3NYCA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 126
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nycA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nycA01
4J33A 4RG3A 3SM8A 2BXRA 1S3EA 4NTDA 2YM1A 4H4UA 1GTEA 4XWRA 1OJ9A 4IVMB 4YJGA 4YSYA 2DKHA 1NHQA 2CULA 3CTYA 3RP8A 4IA5A 1PS9A 1K0JA 3I3LA 4YJFB 1KSSA 2BCPA 1H7XA 3UOZA 1DOBA 1EL5A 4BK3A 1E6EA 1D7LA 1ZX9A 4K22A 4CBQA 4U8NA 4YJDA 1COYA 2EQ8A 3G5RA 2OA1A 4GDPA 2V60A 4Z43A 1NAAA 3QFAA 4LU6A 2XCGA 1GRGA 1NDAA 2V3BA 1YQ3A 3ATQA 2I0ZA 3K7TA 1NHSA 2NPXA 5JCNA 3PVCA 4MJWA 3BI4A 3AE7A 4OPTA 4DGKA 1QLBA 4LA1A 4AOSA 5BUKA 4YJHA 3DH9A 3AE8A 3QSEA 1UKVG 4H2RA 1PXBA 2PHHA 5U1OA 3AE5A 3FBSA 3GDNA 3KD9A 1CL0A 1EL8A 3NIXA 3NK0X 2XFOA 3O0HA 4H2NA 4BJZA 5IQ1A 3UCLA 2BS4A 2GAGB 1W4XA 3Q9TA 4EMJA 4XWZA 4EIQA 4USRA 4IVOB 2TPRA 4IA6A 2FJBA 3ALMA 4C74A 2GQWA 1B8SA 1NG4A 1JNZA 3B3RA 3CNTA 3IHGA 5JCKA 2X50A 4C77A 2RGOA 1PXAA 2VRMA 3GMBA 1LVLA 4KX6A 3AEDA 2FBWA 3CUKA 2WU5A 3NKSA 1JEHA 2WP9A 3AE6A 1PBDA 1DOCA 4YJGB 1YY5A 3LOVA 2GV8A 3DK8A 2GMJA 2WOWA 2C70A 3URHA 3LB8A 1FL2A 1GERA 1ZDLA 2BXSA 3CNPA 2GAHB 3CGDA 3UKLA 3ATRA 3NTAA 4BJYA 5J7XA 3AWIA 4I59A 1XDIA 1TYPA 2YR6A 3P4PA 4H4SA 3ZNPA 1REOA 4Y4MA 3VRBA 5FS9A 2X8HA 2XDOA 2UZZA 4AOXA 4C3XA 1GPEA 1B4VA 1MO9A 4TM0A 3OC4A 2ZZ0A 4DNAA 4DSHA 4Z2TA 4BV6A 1H84A 3VR9A 2VOUA 4YJHB 2YG5A 1O94A 4B66A 3M0OA 2YLXA 3CPJG 3BNMA 4ZCDA 4Z25A 5TR3A 1D7YA 3G5SA 3UKFA 2YWLA 1O5WA 2FJAA 3LZWA 4OCGA 5IQ4A 1GEUA 1PJ5A 3V76A 3S61A 3SFEA 2AR8A 1TDKA 4EQRA 1GRFA 2WEUA 2XLTA 4U8OA 2XLSA 3IHMA 1PN0A 1PBBA 1JOAA 2GQFA 3CNJA 2X8CA 3M12A 4CCRA 1L0VA 4ZN0A 1JRXA 4FX9A 5HYMA 1VRQB 1Y0PA 4NEWA 3CPHG 4B65A 1NG3A 4YXDA 1PBEA 4NEVA 1NEKA 4J57A 5KOWA 1ZKQA 3BNUA 3F8RA 2JB3A 4H4VA 4Z26A 2J3NA 4CY8A 3EAOA 2GH5A 2XVIA 2YR5A 3GD3A 3E1TA 1CJ3A 3NK1X 4PABA 1E7PA 4USQA 4ADWA 2GVCA 4EM4A 2YR4A 3UTHA 1N4WA 2C65A 4J56A 2WP6A 2C64A 4OPCA 5GSNA 2Q6UA 4Y4LA 1EVIA 4KPRA 2FJDA 4GDEA 1D5TA 1PXCA 1M6IA 2V3AA 1FEAA 2GEWA 1K4QA 5EOWA 2GR0A 4YKFA 3GDPA 3RP7A 1GRHA 1B5QA 3ICTA 1KF6A 1X31B 1JU2A 1CC2A 1GESA 2IIDA 1Y56B 5CQFA 3BHKA 3P4SA 1L9DA 4CCQA 4J36A 3ITJA 2Q7VA 1TRBA 4H50A 3ABVA 2JB1A 1GNDA 1V59A 2YM2A 4QFDA 3EANA 3LJPA 4EM3A 2JK6A 2YG3A 1F8RA 2R45A 1EBDA 1IUSA 1BGNA 1IJHA 2BCGG 3UP5A 4Z2RA 1NENA 4FK1C 3CGEA 1AOGA 1DJNA 1NPXA 2CVJA 4H4QA 5EB4A 5KRQA 2XFNA 3DGZA 4B67A 4M52A 3UKKA 3B6DA 1C0LA 1P2EA 4EQWA 3QFBA 2WETA 1SEZA 3W4IA 2WOVA 2WPCA 1IUUA 2XFQA 3AE9A 5ER0A 4BURA 1GOSA 2H88A 4EMWA 3DJJA 4RSLA 4A79A 2B9YA 1AN9A 2GF3A 4JN9A 2ZZCA 4JDRA 1E1MA 1FECA 3K30A 2EQ9A 3QJ4A 1OJCA 3AD9B 3AE2A 3L1RA 1N4VA 3VR8A 1M64A 1VE9A 1E39A 3GWDA 2BC0A 3FIMB 3NT6A 3P1WA 4FK1A 5HXIA 4H4WA 4CY6A 4YWOA 1OJDA 1VDCA 4GCMA 4AT0A 4YSHA 3QVPA 3GRSA 1MOKA 3IF9A 4K5RA 1TDEA 4BK1A 1H82A 2VVMA 2E82A 4REKA 1DXLA 4A7AA 1KFYA 3ZDNA 4U8IA 2B7SA 2QA1A 2WP5A 2BK5A 2VZ2A 3AEFA 4TM4A 1D4EA 3AECA 5FS7A 4B1BA 4CNJA 2C7GA 3RP6A 4OPDA 2OALA 2XVJA 5J60A 3HZLA 2C72A 2H89A 4JNQA 1E1KA 1GREA 1TDNA 1B37A 1L9CA 4C3YA 2BK3A 2RABA 5L46A 1JRYA 1RYIA 4HB9A 2APGA 5GRTA 4OVIA 1IUWA 3QVRA 1HYUA 2GR2A 1C0IA 1CC4A 3K7MX 4QFCA 2WS3A 4J2WA 4AP3A 4X9NA 3FG2P 4EIPA 1DDOA 3NYFA 1PBCA 1FEBA 3BI5A 5KVHA 3NYEA 3RNMA 5KXJA 1CJ4A 2R9ZA 2R4JA 2W0HA 3ADAB 4YSZA 1IUTA 1PJ6A 3CGBA 1TDOA 2RGJA 4H2PA 4AP1A 4U2LA 3EF6A 2CDUA 2OLNA 2WHDA 3AD7B 4H4ZA 4A65A 1H7WA 4ICYA 1TDFA 4O5UA 3UKPA 1TYTA 3KPFA 3V3NA 4UP3A 3NHOX 1DNCA 3UTGA 3WE0A 1NHRA 1DAOA 3NYCA 3LZXA 1BGJA 4K7ZA 1DODA 1S3BA 3ALLA 2F5ZA 2BC1A 4B64A 5BRTA 1FOHA 2VRLA 2R46A 2WESA 2HQMA 3H4KA 4A6NA 2PYXA 2O9ZA 3AXBA 4B69A 4UDQA 1IUXA 3OZ2A 5EBKA 1ELIA 2A87A 4RG4A 3C96A 1N1PA 4O5QA 2XLUA 4J31A 2JBVA 1YQ4A 3NLCA 2VVLA 1RP0A 2XFUA 2IVEA 3SQPA 3CNSA 4U8LA 2E49A 3WGTA 3H8IA 4JY2A 5C2TA 4CRTA 1MXTA 2YAUA 2EQ6A 3PS9A 3DJDA 2BABA 3NK2X 2Q0LA 1Q1WA 4UDRA 2GRTA 1ZMDA 2YLTA 3AYLA 5U25A 5JCMA 3ZNQA 1CJCA 1GALA 1LQTA 3UP4A 4J34A 4TLXA 2X3NA 2XLPA 3GRTA 4A5LA 2WPFA 2C3CA 5FS6A 4H4PA 4DSGA 1NHPA 2WDRA 1KNPA 4B63A 5HY5A 3KKJA 3VRAA 1JNRA 2BYBA 1CC6A 4AT2A 3DK9A 2JB2A 5M0ZA 4APNA 3UOXA 2BACA 4H2QA 4TLZA 1H6VA 3VQRA 1E1LA 2WU2A 4H4YA 1LQUA 1K0LA 3GMCA 2YVFA 4NTEA 2E48A 2R4EA 1GRTA 3F8PA 4GUVA 2R0GA 1C0PA 3AD8B 5KOXA 1Z6LA 3UOVA 3F8DA 3AB1A 3ZYXA 5U63A 3II4A 2ARDA 2BS3A 2V6OA 2XVFA 4WX1A 4E0VA 1F3PA 3QSSA 2YVGA 1C0KA 1FCDA 5CKUA 1S2YA 1ZK7A 4A6NB 4D03A 3C4AA 2WOIA 3AYJA 3GD4A 3GYIA 3CNDA 4TM1A 2AQJA 3KLJA 1DJQA 1CHUA 3ALJA 3IWAA 5FMHA 3UTFA 4WCTA 3L8KA 3REDA 1CJ2A 3DGHA 4JY3A 1H86A 5KWFA 1H83A 3NH3X 5JCLA 1F8SA 3QSMA 2GMHA 5BULA 1KIFA 3IC9A 2YLRA 4YKGA 4H7UA 3V3OA 2Y6RA 3GWFA 3ISHA 1LV0A 3PO7A 1LTXR 5LV9A 1P2HA 4TM3A 1EL9A 2GR3A 3G5QA 3AE1A 2C67A 2B9XA 1PHHA 3C4NA 2X8GA 2Z5YA 3DJGX 4EQSA 3KU9A 1DOEA 3NNEA 3CIRA 3K7QX 1CF3A 1KSUA 4PAAA 2BK4A 4Z44A 2V61A 2YVJA 2JKCA 4FDCB 4K2XA 3UKHA 3BHFA 2DKIA 4IV9A 3NN0X 3LXDA 3M13A 2E1MA 4ECHA 1XANA 1BWCA 4U8JA 3VRDB 2YG6A 2QAEA 1ZOYA 3AEBA 2E5VA 3COXA 1BKWA 1QJDA 2JAEA 2XVHA 2TMDA 1GSNA 2Y6QA 2YG4A 3BI2A 3ICRA 4CNKA 2R0PA 2WBAA 5HHFA 1PDHA 4HA6A 2VVLG 3LADA 4U2SA 1F6MA 3NTDA 1VQWA 3DJEA 2E4AA 4GRTA 2VQBA 2YLWA 1K0IA 2OAMA 5DBJA 2E4GA 2R0CA 4XXGA 4K5SA 4NZHA 1GRAA 3D8XA 3P4RA 4X4JA 2QCUA 2XVEA 4H4XA 1KDGA 1LJ1A 3NG7X 3NRNA 4YTMA 1ONFA 1F8WA 1XPQA 5FS8A 2GR1A 3AEAA 4N9XA 1JRZA 1OJTA 2B76A 2OLOA 4Z2UA 2CFYA 2Q0KA 2WPEA 2BA9A 2NVKX 1GRBA 4C5OA 3UKQA 2WDQA 3G3EA 1OJAA 1O95A 2IVDA 3SFDA 4I58A 1XHCA 1Y56A 2B9WA 4JNAA 2C76A 2V5ZA 4B68A 1BF3A 1CBOA 3DA1A 2YLZA 1QO8A 3AEEA 3T37A 4EQXA 4YSXA 4OPGA 2ACZA 1ZP0A 1ZMCA 4OPIA 3KA7A 4OPLA 1D4DA 3JSKA 4ZCCA 2XYOA 3P4QA 4GR1A 1ZY8A 3RHAA 2C73A 2GB0A 3CGCA 1GT8A 3EPTA 4K8DA 5BVAA 1VG0A 4H4RA 4YJFA 1L9EA 3W4KA 2VQ7A 3ICSA 2DU8A 3P9UA 5EB5A 4JQ9A 5C3JA 1YQZA 3Q6JA 2A89A 1Q1RA 3ZNOA 4A9WA 1H81A 1S2QA 4YTNA 2C66A 3H8LA 1N4UA 3UOYA 3DMEA 1BZLA 3AYIA 4UDPA 4EMIA 5JCIA 2Z5XA 4Z24A 4X9MA 1KNRA 3AE3A 3UKAA 4A99A 2WDVA 1LPFA 1RSGA 3KVEA 3R9UA 4D04A 3S5WA 1GETA 1PBFA 4U8MA 5KVIA 3GYJA 3UTEA 1YKJA 4YTPA 2BS2A 2C3DA 2XFPA 1E1NA 3GSIA 1D4CA 2C75A 3AE4A 2A8XA 2FJEA 2YG7A 3CN8A 5IPYA 4U2TA 3I6DA 1VG9A 1GXFA 4U8PA 3FPZA 1ZOVA 4P9SA 3SGLA 2AAQA 2QA2A 4NTCA 4BK2A 2ZZBA 3DK4A 3FMWA 4GF7A 5M10A 2YQUA 3NN6X 2ZBWA 2B7RA 3AEGA 4OPUA 4U8KA 4LIIA 1EL7A 2WQYA 2XLRA 2YLSA 2EQ7A 3NGCX 4H4TA 4YT0A 3W4JA 2X99A 4Y4NA 3CPIG 1IUVA 3D1CA 2RGHA 1GV4A 1Q9IA 1PJ7A 3ZNNA 1GTHA
chains in the Genus database with same CATH superfamily
4J33A 4RG3A 3SM8A 2BXRA 1S3EA 4NTDA 2YM1A 4H4UA 1GTEA 4XWRA 1OJ9A 4IVMB 4YJGA 4YSYA 2DKHA 3RP8A 1NHQA 2CULA 3CTYA 4IA5A 1PS9A 1K0JA 3I3LA 4YJFB 1KSSA 2BCPA 1H7XA 3UOZA 1DOBA 1EL5A 4BK3A 1E6EA 1D7LA 4K22A 1ZX9A 4CBQA 4NWZA 4U8NA 4YJDA 1COYA 2EQ8A 3G5RA 2OA1A 4GDPA 2V60A 4Z43A 1NAAA 3QFAA 4LU6A 2XCGA 1GRGA 1NDAA 2V3BA 1YQ3A 3ATQA 2I0ZA 3K7TA 1NHSA 2NPXA 5JCNA 3PVCA 4MJWA 3BI4A 3AE7A 4OPTA 4DGKA 1QLBA 4LA1A 4AOSA 5BUKA 4YJHA 3DH9A 3AE8A 3QSEA 1UKVG 4H2RA 1PXBA 2PHHA 4GAPA 3AE5A 5U1OA 3FBSA 3GDNA 3KD9A 1CL0A 1EL8A 3NIXA 3T31A 3NK0X 2XFOA 4H2NA 3O0HA 4BJZA 5IQ1A 3UCLA 2BS4A 2GAGB 1W4XA 3Q9TA 4EMJA 4XWZA 4EIQA 3SXIA 4USRA 4IVOB 2TPRA 4IA6A 2FJBA 3ALMA 4C74A 2GQWA 1B8SA 1NG4A 1JNZA 3IHGA 3B3RA 3CNTA 5JCKA 2X50A 4C77A 2RGOA 1PXAA 2VRMA 4G9KA 3GMBA 1LVLA 4KX6A 3AEDA 2FBWA 3CUKA 2WU5A 3NKSA 1JEHA 2WP9A 3AE6A 5KMPA 1PBDA 1DOCA 4YJGB 1YY5A 3LOVA 2GV8A 3DK8A 2GMJA 2WOWA 2C70A 3URHA 5KMSA 3LB8A 1FL2A 1GERA 1ZDLA 2BXSA 3CNPA 2GAHB 3CGDA 3UKLA 3ATRA 3NTAA 3SX6A 4BJYA 5J7XA 3AWIA 4I59A 1XDIA 1TYPA 2YR6A 3P4PA 4H4SA 3ZNPA 1REOA 4Y4MA 3VRBA 5FS9A 2X8HA 2XDOA 2UZZA 4AOXA 4C3XA 1GPEA 1B4VA 1MO9A 4TM0A 3OC4A 2ZZ0A 4DNAA 4DSHA 4Z2TA 4BV6A 1H84A 3VR9A 2VOUA 4YJHB 4II2A 2YG5A 1O94A 4B66A 3M0OA 2YLXA 3CPJG 3BNMA 4ZCDA 4Z25A 5TR3A 1D7YA 3G5SA 3UKFA 2YWLA 1O5WA 2FJAA 3LZWA 4OCGA 5IQ4A 3T2YA 1GEUA 1PJ5A 3V76A 3S61A 3SFEA 2AR8A 1TDKA 4EQRA 1GRFA 2WEUA 2XLTA 4U8OA 2XLSA 3IHMA 1PN0A 1PBBA 1JOAA 2GQFA 3CNJA 2X8CA 3M12A 4CCRA 1L0VA 4ZN0A 1JRXA 4G6HA 4FX9A 3CMMA 5HYMA 1VRQB 1Y0PA 4NEWA 3CPHG 4B65A 1NG3A 4YXDA 1PBEA 4NEVA 1NEKA 4J57A 5KOWA 1ZKQA 3BNUA 3F8RA 2JB3A 4H4VA 4Z26A 2BRAA 2J3NA 3T2KA 4CY8A 3EAOA 2GH5A 2XVIA 2YR5A 3GD3A 3E1TA 1CJ3A 3NK1X 4PABA 1E7PA 4USQA 4ADWA 2GVCA 4EM4A 2YR4A 3UTHA 1N4WA 2C65A 4J56A 2WP6A 2C64A 4OPCA 5GSNA 2Q6UA 4Y4LA 1EVIA 4KPRA 2FJDA 4GDEA 1D5TA 1PXCA 1M6IA 2V3AA 1FEAA 2GEWA 1K4QA 4G6GA 2GR0A 5EOWA 3RP7A 3GDPA 4YKFA 1GRHA 1B5QA 3ICTA 1KF6A 1X31B 1JU2A 1CC2A 1GESA 2IIDA 1Y56B 5CQFA 3BHKA 3P4SA 4G73A 1L9DA 4CCQA 4J36A 3ITJA 2Q7VA 1TRBA 4H50A 3ABVA 2JB1A 1GNDA 1V59A 2YM2A 4QFDA 3EANA 3LJPA 4EM3A 2JK6A 2YG3A 1F8RA 2R45A 1EBDA 1IUSA 1BGNA 1IJHA 2BCGG 3UP5A 4Z2RA 1NENA 3SY4A 4FK1C 3CGEA 1AOGA 1DJNA 1NPXA 2CVJA 4H4QA 5EB4A 5KRQA 2XFNA 3DGZA 3GYXA 4M52A 3UKKA 4B67A 3B6DA 1C0LA 1P2EA 4EQWA 3QFBA 2WETA 3SZFA 1SEZA 3W4IA 2WOVA 2WPCA 1IUUA 2XFQA 3AE9A 5ER0A 4BURA 1GOSA 2H88A 4EMWA 3DJJA 4RSLA 4A79A 5KNLA 2B9YA 1AN9A 2GF3A 4JN9A 2ZZCA 4JDRA 1E1MA 1FECA 3K30A 3SZWA 2EQ9A 2BRYA 3QJ4A 3AD9B 1OJCA 3AE2A 3L1RA 1N4VA 3VR8A 1M64A 1VE9A 1E39A 3GWDA 2BC0A 3FIMB 3NT6A 3P1WA 4FK1A 5HXIA 4H4WA 4CY6A 4YWOA 1OJDA 1VDCA 4GCMA 4AT0A 4YSHA 3QVPA 3GRSA 1MOKA 3IF9A 4BK1A 1TDEA 4K5RA 1H82A 2VVMA 2E82A 4REKA 1DXLA 4A7AA 1KFYA 3ZDNA 4U8IA 2B7SA 2QA1A 2WP5A 2BK5A 2VZ2A 3AEFA 4TM4A 1D4EA 3AECA 5FS7A 4B1BA 4CNJA 3RP6A 2C7GA 4OPDA 2OALA 2XVJA 5J60A 3HZLA 2C72A 2H89A 4JNQA 1E1KA 1GREA 1TDNA 1B37A 1L9CA 4C3YA 2BK3A 2RABA 5L46A 1JRYA 1RYIA 4HB9A 2APGA 3KPKA 5GRTA 4OVIA 1IUWA 3QVRA 1HYUA 2GR2A 1C0IA 1CC4A 3K7MX 4QFCA 2WS3A 4J2WA 4AP3A 4X9NA 3FG2P 4EIPA 1DDOA 3NYFA 1PBCA 1FEBA 3BI5A 5KVHA 3NYEA 4NNJA 3RNMA 5KXJA 1CJ4A 2R9ZA 2R4JA 2W0HA 3ADAB 4YSZA 1IUTA 1PJ6A 3CGBA 1TDOA 2RGJA 4H2PA 4AP1A 4U2LA 3EF6A 2CDUA 2OLNA 2WHDA 3AD7B 4H4ZA 4A65A 1H7WA 4ICYA 1TDFA 4O5UA 3UKPA 3SZCA 1TYTA 3KPFA 3V3NA 4UP3A 3NHOX 1DNCA 3UTGA 3WE0A 1NHRA 1DAOA 3NYCA 3LZXA 1BGJA 4K7ZA 1DODA 1S3BA 3ALLA 2F5ZA 2BC1A 4B64A 5BRTA 1FOHA 2VRLA 2R46A 2WESA 2HQMA 3H4KA 4A6NA 2PYXA 2O9ZA 3AXBA 4B69A 4UDQA 1IUXA 3OZ2A 3HYVA 5EBKA 1ELIA 2A87A 4RG4A 3C96A 1N1PA 4O5QA 2XLUA 4J31A 2JBVA 1YQ4A 3NLCA 2VVLA 1RP0A 2XFUA 2IVEA 3SQPA 3CNSA 4U8LA 2E49A 3WGTA 4JY2A 3H8IA 5C2TA 4CRTA 1MXTA 2YAUA 2EQ6A 3PS9A 3HYWA 3DJDA 2BABA 3NK2X 2Q0LA 1Q1WA 4UDRA 2GRTA 1ZMDA 2YLTA 3AYLA 5U25A 5JCMA 4II3A 3ZNQA 1CJCA 1GALA 1LQTA 3UP4A 4J34A 4TLXA 2X3NA 2XLPA 3GRTA 4A5LA 5KMQA 2WPFA 2C3CA 5FS6A 4H4PA 4DSGA 1NHPA 2WDRA 1KNPA 4B63A 5HY5A 3KKJA 3VRAA 1JNRA 2BYBA 3T14A 1CC6A 4AT2A 3DK9A 2JB2A 5M0ZA 4APNA 3UOXA 2BACA 4H2QA 4TLZA 1H6VA 3VQRA 1E1LA 2WU2A 4H4YA 1LQUA 1K0LA 3GMCA 2YVFA 4NTEA 2E48A 2R4EA 1GRTA 3F8PA 3SYIA 4GUVA 2R0GA 1C0PA 3AD8B 5KOXA 1Z6LA 3UOVA 3F8DA 3AB1A 3ZYXA 5U63A 3II4A 2ARDA 2BS3A 2V6OA 2XVFA 4WX1A 4E0VA 1F3PA 3QSSA 2YVGA 1C0KA 1FCDA 5CKUA 1S2YA 1ZK7A 4A6NB 4D03A 3C4AA 2WOIA 3AYJA 3GD4A 3GYIA 3CNDA 3HYXA 4TM1A 2AQJA 3KLJA 1DJQA 1CHUA 3ALJA 3IWAA 5FMHA 3UTFA 4WCTA 3L8KA 3REDA 1CJ2A 3DGHA 4JY3A 1H86A 5KWFA 1H83A 3NH3X 5JCLA 1F8SA 3QSMA 2GMHA 5BULA 1KIFA 3IC9A 2YLRA 4YKGA 4H7UA 3V3OA 2Y6RA 3GWFA 3ISHA 1LV0A 3PO7A 1LTXR 5LV9A 1P2HA 4TM3A 1EL9A 2GR3A 3G5QA 3AE1A 2C67A 2B9XA 1PHHA 3C4NA 2X8GA 2Z5YA 3DJGX 4EQSA 3KU9A 1DOEA 3NNEA 3CIRA 3K7QX 4GAVA 1CF3A 1KSUA 4PAAA 2BK4A 4Z44A 2V61A 2YVJA 2JKCA 4FDCB 4K2XA 3UKHA 3BHFA 2DKIA 4IV9A 3NN0X 3LXDA 3M13A 2E1MA 4ECHA 1XANA 1BWCA 4G74A 4U8JA 3VRDB 2YG6A 2QAEA 5KMRA 1ZOYA 3AEBA 2E5VA 3COXA 1BKWA 1QJDA 2JAEA 2XVHA 2TMDA 1GSNA 2Y6QA 2YG4A 3BI2A 3ICRA 4CNKA 2R0PA 2WBAA 3T2ZA 5HHFA 1PDHA 4HA6A 2VVLG 3LADA 4U2SA 1F6MA 3NTDA 1VQWA 3DJEA 2E4AA 4GRTA 2VQBA 2YLWA 1K0IA 2OAMA 5DBJA 2E4GA 2R0CA 4XXGA 4K5SA 3SZ0A 4NZHA 1GRAA 3D8XA 3P4RA 4X4JA 2QCUA 2XVEA 4H4XA 1KDGA 1LJ1A 3NG7X 3NRNA 4YTMA 1ONFA 1F8WA 1XPQA 5FS8A 2GR1A 3AEAA 4N9XA 1JRZA 1OJTA 2B76A 2OLOA 4Z2UA 2C4CA 2CFYA 2Q0KA 2WPEA 2BA9A 2NVKX 1GRBA 4C5OA 3UKQA 2WDQA 3G3EA 1OJAA 1O95A 2IVDA 3SFDA 4I58A 1XHCA 1Y56A 2B9WA 4JNAA 2C76A 2V5ZA 4B68A 1BF3A 1CBOA 3DA1A 2YLZA 1QO8A 3AEEA 3T37A 4EQXA 4YSXA 4OPGA 2ACZA 1ZP0A 1ZMCA 4OPIA 3KA7A 4OPLA 1D4DA 3JSKA 4ZCCA 2XYOA 3P4QA 4GR1A 1ZY8A 3RHAA 2C73A 2GB0A 3CGCA 1GT8A 3EPTA 4K8DA 5BVAA 1VG0A 4H4RA 4YJFA 1L9EA 3W4KA 2VQ7A 3ICSA 2DU8A 3P9UA 5EB5A 4JQ9A 5C3JA 1YQZA 3Q6JA 2A89A 1Q1RA 3ZNOA 4A9WA 1H81A 1S2QA 4YTNA 2C66A 3H8LA 1N4UA 3UOYA 3DMEA 1BZLA 3AYIA 4UDPA 4EMIA 5JCIA 2Z5XA 4Z24A 4X9MA 1KNRA 3AE3A 3UKAA 4A99A 2WDVA 1LPFA 1RSGA 3KVEA 3R9UA 4D04A 3S5WA 1GETA 1PBFA 4U8MA 5KVIA 3GYJA 3UTEA 1YKJA 4YTPA 2BS2A 2C3DA 2XFPA 1E1NA 3GSIA 1D4CA 2C75A 3AE4A 2A8XA 2FJEA 2YG7A 3CN8A 5IPYA 4U2TA 3I6DA 1VG9A 1GXFA 4U8PA 3FPZA 1ZOVA 4P9SA 3SGLA 2AAQA 2QA2A 4NTCA 4BK2A 2ZZBA 3DK4A 3FMWA 4GF7A 3T0KA 5M10A 2YQUA 3NN6X 2ZBWA 2B7RA 3AEGA 4OPUA 4U8KA 4LIIA 1EL7A 2WQYA 2XLRA 2YLSA 2EQ7A 3NGCX 4H4TA 4YT0A 3W4JA 2X99A 4Y4NA 3CPIG 1IUVA 3D1CA 2RGHA 1GV4A 1Q9IA 1PJ7A 3ZNNA 1GTHA
chains in the Genus database with same CATH topology
4J33A 4RG3A 3SM8A 2BXRA 1S3EA 4NTDA 2YM1A 4H4UA 1GTEA 4XWRA 1OJ9A 4IVMB 4YJGA 4YSYA 2DKHA 1NHQA 2CULA 3CTYA 3RP8A 4IA5A 1PS9A 1K0JA 3I3LA 4YJFB 1KSSA 2BCPA 1H7XA 3UOZA 1DOBA 1EL5A 4BK3A 1E6EA 1D7LA 1ZX9A 4K22A 4CBQA 4NWZA 4U8NA 4YJDA 1COYA 2EQ8A 3G5RA 2OA1A 4GDPA 2V60A 4Z43A 1NAAA 3QFAA 4LU6A 2XCGA 1GRGA 1NDAA 2V3BA 1YQ3A 3ATQA 2I0ZA 3K7TA 1NHSA 2NPXA 5JCNA 3PVCA 4MJWA 3BI4A 3AE7A 4OPTA 4DGKA 1QLBA 4LA1A 4AOSA 5BUKA 4YJHA 3DH9A 3AE8A 3QSEA 1UKVG 4H2RA 1PXBA 2PHHA 4GAPA 3AE5A 5U1OA 3FBSA 3GDNA 3KD9A 1CL0A 1EL8A 3NIXA 3T31A 3NK0X 2XFOA 3O0HA 4H2NA 4BJZA 5IQ1A 3UCLA 2BS4A 2GAGB 1W4XA 3Q9TA 4EMJA 4XWZA 4EIQA 3SXIA 4USRA 4IVOB 2TPRA 4IA6A 2FJBA 3ALMA 4C74A 2GQWA 1B8SA 1NG4A 1JNZA 3B3RA 3CNTA 3IHGA 5JCKA 2X50A 4C77A 2RGOA 1PXAA 2VRMA 4G9KA 3GMBA 1LVLA 4KX6A 3AEDA 2FBWA 3CUKA 2WU5A 3NKSA 1JEHA 2WP9A 3AE6A 5KMPA 1PBDA 1DOCA 4YJGB 1YY5A 3LOVA 2GV8A 3DK8A 2GMJA 2WOWA 2C70A 3URHA 5KMSA 3LB8A 1FL2A 1GERA 1ZDLA 2BXSA 3CNPA 2GAHB 3CGDA 3UKLA 3ATRA 3NTAA 3SX6A 4BJYA 5J7XA 3AWIA 4I59A 1XDIA 1TYPA 2YR6A 3P4PA 4H4SA 3ZNPA 1REOA 4Y4MA 3VRBA 5FS9A 2X8HA 2XDOA 2UZZA 4AOXA 4C3XA 1GPEA 1B4VA 1MO9A 4TM0A 3OC4A 2ZZ0A 4DNAA 4DSHA 4Z2TA 4BV6A 1H84A 3VR9A 2VOUA 4YJHB 4II2A 2YG5A 1O94A 4B66A 3M0OA 2YLXA 3CPJG 3BNMA 4ZCDA 4Z25A 5TR3A 1D7YA 3G5SA 3UKFA 2YWLA 1O5WA 2FJAA 3LZWA 4OCGA 5IQ4A 3T2YA 1GEUA 1PJ5A 3V76A 3S61A 3SFEA 2AR8A 1TDKA 4EQRA 1GRFA 2WEUA 2XLTA 4U8OA 2XLSA 3IHMA 1PN0A 1PBBA 1JOAA 2GQFA 3CNJA 2X8CA 3M12A 4CCRA 1L0VA 4ZN0A 1JRXA 4G6HA 4FX9A 3CMMA 5HYMA 1VRQB 1Y0PA 4NEWA 3CPHG 4B65A 1NG3A 4YXDA 1PBEA 4NEVA 1NEKA 4J57A 5KOWA 1ZKQA 3BNUA 3F8RA 2JB3A 4H4VA 4Z26A 2BRAA 2J3NA 3T2KA 4CY8A 3EAOA 2GH5A 2XVIA 2YR5A 3GD3A 3E1TA 1CJ3A 3NK1X 4PABA 1E7PA 4USQA 4ADWA 2GVCA 4EM4A 2YR4A 3UTHA 1N4WA 2C65A 4J56A 2WP6A 2C64A 4OPCA 5GSNA 2Q6UA 4Y4LA 1EVIA 4KPRA 2FJDA 4GDEA 1D5TA 1PXCA 1M6IA 2V3AA 1FEAA 2GEWA 1K4QA 4G6GA 2GR0A 5EOWA 4YKFA 3GDPA 3RP7A 1GRHA 1B5QA 3ICTA 1KF6A 1X31B 1JU2A 1CC2A 1GESA 2IIDA 1Y56B 5CQFA 3BHKA 3P4SA 4G73A 1L9DA 4CCQA 4J36A 3ITJA 2Q7VA 1TRBA 4H50A 3ABVA 2JB1A 1GNDA 1V59A 2YM2A 4QFDA 3EANA 3LJPA 4EM3A 2JK6A 2YG3A 1F8RA 2R45A 1EBDA 1IUSA 1BGNA 1IJHA 2BCGG 3UP5A 4Z2RA 1NENA 3SY4A 4FK1C 3CGEA 1AOGA 1DJNA 1NPXA 2CVJA 4H4QA 5EB4A 5KRQA 2XFNA 3DGZA 3GYXA 4M52A 3UKKA 4B67A 3B6DA 1C0LA 1P2EA 4EQWA 3QFBA 2WETA 3SZFA 1SEZA 3W4IA 2WOVA 2WPCA 1IUUA 2XFQA 3AE9A 5ER0A 4BURA 1GOSA 2H88A 4EMWA 3DJJA 4RSLA 4A79A 5KNLA 2B9YA 1AN9A 2GF3A 4JN9A 2ZZCA 4JDRA 1E1MA 1FECA 3K30A 3SZWA 2EQ9A 2BRYA 3QJ4A 1OJCA 3AD9B 3AE2A 3L1RA 1N4VA 3VR8A 1M64A 1VE9A 1E39A 3GWDA 2BC0A 3FIMB 3NT6A 3P1WA 4FK1A 5HXIA 4H4WA 4CY6A 4YWOA 1OJDA 1VDCA 4GCMA 4AT0A 4YSHA 3QVPA 3GRSA 1MOKA 3IF9A 4K5RA 1TDEA 4BK1A 1H82A 2VVMA 2E82A 4REKA 1DXLA 4A7AA 1KFYA 3ZDNA 4U8IA 2B7SA 2QA1A 2WP5A 2BK5A 2VZ2A 3AEFA 4TM4A 1D4EA 3AECA 5FS7A 4B1BA 4CNJA 2C7GA 3RP6A 4OPDA 2OALA 2XVJA 5J60A 3HZLA 2C72A 2H89A 4JNQA 1E1KA 1GREA 1TDNA 1B37A 1L9CA 4C3YA 2BK3A 2RABA 5L46A 1JRYA 1RYIA 4HB9A 2APGA 3KPKA 5GRTA 4OVIA 1IUWA 3QVRA 1HYUA 2GR2A 1C0IA 1CC4A 3K7MX 4QFCA 2WS3A 4J2WA 4AP3A 4X9NA 3FG2P 4EIPA 1DDOA 3NYFA 1PBCA 1FEBA 3BI5A 5KVHA 3NYEA 4NNJA 3RNMA 5KXJA 1CJ4A 2R9ZA 2R4JA 2W0HA 3ADAB 4YSZA 1IUTA 1PJ6A 3CGBA 1TDOA 2RGJA 4H2PA 4AP1A 4U2LA 3EF6A 2CDUA 2OLNA 2WHDA 3AD7B 4H4ZA 4A65A 1H7WA 4ICYA 1TDFA 4O5UA 3UKPA 3SZCA 1TYTA 3KPFA 3V3NA 4UP3A 3NHOX 1DNCA 3UTGA 3WE0A 1NHRA 1DAOA 3NYCA 3LZXA 1BGJA 4K7ZA 1DODA 1S3BA 3ALLA 2F5ZA 2BC1A 4B64A 5BRTA 1FOHA 2VRLA 2R46A 2WESA 2HQMA 3H4KA 4A6NA 2PYXA 2O9ZA 3AXBA 4B69A 4UDQA 1IUXA 3OZ2A 3HYVA 5EBKA 1ELIA 2A87A 4RG4A 3C96A 1N1PA 4O5QA 2XLUA 4J31A 2JBVA 1YQ4A 3NLCA 2VVLA 1RP0A 2XFUA 2IVEA 3SQPA 3CNSA 4U8LA 2E49A 3WGTA 3H8IA 4JY2A 5C2TA 4CRTA 1MXTA 2YAUA 2EQ6A 3PS9A 3HYWA 3DJDA 2BABA 3NK2X 2Q0LA 1Q1WA 4UDRA 2GRTA 1ZMDA 2YLTA 3AYLA 5U25A 5JCMA 4II3A 3ZNQA 1CJCA 1GALA 1LQTA 3UP4A 4J34A 4TLXA 2X3NA 2XLPA 3GRTA 4A5LA 5KMQA 2WPFA 2C3CA 5FS6A 4H4PA 4DSGA 1NHPA 2WDRA 1KNPA 4B63A 5HY5A 3KKJA 3VRAA 1JNRA 2BYBA 3T14A 1CC6A 4AT2A 3DK9A 2JB2A 5M0ZA 4APNA 3UOXA 2BACA 4H2QA 4TLZA 1H6VA 3VQRA 1E1LA 2WU2A 4H4YA 1LQUA 1K0LA 3GMCA 2YVFA 4NTEA 2E48A 2R4EA 1GRTA 3F8PA 3SYIA 4GUVA 2R0GA 1C0PA 3AD8B 5KOXA 1Z6LA 3UOVA 3F8DA 3AB1A 3ZYXA 5U63A 3II4A 2ARDA 2BS3A 2V6OA 2XVFA 4WX1A 4E0VA 1F3PA 3QSSA 2YVGA 1C0KA 1FCDA 5CKUA 1S2YA 1ZK7A 4A6NB 4D03A 3C4AA 2WOIA 3AYJA 3GD4A 3GYIA 3CNDA 3HYXA 4TM1A 2AQJA 3KLJA 1DJQA 1CHUA 3ALJA 3IWAA 5FMHA 3UTFA 4WCTA 3L8KA 3REDA 1CJ2A 3DGHA 4JY3A 1H86A 5KWFA 1H83A 3NH3X 5JCLA 1F8SA 3QSMA 2GMHA 5BULA 1KIFA 3IC9A 2YLRA 4YKGA 4H7UA 3V3OA 2Y6RA 3GWFA 3ISHA 1LV0A 3PO7A 1LTXR 5LV9A 1P2HA 4TM3A 1EL9A 2GR3A 3G5QA 3AE1A 2C67A 2B9XA 1PHHA 3C4NA 2X8GA 2Z5YA 3DJGX 4EQSA 3KU9A 1DOEA 3NNEA 3CIRA 3K7QX 4GAVA 1CF3A 1KSUA 4PAAA 2BK4A 4Z44A 2V61A 2YVJA 2JKCA 4FDCB 4K2XA 3UKHA 3BHFA 2DKIA 4IV9A 3NN0X 3LXDA 3M13A 2E1MA 4ECHA 1XANA 1BWCA 4G74A 4U8JA 3VRDB 2YG6A 2QAEA 5KMRA 1ZOYA 3AEBA 2E5VA 3COXA 1BKWA 1QJDA 2JAEA 2XVHA 2TMDA 1GSNA 2Y6QA 2YG4A 3BI2A 3ICRA 4CNKA 2R0PA 2WBAA 3T2ZA 5HHFA 1PDHA 4HA6A 2VVLG 3LADA 4U2SA 1F6MA 3NTDA 1VQWA 3DJEA 2E4AA 4GRTA 2VQBA 2YLWA 1K0IA 2OAMA 5DBJA 2E4GA 2R0CA 4XXGA 4K5SA 3SZ0A 4NZHA 1GRAA 3D8XA 3P4RA 4X4JA 2QCUA 2XVEA 4H4XA 1KDGA 1LJ1A 3NG7X 3NRNA 4YTMA 1ONFA 1F8WA 1XPQA 5FS8A 2GR1A 3AEAA 4N9XA 1JRZA 1OJTA 2B76A 2OLOA 4Z2UA 2C4CA 2CFYA 2Q0KA 2WPEA 2BA9A 2NVKX 1GRBA 4C5OA 3UKQA 2WDQA 3G3EA 1OJAA 1O95A 2IVDA 3SFDA 4I58A 1XHCA 1Y56A 2B9WA 4JNAA 2C76A 2V5ZA 4B68A 1BF3A 1CBOA 3DA1A 2YLZA 1QO8A 3AEEA 3T37A 4EQXA 4YSXA 4OPGA 2ACZA 1ZP0A 1ZMCA 4OPIA 3KA7A 4OPLA 1D4DA 3JSKA 4ZCCA 2XYOA 3P4QA 4GR1A 1ZY8A 3RHAA 2C73A 2GB0A 3CGCA 1GT8A 3EPTA 4K8DA 5BVAA 1VG0A 4H4RA 4YJFA 1L9EA 3W4KA 2VQ7A 3ICSA 2DU8A 3P9UA 5EB5A 4JQ9A 5C3JA 1YQZA 3Q6JA 2A89A 1Q1RA 3ZNOA 4A9WA 1H81A 1S2QA 4YTNA 2C66A 3H8LA 1N4UA 3UOYA 3DMEA 1BZLA 3AYIA 4UDPA 4EMIA 5JCIA 2Z5XA 4Z24A 4X9MA 1KNRA 3AE3A 3UKAA 4A99A 2WDVA 1LPFA 1RSGA 3KVEA 3R9UA 4D04A 3S5WA 1GETA 1PBFA 4U8MA 5KVIA 3GYJA 3UTEA 1YKJA 4YTPA 2BS2A 2C3DA 2XFPA 1E1NA 3GSIA 1D4CA 2C75A 3AE4A 2A8XA 2FJEA 2YG7A 3CN8A 5IPYA 4U2TA 3I6DA 1VG9A 1GXFA 4U8PA 3FPZA 1ZOVA 4P9SA 3SGLA 2AAQA 2QA2A 4NTCA 4BK2A 2ZZBA 3DK4A 3FMWA 4GF7A 3T0KA 5M10A 2YQUA 3NN6X 2ZBWA 2B7RA 3AEGA 4OPUA 4U8KA 4LIIA 1EL7A 2WQYA 2XLRA 2YLSA 2EQ7A 3NGCX 4H4TA 4YT0A 3W4JA 2X99A 4Y4NA 3CPIG 1IUVA 3D1CA 2RGHA 1GV4A 1Q9IA 1PJ7A 3ZNNA 1GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J33 A;  4RG3 A;  3SM8 A;  2BXR A;  1S3E A;  4NTD A;  2YM1 A;  4H4U A;  1GTE A;  4XWR A;  1OJ9 A;  4IVM B;  4YJG A;  4YSY A;  2DKH A;  1NHQ A;  2CUL A;  3CTY A;  3RP8 A;  4IA5 A;  1PS9 A;  1K0J A;  3I3L A;  4YJF B;  1KSS A;  2BCP A;  1H7X A;  3UOZ A;  1DOB A;  1EL5 A;  4BK3 A;  1E6E A;  1D7L A;  1ZX9 A;  4K22 A;  4CBQ A;  4U8N A;  4YJD A;  1COY A;  2EQ8 A;  3G5R A;  2OA1 A;  4GDP A;  2V60 A;  4Z43 A;  1NAA A;  3QFA A;  4LU6 A;  2XCG A;  1GRG A;  1NDA A;  2V3B A;  1YQ3 A;  3ATQ A;  2I0Z A;  3K7T A;  1NHS A;  2NPX A;  5JCN A;  3PVC A;  4MJW A;  3BI4 A;  3AE7 A;  4OPT A;  4DGK A;  1QLB A;  4LA1 A;  4AOS A;  5BUK A;  4YJH A;  3DH9 A;  3AE8 A;  3QSE A;  1UKV G;  4H2R A;  1PXB A;  2PHH A;  5U1O A;  3AE5 A;  3FBS A;  3GDN A;  3KD9 A;  1CL0 A;  1EL8 A;  3NIX A;  3NK0 X;  2XFO A;  3O0H A;  4H2N A;  4BJZ A;  5IQ1 A;  3UCL A;  2BS4 A;  2GAG B;  1W4X A;  3Q9T A;  4EMJ A;  4XWZ A;  4EIQ A;  4USR A;  4IVO B;  2TPR A;  4IA6 A;  2FJB A;  3ALM A;  4C74 A;  2GQW A;  1B8S A;  1NG4 A;  1JNZ A;  3B3R A;  3CNT A;  3IHG A;  5JCK A;  2X50 A;  4C77 A;  2RGO A;  1PXA A;  2VRM A;  3GMB A;  1LVL A;  4KX6 A;  3AED A;  2FBW A;  3CUK A;  2WU5 A;  3NKS A;  1JEH A;  2WP9 A;  3AE6 A;  1PBD A;  1DOC A;  4YJG B;  1YY5 A;  3LOV A;  2GV8 A;  3DK8 A;  2GMJ A;  2WOW A;  2C70 A;  3URH A;  3LB8 A;  1FL2 A;  1GER A;  1ZDL A;  2BXS A;  3CNP A;  2GAH B;  3CGD A;  3UKL A;  3ATR A;  3NTA A;  4BJY A;  5J7X A;  3AWI A;  4I59 A;  1XDI A;  1TYP A;  2YR6 A;  3P4P A;  4H4S A;  3ZNP A;  1REO A;  4Y4M A;  3VRB A;  5FS9 A;  2X8H A;  2XDO A;  2UZZ A;  4AOX A;  4C3X A;  1GPE A;  1B4V A;  1MO9 A;  4TM0 A;  3OC4 A;  2ZZ0 A;  4DNA A;  4DSH A;  4Z2T A;  4BV6 A;  1H84 A;  3VR9 A;  2VOU A;  4YJH B;  2YG5 A;  1O94 A;  4B66 A;  3M0O A;  2YLX A;  3CPJ G;  3BNM A;  4ZCD A;  4Z25 A;  5TR3 A;  1D7Y A;  3G5S A;  3UKF A;  2YWL A;  1O5W A;  2FJA A;  3LZW A;  4OCG A;  5IQ4 A;  1GEU A;  1PJ5 A;  3V76 A;  3S61 A;  3SFE A;  2AR8 A;  1TDK A;  4EQR A;  1GRF A;  2WEU A;  2XLT A;  4U8O A;  2XLS A;  3IHM A;  1PN0 A;  1PBB A;  1JOA A;  2GQF A;  3CNJ A;  2X8C A;  3M12 A;  4CCR A;  1L0V A;  4ZN0 A;  1JRX A;  4FX9 A;  5HYM A;  1VRQ B;  1Y0P A;  4NEW A;  3CPH G;  4B65 A;  1NG3 A;  4YXD A;  1PBE A;  4NEV A;  1NEK A;  4J57 A;  5KOW A;  1ZKQ A;  3BNU A;  3F8R A;  2JB3 A;  4H4V A;  4Z26 A;  2J3N A;  4CY8 A;  3EAO A;  2GH5 A;  2XVI A;  2YR5 A;  3GD3 A;  3E1T A;  1CJ3 A;  3NK1 X;  4PAB A;  1E7P A;  4USQ A;  4ADW A;  2GVC A;  4EM4 A;  2YR4 A;  3UTH A;  1N4W A;  2C65 A;  4J56 A;  2WP6 A;  2C64 A;  4OPC A;  5GSN A;  2Q6U A;  4Y4L A;  1EVI A;  4KPR A;  2FJD A;  4GDE A;  1D5T A;  1PXC A;  1M6I A;  2V3A A;  1FEA A;  2GEW A;  1K4Q A;  5EOW A;  2GR0 A;  4YKF A;  3GDP A;  3RP7 A;  1GRH A;  1B5Q A;  3ICT A;  1KF6 A;  1X31 B;  1JU2 A;  1CC2 A;  1GES A;  2IID A;  1Y56 B;  5CQF A;  3BHK A;  3P4S A;  1L9D A;  4CCQ A;  4J36 A;  3ITJ A;  2Q7V A;  1TRB A;  4H50 A;  3ABV A;  2JB1 A;  1GND A;  1V59 A;  2YM2 A;  4QFD A;  3EAN A;  3LJP A;  4EM3 A;  2JK6 A;  2YG3 A;  1F8R A;  2R45 A;  1EBD A;  1IUS A;  1BGN A;  1IJH A;  2BCG G;  3UP5 A;  4Z2R A;  1NEN A;  4FK1 C;  3CGE A;  1AOG A;  1DJN A;  1NPX A;  2CVJ A;  4H4Q A;  5EB4 A;  5KRQ A;  2XFN A;  3DGZ A;  4B67 A;  4M52 A;  3UKK A;  3B6D A;  1C0L A;  1P2E A;  4EQW A;  3QFB A;  2WET A;  1SEZ A;  3W4I A;  2WOV A;  2WPC A;  1IUU A;  2XFQ A;  3AE9 A;  5ER0 A;  4BUR A;  1GOS A;  2H88 A;  4EMW A;  3DJJ A;  4RSL A;  4A79 A;  2B9Y A;  1AN9 A;  2GF3 A;  4JN9 A;  2ZZC A;  4JDR A;  1E1M A;  1FEC A;  3K30 A;  2EQ9 A;  3QJ4 A;  1OJC A;  3AD9 B;  3AE2 A;  3L1R A;  1N4V A;  3VR8 A;  1M64 A;  1VE9 A;  1E39 A;  3GWD A;  2BC0 A;  3FIM B;  3NT6 A;  3P1W A;  4FK1 A;  5HXI A;  4H4W A;  4CY6 A;  4YWO A;  1OJD A;  1VDC A;  4GCM A;  4AT0 A;  4YSH A;  3QVP A;  3GRS A;  1MOK A;  3IF9 A;  4K5R A;  1TDE A;  4BK1 A;  1H82 A;  2VVM A;  2E82 A;  4REK A;  1DXL A;  4A7A A;  1KFY A;  3ZDN A;  4U8I A;  2B7S A;  2QA1 A;  2WP5 A;  2BK5 A;  2VZ2 A;  3AEF A;  4TM4 A;  1D4E A;  3AEC A;  5FS7 A;  4B1B A;  4CNJ A;  2C7G A;  3RP6 A;  4OPD A;  2OAL A;  2XVJ A;  5J60 A;  3HZL A;  2C72 A;  2H89 A;  4JNQ A;  1E1K A;  1GRE A;  1TDN A;  1B37 A;  1L9C A;  4C3Y A;  2BK3 A;  2RAB A;  5L46 A;  1JRY A;  1RYI A;  4HB9 A;  2APG A;  5GRT A;  4OVI A;  1IUW A;  3QVR A;  1HYU A;  2GR2 A;  1C0I A;  1CC4 A;  3K7M X;  4QFC A;  2WS3 A;  4J2W A;  4AP3 A;  4X9N A;  3FG2 P;  4EIP A;  1DDO A;  3NYF A;  1PBC A;  1FEB A;  3BI5 A;  5KVH A;  3NYE A;  3RNM A;  5KXJ A;  1CJ4 A;  2R9Z A;  2R4J A;  2W0H A;  3ADA B;  4YSZ A;  1IUT A;  1PJ6 A;  3CGB A;  1TDO A;  2RGJ A;  4H2P A;  4AP1 A;  4U2L A;  3EF6 A;  2CDU A;  2OLN A;  2WHD A;  3AD7 B;  4H4Z A;  4A65 A;  1H7W A;  4ICY A;  1TDF A;  4O5U A;  3UKP A;  1TYT A;  3KPF A;  3V3N A;  4UP3 A;  3NHO X;  1DNC A;  3UTG A;  3WE0 A;  1NHR A;  1DAO A;  3NYC A;  3LZX A;  1BGJ A;  4K7Z A;  1DOD A;  1S3B A;  3ALL A;  2F5Z A;  2BC1 A;  4B64 A;  5BRT A;  1FOH A;  2VRL A;  2R46 A;  2WES A;  2HQM A;  3H4K A;  4A6N A;  2PYX A;  2O9Z A;  3AXB A;  4B69 A;  4UDQ A;  1IUX A;  3OZ2 A;  5EBK A;  1ELI A;  2A87 A;  4RG4 A;  3C96 A;  1N1P A;  4O5Q A;  2XLU A;  4J31 A;  2JBV A;  1YQ4 A;  3NLC A;  2VVL A;  1RP0 A;  2XFU A;  2IVE A;  3SQP A;  3CNS A;  4U8L A;  2E49 A;  3WGT A;  3H8I A;  4JY2 A;  5C2T A;  4CRT A;  1MXT A;  2YAU A;  2EQ6 A;  3PS9 A;  3DJD A;  2BAB A;  3NK2 X;  2Q0L A;  1Q1W A;  4UDR A;  2GRT A;  1ZMD A;  2YLT A;  3AYL A;  5U25 A;  5JCM A;  3ZNQ A;  1CJC A;  1GAL A;  1LQT A;  3UP4 A;  4J34 A;  4TLX A;  2X3N A;  2XLP A;  3GRT A;  4A5L A;  2WPF A;  2C3C A;  5FS6 A;  4H4P A;  4DSG A;  1NHP A;  2WDR A;  1KNP A;  4B63 A;  5HY5 A;  3KKJ A;  3VRA A;  1JNR A;  2BYB A;  1CC6 A;  4AT2 A;  3DK9 A;  2JB2 A;  5M0Z A;  4APN A;  3UOX A;  2BAC A;  4H2Q A;  4TLZ A;  1H6V A;  3VQR A;  1E1L A;  2WU2 A;  4H4Y A;  1LQU A;  1K0L A;  3GMC A;  2YVF A;  4NTE A;  2E48 A;  2R4E A;  1GRT A;  3F8P A;  4GUV A;  2R0G A;  1C0P A;  3AD8 B;  5KOX A;  1Z6L A;  3UOV A;  3F8D A;  3AB1 A;  3ZYX A;  5U63 A;  3II4 A;  2ARD A;  2BS3 A;  2V6O A;  2XVF A;  4WX1 A;  4E0V A;  1F3P A;  3QSS A;  2YVG A;  1C0K A;  1FCD A;  5CKU A;  1S2Y A;  1ZK7 A;  4A6N B;  4D03 A;  3C4A A;  2WOI A;  3AYJ A;  3GD4 A;  3GYI A;  3CND A;  4TM1 A;  2AQJ A;  3KLJ A;  1DJQ A;  1CHU A;  3ALJ A;  3IWA A;  5FMH A;  3UTF A;  4WCT A;  3L8K A;  3RED A;  1CJ2 A;  3DGH A;  4JY3 A;  1H86 A;  5KWF A;  1H83 A;  3NH3 X;  5JCL A;  1F8S A;  3QSM A;  2GMH A;  5BUL A;  1KIF A;  3IC9 A;  2YLR A;  4YKG A;  4H7U A;  3V3O A;  2Y6R A;  3GWF A;  3ISH A;  1LV0 A;  3PO7 A;  1LTX R;  5LV9 A;  1P2H A;  4TM3 A;  1EL9 A;  2GR3 A;  3G5Q A;  3AE1 A;  2C67 A;  2B9X A;  1PHH A;  3C4N A;  2X8G A;  2Z5Y A;  3DJG X;  4EQS A;  3KU9 A;  1DOE A;  3NNE A;  3CIR A;  3K7Q X;  1CF3 A;  1KSU A;  4PAA A;  2BK4 A;  4Z44 A;  2V61 A;  2YVJ A;  2JKC A;  4FDC B;  4K2X A;  3UKH A;  3BHF A;  2DKI A;  4IV9 A;  3NN0 X;  3LXD A;  3M13 A;  2E1M A;  4ECH A;  1XAN A;  1BWC A;  4U8J A;  3VRD B;  2YG6 A;  2QAE A;  1ZOY A;  3AEB A;  2E5V A;  3COX A;  1BKW A;  1QJD A;  2JAE A;  2XVH A;  2TMD A;  1GSN A;  2Y6Q A;  2YG4 A;  3BI2 A;  3ICR A;  4CNK A;  2R0P A;  2WBA A;  5HHF A;  1PDH A;  4HA6 A;  2VVL G;  3LAD A;  4U2S A;  1F6M A;  3NTD A;  1VQW A;  3DJE A;  2E4A A;  4GRT A;  2VQB A;  2YLW A;  1K0I A;  2OAM A;  5DBJ A;  2E4G A;  2R0C A;  4XXG A;  4K5S A;  4NZH A;  1GRA A;  3D8X A;  3P4R A;  4X4J A;  2QCU A;  2XVE A;  4H4X A;  1KDG A;  1LJ1 A;  3NG7 X;  3NRN A;  4YTM A;  1ONF A;  1F8W A;  1XPQ A;  5FS8 A;  2GR1 A;  3AEA A;  4N9X A;  1JRZ A;  1OJT A;  2B76 A;  2OLO A;  4Z2U A;  2CFY A;  2Q0K A;  2WPE A;  2BA9 A;  2NVK X;  1GRB A;  4C5O A;  3UKQ A;  2WDQ A;  3G3E A;  1OJA A;  1O95 A;  2IVD A;  3SFD A;  4I58 A;  1XHC A;  1Y56 A;  2B9W A;  4JNA A;  2C76 A;  2V5Z A;  4B68 A;  1BF3 A;  1CBO A;  3DA1 A;  2YLZ A;  1QO8 A;  3AEE A;  3T37 A;  4EQX A;  4YSX A;  4OPG A;  2ACZ A;  1ZP0 A;  1ZMC A;  4OPI A;  3KA7 A;  4OPL A;  1D4D A;  3JSK A;  4ZCC A;  2XYO A;  3P4Q A;  4GR1 A;  1ZY8 A;  3RHA A;  2C73 A;  2GB0 A;  3CGC A;  1GT8 A;  3EPT A;  4K8D A;  5BVA A;  1VG0 A;  4H4R A;  4YJF A;  1L9E A;  3W4K A;  2VQ7 A;  3ICS A;  2DU8 A;  3P9U A;  5EB5 A;  4JQ9 A;  5C3J A;  1YQZ A;  3Q6J A;  2A89 A;  1Q1R A;  3ZNO A;  4A9W A;  1H81 A;  1S2Q A;  4YTN A;  2C66 A;  3H8L A;  1N4U A;  3UOY A;  3DME A;  1BZL A;  3AYI A;  4UDP A;  4EMI A;  5JCI A;  2Z5X A;  4Z24 A;  4X9M A;  1KNR A;  3AE3 A;  3UKA A;  4A99 A;  2WDV A;  1LPF A;  1RSG A;  3KVE A;  3R9U A;  4D04 A;  3S5W A;  1GET A;  1PBF A;  4U8M A;  5KVI A;  3GYJ A;  3UTE A;  1YKJ A;  4YTP A;  2BS2 A;  2C3D A;  2XFP A;  1E1N A;  3GSI A;  1D4C A;  2C75 A;  3AE4 A;  2A8X A;  2FJE A;  2YG7 A;  3CN8 A;  5IPY A;  4U2T A;  3I6D A;  1VG9 A;  1GXF A;  4U8P A;  3FPZ A;  1ZOV A;  4P9S A;  3SGL A;  2AAQ A;  2QA2 A;  4NTC A;  4BK2 A;  2ZZB A;  3DK4 A;  3FMW A;  4GF7 A;  5M10 A;  2YQU A;  3NN6 X;  2ZBW A;  2B7R A;  3AEG A;  4OPU A;  4U8K A;  4LII A;  1EL7 A;  2WQY A;  2XLR A;  2YLS A;  2EQ7 A;  3NGC X;  4H4T A;  4YT0 A;  3W4J A;  2X99 A;  4Y4N A;  3CPI G;  1IUV A;  3D1C A;  2RGH A;  1GV4 A;  1Q9I A;  1PJ7 A;  3ZNN A;  1GTH A; 
#chains in the Genus database with same CATH topology
 4J33 A;  4RG3 A;  3SM8 A;  2BXR A;  1S3E A;  4NTD A;  2YM1 A;  4H4U A;  1GTE A;  4XWR A;  1OJ9 A;  4IVM B;  4YJG A;  4YSY A;  2DKH A;  3RP8 A;  1NHQ A;  2CUL A;  3CTY A;  4IA5 A;  1PS9 A;  1K0J A;  3I3L A;  4YJF B;  1KSS A;  2BCP A;  1H7X A;  3UOZ A;  1DOB A;  1EL5 A;  4BK3 A;  1E6E A;  1D7L A;  4K22 A;  1ZX9 A;  4CBQ A;  4NWZ A;  4U8N A;  4YJD A;  1COY A;  2EQ8 A;  3G5R A;  2OA1 A;  4GDP A;  2V60 A;  4Z43 A;  1NAA A;  3QFA A;  4LU6 A;  2XCG A;  1GRG A;  1NDA A;  2V3B A;  1YQ3 A;  3ATQ A;  2I0Z A;  3K7T A;  1NHS A;  2NPX A;  5JCN A;  3PVC A;  4MJW A;  3BI4 A;  3AE7 A;  4OPT A;  4DGK A;  1QLB A;  4LA1 A;  4AOS A;  5BUK A;  4YJH A;  3DH9 A;  3AE8 A;  3QSE A;  1UKV G;  4H2R A;  1PXB A;  2PHH A;  4GAP A;  3AE5 A;  5U1O A;  3FBS A;  3GDN A;  3KD9 A;  1CL0 A;  1EL8 A;  3NIX A;  3T31 A;  3NK0 X;  2XFO A;  4H2N A;  3O0H A;  4BJZ A;  5IQ1 A;  3UCL A;  2BS4 A;  2GAG B;  1W4X A;  3Q9T A;  4EMJ A;  4XWZ A;  4EIQ A;  3SXI A;  4USR A;  4IVO B;  2TPR A;  4IA6 A;  2FJB A;  3ALM A;  4C74 A;  2GQW A;  1B8S A;  1NG4 A;  1JNZ A;  3IHG A;  3B3R A;  3CNT A;  5JCK A;  2X50 A;  4C77 A;  2RGO A;  1PXA A;  2VRM A;  4G9K A;  3GMB A;  1LVL A;  4KX6 A;  3AED A;  2FBW A;  3CUK A;  2WU5 A;  3NKS A;  1JEH A;  2WP9 A;  3AE6 A;  5KMP A;  1PBD A;  1DOC A;  4YJG B;  1YY5 A;  3LOV A;  2GV8 A;  3DK8 A;  2GMJ A;  2WOW A;  2C70 A;  3URH A;  5KMS A;  3LB8 A;  1FL2 A;  1GER A;  1ZDL A;  2BXS A;  3CNP A;  2GAH B;  3CGD A;  3UKL A;  3ATR A;  3NTA A;  3SX6 A;  4BJY A;  5J7X A;  3AWI A;  4I59 A;  1XDI A;  1TYP A;  2YR6 A;  3P4P A;  4H4S A;  3ZNP A;  1REO A;  4Y4M A;  3VRB A;  5FS9 A;  2X8H A;  2XDO A;  2UZZ A;  4AOX A;  4C3X A;  1GPE A;  1B4V A;  1MO9 A;  4TM0 A;  3OC4 A;  2ZZ0 A;  4DNA A;  4DSH A;  4Z2T A;  4BV6 A;  1H84 A;  3VR9 A;  2VOU A;  4YJH B;  4II2 A;  2YG5 A;  1O94 A;  4B66 A;  3M0O A;  2YLX A;  3CPJ G;  3BNM A;  4ZCD A;  4Z25 A;  5TR3 A;  1D7Y A;  3G5S A;  3UKF A;  2YWL A;  1O5W A;  2FJA A;  3LZW A;  4OCG A;  5IQ4 A;  3T2Y A;  1GEU A;  1PJ5 A;  3V76 A;  3S61 A;  3SFE A;  2AR8 A;  1TDK A;  4EQR A;  1GRF A;  2WEU A;  2XLT A;  4U8O A;  2XLS A;  3IHM A;  1PN0 A;  1PBB A;  1JOA A;  2GQF A;  3CNJ A;  2X8C A;  3M12 A;  4CCR A;  1L0V A;  4ZN0 A;  1JRX A;  4G6H A;  4FX9 A;  3CMM A;  5HYM A;  1VRQ B;  1Y0P A;  4NEW A;  3CPH G;  4B65 A;  1NG3 A;  4YXD A;  1PBE A;  4NEV A;  1NEK A;  4J57 A;  5KOW A;  1ZKQ A;  3BNU A;  3F8R A;  2JB3 A;  4H4V A;  4Z26 A;  2BRA A;  2J3N A;  3T2K A;  4CY8 A;  3EAO A;  2GH5 A;  2XVI A;  2YR5 A;  3GD3 A;  3E1T A;  1CJ3 A;  3NK1 X;  4PAB A;  1E7P A;  4USQ A;  4ADW A;  2GVC A;  4EM4 A;  2YR4 A;  3UTH A;  1N4W A;  2C65 A;  4J56 A;  2WP6 A;  2C64 A;  4OPC A;  5GSN A;  2Q6U A;  4Y4L A;  1EVI A;  4KPR A;  2FJD A;  4GDE A;  1D5T A;  1PXC A;  1M6I A;  2V3A A;  1FEA A;  2GEW A;  1K4Q A;  4G6G A;  2GR0 A;  5EOW A;  3RP7 A;  3GDP A;  4YKF A;  1GRH A;  1B5Q A;  3ICT A;  1KF6 A;  1X31 B;  1JU2 A;  1CC2 A;  1GES A;  2IID A;  1Y56 B;  5CQF A;  3BHK A;  3P4S A;  4G73 A;  1L9D A;  4CCQ A;  4J36 A;  3ITJ A;  2Q7V A;  1TRB A;  4H50 A;  3ABV A;  2JB1 A;  1GND A;  1V59 A;  2YM2 A;  4QFD A;  3EAN A;  3LJP A;  4EM3 A;  2JK6 A;  2YG3 A;  1F8R A;  2R45 A;  1EBD A;  1IUS A;  1BGN A;  1IJH A;  2BCG G;  3UP5 A;  4Z2R A;  1NEN A;  3SY4 A;  4FK1 C;  3CGE A;  1AOG A;  1DJN A;  1NPX A;  2CVJ A;  4H4Q A;  5EB4 A;  5KRQ A;  2XFN A;  3DGZ A;  3GYX A;  4M52 A;  3UKK A;  4B67 A;  3B6D A;  1C0L A;  1P2E A;  4EQW A;  3QFB A;  2WET A;  3SZF A;  1SEZ A;  3W4I A;  2WOV A;  2WPC A;  1IUU A;  2XFQ A;  3AE9 A;  5ER0 A;  4BUR A;  1GOS A;  2H88 A;  4EMW A;  3DJJ A;  4RSL A;  4A79 A;  5KNL A;  2B9Y A;  1AN9 A;  2GF3 A;  4JN9 A;  2ZZC A;  4JDR A;  1E1M A;  1FEC A;  3K30 A;  3SZW A;  2EQ9 A;  2BRY A;  3QJ4 A;  3AD9 B;  1OJC A;  3AE2 A;  3L1R A;  1N4V A;  3VR8 A;  1M64 A;  1VE9 A;  1E39 A;  3GWD A;  2BC0 A;  3FIM B;  3NT6 A;  3P1W A;  4FK1 A;  5HXI A;  4H4W A;  4CY6 A;  4YWO A;  1OJD A;  1VDC A;  4GCM A;  4AT0 A;  4YSH A;  3QVP A;  3GRS A;  1MOK A;  3IF9 A;  4BK1 A;  1TDE A;  4K5R A;  1H82 A;  2VVM A;  2E82 A;  4REK A;  1DXL A;  4A7A A;  1KFY A;  3ZDN A;  4U8I A;  2B7S A;  2QA1 A;  2WP5 A;  2BK5 A;  2VZ2 A;  3AEF A;  4TM4 A;  1D4E A;  3AEC A;  5FS7 A;  4B1B A;  4CNJ A;  3RP6 A;  2C7G A;  4OPD A;  2OAL A;  2XVJ A;  5J60 A;  3HZL A;  2C72 A;  2H89 A;  4JNQ A;  1E1K A;  1GRE A;  1TDN A;  1B37 A;  1L9C A;  4C3Y A;  2BK3 A;  2RAB A;  5L46 A;  1JRY A;  1RYI A;  4HB9 A;  2APG A;  3KPK A;  5GRT A;  4OVI A;  1IUW A;  3QVR A;  1HYU A;  2GR2 A;  1C0I A;  1CC4 A;  3K7M X;  4QFC A;  2WS3 A;  4J2W A;  4AP3 A;  4X9N A;  3FG2 P;  4EIP A;  1DDO A;  3NYF A;  1PBC A;  1FEB A;  3BI5 A;  5KVH A;  3NYE A;  4NNJ A;  3RNM A;  5KXJ A;  1CJ4 A;  2R9Z A;  2R4J A;  2W0H A;  3ADA B;  4YSZ A;  1IUT A;  1PJ6 A;  3CGB A;  1TDO A;  2RGJ A;  4H2P A;  4AP1 A;  4U2L A;  3EF6 A;  2CDU A;  2OLN A;  2WHD A;  3AD7 B;  4H4Z A;  4A65 A;  1H7W A;  4ICY A;  1TDF A;  4O5U A;  3UKP A;  3SZC A;  1TYT A;  3KPF A;  3V3N A;  4UP3 A;  3NHO X;  1DNC A;  3UTG A;  3WE0 A;  1NHR A;  1DAO A;  3NYC A;  3LZX A;  1BGJ A;  4K7Z A;  1DOD A;  1S3B A;  3ALL A;  2F5Z A;  2BC1 A;  4B64 A;  5BRT A;  1FOH A;  2VRL A;  2R46 A;  2WES A;  2HQM A;  3H4K A;  4A6N A;  2PYX A;  2O9Z A;  3AXB A;  4B69 A;  4UDQ A;  1IUX A;  3OZ2 A;  3HYV A;  5EBK A;  1ELI A;  2A87 A;  4RG4 A;  3C96 A;  1N1P A;  4O5Q A;  2XLU A;  4J31 A;  2JBV A;  1YQ4 A;  3NLC A;  2VVL A;  1RP0 A;  2XFU A;  2IVE A;  3SQP A;  3CNS A;  4U8L A;  2E49 A;  3WGT A;  4JY2 A;  3H8I A;  5C2T A;  4CRT A;  1MXT A;  2YAU A;  2EQ6 A;  3PS9 A;  3HYW A;  3DJD A;  2BAB A;  3NK2 X;  2Q0L A;  1Q1W A;  4UDR A;  2GRT A;  1ZMD A;  2YLT A;  3AYL A;  5U25 A;  5JCM A;  4II3 A;  3ZNQ A;  1CJC A;  1GAL A;  1LQT A;  3UP4 A;  4J34 A;  4TLX A;  2X3N A;  2XLP A;  3GRT A;  4A5L A;  5KMQ A;  2WPF A;  2C3C A;  5FS6 A;  4H4P A;  4DSG A;  1NHP A;  2WDR A;  1KNP A;  4B63 A;  5HY5 A;  3KKJ A;  3VRA A;  1JNR A;  2BYB A;  3T14 A;  1CC6 A;  4AT2 A;  3DK9 A;  2JB2 A;  5M0Z A;  4APN A;  3UOX A;  2BAC A;  4H2Q A;  4TLZ A;  1H6V A;  3VQR A;  1E1L A;  2WU2 A;  4H4Y A;  1LQU A;  1K0L A;  3GMC A;  2YVF A;  4NTE A;  2E48 A;  2R4E A;  1GRT A;  3F8P A;  3SYI A;  4GUV A;  2R0G A;  1C0P A;  3AD8 B;  5KOX A;  1Z6L A;  3UOV A;  3F8D A;  3AB1 A;  3ZYX A;  5U63 A;  3II4 A;  2ARD A;  2BS3 A;  2V6O A;  2XVF A;  4WX1 A;  4E0V A;  1F3P A;  3QSS A;  2YVG A;  1C0K A;  1FCD A;  5CKU A;  1S2Y A;  1ZK7 A;  4A6N B;  4D03 A;  3C4A A;  2WOI A;  3AYJ A;  3GD4 A;  3GYI A;  3CND A;  3HYX A;  4TM1 A;  2AQJ A;  3KLJ A;  1DJQ A;  1CHU A;  3ALJ A;  3IWA A;  5FMH A;  3UTF A;  4WCT A;  3L8K A;  3RED A;  1CJ2 A;  3DGH A;  4JY3 A;  1H86 A;  5KWF A;  1H83 A;  3NH3 X;  5JCL A;  1F8S A;  3QSM A;  2GMH A;  5BUL A;  1KIF A;  3IC9 A;  2YLR A;  4YKG A;  4H7U A;  3V3O A;  2Y6R A;  3GWF A;  3ISH A;  1LV0 A;  3PO7 A;  1LTX R;  5LV9 A;  1P2H A;  4TM3 A;  1EL9 A;  2GR3 A;  3G5Q A;  3AE1 A;  2C67 A;  2B9X A;  1PHH A;  3C4N A;  2X8G A;  2Z5Y A;  3DJG X;  4EQS A;  3KU9 A;  1DOE A;  3NNE A;  3CIR A;  3K7Q X;  4GAV A;  1CF3 A;  1KSU A;  4PAA A;  2BK4 A;  4Z44 A;  2V61 A;  2YVJ A;  2JKC A;  4FDC B;  4K2X A;  3UKH A;  3BHF A;  2DKI A;  4IV9 A;  3NN0 X;  3LXD A;  3M13 A;  2E1M A;  4ECH A;  1XAN A;  1BWC A;  4G74 A;  4U8J A;  3VRD B;  2YG6 A;  2QAE A;  5KMR A;  1ZOY A;  3AEB A;  2E5V A;  3COX A;  1BKW A;  1QJD A;  2JAE A;  2XVH A;  2TMD A;  1GSN A;  2Y6Q A;  2YG4 A;  3BI2 A;  3ICR A;  4CNK A;  2R0P A;  2WBA A;  3T2Z A;  5HHF A;  1PDH A;  4HA6 A;  2VVL G;  3LAD A;  4U2S A;  1F6M A;  3NTD A;  1VQW A;  3DJE A;  2E4A A;  4GRT A;  2VQB A;  2YLW A;  1K0I A;  2OAM A;  5DBJ A;  2E4G A;  2R0C A;  4XXG A;  4K5S A;  3SZ0 A;  4NZH A;  1GRA A;  3D8X A;  3P4R A;  4X4J A;  2QCU A;  2XVE A;  4H4X A;  1KDG A;  1LJ1 A;  3NG7 X;  3NRN A;  4YTM A;  1ONF A;  1F8W A;  1XPQ A;  5FS8 A;  2GR1 A;  3AEA A;  4N9X A;  1JRZ A;  1OJT A;  2B76 A;  2OLO A;  4Z2U A;  2C4C A;  2CFY A;  2Q0K A;  2WPE A;  2BA9 A;  2NVK X;  1GRB A;  4C5O A;  3UKQ A;  2WDQ A;  3G3E A;  1OJA A;  1O95 A;  2IVD A;  3SFD A;  4I58 A;  1XHC A;  1Y56 A;  2B9W A;  4JNA A;  2C76 A;  2V5Z A;  4B68 A;  1BF3 A;  1CBO A;  3DA1 A;  2YLZ A;  1QO8 A;  3AEE A;  3T37 A;  4EQX A;  4YSX A;  4OPG A;  2ACZ A;  1ZP0 A;  1ZMC A;  4OPI A;  3KA7 A;  4OPL A;  1D4D A;  3JSK A;  4ZCC A;  2XYO A;  3P4Q A;  4GR1 A;  1ZY8 A;  3RHA A;  2C73 A;  2GB0 A;  3CGC A;  1GT8 A;  3EPT A;  4K8D A;  5BVA A;  1VG0 A;  4H4R A;  4YJF A;  1L9E A;  3W4K A;  2VQ7 A;  3ICS A;  2DU8 A;  3P9U A;  5EB5 A;  4JQ9 A;  5C3J A;  1YQZ A;  3Q6J A;  2A89 A;  1Q1R A;  3ZNO A;  4A9W A;  1H81 A;  1S2Q A;  4YTN A;  2C66 A;  3H8L A;  1N4U A;  3UOY A;  3DME A;  1BZL A;  3AYI A;  4UDP A;  4EMI A;  5JCI A;  2Z5X A;  4Z24 A;  4X9M A;  1KNR A;  3AE3 A;  3UKA A;  4A99 A;  2WDV A;  1LPF A;  1RSG A;  3KVE A;  3R9U A;  4D04 A;  3S5W A;  1GET A;  1PBF A;  4U8M A;  5KVI A;  3GYJ A;  3UTE A;  1YKJ A;  4YTP A;  2BS2 A;  2C3D A;  2XFP A;  1E1N A;  3GSI A;  1D4C A;  2C75 A;  3AE4 A;  2A8X A;  2FJE A;  2YG7 A;  3CN8 A;  5IPY A;  4U2T A;  3I6D A;  1VG9 A;  1GXF A;  4U8P A;  3FPZ A;  1ZOV A;  4P9S A;  3SGL A;  2AAQ A;  2QA2 A;  4NTC A;  4BK2 A;  2ZZB A;  3DK4 A;  3FMW A;  4GF7 A;  3T0K A;  5M10 A;  2YQU A;  3NN6 X;  2ZBW A;  2B7R A;  3AEG A;  4OPU A;  4U8K A;  4LII A;  1EL7 A;  2WQY A;  2XLR A;  2YLS A;  2EQ7 A;  3NGC X;  4H4T A;  4YT0 A;  3W4J A;  2X99 A;  4Y4N A;  3CPI G;  1IUV A;  3D1C A;  2RGH A;  1GV4 A;  1Q9I A;  1PJ7 A;  3ZNN A;  1GTH A; 
#chains in the Genus database with same CATH homology
 4J33 A;  4RG3 A;  3SM8 A;  2BXR A;  1S3E A;  4NTD A;  2YM1 A;  4H4U A;  1GTE A;  4XWR A;  1OJ9 A;  4IVM B;  4YJG A;  4YSY A;  2DKH A;  1NHQ A;  2CUL A;  3CTY A;  3RP8 A;  4IA5 A;  1PS9 A;  1K0J A;  3I3L A;  4YJF B;  1KSS A;  2BCP A;  1H7X A;  3UOZ A;  1DOB A;  1EL5 A;  4BK3 A;  1E6E A;  1D7L A;  1ZX9 A;  4K22 A;  4CBQ A;  4NWZ A;  4U8N A;  4YJD A;  1COY A;  2EQ8 A;  3G5R A;  2OA1 A;  4GDP A;  2V60 A;  4Z43 A;  1NAA A;  3QFA A;  4LU6 A;  2XCG A;  1GRG A;  1NDA A;  2V3B A;  1YQ3 A;  3ATQ A;  2I0Z A;  3K7T A;  1NHS A;  2NPX A;  5JCN A;  3PVC A;  4MJW A;  3BI4 A;  3AE7 A;  4OPT A;  4DGK A;  1QLB A;  4LA1 A;  4AOS A;  5BUK A;  4YJH A;  3DH9 A;  3AE8 A;  3QSE A;  1UKV G;  4H2R A;  1PXB A;  2PHH A;  4GAP A;  3AE5 A;  5U1O A;  3FBS A;  3GDN A;  3KD9 A;  1CL0 A;  1EL8 A;  3NIX A;  3T31 A;  3NK0 X;  2XFO A;  3O0H A;  4H2N A;  4BJZ A;  5IQ1 A;  3UCL A;  2BS4 A;  2GAG B;  1W4X A;  3Q9T A;  4EMJ A;  4XWZ A;  4EIQ A;  3SXI A;  4USR A;  4IVO B;  2TPR A;  4IA6 A;  2FJB A;  3ALM A;  4C74 A;  2GQW A;  1B8S A;  1NG4 A;  1JNZ A;  3B3R A;  3CNT A;  3IHG A;  5JCK A;  2X50 A;  4C77 A;  2RGO A;  1PXA A;  2VRM A;  4G9K A;  3GMB A;  1LVL A;  4KX6 A;  3AED A;  2FBW A;  3CUK A;  2WU5 A;  3NKS A;  1JEH A;  2WP9 A;  3AE6 A;  5KMP A;  1PBD A;  1DOC A;  4YJG B;  1YY5 A;  3LOV A;  2GV8 A;  3DK8 A;  2GMJ A;  2WOW A;  2C70 A;  3URH A;  5KMS A;  3LB8 A;  1FL2 A;  1GER A;  1ZDL A;  2BXS A;  3CNP A;  2GAH B;  3CGD A;  3UKL A;  3ATR A;  3NTA A;  3SX6 A;  4BJY A;  5J7X A;  3AWI A;  4I59 A;  1XDI A;  1TYP A;  2YR6 A;  3P4P A;  4H4S A;  3ZNP A;  1REO A;  4Y4M A;  3VRB A;  5FS9 A;  2X8H A;  2XDO A;  2UZZ A;  4AOX A;  4C3X A;  1GPE A;  1B4V A;  1MO9 A;  4TM0 A;  3OC4 A;  2ZZ0 A;  4DNA A;  4DSH A;  4Z2T A;  4BV6 A;  1H84 A;  3VR9 A;  2VOU A;  4YJH B;  4II2 A;  2YG5 A;  1O94 A;  4B66 A;  3M0O A;  2YLX A;  3CPJ G;  3BNM A;  4ZCD A;  4Z25 A;  5TR3 A;  1D7Y A;  3G5S A;  3UKF A;  2YWL A;  1O5W A;  2FJA A;  3LZW A;  4OCG A;  5IQ4 A;  3T2Y A;  1GEU A;  1PJ5 A;  3V76 A;  3S61 A;  3SFE A;  2AR8 A;  1TDK A;  4EQR A;  1GRF A;  2WEU A;  2XLT A;  4U8O A;  2XLS A;  3IHM A;  1PN0 A;  1PBB A;  1JOA A;  2GQF A;  3CNJ A;  2X8C A;  3M12 A;  4CCR A;  1L0V A;  4ZN0 A;  1JRX A;  4G6H A;  4FX9 A;  3CMM A;  5HYM A;  1VRQ B;  1Y0P A;  4NEW A;  3CPH G;  4B65 A;  1NG3 A;  4YXD A;  1PBE A;  4NEV A;  1NEK A;  4J57 A;  5KOW A;  1ZKQ A;  3BNU A;  3F8R A;  2JB3 A;  4H4V A;  4Z26 A;  2BRA A;  2J3N A;  3T2K A;  4CY8 A;  3EAO A;  2GH5 A;  2XVI A;  2YR5 A;  3GD3 A;  3E1T A;  1CJ3 A;  3NK1 X;  4PAB A;  1E7P A;  4USQ A;  4ADW A;  2GVC A;  4EM4 A;  2YR4 A;  3UTH A;  1N4W A;  2C65 A;  4J56 A;  2WP6 A;  2C64 A;  4OPC A;  5GSN A;  2Q6U A;  4Y4L A;  1EVI A;  4KPR A;  2FJD A;  4GDE A;  1D5T A;  1PXC A;  1M6I A;  2V3A A;  1FEA A;  2GEW A;  1K4Q A;  4G6G A;  2GR0 A;  5EOW A;  4YKF A;  3GDP A;  3RP7 A;  1GRH A;  1B5Q A;  3ICT A;  1KF6 A;  1X31 B;  1JU2 A;  1CC2 A;  1GES A;  2IID A;  1Y56 B;  5CQF A;  3BHK A;  3P4S A;  4G73 A;  1L9D A;  4CCQ A;  4J36 A;  3ITJ A;  2Q7V A;  1TRB A;  4H50 A;  3ABV A;  2JB1 A;  1GND A;  1V59 A;  2YM2 A;  4QFD A;  3EAN A;  3LJP A;  4EM3 A;  2JK6 A;  2YG3 A;  1F8R A;  2R45 A;  1EBD A;  1IUS A;  1BGN A;  1IJH A;  2BCG G;  3UP5 A;  4Z2R A;  1NEN A;  3SY4 A;  4FK1 C;  3CGE A;  1AOG A;  1DJN A;  1NPX A;  2CVJ A;  4H4Q A;  5EB4 A;  5KRQ A;  2XFN A;  3DGZ A;  3GYX A;  4M52 A;  3UKK A;  4B67 A;  3B6D A;  1C0L A;  1P2E A;  4EQW A;  3QFB A;  2WET A;  3SZF A;  1SEZ A;  3W4I A;  2WOV A;  2WPC A;  1IUU A;  2XFQ A;  3AE9 A;  5ER0 A;  4BUR A;  1GOS A;  2H88 A;  4EMW A;  3DJJ A;  4RSL A;  4A79 A;  5KNL A;  2B9Y A;  1AN9 A;  2GF3 A;  4JN9 A;  2ZZC A;  4JDR A;  1E1M A;  1FEC A;  3K30 A;  3SZW A;  2EQ9 A;  2BRY A;  3QJ4 A;  1OJC A;  3AD9 B;  3AE2 A;  3L1R A;  1N4V A;  3VR8 A;  1M64 A;  1VE9 A;  1E39 A;  3GWD A;  2BC0 A;  3FIM B;  3NT6 A;  3P1W A;  4FK1 A;  5HXI A;  4H4W A;  4CY6 A;  4YWO A;  1OJD A;  1VDC A;  4GCM A;  4AT0 A;  4YSH A;  3QVP A;  3GRS A;  1MOK A;  3IF9 A;  4K5R A;  1TDE A;  4BK1 A;  1H82 A;  2VVM A;  2E82 A;  4REK A;  1DXL A;  4A7A A;  1KFY A;  3ZDN A;  4U8I A;  2B7S A;  2QA1 A;  2WP5 A;  2BK5 A;  2VZ2 A;  3AEF A;  4TM4 A;  1D4E A;  3AEC A;  5FS7 A;  4B1B A;  4CNJ A;  2C7G A;  3RP6 A;  4OPD A;  2OAL A;  2XVJ A;  5J60 A;  3HZL A;  2C72 A;  2H89 A;  4JNQ A;  1E1K A;  1GRE A;  1TDN A;  1B37 A;  1L9C A;  4C3Y A;  2BK3 A;  2RAB A;  5L46 A;  1JRY A;  1RYI A;  4HB9 A;  2APG A;  3KPK A;  5GRT A;  4OVI A;  1IUW A;  3QVR A;  1HYU A;  2GR2 A;  1C0I A;  1CC4 A;  3K7M X;  4QFC A;  2WS3 A;  4J2W A;  4AP3 A;  4X9N A;  3FG2 P;  4EIP A;  1DDO A;  3NYF A;  1PBC A;  1FEB A;  3BI5 A;  5KVH A;  3NYE A;  4NNJ A;  3RNM A;  5KXJ A;  1CJ4 A;  2R9Z A;  2R4J A;  2W0H A;  3ADA B;  4YSZ A;  1IUT A;  1PJ6 A;  3CGB A;  1TDO A;  2RGJ A;  4H2P A;  4AP1 A;  4U2L A;  3EF6 A;  2CDU A;  2OLN A;  2WHD A;  3AD7 B;  4H4Z A;  4A65 A;  1H7W A;  4ICY A;  1TDF A;  4O5U A;  3UKP A;  3SZC A;  1TYT A;  3KPF A;  3V3N A;  4UP3 A;  3NHO X;  1DNC A;  3UTG A;  3WE0 A;  1NHR A;  1DAO A;  3NYC A;  3LZX A;  1BGJ A;  4K7Z A;  1DOD A;  1S3B A;  3ALL A;  2F5Z A;  2BC1 A;  4B64 A;  5BRT A;  1FOH A;  2VRL A;  2R46 A;  2WES A;  2HQM A;  3H4K A;  4A6N A;  2PYX A;  2O9Z A;  3AXB A;  4B69 A;  4UDQ A;  1IUX A;  3OZ2 A;  3HYV A;  5EBK A;  1ELI A;  2A87 A;  4RG4 A;  3C96 A;  1N1P A;  4O5Q A;  2XLU A;  4J31 A;  2JBV A;  1YQ4 A;  3NLC A;  2VVL A;  1RP0 A;  2XFU A;  2IVE A;  3SQP A;  3CNS A;  4U8L A;  2E49 A;  3WGT A;  3H8I A;  4JY2 A;  5C2T A;  4CRT A;  1MXT A;  2YAU A;  2EQ6 A;  3PS9 A;  3HYW A;  3DJD A;  2BAB A;  3NK2 X;  2Q0L A;  1Q1W A;  4UDR A;  2GRT A;  1ZMD A;  2YLT A;  3AYL A;  5U25 A;  5JCM A;  4II3 A;  3ZNQ A;  1CJC A;  1GAL A;  1LQT A;  3UP4 A;  4J34 A;  4TLX A;  2X3N A;  2XLP A;  3GRT A;  4A5L A;  5KMQ A;  2WPF A;  2C3C A;  5FS6 A;  4H4P A;  4DSG A;  1NHP A;  2WDR A;  1KNP A;  4B63 A;  5HY5 A;  3KKJ A;  3VRA A;  1JNR A;  2BYB A;  3T14 A;  1CC6 A;  4AT2 A;  3DK9 A;  2JB2 A;  5M0Z A;  4APN A;  3UOX A;  2BAC A;  4H2Q A;  4TLZ A;  1H6V A;  3VQR A;  1E1L A;  2WU2 A;  4H4Y A;  1LQU A;  1K0L A;  3GMC A;  2YVF A;  4NTE A;  2E48 A;  2R4E A;  1GRT A;  3F8P A;  3SYI A;  4GUV A;  2R0G A;  1C0P A;  3AD8 B;  5KOX A;  1Z6L A;  3UOV A;  3F8D A;  3AB1 A;  3ZYX A;  5U63 A;  3II4 A;  2ARD A;  2BS3 A;  2V6O A;  2XVF A;  4WX1 A;  4E0V A;  1F3P A;  3QSS A;  2YVG A;  1C0K A;  1FCD A;  5CKU A;  1S2Y A;  1ZK7 A;  4A6N B;  4D03 A;  3C4A A;  2WOI A;  3AYJ A;  3GD4 A;  3GYI A;  3CND A;  3HYX A;  4TM1 A;  2AQJ A;  3KLJ A;  1DJQ A;  1CHU A;  3ALJ A;  3IWA A;  5FMH A;  3UTF A;  4WCT A;  3L8K A;  3RED A;  1CJ2 A;  3DGH A;  4JY3 A;  1H86 A;  5KWF A;  1H83 A;  3NH3 X;  5JCL A;  1F8S A;  3QSM A;  2GMH A;  5BUL A;  1KIF A;  3IC9 A;  2YLR A;  4YKG A;  4H7U A;  3V3O A;  2Y6R A;  3GWF A;  3ISH A;  1LV0 A;  3PO7 A;  1LTX R;  5LV9 A;  1P2H A;  4TM3 A;  1EL9 A;  2GR3 A;  3G5Q A;  3AE1 A;  2C67 A;  2B9X A;  1PHH A;  3C4N A;  2X8G A;  2Z5Y A;  3DJG X;  4EQS A;  3KU9 A;  1DOE A;  3NNE A;  3CIR A;  3K7Q X;  4GAV A;  1CF3 A;  1KSU A;  4PAA A;  2BK4 A;  4Z44 A;  2V61 A;  2YVJ A;  2JKC A;  4FDC B;  4K2X A;  3UKH A;  3BHF A;  2DKI A;  4IV9 A;  3NN0 X;  3LXD A;  3M13 A;  2E1M A;  4ECH A;  1XAN A;  1BWC A;  4G74 A;  4U8J A;  3VRD B;  2YG6 A;  2QAE A;  5KMR A;  1ZOY A;  3AEB A;  2E5V A;  3COX A;  1BKW A;  1QJD A;  2JAE A;  2XVH A;  2TMD A;  1GSN A;  2Y6Q A;  2YG4 A;  3BI2 A;  3ICR A;  4CNK A;  2R0P A;  2WBA A;  3T2Z A;  5HHF A;  1PDH A;  4HA6 A;  2VVL G;  3LAD A;  4U2S A;  1F6M A;  3NTD A;  1VQW A;  3DJE A;  2E4A A;  4GRT A;  2VQB A;  2YLW A;  1K0I A;  2OAM A;  5DBJ A;  2E4G A;  2R0C A;  4XXG A;  4K5S A;  3SZ0 A;  4NZH A;  1GRA A;  3D8X A;  3P4R A;  4X4J A;  2QCU A;  2XVE A;  4H4X A;  1KDG A;  1LJ1 A;  3NG7 X;  3NRN A;  4YTM A;  1ONF A;  1F8W A;  1XPQ A;  5FS8 A;  2GR1 A;  3AEA A;  4N9X A;  1JRZ A;  1OJT A;  2B76 A;  2OLO A;  4Z2U A;  2C4C A;  2CFY A;  2Q0K A;  2WPE A;  2BA9 A;  2NVK X;  1GRB A;  4C5O A;  3UKQ A;  2WDQ A;  3G3E A;  1OJA A;  1O95 A;  2IVD A;  3SFD A;  4I58 A;  1XHC A;  1Y56 A;  2B9W A;  4JNA A;  2C76 A;  2V5Z A;  4B68 A;  1BF3 A;  1CBO A;  3DA1 A;  2YLZ A;  1QO8 A;  3AEE A;  3T37 A;  4EQX A;  4YSX A;  4OPG A;  2ACZ A;  1ZP0 A;  1ZMC A;  4OPI A;  3KA7 A;  4OPL A;  1D4D A;  3JSK A;  4ZCC A;  2XYO A;  3P4Q A;  4GR1 A;  1ZY8 A;  3RHA A;  2C73 A;  2GB0 A;  3CGC A;  1GT8 A;  3EPT A;  4K8D A;  5BVA A;  1VG0 A;  4H4R A;  4YJF A;  1L9E A;  3W4K A;  2VQ7 A;  3ICS A;  2DU8 A;  3P9U A;  5EB5 A;  4JQ9 A;  5C3J A;  1YQZ A;  3Q6J A;  2A89 A;  1Q1R A;  3ZNO A;  4A9W A;  1H81 A;  1S2Q A;  4YTN A;  2C66 A;  3H8L A;  1N4U A;  3UOY A;  3DME A;  1BZL A;  3AYI A;  4UDP A;  4EMI A;  5JCI A;  2Z5X A;  4Z24 A;  4X9M A;  1KNR A;  3AE3 A;  3UKA A;  4A99 A;  2WDV A;  1LPF A;  1RSG A;  3KVE A;  3R9U A;  4D04 A;  3S5W A;  1GET A;  1PBF A;  4U8M A;  5KVI A;  3GYJ A;  3UTE A;  1YKJ A;  4YTP A;  2BS2 A;  2C3D A;  2XFP A;  1E1N A;  3GSI A;  1D4C A;  2C75 A;  3AE4 A;  2A8X A;  2FJE A;  2YG7 A;  3CN8 A;  5IPY A;  4U2T A;  3I6D A;  1VG9 A;  1GXF A;  4U8P A;  3FPZ A;  1ZOV A;  4P9S A;  3SGL A;  2AAQ A;  2QA2 A;  4NTC A;  4BK2 A;  2ZZB A;  3DK4 A;  3FMW A;  4GF7 A;  3T0K A;  5M10 A;  2YQU A;  3NN6 X;  2ZBW A;  2B7R A;  3AEG A;  4OPU A;  4U8K A;  4LII A;  1EL7 A;  2WQY A;  2XLR A;  2YLS A;  2EQ7 A;  3NGC X;  4H4T A;  4YT0 A;  3W4J A;  2X99 A;  4Y4N A;  3CPI G;  1IUV A;  3D1C A;  2RGH A;  1GV4 A;  1Q9I A;  1PJ7 A;  3ZNN A;  1GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...