3R9UA

Thioredoxin-disulfide reductase from campylobacter jejuni.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
314
structure length
314
Chain Sequence
SNAMLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKDGSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Thioredoxin-disulfide reductase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Oxidoreductase
total genus 86
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA02
2GR2A 3NGCX 3AE5A 2ZZCA 3QVPA 2QA1A 3ISHA 1PBBA 4H50A 4LIIA 4Z24A 3LZWA 1E1NA 1F8SA 2B7SA 1HYUA 2B9XA 1NAAA 3CNTA 1TDOA 4U2SA 3S5WA 4N9XA 3NK2X 3NLCA 2GR1A 3I6DA 2X50A 4U8KA 2C3DA 2GEWA 3QFAA 4Z2TA 5KWFA 4KPRA 4A7AA 3DK9A 3P4SA 1H6VA 1QO8A 4FX9A 1JNRA 1XPQA 2FBWA 3P9UA 3DGZA 1CL0A 2C73A 4D03A 4EM3A 4Y4LA 3ATRA 3K30A 1PJ7A 4O5QA 3NK0X 1XDIA 4K2XA 2R9ZA 4HB9A 4K7ZA 2E5VA 4A9WA 4H2NA 1KNRA 1Y56A 4LA1A 3NT6A 4J2WA 2ACZA 1NHQA 3DK8A 2B7RA 1YQ4A 1ZP0A 2YR6A 2VVMA 3GD4A 1E6EA 1H7XA 3AWIA 3OC4A 4NEVA 2XVHA 2A8XA 2GRTA 4GR1A 1GRBA 3NYCA 3AYIA 3DH9A 4TM1A 2WU5A 3UKHA 4H4RA 2F5ZA 2WP5A 3KD9A 2EQ9A 1N4VA 4AP3A 4EQRA 1JOAA 4U8OA 2ZZ0A 3SM8A 3QSSA 5TR3A 4RG3A 3ABVA 4K8DA 4LU6A 2BXSA 1GRTA 3RP8A 3CIRA 4H7UA 4YWOA 3LZXA 4EQWA 4UDRA 2BC1A 4U8NA 3QVRA 3KA7A 4I58A 2PHHA 5HYMA 5KXJA 1CJCA 3PS9A 3ICSA 4EM4A 4M52A 2C3CA 2VRLA 3D8XA 4Z2UA 3I3LA 1B4VA 4H4SA 1OJDA 3CGDA 1BWCA 1Y56B 1ZK7A 3DA1A 4BJYA 1TDEA 1TDKA 1GRHA 4JNAA 3GRSA 1TYTA 3KKJA 4FK1C 4U2LA 5HHFA 4JNQA 5KOWA 4TM0A 4AOSA 4K22A 3AE4A 4KX6A 3GMCA 3Q9TA 2X8HA 2YG6A 4OPLA 4B64A 2YG4A 3BI4A 2GMJA 4DSGA 3GYIA 2XVEA 1FEAA 1S2YA 2BACA 3GDNA 3NIXA 4DGKA 4YSZA 3M0OA 4H2PA 3NYEA 2V61A 1MXTA 1EL9A 4GDEA 2WU2A 4U8LA 3T37A 1DOBA 3UOVA 3UKAA 3UKPA 3RP6A 4TLZA 2WQYA 1GRFA 2JB3A 3KU9A 3L1RA 2R45A 2WHDA 1DODA 2BXRA 2OALA 2WESA 3NN0X 3R9UA 1F3PA 3NH3X 3NYFA 2WBAA 1RYIA 3RP7A 2BA9A 1GRAA 1PDHA 3IWAA 3QFBA 4J34A 2YAUA 4Y4NA 3P4QA 4A6NB 1OJAA 2B76A 3AEAA 3BHKA 1ZDLA 4JQ9A 2WDVA 5J60A 1KFYA 2BK4A 2BCGG 1N4UA 4USQA 4Z43A 3UKFA 2RABA 3GWDA 4P9SA 3H8IA 4YKFA 5FS9A 5JCNA 2C65A 2V60A 3KLJA 1ZKQA 1O95A 1X31B 4XWZA 4YSXA 2C67A 2YR5A 4YKGA 3EANA 1IUWA 4JDRA 2E1MA 5M10A 1CJ2A 2Y6RA 5FS7A 3UKQA 1BGJA 2Z5YA 3CNDA 2BK5A 3PO7A 4Z44A 2V3AA 4TM4A 3GWFA 3GD3A 2XCGA 3NHOX 2Q0LA 5U25A 1RSGA 4C77A 3GDPA 5CQFA 3UKKA 1NHPA 4IA5A 1O5WA 1N1PA 3HZLA 2EQ7A 2W0HA 3BI2A 4B65A 4IV9A 1ZOYA 2AAQA 4I59A 4USRA 1FEBA 1F8WA 1L0VA 2XVIA 4YSYA 3UTGA 4X9MA 3M13A 2YVJA 1FOHA 2XLRA 4APNA 1RP0A 1S3BA 2WDRA 1D4CA 2YG7A 4EQXA 4FDCB 1F8RA 2WOVA 1PBCA 2C76A 4IA6A 3LADA 3F8DA 2WS3A 3AE1A 3OZ2A 2CFYA 1S2QA 2OA1A 3AYLA 4A99A 2GAGB 2GQFA 2NVKX 4GUVA 2IVEA 5KOXA 3UTEA 4H2QA 1K0JA 4B69A 4NTCA 1PJ6A 2B9YA 4H4TA 2TMDA 2R4EA 2VZ2A 2XFOA 3JSKA 5KVHA 1IUVA 2YLRA 1GTHA 1ONFA 2R4JA 4GF7A 1KSSA 1E1MA 3REDA 1KNPA 3AD9B 3FG2P 3IHGA 4WCTA 1EL8A 2B9WA 3LB8A 2FJDA 1LJ1A 2E4GA 3CPHG 1LPFA 3NTAA 2OLOA 2GAHB 4OPIA 2WOIA 4DSHA 3GSIA 5BVAA 4B1BA 1W4XA 2AQJA 1TDFA 1H7WA 2BS3A 5FMHA 3G5QA 2Q7VA 3S61A 1CJ3A 1NEKA 1DOCA 2RGHA 4CCRA 3V3NA 2YG5A 3AEFA 3ALJA 1DNCA 3AEEA 4K5SA 2C75A 1IUSA 1E1KA 3AXBA 4UP3A 3UOXA 2OAMA 1D7LA 1NDAA 2GMHA 2R46A 4U8IA 3VRAA 1NPXA 5JCKA 1FECA 1VG9A 5C2TA 3ZYXA 3LJPA 4B67A 3P4PA 4REKA 2XYOA 3RHAA 1KSUA 1NG4A 2ARDA 2RGOA 1GETA 2XLUA 4IVMB 4ZCDA 1NENA 3DJEA 2R0CA 1BF3A 2XLTA 1K0LA 3CNSA 4ZN0A 3AEGA 2YWLA 3KPFA 2QAEA 1BZLA 3UOZA 3ALLA 1H82A 1AOGA 3PVCA 4B63A 1QJDA 3IC9A 5BULA 1XANA 3EAOA 1CBOA 4H4XA 5HXIA 4C74A 3CGEA 1PXBA 3UKLA 3SQPA 4ZCCA 1GTEA 1XHCA 1GNDA 4PABA 1YQ3A 3AD7B 4TM3A 5U63A 4CY8A 2VVLG 1JRYA 3K7QX 3QJ4A 3VQRA 4EIPA 4J36A 5EB4A 2WOWA 3P1WA 1UKVG 4H4UA 2JK6A 3K7TA 1LTXR 1CHUA 1ZOVA 4MJWA 3ITJA 4GCMA 1JRZA 5DBJA 4Z26A 2JB2A 3AEBA 1PHHA 2H89A 2XLPA 3ICTA 4CRTA 3F8RA 2VVLA 1GEUA 1IJHA 3BNUA 3EPTA 4U2TA 2BABA 2XFUA 4H2RA 2XLSA 3AD8B 1GREA 2C72A 2GR3A 1B8SA 3II4A 4A79A 2V5ZA 4IVOB 5IPYA 4CBQA 1MO9A 2A87A 2BC0A 4B66A 4EIQA 1EBDA 1GERA 1PBDA 3BHFA 1CC4A 3DMEA 1Q1RA 1VG0A 3V76A 4RG4A 1FL2A 4C5OA 5FS6A 3AE6A 3VRBA 5ER0A 2X3NA 2BS2A 2QCUA 3IF9A 4H4VA 4TLXA 2I0ZA 2V6OA 1GALA 1KF6A 2WP9A 2YM1A 4DNAA 2WDQA 5BRTA 4C3XA 1B37A 2PYXA 3AB1A 4FK1A 1NG3A 1ZY8A 1GT8A 3E1TA 4AT2A 1QLBA 2HQMA 5HY5A 5EBKA 2YG3A 1GV4A 5IQ4A 5JCIA 1EL7A 1PBFA 4X4JA 1Y0PA 2YM2A 1BKWA 4U8MA 1OJTA 1PS9A 3NKSA 2R0PA 1LQUA 4O5UA 4OPGA 4BURA 1LVLA 4JN9A 3NG7X 1IUTA 4EMJA 3B6DA 3URHA 1P2HA 1VQWA 4HA6A 2VQ7A 3LXDA 3CGCA 3G5SA 2O9ZA 1H86A 1DJQA 3P4RA 3BI5A 2XDOA 1K0IA 5KRQA 1CJ4A 1GESA 3CTYA 3CGBA 3NTDA 4XXGA 3AE2A 3NN6X 3ALMA 3C4AA 3FBSA 5GRTA 3UP4A 2BS4A 1H83A 2Q6UA 2VOUA 4K5RA 1PBEA 3F8PA 2FJAA 2BCPA 4GDPA 2QA2A 2JAEA 4Y4MA 1Q9IA 1EL5A 4ADWA 2YLSA 5JCMA 4EMWA 5FS8A 3NNEA 3IHMA 1DJNA 2C66A 4H4ZA 5L46A 5U1OA 3GMBA 4YTNA 3UTFA 2GH5A 3NRNA 1CC6A 1KDGA 4UDPA 2C64A 2H88A 2WETA 3CNJA 1LV0A 4JY2A 3QSEA 1NHRA 1OJCA 3C96A 4OPDA 2R0GA 2GB0A 2YR4A 2EQ6A 1FCDA 1GXFA 1PN0A 2BYBA 2CULA 4NEWA 3AECA 4CY6A 1TYPA 2EQ8A 4YTMA 2FJBA 3NK1X 3C4NA 4YTPA 5LV9A 4XWRA 1M6IA 4YT0A 2DKIA 1ELIA 4ICYA 3WE0A 4AT0A 4E0VA 1SEZA 3L8KA 5JCLA 4H4QA 1LQTA 3AEDA 3DK4A 4OCGA 3LOVA 1ZX9A 1V59A 2YVGA 1Z6LA 2BK3A 2YVFA 4GRTA 1D4DA 2UZZA 2JKCA 2YLTA 5M0ZA 3FPZA 4AP1A 4Z2RA 3H4KA 2C7GA 4OPCA 1Q1WA 2WPFA 1S3EA 2XVFA 2ZZBA 3UOYA 3CPIG 1F6MA 3DJJA 2ZBWA 3M12A 4NZHA 3UP5A 1IUUA 3VR8A 3D1CA 4YXDA 1P2EA 2GV8A 1H81A 4OPTA 4EQSA 1IUXA 4J33A 3AE8A 2Z5XA 1O94A 1PXAA 2IIDA 1OJ9A 2IVDA 4H4WA 4NTEA 3RNMA 3EF6A 4AOXA 4A5LA 4A6NA 2Q0KA 1K4QA 2VRMA 3K7MX 2YLXA 3AYJA 3UTHA 4CNJA 1GPEA 2VQBA 2A89A 1JNZA 4ECHA 1L9EA 4H4PA 2Y6QA 1D4EA 3GRTA 3AE7A 4YSHA 4H4YA 5C3JA 3DGHA 3Q6JA 2GQWA 2WPEA 2WPCA 3KVEA 2NPXA 4BK3A 1ZMDA 1L9CA 2FJEA 3CPJG 3O0HA 1E7PA 3ADAB 2WP6A 4A65A 2JB1A 2JBVA 3ATQA 1D5TA 1VDCA 2GF3A 5GSNA 4EMIA 2AR8A 4X9NA 3VRDB 1YY5A 1REOA 1VRQB 1ZMCA 4OVIA 1COYA 1DOEA 2WEUA 3AE9A 3FMWA 5CKUA 4PAAA 3GYJA 3ZDNA 2YQUA 3SFDA 1E39A 3UCLA 4B68A 2J3NA 1GOSA 4UDQA 4RSLA 2XVJA 2C70A 1CF3A 3CNPA 5BUKA 1L9DA 5IQ1A 3ICRA 4BK1A 2X8CA 1JRXA 1H84A 1MOKA 1DXLA 5KVIA 1B5QA 3AE3A 2CDUA 2OLNA 3QSMA 2X8GA 1YKJA 2GR0A 5EOWA 4CCQA 4OPUA 2GVCA 1PJ5A 2RGJA 2YLWA 3FIMB 5EB5A 2TPRA 3SGLA 1TRBA 1E1LA 2CVJA 2XFQA 4J57A 4C3YA 4U8JA 1JU2A 4BV6A 4CNKA 4J56A 3H8LA 3B3RA 5J7XA 1TDNA 4BK2A 1CC2A 4J31A 4U8PA 4JY3A 4Z25A 2DKHA 1PXCA 2APGA 3COXA 4D04A 3CN8A 2XFPA 1BGNA 1GSNA 1JEHA 3DJGX 1M64A 3G5RA 1YQZA 4WX1A 3DJDA 2X99A 1GRGA 3VR9A 2V3BA 2XFNA 2YLZA 1NHSA 3BNMA 4NTDA 3V3OA 4BJZA 3SFEA 1N4WA 1D7YA
chains in the Genus database with same CATH superfamily
2GR2A 3NGCX 3AE5A 2ZZCA 3QVPA 2QA1A 3ISHA 1PBBA 4H50A 4LIIA 4Z24A 3LZWA 1E1NA 1F8SA 2B7SA 1HYUA 2B9XA 1NAAA 3CNTA 1TDOA 4U2SA 3S5WA 4GAVA 3NK2X 3NLCA 4N9XA 2GR1A 3I6DA 2X50A 4U8KA 2C3DA 2GEWA 3KPKA 3QFAA 4Z2TA 5KWFA 4KPRA 4A7AA 3DK9A 3P4SA 1H6VA 1QO8A 4FX9A 1JNRA 1XPQA 2FBWA 3P9UA 3DGZA 1CL0A 2C73A 4D03A 4EM3A 4Y4LA 3ATRA 3K30A 1PJ7A 4O5QA 3NK0X 1XDIA 4K2XA 2R9ZA 4HB9A 4K7ZA 2E5VA 4A9WA 4H2NA 3T2ZA 1KNRA 1Y56A 4LA1A 3NT6A 4J2WA 2ACZA 1NHQA 3DK8A 4GAPA 2B7RA 3SY4A 1YQ4A 1ZP0A 2YR6A 2VVMA 3GD4A 3T2YA 1E6EA 1H7XA 3AWIA 3OC4A 4NEVA 2XVHA 2A8XA 2GRTA 4GR1A 1GRBA 3NYCA 3AYIA 3DH9A 4TM1A 2WU5A 3UKHA 4H4RA 2F5ZA 2WP5A 3KD9A 2EQ9A 1N4VA 4AP3A 4NNJA 4II2A 4EQRA 1JOAA 4U8OA 2ZZ0A 3SM8A 3QSSA 5TR3A 4RG3A 3ABVA 4K8DA 4LU6A 2BXSA 1GRTA 3RP8A 3CIRA 4H7UA 4YWOA 3LZXA 4EQWA 4UDRA 2BC1A 4U8NA 3QVRA 3KA7A 4I58A 2PHHA 5HYMA 5KXJA 1CJCA 3PS9A 3ICSA 4EM4A 4M52A 2C3CA 2VRLA 3D8XA 4Z2UA 3HYXA 3I3LA 1B4VA 4H4SA 1OJDA 3CGDA 1BWCA 1Y56B 1ZK7A 3DA1A 4BJYA 1TDEA 1TDKA 1GRHA 4JNAA 3GRSA 1TYTA 3KKJA 4FK1C 4U2LA 5HHFA 4JNQA 5KOWA 4TM0A 4AOSA 4K22A 3AE4A 4KX6A 3GMCA 3Q9TA 2X8HA 2YG6A 4OPLA 4B64A 2YG4A 3BI4A 2GMJA 4DSGA 3GYIA 2XVEA 1FEAA 1S2YA 2BACA 3GDNA 3NIXA 4DGKA 4YSZA 3M0OA 4H2PA 3NYEA 2V61A 1MXTA 1EL9A 4GDEA 2WU2A 4U8LA 3T37A 4G6HA 1DOBA 3UOVA 3UKAA 3UKPA 3RP6A 4TLZA 2WQYA 1GRFA 2JB3A 3KU9A 3L1RA 2R45A 2WHDA 1DODA 2BXRA 2OALA 2WESA 3NN0X 3R9UA 1F3PA 3NH3X 3NYFA 2WBAA 1RYIA 3RP7A 2BA9A 1GRAA 1PDHA 3IWAA 3QFBA 4J34A 2YAUA 4Y4NA 3P4QA 4A6NB 1OJAA 2B76A 3AEAA 3BHKA 1ZDLA 4JQ9A 2WDVA 5J60A 1KFYA 2BK4A 2BCGG 1N4UA 4USQA 4Z43A 3UKFA 2RABA 3GWDA 4P9SA 3H8IA 4YKFA 5FS9A 5JCNA 2C65A 2V60A 3KLJA 1ZKQA 5KMQA 1O95A 1X31B 4XWZA 4YSXA 2C67A 3SZ0A 3SZCA 2YR5A 4YKGA 3EANA 1IUWA 4JDRA 2E1MA 5M10A 1CJ2A 2Y6RA 5FS7A 3UKQA 1BGJA 2Z5YA 3CNDA 2BK5A 3PO7A 4Z44A 2V3AA 3HYWA 4TM4A 3GWFA 3GD3A 2XCGA 3NHOX 2Q0LA 5U25A 1RSGA 4C77A 3GDPA 5CQFA 3UKKA 1NHPA 4IA5A 1O5WA 1N1PA 3HZLA 2EQ7A 2W0HA 3BI2A 4B65A 4IV9A 1ZOYA 2AAQA 4I59A 4USRA 1FEBA 1F8WA 1L0VA 2XVIA 4YSYA 3UTGA 4X9MA 3M13A 2YVJA 1FOHA 2XLRA 4APNA 1RP0A 3GYXA 1S3BA 2WDRA 1D4CA 2YG7A 4G74A 4EQXA 4FDCB 1F8RA 2WOVA 1PBCA 2C76A 4IA6A 3LADA 3F8DA 2WS3A 3AE1A 3OZ2A 2CFYA 4II3A 1S2QA 2OA1A 3AYLA 4A99A 2GAGB 2GQFA 2NVKX 4GUVA 2IVEA 5KOXA 3UTEA 4H2QA 1K0JA 4B69A 4NTCA 1PJ6A 2B9YA 4H4TA 2TMDA 2R4EA 2VZ2A 2XFOA 3JSKA 5KVHA 1IUVA 2YLRA 1GTHA 1ONFA 2R4JA 4GF7A 1KSSA 1E1MA 3REDA 1KNPA 3AD9B 3FG2P 3IHGA 4WCTA 1EL8A 2B9WA 3LB8A 2FJDA 1LJ1A 2E4GA 3CPHG 1LPFA 3NTAA 2OLOA 2GAHB 4OPIA 2WOIA 4DSHA 3GSIA 5BVAA 4B1BA 1W4XA 2AQJA 1TDFA 1H7WA 2BS3A 5FMHA 3G5QA 2Q7VA 3S61A 1CJ3A 1NEKA 1DOCA 2RGHA 4CCRA 3V3NA 2YG5A 3AEFA 3ALJA 1DNCA 3AEEA 4K5SA 2C75A 1IUSA 1E1KA 3AXBA 4UP3A 3UOXA 2OAMA 1D7LA 1NDAA 2GMHA 2R46A 4U8IA 3SZFA 3VRAA 1NPXA 5JCKA 1FECA 1VG9A 5C2TA 2BRYA 3LJPA 3ZYXA 4B67A 3P4PA 4REKA 2BRAA 2XYOA 3RHAA 1KSUA 1NG4A 2ARDA 2RGOA 1GETA 2XLUA 4IVMB 4ZCDA 1NENA 3DJEA 2R0CA 1BF3A 2XLTA 1K0LA 3CNSA 4ZN0A 3AEGA 2YWLA 3KPFA 2QAEA 1BZLA 3UOZA 3ALLA 1H82A 1AOGA 5KMPA 3PVCA 4B63A 1QJDA 3IC9A 5BULA 3SXIA 1XANA 3EAOA 1CBOA 4H4XA 5HXIA 4C74A 3CGEA 1PXBA 3UKLA 3SQPA 4ZCCA 1GTEA 1XHCA 1GNDA 4PABA 1YQ3A 3AD7B 4TM3A 2C4CA 5U63A 4CY8A 2VVLG 1JRYA 3K7QX 3QJ4A 3VQRA 4EIPA 4J36A 5EB4A 2WOWA 3P1WA 1UKVG 4H4UA 4G73A 2JK6A 3K7TA 1LTXR 3HYVA 1CHUA 1ZOVA 4MJWA 3ITJA 4GCMA 1JRZA 5DBJA 4Z26A 2JB2A 3AEBA 1PHHA 2H89A 2XLPA 3ICTA 4CRTA 3F8RA 2VVLA 1GEUA 1IJHA 3BNUA 3EPTA 4U2TA 2BABA 2XFUA 4H2RA 2XLSA 3AD8B 1GREA 2C72A 2GR3A 1B8SA 3II4A 4A79A 2V5ZA 4IVOB 5IPYA 4CBQA 1MO9A 2A87A 2BC0A 4B66A 4EIQA 1EBDA 1GERA 1PBDA 3BHFA 1CC4A 3DMEA 1Q1RA 1VG0A 3V76A 4RG4A 1FL2A 4C5OA 5FS6A 3AE6A 5KMRA 4NWZA 3VRBA 5ER0A 2X3NA 3SYIA 2BS2A 2QCUA 3IF9A 4H4VA 3T0KA 4TLXA 2I0ZA 2V6OA 1GALA 1KF6A 2WP9A 2YM1A 4DNAA 2WDQA 5BRTA 4C3XA 1B37A 2PYXA 3AB1A 4FK1A 1NG3A 1ZY8A 1GT8A 3E1TA 4AT2A 1QLBA 2HQMA 5HY5A 5EBKA 2YG3A 1GV4A 5IQ4A 5JCIA 1EL7A 1PBFA 4X4JA 1Y0PA 2YM2A 1BKWA 4U8MA 1OJTA 1PS9A 3NKSA 2R0PA 1LQUA 4O5UA 4OPGA 3SX6A 4BURA 1LVLA 4JN9A 3NG7X 1IUTA 5KNLA 4EMJA 3B6DA 3URHA 1P2HA 1VQWA 4HA6A 2VQ7A 3LXDA 3CGCA 3G5SA 3CMMA 2O9ZA 1H86A 1DJQA 3P4RA 3BI5A 3T31A 2XDOA 1K0IA 5KRQA 1CJ4A 1GESA 3CTYA 3CGBA 3NTDA 4XXGA 3AE2A 3NN6X 3ALMA 3C4AA 3FBSA 5GRTA 3UP4A 2BS4A 1H83A 2Q6UA 2VOUA 4K5RA 1PBEA 3F8PA 2FJAA 2BCPA 4GDPA 2QA2A 2JAEA 4Y4MA 1Q9IA 1EL5A 4ADWA 2YLSA 5JCMA 4EMWA 5FS8A 3NNEA 3IHMA 1DJNA 2C66A 4H4ZA 5L46A 5U1OA 3GMBA 4YTNA 3UTFA 2GH5A 3NRNA 1CC6A 1KDGA 4UDPA 2C64A 2H88A 2WETA 3CNJA 1LV0A 4JY2A 3QSEA 1NHRA 1OJCA 3C96A 4OPDA 2R0GA 2GB0A 2YR4A 2EQ6A 1FCDA 1GXFA 1PN0A 2BYBA 2CULA 4NEWA 3AECA 4CY6A 1TYPA 2EQ8A 4YTMA 2FJBA 3NK1X 3C4NA 4YTPA 5LV9A 4XWRA 1M6IA 4G6GA 4YT0A 2DKIA 1ELIA 4ICYA 3WE0A 4AT0A 4E0VA 1SEZA 3L8KA 5JCLA 4H4QA 1LQTA 3AEDA 3DK4A 4OCGA 3LOVA 1ZX9A 1V59A 2YVGA 1Z6LA 2BK3A 2YVFA 4GRTA 1D4DA 2UZZA 2JKCA 2YLTA 5M0ZA 3FPZA 4AP1A 4Z2RA 3H4KA 2C7GA 4OPCA 1Q1WA 2WPFA 1S3EA 2XVFA 2ZZBA 3UOYA 3CPIG 1F6MA 3DJJA 2ZBWA 3M12A 4NZHA 3UP5A 1IUUA 3VR8A 3D1CA 4YXDA 1P2EA 2GV8A 1H81A 4OPTA 4EQSA 1IUXA 4J33A 3AE8A 2Z5XA 1O94A 1PXAA 2IIDA 1OJ9A 2IVDA 4H4WA 4NTEA 3RNMA 3EF6A 4AOXA 4A5LA 4A6NA 5KMSA 2Q0KA 1K4QA 2VRMA 3K7MX 2YLXA 3AYJA 3UTHA 4CNJA 1GPEA 2VQBA 2A89A 1JNZA 4ECHA 1L9EA 4H4PA 2Y6QA 1D4EA 3GRTA 3AE7A 4YSHA 4H4YA 5C3JA 3DGHA 3Q6JA 2GQWA 2WPEA 2WPCA 3KVEA 2NPXA 4BK3A 1ZMDA 1L9CA 2FJEA 3CPJG 3O0HA 1E7PA 3ADAB 2WP6A 4A65A 2JB1A 2JBVA 3ATQA 1D5TA 1VDCA 2GF3A 5GSNA 4EMIA 2AR8A 4X9NA 3SZWA 3VRDB 1YY5A 1REOA 1VRQB 1ZMCA 4OVIA 1COYA 1DOEA 3T2KA 2WEUA 3AE9A 3FMWA 5CKUA 4PAAA 3GYJA 3ZDNA 2YQUA 3SFDA 1E39A 3UCLA 4B68A 2J3NA 1GOSA 4UDQA 4RSLA 2XVJA 2C70A 1CF3A 3CNPA 5BUKA 1L9DA 5IQ1A 3ICRA 4BK1A 2X8CA 1JRXA 1H84A 1MOKA 1DXLA 5KVIA 1B5QA 3AE3A 2CDUA 2OLNA 3QSMA 2X8GA 1YKJA 2GR0A 5EOWA 4CCQA 4OPUA 2GVCA 1PJ5A 2RGJA 2YLWA 3FIMB 5EB5A 2TPRA 3SGLA 1TRBA 1E1LA 2CVJA 2XFQA 4J57A 4C3YA 4U8JA 1JU2A 3T14A 4BV6A 4CNKA 4G9KA 4J56A 3H8LA 3B3RA 5J7XA 1TDNA 4BK2A 1CC2A 4J31A 4U8PA 4JY3A 4Z25A 2DKHA 1PXCA 2APGA 3COXA 4D04A 3CN8A 2XFPA 1BGNA 1GSNA 1JEHA 3DJGX 1M64A 3G5RA 1YQZA 4WX1A 3DJDA 2X99A 1GRGA 3VR9A 2V3BA 2XFNA 2YLZA 1NHSA 3BNMA 4NTDA 3V3OA 4BJZA 3SFEA 1N4WA 1D7YA
chains in the Genus database with same CATH topology
2GR2A 3NGCX 3AE5A 2ZZCA 3QVPA 2QA1A 3ISHA 1PBBA 4H50A 4LIIA 4Z24A 3LZWA 1E1NA 1F8SA 2B7SA 1HYUA 2B9XA 1NAAA 3CNTA 1TDOA 4U2SA 3S5WA 4GAVA 3NK2X 3NLCA 4N9XA 2GR1A 3I6DA 2X50A 4U8KA 2C3DA 2GEWA 3KPKA 3QFAA 4Z2TA 5KWFA 4KPRA 4A7AA 3DK9A 3P4SA 1H6VA 1QO8A 4FX9A 1JNRA 1XPQA 2FBWA 3P9UA 3DGZA 1CL0A 2C73A 4D03A 4EM3A 4Y4LA 3ATRA 3K30A 1PJ7A 4O5QA 3NK0X 1XDIA 4K2XA 2R9ZA 4HB9A 4K7ZA 2E5VA 4A9WA 4H2NA 3T2ZA 1KNRA 1Y56A 4LA1A 3NT6A 4J2WA 2ACZA 1NHQA 3DK8A 4GAPA 2B7RA 3SY4A 1YQ4A 1ZP0A 2YR6A 2VVMA 3GD4A 3T2YA 1E6EA 1H7XA 3AWIA 3OC4A 4NEVA 2XVHA 2A8XA 2GRTA 4GR1A 1GRBA 3NYCA 3AYIA 3DH9A 4TM1A 2WU5A 3UKHA 4H4RA 2F5ZA 2WP5A 3KD9A 2EQ9A 1N4VA 4AP3A 4NNJA 4II2A 4EQRA 1JOAA 4U8OA 2ZZ0A 3SM8A 3QSSA 5TR3A 4RG3A 3ABVA 4K8DA 4LU6A 2BXSA 1GRTA 3RP8A 3CIRA 4H7UA 4YWOA 3LZXA 4EQWA 4UDRA 2BC1A 4U8NA 3QVRA 3KA7A 4I58A 2PHHA 5HYMA 5KXJA 1CJCA 3PS9A 3ICSA 4EM4A 4M52A 2C3CA 2VRLA 3D8XA 4Z2UA 3HYXA 3I3LA 1B4VA 4H4SA 1OJDA 3CGDA 1BWCA 1Y56B 1ZK7A 3DA1A 4BJYA 1TDEA 1TDKA 1GRHA 4JNAA 3GRSA 1TYTA 3KKJA 4FK1C 4U2LA 5HHFA 4JNQA 5KOWA 4TM0A 4AOSA 4K22A 3AE4A 4KX6A 3GMCA 3Q9TA 2X8HA 2YG6A 4OPLA 4B64A 2YG4A 3BI4A 2GMJA 4DSGA 3GYIA 2XVEA 1FEAA 1S2YA 2BACA 3GDNA 3NIXA 4DGKA 4YSZA 3M0OA 4H2PA 3NYEA 2V61A 1MXTA 1EL9A 4GDEA 2WU2A 4U8LA 3T37A 4G6HA 1DOBA 3UOVA 3UKAA 3UKPA 3RP6A 4TLZA 2WQYA 1GRFA 2JB3A 3KU9A 3L1RA 2R45A 2WHDA 1DODA 2BXRA 2OALA 2WESA 3NN0X 3R9UA 1F3PA 3NH3X 3NYFA 2WBAA 1RYIA 3RP7A 2BA9A 1GRAA 1PDHA 3IWAA 3QFBA 4J34A 2YAUA 4Y4NA 3P4QA 4A6NB 1OJAA 2B76A 3AEAA 3BHKA 1ZDLA 4JQ9A 2WDVA 5J60A 1KFYA 2BK4A 2BCGG 1N4UA 4USQA 4Z43A 3UKFA 2RABA 3GWDA 4P9SA 3H8IA 4YKFA 5FS9A 5JCNA 2C65A 2V60A 3KLJA 1ZKQA 5KMQA 1O95A 1X31B 4XWZA 4YSXA 2C67A 3SZ0A 3SZCA 2YR5A 4YKGA 3EANA 1IUWA 4JDRA 2E1MA 5M10A 1CJ2A 2Y6RA 5FS7A 3UKQA 1BGJA 2Z5YA 3CNDA 2BK5A 3PO7A 4Z44A 2V3AA 3HYWA 4TM4A 3GWFA 3GD3A 2XCGA 3NHOX 2Q0LA 5U25A 1RSGA 4C77A 3GDPA 5CQFA 3UKKA 1NHPA 4IA5A 1O5WA 1N1PA 3HZLA 2EQ7A 2W0HA 3BI2A 4B65A 4IV9A 1ZOYA 2AAQA 4I59A 4USRA 1FEBA 1F8WA 1L0VA 2XVIA 4YSYA 3UTGA 4X9MA 3M13A 2YVJA 1FOHA 2XLRA 4APNA 1RP0A 3GYXA 1S3BA 2WDRA 1D4CA 2YG7A 4G74A 4EQXA 4FDCB 1F8RA 2WOVA 1PBCA 2C76A 4IA6A 3LADA 3F8DA 2WS3A 3AE1A 3OZ2A 2CFYA 4II3A 1S2QA 2OA1A 3AYLA 4A99A 2GAGB 2GQFA 2NVKX 4GUVA 2IVEA 5KOXA 3UTEA 4H2QA 1K0JA 4B69A 4NTCA 1PJ6A 2B9YA 4H4TA 2TMDA 2R4EA 2VZ2A 2XFOA 3JSKA 5KVHA 1IUVA 2YLRA 1GTHA 1ONFA 2R4JA 4GF7A 1KSSA 1E1MA 3REDA 1KNPA 3AD9B 3FG2P 3IHGA 4WCTA 1EL8A 2B9WA 3LB8A 2FJDA 1LJ1A 2E4GA 3CPHG 1LPFA 3NTAA 2OLOA 2GAHB 4OPIA 2WOIA 4DSHA 3GSIA 5BVAA 4B1BA 1W4XA 2AQJA 1TDFA 1H7WA 2BS3A 5FMHA 3G5QA 2Q7VA 3S61A 1CJ3A 1NEKA 1DOCA 2RGHA 4CCRA 3V3NA 2YG5A 3AEFA 3ALJA 1DNCA 3AEEA 4K5SA 2C75A 1IUSA 1E1KA 3AXBA 4UP3A 3UOXA 2OAMA 1D7LA 1NDAA 2GMHA 2R46A 4U8IA 3SZFA 3VRAA 1NPXA 5JCKA 1FECA 1VG9A 5C2TA 2BRYA 3LJPA 3ZYXA 4B67A 3P4PA 4REKA 2BRAA 2XYOA 3RHAA 1KSUA 1NG4A 2ARDA 2RGOA 1GETA 2XLUA 4IVMB 4ZCDA 1NENA 3DJEA 2R0CA 1BF3A 2XLTA 1K0LA 3CNSA 4ZN0A 3AEGA 2YWLA 3KPFA 2QAEA 1BZLA 3UOZA 3ALLA 1H82A 1AOGA 5KMPA 3PVCA 4B63A 1QJDA 3IC9A 5BULA 3SXIA 1XANA 3EAOA 1CBOA 4H4XA 5HXIA 4C74A 3CGEA 1PXBA 3UKLA 3SQPA 4ZCCA 1GTEA 1XHCA 1GNDA 4PABA 1YQ3A 3AD7B 4TM3A 2C4CA 5U63A 4CY8A 2VVLG 1JRYA 3K7QX 3QJ4A 3VQRA 4EIPA 4J36A 5EB4A 2WOWA 3P1WA 1UKVG 4H4UA 4G73A 2JK6A 3K7TA 1LTXR 3HYVA 1CHUA 1ZOVA 4MJWA 3ITJA 4GCMA 1JRZA 5DBJA 4Z26A 2JB2A 3AEBA 1PHHA 2H89A 2XLPA 3ICTA 4CRTA 3F8RA 2VVLA 1GEUA 1IJHA 3BNUA 3EPTA 4U2TA 2BABA 2XFUA 4H2RA 2XLSA 3AD8B 1GREA 2C72A 2GR3A 1B8SA 3II4A 4A79A 2V5ZA 4IVOB 5IPYA 4CBQA 1MO9A 2A87A 2BC0A 4B66A 4EIQA 1EBDA 1GERA 1PBDA 3BHFA 1CC4A 3DMEA 1Q1RA 1VG0A 3V76A 4RG4A 1FL2A 4C5OA 5FS6A 3AE6A 5KMRA 4NWZA 3VRBA 5ER0A 2X3NA 3SYIA 2BS2A 2QCUA 3IF9A 4H4VA 3T0KA 4TLXA 2I0ZA 2V6OA 1GALA 1KF6A 2WP9A 2YM1A 4DNAA 2WDQA 5BRTA 4C3XA 1B37A 2PYXA 3AB1A 4FK1A 1NG3A 1ZY8A 1GT8A 3E1TA 4AT2A 1QLBA 2HQMA 5HY5A 5EBKA 2YG3A 1GV4A 5IQ4A 5JCIA 1EL7A 1PBFA 4X4JA 1Y0PA 2YM2A 1BKWA 4U8MA 1OJTA 1PS9A 3NKSA 2R0PA 1LQUA 4O5UA 4OPGA 3SX6A 4BURA 1LVLA 4JN9A 3NG7X 1IUTA 5KNLA 4EMJA 3B6DA 3URHA 1P2HA 1VQWA 4HA6A 2VQ7A 3LXDA 3CGCA 3G5SA 3CMMA 2O9ZA 1H86A 1DJQA 3P4RA 3BI5A 3T31A 2XDOA 1K0IA 5KRQA 1CJ4A 1GESA 3CTYA 3CGBA 3NTDA 4XXGA 3AE2A 3NN6X 3ALMA 3C4AA 3FBSA 5GRTA 3UP4A 2BS4A 1H83A 2Q6UA 2VOUA 4K5RA 1PBEA 3F8PA 2FJAA 2BCPA 4GDPA 2QA2A 2JAEA 4Y4MA 1Q9IA 1EL5A 4ADWA 2YLSA 5JCMA 4EMWA 5FS8A 3NNEA 3IHMA 1DJNA 2C66A 4H4ZA 5L46A 5U1OA 3GMBA 4YTNA 3UTFA 2GH5A 3NRNA 1CC6A 1KDGA 4UDPA 2C64A 2H88A 2WETA 3CNJA 1LV0A 4JY2A 3QSEA 1NHRA 1OJCA 3C96A 4OPDA 2R0GA 2GB0A 2YR4A 2EQ6A 1FCDA 1GXFA 1PN0A 2BYBA 2CULA 4NEWA 3AECA 4CY6A 1TYPA 2EQ8A 4YTMA 2FJBA 3NK1X 3C4NA 4YTPA 5LV9A 4XWRA 1M6IA 4G6GA 4YT0A 2DKIA 1ELIA 4ICYA 3WE0A 4AT0A 4E0VA 1SEZA 3L8KA 5JCLA 4H4QA 1LQTA 3AEDA 3DK4A 4OCGA 3LOVA 1ZX9A 1V59A 2YVGA 1Z6LA 2BK3A 2YVFA 4GRTA 1D4DA 2UZZA 2JKCA 2YLTA 5M0ZA 3FPZA 4AP1A 4Z2RA 3H4KA 2C7GA 4OPCA 1Q1WA 2WPFA 1S3EA 2XVFA 2ZZBA 3UOYA 3CPIG 1F6MA 3DJJA 2ZBWA 3M12A 4NZHA 3UP5A 1IUUA 3VR8A 3D1CA 4YXDA 1P2EA 2GV8A 1H81A 4OPTA 4EQSA 1IUXA 4J33A 3AE8A 2Z5XA 1O94A 1PXAA 2IIDA 1OJ9A 2IVDA 4H4WA 4NTEA 3RNMA 3EF6A 4AOXA 4A5LA 4A6NA 5KMSA 2Q0KA 1K4QA 2VRMA 3K7MX 2YLXA 3AYJA 3UTHA 4CNJA 1GPEA 2VQBA 2A89A 1JNZA 4ECHA 1L9EA 4H4PA 2Y6QA 1D4EA 3GRTA 3AE7A 4YSHA 4H4YA 5C3JA 3DGHA 3Q6JA 2GQWA 2WPEA 2WPCA 3KVEA 2NPXA 4BK3A 1ZMDA 1L9CA 2FJEA 3CPJG 3O0HA 1E7PA 3ADAB 2WP6A 4A65A 2JB1A 2JBVA 3ATQA 1D5TA 1VDCA 2GF3A 5GSNA 4EMIA 2AR8A 4X9NA 3SZWA 3VRDB 1YY5A 1REOA 1VRQB 1ZMCA 4OVIA 1COYA 1DOEA 3T2KA 2WEUA 3AE9A 3FMWA 5CKUA 4PAAA 3GYJA 3ZDNA 2YQUA 3SFDA 1E39A 3UCLA 4B68A 2J3NA 1GOSA 4UDQA 4RSLA 2XVJA 2C70A 1CF3A 3CNPA 5BUKA 1L9DA 5IQ1A 3ICRA 4BK1A 2X8CA 1JRXA 1H84A 1MOKA 1DXLA 5KVIA 1B5QA 3AE3A 2CDUA 2OLNA 3QSMA 2X8GA 1YKJA 2GR0A 5EOWA 4CCQA 4OPUA 2GVCA 1PJ5A 2RGJA 2YLWA 3FIMB 5EB5A 2TPRA 3SGLA 1TRBA 1E1LA 2CVJA 2XFQA 4J57A 4C3YA 4U8JA 1JU2A 3T14A 4BV6A 4CNKA 4G9KA 4J56A 3H8LA 3B3RA 5J7XA 1TDNA 4BK2A 1CC2A 4J31A 4U8PA 4JY3A 4Z25A 2DKHA 1PXCA 2APGA 3COXA 4D04A 3CN8A 2XFPA 1BGNA 1GSNA 1JEHA 3DJGX 1M64A 3G5RA 1YQZA 4WX1A 3DJDA 2X99A 1GRGA 3VR9A 2V3BA 2XFNA 2YLZA 1NHSA 3BNMA 4NTDA 3V3OA 4BJZA 3SFEA 1N4WA 1D7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GR2 A;  3NGC X;  3AE5 A;  2ZZC A;  3QVP A;  2QA1 A;  3ISH A;  1PBB A;  4H50 A;  4LII A;  4Z24 A;  3LZW A;  1E1N A;  1F8S A;  2B7S A;  1HYU A;  2B9X A;  1NAA A;  3CNT A;  1TDO A;  4U2S A;  3S5W A;  4N9X A;  3NK2 X;  3NLC A;  2GR1 A;  3I6D A;  2X50 A;  4U8K A;  2C3D A;  2GEW A;  3QFA A;  4Z2T A;  5KWF A;  4KPR A;  4A7A A;  3DK9 A;  3P4S A;  1H6V A;  1QO8 A;  4FX9 A;  1JNR A;  1XPQ A;  2FBW A;  3P9U A;  3DGZ A;  1CL0 A;  2C73 A;  4D03 A;  4EM3 A;  4Y4L A;  3ATR A;  3K30 A;  1PJ7 A;  4O5Q A;  3NK0 X;  1XDI A;  4K2X A;  2R9Z A;  4HB9 A;  4K7Z A;  2E5V A;  4A9W A;  4H2N A;  1KNR A;  1Y56 A;  4LA1 A;  3NT6 A;  4J2W A;  2ACZ A;  1NHQ A;  3DK8 A;  2B7R A;  1YQ4 A;  1ZP0 A;  2YR6 A;  2VVM A;  3GD4 A;  1E6E A;  1H7X A;  3AWI A;  3OC4 A;  4NEV A;  2XVH A;  2A8X A;  2GRT A;  4GR1 A;  1GRB A;  3NYC A;  3AYI A;  3DH9 A;  4TM1 A;  2WU5 A;  3UKH A;  4H4R A;  2F5Z A;  2WP5 A;  3KD9 A;  2EQ9 A;  1N4V A;  4AP3 A;  4EQR A;  1JOA A;  4U8O A;  2ZZ0 A;  3SM8 A;  3QSS A;  5TR3 A;  4RG3 A;  3ABV A;  4K8D A;  4LU6 A;  2BXS A;  1GRT A;  3RP8 A;  3CIR A;  4H7U A;  4YWO A;  3LZX A;  4EQW A;  4UDR A;  2BC1 A;  4U8N A;  3QVR A;  3KA7 A;  4I58 A;  2PHH A;  5HYM A;  5KXJ A;  1CJC A;  3PS9 A;  3ICS A;  4EM4 A;  4M52 A;  2C3C A;  2VRL A;  3D8X A;  4Z2U A;  3I3L A;  1B4V A;  4H4S A;  1OJD A;  3CGD A;  1BWC A;  1Y56 B;  1ZK7 A;  3DA1 A;  4BJY A;  1TDE A;  1TDK A;  1GRH A;  4JNA A;  3GRS A;  1TYT A;  3KKJ A;  4FK1 C;  4U2L A;  5HHF A;  4JNQ A;  5KOW A;  4TM0 A;  4AOS A;  4K22 A;  3AE4 A;  4KX6 A;  3GMC A;  3Q9T A;  2X8H A;  2YG6 A;  4OPL A;  4B64 A;  2YG4 A;  3BI4 A;  2GMJ A;  4DSG A;  3GYI A;  2XVE A;  1FEA A;  1S2Y A;  2BAC A;  3GDN A;  3NIX A;  4DGK A;  4YSZ A;  3M0O A;  4H2P A;  3NYE A;  2V61 A;  1MXT A;  1EL9 A;  4GDE A;  2WU2 A;  4U8L A;  3T37 A;  1DOB A;  3UOV A;  3UKA A;  3UKP A;  3RP6 A;  4TLZ A;  2WQY A;  1GRF A;  2JB3 A;  3KU9 A;  3L1R A;  2R45 A;  2WHD A;  1DOD A;  2BXR A;  2OAL A;  2WES A;  3NN0 X;  3R9U A;  1F3P A;  3NH3 X;  3NYF A;  2WBA A;  1RYI A;  3RP7 A;  2BA9 A;  1GRA A;  1PDH A;  3IWA A;  3QFB A;  4J34 A;  2YAU A;  4Y4N A;  3P4Q A;  4A6N B;  1OJA A;  2B76 A;  3AEA A;  3BHK A;  1ZDL A;  4JQ9 A;  2WDV A;  5J60 A;  1KFY A;  2BK4 A;  2BCG G;  1N4U A;  4USQ A;  4Z43 A;  3UKF A;  2RAB A;  3GWD A;  4P9S A;  3H8I A;  4YKF A;  5FS9 A;  5JCN A;  2C65 A;  2V60 A;  3KLJ A;  1ZKQ A;  1O95 A;  1X31 B;  4XWZ A;  4YSX A;  2C67 A;  2YR5 A;  4YKG A;  3EAN A;  1IUW A;  4JDR A;  2E1M A;  5M10 A;  1CJ2 A;  2Y6R A;  5FS7 A;  3UKQ A;  1BGJ A;  2Z5Y A;  3CND A;  2BK5 A;  3PO7 A;  4Z44 A;  2V3A A;  4TM4 A;  3GWF A;  3GD3 A;  2XCG A;  3NHO X;  2Q0L A;  5U25 A;  1RSG A;  4C77 A;  3GDP A;  5CQF A;  3UKK A;  1NHP A;  4IA5 A;  1O5W A;  1N1P A;  3HZL A;  2EQ7 A;  2W0H A;  3BI2 A;  4B65 A;  4IV9 A;  1ZOY A;  2AAQ A;  4I59 A;  4USR A;  1FEB A;  1F8W A;  1L0V A;  2XVI A;  4YSY A;  3UTG A;  4X9M A;  3M13 A;  2YVJ A;  1FOH A;  2XLR A;  4APN A;  1RP0 A;  1S3B A;  2WDR A;  1D4C A;  2YG7 A;  4EQX A;  4FDC B;  1F8R A;  2WOV A;  1PBC A;  2C76 A;  4IA6 A;  3LAD A;  3F8D A;  2WS3 A;  3AE1 A;  3OZ2 A;  2CFY A;  1S2Q A;  2OA1 A;  3AYL A;  4A99 A;  2GAG B;  2GQF A;  2NVK X;  4GUV A;  2IVE A;  5KOX A;  3UTE A;  4H2Q A;  1K0J A;  4B69 A;  4NTC A;  1PJ6 A;  2B9Y A;  4H4T A;  2TMD A;  2R4E A;  2VZ2 A;  2XFO A;  3JSK A;  5KVH A;  1IUV A;  2YLR A;  1GTH A;  1ONF A;  2R4J A;  4GF7 A;  1KSS A;  1E1M A;  3RED A;  1KNP A;  3AD9 B;  3FG2 P;  3IHG A;  4WCT A;  1EL8 A;  2B9W A;  3LB8 A;  2FJD A;  1LJ1 A;  2E4G A;  3CPH G;  1LPF A;  3NTA A;  2OLO A;  2GAH B;  4OPI A;  2WOI A;  4DSH A;  3GSI A;  5BVA A;  4B1B A;  1W4X A;  2AQJ A;  1TDF A;  1H7W A;  2BS3 A;  5FMH A;  3G5Q A;  2Q7V A;  3S61 A;  1CJ3 A;  1NEK A;  1DOC A;  2RGH A;  4CCR A;  3V3N A;  2YG5 A;  3AEF A;  3ALJ A;  1DNC A;  3AEE A;  4K5S A;  2C75 A;  1IUS A;  1E1K A;  3AXB A;  4UP3 A;  3UOX A;  2OAM A;  1D7L A;  1NDA A;  2GMH A;  2R46 A;  4U8I A;  3VRA A;  1NPX A;  5JCK A;  1FEC A;  1VG9 A;  5C2T A;  3ZYX A;  3LJP A;  4B67 A;  3P4P A;  4REK A;  2XYO A;  3RHA A;  1KSU A;  1NG4 A;  2ARD A;  2RGO A;  1GET A;  2XLU A;  4IVM B;  4ZCD A;  1NEN A;  3DJE A;  2R0C A;  1BF3 A;  2XLT A;  1K0L A;  3CNS A;  4ZN0 A;  3AEG A;  2YWL A;  3KPF A;  2QAE A;  1BZL A;  3UOZ A;  3ALL A;  1H82 A;  1AOG A;  3PVC A;  4B63 A;  1QJD A;  3IC9 A;  5BUL A;  1XAN A;  3EAO A;  1CBO A;  4H4X A;  5HXI A;  4C74 A;  3CGE A;  1PXB A;  3UKL A;  3SQP A;  4ZCC A;  1GTE A;  1XHC A;  1GND A;  4PAB A;  1YQ3 A;  3AD7 B;  4TM3 A;  5U63 A;  4CY8 A;  2VVL G;  1JRY A;  3K7Q X;  3QJ4 A;  3VQR A;  4EIP A;  4J36 A;  5EB4 A;  2WOW A;  3P1W A;  1UKV G;  4H4U A;  2JK6 A;  3K7T A;  1LTX R;  1CHU A;  1ZOV A;  4MJW A;  3ITJ A;  4GCM A;  1JRZ A;  5DBJ A;  4Z26 A;  2JB2 A;  3AEB A;  1PHH A;  2H89 A;  2XLP A;  3ICT A;  4CRT A;  3F8R A;  2VVL A;  1GEU A;  1IJH A;  3BNU A;  3EPT A;  4U2T A;  2BAB A;  2XFU A;  4H2R A;  2XLS A;  3AD8 B;  1GRE A;  2C72 A;  2GR3 A;  1B8S A;  3II4 A;  4A79 A;  2V5Z A;  4IVO B;  5IPY A;  4CBQ A;  1MO9 A;  2A87 A;  2BC0 A;  4B66 A;  4EIQ A;  1EBD A;  1GER A;  1PBD A;  3BHF A;  1CC4 A;  3DME A;  1Q1R A;  1VG0 A;  3V76 A;  4RG4 A;  1FL2 A;  4C5O A;  5FS6 A;  3AE6 A;  3VRB A;  5ER0 A;  2X3N A;  2BS2 A;  2QCU A;  3IF9 A;  4H4V A;  4TLX A;  2I0Z A;  2V6O A;  1GAL A;  1KF6 A;  2WP9 A;  2YM1 A;  4DNA A;  2WDQ A;  5BRT A;  4C3X A;  1B37 A;  2PYX A;  3AB1 A;  4FK1 A;  1NG3 A;  1ZY8 A;  1GT8 A;  3E1T A;  4AT2 A;  1QLB A;  2HQM A;  5HY5 A;  5EBK A;  2YG3 A;  1GV4 A;  5IQ4 A;  5JCI A;  1EL7 A;  1PBF A;  4X4J A;  1Y0P A;  2YM2 A;  1BKW A;  4U8M A;  1OJT A;  1PS9 A;  3NKS A;  2R0P A;  1LQU A;  4O5U A;  4OPG A;  4BUR A;  1LVL A;  4JN9 A;  3NG7 X;  1IUT A;  4EMJ A;  3B6D A;  3URH A;  1P2H A;  1VQW A;  4HA6 A;  2VQ7 A;  3LXD A;  3CGC A;  3G5S A;  2O9Z A;  1H86 A;  1DJQ A;  3P4R A;  3BI5 A;  2XDO A;  1K0I A;  5KRQ A;  1CJ4 A;  1GES A;  3CTY A;  3CGB A;  3NTD A;  4XXG A;  3AE2 A;  3NN6 X;  3ALM A;  3C4A A;  3FBS A;  5GRT A;  3UP4 A;  2BS4 A;  1H83 A;  2Q6U A;  2VOU A;  4K5R A;  1PBE A;  3F8P A;  2FJA A;  2BCP A;  4GDP A;  2QA2 A;  2JAE A;  4Y4M A;  1Q9I A;  1EL5 A;  4ADW A;  2YLS A;  5JCM A;  4EMW A;  5FS8 A;  3NNE A;  3IHM A;  1DJN A;  2C66 A;  4H4Z A;  5L46 A;  5U1O A;  3GMB A;  4YTN A;  3UTF A;  2GH5 A;  3NRN A;  1CC6 A;  1KDG A;  4UDP A;  2C64 A;  2H88 A;  2WET A;  3CNJ A;  1LV0 A;  4JY2 A;  3QSE A;  1NHR A;  1OJC A;  3C96 A;  4OPD A;  2R0G A;  2GB0 A;  2YR4 A;  2EQ6 A;  1FCD A;  1GXF A;  1PN0 A;  2BYB A;  2CUL A;  4NEW A;  3AEC A;  4CY6 A;  1TYP A;  2EQ8 A;  4YTM A;  2FJB A;  3NK1 X;  3C4N A;  4YTP A;  5LV9 A;  4XWR A;  1M6I A;  4YT0 A;  2DKI A;  1ELI A;  4ICY A;  3WE0 A;  4AT0 A;  4E0V A;  1SEZ A;  3L8K A;  5JCL A;  4H4Q A;  1LQT A;  3AED A;  3DK4 A;  4OCG A;  3LOV A;  1ZX9 A;  1V59 A;  2YVG A;  1Z6L A;  2BK3 A;  2YVF A;  4GRT A;  1D4D A;  2UZZ A;  2JKC A;  2YLT A;  5M0Z A;  3FPZ A;  4AP1 A;  4Z2R A;  3H4K A;  2C7G A;  4OPC A;  1Q1W A;  2WPF A;  1S3E A;  2XVF A;  2ZZB A;  3UOY A;  3CPI G;  1F6M A;  3DJJ A;  2ZBW A;  3M12 A;  4NZH A;  3UP5 A;  1IUU A;  3VR8 A;  3D1C A;  4YXD A;  1P2E A;  2GV8 A;  1H81 A;  4OPT A;  4EQS A;  1IUX A;  4J33 A;  3AE8 A;  2Z5X A;  1O94 A;  1PXA A;  2IID A;  1OJ9 A;  2IVD A;  4H4W A;  4NTE A;  3RNM A;  3EF6 A;  4AOX A;  4A5L A;  4A6N A;  2Q0K A;  1K4Q A;  2VRM A;  3K7M X;  2YLX A;  3AYJ A;  3UTH A;  4CNJ A;  1GPE A;  2VQB A;  2A89 A;  1JNZ A;  4ECH A;  1L9E A;  4H4P A;  2Y6Q A;  1D4E A;  3GRT A;  3AE7 A;  4YSH A;  4H4Y A;  5C3J A;  3DGH A;  3Q6J A;  2GQW A;  2WPE A;  2WPC A;  3KVE A;  2NPX A;  4BK3 A;  1ZMD A;  1L9C A;  2FJE A;  3CPJ G;  3O0H A;  1E7P A;  3ADA B;  2WP6 A;  4A65 A;  2JB1 A;  2JBV A;  3ATQ A;  1D5T A;  1VDC A;  2GF3 A;  5GSN A;  4EMI A;  2AR8 A;  4X9N A;  3VRD B;  1YY5 A;  1REO A;  1VRQ B;  1ZMC A;  4OVI A;  1COY A;  1DOE A;  2WEU A;  3AE9 A;  3FMW A;  5CKU A;  4PAA A;  3GYJ A;  3ZDN A;  2YQU A;  3SFD A;  1E39 A;  3UCL A;  4B68 A;  2J3N A;  1GOS A;  4UDQ A;  4RSL A;  2XVJ A;  2C70 A;  1CF3 A;  3CNP A;  5BUK A;  1L9D A;  5IQ1 A;  3ICR A;  4BK1 A;  2X8C A;  1JRX A;  1H84 A;  1MOK A;  1DXL A;  5KVI A;  1B5Q A;  3AE3 A;  2CDU A;  2OLN A;  3QSM A;  2X8G A;  1YKJ A;  2GR0 A;  5EOW A;  4CCQ A;  4OPU A;  2GVC A;  1PJ5 A;  2RGJ A;  2YLW A;  3FIM B;  5EB5 A;  2TPR A;  3SGL A;  1TRB A;  1E1L A;  2CVJ A;  2XFQ A;  4J57 A;  4C3Y A;  4U8J A;  1JU2 A;  4BV6 A;  4CNK A;  4J56 A;  3H8L A;  3B3R A;  5J7X A;  1TDN A;  4BK2 A;  1CC2 A;  4J31 A;  4U8P A;  4JY3 A;  4Z25 A;  2DKH A;  1PXC A;  2APG A;  3COX A;  4D04 A;  3CN8 A;  2XFP A;  1BGN A;  1GSN A;  1JEH A;  3DJG X;  1M64 A;  3G5R A;  1YQZ A;  4WX1 A;  3DJD A;  2X99 A;  1GRG A;  3VR9 A;  2V3B A;  2XFN A;  2YLZ A;  1NHS A;  3BNM A;  4NTD A;  3V3O A;  4BJZ A;  3SFE A;  1N4W A;  1D7Y A; 
#chains in the Genus database with same CATH topology
 2GR2 A;  3NGC X;  3AE5 A;  2ZZC A;  3QVP A;  2QA1 A;  3ISH A;  1PBB A;  4H50 A;  4LII A;  4Z24 A;  3LZW A;  1E1N A;  1F8S A;  2B7S A;  1HYU A;  2B9X A;  1NAA A;  3CNT A;  1TDO A;  4U2S A;  3S5W A;  4GAV A;  3NK2 X;  3NLC A;  4N9X A;  2GR1 A;  3I6D A;  2X50 A;  4U8K A;  2C3D A;  2GEW A;  3KPK A;  3QFA A;  4Z2T A;  5KWF A;  4KPR A;  4A7A A;  3DK9 A;  3P4S A;  1H6V A;  1QO8 A;  4FX9 A;  1JNR A;  1XPQ A;  2FBW A;  3P9U A;  3DGZ A;  1CL0 A;  2C73 A;  4D03 A;  4EM3 A;  4Y4L A;  3ATR A;  3K30 A;  1PJ7 A;  4O5Q A;  3NK0 X;  1XDI A;  4K2X A;  2R9Z A;  4HB9 A;  4K7Z A;  2E5V A;  4A9W A;  4H2N A;  3T2Z A;  1KNR A;  1Y56 A;  4LA1 A;  3NT6 A;  4J2W A;  2ACZ A;  1NHQ A;  3DK8 A;  4GAP A;  2B7R A;  3SY4 A;  1YQ4 A;  1ZP0 A;  2YR6 A;  2VVM A;  3GD4 A;  3T2Y A;  1E6E A;  1H7X A;  3AWI A;  3OC4 A;  4NEV A;  2XVH A;  2A8X A;  2GRT A;  4GR1 A;  1GRB A;  3NYC A;  3AYI A;  3DH9 A;  4TM1 A;  2WU5 A;  3UKH A;  4H4R A;  2F5Z A;  2WP5 A;  3KD9 A;  2EQ9 A;  1N4V A;  4AP3 A;  4NNJ A;  4II2 A;  4EQR A;  1JOA A;  4U8O A;  2ZZ0 A;  3SM8 A;  3QSS A;  5TR3 A;  4RG3 A;  3ABV A;  4K8D A;  4LU6 A;  2BXS A;  1GRT A;  3RP8 A;  3CIR A;  4H7U A;  4YWO A;  3LZX A;  4EQW A;  4UDR A;  2BC1 A;  4U8N A;  3QVR A;  3KA7 A;  4I58 A;  2PHH A;  5HYM A;  5KXJ A;  1CJC A;  3PS9 A;  3ICS A;  4EM4 A;  4M52 A;  2C3C A;  2VRL A;  3D8X A;  4Z2U A;  3HYX A;  3I3L A;  1B4V A;  4H4S A;  1OJD A;  3CGD A;  1BWC A;  1Y56 B;  1ZK7 A;  3DA1 A;  4BJY A;  1TDE A;  1TDK A;  1GRH A;  4JNA A;  3GRS A;  1TYT A;  3KKJ A;  4FK1 C;  4U2L A;  5HHF A;  4JNQ A;  5KOW A;  4TM0 A;  4AOS A;  4K22 A;  3AE4 A;  4KX6 A;  3GMC A;  3Q9T A;  2X8H A;  2YG6 A;  4OPL A;  4B64 A;  2YG4 A;  3BI4 A;  2GMJ A;  4DSG A;  3GYI A;  2XVE A;  1FEA A;  1S2Y A;  2BAC A;  3GDN A;  3NIX A;  4DGK A;  4YSZ A;  3M0O A;  4H2P A;  3NYE A;  2V61 A;  1MXT A;  1EL9 A;  4GDE A;  2WU2 A;  4U8L A;  3T37 A;  4G6H A;  1DOB A;  3UOV A;  3UKA A;  3UKP A;  3RP6 A;  4TLZ A;  2WQY A;  1GRF A;  2JB3 A;  3KU9 A;  3L1R A;  2R45 A;  2WHD A;  1DOD A;  2BXR A;  2OAL A;  2WES A;  3NN0 X;  3R9U A;  1F3P A;  3NH3 X;  3NYF A;  2WBA A;  1RYI A;  3RP7 A;  2BA9 A;  1GRA A;  1PDH A;  3IWA A;  3QFB A;  4J34 A;  2YAU A;  4Y4N A;  3P4Q A;  4A6N B;  1OJA A;  2B76 A;  3AEA A;  3BHK A;  1ZDL A;  4JQ9 A;  2WDV A;  5J60 A;  1KFY A;  2BK4 A;  2BCG G;  1N4U A;  4USQ A;  4Z43 A;  3UKF A;  2RAB A;  3GWD A;  4P9S A;  3H8I A;  4YKF A;  5FS9 A;  5JCN A;  2C65 A;  2V60 A;  3KLJ A;  1ZKQ A;  5KMQ A;  1O95 A;  1X31 B;  4XWZ A;  4YSX A;  2C67 A;  3SZ0 A;  3SZC A;  2YR5 A;  4YKG A;  3EAN A;  1IUW A;  4JDR A;  2E1M A;  5M10 A;  1CJ2 A;  2Y6R A;  5FS7 A;  3UKQ A;  1BGJ A;  2Z5Y A;  3CND A;  2BK5 A;  3PO7 A;  4Z44 A;  2V3A A;  3HYW A;  4TM4 A;  3GWF A;  3GD3 A;  2XCG A;  3NHO X;  2Q0L A;  5U25 A;  1RSG A;  4C77 A;  3GDP A;  5CQF A;  3UKK A;  1NHP A;  4IA5 A;  1O5W A;  1N1P A;  3HZL A;  2EQ7 A;  2W0H A;  3BI2 A;  4B65 A;  4IV9 A;  1ZOY A;  2AAQ A;  4I59 A;  4USR A;  1FEB A;  1F8W A;  1L0V A;  2XVI A;  4YSY A;  3UTG A;  4X9M A;  3M13 A;  2YVJ A;  1FOH A;  2XLR A;  4APN A;  1RP0 A;  3GYX A;  1S3B A;  2WDR A;  1D4C A;  2YG7 A;  4G74 A;  4EQX A;  4FDC B;  1F8R A;  2WOV A;  1PBC A;  2C76 A;  4IA6 A;  3LAD A;  3F8D A;  2WS3 A;  3AE1 A;  3OZ2 A;  2CFY A;  4II3 A;  1S2Q A;  2OA1 A;  3AYL A;  4A99 A;  2GAG B;  2GQF A;  2NVK X;  4GUV A;  2IVE A;  5KOX A;  3UTE A;  4H2Q A;  1K0J A;  4B69 A;  4NTC A;  1PJ6 A;  2B9Y A;  4H4T A;  2TMD A;  2R4E A;  2VZ2 A;  2XFO A;  3JSK A;  5KVH A;  1IUV A;  2YLR A;  1GTH A;  1ONF A;  2R4J A;  4GF7 A;  1KSS A;  1E1M A;  3RED A;  1KNP A;  3AD9 B;  3FG2 P;  3IHG A;  4WCT A;  1EL8 A;  2B9W A;  3LB8 A;  2FJD A;  1LJ1 A;  2E4G A;  3CPH G;  1LPF A;  3NTA A;  2OLO A;  2GAH B;  4OPI A;  2WOI A;  4DSH A;  3GSI A;  5BVA A;  4B1B A;  1W4X A;  2AQJ A;  1TDF A;  1H7W A;  2BS3 A;  5FMH A;  3G5Q A;  2Q7V A;  3S61 A;  1CJ3 A;  1NEK A;  1DOC A;  2RGH A;  4CCR A;  3V3N A;  2YG5 A;  3AEF A;  3ALJ A;  1DNC A;  3AEE A;  4K5S A;  2C75 A;  1IUS A;  1E1K A;  3AXB A;  4UP3 A;  3UOX A;  2OAM A;  1D7L A;  1NDA A;  2GMH A;  2R46 A;  4U8I A;  3SZF A;  3VRA A;  1NPX A;  5JCK A;  1FEC A;  1VG9 A;  5C2T A;  2BRY A;  3LJP A;  3ZYX A;  4B67 A;  3P4P A;  4REK A;  2BRA A;  2XYO A;  3RHA A;  1KSU A;  1NG4 A;  2ARD A;  2RGO A;  1GET A;  2XLU A;  4IVM B;  4ZCD A;  1NEN A;  3DJE A;  2R0C A;  1BF3 A;  2XLT A;  1K0L A;  3CNS A;  4ZN0 A;  3AEG A;  2YWL A;  3KPF A;  2QAE A;  1BZL A;  3UOZ A;  3ALL A;  1H82 A;  1AOG A;  5KMP A;  3PVC A;  4B63 A;  1QJD A;  3IC9 A;  5BUL A;  3SXI A;  1XAN A;  3EAO A;  1CBO A;  4H4X A;  5HXI A;  4C74 A;  3CGE A;  1PXB A;  3UKL A;  3SQP A;  4ZCC A;  1GTE A;  1XHC A;  1GND A;  4PAB A;  1YQ3 A;  3AD7 B;  4TM3 A;  2C4C A;  5U63 A;  4CY8 A;  2VVL G;  1JRY A;  3K7Q X;  3QJ4 A;  3VQR A;  4EIP A;  4J36 A;  5EB4 A;  2WOW A;  3P1W A;  1UKV G;  4H4U A;  4G73 A;  2JK6 A;  3K7T A;  1LTX R;  3HYV A;  1CHU A;  1ZOV A;  4MJW A;  3ITJ A;  4GCM A;  1JRZ A;  5DBJ A;  4Z26 A;  2JB2 A;  3AEB A;  1PHH A;  2H89 A;  2XLP A;  3ICT A;  4CRT A;  3F8R A;  2VVL A;  1GEU A;  1IJH A;  3BNU A;  3EPT A;  4U2T A;  2BAB A;  2XFU A;  4H2R A;  2XLS A;  3AD8 B;  1GRE A;  2C72 A;  2GR3 A;  1B8S A;  3II4 A;  4A79 A;  2V5Z A;  4IVO B;  5IPY A;  4CBQ A;  1MO9 A;  2A87 A;  2BC0 A;  4B66 A;  4EIQ A;  1EBD A;  1GER A;  1PBD A;  3BHF A;  1CC4 A;  3DME A;  1Q1R A;  1VG0 A;  3V76 A;  4RG4 A;  1FL2 A;  4C5O A;  5FS6 A;  3AE6 A;  5KMR A;  4NWZ A;  3VRB A;  5ER0 A;  2X3N A;  3SYI A;  2BS2 A;  2QCU A;  3IF9 A;  4H4V A;  3T0K A;  4TLX A;  2I0Z A;  2V6O A;  1GAL A;  1KF6 A;  2WP9 A;  2YM1 A;  4DNA A;  2WDQ A;  5BRT A;  4C3X A;  1B37 A;  2PYX A;  3AB1 A;  4FK1 A;  1NG3 A;  1ZY8 A;  1GT8 A;  3E1T A;  4AT2 A;  1QLB A;  2HQM A;  5HY5 A;  5EBK A;  2YG3 A;  1GV4 A;  5IQ4 A;  5JCI A;  1EL7 A;  1PBF A;  4X4J A;  1Y0P A;  2YM2 A;  1BKW A;  4U8M A;  1OJT A;  1PS9 A;  3NKS A;  2R0P A;  1LQU A;  4O5U A;  4OPG A;  3SX6 A;  4BUR A;  1LVL A;  4JN9 A;  3NG7 X;  1IUT A;  5KNL A;  4EMJ A;  3B6D A;  3URH A;  1P2H A;  1VQW A;  4HA6 A;  2VQ7 A;  3LXD A;  3CGC A;  3G5S A;  3CMM A;  2O9Z A;  1H86 A;  1DJQ A;  3P4R A;  3BI5 A;  3T31 A;  2XDO A;  1K0I A;  5KRQ A;  1CJ4 A;  1GES A;  3CTY A;  3CGB A;  3NTD A;  4XXG A;  3AE2 A;  3NN6 X;  3ALM A;  3C4A A;  3FBS A;  5GRT A;  3UP4 A;  2BS4 A;  1H83 A;  2Q6U A;  2VOU A;  4K5R A;  1PBE A;  3F8P A;  2FJA A;  2BCP A;  4GDP A;  2QA2 A;  2JAE A;  4Y4M A;  1Q9I A;  1EL5 A;  4ADW A;  2YLS A;  5JCM A;  4EMW A;  5FS8 A;  3NNE A;  3IHM A;  1DJN A;  2C66 A;  4H4Z A;  5L46 A;  5U1O A;  3GMB A;  4YTN A;  3UTF A;  2GH5 A;  3NRN A;  1CC6 A;  1KDG A;  4UDP A;  2C64 A;  2H88 A;  2WET A;  3CNJ A;  1LV0 A;  4JY2 A;  3QSE A;  1NHR A;  1OJC A;  3C96 A;  4OPD A;  2R0G A;  2GB0 A;  2YR4 A;  2EQ6 A;  1FCD A;  1GXF A;  1PN0 A;  2BYB A;  2CUL A;  4NEW A;  3AEC A;  4CY6 A;  1TYP A;  2EQ8 A;  4YTM A;  2FJB A;  3NK1 X;  3C4N A;  4YTP A;  5LV9 A;  4XWR A;  1M6I A;  4G6G A;  4YT0 A;  2DKI A;  1ELI A;  4ICY A;  3WE0 A;  4AT0 A;  4E0V A;  1SEZ A;  3L8K A;  5JCL A;  4H4Q A;  1LQT A;  3AED A;  3DK4 A;  4OCG A;  3LOV A;  1ZX9 A;  1V59 A;  2YVG A;  1Z6L A;  2BK3 A;  2YVF A;  4GRT A;  1D4D A;  2UZZ A;  2JKC A;  2YLT A;  5M0Z A;  3FPZ A;  4AP1 A;  4Z2R A;  3H4K A;  2C7G A;  4OPC A;  1Q1W A;  2WPF A;  1S3E A;  2XVF A;  2ZZB A;  3UOY A;  3CPI G;  1F6M A;  3DJJ A;  2ZBW A;  3M12 A;  4NZH A;  3UP5 A;  1IUU A;  3VR8 A;  3D1C A;  4YXD A;  1P2E A;  2GV8 A;  1H81 A;  4OPT A;  4EQS A;  1IUX A;  4J33 A;  3AE8 A;  2Z5X A;  1O94 A;  1PXA A;  2IID A;  1OJ9 A;  2IVD A;  4H4W A;  4NTE A;  3RNM A;  3EF6 A;  4AOX A;  4A5L A;  4A6N A;  5KMS A;  2Q0K A;  1K4Q A;  2VRM A;  3K7M X;  2YLX A;  3AYJ A;  3UTH A;  4CNJ A;  1GPE A;  2VQB A;  2A89 A;  1JNZ A;  4ECH A;  1L9E A;  4H4P A;  2Y6Q A;  1D4E A;  3GRT A;  3AE7 A;  4YSH A;  4H4Y A;  5C3J A;  3DGH A;  3Q6J A;  2GQW A;  2WPE A;  2WPC A;  3KVE A;  2NPX A;  4BK3 A;  1ZMD A;  1L9C A;  2FJE A;  3CPJ G;  3O0H A;  1E7P A;  3ADA B;  2WP6 A;  4A65 A;  2JB1 A;  2JBV A;  3ATQ A;  1D5T A;  1VDC A;  2GF3 A;  5GSN A;  4EMI A;  2AR8 A;  4X9N A;  3SZW A;  3VRD B;  1YY5 A;  1REO A;  1VRQ B;  1ZMC A;  4OVI A;  1COY A;  1DOE A;  3T2K A;  2WEU A;  3AE9 A;  3FMW A;  5CKU A;  4PAA A;  3GYJ A;  3ZDN A;  2YQU A;  3SFD A;  1E39 A;  3UCL A;  4B68 A;  2J3N A;  1GOS A;  4UDQ A;  4RSL A;  2XVJ A;  2C70 A;  1CF3 A;  3CNP A;  5BUK A;  1L9D A;  5IQ1 A;  3ICR A;  4BK1 A;  2X8C A;  1JRX A;  1H84 A;  1MOK A;  1DXL A;  5KVI A;  1B5Q A;  3AE3 A;  2CDU A;  2OLN A;  3QSM A;  2X8G A;  1YKJ A;  2GR0 A;  5EOW A;  4CCQ A;  4OPU A;  2GVC A;  1PJ5 A;  2RGJ A;  2YLW A;  3FIM B;  5EB5 A;  2TPR A;  3SGL A;  1TRB A;  1E1L A;  2CVJ A;  2XFQ A;  4J57 A;  4C3Y A;  4U8J A;  1JU2 A;  3T14 A;  4BV6 A;  4CNK A;  4G9K A;  4J56 A;  3H8L A;  3B3R A;  5J7X A;  1TDN A;  4BK2 A;  1CC2 A;  4J31 A;  4U8P A;  4JY3 A;  4Z25 A;  2DKH A;  1PXC A;  2APG A;  3COX A;  4D04 A;  3CN8 A;  2XFP A;  1BGN A;  1GSN A;  1JEH A;  3DJG X;  1M64 A;  3G5R A;  1YQZ A;  4WX1 A;  3DJD A;  2X99 A;  1GRG A;  3VR9 A;  2V3B A;  2XFN A;  2YLZ A;  1NHS A;  3BNM A;  4NTD A;  3V3O A;  4BJZ A;  3SFE A;  1N4W A;  1D7Y A; 
#chains in the Genus database with same CATH homology
 2GR2 A;  3NGC X;  3AE5 A;  2ZZC A;  3QVP A;  2QA1 A;  3ISH A;  1PBB A;  4H50 A;  4LII A;  4Z24 A;  3LZW A;  1E1N A;  1F8S A;  2B7S A;  1HYU A;  2B9X A;  1NAA A;  3CNT A;  1TDO A;  4U2S A;  3S5W A;  4GAV A;  3NK2 X;  3NLC A;  4N9X A;  2GR1 A;  3I6D A;  2X50 A;  4U8K A;  2C3D A;  2GEW A;  3KPK A;  3QFA A;  4Z2T A;  5KWF A;  4KPR A;  4A7A A;  3DK9 A;  3P4S A;  1H6V A;  1QO8 A;  4FX9 A;  1JNR A;  1XPQ A;  2FBW A;  3P9U A;  3DGZ A;  1CL0 A;  2C73 A;  4D03 A;  4EM3 A;  4Y4L A;  3ATR A;  3K30 A;  1PJ7 A;  4O5Q A;  3NK0 X;  1XDI A;  4K2X A;  2R9Z A;  4HB9 A;  4K7Z A;  2E5V A;  4A9W A;  4H2N A;  3T2Z A;  1KNR A;  1Y56 A;  4LA1 A;  3NT6 A;  4J2W A;  2ACZ A;  1NHQ A;  3DK8 A;  4GAP A;  2B7R A;  3SY4 A;  1YQ4 A;  1ZP0 A;  2YR6 A;  2VVM A;  3GD4 A;  3T2Y A;  1E6E A;  1H7X A;  3AWI A;  3OC4 A;  4NEV A;  2XVH A;  2A8X A;  2GRT A;  4GR1 A;  1GRB A;  3NYC A;  3AYI A;  3DH9 A;  4TM1 A;  2WU5 A;  3UKH A;  4H4R A;  2F5Z A;  2WP5 A;  3KD9 A;  2EQ9 A;  1N4V A;  4AP3 A;  4NNJ A;  4II2 A;  4EQR A;  1JOA A;  4U8O A;  2ZZ0 A;  3SM8 A;  3QSS A;  5TR3 A;  4RG3 A;  3ABV A;  4K8D A;  4LU6 A;  2BXS A;  1GRT A;  3RP8 A;  3CIR A;  4H7U A;  4YWO A;  3LZX A;  4EQW A;  4UDR A;  2BC1 A;  4U8N A;  3QVR A;  3KA7 A;  4I58 A;  2PHH A;  5HYM A;  5KXJ A;  1CJC A;  3PS9 A;  3ICS A;  4EM4 A;  4M52 A;  2C3C A;  2VRL A;  3D8X A;  4Z2U A;  3HYX A;  3I3L A;  1B4V A;  4H4S A;  1OJD A;  3CGD A;  1BWC A;  1Y56 B;  1ZK7 A;  3DA1 A;  4BJY A;  1TDE A;  1TDK A;  1GRH A;  4JNA A;  3GRS A;  1TYT A;  3KKJ A;  4FK1 C;  4U2L A;  5HHF A;  4JNQ A;  5KOW A;  4TM0 A;  4AOS A;  4K22 A;  3AE4 A;  4KX6 A;  3GMC A;  3Q9T A;  2X8H A;  2YG6 A;  4OPL A;  4B64 A;  2YG4 A;  3BI4 A;  2GMJ A;  4DSG A;  3GYI A;  2XVE A;  1FEA A;  1S2Y A;  2BAC A;  3GDN A;  3NIX A;  4DGK A;  4YSZ A;  3M0O A;  4H2P A;  3NYE A;  2V61 A;  1MXT A;  1EL9 A;  4GDE A;  2WU2 A;  4U8L A;  3T37 A;  4G6H A;  1DOB A;  3UOV A;  3UKA A;  3UKP A;  3RP6 A;  4TLZ A;  2WQY A;  1GRF A;  2JB3 A;  3KU9 A;  3L1R A;  2R45 A;  2WHD A;  1DOD A;  2BXR A;  2OAL A;  2WES A;  3NN0 X;  3R9U A;  1F3P A;  3NH3 X;  3NYF A;  2WBA A;  1RYI A;  3RP7 A;  2BA9 A;  1GRA A;  1PDH A;  3IWA A;  3QFB A;  4J34 A;  2YAU A;  4Y4N A;  3P4Q A;  4A6N B;  1OJA A;  2B76 A;  3AEA A;  3BHK A;  1ZDL A;  4JQ9 A;  2WDV A;  5J60 A;  1KFY A;  2BK4 A;  2BCG G;  1N4U A;  4USQ A;  4Z43 A;  3UKF A;  2RAB A;  3GWD A;  4P9S A;  3H8I A;  4YKF A;  5FS9 A;  5JCN A;  2C65 A;  2V60 A;  3KLJ A;  1ZKQ A;  5KMQ A;  1O95 A;  1X31 B;  4XWZ A;  4YSX A;  2C67 A;  3SZ0 A;  3SZC A;  2YR5 A;  4YKG A;  3EAN A;  1IUW A;  4JDR A;  2E1M A;  5M10 A;  1CJ2 A;  2Y6R A;  5FS7 A;  3UKQ A;  1BGJ A;  2Z5Y A;  3CND A;  2BK5 A;  3PO7 A;  4Z44 A;  2V3A A;  3HYW A;  4TM4 A;  3GWF A;  3GD3 A;  2XCG A;  3NHO X;  2Q0L A;  5U25 A;  1RSG A;  4C77 A;  3GDP A;  5CQF A;  3UKK A;  1NHP A;  4IA5 A;  1O5W A;  1N1P A;  3HZL A;  2EQ7 A;  2W0H A;  3BI2 A;  4B65 A;  4IV9 A;  1ZOY A;  2AAQ A;  4I59 A;  4USR A;  1FEB A;  1F8W A;  1L0V A;  2XVI A;  4YSY A;  3UTG A;  4X9M A;  3M13 A;  2YVJ A;  1FOH A;  2XLR A;  4APN A;  1RP0 A;  3GYX A;  1S3B A;  2WDR A;  1D4C A;  2YG7 A;  4G74 A;  4EQX A;  4FDC B;  1F8R A;  2WOV A;  1PBC A;  2C76 A;  4IA6 A;  3LAD A;  3F8D A;  2WS3 A;  3AE1 A;  3OZ2 A;  2CFY A;  4II3 A;  1S2Q A;  2OA1 A;  3AYL A;  4A99 A;  2GAG B;  2GQF A;  2NVK X;  4GUV A;  2IVE A;  5KOX A;  3UTE A;  4H2Q A;  1K0J A;  4B69 A;  4NTC A;  1PJ6 A;  2B9Y A;  4H4T A;  2TMD A;  2R4E A;  2VZ2 A;  2XFO A;  3JSK A;  5KVH A;  1IUV A;  2YLR A;  1GTH A;  1ONF A;  2R4J A;  4GF7 A;  1KSS A;  1E1M A;  3RED A;  1KNP A;  3AD9 B;  3FG2 P;  3IHG A;  4WCT A;  1EL8 A;  2B9W A;  3LB8 A;  2FJD A;  1LJ1 A;  2E4G A;  3CPH G;  1LPF A;  3NTA A;  2OLO A;  2GAH B;  4OPI A;  2WOI A;  4DSH A;  3GSI A;  5BVA A;  4B1B A;  1W4X A;  2AQJ A;  1TDF A;  1H7W A;  2BS3 A;  5FMH A;  3G5Q A;  2Q7V A;  3S61 A;  1CJ3 A;  1NEK A;  1DOC A;  2RGH A;  4CCR A;  3V3N A;  2YG5 A;  3AEF A;  3ALJ A;  1DNC A;  3AEE A;  4K5S A;  2C75 A;  1IUS A;  1E1K A;  3AXB A;  4UP3 A;  3UOX A;  2OAM A;  1D7L A;  1NDA A;  2GMH A;  2R46 A;  4U8I A;  3SZF A;  3VRA A;  1NPX A;  5JCK A;  1FEC A;  1VG9 A;  5C2T A;  2BRY A;  3LJP A;  3ZYX A;  4B67 A;  3P4P A;  4REK A;  2BRA A;  2XYO A;  3RHA A;  1KSU A;  1NG4 A;  2ARD A;  2RGO A;  1GET A;  2XLU A;  4IVM B;  4ZCD A;  1NEN A;  3DJE A;  2R0C A;  1BF3 A;  2XLT A;  1K0L A;  3CNS A;  4ZN0 A;  3AEG A;  2YWL A;  3KPF A;  2QAE A;  1BZL A;  3UOZ A;  3ALL A;  1H82 A;  1AOG A;  5KMP A;  3PVC A;  4B63 A;  1QJD A;  3IC9 A;  5BUL A;  3SXI A;  1XAN A;  3EAO A;  1CBO A;  4H4X A;  5HXI A;  4C74 A;  3CGE A;  1PXB A;  3UKL A;  3SQP A;  4ZCC A;  1GTE A;  1XHC A;  1GND A;  4PAB A;  1YQ3 A;  3AD7 B;  4TM3 A;  2C4C A;  5U63 A;  4CY8 A;  2VVL G;  1JRY A;  3K7Q X;  3QJ4 A;  3VQR A;  4EIP A;  4J36 A;  5EB4 A;  2WOW A;  3P1W A;  1UKV G;  4H4U A;  4G73 A;  2JK6 A;  3K7T A;  1LTX R;  3HYV A;  1CHU A;  1ZOV A;  4MJW A;  3ITJ A;  4GCM A;  1JRZ A;  5DBJ A;  4Z26 A;  2JB2 A;  3AEB A;  1PHH A;  2H89 A;  2XLP A;  3ICT A;  4CRT A;  3F8R A;  2VVL A;  1GEU A;  1IJH A;  3BNU A;  3EPT A;  4U2T A;  2BAB A;  2XFU A;  4H2R A;  2XLS A;  3AD8 B;  1GRE A;  2C72 A;  2GR3 A;  1B8S A;  3II4 A;  4A79 A;  2V5Z A;  4IVO B;  5IPY A;  4CBQ A;  1MO9 A;  2A87 A;  2BC0 A;  4B66 A;  4EIQ A;  1EBD A;  1GER A;  1PBD A;  3BHF A;  1CC4 A;  3DME A;  1Q1R A;  1VG0 A;  3V76 A;  4RG4 A;  1FL2 A;  4C5O A;  5FS6 A;  3AE6 A;  5KMR A;  4NWZ A;  3VRB A;  5ER0 A;  2X3N A;  3SYI A;  2BS2 A;  2QCU A;  3IF9 A;  4H4V A;  3T0K A;  4TLX A;  2I0Z A;  2V6O A;  1GAL A;  1KF6 A;  2WP9 A;  2YM1 A;  4DNA A;  2WDQ A;  5BRT A;  4C3X A;  1B37 A;  2PYX A;  3AB1 A;  4FK1 A;  1NG3 A;  1ZY8 A;  1GT8 A;  3E1T A;  4AT2 A;  1QLB A;  2HQM A;  5HY5 A;  5EBK A;  2YG3 A;  1GV4 A;  5IQ4 A;  5JCI A;  1EL7 A;  1PBF A;  4X4J A;  1Y0P A;  2YM2 A;  1BKW A;  4U8M A;  1OJT A;  1PS9 A;  3NKS A;  2R0P A;  1LQU A;  4O5U A;  4OPG A;  3SX6 A;  4BUR A;  1LVL A;  4JN9 A;  3NG7 X;  1IUT A;  5KNL A;  4EMJ A;  3B6D A;  3URH A;  1P2H A;  1VQW A;  4HA6 A;  2VQ7 A;  3LXD A;  3CGC A;  3G5S A;  3CMM A;  2O9Z A;  1H86 A;  1DJQ A;  3P4R A;  3BI5 A;  3T31 A;  2XDO A;  1K0I A;  5KRQ A;  1CJ4 A;  1GES A;  3CTY A;  3CGB A;  3NTD A;  4XXG A;  3AE2 A;  3NN6 X;  3ALM A;  3C4A A;  3FBS A;  5GRT A;  3UP4 A;  2BS4 A;  1H83 A;  2Q6U A;  2VOU A;  4K5R A;  1PBE A;  3F8P A;  2FJA A;  2BCP A;  4GDP A;  2QA2 A;  2JAE A;  4Y4M A;  1Q9I A;  1EL5 A;  4ADW A;  2YLS A;  5JCM A;  4EMW A;  5FS8 A;  3NNE A;  3IHM A;  1DJN A;  2C66 A;  4H4Z A;  5L46 A;  5U1O A;  3GMB A;  4YTN A;  3UTF A;  2GH5 A;  3NRN A;  1CC6 A;  1KDG A;  4UDP A;  2C64 A;  2H88 A;  2WET A;  3CNJ A;  1LV0 A;  4JY2 A;  3QSE A;  1NHR A;  1OJC A;  3C96 A;  4OPD A;  2R0G A;  2GB0 A;  2YR4 A;  2EQ6 A;  1FCD A;  1GXF A;  1PN0 A;  2BYB A;  2CUL A;  4NEW A;  3AEC A;  4CY6 A;  1TYP A;  2EQ8 A;  4YTM A;  2FJB A;  3NK1 X;  3C4N A;  4YTP A;  5LV9 A;  4XWR A;  1M6I A;  4G6G A;  4YT0 A;  2DKI A;  1ELI A;  4ICY A;  3WE0 A;  4AT0 A;  4E0V A;  1SEZ A;  3L8K A;  5JCL A;  4H4Q A;  1LQT A;  3AED A;  3DK4 A;  4OCG A;  3LOV A;  1ZX9 A;  1V59 A;  2YVG A;  1Z6L A;  2BK3 A;  2YVF A;  4GRT A;  1D4D A;  2UZZ A;  2JKC A;  2YLT A;  5M0Z A;  3FPZ A;  4AP1 A;  4Z2R A;  3H4K A;  2C7G A;  4OPC A;  1Q1W A;  2WPF A;  1S3E A;  2XVF A;  2ZZB A;  3UOY A;  3CPI G;  1F6M A;  3DJJ A;  2ZBW A;  3M12 A;  4NZH A;  3UP5 A;  1IUU A;  3VR8 A;  3D1C A;  4YXD A;  1P2E A;  2GV8 A;  1H81 A;  4OPT A;  4EQS A;  1IUX A;  4J33 A;  3AE8 A;  2Z5X A;  1O94 A;  1PXA A;  2IID A;  1OJ9 A;  2IVD A;  4H4W A;  4NTE A;  3RNM A;  3EF6 A;  4AOX A;  4A5L A;  4A6N A;  5KMS A;  2Q0K A;  1K4Q A;  2VRM A;  3K7M X;  2YLX A;  3AYJ A;  3UTH A;  4CNJ A;  1GPE A;  2VQB A;  2A89 A;  1JNZ A;  4ECH A;  1L9E A;  4H4P A;  2Y6Q A;  1D4E A;  3GRT A;  3AE7 A;  4YSH A;  4H4Y A;  5C3J A;  3DGH A;  3Q6J A;  2GQW A;  2WPE A;  2WPC A;  3KVE A;  2NPX A;  4BK3 A;  1ZMD A;  1L9C A;  2FJE A;  3CPJ G;  3O0H A;  1E7P A;  3ADA B;  2WP6 A;  4A65 A;  2JB1 A;  2JBV A;  3ATQ A;  1D5T A;  1VDC A;  2GF3 A;  5GSN A;  4EMI A;  2AR8 A;  4X9N A;  3SZW A;  3VRD B;  1YY5 A;  1REO A;  1VRQ B;  1ZMC A;  4OVI A;  1COY A;  1DOE A;  3T2K A;  2WEU A;  3AE9 A;  3FMW A;  5CKU A;  4PAA A;  3GYJ A;  3ZDN A;  2YQU A;  3SFD A;  1E39 A;  3UCL A;  4B68 A;  2J3N A;  1GOS A;  4UDQ A;  4RSL A;  2XVJ A;  2C70 A;  1CF3 A;  3CNP A;  5BUK A;  1L9D A;  5IQ1 A;  3ICR A;  4BK1 A;  2X8C A;  1JRX A;  1H84 A;  1MOK A;  1DXL A;  5KVI A;  1B5Q A;  3AE3 A;  2CDU A;  2OLN A;  3QSM A;  2X8G A;  1YKJ A;  2GR0 A;  5EOW A;  4CCQ A;  4OPU A;  2GVC A;  1PJ5 A;  2RGJ A;  2YLW A;  3FIM B;  5EB5 A;  2TPR A;  3SGL A;  1TRB A;  1E1L A;  2CVJ A;  2XFQ A;  4J57 A;  4C3Y A;  4U8J A;  1JU2 A;  3T14 A;  4BV6 A;  4CNK A;  4G9K A;  4J56 A;  3H8L A;  3B3R A;  5J7X A;  1TDN A;  4BK2 A;  1CC2 A;  4J31 A;  4U8P A;  4JY3 A;  4Z25 A;  2DKH A;  1PXC A;  2APG A;  3COX A;  4D04 A;  3CN8 A;  2XFP A;  1BGN A;  1GSN A;  1JEH A;  3DJG X;  1M64 A;  3G5R A;  1YQZ A;  4WX1 A;  3DJD A;  2X99 A;  1GRG A;  3VR9 A;  2V3B A;  2XFN A;  2YLZ A;  1NHS A;  3BNM A;  4NTD A;  3V3O A;  4BJZ A;  3SFE A;  1N4W A;  1D7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...