3R9UA

Thioredoxin-disulfide reductase from campylobacter jejuni.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
314
structure length
314
Chain Sequence
SNAMLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKDGSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
publication title Thioredoxin-disulfide reductase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
total genus 86
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA02
4NTDA 1XPQA 4EMIA 3EF6A 1DJQA 4BJZA 1D7YA 2C64A 1ZMDA 4B64A 2YLXA 3DH9A 5EB4A 3AYIA 4IV9A 4GDEA 4GUVA 1ZMCA 1SEZA 2RGHA 3CPHG 3DK9A 3NH3X 1CF3A 1CC6A 2FJDA 3ZDNA 5JCNA 4J36A 1PDHA 4AT0A 2YG5A 5KRQA 3F8RA 2BXSA 4BURA 4FX9A 5LV9A 4TM4A 3NTDA 1DNCA 5TR3A 4B68A 1VRQB 4GF7A 2VRMA 1VG9A 2BYBA 2VZ2A 2YLRA 2YR4A 2ZZCA 3P1WA 1YKJA 4UP3A 5JCMA 4H4UA 2YLWA 3NYCA 2X50A 3AEGA 3NNEA 4U2LA 3AE7A 3NTAA 3G5QA 1GPEA 4AT2A 2RGOA 3AEBA 4YKFA 5M0ZA 2GB0A 1N1PA 2WP9A 2XYOA 1KF6A 1PJ5A 3GMCA 2XVEA 3VR8A 4ADWA 2C65A 1DOBA 3GWFA 3FIMB 2BCGG 4WX1A 1FOHA 2WPEA 4BK2A 5JCKA 3P4PA 2BS4A 3RP8A 4ZN0A 3CPIG 1D5TA 5KVHA 1IUWA 4AP1A 2BK4A 5HY5A 4NTEA 3B6DA 3CPJG 1TDFA 1DJNA 1PJ7A 4U2TA 1NENA 4PAAA 1GTEA 1Z6LA 3NT6A 4IVMB 4C3YA 1GRHA 1JRXA 3UTHA 2X8GA 3AYJA 4OCGA 2WP6A 3IC9A 1KFYA 1GRBA 5KVIA 2PYXA 3AE5A 1IUUA 2XVIA 4A5LA 1GSNA 2XDOA 4OPCA 3QJ4A 3PO7A 1FCDA 1GNDA 2C73A 2WDQA 2X99A 4Z26A 2YR5A 4B66A 2OAMA 3F8PA 2VRLA 1JU2A 1YQ4A 1OJTA 2A8XA 1PJ6A 3AE4A 4A9WA 2XFUA 4Y4NA 4RG4A 2VOUA 4Y4MA 3QSMA 1PN0A 1LQTA 4H2RA 3GDPA 1UKVG 2ZZ0A 4H2NA 4JQ9A 4RG3A 3GSIA 3UKFA 1K4QA 3NYEA 4Z25A 3VRAA 3ITJA 3DK8A 4UDRA 1GRAA 4HA6A 4B1BA 3UCLA 2GQFA 2Z5XA 1JEHA 2YM1A 4A65A 2BC1A 4BK3A 1PXAA 2B9WA 4A7AA 4DSGA 2A89A 4JY2A 1Y56B 5U63A 1GEUA 2EQ6A 4CY6A 1PBBA 3NHOX 1H83A 4BK1A 2B76A 4E0VA 2VQ7A 4Z2UA 1NHSA 1IUXA 2XLTA 4UDPA 4YSZA 2X3NA 4EMWA 3P4SA 5IPYA 1GESA 1EL8A 1H7WA 1DXLA 3UKKA 4C3XA 1B5QA 1CC2A 3CGCA 4H4SA 3IHGA 3HZLA 4JDRA 2OALA 3QSEA 5IQ1A 1F3PA 3BI5A 2XFOA 3RNMA 3AE8A 4YTNA 1GETA 3II4A 4TLZA 5J7XA 4OPLA 2YR6A 3V3OA 5KWFA 2CVJA 4H4WA 2O9ZA 3QVRA 4YT0A 1KNRA 1TDOA 2E1MA 3DGHA 1H84A 1YQZA 4Z43A 2JK6A 2YG3A 3NK2X 3BNMA 1LTXR 2XVJA 2XVHA 2BA9A 2WP5A 1N4UA 1ZOVA 2FJBA 4DNAA 3KLJA 2XFPA 3QFAA 3GMBA 4GRTA 2AQJA 3GWDA 3NLCA 3QVPA 4B69A 2V60A 1CBOA 1GRTA 3M0OA 4Z2RA 1ZK7A 1NG3A 3C4AA 3UP4A 2QA2A 2GRTA 3ZYXA 1IUSA 2DKIA 2X8CA 4N9XA 1LQUA 4K5SA 1BKWA 1S2YA 1QLBA 2GR3A 3I6DA 5CKUA 4CNKA 1RP0A 4NEWA 2HQMA 1PXBA 2WPCA 4YWOA 1ZDLA 3T37A 4B67A 2F5ZA 1GRGA 2WOWA 4H4XA 4TM1A 1VQWA 2XVFA 2OA1A 2TMDA 4JY3A 1M6IA 1ZX9A 2V5ZA 1W4XA 2YVGA 3ICTA 1RSGA 3RHAA 2YLZA 2OLOA 4IA5A 1FEAA 2BK3A 3AECA 4YKGA 3L1RA 3GDNA 4KPRA 4U8JA 2ZZBA 3CNJA 1Q1RA 1BGNA 4J57A 4TM0A 2H89A 4NEVA 3UKPA 3KA7A 3UP5A 3DA1A 5EOWA 3S5WA 3LXDA 3UOYA 2YLSA 4CNJA 1S2QA 3F8DA 1L9EA 5JCIA 1CHUA 2WU2A 2R4EA 4GDPA 2GR2A 2YG7A 3CGBA 4GR1A 1ZOYA 1GT8A 2JB1A 4IA6A 1TDNA 4MJWA 5ER0A 3REDA 1B8SA 1CJ2A 1EBDA 2VVLG 2WEUA 2WOIA 3M12A 4LIIA 3NIXA 2VVMA 2PHHA 2R0GA 3VQRA 4RSLA 4REKA 1PBDA 3AXBA 4JN9A 4X9NA 1MO9A 3L8KA 1D7LA 2DKHA 4C77A 1RYIA 2GH5A 3ATRA 2C76A 5BRTA 1TYTA 1GERA 3D1CA 3NK0X 4U8LA 1QO8A 2YG6A 5FMHA 3UOZA 2W0HA 4FK1C 1XHCA 2Q6UA 3AEDA 2WBAA 3FPZA 4PABA 5KOWA 4U2SA 4Z2TA 3CTYA 3GYJA 3M13A 2JB2A 3NG7X 2WOVA 4H4VA 1YQ3A 4O5UA 4XWRA 4M52A 3UOVA 3DJEA 3KD9A 3SM8A 2ACZA 3I3LA 2R9ZA 4A6NB 4JNAA 1JRZA 5C3JA 5GRTA 2C75A 4U8PA 3SQPA 1PBEA 3UKQA 5FS7A 2GEWA 1F8WA 1GREA 2WESA 3ALMA 1JRYA 2C72A 4C74A 1VG0A 1IUTA 1H6VA 2XFNA 2Q0KA 4AP3A 3ABVA 4H4YA 3CIRA 1NHPA 5EBKA 1JNRA 3SFDA 3AEAA 2GV8A 3QSSA 4AOXA 2C7GA 3K30A 1DODA 2C67A 1COYA 2QCUA 2GAGB 1NHQA 3CNPA 4TM3A 2NVKX 5C2TA 3CNSA 3AEFA 2Q7VA 2XFQA 3DJJA 5U25A 1P2HA 2CFYA 1MOKA 1NHRA 2AR8A 2BK5A 1PHHA 2I0ZA 2JKCA 3OZ2A 4J56A 3UOXA 3AE1A 4JNQA 4D04A 4DGKA 1EL9A 3H8IA 1H86A 2EQ9A 4IVOB 2WQYA 4YTMA 3ADAB 3R9UA 4EQXA 5FS6A 1AOGA 2BXRA 1OJ9A 2IIDA 3JSKA 1H81A 3LJPA 4O5QA 1BF3A 1DOCA 3COXA 3KPFA 5KXJA 1E6EA 2E5VA 4LA1A 3BNUA 1E1NA 3AD8B 1EL5A 3IWAA 3AE3A 4B63A 3E1TA 3DJGX 3EPTA 1B37A 1N4VA 4Y4LA 2GAHB 2XLRA 1F8SA 3DK4A 1NAAA 2VQBA 3ICSA 3H8LA 3ISHA 2A87A 1K0JA 4UDQA 1KNPA 2V3AA 2C70A 3S61A 1NPXA 1EL7A 2FJAA 1LVLA 3BHKA 3ICRA 5CQFA 4OPDA 1ZKQA 3NYFA 2Z5YA 2V61A 4YSHA 4H2QA 1XDIA 4ICYA 4EQRA 4K2XA 1O5WA 2AAQA 2B9YA 4LU6A 4BJYA 1FECA 2BS3A 2WDRA 4OPUA 4HB9A 2YQUA 3EAOA 1ONFA 3GYIA 4CY8A 2IVEA 1GOSA 1H82A 2FBWA 2JB3A 3Q9TA 1PBCA 1GXFA 1F8RA 1CJCA 4U8MA 4H7UA 1B4VA 5L46A 2CDUA 1OJAA 4I59A 4K8DA 1K0LA 3CGDA 4H4ZA 2BS2A 2QAEA 2YVJA 1O94A 2WU5A 3UTEA 4KX6A 1LV0A 1P2EA 3QFBA 5U1OA 1NEKA 4ZCDA 3RP7A 3NN6X 5FS9A 3FMWA 3V76A 2JBVA 1REOA 3KKJA 4C5OA 4X4JA 2RABA 3V3NA 1FL2A 2B7SA 1D4DA 4H4PA 1OJDA 1TDKA 4NZHA 3B3RA 4APNA 3O0HA 3IHMA 2Y6RA 3P9UA 3K7QX 4EM4A 5BUKA 5JCLA 2GR0A 3G5RA 3KU9A 3GRTA 4OPGA 1E1LA 3NRNA 2VVLA 5KOXA 4U8KA 1PBFA 2BC0A 3NKSA 2WPFA 2XLSA 4YSYA 1F6MA 1LJ1A 2C3CA 3H4KA 3C96A 3AEEA 3BHFA 3AE9A 4FK1A 1GV4A 5HXIA 2BACA 1NG4A 4OVIA 1BWCA 3EANA 2R46A 4H4RA 3AD7B 2GF3A 3CGEA 1KSSA 3LOVA 4X9MA 2ARDA 2C3DA 3GRSA 5GSNA 4CRTA 2WETA 1JNZA 2YAUA 2ZBWA 3D8XA 1CJ3A 1E39A 1H7XA 1TDEA 4OPTA 2E4GA 5BVAA 1FEBA 5EB5A 2EQ7A 3SFEA 1V59A 2V6OA 4EQSA 2UZZA 4A79A 2WDVA 1DOEA 2X8HA 2QA1A 1X31B 4OPIA 3OC4A 4WCTA 1ELIA 1KSUA 1Y0PA 4Z44A 2R0CA 2GVCA 2C66A 2GMJA 1E1KA 3LZXA 3ALJA 4I58A 1Q1WA 4FDCB 5BULA 4D03A 4B65A 5DBJA 3AE2A 2APGA 4A6NA 2WHDA 5FS8A 3PVCA 2B9XA 4K7ZA 3NK1X 4U8NA 4TLXA 3AE6A 4J33A 4USRA 5IQ4A 4H4QA 1E7PA 4J34A 1IJHA 4EIPA 4CCRA 1KDGA 2YVFA 1D4EA 2OLNA 4YSXA 1K0IA 2Q0LA 2WS3A 3AWIA 3WE0A 3FBSA 1L9DA 3P4QA 4K22A 1ZY8A 1XANA 1BZLA 3UKHA 3DGZA 5J60A 3ATQA 2TPRA 1S3EA 3G5SA 4YTPA 4XWZA 2R45A 2NPXA 1L0VA 1S3BA 3LADA 3BI2A 1IUVA 1Y56A 4XXGA 3UKLA 2RGJA 4A99A 1Q9IA 2BCPA 2IVDA 2V3BA 3DMEA 4ZCCA 1TRBA 4EMJA 2R4JA 3Q6JA 4H2PA 4GCMA 1E1MA 1GRFA 1PS9A 3NN0X 3P4RA 3VRBA 4CCQA 1GTHA 4EM3A 3LZWA 4P9SA 2YG4A 2YWLA 1N4WA 4H50A 2H88A 2GR1A 4ECHA 3AB1A 2YM2A 1OJCA 3PS9A 3CNDA 1L9CA 4CBQA 2EQ8A 2YLTA 3UTGA 1ZP0A 3AYLA 3CN8A 4YXDA 1CJ4A 1MXTA 3K7TA 1PXCA 4NTCA 4J31A 1M64A 4DSHA 4AOSA 1TYPA 3C4NA 3GD3A 1JOAA 2FJEA 4U8OA 3URHA 1QJDA 1YY5A 3K7MX 2GQWA 2XLUA 2XCGA 3ALLA 2GMHA 3UKAA 4K5RA 3VR9A 1NDAA 1VDCA 2B7RA 2J3NA 3SGLA 1CC4A 5HHFA 3KVEA 2Y6QA 4H4TA 1BGJA 4EIQA 1D4CA 4Z24A 3DJDA 3FG2P 4USQA 3LB8A 3IF9A 5M10A 1GALA 2BABA 3GD4A 1O95A 4U8IA 2JAEA 5HYMA 1LPFA 2R0PA 2XLPA 4BV6A 1CL0A 3AD9B 3NGCX 4EQWA 3CNTA 3VRDB 3RP6A 4J2WA 3UTFA 1HYUA 2CULA 3BI4A
chains in the Genus database with same CATH superfamily
4NTDA 1XPQA 4EMIA 3EF6A 1DJQA 4BJZA 1D7YA 2C64A 3SZWA 1ZMDA 4B64A 2YLXA 3DH9A 5EB4A 3AYIA 4IV9A 5KNLA 4GDEA 4GUVA 1ZMCA 1SEZA 2RGHA 3CPHG 3DK9A 3NH3X 1CF3A 1CC6A 2FJDA 3ZDNA 5JCNA 4J36A 1PDHA 4AT0A 2YG5A 5KRQA 3F8RA 2BXSA 4BURA 4FX9A 5LV9A 4TM4A 3NTDA 1DNCA 5TR3A 4B68A 1VRQB 4GF7A 2VRMA 1VG9A 2BYBA 2VZ2A 2YLRA 2YR4A 2ZZCA 3P1WA 1YKJA 4G74A 4UP3A 5JCMA 4H4UA 2YLWA 3NYCA 2X50A 3AEGA 3NNEA 4U2LA 3AE7A 3NTAA 3G5QA 1GPEA 4AT2A 2RGOA 3AEBA 4YKFA 5M0ZA 2GB0A 1N1PA 2WP9A 2XYOA 1KF6A 1PJ5A 3GMCA 2XVEA 3VR8A 4ADWA 2C65A 1DOBA 3GWFA 3FIMB 2BCGG 4WX1A 1FOHA 2WPEA 4BK2A 5JCKA 3P4PA 2BS4A 3RP8A 4ZN0A 3CPIG 1D5TA 5KVHA 1IUWA 4AP1A 2BK4A 5HY5A 4NTEA 3B6DA 3CPJG 1TDFA 1DJNA 1PJ7A 4U2TA 1NENA 4PAAA 1GTEA 1Z6LA 3NT6A 4IVMB 4C3YA 1GRHA 1JRXA 3UTHA 2X8GA 3AYJA 4OCGA 2WP6A 3IC9A 1KFYA 1GRBA 5KVIA 2PYXA 3AE5A 1IUUA 2XVIA 4A5LA 1GSNA 2XDOA 4OPCA 3QJ4A 3PO7A 1FCDA 1GNDA 2C73A 2WDQA 2X99A 4Z26A 2YR5A 4B66A 2OAMA 3F8PA 2VRLA 1JU2A 1YQ4A 1OJTA 2A8XA 1PJ6A 3AE4A 4A9WA 2XFUA 4Y4NA 4RG4A 2VOUA 4Y4MA 3QSMA 1PN0A 1LQTA 4H2RA 3GDPA 1UKVG 2ZZ0A 4H2NA 4JQ9A 4RG3A 3GSIA 3UKFA 1K4QA 3NYEA 4Z25A 3VRAA 3ITJA 3DK8A 4UDRA 1GRAA 4HA6A 4B1BA 3UCLA 2GQFA 2Z5XA 1JEHA 2YM1A 4A65A 2BC1A 4BK3A 1PXAA 2B9WA 4A7AA 4DSGA 3HYWA 2A89A 4JY2A 1Y56B 5U63A 1GEUA 2EQ6A 4CY6A 1PBBA 3NHOX 1H83A 4BK1A 2B76A 4E0VA 2VQ7A 4Z2UA 1NHSA 1IUXA 2XLTA 4UDPA 4YSZA 2X3NA 4EMWA 3P4SA 5IPYA 1GESA 1EL8A 1H7WA 1DXLA 3UKKA 4C3XA 4G73A 1B5QA 1CC2A 3CGCA 4H4SA 3IHGA 3HZLA 4JDRA 2OALA 3QSEA 5IQ1A 1F3PA 3BI5A 2XFOA 3RNMA 3AE8A 4YTNA 1GETA 3II4A 4TLZA 5J7XA 4OPLA 2YR6A 3V3OA 5KWFA 2CVJA 4H4WA 2O9ZA 3QVRA 4YT0A 1KNRA 1TDOA 2E1MA 3DGHA 1H84A 1YQZA 4Z43A 2JK6A 2YG3A 3NK2X 3BNMA 1LTXR 2XVJA 2XVHA 2BA9A 2WP5A 1N4UA 1ZOVA 2FJBA 4DNAA 3KLJA 2XFPA 3QFAA 3GMBA 4GRTA 2AQJA 3GWDA 3NLCA 3QVPA 4B69A 2V60A 1CBOA 1GRTA 3M0OA 4Z2RA 1ZK7A 1NG3A 3C4AA 3UP4A 2QA2A 2GRTA 3ZYXA 5KMPA 1IUSA 2DKIA 2X8CA 4N9XA 1LQUA 4K5SA 1BKWA 1S2YA 1QLBA 2GR3A 3I6DA 5CKUA 4CNKA 1RP0A 4NEWA 2HQMA 1PXBA 2WPCA 4YWOA 1ZDLA 3T37A 4B67A 3SXIA 2F5ZA 1GRGA 2WOWA 4H4XA 4TM1A 1VQWA 2XVFA 2OA1A 2TMDA 4JY3A 1M6IA 1ZX9A 2V5ZA 1W4XA 2YVGA 3ICTA 1RSGA 3RHAA 2YLZA 2OLOA 4IA5A 1FEAA 2BK3A 3SZCA 3SYIA 3AECA 4YKGA 3L1RA 3GDNA 4KPRA 4U8JA 5KMRA 2ZZBA 3CNJA 1Q1RA 1BGNA 4J57A 3T14A 4TM0A 2H89A 4NEVA 4II2A 3UKPA 3KA7A 3UP5A 3DA1A 5EOWA 3S5WA 3LXDA 3UOYA 2YLSA 4CNJA 1S2QA 3F8DA 1L9EA 5JCIA 1CHUA 2WU2A 2R4EA 4GDPA 2GR2A 2YG7A 3CGBA 4GR1A 1ZOYA 1GT8A 2JB1A 4IA6A 1TDNA 4MJWA 5ER0A 3REDA 1B8SA 1CJ2A 1EBDA 2VVLG 2WEUA 2WOIA 3M12A 4LIIA 3NIXA 2VVMA 2PHHA 2R0GA 3VQRA 4G6HA 4RSLA 4REKA 1PBDA 3AXBA 4JN9A 4X9NA 1MO9A 3L8KA 1D7LA 2DKHA 4C77A 1RYIA 2GH5A 3ATRA 2C76A 5BRTA 1TYTA 1GERA 3D1CA 3NK0X 4U8LA 1QO8A 2YG6A 5FMHA 3UOZA 2W0HA 4FK1C 1XHCA 2Q6UA 3AEDA 2WBAA 3FPZA 4PABA 5KOWA 4U2SA 4Z2TA 3CTYA 2C4CA 4GAVA 3GYJA 3M13A 2JB2A 3NG7X 2WOVA 4H4VA 1YQ3A 4O5UA 4XWRA 4M52A 3UOVA 3DJEA 3KD9A 3SM8A 2ACZA 3I3LA 2R9ZA 4A6NB 4JNAA 1JRZA 5C3JA 5GRTA 3T2KA 2C75A 4U8PA 3SQPA 1PBEA 3UKQA 5FS7A 2GEWA 1F8WA 1GREA 2WESA 3ALMA 1JRYA 2C72A 3T31A 4C74A 1VG0A 1IUTA 1H6VA 2XFNA 2Q0KA 4AP3A 3ABVA 4H4YA 3CIRA 1NHPA 5EBKA 1JNRA 5KMQA 3SFDA 3AEAA 2GV8A 3QSSA 4AOXA 2C7GA 3K30A 3T2YA 1DODA 2C67A 1COYA 3HYVA 2QCUA 2GAGB 1NHQA 3CNPA 4TM3A 2NVKX 5C2TA 3CNSA 3AEFA 2Q7VA 2XFQA 3DJJA 5U25A 1P2HA 2CFYA 1MOKA 1NHRA 2AR8A 2BK5A 1PHHA 2I0ZA 2JKCA 3OZ2A 4J56A 3UOXA 3AE1A 4JNQA 4D04A 4DGKA 1EL9A 3H8IA 1H86A 2EQ9A 4IVOB 2WQYA 4YTMA 3ADAB 3R9UA 4EQXA 5FS6A 1AOGA 2BXRA 1OJ9A 2IIDA 3JSKA 1H81A 3LJPA 4O5QA 1BF3A 1DOCA 3COXA 3KPFA 5KXJA 1E6EA 2E5VA 4LA1A 3BNUA 1E1NA 3AD8B 1EL5A 3IWAA 3AE3A 4B63A 3E1TA 3DJGX 3EPTA 1B37A 1N4VA 4Y4LA 2GAHB 2XLRA 1F8SA 3DK4A 1NAAA 2VQBA 3ICSA 3H8LA 3ISHA 2A87A 1K0JA 4UDQA 1KNPA 2V3AA 3SZ0A 2C70A 3S61A 1NPXA 1EL7A 2FJAA 1LVLA 3BHKA 3ICRA 5CQFA 4OPDA 1ZKQA 3NYFA 2Z5YA 2V61A 4YSHA 4H2QA 1XDIA 4ICYA 4EQRA 4K2XA 1O5WA 2AAQA 2B9YA 4LU6A 4BJYA 1FECA 2BS3A 2WDRA 4OPUA 4HB9A 2YQUA 3EAOA 1ONFA 3CMMA 3GYIA 4CY8A 2IVEA 1GOSA 1H82A 2FBWA 2JB3A 3Q9TA 1PBCA 1GXFA 3T2ZA 1F8RA 1CJCA 4U8MA 4H7UA 1B4VA 5L46A 2CDUA 1OJAA 4I59A 4K8DA 3HYXA 1K0LA 3CGDA 4H4ZA 2BS2A 2QAEA 2YVJA 1O94A 2WU5A 3UTEA 4KX6A 1LV0A 1P2EA 3QFBA 5U1OA 1NEKA 4ZCDA 3RP7A 3NN6X 5FS9A 3FMWA 3V76A 2JBVA 1REOA 3KKJA 4C5OA 4X4JA 2RABA 3V3NA 1FL2A 2B7SA 1D4DA 4H4PA 1OJDA 1TDKA 4NZHA 3B3RA 4APNA 3O0HA 3T0KA 3IHMA 2Y6RA 3P9UA 3K7QX 4EM4A 5BUKA 5JCLA 2GR0A 3G5RA 3KU9A 3GRTA 4OPGA 1E1LA 3NRNA 2VVLA 5KOXA 4U8KA 1PBFA 2BC0A 3NKSA 2WPFA 2XLSA 4YSYA 3SX6A 1F6MA 1LJ1A 2C3CA 3H4KA 3C96A 3AEEA 3BHFA 3AE9A 4FK1A 1GV4A 5HXIA 2BACA 1NG4A 4OVIA 1BWCA 3EANA 2R46A 4H4RA 3AD7B 4G6GA 2GF3A 3CGEA 1KSSA 3LOVA 4X9MA 2ARDA 2C3DA 3GRSA 5GSNA 4CRTA 2WETA 1JNZA 2YAUA 2ZBWA 3D8XA 1CJ3A 1E39A 1H7XA 1TDEA 4OPTA 2E4GA 5BVAA 1FEBA 5EB5A 2EQ7A 3SFEA 1V59A 2V6OA 4EQSA 2UZZA 4A79A 2BRYA 1DOEA 2WDVA 2X8HA 2QA1A 1X31B 4OPIA 3OC4A 4WCTA 1ELIA 1KSUA 1Y0PA 4G9KA 4Z44A 2R0CA 2GVCA 2C66A 2GMJA 4GAPA 1E1KA 3LZXA 3ALJA 4I58A 1Q1WA 4FDCB 5BULA 4D03A 4B65A 5DBJA 3AE2A 2APGA 4A6NA 2WHDA 5FS8A 3PVCA 2B9XA 4K7ZA 3NK1X 4U8NA 4TLXA 3AE6A 4J33A 4USRA 5IQ4A 4H4QA 1E7PA 4J34A 1IJHA 4EIPA 4CCRA 1KDGA 2YVFA 1D4EA 2OLNA 4YSXA 1K0IA 2Q0LA 2WS3A 3AWIA 3WE0A 3FBSA 1L9DA 3P4QA 4K22A 1ZY8A 1XANA 1BZLA 3UKHA 3DGZA 5J60A 3ATQA 2TPRA 1S3EA 3G5SA 4YTPA 4XWZA 2R45A 2NPXA 1L0VA 1S3BA 3LADA 3BI2A 1IUVA 1Y56A 4XXGA 3UKLA 2RGJA 4A99A 1Q9IA 2BCPA 2IVDA 2V3BA 3DMEA 3SY4A 4ZCCA 1TRBA 4EMJA 2R4JA 3Q6JA 4H2PA 4GCMA 1E1MA 1GRFA 1PS9A 3NN0X 3P4RA 3VRBA 4CCQA 1GTHA 4EM3A 3LZWA 4P9SA 2YG4A 2YWLA 1N4WA 4H50A 2H88A 2GR1A 4ECHA 3AB1A 2YM2A 4NNJA 1OJCA 3PS9A 3CNDA 1L9CA 4CBQA 2EQ8A 2YLTA 3UTGA 1ZP0A 3AYLA 3CN8A 4YXDA 1CJ4A 1MXTA 3K7TA 1PXCA 4NTCA 2BRAA 1M64A 3GYXA 4J31A 4DSHA 4AOSA 1TYPA 3C4NA 3GD3A 3SZFA 1JOAA 2FJEA 4U8OA 3URHA 1QJDA 1YY5A 3K7MX 5KMSA 3KPKA 2GQWA 2XLUA 2XCGA 3ALLA 2GMHA 3UKAA 4K5RA 3VR9A 1NDAA 1VDCA 2B7RA 2J3NA 3SGLA 1CC4A 5HHFA 3KVEA 2Y6QA 4H4TA 4NWZA 1BGJA 4EIQA 1D4CA 4Z24A 3DJDA 3FG2P 4USQA 3LB8A 3IF9A 5M10A 1GALA 2BABA 3GD4A 1O95A 4U8IA 2JAEA 5HYMA 1LPFA 2R0PA 2XLPA 4BV6A 1CL0A 3AD9B 3NGCX 4EQWA 3CNTA 3VRDB 3RP6A 4J2WA 4II3A 3UTFA 1HYUA 2CULA 3BI4A
chains in the Genus database with same CATH topology
4NTDA 1XPQA 4EMIA 3EF6A 1DJQA 4BJZA 1D7YA 2C64A 3SZWA 1ZMDA 4B64A 2YLXA 3DH9A 5EB4A 3AYIA 4IV9A 5KNLA 4GDEA 4GUVA 1ZMCA 1SEZA 2RGHA 3CPHG 3DK9A 3NH3X 1CF3A 1CC6A 2FJDA 3ZDNA 5JCNA 4J36A 1PDHA 4AT0A 2YG5A 5KRQA 3F8RA 2BXSA 4BURA 4FX9A 5LV9A 4TM4A 3NTDA 1DNCA 5TR3A 4B68A 1VRQB 4GF7A 2VRMA 1VG9A 2BYBA 2VZ2A 2YLRA 2YR4A 2ZZCA 3P1WA 1YKJA 4G74A 4UP3A 5JCMA 4H4UA 2YLWA 3NYCA 2X50A 3AEGA 3NNEA 4U2LA 3AE7A 3NTAA 3G5QA 1GPEA 4AT2A 2RGOA 3AEBA 4YKFA 5M0ZA 2GB0A 1N1PA 2WP9A 2XYOA 1KF6A 1PJ5A 3GMCA 2XVEA 3VR8A 4ADWA 2C65A 1DOBA 3GWFA 3FIMB 2BCGG 4WX1A 1FOHA 2WPEA 4BK2A 5JCKA 3P4PA 2BS4A 3RP8A 4ZN0A 3CPIG 1D5TA 5KVHA 1IUWA 4AP1A 2BK4A 5HY5A 4NTEA 3B6DA 3CPJG 1TDFA 1DJNA 1PJ7A 4U2TA 1NENA 4PAAA 1GTEA 1Z6LA 3NT6A 4IVMB 4C3YA 1GRHA 1JRXA 3UTHA 2X8GA 3AYJA 4OCGA 2WP6A 3IC9A 1KFYA 1GRBA 5KVIA 2PYXA 3AE5A 1IUUA 2XVIA 4A5LA 1GSNA 2XDOA 4OPCA 3QJ4A 3PO7A 1FCDA 1GNDA 2C73A 2WDQA 2X99A 4Z26A 2YR5A 4B66A 2OAMA 3F8PA 2VRLA 1JU2A 1YQ4A 1OJTA 2A8XA 1PJ6A 3AE4A 4A9WA 2XFUA 4Y4NA 4RG4A 2VOUA 4Y4MA 3QSMA 1PN0A 1LQTA 4H2RA 3GDPA 1UKVG 2ZZ0A 4H2NA 4JQ9A 4RG3A 3GSIA 3UKFA 1K4QA 3NYEA 4Z25A 3VRAA 3ITJA 3DK8A 4UDRA 1GRAA 4HA6A 4B1BA 3UCLA 2GQFA 2Z5XA 1JEHA 2YM1A 4A65A 2BC1A 4BK3A 1PXAA 2B9WA 4A7AA 4DSGA 3HYWA 2A89A 4JY2A 1Y56B 5U63A 1GEUA 2EQ6A 4CY6A 1PBBA 3NHOX 1H83A 4BK1A 2B76A 4E0VA 2VQ7A 4Z2UA 1NHSA 1IUXA 2XLTA 4UDPA 4YSZA 2X3NA 4EMWA 3P4SA 5IPYA 1GESA 1EL8A 1H7WA 1DXLA 3UKKA 4C3XA 4G73A 1B5QA 1CC2A 3CGCA 4H4SA 3IHGA 3HZLA 4JDRA 2OALA 3QSEA 5IQ1A 1F3PA 3BI5A 2XFOA 3RNMA 3AE8A 4YTNA 1GETA 3II4A 4TLZA 5J7XA 4OPLA 2YR6A 3V3OA 5KWFA 2CVJA 4H4WA 2O9ZA 3QVRA 4YT0A 1KNRA 1TDOA 2E1MA 3DGHA 1H84A 1YQZA 4Z43A 2JK6A 2YG3A 3NK2X 3BNMA 1LTXR 2XVJA 2XVHA 2BA9A 2WP5A 1N4UA 1ZOVA 2FJBA 4DNAA 3KLJA 2XFPA 3QFAA 3GMBA 4GRTA 2AQJA 3GWDA 3NLCA 3QVPA 4B69A 2V60A 1CBOA 1GRTA 3M0OA 4Z2RA 1ZK7A 1NG3A 3C4AA 3UP4A 2QA2A 2GRTA 3ZYXA 5KMPA 1IUSA 2DKIA 2X8CA 4N9XA 1LQUA 4K5SA 1BKWA 1S2YA 1QLBA 2GR3A 3I6DA 5CKUA 4CNKA 1RP0A 4NEWA 2HQMA 1PXBA 2WPCA 4YWOA 1ZDLA 3T37A 4B67A 3SXIA 2F5ZA 1GRGA 2WOWA 4H4XA 4TM1A 1VQWA 2XVFA 2OA1A 2TMDA 4JY3A 1M6IA 1ZX9A 2V5ZA 1W4XA 2YVGA 3ICTA 1RSGA 3RHAA 2YLZA 2OLOA 4IA5A 1FEAA 2BK3A 3SZCA 3SYIA 3AECA 4YKGA 3L1RA 3GDNA 4KPRA 4U8JA 5KMRA 2ZZBA 3CNJA 1Q1RA 1BGNA 4J57A 3T14A 4TM0A 2H89A 4NEVA 4II2A 3UKPA 3KA7A 3UP5A 3DA1A 5EOWA 3S5WA 3LXDA 3UOYA 2YLSA 4CNJA 1S2QA 3F8DA 1L9EA 5JCIA 1CHUA 2WU2A 2R4EA 4GDPA 2GR2A 2YG7A 3CGBA 4GR1A 1ZOYA 1GT8A 2JB1A 4IA6A 1TDNA 4MJWA 5ER0A 3REDA 1B8SA 1CJ2A 1EBDA 2VVLG 2WEUA 2WOIA 3M12A 4LIIA 3NIXA 2VVMA 2PHHA 2R0GA 3VQRA 4G6HA 4RSLA 4REKA 1PBDA 3AXBA 4JN9A 4X9NA 1MO9A 3L8KA 1D7LA 2DKHA 4C77A 1RYIA 2GH5A 3ATRA 2C76A 5BRTA 1TYTA 1GERA 3D1CA 3NK0X 4U8LA 1QO8A 2YG6A 5FMHA 3UOZA 2W0HA 4FK1C 1XHCA 2Q6UA 3AEDA 2WBAA 3FPZA 4PABA 5KOWA 4U2SA 4Z2TA 3CTYA 2C4CA 4GAVA 3GYJA 3M13A 2JB2A 3NG7X 2WOVA 4H4VA 1YQ3A 4O5UA 4XWRA 4M52A 3UOVA 3DJEA 3KD9A 3SM8A 2ACZA 3I3LA 2R9ZA 4A6NB 4JNAA 1JRZA 5C3JA 5GRTA 3T2KA 2C75A 4U8PA 3SQPA 1PBEA 3UKQA 5FS7A 2GEWA 1F8WA 1GREA 2WESA 3ALMA 1JRYA 2C72A 3T31A 4C74A 1VG0A 1IUTA 1H6VA 2XFNA 2Q0KA 4AP3A 3ABVA 4H4YA 3CIRA 1NHPA 5EBKA 1JNRA 5KMQA 3SFDA 3AEAA 2GV8A 3QSSA 4AOXA 2C7GA 3K30A 3T2YA 1DODA 2C67A 1COYA 3HYVA 2QCUA 2GAGB 1NHQA 3CNPA 4TM3A 2NVKX 5C2TA 3CNSA 3AEFA 2Q7VA 2XFQA 3DJJA 5U25A 1P2HA 2CFYA 1MOKA 1NHRA 2AR8A 2BK5A 1PHHA 2I0ZA 2JKCA 3OZ2A 4J56A 3UOXA 3AE1A 4JNQA 4D04A 4DGKA 1EL9A 3H8IA 1H86A 2EQ9A 4IVOB 2WQYA 4YTMA 3ADAB 3R9UA 4EQXA 5FS6A 1AOGA 2BXRA 1OJ9A 2IIDA 3JSKA 1H81A 3LJPA 4O5QA 1BF3A 1DOCA 3COXA 3KPFA 5KXJA 1E6EA 2E5VA 4LA1A 3BNUA 1E1NA 3AD8B 1EL5A 3IWAA 3AE3A 4B63A 3E1TA 3DJGX 3EPTA 1B37A 1N4VA 4Y4LA 2GAHB 2XLRA 1F8SA 3DK4A 1NAAA 2VQBA 3ICSA 3H8LA 3ISHA 2A87A 1K0JA 4UDQA 1KNPA 2V3AA 3SZ0A 2C70A 3S61A 1NPXA 1EL7A 2FJAA 1LVLA 3BHKA 3ICRA 5CQFA 4OPDA 1ZKQA 3NYFA 2Z5YA 2V61A 4YSHA 4H2QA 1XDIA 4ICYA 4EQRA 4K2XA 1O5WA 2AAQA 2B9YA 4LU6A 4BJYA 1FECA 2BS3A 2WDRA 4OPUA 4HB9A 2YQUA 3EAOA 1ONFA 3CMMA 3GYIA 4CY8A 2IVEA 1GOSA 1H82A 2FBWA 2JB3A 3Q9TA 1PBCA 1GXFA 3T2ZA 1F8RA 1CJCA 4U8MA 4H7UA 1B4VA 5L46A 2CDUA 1OJAA 4I59A 4K8DA 3HYXA 1K0LA 3CGDA 4H4ZA 2BS2A 2QAEA 2YVJA 1O94A 2WU5A 3UTEA 4KX6A 1LV0A 1P2EA 3QFBA 5U1OA 1NEKA 4ZCDA 3RP7A 3NN6X 5FS9A 3FMWA 3V76A 2JBVA 1REOA 3KKJA 4C5OA 4X4JA 2RABA 3V3NA 1FL2A 2B7SA 1D4DA 4H4PA 1OJDA 1TDKA 4NZHA 3B3RA 4APNA 3O0HA 3T0KA 3IHMA 2Y6RA 3P9UA 3K7QX 4EM4A 5BUKA 5JCLA 2GR0A 3G5RA 3KU9A 3GRTA 4OPGA 1E1LA 3NRNA 2VVLA 5KOXA 4U8KA 1PBFA 2BC0A 3NKSA 2WPFA 2XLSA 4YSYA 3SX6A 1F6MA 1LJ1A 2C3CA 3H4KA 3C96A 3AEEA 3BHFA 3AE9A 4FK1A 1GV4A 5HXIA 2BACA 1NG4A 4OVIA 1BWCA 3EANA 2R46A 4H4RA 3AD7B 4G6GA 2GF3A 3CGEA 1KSSA 3LOVA 4X9MA 2ARDA 2C3DA 3GRSA 5GSNA 4CRTA 2WETA 1JNZA 2YAUA 2ZBWA 3D8XA 1CJ3A 1E39A 1H7XA 1TDEA 4OPTA 2E4GA 5BVAA 1FEBA 5EB5A 2EQ7A 3SFEA 1V59A 2V6OA 4EQSA 2UZZA 4A79A 2BRYA 1DOEA 2WDVA 2X8HA 2QA1A 1X31B 4OPIA 3OC4A 4WCTA 1ELIA 1KSUA 1Y0PA 4G9KA 4Z44A 2R0CA 2GVCA 2C66A 2GMJA 4GAPA 1E1KA 3LZXA 3ALJA 4I58A 1Q1WA 4FDCB 5BULA 4D03A 4B65A 5DBJA 3AE2A 2APGA 4A6NA 2WHDA 5FS8A 3PVCA 2B9XA 4K7ZA 3NK1X 4U8NA 4TLXA 3AE6A 4J33A 4USRA 5IQ4A 4H4QA 1E7PA 4J34A 1IJHA 4EIPA 4CCRA 1KDGA 2YVFA 1D4EA 2OLNA 4YSXA 1K0IA 2Q0LA 2WS3A 3AWIA 3WE0A 3FBSA 1L9DA 3P4QA 4K22A 1ZY8A 1XANA 1BZLA 3UKHA 3DGZA 5J60A 3ATQA 2TPRA 1S3EA 3G5SA 4YTPA 4XWZA 2R45A 2NPXA 1L0VA 1S3BA 3LADA 3BI2A 1IUVA 1Y56A 4XXGA 3UKLA 2RGJA 4A99A 1Q9IA 2BCPA 2IVDA 2V3BA 3DMEA 3SY4A 4ZCCA 1TRBA 4EMJA 2R4JA 3Q6JA 4H2PA 4GCMA 1E1MA 1GRFA 1PS9A 3NN0X 3P4RA 3VRBA 4CCQA 1GTHA 4EM3A 3LZWA 4P9SA 2YG4A 2YWLA 1N4WA 4H50A 2H88A 2GR1A 4ECHA 3AB1A 2YM2A 4NNJA 1OJCA 3PS9A 3CNDA 1L9CA 4CBQA 2EQ8A 2YLTA 3UTGA 1ZP0A 3AYLA 3CN8A 4YXDA 1CJ4A 1MXTA 3K7TA 1PXCA 4NTCA 2BRAA 1M64A 3GYXA 4J31A 4DSHA 4AOSA 1TYPA 3C4NA 3GD3A 3SZFA 1JOAA 2FJEA 4U8OA 3URHA 1QJDA 1YY5A 3K7MX 5KMSA 3KPKA 2GQWA 2XLUA 2XCGA 3ALLA 2GMHA 3UKAA 4K5RA 3VR9A 1NDAA 1VDCA 2B7RA 2J3NA 3SGLA 1CC4A 5HHFA 3KVEA 2Y6QA 4H4TA 4NWZA 1BGJA 4EIQA 1D4CA 4Z24A 3DJDA 3FG2P 4USQA 3LB8A 3IF9A 5M10A 1GALA 2BABA 3GD4A 1O95A 4U8IA 2JAEA 5HYMA 1LPFA 2R0PA 2XLPA 4BV6A 1CL0A 3AD9B 3NGCX 4EQWA 3CNTA 3VRDB 3RP6A 4J2WA 4II3A 3UTFA 1HYUA 2CULA 3BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NTD A;  1XPQ A;  4EMI A;  3EF6 A;  1DJQ A;  4BJZ A;  1D7Y A;  2C64 A;  1ZMD A;  4B64 A;  2YLX A;  3DH9 A;  5EB4 A;  3AYI A;  4IV9 A;  4GDE A;  4GUV A;  1ZMC A;  1SEZ A;  2RGH A;  3CPH G;  3DK9 A;  3NH3 X;  1CF3 A;  1CC6 A;  2FJD A;  3ZDN A;  5JCN A;  4J36 A;  1PDH A;  4AT0 A;  2YG5 A;  5KRQ A;  3F8R A;  2BXS A;  4BUR A;  4FX9 A;  5LV9 A;  4TM4 A;  3NTD A;  1DNC A;  5TR3 A;  4B68 A;  1VRQ B;  4GF7 A;  2VRM A;  1VG9 A;  2BYB A;  2VZ2 A;  2YLR A;  2YR4 A;  2ZZC A;  3P1W A;  1YKJ A;  4UP3 A;  5JCM A;  4H4U A;  2YLW A;  3NYC A;  2X50 A;  3AEG A;  3NNE A;  4U2L A;  3AE7 A;  3NTA A;  3G5Q A;  1GPE A;  4AT2 A;  2RGO A;  3AEB A;  4YKF A;  5M0Z A;  2GB0 A;  1N1P A;  2WP9 A;  2XYO A;  1KF6 A;  1PJ5 A;  3GMC A;  2XVE A;  3VR8 A;  4ADW A;  2C65 A;  1DOB A;  3GWF A;  3FIM B;  2BCG G;  4WX1 A;  1FOH A;  2WPE A;  4BK2 A;  5JCK A;  3P4P A;  2BS4 A;  3RP8 A;  4ZN0 A;  3CPI G;  1D5T A;  5KVH A;  1IUW A;  4AP1 A;  2BK4 A;  5HY5 A;  4NTE A;  3B6D A;  3CPJ G;  1TDF A;  1DJN A;  1PJ7 A;  4U2T A;  1NEN A;  4PAA A;  1GTE A;  1Z6L A;  3NT6 A;  4IVM B;  4C3Y A;  1GRH A;  1JRX A;  3UTH A;  2X8G A;  3AYJ A;  4OCG A;  2WP6 A;  3IC9 A;  1KFY A;  1GRB A;  5KVI A;  2PYX A;  3AE5 A;  1IUU A;  2XVI A;  4A5L A;  1GSN A;  2XDO A;  4OPC A;  3QJ4 A;  3PO7 A;  1FCD A;  1GND A;  2C73 A;  2WDQ A;  2X99 A;  4Z26 A;  2YR5 A;  4B66 A;  2OAM A;  3F8P A;  2VRL A;  1JU2 A;  1YQ4 A;  1OJT A;  2A8X A;  1PJ6 A;  3AE4 A;  4A9W A;  2XFU A;  4Y4N A;  4RG4 A;  2VOU A;  4Y4M A;  3QSM A;  1PN0 A;  1LQT A;  4H2R A;  3GDP A;  1UKV G;  2ZZ0 A;  4H2N A;  4JQ9 A;  4RG3 A;  3GSI A;  3UKF A;  1K4Q A;  3NYE A;  4Z25 A;  3VRA A;  3ITJ A;  3DK8 A;  4UDR A;  1GRA A;  4HA6 A;  4B1B A;  3UCL A;  2GQF A;  2Z5X A;  1JEH A;  2YM1 A;  4A65 A;  2BC1 A;  4BK3 A;  1PXA A;  2B9W A;  4A7A A;  4DSG A;  2A89 A;  4JY2 A;  1Y56 B;  5U63 A;  1GEU A;  2EQ6 A;  4CY6 A;  1PBB A;  3NHO X;  1H83 A;  4BK1 A;  2B76 A;  4E0V A;  2VQ7 A;  4Z2U A;  1NHS A;  1IUX A;  2XLT A;  4UDP A;  4YSZ A;  2X3N A;  4EMW A;  3P4S A;  5IPY A;  1GES A;  1EL8 A;  1H7W A;  1DXL A;  3UKK A;  4C3X A;  1B5Q A;  1CC2 A;  3CGC A;  4H4S A;  3IHG A;  3HZL A;  4JDR A;  2OAL A;  3QSE A;  5IQ1 A;  1F3P A;  3BI5 A;  2XFO A;  3RNM A;  3AE8 A;  4YTN A;  1GET A;  3II4 A;  4TLZ A;  5J7X A;  4OPL A;  2YR6 A;  3V3O A;  5KWF A;  2CVJ A;  4H4W A;  2O9Z A;  3QVR A;  4YT0 A;  1KNR A;  1TDO A;  2E1M A;  3DGH A;  1H84 A;  1YQZ A;  4Z43 A;  2JK6 A;  2YG3 A;  3NK2 X;  3BNM A;  1LTX R;  2XVJ A;  2XVH A;  2BA9 A;  2WP5 A;  1N4U A;  1ZOV A;  2FJB A;  4DNA A;  3KLJ A;  2XFP A;  3QFA A;  3GMB A;  4GRT A;  2AQJ A;  3GWD A;  3NLC A;  3QVP A;  4B69 A;  2V60 A;  1CBO A;  1GRT A;  3M0O A;  4Z2R A;  1ZK7 A;  1NG3 A;  3C4A A;  3UP4 A;  2QA2 A;  2GRT A;  3ZYX A;  1IUS A;  2DKI A;  2X8C A;  4N9X A;  1LQU A;  4K5S A;  1BKW A;  1S2Y A;  1QLB A;  2GR3 A;  3I6D A;  5CKU A;  4CNK A;  1RP0 A;  4NEW A;  2HQM A;  1PXB A;  2WPC A;  4YWO A;  1ZDL A;  3T37 A;  4B67 A;  2F5Z A;  1GRG A;  2WOW A;  4H4X A;  4TM1 A;  1VQW A;  2XVF A;  2OA1 A;  2TMD A;  4JY3 A;  1M6I A;  1ZX9 A;  2V5Z A;  1W4X A;  2YVG A;  3ICT A;  1RSG A;  3RHA A;  2YLZ A;  2OLO A;  4IA5 A;  1FEA A;  2BK3 A;  3AEC A;  4YKG A;  3L1R A;  3GDN A;  4KPR A;  4U8J A;  2ZZB A;  3CNJ A;  1Q1R A;  1BGN A;  4J57 A;  4TM0 A;  2H89 A;  4NEV A;  3UKP A;  3KA7 A;  3UP5 A;  3DA1 A;  5EOW A;  3S5W A;  3LXD A;  3UOY A;  2YLS A;  4CNJ A;  1S2Q A;  3F8D A;  1L9E A;  5JCI A;  1CHU A;  2WU2 A;  2R4E A;  4GDP A;  2GR2 A;  2YG7 A;  3CGB A;  4GR1 A;  1ZOY A;  1GT8 A;  2JB1 A;  4IA6 A;  1TDN A;  4MJW A;  5ER0 A;  3RED A;  1B8S A;  1CJ2 A;  1EBD A;  2VVL G;  2WEU A;  2WOI A;  3M12 A;  4LII A;  3NIX A;  2VVM A;  2PHH A;  2R0G A;  3VQR A;  4RSL A;  4REK A;  1PBD A;  3AXB A;  4JN9 A;  4X9N A;  1MO9 A;  3L8K A;  1D7L A;  2DKH A;  4C77 A;  1RYI A;  2GH5 A;  3ATR A;  2C76 A;  5BRT A;  1TYT A;  1GER A;  3D1C A;  3NK0 X;  4U8L A;  1QO8 A;  2YG6 A;  5FMH A;  3UOZ A;  2W0H A;  4FK1 C;  1XHC A;  2Q6U A;  3AED A;  2WBA A;  3FPZ A;  4PAB A;  5KOW A;  4U2S A;  4Z2T A;  3CTY A;  3GYJ A;  3M13 A;  2JB2 A;  3NG7 X;  2WOV A;  4H4V A;  1YQ3 A;  4O5U A;  4XWR A;  4M52 A;  3UOV A;  3DJE A;  3KD9 A;  3SM8 A;  2ACZ A;  3I3L A;  2R9Z A;  4A6N B;  4JNA A;  1JRZ A;  5C3J A;  5GRT A;  2C75 A;  4U8P A;  3SQP A;  1PBE A;  3UKQ A;  5FS7 A;  2GEW A;  1F8W A;  1GRE A;  2WES A;  3ALM A;  1JRY A;  2C72 A;  4C74 A;  1VG0 A;  1IUT A;  1H6V A;  2XFN A;  2Q0K A;  4AP3 A;  3ABV A;  4H4Y A;  3CIR A;  1NHP A;  5EBK A;  1JNR A;  3SFD A;  3AEA A;  2GV8 A;  3QSS A;  4AOX A;  2C7G A;  3K30 A;  1DOD A;  2C67 A;  1COY A;  2QCU A;  2GAG B;  1NHQ A;  3CNP A;  4TM3 A;  2NVK X;  5C2T A;  3CNS A;  3AEF A;  2Q7V A;  2XFQ A;  3DJJ A;  5U25 A;  1P2H A;  2CFY A;  1MOK A;  1NHR A;  2AR8 A;  2BK5 A;  1PHH A;  2I0Z A;  2JKC A;  3OZ2 A;  4J56 A;  3UOX A;  3AE1 A;  4JNQ A;  4D04 A;  4DGK A;  1EL9 A;  3H8I A;  1H86 A;  2EQ9 A;  4IVO B;  2WQY A;  4YTM A;  3ADA B;  3R9U A;  4EQX A;  5FS6 A;  1AOG A;  2BXR A;  1OJ9 A;  2IID A;  3JSK A;  1H81 A;  3LJP A;  4O5Q A;  1BF3 A;  1DOC A;  3COX A;  3KPF A;  5KXJ A;  1E6E A;  2E5V A;  4LA1 A;  3BNU A;  1E1N A;  3AD8 B;  1EL5 A;  3IWA A;  3AE3 A;  4B63 A;  3E1T A;  3DJG X;  3EPT A;  1B37 A;  1N4V A;  4Y4L A;  2GAH B;  2XLR A;  1F8S A;  3DK4 A;  1NAA A;  2VQB A;  3ICS A;  3H8L A;  3ISH A;  2A87 A;  1K0J A;  4UDQ A;  1KNP A;  2V3A A;  2C70 A;  3S61 A;  1NPX A;  1EL7 A;  2FJA A;  1LVL A;  3BHK A;  3ICR A;  5CQF A;  4OPD A;  1ZKQ A;  3NYF A;  2Z5Y A;  2V61 A;  4YSH A;  4H2Q A;  1XDI A;  4ICY A;  4EQR A;  4K2X A;  1O5W A;  2AAQ A;  2B9Y A;  4LU6 A;  4BJY A;  1FEC A;  2BS3 A;  2WDR A;  4OPU A;  4HB9 A;  2YQU A;  3EAO A;  1ONF A;  3GYI A;  4CY8 A;  2IVE A;  1GOS A;  1H82 A;  2FBW A;  2JB3 A;  3Q9T A;  1PBC A;  1GXF A;  1F8R A;  1CJC A;  4U8M A;  4H7U A;  1B4V A;  5L46 A;  2CDU A;  1OJA A;  4I59 A;  4K8D A;  1K0L A;  3CGD A;  4H4Z A;  2BS2 A;  2QAE A;  2YVJ A;  1O94 A;  2WU5 A;  3UTE A;  4KX6 A;  1LV0 A;  1P2E A;  3QFB A;  5U1O A;  1NEK A;  4ZCD A;  3RP7 A;  3NN6 X;  5FS9 A;  3FMW A;  3V76 A;  2JBV A;  1REO A;  3KKJ A;  4C5O A;  4X4J A;  2RAB A;  3V3N A;  1FL2 A;  2B7S A;  1D4D A;  4H4P A;  1OJD A;  1TDK A;  4NZH A;  3B3R A;  4APN A;  3O0H A;  3IHM A;  2Y6R A;  3P9U A;  3K7Q X;  4EM4 A;  5BUK A;  5JCL A;  2GR0 A;  3G5R A;  3KU9 A;  3GRT A;  4OPG A;  1E1L A;  3NRN A;  2VVL A;  5KOX A;  4U8K A;  1PBF A;  2BC0 A;  3NKS A;  2WPF A;  2XLS A;  4YSY A;  1F6M A;  1LJ1 A;  2C3C A;  3H4K A;  3C96 A;  3AEE A;  3BHF A;  3AE9 A;  4FK1 A;  1GV4 A;  5HXI A;  2BAC A;  1NG4 A;  4OVI A;  1BWC A;  3EAN A;  2R46 A;  4H4R A;  3AD7 B;  2GF3 A;  3CGE A;  1KSS A;  3LOV A;  4X9M A;  2ARD A;  2C3D A;  3GRS A;  5GSN A;  4CRT A;  2WET A;  1JNZ A;  2YAU A;  2ZBW A;  3D8X A;  1CJ3 A;  1E39 A;  1H7X A;  1TDE A;  4OPT A;  2E4G A;  5BVA A;  1FEB A;  5EB5 A;  2EQ7 A;  3SFE A;  1V59 A;  2V6O A;  4EQS A;  2UZZ A;  4A79 A;  2WDV A;  1DOE A;  2X8H A;  2QA1 A;  1X31 B;  4OPI A;  3OC4 A;  4WCT A;  1ELI A;  1KSU A;  1Y0P A;  4Z44 A;  2R0C A;  2GVC A;  2C66 A;  2GMJ A;  1E1K A;  3LZX A;  3ALJ A;  4I58 A;  1Q1W A;  4FDC B;  5BUL A;  4D03 A;  4B65 A;  5DBJ A;  3AE2 A;  2APG A;  4A6N A;  2WHD A;  5FS8 A;  3PVC A;  2B9X A;  4K7Z A;  3NK1 X;  4U8N A;  4TLX A;  3AE6 A;  4J33 A;  4USR A;  5IQ4 A;  4H4Q A;  1E7P A;  4J34 A;  1IJH A;  4EIP A;  4CCR A;  1KDG A;  2YVF A;  1D4E A;  2OLN A;  4YSX A;  1K0I A;  2Q0L A;  2WS3 A;  3AWI A;  3WE0 A;  3FBS A;  1L9D A;  3P4Q A;  4K22 A;  1ZY8 A;  1XAN A;  1BZL A;  3UKH A;  3DGZ A;  5J60 A;  3ATQ A;  2TPR A;  1S3E A;  3G5S A;  4YTP A;  4XWZ A;  2R45 A;  2NPX A;  1L0V A;  1S3B A;  3LAD A;  3BI2 A;  1IUV A;  1Y56 A;  4XXG A;  3UKL A;  2RGJ A;  4A99 A;  1Q9I A;  2BCP A;  2IVD A;  2V3B A;  3DME A;  4ZCC A;  1TRB A;  4EMJ A;  2R4J A;  3Q6J A;  4H2P A;  4GCM A;  1E1M A;  1GRF A;  1PS9 A;  3NN0 X;  3P4R A;  3VRB A;  4CCQ A;  1GTH A;  4EM3 A;  3LZW A;  4P9S A;  2YG4 A;  2YWL A;  1N4W A;  4H50 A;  2H88 A;  2GR1 A;  4ECH A;  3AB1 A;  2YM2 A;  1OJC A;  3PS9 A;  3CND A;  1L9C A;  4CBQ A;  2EQ8 A;  2YLT A;  3UTG A;  1ZP0 A;  3AYL A;  3CN8 A;  4YXD A;  1CJ4 A;  1MXT A;  3K7T A;  1PXC A;  4NTC A;  4J31 A;  1M64 A;  4DSH A;  4AOS A;  1TYP A;  3C4N A;  3GD3 A;  1JOA A;  2FJE A;  4U8O A;  3URH A;  1QJD A;  1YY5 A;  3K7M X;  2GQW A;  2XLU A;  2XCG A;  3ALL A;  2GMH A;  3UKA A;  4K5R A;  3VR9 A;  1NDA A;  1VDC A;  2B7R A;  2J3N A;  3SGL A;  1CC4 A;  5HHF A;  3KVE A;  2Y6Q A;  4H4T A;  1BGJ A;  4EIQ A;  1D4C A;  4Z24 A;  3DJD A;  3FG2 P;  4USQ A;  3LB8 A;  3IF9 A;  5M10 A;  1GAL A;  2BAB A;  3GD4 A;  1O95 A;  4U8I A;  2JAE A;  5HYM A;  1LPF A;  2R0P A;  2XLP A;  4BV6 A;  1CL0 A;  3AD9 B;  3NGC X;  4EQW A;  3CNT A;  3VRD B;  3RP6 A;  4J2W A;  3UTF A;  1HYU A;  2CUL A;  3BI4 A; 
#chains in the Genus database with same CATH topology
 4NTD A;  1XPQ A;  4EMI A;  3EF6 A;  1DJQ A;  4BJZ A;  1D7Y A;  2C64 A;  3SZW A;  1ZMD A;  4B64 A;  2YLX A;  3DH9 A;  5EB4 A;  3AYI A;  4IV9 A;  5KNL A;  4GDE A;  4GUV A;  1ZMC A;  1SEZ A;  2RGH A;  3CPH G;  3DK9 A;  3NH3 X;  1CF3 A;  1CC6 A;  2FJD A;  3ZDN A;  5JCN A;  4J36 A;  1PDH A;  4AT0 A;  2YG5 A;  5KRQ A;  3F8R A;  2BXS A;  4BUR A;  4FX9 A;  5LV9 A;  4TM4 A;  3NTD A;  1DNC A;  5TR3 A;  4B68 A;  1VRQ B;  4GF7 A;  2VRM A;  1VG9 A;  2BYB A;  2VZ2 A;  2YLR A;  2YR4 A;  2ZZC A;  3P1W A;  1YKJ A;  4G74 A;  4UP3 A;  5JCM A;  4H4U A;  2YLW A;  3NYC A;  2X50 A;  3AEG A;  3NNE A;  4U2L A;  3AE7 A;  3NTA A;  3G5Q A;  1GPE A;  4AT2 A;  2RGO A;  3AEB A;  4YKF A;  5M0Z A;  2GB0 A;  1N1P A;  2WP9 A;  2XYO A;  1KF6 A;  1PJ5 A;  3GMC A;  2XVE A;  3VR8 A;  4ADW A;  2C65 A;  1DOB A;  3GWF A;  3FIM B;  2BCG G;  4WX1 A;  1FOH A;  2WPE A;  4BK2 A;  5JCK A;  3P4P A;  2BS4 A;  3RP8 A;  4ZN0 A;  3CPI G;  1D5T A;  5KVH A;  1IUW A;  4AP1 A;  2BK4 A;  5HY5 A;  4NTE A;  3B6D A;  3CPJ G;  1TDF A;  1DJN A;  1PJ7 A;  4U2T A;  1NEN A;  4PAA A;  1GTE A;  1Z6L A;  3NT6 A;  4IVM B;  4C3Y A;  1GRH A;  1JRX A;  3UTH A;  2X8G A;  3AYJ A;  4OCG A;  2WP6 A;  3IC9 A;  1KFY A;  1GRB A;  5KVI A;  2PYX A;  3AE5 A;  1IUU A;  2XVI A;  4A5L A;  1GSN A;  2XDO A;  4OPC A;  3QJ4 A;  3PO7 A;  1FCD A;  1GND A;  2C73 A;  2WDQ A;  2X99 A;  4Z26 A;  2YR5 A;  4B66 A;  2OAM A;  3F8P A;  2VRL A;  1JU2 A;  1YQ4 A;  1OJT A;  2A8X A;  1PJ6 A;  3AE4 A;  4A9W A;  2XFU A;  4Y4N A;  4RG4 A;  2VOU A;  4Y4M A;  3QSM A;  1PN0 A;  1LQT A;  4H2R A;  3GDP A;  1UKV G;  2ZZ0 A;  4H2N A;  4JQ9 A;  4RG3 A;  3GSI A;  3UKF A;  1K4Q A;  3NYE A;  4Z25 A;  3VRA A;  3ITJ A;  3DK8 A;  4UDR A;  1GRA A;  4HA6 A;  4B1B A;  3UCL A;  2GQF A;  2Z5X A;  1JEH A;  2YM1 A;  4A65 A;  2BC1 A;  4BK3 A;  1PXA A;  2B9W A;  4A7A A;  4DSG A;  3HYW A;  2A89 A;  4JY2 A;  1Y56 B;  5U63 A;  1GEU A;  2EQ6 A;  4CY6 A;  1PBB A;  3NHO X;  1H83 A;  4BK1 A;  2B76 A;  4E0V A;  2VQ7 A;  4Z2U A;  1NHS A;  1IUX A;  2XLT A;  4UDP A;  4YSZ A;  2X3N A;  4EMW A;  3P4S A;  5IPY A;  1GES A;  1EL8 A;  1H7W A;  1DXL A;  3UKK A;  4C3X A;  4G73 A;  1B5Q A;  1CC2 A;  3CGC A;  4H4S A;  3IHG A;  3HZL A;  4JDR A;  2OAL A;  3QSE A;  5IQ1 A;  1F3P A;  3BI5 A;  2XFO A;  3RNM A;  3AE8 A;  4YTN A;  1GET A;  3II4 A;  4TLZ A;  5J7X A;  4OPL A;  2YR6 A;  3V3O A;  5KWF A;  2CVJ A;  4H4W A;  2O9Z A;  3QVR A;  4YT0 A;  1KNR A;  1TDO A;  2E1M A;  3DGH A;  1H84 A;  1YQZ A;  4Z43 A;  2JK6 A;  2YG3 A;  3NK2 X;  3BNM A;  1LTX R;  2XVJ A;  2XVH A;  2BA9 A;  2WP5 A;  1N4U A;  1ZOV A;  2FJB A;  4DNA A;  3KLJ A;  2XFP A;  3QFA A;  3GMB A;  4GRT A;  2AQJ A;  3GWD A;  3NLC A;  3QVP A;  4B69 A;  2V60 A;  1CBO A;  1GRT A;  3M0O A;  4Z2R A;  1ZK7 A;  1NG3 A;  3C4A A;  3UP4 A;  2QA2 A;  2GRT A;  3ZYX A;  5KMP A;  1IUS A;  2DKI A;  2X8C A;  4N9X A;  1LQU A;  4K5S A;  1BKW A;  1S2Y A;  1QLB A;  2GR3 A;  3I6D A;  5CKU A;  4CNK A;  1RP0 A;  4NEW A;  2HQM A;  1PXB A;  2WPC A;  4YWO A;  1ZDL A;  3T37 A;  4B67 A;  3SXI A;  2F5Z A;  1GRG A;  2WOW A;  4H4X A;  4TM1 A;  1VQW A;  2XVF A;  2OA1 A;  2TMD A;  4JY3 A;  1M6I A;  1ZX9 A;  2V5Z A;  1W4X A;  2YVG A;  3ICT A;  1RSG A;  3RHA A;  2YLZ A;  2OLO A;  4IA5 A;  1FEA A;  2BK3 A;  3SZC A;  3SYI A;  3AEC A;  4YKG A;  3L1R A;  3GDN A;  4KPR A;  4U8J A;  5KMR A;  2ZZB A;  3CNJ A;  1Q1R A;  1BGN A;  4J57 A;  3T14 A;  4TM0 A;  2H89 A;  4NEV A;  4II2 A;  3UKP A;  3KA7 A;  3UP5 A;  3DA1 A;  5EOW A;  3S5W A;  3LXD A;  3UOY A;  2YLS A;  4CNJ A;  1S2Q A;  3F8D A;  1L9E A;  5JCI A;  1CHU A;  2WU2 A;  2R4E A;  4GDP A;  2GR2 A;  2YG7 A;  3CGB A;  4GR1 A;  1ZOY A;  1GT8 A;  2JB1 A;  4IA6 A;  1TDN A;  4MJW A;  5ER0 A;  3RED A;  1B8S A;  1CJ2 A;  1EBD A;  2VVL G;  2WEU A;  2WOI A;  3M12 A;  4LII A;  3NIX A;  2VVM A;  2PHH A;  2R0G A;  3VQR A;  4G6H A;  4RSL A;  4REK A;  1PBD A;  3AXB A;  4JN9 A;  4X9N A;  1MO9 A;  3L8K A;  1D7L A;  2DKH A;  4C77 A;  1RYI A;  2GH5 A;  3ATR A;  2C76 A;  5BRT A;  1TYT A;  1GER A;  3D1C A;  3NK0 X;  4U8L A;  1QO8 A;  2YG6 A;  5FMH A;  3UOZ A;  2W0H A;  4FK1 C;  1XHC A;  2Q6U A;  3AED A;  2WBA A;  3FPZ A;  4PAB A;  5KOW A;  4U2S A;  4Z2T A;  3CTY A;  2C4C A;  4GAV A;  3GYJ A;  3M13 A;  2JB2 A;  3NG7 X;  2WOV A;  4H4V A;  1YQ3 A;  4O5U A;  4XWR A;  4M52 A;  3UOV A;  3DJE A;  3KD9 A;  3SM8 A;  2ACZ A;  3I3L A;  2R9Z A;  4A6N B;  4JNA A;  1JRZ A;  5C3J A;  5GRT A;  3T2K A;  2C75 A;  4U8P A;  3SQP A;  1PBE A;  3UKQ A;  5FS7 A;  2GEW A;  1F8W A;  1GRE A;  2WES A;  3ALM A;  1JRY A;  2C72 A;  3T31 A;  4C74 A;  1VG0 A;  1IUT A;  1H6V A;  2XFN A;  2Q0K A;  4AP3 A;  3ABV A;  4H4Y A;  3CIR A;  1NHP A;  5EBK A;  1JNR A;  5KMQ A;  3SFD A;  3AEA A;  2GV8 A;  3QSS A;  4AOX A;  2C7G A;  3K30 A;  3T2Y A;  1DOD A;  2C67 A;  1COY A;  3HYV A;  2QCU A;  2GAG B;  1NHQ A;  3CNP A;  4TM3 A;  2NVK X;  5C2T A;  3CNS A;  3AEF A;  2Q7V A;  2XFQ A;  3DJJ A;  5U25 A;  1P2H A;  2CFY A;  1MOK A;  1NHR A;  2AR8 A;  2BK5 A;  1PHH A;  2I0Z A;  2JKC A;  3OZ2 A;  4J56 A;  3UOX A;  3AE1 A;  4JNQ A;  4D04 A;  4DGK A;  1EL9 A;  3H8I A;  1H86 A;  2EQ9 A;  4IVO B;  2WQY A;  4YTM A;  3ADA B;  3R9U A;  4EQX A;  5FS6 A;  1AOG A;  2BXR A;  1OJ9 A;  2IID A;  3JSK A;  1H81 A;  3LJP A;  4O5Q A;  1BF3 A;  1DOC A;  3COX A;  3KPF A;  5KXJ A;  1E6E A;  2E5V A;  4LA1 A;  3BNU A;  1E1N A;  3AD8 B;  1EL5 A;  3IWA A;  3AE3 A;  4B63 A;  3E1T A;  3DJG X;  3EPT A;  1B37 A;  1N4V A;  4Y4L A;  2GAH B;  2XLR A;  1F8S A;  3DK4 A;  1NAA A;  2VQB A;  3ICS A;  3H8L A;  3ISH A;  2A87 A;  1K0J A;  4UDQ A;  1KNP A;  2V3A A;  3SZ0 A;  2C70 A;  3S61 A;  1NPX A;  1EL7 A;  2FJA A;  1LVL A;  3BHK A;  3ICR A;  5CQF A;  4OPD A;  1ZKQ A;  3NYF A;  2Z5Y A;  2V61 A;  4YSH A;  4H2Q A;  1XDI A;  4ICY A;  4EQR A;  4K2X A;  1O5W A;  2AAQ A;  2B9Y A;  4LU6 A;  4BJY A;  1FEC A;  2BS3 A;  2WDR A;  4OPU A;  4HB9 A;  2YQU A;  3EAO A;  1ONF A;  3CMM A;  3GYI A;  4CY8 A;  2IVE A;  1GOS A;  1H82 A;  2FBW A;  2JB3 A;  3Q9T A;  1PBC A;  1GXF A;  3T2Z A;  1F8R A;  1CJC A;  4U8M A;  4H7U A;  1B4V A;  5L46 A;  2CDU A;  1OJA A;  4I59 A;  4K8D A;  3HYX A;  1K0L A;  3CGD A;  4H4Z A;  2BS2 A;  2QAE A;  2YVJ A;  1O94 A;  2WU5 A;  3UTE A;  4KX6 A;  1LV0 A;  1P2E A;  3QFB A;  5U1O A;  1NEK A;  4ZCD A;  3RP7 A;  3NN6 X;  5FS9 A;  3FMW A;  3V76 A;  2JBV A;  1REO A;  3KKJ A;  4C5O A;  4X4J A;  2RAB A;  3V3N A;  1FL2 A;  2B7S A;  1D4D A;  4H4P A;  1OJD A;  1TDK A;  4NZH A;  3B3R A;  4APN A;  3O0H A;  3T0K A;  3IHM A;  2Y6R A;  3P9U A;  3K7Q X;  4EM4 A;  5BUK A;  5JCL A;  2GR0 A;  3G5R A;  3KU9 A;  3GRT A;  4OPG A;  1E1L A;  3NRN A;  2VVL A;  5KOX A;  4U8K A;  1PBF A;  2BC0 A;  3NKS A;  2WPF A;  2XLS A;  4YSY A;  3SX6 A;  1F6M A;  1LJ1 A;  2C3C A;  3H4K A;  3C96 A;  3AEE A;  3BHF A;  3AE9 A;  4FK1 A;  1GV4 A;  5HXI A;  2BAC A;  1NG4 A;  4OVI A;  1BWC A;  3EAN A;  2R46 A;  4H4R A;  3AD7 B;  4G6G A;  2GF3 A;  3CGE A;  1KSS A;  3LOV A;  4X9M A;  2ARD A;  2C3D A;  3GRS A;  5GSN A;  4CRT A;  2WET A;  1JNZ A;  2YAU A;  2ZBW A;  3D8X A;  1CJ3 A;  1E39 A;  1H7X A;  1TDE A;  4OPT A;  2E4G A;  5BVA A;  1FEB A;  5EB5 A;  2EQ7 A;  3SFE A;  1V59 A;  2V6O A;  4EQS A;  2UZZ A;  4A79 A;  2BRY A;  1DOE A;  2WDV A;  2X8H A;  2QA1 A;  1X31 B;  4OPI A;  3OC4 A;  4WCT A;  1ELI A;  1KSU A;  1Y0P A;  4G9K A;  4Z44 A;  2R0C A;  2GVC A;  2C66 A;  2GMJ A;  4GAP A;  1E1K A;  3LZX A;  3ALJ A;  4I58 A;  1Q1W A;  4FDC B;  5BUL A;  4D03 A;  4B65 A;  5DBJ A;  3AE2 A;  2APG A;  4A6N A;  2WHD A;  5FS8 A;  3PVC A;  2B9X A;  4K7Z A;  3NK1 X;  4U8N A;  4TLX A;  3AE6 A;  4J33 A;  4USR A;  5IQ4 A;  4H4Q A;  1E7P A;  4J34 A;  1IJH A;  4EIP A;  4CCR A;  1KDG A;  2YVF A;  1D4E A;  2OLN A;  4YSX A;  1K0I A;  2Q0L A;  2WS3 A;  3AWI A;  3WE0 A;  3FBS A;  1L9D A;  3P4Q A;  4K22 A;  1ZY8 A;  1XAN A;  1BZL A;  3UKH A;  3DGZ A;  5J60 A;  3ATQ A;  2TPR A;  1S3E A;  3G5S A;  4YTP A;  4XWZ A;  2R45 A;  2NPX A;  1L0V A;  1S3B A;  3LAD A;  3BI2 A;  1IUV A;  1Y56 A;  4XXG A;  3UKL A;  2RGJ A;  4A99 A;  1Q9I A;  2BCP A;  2IVD A;  2V3B A;  3DME A;  3SY4 A;  4ZCC A;  1TRB A;  4EMJ A;  2R4J A;  3Q6J A;  4H2P A;  4GCM A;  1E1M A;  1GRF A;  1PS9 A;  3NN0 X;  3P4R A;  3VRB A;  4CCQ A;  1GTH A;  4EM3 A;  3LZW A;  4P9S A;  2YG4 A;  2YWL A;  1N4W A;  4H50 A;  2H88 A;  2GR1 A;  4ECH A;  3AB1 A;  2YM2 A;  4NNJ A;  1OJC A;  3PS9 A;  3CND A;  1L9C A;  4CBQ A;  2EQ8 A;  2YLT A;  3UTG A;  1ZP0 A;  3AYL A;  3CN8 A;  4YXD A;  1CJ4 A;  1MXT A;  3K7T A;  1PXC A;  4NTC A;  2BRA A;  1M64 A;  3GYX A;  4J31 A;  4DSH A;  4AOS A;  1TYP A;  3C4N A;  3GD3 A;  3SZF A;  1JOA A;  2FJE A;  4U8O A;  3URH A;  1QJD A;  1YY5 A;  3K7M X;  5KMS A;  3KPK A;  2GQW A;  2XLU A;  2XCG A;  3ALL A;  2GMH A;  3UKA A;  4K5R A;  3VR9 A;  1NDA A;  1VDC A;  2B7R A;  2J3N A;  3SGL A;  1CC4 A;  5HHF A;  3KVE A;  2Y6Q A;  4H4T A;  4NWZ A;  1BGJ A;  4EIQ A;  1D4C A;  4Z24 A;  3DJD A;  3FG2 P;  4USQ A;  3LB8 A;  3IF9 A;  5M10 A;  1GAL A;  2BAB A;  3GD4 A;  1O95 A;  4U8I A;  2JAE A;  5HYM A;  1LPF A;  2R0P A;  2XLP A;  4BV6 A;  1CL0 A;  3AD9 B;  3NGC X;  4EQW A;  3CNT A;  3VRD B;  3RP6 A;  4J2W A;  4II3 A;  3UTF A;  1HYU A;  2CUL A;  3BI4 A; 
#chains in the Genus database with same CATH homology
 4NTD A;  1XPQ A;  4EMI A;  3EF6 A;  1DJQ A;  4BJZ A;  1D7Y A;  2C64 A;  3SZW A;  1ZMD A;  4B64 A;  2YLX A;  3DH9 A;  5EB4 A;  3AYI A;  4IV9 A;  5KNL A;  4GDE A;  4GUV A;  1ZMC A;  1SEZ A;  2RGH A;  3CPH G;  3DK9 A;  3NH3 X;  1CF3 A;  1CC6 A;  2FJD A;  3ZDN A;  5JCN A;  4J36 A;  1PDH A;  4AT0 A;  2YG5 A;  5KRQ A;  3F8R A;  2BXS A;  4BUR A;  4FX9 A;  5LV9 A;  4TM4 A;  3NTD A;  1DNC A;  5TR3 A;  4B68 A;  1VRQ B;  4GF7 A;  2VRM A;  1VG9 A;  2BYB A;  2VZ2 A;  2YLR A;  2YR4 A;  2ZZC A;  3P1W A;  1YKJ A;  4G74 A;  4UP3 A;  5JCM A;  4H4U A;  2YLW A;  3NYC A;  2X50 A;  3AEG A;  3NNE A;  4U2L A;  3AE7 A;  3NTA A;  3G5Q A;  1GPE A;  4AT2 A;  2RGO A;  3AEB A;  4YKF A;  5M0Z A;  2GB0 A;  1N1P A;  2WP9 A;  2XYO A;  1KF6 A;  1PJ5 A;  3GMC A;  2XVE A;  3VR8 A;  4ADW A;  2C65 A;  1DOB A;  3GWF A;  3FIM B;  2BCG G;  4WX1 A;  1FOH A;  2WPE A;  4BK2 A;  5JCK A;  3P4P A;  2BS4 A;  3RP8 A;  4ZN0 A;  3CPI G;  1D5T A;  5KVH A;  1IUW A;  4AP1 A;  2BK4 A;  5HY5 A;  4NTE A;  3B6D A;  3CPJ G;  1TDF A;  1DJN A;  1PJ7 A;  4U2T A;  1NEN A;  4PAA A;  1GTE A;  1Z6L A;  3NT6 A;  4IVM B;  4C3Y A;  1GRH A;  1JRX A;  3UTH A;  2X8G A;  3AYJ A;  4OCG A;  2WP6 A;  3IC9 A;  1KFY A;  1GRB A;  5KVI A;  2PYX A;  3AE5 A;  1IUU A;  2XVI A;  4A5L A;  1GSN A;  2XDO A;  4OPC A;  3QJ4 A;  3PO7 A;  1FCD A;  1GND A;  2C73 A;  2WDQ A;  2X99 A;  4Z26 A;  2YR5 A;  4B66 A;  2OAM A;  3F8P A;  2VRL A;  1JU2 A;  1YQ4 A;  1OJT A;  2A8X A;  1PJ6 A;  3AE4 A;  4A9W A;  2XFU A;  4Y4N A;  4RG4 A;  2VOU A;  4Y4M A;  3QSM A;  1PN0 A;  1LQT A;  4H2R A;  3GDP A;  1UKV G;  2ZZ0 A;  4H2N A;  4JQ9 A;  4RG3 A;  3GSI A;  3UKF A;  1K4Q A;  3NYE A;  4Z25 A;  3VRA A;  3ITJ A;  3DK8 A;  4UDR A;  1GRA A;  4HA6 A;  4B1B A;  3UCL A;  2GQF A;  2Z5X A;  1JEH A;  2YM1 A;  4A65 A;  2BC1 A;  4BK3 A;  1PXA A;  2B9W A;  4A7A A;  4DSG A;  3HYW A;  2A89 A;  4JY2 A;  1Y56 B;  5U63 A;  1GEU A;  2EQ6 A;  4CY6 A;  1PBB A;  3NHO X;  1H83 A;  4BK1 A;  2B76 A;  4E0V A;  2VQ7 A;  4Z2U A;  1NHS A;  1IUX A;  2XLT A;  4UDP A;  4YSZ A;  2X3N A;  4EMW A;  3P4S A;  5IPY A;  1GES A;  1EL8 A;  1H7W A;  1DXL A;  3UKK A;  4C3X A;  4G73 A;  1B5Q A;  1CC2 A;  3CGC A;  4H4S A;  3IHG A;  3HZL A;  4JDR A;  2OAL A;  3QSE A;  5IQ1 A;  1F3P A;  3BI5 A;  2XFO A;  3RNM A;  3AE8 A;  4YTN A;  1GET A;  3II4 A;  4TLZ A;  5J7X A;  4OPL A;  2YR6 A;  3V3O A;  5KWF A;  2CVJ A;  4H4W A;  2O9Z A;  3QVR A;  4YT0 A;  1KNR A;  1TDO A;  2E1M A;  3DGH A;  1H84 A;  1YQZ A;  4Z43 A;  2JK6 A;  2YG3 A;  3NK2 X;  3BNM A;  1LTX R;  2XVJ A;  2XVH A;  2BA9 A;  2WP5 A;  1N4U A;  1ZOV A;  2FJB A;  4DNA A;  3KLJ A;  2XFP A;  3QFA A;  3GMB A;  4GRT A;  2AQJ A;  3GWD A;  3NLC A;  3QVP A;  4B69 A;  2V60 A;  1CBO A;  1GRT A;  3M0O A;  4Z2R A;  1ZK7 A;  1NG3 A;  3C4A A;  3UP4 A;  2QA2 A;  2GRT A;  3ZYX A;  5KMP A;  1IUS A;  2DKI A;  2X8C A;  4N9X A;  1LQU A;  4K5S A;  1BKW A;  1S2Y A;  1QLB A;  2GR3 A;  3I6D A;  5CKU A;  4CNK A;  1RP0 A;  4NEW A;  2HQM A;  1PXB A;  2WPC A;  4YWO A;  1ZDL A;  3T37 A;  4B67 A;  3SXI A;  2F5Z A;  1GRG A;  2WOW A;  4H4X A;  4TM1 A;  1VQW A;  2XVF A;  2OA1 A;  2TMD A;  4JY3 A;  1M6I A;  1ZX9 A;  2V5Z A;  1W4X A;  2YVG A;  3ICT A;  1RSG A;  3RHA A;  2YLZ A;  2OLO A;  4IA5 A;  1FEA A;  2BK3 A;  3SZC A;  3SYI A;  3AEC A;  4YKG A;  3L1R A;  3GDN A;  4KPR A;  4U8J A;  5KMR A;  2ZZB A;  3CNJ A;  1Q1R A;  1BGN A;  4J57 A;  3T14 A;  4TM0 A;  2H89 A;  4NEV A;  4II2 A;  3UKP A;  3KA7 A;  3UP5 A;  3DA1 A;  5EOW A;  3S5W A;  3LXD A;  3UOY A;  2YLS A;  4CNJ A;  1S2Q A;  3F8D A;  1L9E A;  5JCI A;  1CHU A;  2WU2 A;  2R4E A;  4GDP A;  2GR2 A;  2YG7 A;  3CGB A;  4GR1 A;  1ZOY A;  1GT8 A;  2JB1 A;  4IA6 A;  1TDN A;  4MJW A;  5ER0 A;  3RED A;  1B8S A;  1CJ2 A;  1EBD A;  2VVL G;  2WEU A;  2WOI A;  3M12 A;  4LII A;  3NIX A;  2VVM A;  2PHH A;  2R0G A;  3VQR A;  4G6H A;  4RSL A;  4REK A;  1PBD A;  3AXB A;  4JN9 A;  4X9N A;  1MO9 A;  3L8K A;  1D7L A;  2DKH A;  4C77 A;  1RYI A;  2GH5 A;  3ATR A;  2C76 A;  5BRT A;  1TYT A;  1GER A;  3D1C A;  3NK0 X;  4U8L A;  1QO8 A;  2YG6 A;  5FMH A;  3UOZ A;  2W0H A;  4FK1 C;  1XHC A;  2Q6U A;  3AED A;  2WBA A;  3FPZ A;  4PAB A;  5KOW A;  4U2S A;  4Z2T A;  3CTY A;  2C4C A;  4GAV A;  3GYJ A;  3M13 A;  2JB2 A;  3NG7 X;  2WOV A;  4H4V A;  1YQ3 A;  4O5U A;  4XWR A;  4M52 A;  3UOV A;  3DJE A;  3KD9 A;  3SM8 A;  2ACZ A;  3I3L A;  2R9Z A;  4A6N B;  4JNA A;  1JRZ A;  5C3J A;  5GRT A;  3T2K A;  2C75 A;  4U8P A;  3SQP A;  1PBE A;  3UKQ A;  5FS7 A;  2GEW A;  1F8W A;  1GRE A;  2WES A;  3ALM A;  1JRY A;  2C72 A;  3T31 A;  4C74 A;  1VG0 A;  1IUT A;  1H6V A;  2XFN A;  2Q0K A;  4AP3 A;  3ABV A;  4H4Y A;  3CIR A;  1NHP A;  5EBK A;  1JNR A;  5KMQ A;  3SFD A;  3AEA A;  2GV8 A;  3QSS A;  4AOX A;  2C7G A;  3K30 A;  3T2Y A;  1DOD A;  2C67 A;  1COY A;  3HYV A;  2QCU A;  2GAG B;  1NHQ A;  3CNP A;  4TM3 A;  2NVK X;  5C2T A;  3CNS A;  3AEF A;  2Q7V A;  2XFQ A;  3DJJ A;  5U25 A;  1P2H A;  2CFY A;  1MOK A;  1NHR A;  2AR8 A;  2BK5 A;  1PHH A;  2I0Z A;  2JKC A;  3OZ2 A;  4J56 A;  3UOX A;  3AE1 A;  4JNQ A;  4D04 A;  4DGK A;  1EL9 A;  3H8I A;  1H86 A;  2EQ9 A;  4IVO B;  2WQY A;  4YTM A;  3ADA B;  3R9U A;  4EQX A;  5FS6 A;  1AOG A;  2BXR A;  1OJ9 A;  2IID A;  3JSK A;  1H81 A;  3LJP A;  4O5Q A;  1BF3 A;  1DOC A;  3COX A;  3KPF A;  5KXJ A;  1E6E A;  2E5V A;  4LA1 A;  3BNU A;  1E1N A;  3AD8 B;  1EL5 A;  3IWA A;  3AE3 A;  4B63 A;  3E1T A;  3DJG X;  3EPT A;  1B37 A;  1N4V A;  4Y4L A;  2GAH B;  2XLR A;  1F8S A;  3DK4 A;  1NAA A;  2VQB A;  3ICS A;  3H8L A;  3ISH A;  2A87 A;  1K0J A;  4UDQ A;  1KNP A;  2V3A A;  3SZ0 A;  2C70 A;  3S61 A;  1NPX A;  1EL7 A;  2FJA A;  1LVL A;  3BHK A;  3ICR A;  5CQF A;  4OPD A;  1ZKQ A;  3NYF A;  2Z5Y A;  2V61 A;  4YSH A;  4H2Q A;  1XDI A;  4ICY A;  4EQR A;  4K2X A;  1O5W A;  2AAQ A;  2B9Y A;  4LU6 A;  4BJY A;  1FEC A;  2BS3 A;  2WDR A;  4OPU A;  4HB9 A;  2YQU A;  3EAO A;  1ONF A;  3CMM A;  3GYI A;  4CY8 A;  2IVE A;  1GOS A;  1H82 A;  2FBW A;  2JB3 A;  3Q9T A;  1PBC A;  1GXF A;  3T2Z A;  1F8R A;  1CJC A;  4U8M A;  4H7U A;  1B4V A;  5L46 A;  2CDU A;  1OJA A;  4I59 A;  4K8D A;  3HYX A;  1K0L A;  3CGD A;  4H4Z A;  2BS2 A;  2QAE A;  2YVJ A;  1O94 A;  2WU5 A;  3UTE A;  4KX6 A;  1LV0 A;  1P2E A;  3QFB A;  5U1O A;  1NEK A;  4ZCD A;  3RP7 A;  3NN6 X;  5FS9 A;  3FMW A;  3V76 A;  2JBV A;  1REO A;  3KKJ A;  4C5O A;  4X4J A;  2RAB A;  3V3N A;  1FL2 A;  2B7S A;  1D4D A;  4H4P A;  1OJD A;  1TDK A;  4NZH A;  3B3R A;  4APN A;  3O0H A;  3T0K A;  3IHM A;  2Y6R A;  3P9U A;  3K7Q X;  4EM4 A;  5BUK A;  5JCL A;  2GR0 A;  3G5R A;  3KU9 A;  3GRT A;  4OPG A;  1E1L A;  3NRN A;  2VVL A;  5KOX A;  4U8K A;  1PBF A;  2BC0 A;  3NKS A;  2WPF A;  2XLS A;  4YSY A;  3SX6 A;  1F6M A;  1LJ1 A;  2C3C A;  3H4K A;  3C96 A;  3AEE A;  3BHF A;  3AE9 A;  4FK1 A;  1GV4 A;  5HXI A;  2BAC A;  1NG4 A;  4OVI A;  1BWC A;  3EAN A;  2R46 A;  4H4R A;  3AD7 B;  4G6G A;  2GF3 A;  3CGE A;  1KSS A;  3LOV A;  4X9M A;  2ARD A;  2C3D A;  3GRS A;  5GSN A;  4CRT A;  2WET A;  1JNZ A;  2YAU A;  2ZBW A;  3D8X A;  1CJ3 A;  1E39 A;  1H7X A;  1TDE A;  4OPT A;  2E4G A;  5BVA A;  1FEB A;  5EB5 A;  2EQ7 A;  3SFE A;  1V59 A;  2V6O A;  4EQS A;  2UZZ A;  4A79 A;  2BRY A;  1DOE A;  2WDV A;  2X8H A;  2QA1 A;  1X31 B;  4OPI A;  3OC4 A;  4WCT A;  1ELI A;  1KSU A;  1Y0P A;  4G9K A;  4Z44 A;  2R0C A;  2GVC A;  2C66 A;  2GMJ A;  4GAP A;  1E1K A;  3LZX A;  3ALJ A;  4I58 A;  1Q1W A;  4FDC B;  5BUL A;  4D03 A;  4B65 A;  5DBJ A;  3AE2 A;  2APG A;  4A6N A;  2WHD A;  5FS8 A;  3PVC A;  2B9X A;  4K7Z A;  3NK1 X;  4U8N A;  4TLX A;  3AE6 A;  4J33 A;  4USR A;  5IQ4 A;  4H4Q A;  1E7P A;  4J34 A;  1IJH A;  4EIP A;  4CCR A;  1KDG A;  2YVF A;  1D4E A;  2OLN A;  4YSX A;  1K0I A;  2Q0L A;  2WS3 A;  3AWI A;  3WE0 A;  3FBS A;  1L9D A;  3P4Q A;  4K22 A;  1ZY8 A;  1XAN A;  1BZL A;  3UKH A;  3DGZ A;  5J60 A;  3ATQ A;  2TPR A;  1S3E A;  3G5S A;  4YTP A;  4XWZ A;  2R45 A;  2NPX A;  1L0V A;  1S3B A;  3LAD A;  3BI2 A;  1IUV A;  1Y56 A;  4XXG A;  3UKL A;  2RGJ A;  4A99 A;  1Q9I A;  2BCP A;  2IVD A;  2V3B A;  3DME A;  3SY4 A;  4ZCC A;  1TRB A;  4EMJ A;  2R4J A;  3Q6J A;  4H2P A;  4GCM A;  1E1M A;  1GRF A;  1PS9 A;  3NN0 X;  3P4R A;  3VRB A;  4CCQ A;  1GTH A;  4EM3 A;  3LZW A;  4P9S A;  2YG4 A;  2YWL A;  1N4W A;  4H50 A;  2H88 A;  2GR1 A;  4ECH A;  3AB1 A;  2YM2 A;  4NNJ A;  1OJC A;  3PS9 A;  3CND A;  1L9C A;  4CBQ A;  2EQ8 A;  2YLT A;  3UTG A;  1ZP0 A;  3AYL A;  3CN8 A;  4YXD A;  1CJ4 A;  1MXT A;  3K7T A;  1PXC A;  4NTC A;  2BRA A;  1M64 A;  3GYX A;  4J31 A;  4DSH A;  4AOS A;  1TYP A;  3C4N A;  3GD3 A;  3SZF A;  1JOA A;  2FJE A;  4U8O A;  3URH A;  1QJD A;  1YY5 A;  3K7M X;  5KMS A;  3KPK A;  2GQW A;  2XLU A;  2XCG A;  3ALL A;  2GMH A;  3UKA A;  4K5R A;  3VR9 A;  1NDA A;  1VDC A;  2B7R A;  2J3N A;  3SGL A;  1CC4 A;  5HHF A;  3KVE A;  2Y6Q A;  4H4T A;  4NWZ A;  1BGJ A;  4EIQ A;  1D4C A;  4Z24 A;  3DJD A;  3FG2 P;  4USQ A;  3LB8 A;  3IF9 A;  5M10 A;  1GAL A;  2BAB A;  3GD4 A;  1O95 A;  4U8I A;  2JAE A;  5HYM A;  1LPF A;  2R0P A;  2XLP A;  4BV6 A;  1CL0 A;  3AD9 B;  3NGC X;  4EQW A;  3CNT A;  3VRD B;  3RP6 A;  4J2W A;  4II3 A;  3UTF A;  1HYU A;  2CUL A;  3BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...