3R9UA

Thioredoxin-disulfide reductase from campylobacter jejuni.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
314
structure length
314
Chain Sequence
SNAMLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKDGSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thioredoxin-disulfide reductase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 86
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA02
3NT6A 2XLRA 1GRFA 4DSGA 1GNDA 1GRGA 2VRLA 3DMEA 1JNZA 4H2RA 5FS9A 4CY6A 3NKSA 4J57A 4J33A 2C64A 2OLOA 2YLTA 2RGHA 1JRYA 1TYTA 2X99A 3BNUA 2C67A 2XVHA 3CGDA 1ZK7A 4YTMA 5GRTA 2E5VA 1TYPA 5M0ZA 4Z43A 1N4VA 1PBFA 2C70A 2R0PA 4OPLA 5FS6A 1FECA 2Y6RA 2APGA 3P4QA 4BK2A 3D8XA 1TRBA 3FMWA 4U2TA 1NDAA 2RGOA 2XFPA 1PXAA 2GAGB 3CPJG 2OALA 1H7WA 1KSUA 2XFUA 3GWFA 1NHPA 1GTHA 1PXBA 2C72A 2Q0KA 2V3AA 2R45A 2V6OA 2WPCA 3NH3X 4J2WA 2V61A 4IV9A 4YSZA 5EB4A 2WPFA 4TM1A 1GRHA 5KOXA 1DJNA 3EF6A 3AEBA 3AEEA 2XFQA 2WQYA 2YAUA 2YM2A 2J3NA 5C2TA 4GR1A 3UP5A 3SFDA 2Z5YA 3NNEA 1KFYA 2BXSA 3AEAA 4H4YA 2R46A 3ABVA 3DK8A 3T37A 1GRAA 1OJ9A 1PXCA 2VQ7A 3P4RA 2F5ZA 3AXBA 3F8RA 4KPRA 3NHOX 4OCGA 1BF3A 3CGBA 4H4WA 3AYJA 3KA7A 4AP1A 1EL9A 1B4VA 1BKWA 1H86A 1IUVA 1FOHA 3EANA 3FPZA 1CJ2A 3LB8A 3ICRA 4EQSA 2VQBA 2X50A 4A6NB 4EIQA 3VQRA 2YLSA 3BHKA 5J60A 1N4UA 1M64A 2BCPA 1IUSA 1QO8A 5IPYA 2AR8A 4UDRA 1GREA 3GDPA 2NVKX 1L9EA 3G5RA 1QJDA 4DGKA 5KOWA 3VRDB 1E39A 1YKJA 5FMHA 3KKJA 1P2EA 4B1BA 1TDOA 2RABA 1B5QA 3UCLA 3AD8B 3NTDA 1Y0PA 5U63A 4REKA 4B66A 4ZN0A 3II4A 2YVGA 1GEUA 2DKIA 2BA9A 4BV6A 3ICSA 4O5UA 3G5QA 4PABA 3UKHA 3ICTA 1PDHA 1E7PA 4K5RA 2YG3A 2X8HA 3ATRA 5EOWA 1GOSA 1LV0A 1YQ4A 1CHUA 3EPTA 4OVIA 3C4NA 3P4SA 3SFEA 5U25A 1ELIA 1LJ1A 3H4KA 4H4RA 5JCLA 2GEWA 4ECHA 3DK9A 4YWOA 2I0ZA 2WP6A 2QA1A 4JN9A 3AYIA 2XDOA 2VRMA 1ZOYA 3LOVA 3V3OA 5KRQA 1NHSA 3GMBA 2EQ9A 1VDCA 2VZ2A 2A8XA 1VG9A 5EBKA 4A9WA 3DJEA 1OJDA 4H4UA 4AOSA 4KX6A 4B69A 3ALJA 3SGLA 2E1MA 1D4DA 2EQ7A 3HZLA 1KF6A 2QA2A 2WP9A 1EL5A 3IF9A 4M52A 1Z6LA 1GSNA 1S2QA 1ZP0A 2UZZA 2R4EA 2Q7VA 4B63A 3DH9A 1YQZA 4K8DA 1IUXA 4GDPA 5CQFA 4ZCCA 1BGJA 1H84A 1LQUA 3DGHA 4TLXA 2X8GA 3K7TA 1JNRA 2WDRA 5U1OA 3BHFA 1CC2A 1PBEA 3CGCA 3Q9TA 4BJZA 5LV9A 2YLZA 1H82A 2A89A 3COXA 4UDPA 5EB5A 3OC4A 3I6DA 4LIIA 1PS9A 2WS3A 3D1CA 5ER0A 2XVJA 3K7MX 3C96A 5C3JA 2WPEA 3GD3A 3LJPA 1F8WA 3AE7A 1GRBA 1OJTA 2EQ6A 4CNJA 3UOYA 4J34A 3BI4A 2FBWA 3ZDNA 1CF3A 2IIDA 5HXIA 3B6DA 3IWAA 1ZMDA 1HYUA 1TDKA 3H8IA 2WOWA 1XPQA 3ADAB 3PO7A 3S61A 4UP3A 1L9DA 3UTFA 2QCUA 4K22A 4U8MA 5IQ4A 3F8PA 3CIRA 3V76A 5IQ1A 5DBJA 2GR1A 4OPIA 1CJCA 1E6EA 1GETA 1ONFA 2GR2A 4OPGA 3BI2A 2JB1A 3QSMA 4OPCA 2C7GA 2V5ZA 4P9SA 2WU5A 2H89A 1F8RA 3NLCA 4OPUA 3NYEA 4XXGA 5CKUA 2FJEA 2YG6A 3C4AA 1FL2A 3UTEA 3P9UA 4TM3A 4X9MA 3M0OA 2B9YA 2ZZBA 3GRTA 1TDFA 2C65A 1GT8A 4AT2A 1E1LA 1PJ5A 3GWDA 4H4VA 1N1PA 3QSSA 4B64A 2JBVA 1N4WA 1PHHA 4H4ZA 4IVMB 4BK3A 4DSHA 4LA1A 1MOKA 4WCTA 3H8LA 2GF3A 2XLTA 3AEFA 2V60A 2ZBWA 4FDCB 4H2NA 3RP6A 4C3YA 2B7SA 2IVDA 2WOVA 4JNQA 4FK1A 5KVHA 4U8KA 4U8JA 4ZCDA 2FJDA 1NPXA 3NK0X 4Z24A 4RG3A 3AE3A 1TDNA 5L46A 4CRTA 2HQMA 3NIXA 2R0GA 3UKAA 2XLPA 4K7ZA 1GV4A 1EL8A 2GMHA 4JQ9A 2BK3A 3CNJA 2ZZCA 4YSHA 3L1RA 4A65A 5JCKA 2BK4A 2WDQA 3GRSA 3G5SA 1VG0A 1CL0A 2C75A 1MO9A 4GF7A 2B9XA 1DXLA 1SEZA 5FS7A 3CNDA 3K30A 4A99A 3AEDA 1YQ3A 1IUTA 1RP0A 1M6IA 1Y56A 1F6MA 3DJDA 3DK4A 2FJBA 4C5OA 4JY2A 5HYMA 1GALA 4CCQA 1DOEA 3ITJA 2XVFA 3CGEA 3L8KA 3LADA 1K0LA 3NTAA 3NYFA 3QVRA 4OPTA 5FS8A 4YKFA 1CJ3A 2JB2A 1JRZA 2BS2A 4A79A 1KDGA 1REOA 1TDEA 4GCMA 3QFBA 4YKGA 1IUUA 3FIMB 3ALLA 3M13A 4C3XA 3UTHA 3SQPA 4N9XA 4CBQA 2OLNA 3V3NA 1O95A 3GD4A 3GDNA 3QJ4A 5KVIA 1FCDA 1JU2A 2WDVA 3IC9A 2ACZA 3REDA 4FX9A 4H4XA 1COYA 5J7XA 1DODA 4NTDA 1F3PA 1GESA 3AD9B 3QFAA 4JDRA 2BACA 5JCMA 3M12A 3P4PA 2B76A 4H50A 4B67A 4C74A 1DOCA 3UKQA 2Q0LA 1BZLA 2YR6A 3VR9A 4RSLA 2YR4A 1YY5A 2BYBA 4Z25A 3RP7A 2GVCA 2WBAA 1PJ7A 2XFOA 1O5WA 3NRNA 4J36A 1GTEA 2B9WA 4XWRA 2JAEA 3RNMA 5HY5A 5KXJA 4ADWA 3K7QX 4U8IA 1Q1WA 4K5SA 3O0HA 3DGZA 2XVIA 3AE4A 1S3EA 3CNTA 2JK6A 3PVCA 1DJQA 1FEBA 1D7YA 1H6VA 3LZXA 3UKLA 2YG7A 2YLWA 4O5QA 1ZX9A 3FG2P 1O94A 1DOBA 3CNPA 4Z2UA 3NK2X 3DJJA 4EM3A 1PBDA 2C73A 3R9UA 1GERA 4AT0A 2YVFA 3CNSA 3I3LA 3UKPA 4EMIA 4IA5A 1NG3A 1OJCA 1GRTA 2PHHA 4YSXA 1W4XA 3KLJA 3RHAA 4C77A 3KPFA 3E1TA 2WESA 3NN6X 2OAMA 4Y4MA 1D7LA 1PBBA 3AE9A 5HHFA 4APNA 2X8CA 1D4EA 3UKKA 2X3NA 4XWZA 2W0HA 2BABA 4GRTA 3DA1A 2C3DA 4YTPA 2GH5A 3OZ2A 5BRTA 1VQWA 4A7AA 4BJYA 3VRBA 2BCGG 4JNAA 2VOUA 2R4JA 3S5WA 4YXDA 3GMCA 4CY8A 4NEVA 4USRA 1E1NA 2BXRA 3GSIA 4EMJA 3KVEA 1MXTA 3NK1X 1JRXA 2GB0A 3EAOA 1JOAA 3AEGA 5KWFA 2A87A 1ZDLA 2H88A 1ZKQA 2CFYA 2CDUA 2BC0A 3NN0X 2C3CA 4EIPA 1OJAA 2YQUA 4MJWA 1BGNA 2WHDA 4OPDA 2O9ZA 2TPRA 2BS4A 1B8SA 5M10A 2WU2A 3AE6A 2YR5A 4NTCA 3CN8A 1ZMCA 1K0JA 2NPXA 1LTXR 3NYCA 2GRTA 2IVEA 1CJ4A 4U8OA 1IJHA 4JY3A 2B7RA 3ALMA 4IA6A 3GYJA 4Z2TA 1K0IA 4FK1C 2YWLA 4TLZA 2CULA 1NG4A 3KD9A 3UOVA 2C76A 2WP5A 2GQWA 5TR3A 2BK5A 1XDIA 3VR8A 4YT0A 1L9CA 1GPEA 1RSGA 4I58A 2YLRA 2JB3A 4Z44A 4LU6A 4X9NA 1XHCA 3ISHA 1IUWA 3F8DA 1Q9IA 4U2SA 4AOXA 1JEHA 1E1MA 4CNKA 1CC6A 2C66A 4E0VA 4Y4NA 2GR0A 4NZHA 2QAEA 1NEKA 1FEAA 1UKVG 4Z2RA 3JSKA 4HB9A 1LVLA 4X4JA 2FJAA 4H7UA 4RG4A 4EQWA 3Q6JA 2EQ8A 3BNMA 1CC4A 4K2XA 3KU9A 4BURA 1QLBA 3AE8A 3UOZA 5JCNA 4B65A 2DKHA 2AAQA 3AE2A 1H81A 4Z26A 5BVAA 2XLUA 4H2PA 5BUKA 1V59A 3ZYXA 3VRAA 3IHGA 3IHMA 1EBDA 1KSSA 3PS9A 2JKCA 1F8SA 1PBCA 2ARDA 2R9ZA 2V3BA 3LXDA 3RP8A 1NHQA 4D04A 2YG4A 4B68A 1PJ6A 1EL7A 2GMJA 2XVEA 3AE5A 1H7XA 2XCGA 3CPIG 4TM4A 2XYOA 4AP3A 2RGJA 3P1WA 1NAAA 1PN0A 2XLSA 2YLXA 3BI5A 3QSEA 4D03A 4YSYA 2BC1A 1D4CA 3SM8A 2VVMA 1H83A 3UTGA 3UKFA 4H4PA 1DNCA 4USQA 3NGCX 4I59A 4HA6A 1CBOA 1L0VA 1ZOVA 2Y6QA 2WEUA 2GAHB 4H2QA 2WOIA 1KNRA 2BS3A 2Q6UA 4EQXA 4A6NA 1ZY8A 5GSNA 1E1KA 4U2LA 4EQRA 3GYIA 4J56A 2GQFA 1GXFA 1XANA 2VVLG 4H4TA 1S2YA 4J31A 3NG7X 3AECA 3QVPA 3UOXA 2ZZ0A 2YG5A 3FBSA 2R0CA 1KNPA 1D5TA 2Z5XA 4U8NA 3WE0A 2WETA 4YTNA 1LQTA 3LZWA 4WX1A 4GUVA 4A5LA 4EMWA 4IVOB 2OA1A 4Y4LA 3AWIA 3B3RA 4U8PA 3CPHG 2YVJA 2AQJA 3CTYA 1B37A 3URHA 4UDQA 4NEWA 3UP4A 1BWCA 2VVLA 3AD7B 4CCRA 1AOGA 1Y56B 3AYLA 2PYXA 2TMDA 4U8LA 4EM4A 4H4SA 2XFNA 3AB1A 1NHRA 1LPFA 4H4QA 3AE1A 1K4QA 4NTEA 3ATQA 1P2HA 4GDEA 2E4GA 4TM0A 5BULA 5JCIA 4PAAA 4ICYA 3DJGX 4BK1A 1RYIA 2GR3A 4DNAA 1NENA 1X31B 1S3BA 2CVJA 2GV8A 1VRQB 2YM1A 1Q1RA
chains in the Genus database with same CATH superfamily
3NT6A 2XLRA 1GRFA 4DSGA 1GNDA 1GRGA 2VRLA 3DMEA 1JNZA 4H2RA 4GAPA 5FS9A 4CY6A 3NKSA 4J57A 4J33A 2C64A 2OLOA 2YLTA 2RGHA 1JRYA 1TYTA 2X99A 3BNUA 2C67A 2XVHA 3CGDA 1ZK7A 4YTMA 5GRTA 2E5VA 1TYPA 5M0ZA 4Z43A 1N4VA 1PBFA 2C70A 2R0PA 4OPLA 5FS6A 1FECA 2Y6RA 2APGA 3P4QA 4BK2A 3D8XA 1TRBA 3FMWA 4U2TA 1NDAA 2RGOA 2XFPA 1PXAA 2GAGB 3CPJG 2OALA 1H7WA 1KSUA 2XFUA 3GWFA 1NHPA 1GTHA 1PXBA 2C72A 2Q0KA 2V3AA 2R45A 2V6OA 2WPCA 3NH3X 4J2WA 2V61A 4IV9A 3T14A 4YSZA 5EB4A 2WPFA 4TM1A 1GRHA 5KOXA 1DJNA 3EF6A 3AEBA 3AEEA 3SZCA 2XFQA 2WQYA 2YAUA 2YM2A 2J3NA 3SZWA 5C2TA 4GR1A 3UP5A 3SFDA 2Z5YA 3NNEA 1KFYA 2BXSA 3AEAA 4H4YA 2R46A 3ABVA 3DK8A 4II3A 1GRAA 3T37A 1OJ9A 1PXCA 2VQ7A 3P4RA 2F5ZA 3AXBA 3F8RA 4KPRA 3NHOX 4OCGA 1BF3A 3CGBA 4H4WA 3AYJA 3KA7A 4AP1A 1EL9A 1B4VA 1BKWA 1H86A 1IUVA 1FOHA 3EANA 3FPZA 1CJ2A 3LB8A 3ICRA 4EQSA 2VQBA 2X50A 4A6NB 4EIQA 3VQRA 2YLSA 3BHKA 5J60A 1N4UA 1M64A 2BCPA 1IUSA 1QO8A 5IPYA 2AR8A 4UDRA 1GREA 3GDPA 2NVKX 1L9EA 3G5RA 1QJDA 4DGKA 5KOWA 3VRDB 1E39A 1YKJA 5FMHA 3KKJA 1P2EA 3SY4A 4B1BA 1TDOA 2RABA 1B5QA 3UCLA 3AD8B 3NTDA 1Y0PA 5U63A 4REKA 4B66A 4ZN0A 3II4A 2YVGA 1GEUA 2DKIA 2BA9A 3SXIA 4BV6A 3ICSA 4O5UA 3G5QA 4PABA 3UKHA 3ICTA 1PDHA 1E7PA 4K5RA 2YG3A 2X8HA 3ATRA 5EOWA 1GOSA 1LV0A 1YQ4A 1CHUA 3KPKA 3EPTA 3T2YA 4OVIA 3C4NA 3P4SA 3SFEA 5U25A 1ELIA 1LJ1A 3H4KA 4H4RA 5JCLA 2GEWA 4ECHA 3DK9A 4YWOA 2I0ZA 2WP6A 2QA1A 4JN9A 3AYIA 2XDOA 2VRMA 1ZOYA 3LOVA 3V3OA 5KRQA 1NHSA 3GMBA 2EQ9A 1VDCA 2VZ2A 2A8XA 1VG9A 5EBKA 4A9WA 3DJEA 1OJDA 4H4UA 4AOSA 4KX6A 4B69A 3ALJA 3SGLA 4GAVA 2E1MA 1D4DA 2EQ7A 3HZLA 1KF6A 2QA2A 2BRYA 2WP9A 1EL5A 3IF9A 4M52A 1Z6LA 1GSNA 1S2QA 1ZP0A 2UZZA 2R4EA 3SZFA 2Q7VA 4B63A 4G6GA 3DH9A 1YQZA 4K8DA 1IUXA 4GDPA 4NWZA 5CQFA 4ZCCA 1BGJA 1H84A 1LQUA 3DGHA 4TLXA 2X8GA 3K7TA 1JNRA 2WDRA 5U1OA 3BHFA 1CC2A 1PBEA 3CGCA 3Q9TA 4BJZA 5LV9A 2YLZA 1H82A 2A89A 3COXA 4UDPA 5EB5A 2C4CA 3OC4A 3I6DA 4LIIA 1PS9A 2WS3A 3D1CA 5ER0A 2XVJA 3K7MX 3C96A 5C3JA 2WPEA 3GD3A 3LJPA 1F8WA 3AE7A 1GRBA 1OJTA 2EQ6A 4CNJA 3UOYA 4J34A 3BI4A 2FBWA 3GYXA 3SX6A 3ZDNA 1CF3A 2IIDA 5HXIA 3B6DA 3IWAA 1ZMDA 1HYUA 1TDKA 3H8IA 2WOWA 1XPQA 3ADAB 3PO7A 3S61A 4UP3A 1L9DA 3UTFA 2QCUA 4K22A 4U8MA 4G73A 5IQ4A 3F8PA 3CIRA 3V76A 5IQ1A 5DBJA 2GR1A 4OPIA 1CJCA 1E6EA 1GETA 1ONFA 4NNJA 2GR2A 4OPGA 3BI2A 2JB1A 3QSMA 4OPCA 2C7GA 2V5ZA 4P9SA 2WU5A 2H89A 1F8RA 3NLCA 4OPUA 3NYEA 4XXGA 5CKUA 2FJEA 2YG6A 3C4AA 1FL2A 3UTEA 3P9UA 4TM3A 4X9MA 3M0OA 2B9YA 2ZZBA 3GRTA 1TDFA 2C65A 1GT8A 3T2KA 4AT2A 1E1LA 1PJ5A 3GWDA 3HYVA 4H4VA 1N1PA 3QSSA 3SYIA 4B64A 2JBVA 1N4WA 1PHHA 4H4ZA 4IVMB 4BK3A 4DSHA 4LA1A 1MOKA 4WCTA 3H8LA 2GF3A 2XLTA 3AEFA 2V60A 2ZBWA 4FDCB 4H2NA 3RP6A 4C3YA 2B7SA 2IVDA 2WOVA 4JNQA 4FK1A 5KVHA 4U8KA 4U8JA 4ZCDA 2FJDA 1NPXA 3NK0X 4Z24A 4RG3A 3AE3A 1TDNA 5L46A 4CRTA 2HQMA 3NIXA 2R0GA 3UKAA 2XLPA 4K7ZA 1GV4A 1EL8A 2GMHA 4JQ9A 2BK3A 3CNJA 2ZZCA 4YSHA 3L1RA 4A65A 5JCKA 2BK4A 2WDQA 3GRSA 3G5SA 1VG0A 1CL0A 2C75A 1MO9A 4GF7A 2B9XA 1DXLA 1SEZA 5FS7A 3CNDA 3K30A 4A99A 3AEDA 1YQ3A 1IUTA 1RP0A 1M6IA 1Y56A 1F6MA 3DJDA 3DK4A 2FJBA 4C5OA 4JY2A 5HYMA 1GALA 4CCQA 1DOEA 3ITJA 2XVFA 3CGEA 3L8KA 3LADA 1K0LA 3NTAA 3NYFA 3QVRA 4OPTA 5FS8A 4YKFA 1CJ3A 2JB2A 1JRZA 2BS2A 4A79A 1KDGA 1REOA 1TDEA 4GCMA 3QFBA 4YKGA 1IUUA 3FIMB 3ALLA 3M13A 4C3XA 3UTHA 3SQPA 4N9XA 4CBQA 2OLNA 3V3NA 1O95A 3GD4A 3GDNA 3QJ4A 5KVIA 1FCDA 1JU2A 2WDVA 3IC9A 2ACZA 3REDA 4FX9A 4H4XA 1COYA 5J7XA 1DODA 4G9KA 4NTDA 1F3PA 1GESA 3AD9B 3QFAA 4JDRA 2BACA 5JCMA 3M12A 3P4PA 2B76A 4H50A 4B67A 4C74A 1DOCA 3HYWA 3UKQA 2Q0LA 1BZLA 2YR6A 3VR9A 4RSLA 2YR4A 1YY5A 2BYBA 4Z25A 3RP7A 2GVCA 2WBAA 1PJ7A 2XFOA 1O5WA 3NRNA 4J36A 1GTEA 2B9WA 4XWRA 2JAEA 3RNMA 5HY5A 5KXJA 5KMQA 4ADWA 3K7QX 4U8IA 1Q1WA 4K5SA 3O0HA 3DGZA 2XVIA 3AE4A 1S3EA 3CNTA 2JK6A 3PVCA 1DJQA 1FEBA 1D7YA 1H6VA 3LZXA 3UKLA 2YG7A 2YLWA 4O5QA 1ZX9A 3FG2P 1O94A 1DOBA 3CNPA 4Z2UA 3NK2X 3DJJA 4EM3A 1PBDA 2C73A 3R9UA 1GERA 4AT0A 2YVFA 3CNSA 3I3LA 3UKPA 4EMIA 4IA5A 1NG3A 3T0KA 3T31A 1OJCA 1GRTA 2PHHA 4YSXA 1W4XA 3KLJA 3RHAA 4C77A 3KPFA 3E1TA 2WESA 3NN6X 2OAMA 4Y4MA 1D7LA 1PBBA 3AE9A 5HHFA 4APNA 2X8CA 1D4EA 3UKKA 2X3NA 4XWZA 5KMPA 2W0HA 2BABA 4GRTA 3DA1A 2C3DA 4YTPA 2GH5A 3OZ2A 5BRTA 3SZ0A 1VQWA 4A7AA 4BJYA 3VRBA 2BCGG 4JNAA 2VOUA 2R4JA 3S5WA 4YXDA 3GMCA 4CY8A 4NEVA 4USRA 1E1NA 2BXRA 3GSIA 4EMJA 3KVEA 1MXTA 3NK1X 1JRXA 2GB0A 3EAOA 1JOAA 3AEGA 5KWFA 2A87A 1ZDLA 2H88A 1ZKQA 3T2ZA 2CFYA 2CDUA 2BC0A 3NN0X 2BRAA 2C3CA 4EIPA 1OJAA 2YQUA 4MJWA 1BGNA 2WHDA 4II2A 4OPDA 2O9ZA 2TPRA 2BS4A 1B8SA 5M10A 2WU2A 3AE6A 2YR5A 4NTCA 3CN8A 1ZMCA 1K0JA 2NPXA 1LTXR 3NYCA 2GRTA 2IVEA 1CJ4A 4U8OA 1IJHA 4JY3A 2B7RA 3ALMA 4IA6A 3GYJA 4Z2TA 1K0IA 4FK1C 2YWLA 4TLZA 2CULA 1NG4A 3KD9A 3UOVA 2C76A 2WP5A 2GQWA 5TR3A 5KMSA 2BK5A 1XDIA 3VR8A 4YT0A 1L9CA 1GPEA 1RSGA 4I58A 2YLRA 2JB3A 4Z44A 4LU6A 4X9NA 1XHCA 3ISHA 1IUWA 3F8DA 1Q9IA 4U2SA 4AOXA 1JEHA 1E1MA 4CNKA 1CC6A 2C66A 4E0VA 4Y4NA 2GR0A 4NZHA 2QAEA 1NEKA 1FEAA 1UKVG 4Z2RA 3JSKA 4HB9A 1LVLA 4X4JA 2FJAA 4H7UA 4RG4A 4G74A 4EQWA 3Q6JA 2EQ8A 3BNMA 1CC4A 4K2XA 3KU9A 4BURA 1QLBA 3AE8A 3UOZA 5JCNA 4B65A 2DKHA 5KNLA 2AAQA 3AE2A 1H81A 4Z26A 5BVAA 2XLUA 4H2PA 5BUKA 1V59A 3ZYXA 3VRAA 3IHGA 3IHMA 1EBDA 1KSSA 3PS9A 2JKCA 1F8SA 1PBCA 2ARDA 2R9ZA 2V3BA 3LXDA 3RP8A 1NHQA 4D04A 2YG4A 4B68A 1PJ6A 1EL7A 2GMJA 2XVEA 3AE5A 1H7XA 2XCGA 3CPIG 4TM4A 2XYOA 4AP3A 2RGJA 3P1WA 1NAAA 1PN0A 2XLSA 2YLXA 3BI5A 3QSEA 4D03A 4YSYA 2BC1A 1D4CA 3SM8A 2VVMA 1H83A 3UTGA 3UKFA 4H4PA 1DNCA 4USQA 3NGCX 4I59A 4HA6A 1CBOA 1L0VA 1ZOVA 2Y6QA 2WEUA 2GAHB 4H2QA 2WOIA 1KNRA 2BS3A 2Q6UA 4EQXA 4A6NA 1ZY8A 5GSNA 1E1KA 4U2LA 4EQRA 5KMRA 3GYIA 4J56A 2GQFA 1GXFA 1XANA 2VVLG 4H4TA 1S2YA 4J31A 3NG7X 3AECA 3QVPA 3UOXA 2ZZ0A 2YG5A 3FBSA 2R0CA 1KNPA 1D5TA 2Z5XA 4U8NA 3WE0A 2WETA 4YTNA 1LQTA 3LZWA 4WX1A 4GUVA 4A5LA 4EMWA 4IVOB 2OA1A 4Y4LA 3AWIA 3B3RA 4U8PA 3CPHG 2YVJA 2AQJA 3CTYA 1B37A 3URHA 4UDQA 3HYXA 4NEWA 3CMMA 3UP4A 1BWCA 2VVLA 3AD7B 4CCRA 1AOGA 1Y56B 3AYLA 2PYXA 2TMDA 4U8LA 4EM4A 4H4SA 2XFNA 3AB1A 1NHRA 1LPFA 4H4QA 3AE1A 1K4QA 4NTEA 3ATQA 1P2HA 4GDEA 2E4GA 4TM0A 5BULA 5JCIA 4PAAA 4ICYA 3DJGX 4BK1A 1RYIA 2GR3A 4DNAA 4G6HA 1NENA 1X31B 1S3BA 2CVJA 2GV8A 1VRQB 2YM1A 1Q1RA
chains in the Genus database with same CATH topology
3NT6A 2XLRA 1GRFA 4DSGA 1GNDA 1GRGA 2VRLA 3DMEA 1JNZA 4H2RA 4GAPA 5FS9A 4CY6A 3NKSA 4J57A 4J33A 2C64A 2OLOA 2YLTA 2RGHA 1JRYA 1TYTA 2X99A 3BNUA 2C67A 2XVHA 3CGDA 1ZK7A 4YTMA 5GRTA 2E5VA 1TYPA 5M0ZA 4Z43A 1N4VA 1PBFA 2C70A 2R0PA 4OPLA 5FS6A 1FECA 2Y6RA 2APGA 3P4QA 4BK2A 3D8XA 1TRBA 3FMWA 4U2TA 1NDAA 2RGOA 2XFPA 1PXAA 2GAGB 3CPJG 2OALA 1H7WA 1KSUA 2XFUA 3GWFA 1NHPA 1GTHA 1PXBA 2C72A 2Q0KA 2V3AA 2R45A 2V6OA 2WPCA 3NH3X 4J2WA 2V61A 4IV9A 3T14A 4YSZA 5EB4A 2WPFA 4TM1A 1GRHA 5KOXA 1DJNA 3EF6A 3AEBA 3AEEA 3SZCA 2XFQA 2WQYA 2YAUA 2YM2A 2J3NA 3SZWA 5C2TA 4GR1A 3UP5A 3SFDA 2Z5YA 3NNEA 1KFYA 2BXSA 3AEAA 4H4YA 2R46A 3ABVA 3DK8A 4II3A 1GRAA 3T37A 1OJ9A 1PXCA 2VQ7A 3P4RA 2F5ZA 3AXBA 3F8RA 4KPRA 3NHOX 4OCGA 1BF3A 3CGBA 4H4WA 3AYJA 3KA7A 4AP1A 1EL9A 1B4VA 1BKWA 1H86A 1IUVA 1FOHA 3EANA 3FPZA 1CJ2A 3LB8A 3ICRA 4EQSA 2VQBA 2X50A 4A6NB 4EIQA 3VQRA 2YLSA 3BHKA 5J60A 1N4UA 1M64A 2BCPA 1IUSA 1QO8A 5IPYA 2AR8A 4UDRA 1GREA 3GDPA 2NVKX 1L9EA 3G5RA 1QJDA 4DGKA 5KOWA 3VRDB 1E39A 1YKJA 5FMHA 3KKJA 1P2EA 3SY4A 4B1BA 1TDOA 2RABA 1B5QA 3UCLA 3AD8B 3NTDA 1Y0PA 5U63A 4REKA 4B66A 4ZN0A 3II4A 2YVGA 1GEUA 2DKIA 2BA9A 3SXIA 4BV6A 3ICSA 4O5UA 3G5QA 4PABA 3UKHA 3ICTA 1PDHA 1E7PA 4K5RA 2YG3A 2X8HA 3ATRA 5EOWA 1GOSA 1LV0A 1YQ4A 1CHUA 3KPKA 3EPTA 3T2YA 4OVIA 3C4NA 3P4SA 3SFEA 5U25A 1ELIA 1LJ1A 3H4KA 4H4RA 5JCLA 2GEWA 4ECHA 3DK9A 4YWOA 2I0ZA 2WP6A 2QA1A 4JN9A 3AYIA 2XDOA 2VRMA 1ZOYA 3LOVA 3V3OA 5KRQA 1NHSA 3GMBA 2EQ9A 1VDCA 2VZ2A 2A8XA 1VG9A 5EBKA 4A9WA 3DJEA 1OJDA 4H4UA 4AOSA 4KX6A 4B69A 3ALJA 3SGLA 4GAVA 2E1MA 1D4DA 2EQ7A 3HZLA 1KF6A 2QA2A 2BRYA 2WP9A 1EL5A 3IF9A 4M52A 1Z6LA 1GSNA 1S2QA 1ZP0A 2UZZA 2R4EA 3SZFA 2Q7VA 4B63A 4G6GA 3DH9A 1YQZA 4K8DA 1IUXA 4GDPA 4NWZA 5CQFA 4ZCCA 1BGJA 1H84A 1LQUA 3DGHA 4TLXA 2X8GA 3K7TA 1JNRA 2WDRA 5U1OA 3BHFA 1CC2A 1PBEA 3CGCA 3Q9TA 4BJZA 5LV9A 2YLZA 1H82A 2A89A 3COXA 4UDPA 5EB5A 2C4CA 3OC4A 3I6DA 4LIIA 1PS9A 2WS3A 3D1CA 5ER0A 2XVJA 3K7MX 3C96A 5C3JA 2WPEA 3GD3A 3LJPA 1F8WA 3AE7A 1GRBA 1OJTA 2EQ6A 4CNJA 3UOYA 4J34A 3BI4A 2FBWA 3GYXA 3SX6A 3ZDNA 1CF3A 2IIDA 5HXIA 3B6DA 3IWAA 1ZMDA 1HYUA 1TDKA 3H8IA 2WOWA 1XPQA 3ADAB 3PO7A 3S61A 4UP3A 1L9DA 3UTFA 2QCUA 4K22A 4U8MA 4G73A 5IQ4A 3F8PA 3CIRA 3V76A 5IQ1A 5DBJA 2GR1A 4OPIA 1CJCA 1E6EA 1GETA 1ONFA 4NNJA 2GR2A 4OPGA 3BI2A 2JB1A 3QSMA 4OPCA 2C7GA 2V5ZA 4P9SA 2WU5A 2H89A 1F8RA 3NLCA 4OPUA 3NYEA 4XXGA 5CKUA 2FJEA 2YG6A 3C4AA 1FL2A 3UTEA 3P9UA 4TM3A 4X9MA 3M0OA 2B9YA 2ZZBA 3GRTA 1TDFA 2C65A 1GT8A 3T2KA 4AT2A 1E1LA 1PJ5A 3GWDA 3HYVA 4H4VA 1N1PA 3QSSA 3SYIA 4B64A 2JBVA 1N4WA 1PHHA 4H4ZA 4IVMB 4BK3A 4DSHA 4LA1A 1MOKA 4WCTA 3H8LA 2GF3A 2XLTA 3AEFA 2V60A 2ZBWA 4FDCB 4H2NA 3RP6A 4C3YA 2B7SA 2IVDA 2WOVA 4JNQA 4FK1A 5KVHA 4U8KA 4U8JA 4ZCDA 2FJDA 1NPXA 3NK0X 4Z24A 4RG3A 3AE3A 1TDNA 5L46A 4CRTA 2HQMA 3NIXA 2R0GA 3UKAA 2XLPA 4K7ZA 1GV4A 1EL8A 2GMHA 4JQ9A 2BK3A 3CNJA 2ZZCA 4YSHA 3L1RA 4A65A 5JCKA 2BK4A 2WDQA 3GRSA 3G5SA 1VG0A 1CL0A 2C75A 1MO9A 4GF7A 2B9XA 1DXLA 1SEZA 5FS7A 3CNDA 3K30A 4A99A 3AEDA 1YQ3A 1IUTA 1RP0A 1M6IA 1Y56A 1F6MA 3DJDA 3DK4A 2FJBA 4C5OA 4JY2A 5HYMA 1GALA 4CCQA 1DOEA 3ITJA 2XVFA 3CGEA 3L8KA 3LADA 1K0LA 3NTAA 3NYFA 3QVRA 4OPTA 5FS8A 4YKFA 1CJ3A 2JB2A 1JRZA 2BS2A 4A79A 1KDGA 1REOA 1TDEA 4GCMA 3QFBA 4YKGA 1IUUA 3FIMB 3ALLA 3M13A 4C3XA 3UTHA 3SQPA 4N9XA 4CBQA 2OLNA 3V3NA 1O95A 3GD4A 3GDNA 3QJ4A 5KVIA 1FCDA 1JU2A 2WDVA 3IC9A 2ACZA 3REDA 4FX9A 4H4XA 1COYA 5J7XA 1DODA 4G9KA 4NTDA 1F3PA 1GESA 3AD9B 3QFAA 4JDRA 2BACA 5JCMA 3M12A 3P4PA 2B76A 4H50A 4B67A 4C74A 1DOCA 3HYWA 3UKQA 2Q0LA 1BZLA 2YR6A 3VR9A 4RSLA 2YR4A 1YY5A 2BYBA 4Z25A 3RP7A 2GVCA 2WBAA 1PJ7A 2XFOA 1O5WA 3NRNA 4J36A 1GTEA 2B9WA 4XWRA 2JAEA 3RNMA 5HY5A 5KXJA 5KMQA 4ADWA 3K7QX 4U8IA 1Q1WA 4K5SA 3O0HA 3DGZA 2XVIA 3AE4A 1S3EA 3CNTA 2JK6A 3PVCA 1DJQA 1FEBA 1D7YA 1H6VA 3LZXA 3UKLA 2YG7A 2YLWA 4O5QA 1ZX9A 3FG2P 1O94A 1DOBA 3CNPA 4Z2UA 3NK2X 3DJJA 4EM3A 1PBDA 2C73A 3R9UA 1GERA 4AT0A 2YVFA 3CNSA 3I3LA 3UKPA 4EMIA 4IA5A 1NG3A 3T0KA 3T31A 1OJCA 1GRTA 2PHHA 4YSXA 1W4XA 3KLJA 3RHAA 4C77A 3KPFA 3E1TA 2WESA 3NN6X 2OAMA 4Y4MA 1D7LA 1PBBA 3AE9A 5HHFA 4APNA 2X8CA 1D4EA 3UKKA 2X3NA 4XWZA 5KMPA 2W0HA 2BABA 4GRTA 3DA1A 2C3DA 4YTPA 2GH5A 3OZ2A 5BRTA 3SZ0A 1VQWA 4A7AA 4BJYA 3VRBA 2BCGG 4JNAA 2VOUA 2R4JA 3S5WA 4YXDA 3GMCA 4CY8A 4NEVA 4USRA 1E1NA 2BXRA 3GSIA 4EMJA 3KVEA 1MXTA 3NK1X 1JRXA 2GB0A 3EAOA 1JOAA 3AEGA 5KWFA 2A87A 1ZDLA 2H88A 1ZKQA 3T2ZA 2CFYA 2CDUA 2BC0A 3NN0X 2BRAA 2C3CA 4EIPA 1OJAA 2YQUA 4MJWA 1BGNA 2WHDA 4II2A 4OPDA 2O9ZA 2TPRA 2BS4A 1B8SA 5M10A 2WU2A 3AE6A 2YR5A 4NTCA 3CN8A 1ZMCA 1K0JA 2NPXA 1LTXR 3NYCA 2GRTA 2IVEA 1CJ4A 4U8OA 1IJHA 4JY3A 2B7RA 3ALMA 4IA6A 3GYJA 4Z2TA 1K0IA 4FK1C 2YWLA 4TLZA 2CULA 1NG4A 3KD9A 3UOVA 2C76A 2WP5A 2GQWA 5TR3A 5KMSA 2BK5A 1XDIA 3VR8A 4YT0A 1L9CA 1GPEA 1RSGA 4I58A 2YLRA 2JB3A 4Z44A 4LU6A 4X9NA 1XHCA 3ISHA 1IUWA 3F8DA 1Q9IA 4U2SA 4AOXA 1JEHA 1E1MA 4CNKA 1CC6A 2C66A 4E0VA 4Y4NA 2GR0A 4NZHA 2QAEA 1NEKA 1FEAA 1UKVG 4Z2RA 3JSKA 4HB9A 1LVLA 4X4JA 2FJAA 4H7UA 4RG4A 4G74A 4EQWA 3Q6JA 2EQ8A 3BNMA 1CC4A 4K2XA 3KU9A 4BURA 1QLBA 3AE8A 3UOZA 5JCNA 4B65A 2DKHA 5KNLA 2AAQA 3AE2A 1H81A 4Z26A 5BVAA 2XLUA 4H2PA 5BUKA 1V59A 3ZYXA 3VRAA 3IHGA 3IHMA 1EBDA 1KSSA 3PS9A 2JKCA 1F8SA 1PBCA 2ARDA 2R9ZA 2V3BA 3LXDA 3RP8A 1NHQA 4D04A 2YG4A 4B68A 1PJ6A 1EL7A 2GMJA 2XVEA 3AE5A 1H7XA 2XCGA 3CPIG 4TM4A 2XYOA 4AP3A 2RGJA 3P1WA 1NAAA 1PN0A 2XLSA 2YLXA 3BI5A 3QSEA 4D03A 4YSYA 2BC1A 1D4CA 3SM8A 2VVMA 1H83A 3UTGA 3UKFA 4H4PA 1DNCA 4USQA 3NGCX 4I59A 4HA6A 1CBOA 1L0VA 1ZOVA 2Y6QA 2WEUA 2GAHB 4H2QA 2WOIA 1KNRA 2BS3A 2Q6UA 4EQXA 4A6NA 1ZY8A 5GSNA 1E1KA 4U2LA 4EQRA 5KMRA 3GYIA 4J56A 2GQFA 1GXFA 1XANA 2VVLG 4H4TA 1S2YA 4J31A 3NG7X 3AECA 3QVPA 3UOXA 2ZZ0A 2YG5A 3FBSA 2R0CA 1KNPA 1D5TA 2Z5XA 4U8NA 3WE0A 2WETA 4YTNA 1LQTA 3LZWA 4WX1A 4GUVA 4A5LA 4EMWA 4IVOB 2OA1A 4Y4LA 3AWIA 3B3RA 4U8PA 3CPHG 2YVJA 2AQJA 3CTYA 1B37A 3URHA 4UDQA 3HYXA 4NEWA 3CMMA 3UP4A 1BWCA 2VVLA 3AD7B 4CCRA 1AOGA 1Y56B 3AYLA 2PYXA 2TMDA 4U8LA 4EM4A 4H4SA 2XFNA 3AB1A 1NHRA 1LPFA 4H4QA 3AE1A 1K4QA 4NTEA 3ATQA 1P2HA 4GDEA 2E4GA 4TM0A 5BULA 5JCIA 4PAAA 4ICYA 3DJGX 4BK1A 1RYIA 2GR3A 4DNAA 4G6HA 1NENA 1X31B 1S3BA 2CVJA 2GV8A 1VRQB 2YM1A 1Q1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NT6 A;  2XLR A;  1GRF A;  4DSG A;  1GND A;  1GRG A;  2VRL A;  3DME A;  1JNZ A;  4H2R A;  5FS9 A;  4CY6 A;  3NKS A;  4J57 A;  4J33 A;  2C64 A;  2OLO A;  2YLT A;  2RGH A;  1JRY A;  1TYT A;  2X99 A;  3BNU A;  2C67 A;  2XVH A;  3CGD A;  1ZK7 A;  4YTM A;  5GRT A;  2E5V A;  1TYP A;  5M0Z A;  4Z43 A;  1N4V A;  1PBF A;  2C70 A;  2R0P A;  4OPL A;  5FS6 A;  1FEC A;  2Y6R A;  2APG A;  3P4Q A;  4BK2 A;  3D8X A;  1TRB A;  3FMW A;  4U2T A;  1NDA A;  2RGO A;  2XFP A;  1PXA A;  2GAG B;  3CPJ G;  2OAL A;  1H7W A;  1KSU A;  2XFU A;  3GWF A;  1NHP A;  1GTH A;  1PXB A;  2C72 A;  2Q0K A;  2V3A A;  2R45 A;  2V6O A;  2WPC A;  3NH3 X;  4J2W A;  2V61 A;  4IV9 A;  4YSZ A;  5EB4 A;  2WPF A;  4TM1 A;  1GRH A;  5KOX A;  1DJN A;  3EF6 A;  3AEB A;  3AEE A;  2XFQ A;  2WQY A;  2YAU A;  2YM2 A;  2J3N A;  5C2T A;  4GR1 A;  3UP5 A;  3SFD A;  2Z5Y A;  3NNE A;  1KFY A;  2BXS A;  3AEA A;  4H4Y A;  2R46 A;  3ABV A;  3DK8 A;  3T37 A;  1GRA A;  1OJ9 A;  1PXC A;  2VQ7 A;  3P4R A;  2F5Z A;  3AXB A;  3F8R A;  4KPR A;  3NHO X;  4OCG A;  1BF3 A;  3CGB A;  4H4W A;  3AYJ A;  3KA7 A;  4AP1 A;  1EL9 A;  1B4V A;  1BKW A;  1H86 A;  1IUV A;  1FOH A;  3EAN A;  3FPZ A;  1CJ2 A;  3LB8 A;  3ICR A;  4EQS A;  2VQB A;  2X50 A;  4A6N B;  4EIQ A;  3VQR A;  2YLS A;  3BHK A;  5J60 A;  1N4U A;  1M64 A;  2BCP A;  1IUS A;  1QO8 A;  5IPY A;  2AR8 A;  4UDR A;  1GRE A;  3GDP A;  2NVK X;  1L9E A;  3G5R A;  1QJD A;  4DGK A;  5KOW A;  3VRD B;  1E39 A;  1YKJ A;  5FMH A;  3KKJ A;  1P2E A;  4B1B A;  1TDO A;  2RAB A;  1B5Q A;  3UCL A;  3AD8 B;  3NTD A;  1Y0P A;  5U63 A;  4REK A;  4B66 A;  4ZN0 A;  3II4 A;  2YVG A;  1GEU A;  2DKI A;  2BA9 A;  4BV6 A;  3ICS A;  4O5U A;  3G5Q A;  4PAB A;  3UKH A;  3ICT A;  1PDH A;  1E7P A;  4K5R A;  2YG3 A;  2X8H A;  3ATR A;  5EOW A;  1GOS A;  1LV0 A;  1YQ4 A;  1CHU A;  3EPT A;  4OVI A;  3C4N A;  3P4S A;  3SFE A;  5U25 A;  1ELI A;  1LJ1 A;  3H4K A;  4H4R A;  5JCL A;  2GEW A;  4ECH A;  3DK9 A;  4YWO A;  2I0Z A;  2WP6 A;  2QA1 A;  4JN9 A;  3AYI A;  2XDO A;  2VRM A;  1ZOY A;  3LOV A;  3V3O A;  5KRQ A;  1NHS A;  3GMB A;  2EQ9 A;  1VDC A;  2VZ2 A;  2A8X A;  1VG9 A;  5EBK A;  4A9W A;  3DJE A;  1OJD A;  4H4U A;  4AOS A;  4KX6 A;  4B69 A;  3ALJ A;  3SGL A;  2E1M A;  1D4D A;  2EQ7 A;  3HZL A;  1KF6 A;  2QA2 A;  2WP9 A;  1EL5 A;  3IF9 A;  4M52 A;  1Z6L A;  1GSN A;  1S2Q A;  1ZP0 A;  2UZZ A;  2R4E A;  2Q7V A;  4B63 A;  3DH9 A;  1YQZ A;  4K8D A;  1IUX A;  4GDP A;  5CQF A;  4ZCC A;  1BGJ A;  1H84 A;  1LQU A;  3DGH A;  4TLX A;  2X8G A;  3K7T A;  1JNR A;  2WDR A;  5U1O A;  3BHF A;  1CC2 A;  1PBE A;  3CGC A;  3Q9T A;  4BJZ A;  5LV9 A;  2YLZ A;  1H82 A;  2A89 A;  3COX A;  4UDP A;  5EB5 A;  3OC4 A;  3I6D A;  4LII A;  1PS9 A;  2WS3 A;  3D1C A;  5ER0 A;  2XVJ A;  3K7M X;  3C96 A;  5C3J A;  2WPE A;  3GD3 A;  3LJP A;  1F8W A;  3AE7 A;  1GRB A;  1OJT A;  2EQ6 A;  4CNJ A;  3UOY A;  4J34 A;  3BI4 A;  2FBW A;  3ZDN A;  1CF3 A;  2IID A;  5HXI A;  3B6D A;  3IWA A;  1ZMD A;  1HYU A;  1TDK A;  3H8I A;  2WOW A;  1XPQ A;  3ADA B;  3PO7 A;  3S61 A;  4UP3 A;  1L9D A;  3UTF A;  2QCU A;  4K22 A;  4U8M A;  5IQ4 A;  3F8P A;  3CIR A;  3V76 A;  5IQ1 A;  5DBJ A;  2GR1 A;  4OPI A;  1CJC A;  1E6E A;  1GET A;  1ONF A;  2GR2 A;  4OPG A;  3BI2 A;  2JB1 A;  3QSM A;  4OPC A;  2C7G A;  2V5Z A;  4P9S A;  2WU5 A;  2H89 A;  1F8R A;  3NLC A;  4OPU A;  3NYE A;  4XXG A;  5CKU A;  2FJE A;  2YG6 A;  3C4A A;  1FL2 A;  3UTE A;  3P9U A;  4TM3 A;  4X9M A;  3M0O A;  2B9Y A;  2ZZB A;  3GRT A;  1TDF A;  2C65 A;  1GT8 A;  4AT2 A;  1E1L A;  1PJ5 A;  3GWD A;  4H4V A;  1N1P A;  3QSS A;  4B64 A;  2JBV A;  1N4W A;  1PHH A;  4H4Z A;  4IVM B;  4BK3 A;  4DSH A;  4LA1 A;  1MOK A;  4WCT A;  3H8L A;  2GF3 A;  2XLT A;  3AEF A;  2V60 A;  2ZBW A;  4FDC B;  4H2N A;  3RP6 A;  4C3Y A;  2B7S A;  2IVD A;  2WOV A;  4JNQ A;  4FK1 A;  5KVH A;  4U8K A;  4U8J A;  4ZCD A;  2FJD A;  1NPX A;  3NK0 X;  4Z24 A;  4RG3 A;  3AE3 A;  1TDN A;  5L46 A;  4CRT A;  2HQM A;  3NIX A;  2R0G A;  3UKA A;  2XLP A;  4K7Z A;  1GV4 A;  1EL8 A;  2GMH A;  4JQ9 A;  2BK3 A;  3CNJ A;  2ZZC A;  4YSH A;  3L1R A;  4A65 A;  5JCK A;  2BK4 A;  2WDQ A;  3GRS A;  3G5S A;  1VG0 A;  1CL0 A;  2C75 A;  1MO9 A;  4GF7 A;  2B9X A;  1DXL A;  1SEZ A;  5FS7 A;  3CND A;  3K30 A;  4A99 A;  3AED A;  1YQ3 A;  1IUT A;  1RP0 A;  1M6I A;  1Y56 A;  1F6M A;  3DJD A;  3DK4 A;  2FJB A;  4C5O A;  4JY2 A;  5HYM A;  1GAL A;  4CCQ A;  1DOE A;  3ITJ A;  2XVF A;  3CGE A;  3L8K A;  3LAD A;  1K0L A;  3NTA A;  3NYF A;  3QVR A;  4OPT A;  5FS8 A;  4YKF A;  1CJ3 A;  2JB2 A;  1JRZ A;  2BS2 A;  4A79 A;  1KDG A;  1REO A;  1TDE A;  4GCM A;  3QFB A;  4YKG A;  1IUU A;  3FIM B;  3ALL A;  3M13 A;  4C3X A;  3UTH A;  3SQP A;  4N9X A;  4CBQ A;  2OLN A;  3V3N A;  1O95 A;  3GD4 A;  3GDN A;  3QJ4 A;  5KVI A;  1FCD A;  1JU2 A;  2WDV A;  3IC9 A;  2ACZ A;  3RED A;  4FX9 A;  4H4X A;  1COY A;  5J7X A;  1DOD A;  4NTD A;  1F3P A;  1GES A;  3AD9 B;  3QFA A;  4JDR A;  2BAC A;  5JCM A;  3M12 A;  3P4P A;  2B76 A;  4H50 A;  4B67 A;  4C74 A;  1DOC A;  3UKQ A;  2Q0L A;  1BZL A;  2YR6 A;  3VR9 A;  4RSL A;  2YR4 A;  1YY5 A;  2BYB A;  4Z25 A;  3RP7 A;  2GVC A;  2WBA A;  1PJ7 A;  2XFO A;  1O5W A;  3NRN A;  4J36 A;  1GTE A;  2B9W A;  4XWR A;  2JAE A;  3RNM A;  5HY5 A;  5KXJ A;  4ADW A;  3K7Q X;  4U8I A;  1Q1W A;  4K5S A;  3O0H A;  3DGZ A;  2XVI A;  3AE4 A;  1S3E A;  3CNT A;  2JK6 A;  3PVC A;  1DJQ A;  1FEB A;  1D7Y A;  1H6V A;  3LZX A;  3UKL A;  2YG7 A;  2YLW A;  4O5Q A;  1ZX9 A;  3FG2 P;  1O94 A;  1DOB A;  3CNP A;  4Z2U A;  3NK2 X;  3DJJ A;  4EM3 A;  1PBD A;  2C73 A;  3R9U A;  1GER A;  4AT0 A;  2YVF A;  3CNS A;  3I3L A;  3UKP A;  4EMI A;  4IA5 A;  1NG3 A;  1OJC A;  1GRT A;  2PHH A;  4YSX A;  1W4X A;  3KLJ A;  3RHA A;  4C77 A;  3KPF A;  3E1T A;  2WES A;  3NN6 X;  2OAM A;  4Y4M A;  1D7L A;  1PBB A;  3AE9 A;  5HHF A;  4APN A;  2X8C A;  1D4E A;  3UKK A;  2X3N A;  4XWZ A;  2W0H A;  2BAB A;  4GRT A;  3DA1 A;  2C3D A;  4YTP A;  2GH5 A;  3OZ2 A;  5BRT A;  1VQW A;  4A7A A;  4BJY A;  3VRB A;  2BCG G;  4JNA A;  2VOU A;  2R4J A;  3S5W A;  4YXD A;  3GMC A;  4CY8 A;  4NEV A;  4USR A;  1E1N A;  2BXR A;  3GSI A;  4EMJ A;  3KVE A;  1MXT A;  3NK1 X;  1JRX A;  2GB0 A;  3EAO A;  1JOA A;  3AEG A;  5KWF A;  2A87 A;  1ZDL A;  2H88 A;  1ZKQ A;  2CFY A;  2CDU A;  2BC0 A;  3NN0 X;  2C3C A;  4EIP A;  1OJA A;  2YQU A;  4MJW A;  1BGN A;  2WHD A;  4OPD A;  2O9Z A;  2TPR A;  2BS4 A;  1B8S A;  5M10 A;  2WU2 A;  3AE6 A;  2YR5 A;  4NTC A;  3CN8 A;  1ZMC A;  1K0J A;  2NPX A;  1LTX R;  3NYC A;  2GRT A;  2IVE A;  1CJ4 A;  4U8O A;  1IJH A;  4JY3 A;  2B7R A;  3ALM A;  4IA6 A;  3GYJ A;  4Z2T A;  1K0I A;  4FK1 C;  2YWL A;  4TLZ A;  2CUL A;  1NG4 A;  3KD9 A;  3UOV A;  2C76 A;  2WP5 A;  2GQW A;  5TR3 A;  2BK5 A;  1XDI A;  3VR8 A;  4YT0 A;  1L9C A;  1GPE A;  1RSG A;  4I58 A;  2YLR A;  2JB3 A;  4Z44 A;  4LU6 A;  4X9N A;  1XHC A;  3ISH A;  1IUW A;  3F8D A;  1Q9I A;  4U2S A;  4AOX A;  1JEH A;  1E1M A;  4CNK A;  1CC6 A;  2C66 A;  4E0V A;  4Y4N A;  2GR0 A;  4NZH A;  2QAE A;  1NEK A;  1FEA A;  1UKV G;  4Z2R A;  3JSK A;  4HB9 A;  1LVL A;  4X4J A;  2FJA A;  4H7U A;  4RG4 A;  4EQW A;  3Q6J A;  2EQ8 A;  3BNM A;  1CC4 A;  4K2X A;  3KU9 A;  4BUR A;  1QLB A;  3AE8 A;  3UOZ A;  5JCN A;  4B65 A;  2DKH A;  2AAQ A;  3AE2 A;  1H81 A;  4Z26 A;  5BVA A;  2XLU A;  4H2P A;  5BUK A;  1V59 A;  3ZYX A;  3VRA A;  3IHG A;  3IHM A;  1EBD A;  1KSS A;  3PS9 A;  2JKC A;  1F8S A;  1PBC A;  2ARD A;  2R9Z A;  2V3B A;  3LXD A;  3RP8 A;  1NHQ A;  4D04 A;  2YG4 A;  4B68 A;  1PJ6 A;  1EL7 A;  2GMJ A;  2XVE A;  3AE5 A;  1H7X A;  2XCG A;  3CPI G;  4TM4 A;  2XYO A;  4AP3 A;  2RGJ A;  3P1W A;  1NAA A;  1PN0 A;  2XLS A;  2YLX A;  3BI5 A;  3QSE A;  4D03 A;  4YSY A;  2BC1 A;  1D4C A;  3SM8 A;  2VVM A;  1H83 A;  3UTG A;  3UKF A;  4H4P A;  1DNC A;  4USQ A;  3NGC X;  4I59 A;  4HA6 A;  1CBO A;  1L0V A;  1ZOV A;  2Y6Q A;  2WEU A;  2GAH B;  4H2Q A;  2WOI A;  1KNR A;  2BS3 A;  2Q6U A;  4EQX A;  4A6N A;  1ZY8 A;  5GSN A;  1E1K A;  4U2L A;  4EQR A;  3GYI A;  4J56 A;  2GQF A;  1GXF A;  1XAN A;  2VVL G;  4H4T A;  1S2Y A;  4J31 A;  3NG7 X;  3AEC A;  3QVP A;  3UOX A;  2ZZ0 A;  2YG5 A;  3FBS A;  2R0C A;  1KNP A;  1D5T A;  2Z5X A;  4U8N A;  3WE0 A;  2WET A;  4YTN A;  1LQT A;  3LZW A;  4WX1 A;  4GUV A;  4A5L A;  4EMW A;  4IVO B;  2OA1 A;  4Y4L A;  3AWI A;  3B3R A;  4U8P A;  3CPH G;  2YVJ A;  2AQJ A;  3CTY A;  1B37 A;  3URH A;  4UDQ A;  4NEW A;  3UP4 A;  1BWC A;  2VVL A;  3AD7 B;  4CCR A;  1AOG A;  1Y56 B;  3AYL A;  2PYX A;  2TMD A;  4U8L A;  4EM4 A;  4H4S A;  2XFN A;  3AB1 A;  1NHR A;  1LPF A;  4H4Q A;  3AE1 A;  1K4Q A;  4NTE A;  3ATQ A;  1P2H A;  4GDE A;  2E4G A;  4TM0 A;  5BUL A;  5JCI A;  4PAA A;  4ICY A;  3DJG X;  4BK1 A;  1RYI A;  2GR3 A;  4DNA A;  1NEN A;  1X31 B;  1S3B A;  2CVJ A;  2GV8 A;  1VRQ B;  2YM1 A;  1Q1R A; 
#chains in the Genus database with same CATH topology
 3NT6 A;  2XLR A;  1GRF A;  4DSG A;  1GND A;  1GRG A;  2VRL A;  3DME A;  1JNZ A;  4H2R A;  4GAP A;  5FS9 A;  4CY6 A;  3NKS A;  4J57 A;  4J33 A;  2C64 A;  2OLO A;  2YLT A;  2RGH A;  1JRY A;  1TYT A;  2X99 A;  3BNU A;  2C67 A;  2XVH A;  3CGD A;  1ZK7 A;  4YTM A;  5GRT A;  2E5V A;  1TYP A;  5M0Z A;  4Z43 A;  1N4V A;  1PBF A;  2C70 A;  2R0P A;  4OPL A;  5FS6 A;  1FEC A;  2Y6R A;  2APG A;  3P4Q A;  4BK2 A;  3D8X A;  1TRB A;  3FMW A;  4U2T A;  1NDA A;  2RGO A;  2XFP A;  1PXA A;  2GAG B;  3CPJ G;  2OAL A;  1H7W A;  1KSU A;  2XFU A;  3GWF A;  1NHP A;  1GTH A;  1PXB A;  2C72 A;  2Q0K A;  2V3A A;  2R45 A;  2V6O A;  2WPC A;  3NH3 X;  4J2W A;  2V61 A;  4IV9 A;  3T14 A;  4YSZ A;  5EB4 A;  2WPF A;  4TM1 A;  1GRH A;  5KOX A;  1DJN A;  3EF6 A;  3AEB A;  3AEE A;  3SZC A;  2XFQ A;  2WQY A;  2YAU A;  2YM2 A;  2J3N A;  3SZW A;  5C2T A;  4GR1 A;  3UP5 A;  3SFD A;  2Z5Y A;  3NNE A;  1KFY A;  2BXS A;  3AEA A;  4H4Y A;  2R46 A;  3ABV A;  3DK8 A;  4II3 A;  1GRA A;  3T37 A;  1OJ9 A;  1PXC A;  2VQ7 A;  3P4R A;  2F5Z A;  3AXB A;  3F8R A;  4KPR A;  3NHO X;  4OCG A;  1BF3 A;  3CGB A;  4H4W A;  3AYJ A;  3KA7 A;  4AP1 A;  1EL9 A;  1B4V A;  1BKW A;  1H86 A;  1IUV A;  1FOH A;  3EAN A;  3FPZ A;  1CJ2 A;  3LB8 A;  3ICR A;  4EQS A;  2VQB A;  2X50 A;  4A6N B;  4EIQ A;  3VQR A;  2YLS A;  3BHK A;  5J60 A;  1N4U A;  1M64 A;  2BCP A;  1IUS A;  1QO8 A;  5IPY A;  2AR8 A;  4UDR A;  1GRE A;  3GDP A;  2NVK X;  1L9E A;  3G5R A;  1QJD A;  4DGK A;  5KOW A;  3VRD B;  1E39 A;  1YKJ A;  5FMH A;  3KKJ A;  1P2E A;  3SY4 A;  4B1B A;  1TDO A;  2RAB A;  1B5Q A;  3UCL A;  3AD8 B;  3NTD A;  1Y0P A;  5U63 A;  4REK A;  4B66 A;  4ZN0 A;  3II4 A;  2YVG A;  1GEU A;  2DKI A;  2BA9 A;  3SXI A;  4BV6 A;  3ICS A;  4O5U A;  3G5Q A;  4PAB A;  3UKH A;  3ICT A;  1PDH A;  1E7P A;  4K5R A;  2YG3 A;  2X8H A;  3ATR A;  5EOW A;  1GOS A;  1LV0 A;  1YQ4 A;  1CHU A;  3KPK A;  3EPT A;  3T2Y A;  4OVI A;  3C4N A;  3P4S A;  3SFE A;  5U25 A;  1ELI A;  1LJ1 A;  3H4K A;  4H4R A;  5JCL A;  2GEW A;  4ECH A;  3DK9 A;  4YWO A;  2I0Z A;  2WP6 A;  2QA1 A;  4JN9 A;  3AYI A;  2XDO A;  2VRM A;  1ZOY A;  3LOV A;  3V3O A;  5KRQ A;  1NHS A;  3GMB A;  2EQ9 A;  1VDC A;  2VZ2 A;  2A8X A;  1VG9 A;  5EBK A;  4A9W A;  3DJE A;  1OJD A;  4H4U A;  4AOS A;  4KX6 A;  4B69 A;  3ALJ A;  3SGL A;  4GAV A;  2E1M A;  1D4D A;  2EQ7 A;  3HZL A;  1KF6 A;  2QA2 A;  2BRY A;  2WP9 A;  1EL5 A;  3IF9 A;  4M52 A;  1Z6L A;  1GSN A;  1S2Q A;  1ZP0 A;  2UZZ A;  2R4E A;  3SZF A;  2Q7V A;  4B63 A;  4G6G A;  3DH9 A;  1YQZ A;  4K8D A;  1IUX A;  4GDP A;  4NWZ A;  5CQF A;  4ZCC A;  1BGJ A;  1H84 A;  1LQU A;  3DGH A;  4TLX A;  2X8G A;  3K7T A;  1JNR A;  2WDR A;  5U1O A;  3BHF A;  1CC2 A;  1PBE A;  3CGC A;  3Q9T A;  4BJZ A;  5LV9 A;  2YLZ A;  1H82 A;  2A89 A;  3COX A;  4UDP A;  5EB5 A;  2C4C A;  3OC4 A;  3I6D A;  4LII A;  1PS9 A;  2WS3 A;  3D1C A;  5ER0 A;  2XVJ A;  3K7M X;  3C96 A;  5C3J A;  2WPE A;  3GD3 A;  3LJP A;  1F8W A;  3AE7 A;  1GRB A;  1OJT A;  2EQ6 A;  4CNJ A;  3UOY A;  4J34 A;  3BI4 A;  2FBW A;  3GYX A;  3SX6 A;  3ZDN A;  1CF3 A;  2IID A;  5HXI A;  3B6D A;  3IWA A;  1ZMD A;  1HYU A;  1TDK A;  3H8I A;  2WOW A;  1XPQ A;  3ADA B;  3PO7 A;  3S61 A;  4UP3 A;  1L9D A;  3UTF A;  2QCU A;  4K22 A;  4U8M A;  4G73 A;  5IQ4 A;  3F8P A;  3CIR A;  3V76 A;  5IQ1 A;  5DBJ A;  2GR1 A;  4OPI A;  1CJC A;  1E6E A;  1GET A;  1ONF A;  4NNJ A;  2GR2 A;  4OPG A;  3BI2 A;  2JB1 A;  3QSM A;  4OPC A;  2C7G A;  2V5Z A;  4P9S A;  2WU5 A;  2H89 A;  1F8R A;  3NLC A;  4OPU A;  3NYE A;  4XXG A;  5CKU A;  2FJE A;  2YG6 A;  3C4A A;  1FL2 A;  3UTE A;  3P9U A;  4TM3 A;  4X9M A;  3M0O A;  2B9Y A;  2ZZB A;  3GRT A;  1TDF A;  2C65 A;  1GT8 A;  3T2K A;  4AT2 A;  1E1L A;  1PJ5 A;  3GWD A;  3HYV A;  4H4V A;  1N1P A;  3QSS A;  3SYI A;  4B64 A;  2JBV A;  1N4W A;  1PHH A;  4H4Z A;  4IVM B;  4BK3 A;  4DSH A;  4LA1 A;  1MOK A;  4WCT A;  3H8L A;  2GF3 A;  2XLT A;  3AEF A;  2V60 A;  2ZBW A;  4FDC B;  4H2N A;  3RP6 A;  4C3Y A;  2B7S A;  2IVD A;  2WOV A;  4JNQ A;  4FK1 A;  5KVH A;  4U8K A;  4U8J A;  4ZCD A;  2FJD A;  1NPX A;  3NK0 X;  4Z24 A;  4RG3 A;  3AE3 A;  1TDN A;  5L46 A;  4CRT A;  2HQM A;  3NIX A;  2R0G A;  3UKA A;  2XLP A;  4K7Z A;  1GV4 A;  1EL8 A;  2GMH A;  4JQ9 A;  2BK3 A;  3CNJ A;  2ZZC A;  4YSH A;  3L1R A;  4A65 A;  5JCK A;  2BK4 A;  2WDQ A;  3GRS A;  3G5S A;  1VG0 A;  1CL0 A;  2C75 A;  1MO9 A;  4GF7 A;  2B9X A;  1DXL A;  1SEZ A;  5FS7 A;  3CND A;  3K30 A;  4A99 A;  3AED A;  1YQ3 A;  1IUT A;  1RP0 A;  1M6I A;  1Y56 A;  1F6M A;  3DJD A;  3DK4 A;  2FJB A;  4C5O A;  4JY2 A;  5HYM A;  1GAL A;  4CCQ A;  1DOE A;  3ITJ A;  2XVF A;  3CGE A;  3L8K A;  3LAD A;  1K0L A;  3NTA A;  3NYF A;  3QVR A;  4OPT A;  5FS8 A;  4YKF A;  1CJ3 A;  2JB2 A;  1JRZ A;  2BS2 A;  4A79 A;  1KDG A;  1REO A;  1TDE A;  4GCM A;  3QFB A;  4YKG A;  1IUU A;  3FIM B;  3ALL A;  3M13 A;  4C3X A;  3UTH A;  3SQP A;  4N9X A;  4CBQ A;  2OLN A;  3V3N A;  1O95 A;  3GD4 A;  3GDN A;  3QJ4 A;  5KVI A;  1FCD A;  1JU2 A;  2WDV A;  3IC9 A;  2ACZ A;  3RED A;  4FX9 A;  4H4X A;  1COY A;  5J7X A;  1DOD A;  4G9K A;  4NTD A;  1F3P A;  1GES A;  3AD9 B;  3QFA A;  4JDR A;  2BAC A;  5JCM A;  3M12 A;  3P4P A;  2B76 A;  4H50 A;  4B67 A;  4C74 A;  1DOC A;  3HYW A;  3UKQ A;  2Q0L A;  1BZL A;  2YR6 A;  3VR9 A;  4RSL A;  2YR4 A;  1YY5 A;  2BYB A;  4Z25 A;  3RP7 A;  2GVC A;  2WBA A;  1PJ7 A;  2XFO A;  1O5W A;  3NRN A;  4J36 A;  1GTE A;  2B9W A;  4XWR A;  2JAE A;  3RNM A;  5HY5 A;  5KXJ A;  5KMQ A;  4ADW A;  3K7Q X;  4U8I A;  1Q1W A;  4K5S A;  3O0H A;  3DGZ A;  2XVI A;  3AE4 A;  1S3E A;  3CNT A;  2JK6 A;  3PVC A;  1DJQ A;  1FEB A;  1D7Y A;  1H6V A;  3LZX A;  3UKL A;  2YG7 A;  2YLW A;  4O5Q A;  1ZX9 A;  3FG2 P;  1O94 A;  1DOB A;  3CNP A;  4Z2U A;  3NK2 X;  3DJJ A;  4EM3 A;  1PBD A;  2C73 A;  3R9U A;  1GER A;  4AT0 A;  2YVF A;  3CNS A;  3I3L A;  3UKP A;  4EMI A;  4IA5 A;  1NG3 A;  3T0K A;  3T31 A;  1OJC A;  1GRT A;  2PHH A;  4YSX A;  1W4X A;  3KLJ A;  3RHA A;  4C77 A;  3KPF A;  3E1T A;  2WES A;  3NN6 X;  2OAM A;  4Y4M A;  1D7L A;  1PBB A;  3AE9 A;  5HHF A;  4APN A;  2X8C A;  1D4E A;  3UKK A;  2X3N A;  4XWZ A;  5KMP A;  2W0H A;  2BAB A;  4GRT A;  3DA1 A;  2C3D A;  4YTP A;  2GH5 A;  3OZ2 A;  5BRT A;  3SZ0 A;  1VQW A;  4A7A A;  4BJY A;  3VRB A;  2BCG G;  4JNA A;  2VOU A;  2R4J A;  3S5W A;  4YXD A;  3GMC A;  4CY8 A;  4NEV A;  4USR A;  1E1N A;  2BXR A;  3GSI A;  4EMJ A;  3KVE A;  1MXT A;  3NK1 X;  1JRX A;  2GB0 A;  3EAO A;  1JOA A;  3AEG A;  5KWF A;  2A87 A;  1ZDL A;  2H88 A;  1ZKQ A;  3T2Z A;  2CFY A;  2CDU A;  2BC0 A;  3NN0 X;  2BRA A;  2C3C A;  4EIP A;  1OJA A;  2YQU A;  4MJW A;  1BGN A;  2WHD A;  4II2 A;  4OPD A;  2O9Z A;  2TPR A;  2BS4 A;  1B8S A;  5M10 A;  2WU2 A;  3AE6 A;  2YR5 A;  4NTC A;  3CN8 A;  1ZMC A;  1K0J A;  2NPX A;  1LTX R;  3NYC A;  2GRT A;  2IVE A;  1CJ4 A;  4U8O A;  1IJH A;  4JY3 A;  2B7R A;  3ALM A;  4IA6 A;  3GYJ A;  4Z2T A;  1K0I A;  4FK1 C;  2YWL A;  4TLZ A;  2CUL A;  1NG4 A;  3KD9 A;  3UOV A;  2C76 A;  2WP5 A;  2GQW A;  5TR3 A;  5KMS A;  2BK5 A;  1XDI A;  3VR8 A;  4YT0 A;  1L9C A;  1GPE A;  1RSG A;  4I58 A;  2YLR A;  2JB3 A;  4Z44 A;  4LU6 A;  4X9N A;  1XHC A;  3ISH A;  1IUW A;  3F8D A;  1Q9I A;  4U2S A;  4AOX A;  1JEH A;  1E1M A;  4CNK A;  1CC6 A;  2C66 A;  4E0V A;  4Y4N A;  2GR0 A;  4NZH A;  2QAE A;  1NEK A;  1FEA A;  1UKV G;  4Z2R A;  3JSK A;  4HB9 A;  1LVL A;  4X4J A;  2FJA A;  4H7U A;  4RG4 A;  4G74 A;  4EQW A;  3Q6J A;  2EQ8 A;  3BNM A;  1CC4 A;  4K2X A;  3KU9 A;  4BUR A;  1QLB A;  3AE8 A;  3UOZ A;  5JCN A;  4B65 A;  2DKH A;  5KNL A;  2AAQ A;  3AE2 A;  1H81 A;  4Z26 A;  5BVA A;  2XLU A;  4H2P A;  5BUK A;  1V59 A;  3ZYX A;  3VRA A;  3IHG A;  3IHM A;  1EBD A;  1KSS A;  3PS9 A;  2JKC A;  1F8S A;  1PBC A;  2ARD A;  2R9Z A;  2V3B A;  3LXD A;  3RP8 A;  1NHQ A;  4D04 A;  2YG4 A;  4B68 A;  1PJ6 A;  1EL7 A;  2GMJ A;  2XVE A;  3AE5 A;  1H7X A;  2XCG A;  3CPI G;  4TM4 A;  2XYO A;  4AP3 A;  2RGJ A;  3P1W A;  1NAA A;  1PN0 A;  2XLS A;  2YLX A;  3BI5 A;  3QSE A;  4D03 A;  4YSY A;  2BC1 A;  1D4C A;  3SM8 A;  2VVM A;  1H83 A;  3UTG A;  3UKF A;  4H4P A;  1DNC A;  4USQ A;  3NGC X;  4I59 A;  4HA6 A;  1CBO A;  1L0V A;  1ZOV A;  2Y6Q A;  2WEU A;  2GAH B;  4H2Q A;  2WOI A;  1KNR A;  2BS3 A;  2Q6U A;  4EQX A;  4A6N A;  1ZY8 A;  5GSN A;  1E1K A;  4U2L A;  4EQR A;  5KMR A;  3GYI A;  4J56 A;  2GQF A;  1GXF A;  1XAN A;  2VVL G;  4H4T A;  1S2Y A;  4J31 A;  3NG7 X;  3AEC A;  3QVP A;  3UOX A;  2ZZ0 A;  2YG5 A;  3FBS A;  2R0C A;  1KNP A;  1D5T A;  2Z5X A;  4U8N A;  3WE0 A;  2WET A;  4YTN A;  1LQT A;  3LZW A;  4WX1 A;  4GUV A;  4A5L A;  4EMW A;  4IVO B;  2OA1 A;  4Y4L A;  3AWI A;  3B3R A;  4U8P A;  3CPH G;  2YVJ A;  2AQJ A;  3CTY A;  1B37 A;  3URH A;  4UDQ A;  3HYX A;  4NEW A;  3CMM A;  3UP4 A;  1BWC A;  2VVL A;  3AD7 B;  4CCR A;  1AOG A;  1Y56 B;  3AYL A;  2PYX A;  2TMD A;  4U8L A;  4EM4 A;  4H4S A;  2XFN A;  3AB1 A;  1NHR A;  1LPF A;  4H4Q A;  3AE1 A;  1K4Q A;  4NTE A;  3ATQ A;  1P2H A;  4GDE A;  2E4G A;  4TM0 A;  5BUL A;  5JCI A;  4PAA A;  4ICY A;  3DJG X;  4BK1 A;  1RYI A;  2GR3 A;  4DNA A;  4G6H A;  1NEN A;  1X31 B;  1S3B A;  2CVJ A;  2GV8 A;  1VRQ B;  2YM1 A;  1Q1R A; 
#chains in the Genus database with same CATH homology
 3NT6 A;  2XLR A;  1GRF A;  4DSG A;  1GND A;  1GRG A;  2VRL A;  3DME A;  1JNZ A;  4H2R A;  4GAP A;  5FS9 A;  4CY6 A;  3NKS A;  4J57 A;  4J33 A;  2C64 A;  2OLO A;  2YLT A;  2RGH A;  1JRY A;  1TYT A;  2X99 A;  3BNU A;  2C67 A;  2XVH A;  3CGD A;  1ZK7 A;  4YTM A;  5GRT A;  2E5V A;  1TYP A;  5M0Z A;  4Z43 A;  1N4V A;  1PBF A;  2C70 A;  2R0P A;  4OPL A;  5FS6 A;  1FEC A;  2Y6R A;  2APG A;  3P4Q A;  4BK2 A;  3D8X A;  1TRB A;  3FMW A;  4U2T A;  1NDA A;  2RGO A;  2XFP A;  1PXA A;  2GAG B;  3CPJ G;  2OAL A;  1H7W A;  1KSU A;  2XFU A;  3GWF A;  1NHP A;  1GTH A;  1PXB A;  2C72 A;  2Q0K A;  2V3A A;  2R45 A;  2V6O A;  2WPC A;  3NH3 X;  4J2W A;  2V61 A;  4IV9 A;  3T14 A;  4YSZ A;  5EB4 A;  2WPF A;  4TM1 A;  1GRH A;  5KOX A;  1DJN A;  3EF6 A;  3AEB A;  3AEE A;  3SZC A;  2XFQ A;  2WQY A;  2YAU A;  2YM2 A;  2J3N A;  3SZW A;  5C2T A;  4GR1 A;  3UP5 A;  3SFD A;  2Z5Y A;  3NNE A;  1KFY A;  2BXS A;  3AEA A;  4H4Y A;  2R46 A;  3ABV A;  3DK8 A;  4II3 A;  1GRA A;  3T37 A;  1OJ9 A;  1PXC A;  2VQ7 A;  3P4R A;  2F5Z A;  3AXB A;  3F8R A;  4KPR A;  3NHO X;  4OCG A;  1BF3 A;  3CGB A;  4H4W A;  3AYJ A;  3KA7 A;  4AP1 A;  1EL9 A;  1B4V A;  1BKW A;  1H86 A;  1IUV A;  1FOH A;  3EAN A;  3FPZ A;  1CJ2 A;  3LB8 A;  3ICR A;  4EQS A;  2VQB A;  2X50 A;  4A6N B;  4EIQ A;  3VQR A;  2YLS A;  3BHK A;  5J60 A;  1N4U A;  1M64 A;  2BCP A;  1IUS A;  1QO8 A;  5IPY A;  2AR8 A;  4UDR A;  1GRE A;  3GDP A;  2NVK X;  1L9E A;  3G5R A;  1QJD A;  4DGK A;  5KOW A;  3VRD B;  1E39 A;  1YKJ A;  5FMH A;  3KKJ A;  1P2E A;  3SY4 A;  4B1B A;  1TDO A;  2RAB A;  1B5Q A;  3UCL A;  3AD8 B;  3NTD A;  1Y0P A;  5U63 A;  4REK A;  4B66 A;  4ZN0 A;  3II4 A;  2YVG A;  1GEU A;  2DKI A;  2BA9 A;  3SXI A;  4BV6 A;  3ICS A;  4O5U A;  3G5Q A;  4PAB A;  3UKH A;  3ICT A;  1PDH A;  1E7P A;  4K5R A;  2YG3 A;  2X8H A;  3ATR A;  5EOW A;  1GOS A;  1LV0 A;  1YQ4 A;  1CHU A;  3KPK A;  3EPT A;  3T2Y A;  4OVI A;  3C4N A;  3P4S A;  3SFE A;  5U25 A;  1ELI A;  1LJ1 A;  3H4K A;  4H4R A;  5JCL A;  2GEW A;  4ECH A;  3DK9 A;  4YWO A;  2I0Z A;  2WP6 A;  2QA1 A;  4JN9 A;  3AYI A;  2XDO A;  2VRM A;  1ZOY A;  3LOV A;  3V3O A;  5KRQ A;  1NHS A;  3GMB A;  2EQ9 A;  1VDC A;  2VZ2 A;  2A8X A;  1VG9 A;  5EBK A;  4A9W A;  3DJE A;  1OJD A;  4H4U A;  4AOS A;  4KX6 A;  4B69 A;  3ALJ A;  3SGL A;  4GAV A;  2E1M A;  1D4D A;  2EQ7 A;  3HZL A;  1KF6 A;  2QA2 A;  2BRY A;  2WP9 A;  1EL5 A;  3IF9 A;  4M52 A;  1Z6L A;  1GSN A;  1S2Q A;  1ZP0 A;  2UZZ A;  2R4E A;  3SZF A;  2Q7V A;  4B63 A;  4G6G A;  3DH9 A;  1YQZ A;  4K8D A;  1IUX A;  4GDP A;  4NWZ A;  5CQF A;  4ZCC A;  1BGJ A;  1H84 A;  1LQU A;  3DGH A;  4TLX A;  2X8G A;  3K7T A;  1JNR A;  2WDR A;  5U1O A;  3BHF A;  1CC2 A;  1PBE A;  3CGC A;  3Q9T A;  4BJZ A;  5LV9 A;  2YLZ A;  1H82 A;  2A89 A;  3COX A;  4UDP A;  5EB5 A;  2C4C A;  3OC4 A;  3I6D A;  4LII A;  1PS9 A;  2WS3 A;  3D1C A;  5ER0 A;  2XVJ A;  3K7M X;  3C96 A;  5C3J A;  2WPE A;  3GD3 A;  3LJP A;  1F8W A;  3AE7 A;  1GRB A;  1OJT A;  2EQ6 A;  4CNJ A;  3UOY A;  4J34 A;  3BI4 A;  2FBW A;  3GYX A;  3SX6 A;  3ZDN A;  1CF3 A;  2IID A;  5HXI A;  3B6D A;  3IWA A;  1ZMD A;  1HYU A;  1TDK A;  3H8I A;  2WOW A;  1XPQ A;  3ADA B;  3PO7 A;  3S61 A;  4UP3 A;  1L9D A;  3UTF A;  2QCU A;  4K22 A;  4U8M A;  4G73 A;  5IQ4 A;  3F8P A;  3CIR A;  3V76 A;  5IQ1 A;  5DBJ A;  2GR1 A;  4OPI A;  1CJC A;  1E6E A;  1GET A;  1ONF A;  4NNJ A;  2GR2 A;  4OPG A;  3BI2 A;  2JB1 A;  3QSM A;  4OPC A;  2C7G A;  2V5Z A;  4P9S A;  2WU5 A;  2H89 A;  1F8R A;  3NLC A;  4OPU A;  3NYE A;  4XXG A;  5CKU A;  2FJE A;  2YG6 A;  3C4A A;  1FL2 A;  3UTE A;  3P9U A;  4TM3 A;  4X9M A;  3M0O A;  2B9Y A;  2ZZB A;  3GRT A;  1TDF A;  2C65 A;  1GT8 A;  3T2K A;  4AT2 A;  1E1L A;  1PJ5 A;  3GWD A;  3HYV A;  4H4V A;  1N1P A;  3QSS A;  3SYI A;  4B64 A;  2JBV A;  1N4W A;  1PHH A;  4H4Z A;  4IVM B;  4BK3 A;  4DSH A;  4LA1 A;  1MOK A;  4WCT A;  3H8L A;  2GF3 A;  2XLT A;  3AEF A;  2V60 A;  2ZBW A;  4FDC B;  4H2N A;  3RP6 A;  4C3Y A;  2B7S A;  2IVD A;  2WOV A;  4JNQ A;  4FK1 A;  5KVH A;  4U8K A;  4U8J A;  4ZCD A;  2FJD A;  1NPX A;  3NK0 X;  4Z24 A;  4RG3 A;  3AE3 A;  1TDN A;  5L46 A;  4CRT A;  2HQM A;  3NIX A;  2R0G A;  3UKA A;  2XLP A;  4K7Z A;  1GV4 A;  1EL8 A;  2GMH A;  4JQ9 A;  2BK3 A;  3CNJ A;  2ZZC A;  4YSH A;  3L1R A;  4A65 A;  5JCK A;  2BK4 A;  2WDQ A;  3GRS A;  3G5S A;  1VG0 A;  1CL0 A;  2C75 A;  1MO9 A;  4GF7 A;  2B9X A;  1DXL A;  1SEZ A;  5FS7 A;  3CND A;  3K30 A;  4A99 A;  3AED A;  1YQ3 A;  1IUT A;  1RP0 A;  1M6I A;  1Y56 A;  1F6M A;  3DJD A;  3DK4 A;  2FJB A;  4C5O A;  4JY2 A;  5HYM A;  1GAL A;  4CCQ A;  1DOE A;  3ITJ A;  2XVF A;  3CGE A;  3L8K A;  3LAD A;  1K0L A;  3NTA A;  3NYF A;  3QVR A;  4OPT A;  5FS8 A;  4YKF A;  1CJ3 A;  2JB2 A;  1JRZ A;  2BS2 A;  4A79 A;  1KDG A;  1REO A;  1TDE A;  4GCM A;  3QFB A;  4YKG A;  1IUU A;  3FIM B;  3ALL A;  3M13 A;  4C3X A;  3UTH A;  3SQP A;  4N9X A;  4CBQ A;  2OLN A;  3V3N A;  1O95 A;  3GD4 A;  3GDN A;  3QJ4 A;  5KVI A;  1FCD A;  1JU2 A;  2WDV A;  3IC9 A;  2ACZ A;  3RED A;  4FX9 A;  4H4X A;  1COY A;  5J7X A;  1DOD A;  4G9K A;  4NTD A;  1F3P A;  1GES A;  3AD9 B;  3QFA A;  4JDR A;  2BAC A;  5JCM A;  3M12 A;  3P4P A;  2B76 A;  4H50 A;  4B67 A;  4C74 A;  1DOC A;  3HYW A;  3UKQ A;  2Q0L A;  1BZL A;  2YR6 A;  3VR9 A;  4RSL A;  2YR4 A;  1YY5 A;  2BYB A;  4Z25 A;  3RP7 A;  2GVC A;  2WBA A;  1PJ7 A;  2XFO A;  1O5W A;  3NRN A;  4J36 A;  1GTE A;  2B9W A;  4XWR A;  2JAE A;  3RNM A;  5HY5 A;  5KXJ A;  5KMQ A;  4ADW A;  3K7Q X;  4U8I A;  1Q1W A;  4K5S A;  3O0H A;  3DGZ A;  2XVI A;  3AE4 A;  1S3E A;  3CNT A;  2JK6 A;  3PVC A;  1DJQ A;  1FEB A;  1D7Y A;  1H6V A;  3LZX A;  3UKL A;  2YG7 A;  2YLW A;  4O5Q A;  1ZX9 A;  3FG2 P;  1O94 A;  1DOB A;  3CNP A;  4Z2U A;  3NK2 X;  3DJJ A;  4EM3 A;  1PBD A;  2C73 A;  3R9U A;  1GER A;  4AT0 A;  2YVF A;  3CNS A;  3I3L A;  3UKP A;  4EMI A;  4IA5 A;  1NG3 A;  3T0K A;  3T31 A;  1OJC A;  1GRT A;  2PHH A;  4YSX A;  1W4X A;  3KLJ A;  3RHA A;  4C77 A;  3KPF A;  3E1T A;  2WES A;  3NN6 X;  2OAM A;  4Y4M A;  1D7L A;  1PBB A;  3AE9 A;  5HHF A;  4APN A;  2X8C A;  1D4E A;  3UKK A;  2X3N A;  4XWZ A;  5KMP A;  2W0H A;  2BAB A;  4GRT A;  3DA1 A;  2C3D A;  4YTP A;  2GH5 A;  3OZ2 A;  5BRT A;  3SZ0 A;  1VQW A;  4A7A A;  4BJY A;  3VRB A;  2BCG G;  4JNA A;  2VOU A;  2R4J A;  3S5W A;  4YXD A;  3GMC A;  4CY8 A;  4NEV A;  4USR A;  1E1N A;  2BXR A;  3GSI A;  4EMJ A;  3KVE A;  1MXT A;  3NK1 X;  1JRX A;  2GB0 A;  3EAO A;  1JOA A;  3AEG A;  5KWF A;  2A87 A;  1ZDL A;  2H88 A;  1ZKQ A;  3T2Z A;  2CFY A;  2CDU A;  2BC0 A;  3NN0 X;  2BRA A;  2C3C A;  4EIP A;  1OJA A;  2YQU A;  4MJW A;  1BGN A;  2WHD A;  4II2 A;  4OPD A;  2O9Z A;  2TPR A;  2BS4 A;  1B8S A;  5M10 A;  2WU2 A;  3AE6 A;  2YR5 A;  4NTC A;  3CN8 A;  1ZMC A;  1K0J A;  2NPX A;  1LTX R;  3NYC A;  2GRT A;  2IVE A;  1CJ4 A;  4U8O A;  1IJH A;  4JY3 A;  2B7R A;  3ALM A;  4IA6 A;  3GYJ A;  4Z2T A;  1K0I A;  4FK1 C;  2YWL A;  4TLZ A;  2CUL A;  1NG4 A;  3KD9 A;  3UOV A;  2C76 A;  2WP5 A;  2GQW A;  5TR3 A;  5KMS A;  2BK5 A;  1XDI A;  3VR8 A;  4YT0 A;  1L9C A;  1GPE A;  1RSG A;  4I58 A;  2YLR A;  2JB3 A;  4Z44 A;  4LU6 A;  4X9N A;  1XHC A;  3ISH A;  1IUW A;  3F8D A;  1Q9I A;  4U2S A;  4AOX A;  1JEH A;  1E1M A;  4CNK A;  1CC6 A;  2C66 A;  4E0V A;  4Y4N A;  2GR0 A;  4NZH A;  2QAE A;  1NEK A;  1FEA A;  1UKV G;  4Z2R A;  3JSK A;  4HB9 A;  1LVL A;  4X4J A;  2FJA A;  4H7U A;  4RG4 A;  4G74 A;  4EQW A;  3Q6J A;  2EQ8 A;  3BNM A;  1CC4 A;  4K2X A;  3KU9 A;  4BUR A;  1QLB A;  3AE8 A;  3UOZ A;  5JCN A;  4B65 A;  2DKH A;  5KNL A;  2AAQ A;  3AE2 A;  1H81 A;  4Z26 A;  5BVA A;  2XLU A;  4H2P A;  5BUK A;  1V59 A;  3ZYX A;  3VRA A;  3IHG A;  3IHM A;  1EBD A;  1KSS A;  3PS9 A;  2JKC A;  1F8S A;  1PBC A;  2ARD A;  2R9Z A;  2V3B A;  3LXD A;  3RP8 A;  1NHQ A;  4D04 A;  2YG4 A;  4B68 A;  1PJ6 A;  1EL7 A;  2GMJ A;  2XVE A;  3AE5 A;  1H7X A;  2XCG A;  3CPI G;  4TM4 A;  2XYO A;  4AP3 A;  2RGJ A;  3P1W A;  1NAA A;  1PN0 A;  2XLS A;  2YLX A;  3BI5 A;  3QSE A;  4D03 A;  4YSY A;  2BC1 A;  1D4C A;  3SM8 A;  2VVM A;  1H83 A;  3UTG A;  3UKF A;  4H4P A;  1DNC A;  4USQ A;  3NGC X;  4I59 A;  4HA6 A;  1CBO A;  1L0V A;  1ZOV A;  2Y6Q A;  2WEU A;  2GAH B;  4H2Q A;  2WOI A;  1KNR A;  2BS3 A;  2Q6U A;  4EQX A;  4A6N A;  1ZY8 A;  5GSN A;  1E1K A;  4U2L A;  4EQR A;  5KMR A;  3GYI A;  4J56 A;  2GQF A;  1GXF A;  1XAN A;  2VVL G;  4H4T A;  1S2Y A;  4J31 A;  3NG7 X;  3AEC A;  3QVP A;  3UOX A;  2ZZ0 A;  2YG5 A;  3FBS A;  2R0C A;  1KNP A;  1D5T A;  2Z5X A;  4U8N A;  3WE0 A;  2WET A;  4YTN A;  1LQT A;  3LZW A;  4WX1 A;  4GUV A;  4A5L A;  4EMW A;  4IVO B;  2OA1 A;  4Y4L A;  3AWI A;  3B3R A;  4U8P A;  3CPH G;  2YVJ A;  2AQJ A;  3CTY A;  1B37 A;  3URH A;  4UDQ A;  3HYX A;  4NEW A;  3CMM A;  3UP4 A;  1BWC A;  2VVL A;  3AD7 B;  4CCR A;  1AOG A;  1Y56 B;  3AYL A;  2PYX A;  2TMD A;  4U8L A;  4EM4 A;  4H4S A;  2XFN A;  3AB1 A;  1NHR A;  1LPF A;  4H4Q A;  3AE1 A;  1K4Q A;  4NTE A;  3ATQ A;  1P2H A;  4GDE A;  2E4G A;  4TM0 A;  5BUL A;  5JCI A;  4PAA A;  4ICY A;  3DJG X;  4BK1 A;  1RYI A;  2GR3 A;  4DNA A;  4G6H A;  1NEN A;  1X31 B;  1S3B A;  2CVJ A;  2GV8 A;  1VRQ B;  2YM1 A;  1Q1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...