJCA 1D4DA 4UDRA 3AB1A 2R45A 4RG4A 2C66A 1DAOA 4IA5A 5FMHA 2EQ9A 1CJ3A 3ADAB 3ZNOA 3ZYXA 3C4NA 1Y56A 3I3LA 5FS8A 1D4CA 4Z24A 3ICTA 4FDCB 5L46A 1MXTA 2EQ8A 2OAMA 1FEBA 3W4IA 2CDUA 2CVJA 3NK2X 3NYCA 3UKHA 5TR3A 5BULA 1IUXA 4OPGA 2ACZA 2BXRA 2XFOA 3EPTA 2FJBA 1S2QA 4P9SA 3H8LA 5HY5A 5IQ1A 2BCGG 2R0CA 3DJGX 3DK9A 4CNJA 1XANA 3P9UA 2C75A 4RG3A 4H4VA 4XWRA 3UTFA 5KWFA 5JCNA 2QA2A 2X8GA 3CNTA 1K0LA 1B8SA 1GRBA 1E7PA 1RSGA 3DGZA 3UKFA 5U63A 4AT0A 2C3DA 2YG7A 3K30A 2E82A 4NTDA 1PDHA 4Z2TA 3B6DA 3P4SA 4WX1A 1ZKQA 1CJ4A 3W4JA 3EANA 4J56A 2GRTA 4A6NB 2B9XA 1VQWA 1H81A 1PBBA 4EM4A 2BK5A 4AOSA 4C74A 3C96A 4K22A 3QFBA 4E0VA 3F8DA 4H4SA 4YT0A 4HA6A 4U8MA 3ICRA 4GUVA 2WBAA 4B68A 2YG5A 3V3NA 2R9ZA 4K7ZA 4Z43A 2YVGA 3SFEA 3SQPA 1AN9A 1KF6A 1BGNA 1PJ7A 4NZHA 3CTYA 1PJ5A 3L8KA 3AEFA 2CFYA 3V76A 4J34A 2GAGB 3FPZA 1ZMDA 1PS9A 1VE9A 4H2QA 4HB9A 2PHHA 1S2YA 2YG4A 4K5SA 5KXJA 1N4VA 2E5VA 4YTNA 4EIPA 2BA9A 4YJHA 1OJCA 2C64A 4BK2A 4JQ9A 5C2TA 3BI4A 1QLBA 5CQFA 2XFUA 3KA7A 4OPLA 4APNA 2XFNA 2JKCA 3D1CA 2XVEA 2GR0A 3KU9A 3R9UA 3AE5A 3IHMA 3DK4A 3NGCX 2BS3A 4B67A 1OJAA 1FOHA 3M0OA 2GH5A 4Y4NA 3C4AA 1YQ3A 2GB0A 4NEWA 1D4EA 1PBDA 4X9MA 1KSUA 1ZDLA 2GMJA 4OPDA 4IV9A 1PJ6A 4B63A 4J2WA 2J3NA 5HYMA 2GR3A 3UP4A 1L9CA 2R0GA 5IPYA 3D8XA 4UP3A 5KOXA 4U8IA 5IQ4A 2VQBA 1EL8A 5M10A 1FL2A 4YKFA 1W4XA 3REDA 4AP1A 2VVMA 3KPFA 2WPCA 2GR2A 2O9ZA 2TMDA 2BCPA 5EB5A 4YWOA 2GF3A 2QA1A 2X8HA 3GWDA 5KVIA 4C77A 4Z26A 4YSXA 2Z5YA 4A99A 4I59A 2WU5A 1TYTA 4U8OA 4USRA 1AOGA 1N1PA 1Z6LA 2FJAA 3LADA 1VG9A 3H8IA 4ADWA 1PXCA 2Y6RA 3CPHG 1Q1RA 1N4WA 3CPJG 1CL0A 2X3NA 2AAQA 2E4AA 3ISHA 1E39A 1GEUA 3CGBA 2R4JA 1K0JA 3GDPA 3PVCA 1IUVA 1HYUA 5FS6A 4CRTA 2XVFA 2V6OA 2RGOA 1F3PA 1JEHA 2H88A 2X99A 3S61A 3UKKA 3QVRA 3VR8A 1H7XA 2XLPA 4LU6A 1H6VA 1H7WA 1DNCA 3UOZA 3FIMB 1LQUA 4CCRA 2WDRA 4H4XA 1X31B 4TLZA 2E4GA 4H2RA 4TM1A 2ZBWA 4H2NA 4J31A 4TLXA 3GRSA 2V3AA 2WDQA 4EMJA 1GESA 4BV6A 1ZK7A 3BNUA 3EAOA 3H4KA 1F6MA 2C73A 2JB1A 3WE0A 2BXSA 1E1NA 2YLWA 3NHOX 2BC0A 4PABA 2XFPA 3RP8A 4AP3A 5U1OA 4H4RA 1C0KA 3AWIA 4XWZA 1KDGA 3P4RA 4BURA 3UOXA 2YAUA 2R4EA 4DGKA 2YWLA 1O5WA 2GQFA 4JY2A 1ZOYA 2BK3A 3GDNA 1CC6A 4OVIA 4AOXA 4C5OA 4YSZA 4J57A 4A79A 4LA1A 3NTAA 2ZZCA 2XCGA 2YVFA 3AEDA 4J33A 4DSGA 2C7GA 4C3XA 1KIFA 4OCGA 4CBQA 3CNSA 1NHSA 1Q9IA 2YM1A 4EQRA 3UOYA 3ABVA 2YM2A 4GCMA 4Z25A 4MJWA 2XYOA 2JK6A 3FG2P 5HXIA 5LV9A 1DOEA 1DJNA 2Y6QA 3UKAA 3O0HA 4USQA 1EVIA 2NPXA 1REOA 1DOCA 4GDPA 3P1WA 1GXFA 3ZNNA 1EL7A 4X4JA 5FS7A 3RP7A 4EMWA 3CIRA 2X50A 2R46A 4U2SA 1GETA 2OLNA 1GRFA 1ZMCA 4EQWA 4YXDA 2ARDA 4YJGB
chains in the Genus database with same CATH superfamily
4G9KA 4JNAA 4AT2A 3GSIA 3DJJA 2RGJA 3LZWA 2XVHA 4OPTA 5GRTA 4YTPA 2ZZ0A 2V61A 3ITJA 4D04A 1D7LA 3AE8A 1E1KA 1GREA 3EF6A 1C0IA 2RABA 3F8PA 3ZDNA 4ZN0A 4A5LA 3IF9A 4NEVA 4A6NA 1JRXA 4YJDA 3KPKA 4UDQA 2Q0LA 2WOIA 1CF3A 4QFCA 4BJZA 2GV8A 3UOVA 3T31A 1K4QA 3WGTA 2B7SA 1TDOA 3HYWA 1KSSA 3GD4A 3S5WA 2DKHA 3V3OA 3GMBA 2VRLA 1GV4A 5FS9A 2QAEA 3AXBA 2WOWA 4U8NA 5CKUA 4H4QA 2WESA 3Q9TA 4O5UA 3PO7A 4JY3A 5EBKA 3DMEA 4Z2UA 2C65A 1JRYA 1KNPA 1PXAA 1GRTA 3KD9A 4JDRA 3GYIA 3Q6JA 3I6DA 1UKVG 3NN6X 3DH9A 3BI2A 1S3BA 3VQRA 5GSNA 3DK8A 4BJYA 3FMWA 3ALJA 2PYXA 2I0ZA 4TM3A 1E1LA 1FECA 2JB2A 4Z2RA 2B76A 4H4ZA 4GAVA 1LVLA 3JSKA 5J7XA 2V3BA 4GDEA 1L0VA 4D03A 3RP6A 4Y4LA 3T14A 3QSMA 4GR1A 4OPUA 1GTHA 2C67A 3AE9A 5EB4A 1YY5A 2WDVA 4U2LA 1H86A 1P2HA 1TYPA 1GPEA 1PBEA 2AR8A 1NENA 3HYXA 3NRNA 2IVEA 3COXA 1M64A 3AD9B 2XLSA 3AEBA 1CJ2A 1D5TA 2YG6A 3ZNPA 2YLSA 2DU8A 4CY8A 4GAPA 1D7YA 2W0HA 4B66A 1B5QA 4J36A 4DNAA 3W4KA 3NIXA 4IVMB 4I58A 1GERA 2FJDA 3OC4A 4YSYA 3CGDA 5JCIA 3HZLA 3AE7A 4FK1C 3T0KA 3UKQA 3VRBA 4BK1A 3CGEA 3PS9A 5JCLA 1DXLA 1JU2A 4GF7A 3CNDA 1QJDA 3VRDB 1XPQA 1YQZA 2WETA 3NLCA 4U2TA 1CC4A 2AQJA 4RSLA 2VZ2A 3AYIA 1TRBA 4O5QA 4CCQA 1GOSA 1KFYA 1EBDA 4TM4A 4XXGA 4OPCA 2CULA 2YVJA 4B64A 3BHKA 4B65A 2WPFA 1JRZA 2XFQA 1NG4A 1K0IA 3E1TA 1E1MA 1TDEA 2VOUA 3AE4A 4UDPA 4YKGA 2EQ7A 2OALA 3SX6A 4A65A 2TPRA 2VVLA 4N9XA 2WOVA 5KVHA 1FEAA 2YR4A 2V60A 2R0PA 4FK1A 1LTXR 3LOVA 3IHGA 3QJ4A 2Q0KA 3LXDA 4K5RA 2GEWA 2BACA 2BS4A 3KLJA 1NG3A 3KVEA 3G5SA 5ER0A 4EMIA 3AE3A 4NTCA 1LV0A 3UCLA 5KRQA 3UTEA 1DJQA 2VRMA 4YSHA 2QCUA 3IWAA 3L1RA 2C70A 2E1MA 2YLZA 3NK0X 1C0LA 1RYIA 1OJTA 2X8CA 2XDOA 3BHFA 3II4A 3ALLA 1DODA 4H4YA 3SZCA 5U25A 1BZLA 3KKJA 2EQ6A 2WHDA 4C3YA 2YLXA 1L9EA 3BI5A 1JNRA 4H2PA 2NVKX 4K8DA 2IVDA 2WS3A 1MO9A 1ZP0A 3IC9A 4IVOB 4CY6A 1BF3A 4ECHA 1E6EA 2F5ZA 1FCDA 2WQYA 3NYEA 1Q1WA 4OPIA 3DJDA 3G5RA 3VR9A 2GQWA 1YKJA 2BABA 3LZXA 1GSNA 3QFAA 4YJFB 4B69A 3GMCA 5JCMA 2JB3A 3NTDA 3CUKA 1GRGA 1BGJA 2B9YA 3ICSA 2VQ7A 2FBWA 2DKIA 4IA6A 4EIPA 2WP9A 1F8WA 3AE2A 3ATRA 3CMMA 2A8XA 2GVCA 1NDAA 3ATQA 3P4QA 3QVPA 4H50A 4EIQA 4A7AA 4U8LA 1IJHA 2Q6UA 1XDIA 1DOBA 4Y4MA 2YQUA 3ZNQA 2FJEA 1PHHA 5BRTA 3CGCA 4U8JA 2E48A 2GR1A 2B9WA 2BYBA 2YLTA 1GALA 5BUKA 3QSSA 4X9NA 3DGHA 1EL5A 3GD3A 1PBCA 1TDNA 1SEZA 1PBFA 2JBVA 3AYLA 3CNPA 1L9DA 2YG3A 3G5QA 3M12A 1B4VA 3AD8B 1RP0A 2Q7VA 1O94A 3UTGA 5C3JA 1DDOA 3DA1A 1V59A 3URHA 3UTHA 3CN8A 1LJ1A 3G3EA 1ONFA 4H7UA 3GWFA 3BNMA 1O95A 2C72A 2OA1A 4H4WA 1BKWA 2RGHA 3SZ0A 3AD7B 1VRQB 1TDFA 2WU2A 1ZX9A 4II2A 2A89A 3AYJA 4U8KA 3T37A 2BC1A 2A87A 1IUTA 5KOWA 3DJEA 3UKPA 4EQXA 3GRTA 3SYIA 4YJHB 1H82A 4B1BA 1GT8A 2WEUA 2H89A 4REKA 4BK3A 5KMPA 2XVIA 3NH3X 5EOWA 1S3EA 2XLTA 2YR6A 3CPIG 1EL9A 3M13A 2XVJA 1NHQA 1IUUA 3RNMA 5KMSA 1M6IA 4QFDA 3B3RA 1N4UA 4ZCDA 1XHCA 2C76A 4FX9A 3P4PA 3UP5A 4ZCCA 1CBOA 4GRTA 3K7TA 5M0ZA 4A9WA 3RHAA 4Z44A 2GMHA 1GTEA 3CNJA 2BK4A 1P2EA 1H84A 2B7RA 1B37A 2C3CA 3NK1X 3K7QX 2GAHB 4YTMA 5KMRA 1NHRA 1VG0A 4K2XA 4EQSA 3AEAA 1TDKA 3QSEA 1OJ9A 2Z5XA 3LB8A 4U8PA 1NPXA 3AE1A 4ICYA 2XLRA 3NYFA 3AEEA 3LJPA 3NNEA 1ELIA 1KNRA 2ZZBA 4YJFA 1GRHA 1LQTA 1NAAA 2XLUA 4NTEA 1NHPA 3HYVA 4H4TA 1COYA 1F8RA 2JAEA 2WP6A 1OJDA 1VDCA 4CNKA 4LIIA 1F8SA 1JOAA 2BS2A 2APGA 2HQMA 1IUSA 2V5ZA 3K7MX 3AECA 2OLOA 2YR5A 3F8RA 2VVLG 1NEKA 3NN0X 2WPEA 3NT6A 5HHFA 3GYJA 1YQ4A 5KMQA 2UZZA 4TM0A 4H4UA 4WCTA 1GRAA 2YLRA 2IIDA 5BVAA 1C0PA 4G74A 1IUWA 3FBSA 4NNJA 1GNDA 4G6HA 1MOKA 4KPRA 4DSHA 2E49A 1PXBA 1CC2A 4H4PA 1H83A 5J60A 1PN0A 4M52A 4YJGA 1BWCA 3ALMA 5JCKA 4PAAA 3AEGA 1Y0PA 3SGLA 3SM8A 1Y56B 1JNZA 4EM3A 3OZ2A 1LPFA 3SY4A 3SZWA 1ZY8A 4JN9A 4JNQA 5DBJA 3SFDA 3UKLA 1CHUA 1QO8A 1ZOVA 3NG7X 3AE6A 4KX6A 2WP5A 3NKSA 1CJCA 1D4DA 4UDRA 3AB1A 2R45A 4RG4A 2C66A 1DAOA 4IA5A 5FMHA 2EQ9A 1CJ3A 3ADAB 2C4CA 3ZNOA 3ZYXA 3C4NA 1Y56A 3I3LA 5FS8A 1D4CA 4Z24A 3ICTA 4FDCB 5L46A 1MXTA 2EQ8A 2OAMA 1FEBA 3W4IA 2CDUA 2CVJA 3NK2X 3NYCA 3UKHA 5TR3A 5BULA 1IUXA 4OPGA 2ACZA 2BXRA 2XFOA 3EPTA 2FJBA 1S2QA 4P9SA 3H8LA 5HY5A 5IQ1A 2BCGG 2R0CA 3DJGX 3DK9A 4CNJA 1XANA 3P9UA 2C75A 4RG3A 4H4VA 4XWRA 3UTFA 5KWFA 5JCNA 2QA2A 2X8GA 3CNTA 1K0LA 1B8SA 1GRBA 1E7PA 1RSGA 3DGZA 3UKFA 5U63A 4AT0A 2C3DA 2YG7A 3K30A 2E82A 4NTDA 1PDHA 4Z2TA 3B6DA 3P4SA 4WX1A 1ZKQA 1CJ4A 3W4JA 3EANA 4J56A 2GRTA 4G6GA 4A6NB 2B9XA 1VQWA 1H81A 1PBBA 4EM4A 2BK5A 4AOSA 4C74A 3C96A 4K22A 3QFBA 4E0VA 3F8DA 4H4SA 4YT0A 4HA6A 4U8MA 3ICRA 4GUVA 2WBAA 4B68A 2YG5A 3V3NA 2R9ZA 4K7ZA 4Z43A 2YVGA 3SFEA 3SQPA 1AN9A 1KF6A 1BGNA 1PJ7A 4NZHA 3CTYA 1PJ5A 3L8KA 3AEFA 2CFYA 3V76A 4J34A 2GAGB 3FPZA 1ZMDA 1PS9A 1VE9A 4H2QA 4II3A 4HB9A 2PHHA 1S2YA 2YG4A 4K5SA 5KXJA 1N4VA 2E5VA 4YTNA 2BA9A 4YJHA 1OJCA 4BK2A 2C64A 4JQ9A 5C2TA 3BI4A 1QLBA 5CQFA 2XFUA 3KA7A 4OPLA 4APNA 2XFNA 2JKCA 3D1CA 2XVEA 2GR0A 3KU9A 3R9UA 3IHMA 3AE5A 3DK4A 3NGCX 2BS3A 4B67A 1OJAA 1FOHA 3M0OA 2GH5A 4Y4NA 3C4AA 1YQ3A 2GB0A 4NEWA 1D4EA 1PBDA 4X9MA 1KSUA 1ZDLA 2GMJA 4OPDA 4IV9A 1PJ6A 4B63A 4J2WA 5HYMA 2J3NA 2GR3A 3UP4A 1L9CA 2R0GA 5IPYA 3D8XA 4UP3A 5KOXA 4U8IA 5IQ4A 2VQBA 1EL8A 5M10A 1FL2A 4YKFA 1W4XA 3REDA 4AP1A 2VVMA 3KPFA 2WPCA 2GR2A 5KNLA 2O9ZA 2TMDA 3SXIA 2BCPA 5EB5A 4YWOA 2GF3A 2QA1A 2X8HA 3GWDA 5KVIA 4C77A 4Z26A 4YSXA 2Z5YA 4A99A 4I59A 2WU5A 1TYTA 4U8OA 4USRA 1AOGA 1N1PA 1Z6LA 2FJAA 3LADA 1VG9A 3SZFA 3H8IA 4ADWA 1PXCA 2Y6RA 3CPHG 1Q1RA 1N4WA 3CPJG 1CL0A 2X3NA 2AAQA 2E4AA 3ISHA 1E39A 1GEUA 3CGBA 2R4JA 1K0JA 3GDPA 3PVCA 1IUVA 1HYUA 5FS6A 4CRTA 2XVFA 2V6OA 2RGOA 3T2KA 1F3PA 1JEHA 2H88A 2X99A 2BRYA 3S61A 3QVRA 3UKKA 3VR8A 1H7XA 2XLPA 4LU6A 1H6VA 1H7WA 3T2YA 1DNCA 3UOZA 3FIMB 1LQUA 4CCRA 2WDRA 4H4XA 1X31B 4TLZA 4H2RA 2E4GA 4TM1A 4H2NA 2ZBWA 4J31A 4TLXA 3GYXA 3GRSA 2V3AA 2WDQA 4EMJA 1GESA 4BV6A 1ZK7A 3BNUA 3EAOA 3H4KA 4NWZA 1F6MA 2C73A 2JB1A 3WE0A 2BRAA 2BXSA 1E1NA 2YLWA 3NHOX 2BC0A 4PABA 3RP8A 2XFPA 4AP3A 5U1OA 4H4RA 1C0KA 3AWIA 4XWZA 1KDGA 3P4RA 4BURA 3UOXA 2YAUA 2R4EA 4DGKA 2YWLA 1O5WA 4JY2A 2GQFA 1ZOYA 2BK3A 3GDNA 1CC6A 4OVIA 4AOXA 4C5OA 4YSZA 4J57A 4A79A 4LA1A 3NTAA 2ZZCA 2XCGA 2YVFA 3AEDA 4J33A 4DSGA 2C7GA 4G73A 4C3XA 1KIFA 4OCGA 3T2ZA 4CBQA 3CNSA 1NHSA 1Q9IA 2YM1A 4EQRA 3UOYA 3ABVA 2YM2A 4GCMA 4Z25A 4MJWA 2XYOA 2JK6A 3FG2P 5HXIA 5LV9A 1DOEA 1DJNA 2Y6QA 3UKAA 3O0HA 4USQA 1EVIA 2NPXA 3VRAA 1REOA 1DOCA 4GDPA 3P1WA 1GXFA 3ZNNA 1EL7A 4X4JA 5FS7A 3RP7A 4EMWA 3CIRA 2X50A 2R46A 4U2SA 1GETA 2OLNA 1GRFA 1ZMCA 4EQWA 4YXDA 2ARDA 4YJGB
chains in the Genus database with same CATH topology
4G9KA 4JNAA 4AT2A 3GSIA 3DJJA 2RGJA 3LZWA 2XVHA 4OPTA 5GRTA 4YTPA 2ZZ0A 2V61A 3ITJA 4D04A 1D7LA 3AE8A 1E1KA 1GREA 3EF6A 1C0IA 2RABA 3F8PA 3ZDNA 4ZN0A 4A5LA 3IF9A 4NEVA 4A6NA 1JRXA 4YJDA 3KPKA 4UDQA 2Q0LA 2WOIA 1CF3A 4QFCA 4BJZA 2GV8A 3UOVA 3T31A 1K4QA 3WGTA 2B7SA 1TDOA 3HYWA 1KSSA 3GD4A 3S5WA 2DKHA 3V3OA 3GMBA 2VRLA 1GV4A 5FS9A 2QAEA 3AXBA 2WOWA 4U8NA 5CKUA 4H4QA 2WESA 3Q9TA 4O5UA 3PO7A 4JY3A 5EBKA 3DMEA 4Z2UA 2C65A 1JRYA 1KNPA 1PXAA 1GRTA 3KD9A 4JDRA 3GYIA 3Q6JA 3I6DA 1UKVG 3NN6X 3DH9A 3BI2A 1S3BA 3VQRA 5GSNA 3DK8A 4BJYA 3FMWA 3ALJA 2PYXA 2I0ZA 4TM3A 1E1LA 1FECA 2JB2A 4Z2RA 2B76A 4H4ZA 4GAVA 1LVLA 3JSKA 5J7XA 2V3BA 4GDEA 1L0VA 4D03A 3RP6A 4Y4LA 3T14A 3QSMA 4GR1A 4OPUA 1GTHA 2C67A 3AE9A 5EB4A 1YY5A 2WDVA 4U2LA 1H86A 1P2HA 1TYPA 1GPEA 2AR8A 1PBEA 1NENA 3HYXA 3NRNA 2IVEA 3COXA 1M64A 3AD9B 2XLSA 3AEBA 1CJ2A 1D5TA 2YG6A 3ZNPA 2YLSA 2DU8A 4CY8A 4GAPA 1D7YA 2W0HA 4B66A 1B5QA 4J36A 4DNAA 3W4KA 3NIXA 4IVMB 4I58A 1GERA 2FJDA 3OC4A 4YSYA 3CGDA 5JCIA 3HZLA 3AE7A 4FK1C 3T0KA 3UKQA 3VRBA 4BK1A 3CGEA 3PS9A 5JCLA 1DXLA 1JU2A 4GF7A 3CNDA 1QJDA 3VRDB 1XPQA 1YQZA 2WETA 3NLCA 4U2TA 1CC4A 2AQJA 4RSLA 2VZ2A 3AYIA 1TRBA 4O5QA 4CCQA 1GOSA 1KFYA 1EBDA 4TM4A 4XXGA 4OPCA 2CULA 2YVJA 4B64A 3BHKA 4B65A 2WPFA 1JRZA 2XFQA 1NG4A 1K0IA 1E1MA 1TDEA 3AE4A 2VOUA 3E1TA 4UDPA 4YKGA 2EQ7A 2OALA 3SX6A 4A65A 2TPRA 2VVLA 4N9XA 2WOVA 5KVHA 1FEAA 2YR4A 2V60A 2R0PA 4FK1A 1LTXR 3LOVA 3IHGA 3QJ4A 2Q0KA 3LXDA 4K5RA 2GEWA 2BACA 2BS4A 3KLJA 1NG3A 3KVEA 3G5SA 5ER0A 4EMIA 3AE3A 4NTCA 1LV0A 3UCLA 5KRQA 3UTEA 1DJQA 2VRMA 4YSHA 2QCUA 3IWAA 3L1RA 2C70A 2E1MA 2YLZA 3NK0X 1C0LA 1RYIA 1OJTA 2X8CA 2XDOA 3BHFA 3II4A 3ALLA 1DODA 4H4YA 3SZCA 5U25A 1BZLA 3KKJA 2EQ6A 2WHDA 4C3YA 2YLXA 1L9EA 3BI5A 1JNRA 2NVKX 4H2PA 4K8DA 2IVDA 2WS3A 1MO9A 1ZP0A 3IC9A 4IVOB 4CY6A 1BF3A 4ECHA 1E6EA 2F5ZA 1FCDA 2WQYA 3NYEA 1Q1WA 4OPIA 3DJDA 3G5RA 3VR9A 2GQWA 1YKJA 2BABA 3LZXA 1GSNA 3QFAA 4YJFB 4B69A 3GMCA 5JCMA 2JB3A 3NTDA 3CUKA 1GRGA 1BGJA 2B9YA 3ICSA 2VQ7A 2FBWA 2DKIA 3AE2A 2WP9A 3ATRA 1F8WA 3CMMA 3P4QA 4IA6A 2A8XA 2GVCA 1NDAA 3ATQA 3QVPA 4H50A 4A7AA 4EIQA 4U8LA 1IJHA 2Q6UA 1XDIA 1DOBA 4Y4MA 2YQUA 3ZNQA 2FJEA 1PHHA 5BRTA 3CGCA 4U8JA 2E48A 2GR1A 2B9WA 2BYBA 2YLTA 1GALA 5BUKA 3QSSA 4X9NA 3DGHA 1EL5A 3GD3A 1PBCA 1TDNA 1SEZA 1PBFA 2JBVA 3AYLA 3CNPA 1L9DA 2YG3A 3G5QA 3M12A 1B4VA 3AD8B 1RP0A 2Q7VA 1O94A 3UTGA 5C3JA 1DDOA 3DA1A 1V59A 3URHA 3UTHA 3CN8A 1LJ1A 3G3EA 1ONFA 4H7UA 3GWFA 3BNMA 1O95A 2C72A 2OA1A 4H4WA 1BKWA 2RGHA 3SZ0A 3AD7B 1VRQB 1TDFA 2WU2A 1ZX9A 4II2A 2A89A 3AYJA 4U8KA 3T37A 2BC1A 2A87A 1IUTA 5KOWA 3DJEA 3UKPA 4EQXA 3GRTA 3SYIA 4YJHB 1H82A 4B1BA 1GT8A 2WEUA 2H89A 4REKA 4BK3A 5KMPA 2XVIA 3NH3X 5EOWA 1S3EA 2XLTA 2YR6A 3CPIG 1EL9A 3M13A 2XVJA 1NHQA 1IUUA 3RNMA 5KMSA 1M6IA 4QFDA 3B3RA 1N4UA 4ZCDA 1XHCA 2C76A 4FX9A 3P4PA 3UP5A 4ZCCA 1CBOA 4GRTA 3K7TA 5M0ZA 4A9WA 3RHAA 4Z44A 1GTEA 2GMHA 3CNJA 2BK4A 1P2EA 1H84A 2B7RA 1B37A 2C3CA 3NK1X 3K7QX 2GAHB 4YTMA 5KMRA 1NHRA 1VG0A 4K2XA 4EQSA 3AEAA 1TDKA 3QSEA 1OJ9A 2Z5XA 3LB8A 4U8PA 1NPXA 3AE1A 4ICYA 2XLRA 3NYFA 3AEEA 3LJPA 3NNEA 1ELIA 1KNRA 2ZZBA 4YJFA 1GRHA 1LQTA 1NAAA 2XLUA 4NTEA 1NHPA 3HYVA 4H4TA 1COYA 1F8RA 2JAEA 2WP6A 1OJDA 1VDCA 4CNKA 4LIIA 1F8SA 1JOAA 2BS2A 2APGA 2HQMA 1IUSA 2V5ZA 3K7MX 3AECA 2OLOA 2YR5A 3F8RA 2VVLG 1NEKA 3NN0X 2WPEA 3NT6A 5HHFA 3GYJA 1YQ4A 5KMQA 2UZZA 4TM0A 4H4UA 4WCTA 1GRAA 2YLRA 2IIDA 5BVAA 1C0PA 4G74A 1IUWA 3FBSA 4NNJA 1GNDA 4G6HA 1MOKA 4KPRA 4DSHA 2E49A 1PXBA 1CC2A 4H4PA 1H83A 5J60A 1PN0A 4M52A 4YJGA 1BWCA 3ALMA 5JCKA 4PAAA 3AEGA 1Y0PA 3SGLA 3SM8A 1Y56B 1JNZA 4EM3A 3OZ2A 1LPFA 3SY4A 3SZWA 1ZY8A 4JN9A 4JNQA 5DBJA 3SFDA 3UKLA 1CHUA 1QO8A 1ZOVA 3NG7X 3AE6A 4KX6A 2WP5A 3NKSA 1CJCA 1D4DA 4UDRA 3AB1A 2R45A 4RG4A 2C66A 1DAOA 4IA5A 5FMHA 2EQ9A 1CJ3A 3ADAB 2C4CA 3ZNOA 3ZYXA 3C4NA 1Y56A 3I3LA 5FS8A 1D4CA 4Z24A 3ICTA 4FDCB 5L46A 1MXTA 2EQ8A 2OAMA 1FEBA 3W4IA 2CDUA 2CVJA 3NK2X 3NYCA 3UKHA 5TR3A 5BULA 1IUXA 4OPGA 2ACZA 2BXRA 2XFOA 3EPTA 2FJBA 1S2QA 4P9SA 3H8LA 5HY5A 5IQ1A 2BCGG 2R0CA 3DJGX 3DK9A 4CNJA 1XANA 3P9UA 2C75A 4RG3A 4H4VA 4XWRA 3UTFA 5KWFA 5JCNA 2QA2A 2X8GA 3CNTA 1K0LA 1B8SA 1GRBA 1E7PA 1RSGA 3DGZA 3UKFA 5U63A 4AT0A 2C3DA 2YG7A 3K30A 2E82A 4NTDA 1PDHA 4Z2TA 3B6DA 3P4SA 4WX1A 1ZKQA 1CJ4A 3W4JA 3EANA 4J56A 2GRTA 4G6GA 4A6NB 2B9XA 1VQWA 1H81A 1PBBA 4EM4A 2BK5A 4AOSA 4C74A 3C96A 4K22A 3QFBA 4E0VA 3F8DA 4H4SA 4YT0A 4HA6A 4U8MA 3ICRA 4GUVA 2WBAA 4B68A 2YG5A 3V3NA 2R9ZA 4K7ZA 4Z43A 2YVGA 3SFEA 3SQPA 1AN9A 1KF6A 1BGNA 1PJ7A 4NZHA 3CTYA 1PJ5A 3L8KA 3AEFA 2CFYA 3V76A 4J34A 2GAGB 3FPZA 1ZMDA 1PS9A 1VE9A 4H2QA 4II3A 4HB9A 2PHHA 1S2YA 2YG4A 4K5SA 5KXJA 1N4VA 2E5VA 4YTNA 4EIPA 2BA9A 4YJHA 1OJCA 2C64A 4BK2A 4JQ9A 5C2TA 3BI4A 1QLBA 5CQFA 2XFUA 3KA7A 4OPLA 4APNA 2XFNA 2JKCA 3D1CA 2XVEA 2GR0A 3KU9A 3R9UA 3AE5A 3IHMA 3DK4A 3NGCX 2BS3A 4B67A 1OJAA 1FOHA 3M0OA 2GH5A 4Y4NA 3C4AA 1YQ3A 2GB0A 4NEWA 1D4EA 1PBDA 4X9MA 1KSUA 1ZDLA 2GMJA 4OPDA 4IV9A 1PJ6A 4B63A 4J2WA 2J3NA 5HYMA 2GR3A 3UP4A 1L9CA 2R0GA 5IPYA 3D8XA 4UP3A 5KOXA 4U8IA 5IQ4A 2VQBA 1EL8A 5M10A 1FL2A 4YKFA 1W4XA 3REDA 4AP1A 2VVMA 3KPFA 2WPCA 2GR2A 5KNLA 2O9ZA 2TMDA 3SXIA 2BCPA 5EB5A 4YWOA 2GF3A 2QA1A 2X8HA 3GWDA 5KVIA 4C77A 4Z26A 4YSXA 2Z5YA 4A99A 4I59A 2WU5A 1TYTA 4U8OA 4USRA 1AOGA 1N1PA 1Z6LA 2FJAA 3LADA 1VG9A 3SZFA 3H8IA 4ADWA 1PXCA 2Y6RA 3CPHG 1Q1RA 1N4WA 3CPJG 1CL0A 2X3NA 2AAQA 2E4AA 3ISHA 1E39A 1GEUA 3CGBA 2R4JA 1K0JA 3GDPA 3PVCA 1IUVA 1HYUA 5FS6A 4CRTA 2XVFA 2V6OA 2RGOA 3T2KA 1F3PA 1JEHA 2H88A 2X99A 2BRYA 3S61A 3QVRA 3UKKA 3VR8A 1H7XA 2XLPA 4LU6A 1H6VA 1H7WA 3T2YA 1DNCA 3UOZA 3FIMB 1LQUA 4CCRA 2WDRA 4H4XA 1X31B 4TLZA 2E4GA 4H2RA 4TM1A 2ZBWA 4H2NA 4J31A 4TLXA 3GYXA 3GRSA 2V3AA 2WDQA 4EMJA 1GESA 4BV6A 1ZK7A 3BNUA 3EAOA 3H4KA 4NWZA 1F6MA 2C73A 2JB1A 3WE0A 2BRAA 2BXSA 1E1NA 2YLWA 3NHOX 2BC0A 4PABA 2XFPA 3RP8A 4AP3A 5U1OA 4H4RA 1C0KA 3AWIA 4XWZA 1KDGA 3P4RA 4BURA 3UOXA 2YAUA 2R4EA 4DGKA 2YWLA 1O5WA 2GQFA 4JY2A 1ZOYA 2BK3A 3GDNA 1CC6A 4OVIA 4AOXA 4C5OA 4YSZA 4J57A 4A79A 4LA1A 3NTAA 2ZZCA 2XCGA 2YVFA 3AEDA 4J33A 4DSGA 2C7GA 4G73A 4C3XA 1KIFA 4OCGA 3T2ZA 4CBQA 3CNSA 1NHSA 1Q9IA 2YM1A 4EQRA 3UOYA 3ABVA 2YM2A 4GCMA 4Z25A 4MJWA 2XYOA 2JK6A 3FG2P 5HXIA 5LV9A 1DOEA 1DJNA 2Y6QA 3UKAA 3O0HA 4USQA 1EVIA 2NPXA 3VRAA 1REOA 1DOCA 4GDPA 3P1WA 1GXFA 3ZNNA 1EL7A 4X4JA 5FS7A 3RP7A 4EMWA 3CIRA 2X50A 2R46A 4U2SA 1GETA 2OLNA 1GRFA 1ZMCA 4EQWA 4YXDA 2ARDA 4YJGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNA A;  4AT2 A;  3GSI A;  3DJJ A;  2RGJ A;  3LZW A;  2XVH A;  4OPT A;  5GRT A;  4YTP A;  2ZZ0 A;  2V61 A;  3ITJ A;  4D04 A;  1D7L A;  3AE8 A;  1E1K A;  1GRE A;  3EF6 A;  1C0I A;  2RAB A;  3F8P A;  3ZDN A;  4ZN0 A;  4A5L A;  3IF9 A;  4NEV A;  4A6N A;  1JRX A;  4YJD A;  4UDQ A;  2Q0L A;  2WOI A;  1CF3 A;  4QFC A;  4BJZ A;  2GV8 A;  3UOV A;  1K4Q A;  3WGT A;  2B7S A;  1TDO A;  1KSS A;  3GD4 A;  3S5W A;  2DKH A;  3V3O A;  3GMB A;  2VRL A;  1GV4 A;  5FS9 A;  2QAE A;  3AXB A;  2WOW A;  4U8N A;  5CKU A;  4H4Q A;  2WES A;  3Q9T A;  4O5U A;  3PO7 A;  4JY3 A;  5EBK A;  3DME A;  4Z2U A;  2C65 A;  1JRY A;  1KNP A;  1PXA A;  1GRT A;  3KD9 A;  4JDR A;  3GYI A;  3Q6J A;  3I6D A;  1UKV G;  3NN6 X;  3DH9 A;  3BI2 A;  1S3B A;  3VQR A;  5GSN A;  3DK8 A;  4BJY A;  3FMW A;  3ALJ A;  2PYX A;  2I0Z A;  4TM3 A;  1E1L A;  1FEC A;  2JB2 A;  4Z2R A;  2B76 A;  4H4Z A;  1LVL A;  3JSK A;  5J7X A;  2V3B A;  4GDE A;  1L0V A;  4D03 A;  3RP6 A;  4Y4L A;  3QSM A;  4GR1 A;  4OPU A;  1GTH A;  2C67 A;  3AE9 A;  5EB4 A;  1YY5 A;  2WDV A;  4U2L A;  1H86 A;  1P2H A;  1TYP A;  1GPE A;  2AR8 A;  1PBE A;  1NEN A;  3NRN A;  2IVE A;  3COX A;  1M64 A;  3AD9 B;  2XLS A;  3AEB A;  1CJ2 A;  1D5T A;  2YG6 A;  3ZNP A;  2YLS A;  2DU8 A;  4CY8 A;  1D7Y A;  2W0H A;  4B66 A;  1B5Q A;  4J36 A;  4DNA A;  3W4K A;  3NIX A;  4IVM B;  4I58 A;  1GER A;  2FJD A;  3OC4 A;  4YSY A;  3CGD A;  5JCI A;  3HZL A;  3AE7 A;  4FK1 C;  3UKQ A;  3VRB A;  4BK1 A;  3CGE A;  3PS9 A;  5JCL A;  1DXL A;  1JU2 A;  4GF7 A;  3CND A;  1QJD A;  3VRD B;  1XPQ A;  1YQZ A;  2WET A;  3NLC A;  4U2T A;  1CC4 A;  2AQJ A;  4RSL A;  2VZ2 A;  3AYI A;  1TRB A;  4O5Q A;  4CCQ A;  1GOS A;  1KFY A;  1EBD A;  4TM4 A;  4XXG A;  4OPC A;  2CUL A;  2YVJ A;  4B64 A;  3BHK A;  4B65 A;  2WPF A;  1JRZ A;  2XFQ A;  1NG4 A;  1K0I A;  1E1M A;  1TDE A;  3AE4 A;  2VOU A;  3E1T A;  4UDP A;  4YKG A;  2EQ7 A;  2OAL A;  4A65 A;  2TPR A;  2VVL A;  4N9X A;  2WOV A;  5KVH A;  1FEA A;  2YR4 A;  2V60 A;  2R0P A;  4FK1 A;  1LTX R;  3LOV A;  3IHG A;  3QJ4 A;  2Q0K A;  3LXD A;  4K5R A;  2GEW A;  2BAC A;  2BS4 A;  3KLJ A;  1NG3 A;  3KVE A;  3G5S A;  5ER0 A;  4EMI A;  3AE3 A;  4NTC A;  1LV0 A;  3UCL A;  5KRQ A;  3UTE A;  1DJQ A;  2VRM A;  4YSH A;  2QCU A;  3IWA A;  3L1R A;  2C70 A;  2E1M A;  2YLZ A;  3NK0 X;  1C0L A;  1RYI A;  1OJT A;  2X8C A;  2XDO A;  3BHF A;  3II4 A;  3ALL A;  1DOD A;  4H4Y A;  5U25 A;  1BZL A;  3KKJ A;  2EQ6 A;  2WHD A;  4C3Y A;  2YLX A;  1L9E A;  3BI5 A;  1JNR A;  2NVK X;  4H2P A;  4K8D A;  2IVD A;  2WS3 A;  1MO9 A;  1ZP0 A;  3IC9 A;  4IVO B;  4CY6 A;  1BF3 A;  4ECH A;  1E6E A;  2F5Z A;  1FCD A;  2WQY A;  3NYE A;  1Q1W A;  4OPI A;  3DJD A;  3G5R A;  3VR9 A;  2GQW A;  1YKJ A;  2BAB A;  3LZX A;  1GSN A;  3QFA A;  4YJF B;  4B69 A;  3GMC A;  5JCM A;  2JB3 A;  3NTD A;  3CUK A;  1GRG A;  1BGJ A;  2B9Y A;  3ICS A;  2VQ7 A;  2FBW A;  2DKI A;  3AE2 A;  2WP9 A;  3ATR A;  1F8W A;  4IA6 A;  3P4Q A;  3VRA A;  2A8X A;  2GVC A;  1NDA A;  3ATQ A;  3QVP A;  4H50 A;  4A7A A;  4EIQ A;  4U8L A;  1IJH A;  2Q6U A;  1XDI A;  1DOB A;  4Y4M A;  2YQU A;  3ZNQ A;  2FJE A;  1PHH A;  5BRT A;  3CGC A;  4U8J A;  2E48 A;  2GR1 A;  2B9W A;  2BYB A;  2YLT A;  1GAL A;  5BUK A;  3QSS A;  4X9N A;  3DGH A;  1EL5 A;  3GD3 A;  1PBC A;  1TDN A;  1SEZ A;  1PBF A;  2JBV A;  3AYL A;  3CNP A;  1L9D A;  2YG3 A;  3G5Q A;  3M12 A;  1B4V A;  3AD8 B;  1RP0 A;  2Q7V A;  1O94 A;  3UTG A;  5C3J A;  1DDO A;  3DA1 A;  1V59 A;  3URH A;  3UTH A;  3CN8 A;  1LJ1 A;  3G3E A;  1ONF A;  4H7U A;  3GWF A;  3BNM A;  1O95 A;  2C72 A;  2OA1 A;  4H4W A;  1BKW A;  2RGH A;  3AD7 B;  1VRQ B;  1TDF A;  2WU2 A;  1ZX9 A;  2A89 A;  3AYJ A;  4U8K A;  3T37 A;  2BC1 A;  2A87 A;  1IUT A;  5KOW A;  3DJE A;  3UKP A;  4EQX A;  3GRT A;  4YJH B;  1H82 A;  4B1B A;  1GT8 A;  2WEU A;  2H89 A;  4REK A;  4BK3 A;  2XVI A;  3NH3 X;  5EOW A;  1S3E A;  2XLT A;  2YR6 A;  3CPI G;  1EL9 A;  3M13 A;  2XVJ A;  1NHQ A;  1IUU A;  3RNM A;  1M6I A;  4QFD A;  3B3R A;  1N4U A;  4ZCD A;  1XHC A;  2C76 A;  4FX9 A;  3P4P A;  3UP5 A;  4ZCC A;  1CBO A;  4GRT A;  3K7T A;  5M0Z A;  4A9W A;  3RHA A;  4Z44 A;  1GTE A;  2GMH A;  3CNJ A;  2BK4 A;  1P2E A;  1H84 A;  2B7R A;  1B37 A;  2C3C A;  3NK1 X;  3K7Q X;  2GAH B;  4YTM A;  1NHR A;  1VG0 A;  4K2X A;  4EQS A;  3AEA A;  1TDK A;  3QSE A;  1OJ9 A;  2Z5X A;  3LB8 A;  4U8P A;  1NPX A;  3AE1 A;  4ICY A;  2XLR A;  3NYF A;  3AEE A;  3LJP A;  3NNE A;  1ELI A;  1KNR A;  2ZZB A;  4YJF A;  1GRH A;  1LQT A;  1NAA A;  2XLU A;  4NTE A;  1NHP A;  4H4T A;  1COY A;  1F8R A;  2JAE A;  2WP6 A;  1OJD A;  1VDC A;  4CNK A;  4LII A;  1F8S A;  1JOA A;  2BS2 A;  2APG A;  2HQM A;  1IUS A;  2V5Z A;  3K7M X;  3AEC A;  2OLO A;  2YR5 A;  3F8R A;  2VVL G;  1NEK A;  3NN0 X;  2WPE A;  3NT6 A;  5HHF A;  3GYJ A;  1YQ4 A;  2UZZ A;  4TM0 A;  4H4U A;  4WCT A;  1GRA A;  2YLR A;  2IID A;  5BVA A;  1C0P A;  1IUW A;  3FBS A;  1GND A;  1MOK A;  4KPR A;  4DSH A;  2E49 A;  1PXB A;  1CC2 A;  4H4P A;  1H83 A;  5J60 A;  1PN0 A;  4M52 A;  4YJG A;  1BWC A;  3ALM A;  5JCK A;  4PAA A;  3AEG A;  1Y0P A;  3SGL A;  3SM8 A;  1Y56 B;  1JNZ A;  4EM3 A;  3OZ2 A;  1LPF A;  3UKL A;  1ZY8 A;  4JN9 A;  4JNQ A;  5DBJ A;  3SFD A;  1CHU A;  1QO8 A;  1ZOV A;  3NG7 X;  3AE6 A;  4KX6 A;  2WP5 A;  3NKS A;  1CJC A;  1D4D A;  4UDR A;  3AB1 A;  2R45 A;  4RG4 A;  2C66 A;  1DAO A;  4IA5 A;  5FMH A;  2EQ9 A;  1CJ3 A;  3ADA B;  3ZNO A;  3ZYX A;  3C4N A;  1Y56 A;  3I3L A;  5FS8 A;  1D4C A;  4Z24 A;  3ICT A;  4FDC B;  5L46 A;  1MXT A;  2EQ8 A;  2OAM A;  1FEB A;  3W4I A;  2CDU A;  2CVJ A;  3NK2 X;  3NYC A;  3UKH A;  5TR3 A;  5BUL A;  1IUX A;  4OPG A;  2ACZ A;  2BXR A;  2XFO A;  3EPT A;  2FJB A;  1S2Q A;  4P9S A;  3H8L A;  5HY5 A;  5IQ1 A;  2BCG G;  2R0C A;  3DJG X;  3DK9 A;  4CNJ A;  1XAN A;  3P9U A;  2C75 A;  4RG3 A;  4H4V A;  4XWR A;  3UTF A;  5KWF A;  5JCN A;  2QA2 A;  2X8G A;  3CNT A;  1K0L A;  1B8S A;  1GRB A;  1E7P A;  1RSG A;  3DGZ A;  3UKF A;  5U63 A;  4AT0 A;  2C3D A;  2YG7 A;  3K30 A;  2E82 A;  4NTD A;  1PDH A;  4Z2T A;  3B6D A;  3P4S A;  4WX1 A;  1ZKQ A;  1CJ4 A;  3W4J A;  3EAN A;  4J56 A;  2GRT A;  4A6N B;  2B9X A;  1VQW A;  1H81 A;  1PBB A;  4EM4 A;  2BK5 A;  4AOS A;  4C74 A;  3C96 A;  4K22 A;  3QFB A;  4E0V A;  3F8D A;  4H4S A;  4YT0 A;  4HA6 A;  4U8M A;  3ICR A;  4GUV A;  2WBA A;  4B68 A;  2YG5 A;  3V3N A;  2R9Z A;  4K7Z A;  4Z43 A;  2YVG A;  3SFE A;  3SQP A;  1AN9 A;  1KF6 A;  1BGN A;  1PJ7 A;  4NZH A;  3CTY A;  1PJ5 A;  3L8K A;  3AEF A;  2CFY A;  3V76 A;  4J34 A;  2GAG B;  3FPZ A;  1ZMD A;  1PS9 A;  1VE9 A;  4H2Q A;  4HB9 A;  2PHH A;  1S2Y A;  2YG4 A;  4K5S A;  5KXJ A;  1N4V A;  2E5V A;  4YTN A;  4EIP A;  2BA9 A;  4YJH A;  1OJC A;  2C64 A;  4BK2 A;  4JQ9 A;  5C2T A;  3BI4 A;  1QLB A;  5CQF A;  2XFU A;  3KA7 A;  4OPL A;  4APN A;  2XFN A;  2JKC A;  3D1C A;  2XVE A;  2GR0 A;  3KU9 A;  3R9U A;  3AE5 A;  3IHM A;  3DK4 A;  3NGC X;  2BS3 A;  4B67 A;  1OJA A;  1FOH A;  3M0O A;  2GH5 A;  4Y4N A;  3C4A A;  1YQ3 A;  2GB0 A;  4NEW A;  1D4E A;  1PBD A;  4X9M A;  1KSU A;  1ZDL A;  2GMJ A;  4OPD A;  4IV9 A;  1PJ6 A;  4B63 A;  4J2W A;  2J3N A;  5HYM A;  2GR3 A;  3UP4 A;  1L9C A;  2R0G A;  5IPY A;  3D8X A;  4UP3 A;  5KOX A;  4U8I A;  5IQ4 A;  2VQB A;  1EL8 A;  5M10 A;  1FL2 A;  4YKF A;  1W4X A;  3RED A;  4AP1 A;  2VVM A;  3KPF A;  2WPC A;  2GR2 A;  2O9Z A;  2TMD A;  2BCP A;  5EB5 A;  4YWO A;  2GF3 A;  2QA1 A;  2X8H A;  3GWD A;  5KVI A;  4C77 A;  4Z26 A;  4YSX A;  2Z5Y A;  4A99 A;  4I59 A;  2WU5 A;  1TYT A;  4U8O A;  4USR A;  1AOG A;  1N1P A;  1Z6L A;  2FJA A;  3LAD A;  1VG9 A;  3H8I A;  4ADW A;  1PXC A;  2Y6R A;  3CPH G;  1Q1R A;  1N4W A;  3CPJ G;  1CL0 A;  2X3N A;  2AAQ A;  2E4A A;  3ISH A;  1E39 A;  1GEU A;  3CGB A;  2R4J A;  1K0J A;  3GDP A;  3PVC A;  1IUV A;  1HYU A;  5FS6 A;  4CRT A;  2XVF A;  2V6O A;  2RGO A;  1F3P A;  1JEH A;  2H88 A;  2X99 A;  3S61 A;  3UKK A;  3QVR A;  3VR8 A;  1H7X A;  2XLP A;  4LU6 A;  1H6V A;  1H7W A;  1DNC A;  3UOZ A;  3FIM B;  1LQU A;  4CCR A;  2WDR A;  4H4X A;  1X31 B;  4TLZ A;  2E4G A;  4H2R A;  4TM1 A;  2ZBW A;  4H2N A;  4J31 A;  4TLX A;  3GRS A;  2V3A A;  2WDQ A;  4EMJ A;  1GES A;  4BV6 A;  1ZK7 A;  3BNU A;  3EAO A;  3H4K A;  1F6M A;  2C73 A;  2JB1 A;  3WE0 A;  2BXS A;  1E1N A;  2YLW A;  3NHO X;  2BC0 A;  4PAB A;  2XFP A;  3RP8 A;  4AP3 A;  5U1O A;  4H4R A;  1C0K A;  3AWI A;  4XWZ A;  1KDG A;  3P4R A;  4BUR A;  3UOX A;  2YAU A;  2R4E A;  4DGK A;  2YWL A;  1O5W A;  2GQF A;  4JY2 A;  1ZOY A;  2BK3 A;  3GDN A;  1CC6 A;  4OVI A;  4AOX A;  4C5O A;  4YSZ A;  4J57 A;  4A79 A;  4LA1 A;  3NTA A;  2ZZC A;  2XCG A;  2YVF A;  3AED A;  4J33 A;  4DSG A;  2C7G A;  4C3X A;  1KIF A;  4OCG A;  4CBQ A;  3CNS A;  1NHS A;  1Q9I A;  2YM1 A;  4EQR A;  3UOY A;  3ABV A;  2YM2 A;  4GCM A;  4Z25 A;  4MJW A;  2XYO A;  2JK6 A;  3FG2 P;  5HXI A;  5LV9 A;  1DOE A;  1DJN A;  2Y6Q A;  3UKA A;  3O0H A;  4USQ A;  1EVI A;  2NPX A;  1REO A;  1DOC A;  4GDP A;  3P1W A;  1GXF A;  3ZNN A;  1EL7 A;  4X4J A;  5FS7 A;  3RP7 A;  4EMW A;  3CIR A;  2X50 A;  2R46 A;  4U2S A;  1GET A;  2OLN A;  1GRF A;  1ZMC A;  4EQW A;  4YXD A;  2ARD A;  4YJG B; 
#chains in the Genus database with same CATH topology
 4G9K A;  4JNA A;  4AT2 A;  3GSI A;  3DJJ A;  2RGJ A;  3LZW A;  2XVH A;  4OPT A;  5GRT A;  4YTP A;  2ZZ0 A;  2V61 A;  3ITJ A;  4D04 A;  1D7L A;  3AE8 A;  1E1K A;  1GRE A;  3EF6 A;  1C0I A;  2RAB A;  3F8P A;  3ZDN A;  4ZN0 A;  4A5L A;  3IF9 A;  4NEV A;  4A6N A;  1JRX A;  4YJD A;  3KPK A;  4UDQ A;  2Q0L A;  2WOI A;  1CF3 A;  4QFC A;  4BJZ A;  2GV8 A;  3UOV A;  3T31 A;  1K4Q A;  3WGT A;  2B7S A;  1TDO A;  3HYW A;  1KSS A;  3GD4 A;  3S5W A;  2DKH A;  3V3O A;  3GMB A;  2VRL A;  1GV4 A;  5FS9 A;  2QAE A;  3AXB A;  2WOW A;  4U8N A;  5CKU A;  4H4Q A;  2WES A;  3Q9T A;  4O5U A;  3PO7 A;  4JY3 A;  5EBK A;  3DME A;  4Z2U A;  2C65 A;  1JRY A;  1KNP A;  1PXA A;  1GRT A;  3KD9 A;  4JDR A;  3GYI A;  3Q6J A;  3I6D A;  1UKV G;  3NN6 X;  3DH9 A;  3BI2 A;  1S3B A;  3VQR A;  5GSN A;  3DK8 A;  4BJY A;  3FMW A;  3ALJ A;  2PYX A;  2I0Z A;  4TM3 A;  1E1L A;  1FEC A;  2JB2 A;  4Z2R A;  2B76 A;  4H4Z A;  4GAV A;  1LVL A;  3JSK A;  5J7X A;  2V3B A;  4GDE A;  1L0V A;  4D03 A;  3RP6 A;  4Y4L A;  3T14 A;  3QSM A;  4GR1 A;  4OPU A;  1GTH A;  2C67 A;  3AE9 A;  5EB4 A;  1YY5 A;  2WDV A;  4U2L A;  1H86 A;  1P2H A;  1TYP A;  1GPE A;  1PBE A;  2AR8 A;  1NEN A;  3HYX A;  3NRN A;  2IVE A;  3COX A;  1M64 A;  3AD9 B;  2XLS A;  3AEB A;  1CJ2 A;  1D5T A;  2YG6 A;  3ZNP A;  2YLS A;  2DU8 A;  4CY8 A;  4GAP A;  1D7Y A;  2W0H A;  4B66 A;  1B5Q A;  4J36 A;  4DNA A;  3W4K A;  3NIX A;  4IVM B;  4I58 A;  1GER A;  2FJD A;  3OC4 A;  4YSY A;  3CGD A;  5JCI A;  3HZL A;  3AE7 A;  4FK1 C;  3T0K A;  3UKQ A;  3VRB A;  4BK1 A;  3CGE A;  3PS9 A;  5JCL A;  1DXL A;  1JU2 A;  4GF7 A;  3CND A;  1QJD A;  3VRD B;  1XPQ A;  1YQZ A;  2WET A;  3NLC A;  4U2T A;  1CC4 A;  2AQJ A;  4RSL A;  2VZ2 A;  3AYI A;  1TRB A;  4O5Q A;  4CCQ A;  1GOS A;  1KFY A;  1EBD A;  4TM4 A;  4XXG A;  4OPC A;  2CUL A;  2YVJ A;  4B64 A;  3BHK A;  4B65 A;  2WPF A;  1JRZ A;  2XFQ A;  1NG4 A;  1K0I A;  3E1T A;  1E1M A;  1TDE A;  2VOU A;  3AE4 A;  4UDP A;  4YKG A;  2EQ7 A;  2OAL A;  3SX6 A;  4A65 A;  2TPR A;  2VVL A;  4N9X A;  2WOV A;  5KVH A;  1FEA A;  2YR4 A;  2V60 A;  2R0P A;  4FK1 A;  1LTX R;  3LOV A;  3IHG A;  3QJ4 A;  2Q0K A;  3LXD A;  4K5R A;  2GEW A;  2BAC A;  2BS4 A;  3KLJ A;  1NG3 A;  3KVE A;  3G5S A;  5ER0 A;  4EMI A;  3AE3 A;  4NTC A;  1LV0 A;  3UCL A;  5KRQ A;  3UTE A;  1DJQ A;  2VRM A;  4YSH A;  2QCU A;  3IWA A;  3L1R A;  2C70 A;  2E1M A;  2YLZ A;  3NK0 X;  1C0L A;  1RYI A;  1OJT A;  2X8C A;  2XDO A;  3BHF A;  3II4 A;  3ALL A;  1DOD A;  4H4Y A;  3SZC A;  5U25 A;  1BZL A;  3KKJ A;  2EQ6 A;  2WHD A;  4C3Y A;  2YLX A;  1L9E A;  3BI5 A;  1JNR A;  4H2P A;  2NVK X;  4K8D A;  2IVD A;  2WS3 A;  1MO9 A;  1ZP0 A;  3IC9 A;  4IVO B;  4CY6 A;  1BF3 A;  4ECH A;  1E6E A;  2F5Z A;  1FCD A;  2WQY A;  3NYE A;  1Q1W A;  4OPI A;  3DJD A;  3G5R A;  3VR9 A;  2GQW A;  1YKJ A;  2BAB A;  3LZX A;  1GSN A;  3QFA A;  4YJF B;  4B69 A;  3GMC A;  5JCM A;  2JB3 A;  3NTD A;  3CUK A;  1GRG A;  1BGJ A;  2B9Y A;  3ICS A;  2VQ7 A;  2FBW A;  2DKI A;  4IA6 A;  4EIP A;  2WP9 A;  1F8W A;  3AE2 A;  3ATR A;  3CMM A;  2A8X A;  2GVC A;  1NDA A;  3ATQ A;  3P4Q A;  3QVP A;  4H50 A;  4EIQ A;  4A7A A;  4U8L A;  1IJH A;  2Q6U A;  1XDI A;  1DOB A;  4Y4M A;  2YQU A;  3ZNQ A;  2FJE A;  1PHH A;  5BRT A;  3CGC A;  4U8J A;  2E48 A;  2GR1 A;  2B9W A;  2BYB A;  2YLT A;  1GAL A;  5BUK A;  3QSS A;  4X9N A;  3DGH A;  1EL5 A;  3GD3 A;  1PBC A;  1TDN A;  1SEZ A;  1PBF A;  2JBV A;  3AYL A;  3CNP A;  1L9D A;  2YG3 A;  3G5Q A;  3M12 A;  1B4V A;  3AD8 B;  1RP0 A;  2Q7V A;  1O94 A;  3UTG A;  5C3J A;  1DDO A;  3DA1 A;  1V59 A;  3URH A;  3UTH A;  3CN8 A;  1LJ1 A;  3G3E A;  1ONF A;  4H7U A;  3GWF A;  3BNM A;  1O95 A;  2C72 A;  2OA1 A;  4H4W A;  1BKW A;  2RGH A;  3SZ0 A;  3AD7 B;  1VRQ B;  1TDF A;  2WU2 A;  1ZX9 A;  4II2 A;  2A89 A;  3AYJ A;  4U8K A;  3T37 A;  2BC1 A;  2A87 A;  1IUT A;  5KOW A;  3DJE A;  3UKP A;  4EQX A;  3GRT A;  3SYI A;  4YJH B;  1H82 A;  4B1B A;  1GT8 A;  2WEU A;  2H89 A;  4REK A;  4BK3 A;  5KMP A;  2XVI A;  3NH3 X;  5EOW A;  1S3E A;  2XLT A;  2YR6 A;  3CPI G;  1EL9 A;  3M13 A;  2XVJ A;  1NHQ A;  1IUU A;  3RNM A;  5KMS A;  1M6I A;  4QFD A;  3B3R A;  1N4U A;  4ZCD A;  1XHC A;  2C76 A;  4FX9 A;  3P4P A;  3UP5 A;  4ZCC A;  1CBO A;  4GRT A;  3K7T A;  5M0Z A;  4A9W A;  3RHA A;  4Z44 A;  2GMH A;  1GTE A;  3CNJ A;  2BK4 A;  1P2E A;  1H84 A;  2B7R A;  1B37 A;  2C3C A;  3NK1 X;  3K7Q X;  2GAH B;  4YTM A;  5KMR A;  1NHR A;  1VG0 A;  4K2X A;  4EQS A;  3AEA A;  1TDK A;  3QSE A;  1OJ9 A;  2Z5X A;  3LB8 A;  4U8P A;  1NPX A;  3AE1 A;  4ICY A;  2XLR A;  3NYF A;  3AEE A;  3LJP A;  3NNE A;  1ELI A;  1KNR A;  2ZZB A;  4YJF A;  1GRH A;  1LQT A;  1NAA A;  2XLU A;  4NTE A;  1NHP A;  3HYV A;  4H4T A;  1COY A;  1F8R A;  2JAE A;  2WP6 A;  1OJD A;  1VDC A;  4CNK A;  4LII A;  1F8S A;  1JOA A;  2BS2 A;  2APG A;  2HQM A;  1IUS A;  2V5Z A;  3K7M X;  3AEC A;  2OLO A;  2YR5 A;  3F8R A;  2VVL G;  1NEK A;  3NN0 X;  2WPE A;  3NT6 A;  5HHF A;  3GYJ A;  1YQ4 A;  5KMQ A;  2UZZ A;  4TM0 A;  4H4U A;  4WCT A;  1GRA A;  2YLR A;  2IID A;  5BVA A;  1C0P A;  4G74 A;  1IUW A;  3FBS A;  4NNJ A;  1GND A;  4G6H A;  1MOK A;  4KPR A;  4DSH A;  2E49 A;  1PXB A;  1CC2 A;  4H4P A;  1H83 A;  5J60 A;  1PN0 A;  4M52 A;  4YJG A;  1BWC A;  3ALM A;  5JCK A;  4PAA A;  3AEG A;  1Y0P A;  3SGL A;  3SM8 A;  1Y56 B;  1JNZ A;  4EM3 A;  3OZ2 A;  1LPF A;  3SY4 A;  3SZW A;  1ZY8 A;  4JN9 A;  4JNQ A;  5DBJ A;  3SFD A;  3UKL A;  1CHU A;  1QO8 A;  1ZOV A;  3NG7 X;  3AE6 A;  4KX6 A;  2WP5 A;  3NKS A;  1CJC A;  1D4D A;  4UDR A;  3AB1 A;  2R45 A;  4RG4 A;  2C66 A;  1DAO A;  4IA5 A;  5FMH A;  2EQ9 A;  1CJ3 A;  3ADA B;  2C4C A;  3ZNO A;  3ZYX A;  3C4N A;  1Y56 A;  3I3L A;  5FS8 A;  1D4C A;  4Z24 A;  3ICT A;  4FDC B;  5L46 A;  1MXT A;  2EQ8 A;  2OAM A;  1FEB A;  3W4I A;  2CDU A;  2CVJ A;  3NK2 X;  3NYC A;  3UKH A;  5TR3 A;  5BUL A;  1IUX A;  4OPG A;  2ACZ A;  2BXR A;  2XFO A;  3EPT A;  2FJB A;  1S2Q A;  4P9S A;  3H8L A;  5HY5 A;  5IQ1 A;  2BCG G;  2R0C A;  3DJG X;  3DK9 A;  4CNJ A;  1XAN A;  3P9U A;  2C75 A;  4RG3 A;  4H4V A;  4XWR A;  3UTF A;  5KWF A;  5JCN A;  2QA2 A;  2X8G A;  3CNT A;  1K0L A;  1B8S A;  1GRB A;  1E7P A;  1RSG A;  3DGZ A;  3UKF A;  5U63 A;  4AT0 A;  2C3D A;  2YG7 A;  3K30 A;  2E82 A;  4NTD A;  1PDH A;  4Z2T A;  3B6D A;  3P4S A;  4WX1 A;  1ZKQ A;  1CJ4 A;  3W4J A;  3EAN A;  4J56 A;  2GRT A;  4G6G A;  4A6N B;  2B9X A;  1VQW A;  1H81 A;  1PBB A;  4EM4 A;  2BK5 A;  4AOS A;  4C74 A;  3C96 A;  4K22 A;  3QFB A;  4E0V A;  3F8D A;  4H4S A;  4YT0 A;  4HA6 A;  4U8M A;  3ICR A;  4GUV A;  2WBA A;  4B68 A;  2YG5 A;  3V3N A;  2R9Z A;  4K7Z A;  4Z43 A;  2YVG A;  3SFE A;  3SQP A;  1AN9 A;  1KF6 A;  1BGN A;  1PJ7 A;  4NZH A;  3CTY A;  1PJ5 A;  3L8K A;  3AEF A;  2CFY A;  3V76 A;  4J34 A;  2GAG B;  3FPZ A;  1ZMD A;  1PS9 A;  1VE9 A;  4H2Q A;  4II3 A;  4HB9 A;  2PHH A;  1S2Y A;  2YG4 A;  4K5S A;  5KXJ A;  1N4V A;  2E5V A;  4YTN A;  2BA9 A;  4YJH A;  1OJC A;  4BK2 A;  2C64 A;  4JQ9 A;  5C2T A;  3BI4 A;  1QLB A;  5CQF A;  2XFU A;  3KA7 A;  4OPL A;  4APN A;  2XFN A;  2JKC A;  3D1C A;  2XVE A;  2GR0 A;  3KU9 A;  3R9U A;  3IHM A;  3AE5 A;  3DK4 A;  3NGC X;  2BS3 A;  4B67 A;  1OJA A;  1FOH A;  3M0O A;  2GH5 A;  4Y4N A;  3C4A A;  1YQ3 A;  2GB0 A;  4NEW A;  1D4E A;  1PBD A;  4X9M A;  1KSU A;  1ZDL A;  2GMJ A;  4OPD A;  4IV9 A;  1PJ6 A;  4B63 A;  4J2W A;  5HYM A;  2J3N A;  2GR3 A;  3UP4 A;  1L9C A;  2R0G A;  5IPY A;  3D8X A;  4UP3 A;  5KOX A;  4U8I A;  5IQ4 A;  2VQB A;  1EL8 A;  5M10 A;  1FL2 A;  4YKF A;  1W4X A;  3RED A;  4AP1 A;  2VVM A;  3KPF A;  2WPC A;  2GR2 A;  5KNL A;  2O9Z A;  2TMD A;  3SXI A;  2BCP A;  5EB5 A;  4YWO A;  2GF3 A;  2QA1 A;  2X8H A;  3GWD A;  5KVI A;  4C77 A;  4Z26 A;  4YSX A;  2Z5Y A;  4A99 A;  4I59 A;  2WU5 A;  1TYT A;  4U8O A;  4USR A;  1AOG A;  1N1P A;  1Z6L A;  2FJA A;  3LAD A;  1VG9 A;  3SZF A;  3H8I A;  4ADW A;  1PXC A;  2Y6R A;  3CPH G;  1Q1R A;  1N4W A;  3CPJ G;  1CL0 A;  2X3N A;  2AAQ A;  2E4A A;  3ISH A;  1E39 A;  1GEU A;  3CGB A;  2R4J A;  1K0J A;  3GDP A;  3PVC A;  1IUV A;  1HYU A;  5FS6 A;  4CRT A;  2XVF A;  2V6O A;  2RGO A;  3T2K A;  1F3P A;  1JEH A;  2H88 A;  2X99 A;  2BRY A;  3S61 A;  3QVR A;  3UKK A;  3VR8 A;  1H7X A;  2XLP A;  4LU6 A;  1H6V A;  1H7W A;  3T2Y A;  1DNC A;  3UOZ A;  3FIM B;  1LQU A;  4CCR A;  2WDR A;  4H4X A;  1X31 B;  4TLZ A;  4H2R A;  2E4G A;  4TM1 A;  4H2N A;  2ZBW A;  4J31 A;  4TLX A;  3GYX A;  3GRS A;  2V3A A;  2WDQ A;  4EMJ A;  1GES A;  4BV6 A;  1ZK7 A;  3BNU A;  3EAO A;  3H4K A;  4NWZ A;  1F6M A;  2C73 A;  2JB1 A;  3WE0 A;  2BRA A;  2BXS A;  1E1N A;  2YLW A;  3NHO X;  2BC0 A;  4PAB A;  3RP8 A;  2XFP A;  4AP3 A;  5U1O A;  4H4R A;  1C0K A;  3AWI A;  4XWZ A;  1KDG A;  3P4R A;  4BUR A;  3UOX A;  2YAU A;  2R4E A;  4DGK A;  2YWL A;  1O5W A;  4JY2 A;  2GQF A;  1ZOY A;  2BK3 A;  3GDN A;  1CC6 A;  4OVI A;  4AOX A;  4C5O A;  4YSZ A;  4J57 A;  4A79 A;  4LA1 A;  3NTA A;  2ZZC A;  2XCG A;  2YVF A;  3AED A;  4J33 A;  4DSG A;  2C7G A;  4G73 A;  4C3X A;  1KIF A;  4OCG A;  3T2Z A;  4CBQ A;  3CNS A;  1NHS A;  1Q9I A;  2YM1 A;  4EQR A;  3UOY A;  3ABV A;  2YM2 A;  4GCM A;  4Z25 A;  4MJW A;  2XYO A;  2JK6 A;  3FG2 P;  5HXI A;  5LV9 A;  1DOE A;  1DJN A;  2Y6Q A;  3UKA A;  3O0H A;  4USQ A;  1EVI A;  2NPX A;  3VRA A;  1REO A;  1DOC A;  4GDP A;  3P1W A;  1GXF A;  3ZNN A;  1EL7 A;  4X4J A;  5FS7 A;  3RP7 A;  4EMW A;  3CIR A;  2X50 A;  2R46 A;  4U2S A;  1GET A;  2OLN A;  1GRF A;  1ZMC A;  4EQW A;  4YXD A;  2ARD A;  4YJG B; 
#chains in the Genus database with same CATH homology
 4G9K A;  4JNA A;  4AT2 A;  3GSI A;  3DJJ A;  2RGJ A;  3LZW A;  2XVH A;  4OPT A;  5GRT A;  4YTP A;  2ZZ0 A;  2V61 A;  3ITJ A;  4D04 A;  1D7L A;  3AE8 A;  1E1K A;  1GRE A;  3EF6 A;  1C0I A;  2RAB A;  3F8P A;  3ZDN A;  4ZN0 A;  4A5L A;  3IF9 A;  4NEV A;  4A6N A;  1JRX A;  4YJD A;  3KPK A;  4UDQ A;  2Q0L A;  2WOI A;  1CF3 A;  4QFC A;  4BJZ A;  2GV8 A;  3UOV A;  3T31 A;  1K4Q A;  3WGT A;  2B7S A;  1TDO A;  3HYW A;  1KSS A;  3GD4 A;  3S5W A;  2DKH A;  3V3O A;  3GMB A;  2VRL A;  1GV4 A;  5FS9 A;  2QAE A;  3AXB A;  2WOW A;  4U8N A;  5CKU A;  4H4Q A;  2WES A;  3Q9T A;  4O5U A;  3PO7 A;  4JY3 A;  5EBK A;  3DME A;  4Z2U A;  2C65 A;  1JRY A;  1KNP A;  1PXA A;  1GRT A;  3KD9 A;  4JDR A;  3GYI A;  3Q6J A;  3I6D A;  1UKV G;  3NN6 X;  3DH9 A;  3BI2 A;  1S3B A;  3VQR A;  5GSN A;  3DK8 A;  4BJY A;  3FMW A;  3ALJ A;  2PYX A;  2I0Z A;  4TM3 A;  1E1L A;  1FEC A;  2JB2 A;  4Z2R A;  2B76 A;  4H4Z A;  4GAV A;  1LVL A;  3JSK A;  5J7X A;  2V3B A;  4GDE A;  1L0V A;  4D03 A;  3RP6 A;  4Y4L A;  3T14 A;  3QSM A;  4GR1 A;  4OPU A;  1GTH A;  2C67 A;  3AE9 A;  5EB4 A;  1YY5 A;  2WDV A;  4U2L A;  1H86 A;  1P2H A;  1TYP A;  1GPE A;  2AR8 A;  1PBE A;  1NEN A;  3HYX A;  3NRN A;  2IVE A;  3COX A;  1M64 A;  3AD9 B;  2XLS A;  3AEB A;  1CJ2 A;  1D5T A;  2YG6 A;  3ZNP A;  2YLS A;  2DU8 A;  4CY8 A;  4GAP A;  1D7Y A;  2W0H A;  4B66 A;  1B5Q A;  4J36 A;  4DNA A;  3W4K A;  3NIX A;  4IVM B;  4I58 A;  1GER A;  2FJD A;  3OC4 A;  4YSY A;  3CGD A;  5JCI A;  3HZL A;  3AE7 A;  4FK1 C;  3T0K A;  3UKQ A;  3VRB A;  4BK1 A;  3CGE A;  3PS9 A;  5JCL A;  1DXL A;  1JU2 A;  4GF7 A;  3CND A;  1QJD A;  3VRD B;  1XPQ A;  1YQZ A;  2WET A;  3NLC A;  4U2T A;  1CC4 A;  2AQJ A;  4RSL A;  2VZ2 A;  3AYI A;  1TRB A;  4O5Q A;  4CCQ A;  1GOS A;  1KFY A;  1EBD A;  4TM4 A;  4XXG A;  4OPC A;  2CUL A;  2YVJ A;  4B64 A;  3BHK A;  4B65 A;  2WPF A;  1JRZ A;  2XFQ A;  1NG4 A;  1K0I A;  1E1M A;  1TDE A;  3AE4 A;  2VOU A;  3E1T A;  4UDP A;  4YKG A;  2EQ7 A;  2OAL A;  3SX6 A;  4A65 A;  2TPR A;  2VVL A;  4N9X A;  2WOV A;  5KVH A;  1FEA A;  2YR4 A;  2V60 A;  2R0P A;  4FK1 A;  1LTX R;  3LOV A;  3IHG A;  3QJ4 A;  2Q0K A;  3LXD A;  4K5R A;  2GEW A;  2BAC A;  2BS4 A;  3KLJ A;  1NG3 A;  3KVE A;  3G5S A;  5ER0 A;  4EMI A;  3AE3 A;  4NTC A;  1LV0 A;  3UCL A;  5KRQ A;  3UTE A;  1DJQ A;  2VRM A;  4YSH A;  2QCU A;  3IWA A;  3L1R A;  2C70 A;  2E1M A;  2YLZ A;  3NK0 X;  1C0L A;  1RYI A;  1OJT A;  2X8C A;  2XDO A;  3BHF A;  3II4 A;  3ALL A;  1DOD A;  4H4Y A;  3SZC A;  5U25 A;  1BZL A;  3KKJ A;  2EQ6 A;  2WHD A;  4C3Y A;  2YLX A;  1L9E A;  3BI5 A;  1JNR A;  2NVK X;  4H2P A;  4K8D A;  2IVD A;  2WS3 A;  1MO9 A;  1ZP0 A;  3IC9 A;  4IVO B;  4CY6 A;  1BF3 A;  4ECH A;  1E6E A;  2F5Z A;  1FCD A;  2WQY A;  3NYE A;  1Q1W A;  4OPI A;  3DJD A;  3G5R A;  3VR9 A;  2GQW A;  1YKJ A;  2BAB A;  3LZX A;  1GSN A;  3QFA A;  4YJF B;  4B69 A;  3GMC A;  5JCM A;  2JB3 A;  3NTD A;  3CUK A;  1GRG A;  1BGJ A;  2B9Y A;  3ICS A;  2VQ7 A;  2FBW A;  2DKI A;  3AE2 A;  2WP9 A;  3ATR A;  1F8W A;  3CMM A;  3P4Q A;  4IA6 A;  2A8X A;  2GVC A;  1NDA A;  3ATQ A;  3QVP A;  4H50 A;  4A7A A;  4EIQ A;  4U8L A;  1IJH A;  2Q6U A;  1XDI A;  1DOB A;  4Y4M A;  2YQU A;  3ZNQ A;  2FJE A;  1PHH A;  5BRT A;  3CGC A;  4U8J A;  2E48 A;  2GR1 A;  2B9W A;  2BYB A;  2YLT A;  1GAL A;  5BUK A;  3QSS A;  4X9N A;  3DGH A;  1EL5 A;  3GD3 A;  1PBC A;  1TDN A;  1SEZ A;  1PBF A;  2JBV A;  3AYL A;  3CNP A;  1L9D A;  2YG3 A;  3G5Q A;  3M12 A;  1B4V A;  3AD8 B;  1RP0 A;  2Q7V A;  1O94 A;  3UTG A;  5C3J A;  1DDO A;  3DA1 A;  1V59 A;  3URH A;  3UTH A;  3CN8 A;  1LJ1 A;  3G3E A;  1ONF A;  4H7U A;  3GWF A;  3BNM A;  1O95 A;  2C72 A;  2OA1 A;  4H4W A;  1BKW A;  2RGH A;  3SZ0 A;  3AD7 B;  1VRQ B;  1TDF A;  2WU2 A;  1ZX9 A;  4II2 A;  2A89 A;  3AYJ A;  4U8K A;  3T37 A;  2BC1 A;  2A87 A;  1IUT A;  5KOW A;  3DJE A;  3UKP A;  4EQX A;  3GRT A;  3SYI A;  4YJH B;  1H82 A;  4B1B A;  1GT8 A;  2WEU A;  2H89 A;  4REK A;  4BK3 A;  5KMP A;  2XVI A;  3NH3 X;  5EOW A;  1S3E A;  2XLT A;  2YR6 A;  3CPI G;  1EL9 A;  3M13 A;  2XVJ A;  1NHQ A;  1IUU A;  3RNM A;  5KMS A;  1M6I A;  4QFD A;  3B3R A;  1N4U A;  4ZCD A;  1XHC A;  2C76 A;  4FX9 A;  3P4P A;  3UP5 A;  4ZCC A;  1CBO A;  4GRT A;  3K7T A;  5M0Z A;  4A9W A;  3RHA A;  4Z44 A;  1GTE A;  2GMH A;  3CNJ A;  2BK4 A;  1P2E A;  1H84 A;  2B7R A;  1B37 A;  2C3C A;  3NK1 X;  3K7Q X;  2GAH B;  4YTM A;  5KMR A;  1NHR A;  1VG0 A;  4K2X A;  4EQS A;  3AEA A;  1TDK A;  3QSE A;  1OJ9 A;  2Z5X A;  3LB8 A;  4U8P A;  1NPX A;  3AE1 A;  4ICY A;  2XLR A;  3NYF A;  3AEE A;  3LJP A;  3NNE A;  1ELI A;  1KNR A;  2ZZB A;  4YJF A;  1GRH A;  1LQT A;  1NAA A;  2XLU A;  4NTE A;  1NHP A;  3HYV A;  4H4T A;  1COY A;  1F8R A;  2JAE A;  2WP6 A;  1OJD A;  1VDC A;  4CNK A;  4LII A;  1F8S A;  1JOA A;  2BS2 A;  2APG A;  2HQM A;  1IUS A;  2V5Z A;  3K7M X;  3AEC A;  2OLO A;  2YR5 A;  3F8R A;  2VVL G;  1NEK A;  3NN0 X;  2WPE A;  3NT6 A;  5HHF A;  3GYJ A;  1YQ4 A;  5KMQ A;  2UZZ A;  4TM0 A;  4H4U A;  4WCT A;  1GRA A;  2YLR A;  2IID A;  5BVA A;  1C0P A;  4G74 A;  1IUW A;  3FBS A;  4NNJ A;  1GND A;  4G6H A;  1MOK A;  4KPR A;  4DSH A;  2E49 A;  1PXB A;  1CC2 A;  4H4P A;  1H83 A;  5J60 A;  1PN0 A;  4M52 A;  4YJG A;  1BWC A;  3ALM A;  5JCK A;  4PAA A;  3AEG A;  1Y0P A;  3SGL A;  3SM8 A;  1Y56 B;  1JNZ A;  4EM3 A;  3OZ2 A;  1LPF A;  3SY4 A;  3SZW A;  1ZY8 A;  4JN9 A;  4JNQ A;  5DBJ A;  3SFD A;  3UKL A;  1CHU A;  1QO8 A;  1ZOV A;  3NG7 X;  3AE6 A;  4KX6 A;  2WP5 A;  3NKS A;  1CJC A;  1D4D A;  4UDR A;  3AB1 A;  2R45 A;  4RG4 A;  2C66 A;  1DAO A;  4IA5 A;  5FMH A;  2EQ9 A;  1CJ3 A;  3ADA B;  2C4C A;  3ZNO A;  3ZYX A;  3C4N A;  1Y56 A;  3I3L A;  5FS8 A;  1D4C A;  4Z24 A;  3ICT A;  4FDC B;  5L46 A;  1MXT A;  2EQ8 A;  2OAM A;  1FEB A;  3W4I A;  2CDU A;  2CVJ A;  3NK2 X;  3NYC A;  3UKH A;  5TR3 A;  5BUL A;  1IUX A;  4OPG A;  2ACZ A;  2BXR A;  2XFO A;  3EPT A;  2FJB A;  1S2Q A;  4P9S A;  3H8L A;  5HY5 A;  5IQ1 A;  2BCG G;  2R0C A;  3DJG X;  3DK9 A;  4CNJ A;  1XAN A;  3P9U A;  2C75 A;  4RG3 A;  4H4V A;  4XWR A;  3UTF A;  5KWF A;  5JCN A;  2QA2 A;  2X8G A;  3CNT A;  1K0L A;  1B8S A;  1GRB A;  1E7P A;  1RSG A;  3DGZ A;  3UKF A;  5U63 A;  4AT0 A;  2C3D A;  2YG7 A;  3K30 A;  2E82 A;  4NTD A;  1PDH A;  4Z2T A;  3B6D A;  3P4S A;  4WX1 A;  1ZKQ A;  1CJ4 A;  3W4J A;  3EAN A;  4J56 A;  2GRT A;  4G6G A;  4A6N B;  2B9X A;  1VQW A;  1H81 A;  1PBB A;  4EM4 A;  2BK5 A;  4AOS A;  4C74 A;  3C96 A;  4K22 A;  3QFB A;  4E0V A;  3F8D A;  4H4S A;  4YT0 A;  4HA6 A;  4U8M A;  3ICR A;  4GUV A;  2WBA A;  4B68 A;  2YG5 A;  3V3N A;  2R9Z A;  4K7Z A;  4Z43 A;  2YVG A;  3SFE A;  3SQP A;  1AN9 A;  1KF6 A;  1BGN A;  1PJ7 A;  4NZH A;  3CTY A;  1PJ5 A;  3L8K A;  3AEF A;  2CFY A;  3V76 A;  4J34 A;  2GAG B;  3FPZ A;  1ZMD A;  1PS9 A;  1VE9 A;  4H2Q A;  4II3 A;  4HB9 A;  2PHH A;  1S2Y A;  2YG4 A;  4K5S A;  5KXJ A;  1N4V A;  2E5V A;  4YTN A;  4EIP A;  2BA9 A;  4YJH A;  1OJC A;  2C64 A;  4BK2 A;  4JQ9 A;  5C2T A;  3BI4 A;  1QLB A;  5CQF A;  2XFU A;  3KA7 A;  4OPL A;  4APN A;  2XFN A;  2JKC A;  3D1C A;  2XVE A;  2GR0 A;  3KU9 A;  3R9U A;  3AE5 A;  3IHM A;  3DK4 A;  3NGC X;  2BS3 A;  4B67 A;  1OJA A;  1FOH A;  3M0O A;  2GH5 A;  4Y4N A;  3C4A A;  1YQ3 A;  2GB0 A;  4NEW A;  1D4E A;  1PBD A;  4X9M A;  1KSU A;  1ZDL A;  2GMJ A;  4OPD A;  4IV9 A;  1PJ6 A;  4B63 A;  4J2W A;  2J3N A;  5HYM A;  2GR3 A;  3UP4 A;  1L9C A;  2R0G A;  5IPY A;  3D8X A;  4UP3 A;  5KOX A;  4U8I A;  5IQ4 A;  2VQB A;  1EL8 A;  5M10 A;  1FL2 A;  4YKF A;  1W4X A;  3RED A;  4AP1 A;  2VVM A;  3KPF A;  2WPC A;  2GR2 A;  5KNL A;  2O9Z A;  2TMD A;  3SXI A;  2BCP A;  5EB5 A;  4YWO A;  2GF3 A;  2QA1 A;  2X8H A;  3GWD A;  5KVI A;  4C77 A;  4Z26 A;  4YSX A;  2Z5Y A;  4A99 A;  4I59 A;  2WU5 A;  1TYT A;  4U8O A;  4USR A;  1AOG A;  1N1P A;  1Z6L A;  2FJA A;  3LAD A;  1VG9 A;  3SZF A;  3H8I A;  4ADW A;  1PXC A;  2Y6R A;  3CPH G;  1Q1R A;  1N4W A;  3CPJ G;  1CL0 A;  2X3N A;  2AAQ A;  2E4A A;  3ISH A;  1E39 A;  1GEU A;  3CGB A;  2R4J A;  1K0J A;  3GDP A;  3PVC A;  1IUV A;  1HYU A;  5FS6 A;  4CRT A;  2XVF A;  2V6O A;  2RGO A;  3T2K A;  1F3P A;  1JEH A;  2H88 A;  2X99 A;  2BRY A;  3S61 A;  3QVR A;  3UKK A;  3VR8 A;  1H7X A;  2XLP A;  4LU6 A;  1H6V A;  1H7W A;  3T2Y A;  1DNC A;  3UOZ A;  3FIM B;  1LQU A;  4CCR A;  2WDR A;  4H4X A;  1X31 B;  4TLZ A;  2E4G A;  4H2R A;  4TM1 A;  2ZBW A;  4H2N A;  4J31 A;  4TLX A;  3GYX A;  3GRS A;  2V3A A;  2WDQ A;  4EMJ A;  1GES A;  4BV6 A;  1ZK7 A;  3BNU A;  3EAO A;  3H4K A;  4NWZ A;  1F6M A;  2C73 A;  2JB1 A;  3WE0 A;  2BRA A;  2BXS A;  1E1N A;  2YLW A;  3NHO X;  2BC0 A;  4PAB A;  2XFP A;  3RP8 A;  4AP3 A;  5U1O A;  4H4R A;  1C0K A;  3AWI A;  4XWZ A;  1KDG A;  3P4R A;  4BUR A;  3UOX A;  2YAU A;  2R4E A;  4DGK A;  2YWL A;  1O5W A;  2GQF A;  4JY2 A;  1ZOY A;  2BK3 A;  3GDN A;  1CC6 A;  4OVI A;  4AOX A;  4C5O A;  4YSZ A;  4J57 A;  4A79 A;  4LA1 A;  3NTA A;  2ZZC A;  2XCG A;  2YVF A;  3AED A;  4J33 A;  4DSG A;  2C7G A;  4G73 A;  4C3X A;  1KIF A;  4OCG A;  3T2Z A;  4CBQ A;  3CNS A;  1NHS A;  1Q9I A;  2YM1 A;  4EQR A;  3UOY A;  3ABV A;  2YM2 A;  4GCM A;  4Z25 A;  4MJW A;  2XYO A;  2JK6 A;  3FG2 P;  5HXI A;  5LV9 A;  1DOE A;  1DJN A;  2Y6Q A;  3UKA A;  3O0H A;  4USQ A;  1EVI A;  2NPX A;  3VRA A;  1REO A;  1DOC A;  4GDP A;  3P1W A;  1GXF A;  3ZNN A;  1EL7 A;  4X4J A;  5FS7 A;  3RP7 A;  4EMW A;  3CIR A;  2X50 A;  2R46 A;  4U2S A;  1GET A;  2OLN A;  1GRF A;  1ZMC A;  4EQW A;  4YXD A;  2ARD A;  4YJG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...