3R9UA

Thioredoxin-disulfide reductase from campylobacter jejuni.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
314
structure length
314
Chain Sequence
SNAMLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSEIENYPGVAQVMDGISFMAPWSEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELAKAVIVCTGSAPKKAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYLANICSKIYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVAGVKVKLKDGSIRDLNVPGIFTFVGLNVRNEILKQDDSKFLCNMEEGGQVSVDLKMQTSVAGLFAAGDLRKDAPKQVICAAGDGAVAALSAMAYIESL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thioredoxin-disulfide reductase from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
total genus 86
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3r9uA02
2YG4A 3AEDA 1K0IA 4U8JA 1M6IA 2X50A 3SFDA 3EAOA 1RSGA 1ZOYA 2RGJA 2OA1A 4NTCA 4JY3A 2GMJA 2A8XA 2XLRA 1E7PA 4C3XA 5EOWA 4CNJA 1DODA 1VQWA 2VOUA 1CL0A 3CTYA 4J2WA 1GSNA 4EM4A 2QA2A 2XFUA 3CNJA 2YR4A 4DSGA 5BRTA 1E1LA 2VVLA 3KD9A 3G5RA 2XFPA 2ACZA 2QCUA 4PAAA 1F8WA 4A5LA 1H6VA 5IPYA 1KF6A 3UKKA 3AE7A 4RG4A 1GRAA 2WDRA 1PN0A 2R0PA 1P2HA 2XFNA 4JN9A 4TLZA 4REKA 5J7XA 1ZMCA 3H8IA 4U2LA 3DGZA 3CNTA 3NT6A 1FEBA 2R0CA 4AOXA 3AE9A 3CPJG 1GOSA 3AXBA 3AE4A 4KX6A 4U8LA 4A9WA 3K7MX 4EQXA 3UOYA 1Y56A 1F8SA 2WEUA 4ICYA 4U8IA 5KOWA 2YQUA 4O5QA 3AEGA 1QLBA 2C65A 2H88A 4GCMA 2GH5A 3F8DA 3NN6X 1IJHA 1E6EA 2WDQA 2WPCA 2WETA 4K5SA 4Y4MA 1EBDA 3P4RA 2F5ZA 2VZ2A 3KKJA 1YQ4A 3UOVA 2YVGA 4WX1A 1EL9A 2R45A 3AWIA 4CRTA 3V3OA 2UZZA 1YKJA 1TYPA 1DOCA 2VVMA 5FS8A 1EL8A 3NK1X 4C77A 1YQZA 3AE8A 2YVFA 3G5SA 1PBDA 2GAGB 3BHFA 1Q1RA 3GWFA 3PS9A 3DGHA 4K8DA 3QVPA 4P9SA 1S3BA 3VR8A 4APNA 5BVAA 2GAHB 3IWAA 4BK2A 3DA1A 2X99A 4YSXA 1FL2A 4GR1A 1H83A 2Q0LA 2Z5XA 4Z2RA 3FPZA 5BULA 3CPHG 3LB8A 1NHRA 3V3NA 3AB1A 4UDRA 1NDAA 3KLJA 3AD9B 4IA5A 1UKVG 2ZZ0A 4A7AA 3CNDA 4AT2A 1TDOA 1GTEA 2AR8A 2E5VA 4NTEA 1IUUA 2BABA 3BNUA 5FS7A 4CBQA 4U2TA 2V61A 1PBCA 1ZY8A 1ZOVA 4A65A 4H4XA 2WHDA 2CULA 2NPXA 4CCQA 2XYOA 3K7QX 2IIDA 2C7GA 1L9DA 3P4SA 2A89A 2GF3A 4FK1C 4GF7A 4H4RA 4BK1A 4C3YA 2OLOA 3BHKA 1GALA 1K4QA 4OPTA 4YTNA 2VRMA 2R46A 3NK0X 2RGOA 2XFOA 2PHHA 2PYXA 5GSNA 3CGEA 3S61A 3UCLA 3VRBA 3BI5A 1ZX9A 4I59A 2I0ZA 4Y4NA 2DKIA 2YLZA 1YY5A 1E1MA 1LPFA 1AOGA 1GRBA 1ZKQA 4ZCCA 4A79A 4U2SA 4ADWA 4B68A 2ZZBA 3ZDNA 1PJ7A 3P9UA 3UTEA 4I58A 2XFQA 3K7TA 4AOSA 1E39A 2BYBA 3GDNA 1PBBA 2BS2A 3B6DA 4Z44A 3B3RA 3H4KA 3COXA 4YTMA 2E1MA 2YLSA 2R4JA 5JCNA 1CC2A 3GYJA 4H4TA 1PDHA 4USQA 3O0HA 3GSIA 3IHMA 2RGHA 1DOBA 5U63A 3DJDA 5KWFA 4X9MA 2R9ZA 2NVKX 2C73A 4H4WA 4OPIA 2YM1A 3CPIG 3LOVA 1GERA 1GNDA 3GRTA 5DBJA 3FBSA 2EQ9A 2OLNA 4EMWA 1B4VA 1GREA 1DJQA 3CGBA 3NHOX 3UKAA 1GTHA 2B7SA 3DK9A 3NYCA 4B63A 1ONFA 1PXAA 3AYIA 1FOHA 1REOA 3NG7X 1O5WA 3AE5A 4Z2UA 1E1KA 3AD8B 2GR0A 4TM4A 3M13A 4K2XA 1VRQB 1KSUA 2V60A 1KDGA 1B8SA 3UKLA 3V76A 1Z6LA 3VRDB 1D7LA 1H81A 1HYUA 3LZXA 1FEAA 4ECHA 5KVIA 3NYFA 4H2RA 5FMHA 1LQTA 1NHSA 3UTFA 4AP3A 1E1NA 1ZMDA 2Q7VA 4XWZA 4EMJA 4CCRA 5M10A 1DNCA 3Q6JA 1BGNA 2TMDA 1ZP0A 1L0VA 3AYJA 2YLWA 2WP9A 3UP4A 1NENA 1D7YA 1KNRA 3AYLA 3QSSA 4TLXA 4H4UA 2XVJA 2EQ8A 1LV0A 2JB3A 1GEUA 3AECA 5BUKA 3G5QA 3ATQA 4Z43A 2WU5A 1N1PA 1F3PA 1H7XA 3GD3A 4U8MA 2BC1A 2JAEA 5IQ4A 1D5TA 3FMWA 1CHUA 3ICRA 1L9CA 3F8PA 4B66A 4JDRA 1FCDA 3EANA 4TM3A 4YSZA 5JCMA 4H4QA 4IVOB 1F8RA 2Q0KA 2FBWA 1CJ4A 4OPCA 2GQWA 2YG6A 3NIXA 3DJJA 1L9EA 3KVEA 4JNQA 1CF3A 1GRGA 3KPFA 3LXDA 3GDPA 2WQYA 2RABA 2Q6UA 4J57A 3AE3A 3REDA 2C3DA 1PS9A 1XPQA 4Z24A 3NTDA 2YG3A 4BK3A 1XDIA 4XWRA 3UOXA 1NPXA 4H50A 4B1BA 1OJ9A 2OAMA 3H8LA 4HA6A 4NZHA 4OPUA 1P2EA 1GRFA 4A6NB 2C64A 2FJDA 4OPDA 3PVCA 4D03A 2FJBA 3II4A 2TPRA 3NTAA 2BACA 5ER0A 4YSHA 1COYA 1JNRA 1JRXA 1DOEA 2XLPA 3VRAA 3CGCA 2B76A 1O95A 2XLTA 2YLXA 4JY2A 4OPGA 4J31A 1TDKA 1VDCA 2WU2A 1IUSA 3RHAA 1GESA 2GVCA 2JBVA 4X4JA 4N9XA 2GRTA 1V59A 3AE2A 1N4WA 3C96A 4J36A 4AP1A 1TYTA 4U8PA 2X8CA 3GRSA 1GRHA 4K22A 1F6MA 1KFYA 2GMHA 3ADAB 4A99A 2JKCA 3T37A 3P4QA 2QAEA 1H7WA 1N4UA 3ALJA 3QSMA 1QO8A 1N4VA 3EF6A 2HQMA 1RYIA 3CGDA 5KOXA 3ABVA 2JB1A 1OJAA 5TR3A 4H4YA 3URHA 1ZDLA 4YSYA 2B7RA 2IVEA 3ITJA 3LJPA 1TDNA 1JRYA 1PJ5A 4EMIA 2R4EA 2BCGG 1LVLA 1LTXR 4GRTA 1W4XA 1PBFA 4YXDA 3IC9A 1JU2A 2C3CA 3L1RA 2YR5A 3P1WA 1S2YA 2X8GA 1MO9A 4B69A 2J3NA 4CY6A 1CJCA 3QFBA 4KPRA 4JQ9A 1LJ1A 2WOVA 3FIMB 4H2PA 2WS3A 3PO7A 4CY8A 1Y56B 2ZZCA 4BURA 1JNZA 3DK8A 5JCIA 4DGKA 4IA6A 4TM1A 1H86A 3D1CA 1M64A 3D8XA 3FG2P 2WP6A 4GDEA 4H4SA 4Y4LA 3SGLA 4K5RA 1PJ6A 1NHPA 2APGA 4H4PA 4IVMB 2YLRA 2YM2A 2W0HA 2BA9A 2GR2A 4LU6A 1D4DA 4FDCB 1D4CA 3ICSA 5KRQA 3EPTA 4Z25A 4YT0A 3JSKA 1H84A 1VG9A 2DKHA 2GEWA 1B37A 4H7UA 3L8KA 3SQPA 4BJZA 1NG4A 4C5OA 4X9NA 4U8NA 1TRBA 4YWOA 4JNAA 2AQJA 1GPEA 5U25A 4EIPA 4USRA 2VRLA 2C76A 2B9XA 2WP5A 3Q9TA 5C2TA 3KU9A 4E0VA 1GXFA 5L46A 3CNSA 4O5UA 2GR3A 3CN8A 4RG3A 4B65A 1QJDA 4ZN0A 2A87A 1IUTA 1BWCA 1CC6A 3I3LA 2BC0A 3DJGX 1BKWA 2CVJA 3DMEA 2V5ZA 1ZK7A 2FJEA 4J33A 2C75A 3ISHA 1CBOA 1GT8A 1BZLA 3DK4A 4NEWA 3AE1A 2Z5YA 4J34A 4DNAA 3ALMA 4GDPA 2WPEA 4H4ZA 4NTDA 4OVIA 1B5QA 1S2QA 1NAAA 2VQ7A 1MOKA 2ZBWA 3GWDA 3KA7A 1DXLA 4Z2TA 1XHCA 4HB9A 5JCLA 3VR9A 5HXIA 1CJ2A 2WPFA 4BJYA 3QSEA 2FJAA 2YLTA 1OJCA 4UP3A 3OC4A 4B67A 1OJTA 2VQBA 2YAUA 2XVFA 2YVJA 3RP7A 1K0LA 1DJNA 3NKSA 2V6OA 4K7ZA 3ATRA 4FK1A 3NNEA 5M0ZA 3UOZA 5HHFA 3GMBA 4M52A 4B64A 2WOIA 1VG0A 4U8KA 1IUWA 4YKGA 5LV9A 3WE0A 2BK3A 3UTGA 4A6NA 2YG7A 3S5WA 2BS3A 4ZCDA 3NYEA 3AEAA 1PXBA 3ZYXA 2QA1A 4H4VA 3UKHA 2C72A 2YG5A 3AEFA 1O94A 3CIRA 2GV8A 2B9YA 1MXTA 3SM8A 4TM0A 1YQ3A 3RNMA 1NEKA 5HY5A 2CFYA 1JOAA 2R0GA 4H2QA 3C4AA 5HYMA 3NK2X 4MJWA 2BCPA 1CJ3A 5GRTA 1SEZA 1BF3A 5C3JA 1EL7A 3UKPA 3I6DA 1FECA 3UKFA 3QJ4A 2O9ZA 3M0OA 3OZ2A 4PABA 4IV9A 2H89A 1D4EA 1Q1WA 2BXSA 5JCKA 1GETA 2ARDA 2YR6A 1KNPA 1IUXA 1LQUA 2C67A 3AE6A 4EIQA 4UDQA 3F8RA 4OCGA 2C70A 3UP5A 3NRNA 3GMCA 2GR1A 3RP8A 2B9WA 3VQRA 5KXJA 1TDFA 2V3AA 3LADA 4EQWA 2XCGA 1PXCA 4GUVA 2BXRA 1XANA 2WESA 2Y6RA 3BI2A 4H2NA 4U8OA 3QFAA 3AD7B 2IVDA 3M12A 3R9UA 3E1TA 5EBKA 3DJEA 3UKQA 3ICTA 2BK4A 5EB5A 3IHGA 5IQ1A 3NGCX 3BI4A 2EQ7A 2V3BA 4UDPA 1K0JA 4WCTA 5EB4A 1PBEA 3K30A 1Y0PA 4FX9A 2EQ6A 4J56A 5FS6A 4RSLA 4XXGA 3RP6A 2YWLA 1JRZA 2AAQA 2XLUA 4NEVA 5J60A 2Y6QA 3DH9A 1NHQA 3BNMA 4OPLA 4CNKA 4LA1A 4Z26A 3AEEA 3NLCA 2GQFA 3QVRA 1PHHA 1S3EA 2E4GA 2WBAA 1Q9IA 2JB2A 3C4NA 5CKUA 1IUVA 1RP0A 3CNPA 2VVLG 1BGJA 1OJDA 2WOWA 4YKFA 3AEBA 2BS4A 2JK6A 4DSHA 1NG3A 1JEHA 2C66A 1GRTA 2CDUA 4LIIA 3P4PA 5CQFA 5FS9A 3GD4A 3SFEA 1KSSA 3NH3X 5U1OA 4EM3A 4C74A 4EQSA 2GB0A 1TDEA 1H82A 3ALLA 1EL5A 3UTHA 1X31B 2XVIA 3IF9A 4AT0A 4D04A 2XLSA 2XVEA 1CC4A 2WDVA 3HZLA 5KVHA 4EQRA 4YTPA 2XVHA 3LZWA 3NN0X 2X8HA 4BV6A 3GYIA 2X3NA 2OALA 2BK5A 1ELIA 2XDOA 1GV4A
chains in the Genus database with same CATH superfamily
2YG4A 3AEDA 1K0IA 4U8JA 1M6IA 2X50A 3SFDA 3EAOA 1RSGA 1ZOYA 2RGJA 2OA1A 4NTCA 4JY3A 2GMJA 2A8XA 2XLRA 1E7PA 4C3XA 5EOWA 4CNJA 1DODA 1VQWA 2VOUA 1CL0A 3CTYA 4J2WA 1GSNA 4EM4A 2QA2A 2XFUA 3CNJA 2YR4A 4DSGA 5BRTA 1E1LA 2VVLA 3KD9A 3G5RA 2XFPA 2ACZA 2QCUA 4PAAA 1F8WA 4A5LA 1H6VA 5IPYA 1KF6A 3UKKA 3AE7A 4RG4A 1GRAA 2WDRA 1PN0A 2R0PA 1P2HA 2XFNA 4JN9A 4TLZA 4REKA 5J7XA 1ZMCA 3H8IA 4U2LA 3DGZA 3CNTA 3NT6A 1FEBA 2R0CA 4AOXA 3AE9A 3CPJG 1GOSA 3AXBA 3AE4A 4KX6A 4U8LA 4A9WA 3K7MX 4EQXA 3UOYA 1Y56A 1F8SA 2WEUA 4ICYA 4U8IA 3HYWA 2YQUA 4O5QA 3AEGA 5KOWA 1QLBA 2C65A 2H88A 4GCMA 4NWZA 2GH5A 3F8DA 3NN6X 1IJHA 1E6EA 2WDQA 2WPCA 2WETA 4K5SA 4Y4MA 1EBDA 3P4RA 2F5ZA 5KNLA 2VZ2A 3KKJA 1YQ4A 3UOVA 2YVGA 4WX1A 1EL9A 2R45A 5KMSA 3AWIA 4CRTA 3V3OA 2UZZA 1YKJA 1TYPA 1DOCA 2VVMA 5FS8A 1EL8A 3NK1X 4C77A 1YQZA 3AE8A 2YVFA 3G5SA 1PBDA 2GAGB 3BHFA 1Q1RA 3GWFA 3PS9A 3DGHA 4K8DA 3QVPA 4P9SA 1S3BA 3VR8A 4APNA 5BVAA 2GAHB 3IWAA 4BK2A 3DA1A 2X99A 4YSXA 1FL2A 4GR1A 1H83A 2Q0LA 2Z5XA 4Z2RA 3FPZA 5BULA 3CPHG 3LB8A 1NHRA 3V3NA 3AB1A 4UDRA 1NDAA 3KLJA 3AD9B 4IA5A 1UKVG 2ZZ0A 4A7AA 3CNDA 4AT2A 1TDOA 1GTEA 2AR8A 2E5VA 4NTEA 1IUUA 2BABA 3BNUA 5FS7A 4CBQA 4U2TA 2V61A 1PBCA 1ZY8A 1ZOVA 4A65A 4H4XA 4II2A 2WHDA 2CULA 2NPXA 4CCQA 2XYOA 3K7QX 2IIDA 2C7GA 1L9DA 3P4SA 2A89A 2GF3A 4FK1C 4GF7A 4H4RA 4BK1A 4C3YA 2OLOA 3BHKA 1GALA 1K4QA 4OPTA 4YTNA 2VRMA 2R46A 3NK0X 4II3A 2RGOA 2XFOA 2PHHA 2PYXA 5GSNA 3CGEA 3S61A 3UCLA 3VRBA 3BI5A 1ZX9A 4I59A 2I0ZA 4Y4NA 2DKIA 2YLZA 1YY5A 1E1MA 1LPFA 1AOGA 1GRBA 1ZKQA 4ZCCA 4A79A 4GAPA 4U2SA 4ADWA 4B68A 2ZZBA 3ZDNA 1PJ7A 3P9UA 3UTEA 4I58A 2XFQA 3K7TA 4AOSA 1E39A 2BYBA 3GDNA 1PBBA 2BRAA 2BS2A 3B6DA 4Z44A 3B3RA 3H4KA 3COXA 4YTMA 2E1MA 2YLSA 2R4JA 5JCNA 1CC2A 3GYJA 3T2KA 4H4TA 1PDHA 4USQA 3O0HA 3SYIA 3GSIA 3IHMA 2RGHA 1DOBA 5U63A 3DJDA 3SZWA 4X9MA 2R9ZA 5KWFA 2NVKX 2C73A 4H4WA 4OPIA 2YM1A 3CPIG 3LOVA 1GERA 1GNDA 3GRTA 5DBJA 5KMPA 3FBSA 2EQ9A 2OLNA 4EMWA 1B4VA 1GREA 1DJQA 3CGBA 3NHOX 3UKAA 1GTHA 2B7SA 3DK9A 3NYCA 4B63A 1ONFA 1PXAA 3AYIA 1FOHA 1REOA 3NG7X 1O5WA 3AE5A 4Z2UA 1E1KA 3AD8B 2GR0A 4TM4A 3M13A 4K2XA 1VRQB 1KSUA 2V60A 1KDGA 1B8SA 3UKLA 3V76A 1Z6LA 3VRDB 1D7LA 1H81A 1HYUA 3LZXA 1FEAA 4ECHA 5KVIA 3NYFA 4H2RA 5FMHA 1LQTA 1NHSA 3HYXA 3UTFA 4AP3A 1E1NA 1ZMDA 2Q7VA 2BRYA 4XWZA 4EMJA 4CCRA 5M10A 1DNCA 3Q6JA 1BGNA 2TMDA 1ZP0A 1L0VA 3AYJA 2YLWA 2WP9A 3UP4A 3SXIA 1NENA 1D7YA 1KNRA 3AYLA 3QSSA 4TLXA 4H4UA 2XVJA 2EQ8A 1LV0A 2JB3A 3T31A 1GEUA 3AECA 5BUKA 3G5QA 3ATQA 4Z43A 4G9KA 3T14A 2WU5A 3CMMA 1N1PA 1F3PA 1H7XA 3GD3A 4U8MA 2BC1A 2JAEA 5IQ4A 1D5TA 3FMWA 1CHUA 3ICRA 1L9CA 3F8PA 4B66A 4JDRA 1FCDA 3EANA 4TM3A 4YSZA 5JCMA 4H4QA 4IVOB 1F8RA 2Q0KA 2FBWA 1CJ4A 3GYXA 4GAVA 4OPCA 2GQWA 2YG6A 3NIXA 3DJJA 1L9EA 3KVEA 4JNQA 1CF3A 1GRGA 3KPFA 3LXDA 3GDPA 2WQYA 2RABA 2Q6UA 4J57A 3AE3A 3REDA 2C3DA 1PS9A 1XPQA 4Z24A 3NTDA 2YG3A 4BK3A 1XDIA 4XWRA 3UOXA 1NPXA 4H50A 4B1BA 1OJ9A 2OAMA 3H8LA 4HA6A 4NZHA 4OPUA 1P2EA 1GRFA 4A6NB 2C64A 2FJDA 4OPDA 3PVCA 4D03A 2FJBA 3II4A 2TPRA 3NTAA 2BACA 5ER0A 4YSHA 1COYA 3SY4A 1JNRA 1JRXA 1DOEA 2XLPA 3VRAA 3CGCA 2B76A 1O95A 2XLTA 2YLXA 4JY2A 4OPGA 4J31A 1TDKA 1VDCA 3KPKA 2WU2A 1IUSA 3RHAA 1GESA 2GVCA 2JBVA 4X4JA 4N9XA 2GRTA 4G74A 1V59A 3AE2A 1N4WA 3C96A 4J36A 4AP1A 1TYTA 4U8PA 2X8CA 3GRSA 1GRHA 4K22A 1F6MA 1KFYA 2GMHA 3ADAB 4A99A 2JKCA 4G6GA 3T37A 3P4QA 2QAEA 1H7WA 1N4UA 3ALJA 3QSMA 1QO8A 1N4VA 3EF6A 2HQMA 1RYIA 3CGDA 5KOXA 3ABVA 2JB1A 1OJAA 5TR3A 4H4YA 2C4CA 3URHA 1ZDLA 4YSYA 3T2YA 2B7RA 2IVEA 3ITJA 3LJPA 1TDNA 1JRYA 1PJ5A 4EMIA 2R4EA 2BCGG 1LVLA 1LTXR 4GRTA 1W4XA 1PBFA 4YXDA 3IC9A 1JU2A 2C3CA 3L1RA 2YR5A 3P1WA 1S2YA 2X8GA 1MO9A 4B69A 2J3NA 4CY6A 1CJCA 3QFBA 4KPRA 4JQ9A 1LJ1A 2WOVA 3FIMB 4H2PA 2WS3A 3PO7A 4CY8A 1Y56B 2ZZCA 4BURA 1JNZA 3DK8A 5JCIA 4DGKA 4IA6A 4TM1A 1H86A 3D1CA 1M64A 3D8XA 3FG2P 2WP6A 4GDEA 4H4SA 3HYVA 4Y4LA 3SGLA 4K5RA 1PJ6A 1NHPA 2APGA 4H4PA 4IVMB 2YLRA 2YM2A 2W0HA 2BA9A 2GR2A 4LU6A 1D4DA 4FDCB 1D4CA 3ICSA 5KRQA 3EPTA 3T2ZA 4Z25A 4YT0A 3JSKA 1H84A 1VG9A 2DKHA 2GEWA 1B37A 4H7UA 3L8KA 3SQPA 4BJZA 1NG4A 4C5OA 4X9NA 4U8NA 1TRBA 4YWOA 4JNAA 2AQJA 1GPEA 5U25A 4EIPA 4USRA 2VRLA 2C76A 2B9XA 2WP5A 3Q9TA 5C2TA 3KU9A 4E0VA 1GXFA 5L46A 3CNSA 4O5UA 2GR3A 3CN8A 4RG3A 4B65A 1QJDA 4ZN0A 2A87A 1IUTA 1BWCA 1CC6A 3I3LA 2BC0A 3DJGX 1BKWA 2CVJA 3DMEA 2V5ZA 1ZK7A 2FJEA 4J33A 2C75A 3ISHA 3SX6A 1CBOA 1GT8A 1BZLA 3DK4A 4NEWA 3AE1A 2Z5YA 4J34A 4DNAA 3ALMA 4GDPA 2WPEA 4H4ZA 4NTDA 4OVIA 1B5QA 1S2QA 1NAAA 2VQ7A 1MOKA 2ZBWA 3GWDA 3KA7A 1DXLA 4Z2TA 1XHCA 4HB9A 5JCLA 3VR9A 5HXIA 1CJ2A 2WPFA 4BJYA 3QSEA 2FJAA 2YLTA 1OJCA 4UP3A 3OC4A 4B67A 1OJTA 2VQBA 2YAUA 2XVFA 2YVJA 3RP7A 1K0LA 1DJNA 3NKSA 2V6OA 4K7ZA 3ATRA 4FK1A 3NNEA 5M0ZA 3UOZA 5HHFA 4G73A 3GMBA 4M52A 4B64A 2WOIA 1VG0A 4U8KA 1IUWA 3T0KA 4YKGA 5LV9A 3WE0A 2BK3A 3UTGA 4A6NA 2YG7A 3S5WA 2BS3A 4ZCDA 3NYEA 3AEAA 1PXBA 3ZYXA 2QA1A 4H4VA 3UKHA 2C72A 2YG5A 3AEFA 1O94A 3CIRA 2GV8A 2B9YA 1MXTA 3SM8A 4TM0A 1YQ3A 3RNMA 1NEKA 5HY5A 2CFYA 1JOAA 2R0GA 4H2QA 3C4AA 5HYMA 3NK2X 4MJWA 2BCPA 1CJ3A 5GRTA 1SEZA 1BF3A 5C3JA 1EL7A 3UKPA 3I6DA 1FECA 3UKFA 3QJ4A 2O9ZA 3M0OA 3OZ2A 4PABA 4IV9A 2H89A 1D4EA 1Q1WA 2BXSA 5JCKA 1GETA 2ARDA 2YR6A 1KNPA 1IUXA 1LQUA 2C67A 3AE6A 4EIQA 4UDQA 3SZFA 3F8RA 5KMQA 4OCGA 2C70A 3UP5A 3NRNA 3GMCA 2GR1A 3RP8A 2B9WA 3VQRA 5KXJA 1TDFA 2V3AA 3LADA 4NNJA 2XCGA 4EQWA 1PXCA 4GUVA 2BXRA 1XANA 2WESA 2Y6RA 3BI2A 4H2NA 4U8OA 3QFAA 3AD7B 2IVDA 3M12A 3R9UA 3E1TA 5EBKA 3DJEA 3UKQA 3ICTA 2BK4A 5EB5A 3IHGA 5IQ1A 3NGCX 3BI4A 2EQ7A 2V3BA 4UDPA 1K0JA 4WCTA 5EB4A 1PBEA 3K30A 1Y0PA 4FX9A 2EQ6A 4J56A 5FS6A 4RSLA 4G6HA 4XXGA 3RP6A 2YWLA 1JRZA 2AAQA 2XLUA 4NEVA 5J60A 5KMRA 2Y6QA 3DH9A 1NHQA 3BNMA 4OPLA 4CNKA 4LA1A 4Z26A 3AEEA 3NLCA 2GQFA 3QVRA 1PHHA 1S3EA 2E4GA 2WBAA 3SZCA 1Q9IA 2JB2A 3C4NA 5CKUA 1IUVA 1RP0A 3CNPA 2VVLG 1BGJA 1OJDA 2WOWA 4YKFA 3AEBA 2BS4A 2JK6A 4DSHA 1NG3A 1JEHA 2C66A 1GRTA 2CDUA 4LIIA 3P4PA 5CQFA 5FS9A 3SZ0A 3GD4A 3SFEA 1KSSA 3NH3X 5U1OA 4EM3A 4C74A 4EQSA 2GB0A 1TDEA 1H82A 3ALLA 1EL5A 3UTHA 1X31B 2XVIA 3IF9A 4AT0A 4D04A 2XLSA 2XVEA 1CC4A 2WDVA 3HZLA 5KVHA 4EQRA 4YTPA 2XVHA 3LZWA 3NN0X 2X8HA 4BV6A 3GYIA 2X3NA 2OALA 2BK5A 1ELIA 2XDOA 1GV4A
chains in the Genus database with same CATH topology
2YG4A 3AEDA 1K0IA 4U8JA 1M6IA 2X50A 3SFDA 3EAOA 1RSGA 1ZOYA 2RGJA 2OA1A 4NTCA 4JY3A 2GMJA 2A8XA 2XLRA 1E7PA 4C3XA 5EOWA 4CNJA 1DODA 1VQWA 2VOUA 1CL0A 3CTYA 4J2WA 1GSNA 4EM4A 2QA2A 2XFUA 3CNJA 2YR4A 4DSGA 5BRTA 1E1LA 2VVLA 3KD9A 3G5RA 2XFPA 2ACZA 2QCUA 4PAAA 1F8WA 4A5LA 1H6VA 5IPYA 1KF6A 3UKKA 3AE7A 4RG4A 1GRAA 2WDRA 1PN0A 2R0PA 1P2HA 2XFNA 4JN9A 4TLZA 4REKA 5J7XA 1ZMCA 3H8IA 4U2LA 3DGZA 3CNTA 3NT6A 1FEBA 2R0CA 4AOXA 3AE9A 3CPJG 1GOSA 3AXBA 3AE4A 4KX6A 4U8LA 4A9WA 3K7MX 4EQXA 3UOYA 1Y56A 1F8SA 2WEUA 4ICYA 4U8IA 3HYWA 2YQUA 4O5QA 3AEGA 5KOWA 1QLBA 2C65A 2H88A 4GCMA 4NWZA 2GH5A 3F8DA 3NN6X 1IJHA 1E6EA 2WDQA 2WPCA 2WETA 4K5SA 4Y4MA 1EBDA 3P4RA 2F5ZA 5KNLA 2VZ2A 3KKJA 1YQ4A 3UOVA 2YVGA 4WX1A 1EL9A 2R45A 5KMSA 3AWIA 4CRTA 3V3OA 2UZZA 1YKJA 1TYPA 1DOCA 2VVMA 5FS8A 1EL8A 3NK1X 4C77A 1YQZA 3AE8A 2YVFA 3G5SA 1PBDA 2GAGB 3BHFA 1Q1RA 3GWFA 3PS9A 3DGHA 4K8DA 3QVPA 4P9SA 1S3BA 3VR8A 4APNA 5BVAA 2GAHB 3IWAA 4BK2A 3DA1A 2X99A 4YSXA 1FL2A 4GR1A 1H83A 2Q0LA 2Z5XA 4Z2RA 3FPZA 5BULA 3CPHG 3LB8A 1NHRA 3V3NA 3AB1A 4UDRA 1NDAA 3KLJA 3AD9B 4IA5A 1UKVG 2ZZ0A 4A7AA 3CNDA 4AT2A 1TDOA 1GTEA 2AR8A 2E5VA 4NTEA 1IUUA 2BABA 3BNUA 5FS7A 4CBQA 4U2TA 2V61A 1PBCA 1ZY8A 1ZOVA 4A65A 4H4XA 4II2A 2WHDA 2CULA 2NPXA 4CCQA 2XYOA 3K7QX 2IIDA 2C7GA 1L9DA 3P4SA 2A89A 2GF3A 4FK1C 4GF7A 4H4RA 4BK1A 4C3YA 2OLOA 3BHKA 1GALA 1K4QA 4OPTA 4YTNA 2VRMA 2R46A 3NK0X 4II3A 2RGOA 2XFOA 2PHHA 2PYXA 5GSNA 3CGEA 3S61A 3UCLA 3VRBA 3BI5A 1ZX9A 4I59A 2I0ZA 4Y4NA 2DKIA 2YLZA 1YY5A 1E1MA 1LPFA 1AOGA 1GRBA 1ZKQA 4ZCCA 4A79A 4GAPA 4U2SA 4ADWA 4B68A 2ZZBA 3ZDNA 1PJ7A 3P9UA 3UTEA 4I58A 2XFQA 3K7TA 4AOSA 1E39A 2BYBA 3GDNA 1PBBA 2BRAA 2BS2A 3B6DA 4Z44A 3B3RA 3H4KA 3COXA 4YTMA 2E1MA 2YLSA 2R4JA 5JCNA 1CC2A 3GYJA 3T2KA 4H4TA 1PDHA 4USQA 3O0HA 3SYIA 3GSIA 3IHMA 2RGHA 1DOBA 5U63A 3DJDA 3SZWA 4X9MA 2R9ZA 5KWFA 2NVKX 2C73A 4H4WA 4OPIA 2YM1A 3CPIG 3LOVA 1GERA 1GNDA 3GRTA 5DBJA 5KMPA 3FBSA 2EQ9A 2OLNA 4EMWA 1B4VA 1GREA 1DJQA 3CGBA 3NHOX 3UKAA 1GTHA 2B7SA 3DK9A 3NYCA 4B63A 1ONFA 1PXAA 3AYIA 1FOHA 1REOA 3NG7X 1O5WA 3AE5A 4Z2UA 1E1KA 3AD8B 2GR0A 4TM4A 3M13A 4K2XA 1VRQB 1KSUA 2V60A 1KDGA 1B8SA 3UKLA 3V76A 1Z6LA 3VRDB 1D7LA 1H81A 1HYUA 3LZXA 1FEAA 4ECHA 5KVIA 3NYFA 4H2RA 5FMHA 1LQTA 1NHSA 3HYXA 3UTFA 4AP3A 1E1NA 1ZMDA 2Q7VA 2BRYA 4XWZA 4EMJA 4CCRA 5M10A 1DNCA 3Q6JA 1BGNA 2TMDA 1ZP0A 1L0VA 3AYJA 2YLWA 2WP9A 3UP4A 3SXIA 1NENA 1D7YA 1KNRA 3AYLA 3QSSA 4TLXA 4H4UA 2XVJA 2EQ8A 1LV0A 2JB3A 3T31A 1GEUA 3AECA 5BUKA 3G5QA 3ATQA 4Z43A 4G9KA 3T14A 2WU5A 3CMMA 1N1PA 1F3PA 1H7XA 3GD3A 4U8MA 2BC1A 2JAEA 5IQ4A 1D5TA 3FMWA 1CHUA 3ICRA 1L9CA 3F8PA 4B66A 4JDRA 1FCDA 3EANA 4TM3A 4YSZA 5JCMA 4H4QA 4IVOB 1F8RA 2Q0KA 2FBWA 1CJ4A 3GYXA 4GAVA 4OPCA 2GQWA 2YG6A 3NIXA 3DJJA 1L9EA 3KVEA 4JNQA 1CF3A 1GRGA 3KPFA 3LXDA 3GDPA 2WQYA 2RABA 2Q6UA 4J57A 3AE3A 3REDA 2C3DA 1PS9A 1XPQA 4Z24A 3NTDA 2YG3A 4BK3A 1XDIA 4XWRA 3UOXA 1NPXA 4H50A 4B1BA 1OJ9A 2OAMA 3H8LA 4HA6A 4NZHA 4OPUA 1P2EA 1GRFA 4A6NB 2C64A 2FJDA 4OPDA 3PVCA 4D03A 2FJBA 3II4A 2TPRA 3NTAA 2BACA 5ER0A 4YSHA 1COYA 3SY4A 1JNRA 1JRXA 1DOEA 2XLPA 3VRAA 3CGCA 2B76A 1O95A 2XLTA 2YLXA 4JY2A 4OPGA 4J31A 1TDKA 1VDCA 3KPKA 2WU2A 1IUSA 3RHAA 1GESA 2GVCA 2JBVA 4X4JA 4N9XA 2GRTA 4G74A 1V59A 3AE2A 1N4WA 3C96A 4J36A 4AP1A 1TYTA 4U8PA 2X8CA 3GRSA 1GRHA 4K22A 1F6MA 1KFYA 2GMHA 3ADAB 4A99A 2JKCA 4G6GA 3T37A 3P4QA 2QAEA 1H7WA 1N4UA 3ALJA 3QSMA 1QO8A 1N4VA 3EF6A 2HQMA 1RYIA 3CGDA 5KOXA 3ABVA 2JB1A 1OJAA 5TR3A 4H4YA 2C4CA 3URHA 1ZDLA 4YSYA 3T2YA 2B7RA 2IVEA 3ITJA 3LJPA 1TDNA 1JRYA 1PJ5A 4EMIA 2R4EA 2BCGG 1LVLA 1LTXR 4GRTA 1W4XA 1PBFA 4YXDA 3IC9A 1JU2A 2C3CA 3L1RA 2YR5A 3P1WA 1S2YA 2X8GA 1MO9A 4B69A 2J3NA 4CY6A 1CJCA 3QFBA 4KPRA 4JQ9A 1LJ1A 2WOVA 3FIMB 4H2PA 2WS3A 3PO7A 4CY8A 1Y56B 2ZZCA 4BURA 1JNZA 3DK8A 5JCIA 4DGKA 4IA6A 4TM1A 1H86A 3D1CA 1M64A 3D8XA 3FG2P 2WP6A 4GDEA 4H4SA 3HYVA 4Y4LA 3SGLA 4K5RA 1PJ6A 1NHPA 2APGA 4H4PA 4IVMB 2YLRA 2YM2A 2W0HA 2BA9A 2GR2A 4LU6A 1D4DA 4FDCB 1D4CA 3ICSA 5KRQA 3EPTA 3T2ZA 4Z25A 4YT0A 3JSKA 1H84A 1VG9A 2DKHA 2GEWA 1B37A 4H7UA 3L8KA 3SQPA 4BJZA 1NG4A 4C5OA 4X9NA 4U8NA 1TRBA 4YWOA 4JNAA 2AQJA 1GPEA 5U25A 4EIPA 4USRA 2VRLA 2C76A 2B9XA 2WP5A 3Q9TA 5C2TA 3KU9A 4E0VA 1GXFA 5L46A 3CNSA 4O5UA 2GR3A 3CN8A 4RG3A 4B65A 1QJDA 4ZN0A 2A87A 1IUTA 1BWCA 1CC6A 3I3LA 2BC0A 3DJGX 1BKWA 2CVJA 3DMEA 2V5ZA 1ZK7A 2FJEA 4J33A 2C75A 3ISHA 3SX6A 1CBOA 1GT8A 1BZLA 3DK4A 4NEWA 3AE1A 2Z5YA 4J34A 4DNAA 3ALMA 4GDPA 2WPEA 4H4ZA 4NTDA 4OVIA 1B5QA 1S2QA 1NAAA 2VQ7A 1MOKA 2ZBWA 3GWDA 3KA7A 1DXLA 4Z2TA 1XHCA 4HB9A 5JCLA 3VR9A 5HXIA 1CJ2A 2WPFA 4BJYA 3QSEA 2FJAA 2YLTA 1OJCA 4UP3A 3OC4A 4B67A 1OJTA 2VQBA 2YAUA 2XVFA 2YVJA 3RP7A 1K0LA 1DJNA 3NKSA 2V6OA 4K7ZA 3ATRA 4FK1A 3NNEA 5M0ZA 3UOZA 5HHFA 4G73A 3GMBA 4M52A 4B64A 2WOIA 1VG0A 4U8KA 1IUWA 3T0KA 4YKGA 5LV9A 3WE0A 2BK3A 3UTGA 4A6NA 2YG7A 3S5WA 2BS3A 4ZCDA 3NYEA 3AEAA 1PXBA 3ZYXA 2QA1A 4H4VA 3UKHA 2C72A 2YG5A 3AEFA 1O94A 3CIRA 2GV8A 2B9YA 1MXTA 3SM8A 4TM0A 1YQ3A 3RNMA 1NEKA 5HY5A 2CFYA 1JOAA 2R0GA 4H2QA 3C4AA 5HYMA 3NK2X 4MJWA 2BCPA 1CJ3A 5GRTA 1SEZA 1BF3A 5C3JA 1EL7A 3UKPA 3I6DA 1FECA 3UKFA 3QJ4A 2O9ZA 3M0OA 3OZ2A 4PABA 4IV9A 2H89A 1D4EA 1Q1WA 2BXSA 5JCKA 1GETA 2ARDA 2YR6A 1KNPA 1IUXA 1LQUA 2C67A 3AE6A 4EIQA 4UDQA 3SZFA 3F8RA 5KMQA 4OCGA 2C70A 3UP5A 3NRNA 3GMCA 2GR1A 3RP8A 2B9WA 3VQRA 5KXJA 1TDFA 2V3AA 3LADA 4NNJA 2XCGA 4EQWA 1PXCA 4GUVA 2BXRA 1XANA 2WESA 2Y6RA 3BI2A 4H2NA 4U8OA 3QFAA 3AD7B 2IVDA 3M12A 3R9UA 3E1TA 5EBKA 3DJEA 3UKQA 3ICTA 2BK4A 5EB5A 3IHGA 5IQ1A 3NGCX 3BI4A 2EQ7A 2V3BA 4UDPA 1K0JA 4WCTA 5EB4A 1PBEA 3K30A 1Y0PA 4FX9A 2EQ6A 4J56A 5FS6A 4RSLA 4G6HA 4XXGA 3RP6A 2YWLA 1JRZA 2AAQA 2XLUA 4NEVA 5J60A 5KMRA 2Y6QA 3DH9A 1NHQA 3BNMA 4OPLA 4CNKA 4LA1A 4Z26A 3AEEA 3NLCA 2GQFA 3QVRA 1PHHA 1S3EA 2E4GA 2WBAA 3SZCA 1Q9IA 2JB2A 3C4NA 5CKUA 1IUVA 1RP0A 3CNPA 2VVLG 1BGJA 1OJDA 2WOWA 4YKFA 3AEBA 2BS4A 2JK6A 4DSHA 1NG3A 1JEHA 2C66A 1GRTA 2CDUA 4LIIA 3P4PA 5CQFA 5FS9A 3SZ0A 3GD4A 3SFEA 1KSSA 3NH3X 5U1OA 4EM3A 4C74A 4EQSA 2GB0A 1TDEA 1H82A 3ALLA 1EL5A 3UTHA 1X31B 2XVIA 3IF9A 4AT0A 4D04A 2XLSA 2XVEA 1CC4A 2WDVA 3HZLA 5KVHA 4EQRA 4YTPA 2XVHA 3LZWA 3NN0X 2X8HA 4BV6A 3GYIA 2X3NA 2OALA 2BK5A 1ELIA 2XDOA 1GV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YG4 A;  3AED A;  1K0I A;  4U8J A;  1M6I A;  2X50 A;  3SFD A;  3EAO A;  1RSG A;  1ZOY A;  2RGJ A;  2OA1 A;  4NTC A;  4JY3 A;  2GMJ A;  2A8X A;  2XLR A;  1E7P A;  4C3X A;  5EOW A;  4CNJ A;  1DOD A;  1VQW A;  2VOU A;  1CL0 A;  3CTY A;  4J2W A;  1GSN A;  4EM4 A;  2QA2 A;  2XFU A;  3CNJ A;  2YR4 A;  4DSG A;  5BRT A;  1E1L A;  2VVL A;  3KD9 A;  3G5R A;  2XFP A;  2ACZ A;  2QCU A;  4PAA A;  1F8W A;  4A5L A;  1H6V A;  5IPY A;  1KF6 A;  3UKK A;  3AE7 A;  4RG4 A;  1GRA A;  2WDR A;  1PN0 A;  2R0P A;  1P2H A;  2XFN A;  4JN9 A;  4TLZ A;  4REK A;  5J7X A;  1ZMC A;  3H8I A;  4U2L A;  3DGZ A;  3CNT A;  3NT6 A;  1FEB A;  2R0C A;  4AOX A;  3AE9 A;  3CPJ G;  1GOS A;  3AXB A;  3AE4 A;  4KX6 A;  4U8L A;  4A9W A;  3K7M X;  4EQX A;  3UOY A;  1Y56 A;  1F8S A;  2WEU A;  4ICY A;  4U8I A;  5KOW A;  2YQU A;  4O5Q A;  3AEG A;  1QLB A;  2C65 A;  2H88 A;  4GCM A;  2GH5 A;  3F8D A;  3NN6 X;  1IJH A;  1E6E A;  2WDQ A;  2WPC A;  2WET A;  4K5S A;  4Y4M A;  1EBD A;  3P4R A;  2F5Z A;  2VZ2 A;  3KKJ A;  1YQ4 A;  3UOV A;  2YVG A;  4WX1 A;  1EL9 A;  2R45 A;  3AWI A;  4CRT A;  3V3O A;  2UZZ A;  1YKJ A;  1TYP A;  1DOC A;  2VVM A;  5FS8 A;  1EL8 A;  3NK1 X;  4C77 A;  1YQZ A;  3AE8 A;  2YVF A;  3G5S A;  1PBD A;  2GAG B;  3BHF A;  1Q1R A;  3GWF A;  3PS9 A;  3DGH A;  4K8D A;  3QVP A;  4P9S A;  1S3B A;  3VR8 A;  4APN A;  5BVA A;  2GAH B;  3IWA A;  4BK2 A;  3DA1 A;  2X99 A;  4YSX A;  1FL2 A;  4GR1 A;  1H83 A;  2Q0L A;  2Z5X A;  4Z2R A;  3FPZ A;  5BUL A;  3CPH G;  3LB8 A;  1NHR A;  3V3N A;  3AB1 A;  4UDR A;  1NDA A;  3KLJ A;  3AD9 B;  4IA5 A;  1UKV G;  2ZZ0 A;  4A7A A;  3CND A;  4AT2 A;  1TDO A;  1GTE A;  2AR8 A;  2E5V A;  4NTE A;  1IUU A;  2BAB A;  3BNU A;  5FS7 A;  4CBQ A;  4U2T A;  2V61 A;  1PBC A;  1ZY8 A;  1ZOV A;  4A65 A;  4H4X A;  2WHD A;  2CUL A;  2NPX A;  4CCQ A;  2XYO A;  3K7Q X;  2IID A;  2C7G A;  1L9D A;  3P4S A;  2A89 A;  2GF3 A;  4FK1 C;  4GF7 A;  4H4R A;  4BK1 A;  4C3Y A;  2OLO A;  3BHK A;  1GAL A;  1K4Q A;  4OPT A;  4YTN A;  2VRM A;  2R46 A;  3NK0 X;  2RGO A;  2XFO A;  2PHH A;  2PYX A;  5GSN A;  3CGE A;  3S61 A;  3UCL A;  3VRB A;  3BI5 A;  1ZX9 A;  4I59 A;  2I0Z A;  4Y4N A;  2DKI A;  2YLZ A;  1YY5 A;  1E1M A;  1LPF A;  1AOG A;  1GRB A;  1ZKQ A;  4ZCC A;  4A79 A;  4U2S A;  4ADW A;  4B68 A;  2ZZB A;  3ZDN A;  1PJ7 A;  3P9U A;  3UTE A;  4I58 A;  2XFQ A;  3K7T A;  4AOS A;  1E39 A;  2BYB A;  3GDN A;  1PBB A;  2BS2 A;  3B6D A;  4Z44 A;  3B3R A;  3H4K A;  3COX A;  4YTM A;  2E1M A;  2YLS A;  2R4J A;  5JCN A;  1CC2 A;  3GYJ A;  4H4T A;  1PDH A;  4USQ A;  3O0H A;  3GSI A;  3IHM A;  2RGH A;  1DOB A;  5U63 A;  3DJD A;  5KWF A;  4X9M A;  2R9Z A;  2NVK X;  2C73 A;  4H4W A;  4OPI A;  2YM1 A;  3CPI G;  3LOV A;  1GER A;  1GND A;  3GRT A;  5DBJ A;  3FBS A;  2EQ9 A;  2OLN A;  4EMW A;  1B4V A;  1GRE A;  1DJQ A;  3CGB A;  3NHO X;  3UKA A;  1GTH A;  2B7S A;  3DK9 A;  3NYC A;  4B63 A;  1ONF A;  1PXA A;  3AYI A;  1FOH A;  1REO A;  3NG7 X;  1O5W A;  3AE5 A;  4Z2U A;  1E1K A;  3AD8 B;  2GR0 A;  4TM4 A;  3M13 A;  4K2X A;  1VRQ B;  1KSU A;  2V60 A;  1KDG A;  1B8S A;  3UKL A;  3V76 A;  1Z6L A;  3VRD B;  1D7L A;  1H81 A;  1HYU A;  3LZX A;  1FEA A;  4ECH A;  5KVI A;  3NYF A;  4H2R A;  5FMH A;  1LQT A;  1NHS A;  3UTF A;  4AP3 A;  1E1N A;  1ZMD A;  2Q7V A;  4XWZ A;  4EMJ A;  4CCR A;  5M10 A;  1DNC A;  3Q6J A;  1BGN A;  2TMD A;  1ZP0 A;  1L0V A;  3AYJ A;  2YLW A;  2WP9 A;  3UP4 A;  1NEN A;  1D7Y A;  1KNR A;  3AYL A;  3QSS A;  4TLX A;  4H4U A;  2XVJ A;  2EQ8 A;  1LV0 A;  2JB3 A;  1GEU A;  3AEC A;  5BUK A;  3G5Q A;  3ATQ A;  4Z43 A;  2WU5 A;  1N1P A;  1F3P A;  1H7X A;  3GD3 A;  4U8M A;  2BC1 A;  2JAE A;  5IQ4 A;  1D5T A;  3FMW A;  1CHU A;  3ICR A;  1L9C A;  3F8P A;  4B66 A;  4JDR A;  1FCD A;  3EAN A;  4TM3 A;  4YSZ A;  5JCM A;  4H4Q A;  4IVO B;  1F8R A;  2Q0K A;  2FBW A;  1CJ4 A;  4OPC A;  2GQW A;  2YG6 A;  3NIX A;  3DJJ A;  1L9E A;  3KVE A;  4JNQ A;  1CF3 A;  1GRG A;  3KPF A;  3LXD A;  3GDP A;  2WQY A;  2RAB A;  2Q6U A;  4J57 A;  3AE3 A;  3RED A;  2C3D A;  1PS9 A;  1XPQ A;  4Z24 A;  3NTD A;  2YG3 A;  4BK3 A;  1XDI A;  4XWR A;  3UOX A;  1NPX A;  4H50 A;  4B1B A;  1OJ9 A;  2OAM A;  3H8L A;  4HA6 A;  4NZH A;  4OPU A;  1P2E A;  1GRF A;  4A6N B;  2C64 A;  2FJD A;  4OPD A;  3PVC A;  4D03 A;  2FJB A;  3II4 A;  2TPR A;  3NTA A;  2BAC A;  5ER0 A;  4YSH A;  1COY A;  1JNR A;  1JRX A;  1DOE A;  2XLP A;  3VRA A;  3CGC A;  2B76 A;  1O95 A;  2XLT A;  2YLX A;  4JY2 A;  4OPG A;  4J31 A;  1TDK A;  1VDC A;  2WU2 A;  1IUS A;  3RHA A;  1GES A;  2GVC A;  2JBV A;  4X4J A;  4N9X A;  2GRT A;  1V59 A;  3AE2 A;  1N4W A;  3C96 A;  4J36 A;  4AP1 A;  1TYT A;  4U8P A;  2X8C A;  3GRS A;  1GRH A;  4K22 A;  1F6M A;  1KFY A;  2GMH A;  3ADA B;  4A99 A;  2JKC A;  3T37 A;  3P4Q A;  2QAE A;  1H7W A;  1N4U A;  3ALJ A;  3QSM A;  1QO8 A;  1N4V A;  3EF6 A;  2HQM A;  1RYI A;  3CGD A;  5KOX A;  3ABV A;  2JB1 A;  1OJA A;  5TR3 A;  4H4Y A;  3URH A;  1ZDL A;  4YSY A;  2B7R A;  2IVE A;  3ITJ A;  3LJP A;  1TDN A;  1JRY A;  1PJ5 A;  4EMI A;  2R4E A;  2BCG G;  1LVL A;  1LTX R;  4GRT A;  1W4X A;  1PBF A;  4YXD A;  3IC9 A;  1JU2 A;  2C3C A;  3L1R A;  2YR5 A;  3P1W A;  1S2Y A;  2X8G A;  1MO9 A;  4B69 A;  2J3N A;  4CY6 A;  1CJC A;  3QFB A;  4KPR A;  4JQ9 A;  1LJ1 A;  2WOV A;  3FIM B;  4H2P A;  2WS3 A;  3PO7 A;  4CY8 A;  1Y56 B;  2ZZC A;  4BUR A;  1JNZ A;  3DK8 A;  5JCI A;  4DGK A;  4IA6 A;  4TM1 A;  1H86 A;  3D1C A;  1M64 A;  3D8X A;  3FG2 P;  2WP6 A;  4GDE A;  4H4S A;  4Y4L A;  3SGL A;  4K5R A;  1PJ6 A;  1NHP A;  2APG A;  4H4P A;  4IVM B;  2YLR A;  2YM2 A;  2W0H A;  2BA9 A;  2GR2 A;  4LU6 A;  1D4D A;  4FDC B;  1D4C A;  3ICS A;  5KRQ A;  3EPT A;  4Z25 A;  4YT0 A;  3JSK A;  1H84 A;  1VG9 A;  2DKH A;  2GEW A;  1B37 A;  4H7U A;  3L8K A;  3SQP A;  4BJZ A;  1NG4 A;  4C5O A;  4X9N A;  4U8N A;  1TRB A;  4YWO A;  4JNA A;  2AQJ A;  1GPE A;  5U25 A;  4EIP A;  4USR A;  2VRL A;  2C76 A;  2B9X A;  2WP5 A;  3Q9T A;  5C2T A;  3KU9 A;  4E0V A;  1GXF A;  5L46 A;  3CNS A;  4O5U A;  2GR3 A;  3CN8 A;  4RG3 A;  4B65 A;  1QJD A;  4ZN0 A;  2A87 A;  1IUT A;  1BWC A;  1CC6 A;  3I3L A;  2BC0 A;  3DJG X;  1BKW A;  2CVJ A;  3DME A;  2V5Z A;  1ZK7 A;  2FJE A;  4J33 A;  2C75 A;  3ISH A;  1CBO A;  1GT8 A;  1BZL A;  3DK4 A;  4NEW A;  3AE1 A;  2Z5Y A;  4J34 A;  4DNA A;  3ALM A;  4GDP A;  2WPE A;  4H4Z A;  4NTD A;  4OVI A;  1B5Q A;  1S2Q A;  1NAA A;  2VQ7 A;  1MOK A;  2ZBW A;  3GWD A;  3KA7 A;  1DXL A;  4Z2T A;  1XHC A;  4HB9 A;  5JCL A;  3VR9 A;  5HXI A;  1CJ2 A;  2WPF A;  4BJY A;  3QSE A;  2FJA A;  2YLT A;  1OJC A;  4UP3 A;  3OC4 A;  4B67 A;  1OJT A;  2VQB A;  2YAU A;  2XVF A;  2YVJ A;  3RP7 A;  1K0L A;  1DJN A;  3NKS A;  2V6O A;  4K7Z A;  3ATR A;  4FK1 A;  3NNE A;  5M0Z A;  3UOZ A;  5HHF A;  3GMB A;  4M52 A;  4B64 A;  2WOI A;  1VG0 A;  4U8K A;  1IUW A;  4YKG A;  5LV9 A;  3WE0 A;  2BK3 A;  3UTG A;  4A6N A;  2YG7 A;  3S5W A;  2BS3 A;  4ZCD A;  3NYE A;  3AEA A;  1PXB A;  3ZYX A;  2QA1 A;  4H4V A;  3UKH A;  2C72 A;  2YG5 A;  3AEF A;  1O94 A;  3CIR A;  2GV8 A;  2B9Y A;  1MXT A;  3SM8 A;  4TM0 A;  1YQ3 A;  3RNM A;  1NEK A;  5HY5 A;  2CFY A;  1JOA A;  2R0G A;  4H2Q A;  3C4A A;  5HYM A;  3NK2 X;  4MJW A;  2BCP A;  1CJ3 A;  5GRT A;  1SEZ A;  1BF3 A;  5C3J A;  1EL7 A;  3UKP A;  3I6D A;  1FEC A;  3UKF A;  3QJ4 A;  2O9Z A;  3M0O A;  3OZ2 A;  4PAB A;  4IV9 A;  2H89 A;  1D4E A;  1Q1W A;  2BXS A;  5JCK A;  1GET A;  2ARD A;  2YR6 A;  1KNP A;  1IUX A;  1LQU A;  2C67 A;  3AE6 A;  4EIQ A;  4UDQ A;  3F8R A;  4OCG A;  2C70 A;  3UP5 A;  3NRN A;  3GMC A;  2GR1 A;  3RP8 A;  2B9W A;  3VQR A;  5KXJ A;  1TDF A;  2V3A A;  3LAD A;  4EQW A;  2XCG A;  1PXC A;  4GUV A;  2BXR A;  1XAN A;  2WES A;  2Y6R A;  3BI2 A;  4H2N A;  4U8O A;  3QFA A;  3AD7 B;  2IVD A;  3M12 A;  3R9U A;  3E1T A;  5EBK A;  3DJE A;  3UKQ A;  3ICT A;  2BK4 A;  5EB5 A;  3IHG A;  5IQ1 A;  3NGC X;  3BI4 A;  2EQ7 A;  2V3B A;  4UDP A;  1K0J A;  4WCT A;  5EB4 A;  1PBE A;  3K30 A;  1Y0P A;  4FX9 A;  2EQ6 A;  4J56 A;  5FS6 A;  4RSL A;  4XXG A;  3RP6 A;  2YWL A;  1JRZ A;  2AAQ A;  2XLU A;  4NEV A;  5J60 A;  2Y6Q A;  3DH9 A;  1NHQ A;  3BNM A;  4OPL A;  4CNK A;  4LA1 A;  4Z26 A;  3AEE A;  3NLC A;  2GQF A;  3QVR A;  1PHH A;  1S3E A;  2E4G A;  2WBA A;  1Q9I A;  2JB2 A;  3C4N A;  5CKU A;  1IUV A;  1RP0 A;  3CNP A;  2VVL G;  1BGJ A;  1OJD A;  2WOW A;  4YKF A;  3AEB A;  2BS4 A;  2JK6 A;  4DSH A;  1NG3 A;  1JEH A;  2C66 A;  1GRT A;  2CDU A;  4LII A;  3P4P A;  5CQF A;  5FS9 A;  3GD4 A;  3SFE A;  1KSS A;  3NH3 X;  5U1O A;  4EM3 A;  4C74 A;  4EQS A;  2GB0 A;  1TDE A;  1H82 A;  3ALL A;  1EL5 A;  3UTH A;  1X31 B;  2XVI A;  3IF9 A;  4AT0 A;  4D04 A;  2XLS A;  2XVE A;  1CC4 A;  2WDV A;  3HZL A;  5KVH A;  4EQR A;  4YTP A;  2XVH A;  3LZW A;  3NN0 X;  2X8H A;  4BV6 A;  3GYI A;  2X3N A;  2OAL A;  2BK5 A;  1ELI A;  2XDO A;  1GV4 A; 
#chains in the Genus database with same CATH topology
 2YG4 A;  3AED A;  1K0I A;  4U8J A;  1M6I A;  2X50 A;  3SFD A;  3EAO A;  1RSG A;  1ZOY A;  2RGJ A;  2OA1 A;  4NTC A;  4JY3 A;  2GMJ A;  2A8X A;  2XLR A;  1E7P A;  4C3X A;  5EOW A;  4CNJ A;  1DOD A;  1VQW A;  2VOU A;  1CL0 A;  3CTY A;  4J2W A;  1GSN A;  4EM4 A;  2QA2 A;  2XFU A;  3CNJ A;  2YR4 A;  4DSG A;  5BRT A;  1E1L A;  2VVL A;  3KD9 A;  3G5R A;  2XFP A;  2ACZ A;  2QCU A;  4PAA A;  1F8W A;  4A5L A;  1H6V A;  5IPY A;  1KF6 A;  3UKK A;  3AE7 A;  4RG4 A;  1GRA A;  2WDR A;  1PN0 A;  2R0P A;  1P2H A;  2XFN A;  4JN9 A;  4TLZ A;  4REK A;  5J7X A;  1ZMC A;  3H8I A;  4U2L A;  3DGZ A;  3CNT A;  3NT6 A;  1FEB A;  2R0C A;  4AOX A;  3AE9 A;  3CPJ G;  1GOS A;  3AXB A;  3AE4 A;  4KX6 A;  4U8L A;  4A9W A;  3K7M X;  4EQX A;  3UOY A;  1Y56 A;  1F8S A;  2WEU A;  4ICY A;  4U8I A;  3HYW A;  2YQU A;  4O5Q A;  3AEG A;  5KOW A;  1QLB A;  2C65 A;  2H88 A;  4GCM A;  4NWZ A;  2GH5 A;  3F8D A;  3NN6 X;  1IJH A;  1E6E A;  2WDQ A;  2WPC A;  2WET A;  4K5S A;  4Y4M A;  1EBD A;  3P4R A;  2F5Z A;  5KNL A;  2VZ2 A;  3KKJ A;  1YQ4 A;  3UOV A;  2YVG A;  4WX1 A;  1EL9 A;  2R45 A;  5KMS A;  3AWI A;  4CRT A;  3V3O A;  2UZZ A;  1YKJ A;  1TYP A;  1DOC A;  2VVM A;  5FS8 A;  1EL8 A;  3NK1 X;  4C77 A;  1YQZ A;  3AE8 A;  2YVF A;  3G5S A;  1PBD A;  2GAG B;  3BHF A;  1Q1R A;  3GWF A;  3PS9 A;  3DGH A;  4K8D A;  3QVP A;  4P9S A;  1S3B A;  3VR8 A;  4APN A;  5BVA A;  2GAH B;  3IWA A;  4BK2 A;  3DA1 A;  2X99 A;  4YSX A;  1FL2 A;  4GR1 A;  1H83 A;  2Q0L A;  2Z5X A;  4Z2R A;  3FPZ A;  5BUL A;  3CPH G;  3LB8 A;  1NHR A;  3V3N A;  3AB1 A;  4UDR A;  1NDA A;  3KLJ A;  3AD9 B;  4IA5 A;  1UKV G;  2ZZ0 A;  4A7A A;  3CND A;  4AT2 A;  1TDO A;  1GTE A;  2AR8 A;  2E5V A;  4NTE A;  1IUU A;  2BAB A;  3BNU A;  5FS7 A;  4CBQ A;  4U2T A;  2V61 A;  1PBC A;  1ZY8 A;  1ZOV A;  4A65 A;  4H4X A;  4II2 A;  2WHD A;  2CUL A;  2NPX A;  4CCQ A;  2XYO A;  3K7Q X;  2IID A;  2C7G A;  1L9D A;  3P4S A;  2A89 A;  2GF3 A;  4FK1 C;  4GF7 A;  4H4R A;  4BK1 A;  4C3Y A;  2OLO A;  3BHK A;  1GAL A;  1K4Q A;  4OPT A;  4YTN A;  2VRM A;  2R46 A;  3NK0 X;  4II3 A;  2RGO A;  2XFO A;  2PHH A;  2PYX A;  5GSN A;  3CGE A;  3S61 A;  3UCL A;  3VRB A;  3BI5 A;  1ZX9 A;  4I59 A;  2I0Z A;  4Y4N A;  2DKI A;  2YLZ A;  1YY5 A;  1E1M A;  1LPF A;  1AOG A;  1GRB A;  1ZKQ A;  4ZCC A;  4A79 A;  4GAP A;  4U2S A;  4ADW A;  4B68 A;  2ZZB A;  3ZDN A;  1PJ7 A;  3P9U A;  3UTE A;  4I58 A;  2XFQ A;  3K7T A;  4AOS A;  1E39 A;  2BYB A;  3GDN A;  1PBB A;  2BRA A;  2BS2 A;  3B6D A;  4Z44 A;  3B3R A;  3H4K A;  3COX A;  4YTM A;  2E1M A;  2YLS A;  2R4J A;  5JCN A;  1CC2 A;  3GYJ A;  3T2K A;  4H4T A;  1PDH A;  4USQ A;  3O0H A;  3SYI A;  3GSI A;  3IHM A;  2RGH A;  1DOB A;  5U63 A;  3DJD A;  3SZW A;  4X9M A;  2R9Z A;  5KWF A;  2NVK X;  2C73 A;  4H4W A;  4OPI A;  2YM1 A;  3CPI G;  3LOV A;  1GER A;  1GND A;  3GRT A;  5DBJ A;  5KMP A;  3FBS A;  2EQ9 A;  2OLN A;  4EMW A;  1B4V A;  1GRE A;  1DJQ A;  3CGB A;  3NHO X;  3UKA A;  1GTH A;  2B7S A;  3DK9 A;  3NYC A;  4B63 A;  1ONF A;  1PXA A;  3AYI A;  1FOH A;  1REO A;  3NG7 X;  1O5W A;  3AE5 A;  4Z2U A;  1E1K A;  3AD8 B;  2GR0 A;  4TM4 A;  3M13 A;  4K2X A;  1VRQ B;  1KSU A;  2V60 A;  1KDG A;  1B8S A;  3UKL A;  3V76 A;  1Z6L A;  3VRD B;  1D7L A;  1H81 A;  1HYU A;  3LZX A;  1FEA A;  4ECH A;  5KVI A;  3NYF A;  4H2R A;  5FMH A;  1LQT A;  1NHS A;  3HYX A;  3UTF A;  4AP3 A;  1E1N A;  1ZMD A;  2Q7V A;  2BRY A;  4XWZ A;  4EMJ A;  4CCR A;  5M10 A;  1DNC A;  3Q6J A;  1BGN A;  2TMD A;  1ZP0 A;  1L0V A;  3AYJ A;  2YLW A;  2WP9 A;  3UP4 A;  3SXI A;  1NEN A;  1D7Y A;  1KNR A;  3AYL A;  3QSS A;  4TLX A;  4H4U A;  2XVJ A;  2EQ8 A;  1LV0 A;  2JB3 A;  3T31 A;  1GEU A;  3AEC A;  5BUK A;  3G5Q A;  3ATQ A;  4Z43 A;  4G9K A;  3T14 A;  2WU5 A;  3CMM A;  1N1P A;  1F3P A;  1H7X A;  3GD3 A;  4U8M A;  2BC1 A;  2JAE A;  5IQ4 A;  1D5T A;  3FMW A;  1CHU A;  3ICR A;  1L9C A;  3F8P A;  4B66 A;  4JDR A;  1FCD A;  3EAN A;  4TM3 A;  4YSZ A;  5JCM A;  4H4Q A;  4IVO B;  1F8R A;  2Q0K A;  2FBW A;  1CJ4 A;  3GYX A;  4GAV A;  4OPC A;  2GQW A;  2YG6 A;  3NIX A;  3DJJ A;  1L9E A;  3KVE A;  4JNQ A;  1CF3 A;  1GRG A;  3KPF A;  3LXD A;  3GDP A;  2WQY A;  2RAB A;  2Q6U A;  4J57 A;  3AE3 A;  3RED A;  2C3D A;  1PS9 A;  1XPQ A;  4Z24 A;  3NTD A;  2YG3 A;  4BK3 A;  1XDI A;  4XWR A;  3UOX A;  1NPX A;  4H50 A;  4B1B A;  1OJ9 A;  2OAM A;  3H8L A;  4HA6 A;  4NZH A;  4OPU A;  1P2E A;  1GRF A;  4A6N B;  2C64 A;  2FJD A;  4OPD A;  3PVC A;  4D03 A;  2FJB A;  3II4 A;  2TPR A;  3NTA A;  2BAC A;  5ER0 A;  4YSH A;  1COY A;  3SY4 A;  1JNR A;  1JRX A;  1DOE A;  2XLP A;  3VRA A;  3CGC A;  2B76 A;  1O95 A;  2XLT A;  2YLX A;  4JY2 A;  4OPG A;  4J31 A;  1TDK A;  1VDC A;  3KPK A;  2WU2 A;  1IUS A;  3RHA A;  1GES A;  2GVC A;  2JBV A;  4X4J A;  4N9X A;  2GRT A;  4G74 A;  1V59 A;  3AE2 A;  1N4W A;  3C96 A;  4J36 A;  4AP1 A;  1TYT A;  4U8P A;  2X8C A;  3GRS A;  1GRH A;  4K22 A;  1F6M A;  1KFY A;  2GMH A;  3ADA B;  4A99 A;  2JKC A;  4G6G A;  3T37 A;  3P4Q A;  2QAE A;  1H7W A;  1N4U A;  3ALJ A;  3QSM A;  1QO8 A;  1N4V A;  3EF6 A;  2HQM A;  1RYI A;  3CGD A;  5KOX A;  3ABV A;  2JB1 A;  1OJA A;  5TR3 A;  4H4Y A;  2C4C A;  3URH A;  1ZDL A;  4YSY A;  3T2Y A;  2B7R A;  2IVE A;  3ITJ A;  3LJP A;  1TDN A;  1JRY A;  1PJ5 A;  4EMI A;  2R4E A;  2BCG G;  1LVL A;  1LTX R;  4GRT A;  1W4X A;  1PBF A;  4YXD A;  3IC9 A;  1JU2 A;  2C3C A;  3L1R A;  2YR5 A;  3P1W A;  1S2Y A;  2X8G A;  1MO9 A;  4B69 A;  2J3N A;  4CY6 A;  1CJC A;  3QFB A;  4KPR A;  4JQ9 A;  1LJ1 A;  2WOV A;  3FIM B;  4H2P A;  2WS3 A;  3PO7 A;  4CY8 A;  1Y56 B;  2ZZC A;  4BUR A;  1JNZ A;  3DK8 A;  5JCI A;  4DGK A;  4IA6 A;  4TM1 A;  1H86 A;  3D1C A;  1M64 A;  3D8X A;  3FG2 P;  2WP6 A;  4GDE A;  4H4S A;  3HYV A;  4Y4L A;  3SGL A;  4K5R A;  1PJ6 A;  1NHP A;  2APG A;  4H4P A;  4IVM B;  2YLR A;  2YM2 A;  2W0H A;  2BA9 A;  2GR2 A;  4LU6 A;  1D4D A;  4FDC B;  1D4C A;  3ICS A;  5KRQ A;  3EPT A;  3T2Z A;  4Z25 A;  4YT0 A;  3JSK A;  1H84 A;  1VG9 A;  2DKH A;  2GEW A;  1B37 A;  4H7U A;  3L8K A;  3SQP A;  4BJZ A;  1NG4 A;  4C5O A;  4X9N A;  4U8N A;  1TRB A;  4YWO A;  4JNA A;  2AQJ A;  1GPE A;  5U25 A;  4EIP A;  4USR A;  2VRL A;  2C76 A;  2B9X A;  2WP5 A;  3Q9T A;  5C2T A;  3KU9 A;  4E0V A;  1GXF A;  5L46 A;  3CNS A;  4O5U A;  2GR3 A;  3CN8 A;  4RG3 A;  4B65 A;  1QJD A;  4ZN0 A;  2A87 A;  1IUT A;  1BWC A;  1CC6 A;  3I3L A;  2BC0 A;  3DJG X;  1BKW A;  2CVJ A;  3DME A;  2V5Z A;  1ZK7 A;  2FJE A;  4J33 A;  2C75 A;  3ISH A;  3SX6 A;  1CBO A;  1GT8 A;  1BZL A;  3DK4 A;  4NEW A;  3AE1 A;  2Z5Y A;  4J34 A;  4DNA A;  3ALM A;  4GDP A;  2WPE A;  4H4Z A;  4NTD A;  4OVI A;  1B5Q A;  1S2Q A;  1NAA A;  2VQ7 A;  1MOK A;  2ZBW A;  3GWD A;  3KA7 A;  1DXL A;  4Z2T A;  1XHC A;  4HB9 A;  5JCL A;  3VR9 A;  5HXI A;  1CJ2 A;  2WPF A;  4BJY A;  3QSE A;  2FJA A;  2YLT A;  1OJC A;  4UP3 A;  3OC4 A;  4B67 A;  1OJT A;  2VQB A;  2YAU A;  2XVF A;  2YVJ A;  3RP7 A;  1K0L A;  1DJN A;  3NKS A;  2V6O A;  4K7Z A;  3ATR A;  4FK1 A;  3NNE A;  5M0Z A;  3UOZ A;  5HHF A;  4G73 A;  3GMB A;  4M52 A;  4B64 A;  2WOI A;  1VG0 A;  4U8K A;  1IUW A;  3T0K A;  4YKG A;  5LV9 A;  3WE0 A;  2BK3 A;  3UTG A;  4A6N A;  2YG7 A;  3S5W A;  2BS3 A;  4ZCD A;  3NYE A;  3AEA A;  1PXB A;  3ZYX A;  2QA1 A;  4H4V A;  3UKH A;  2C72 A;  2YG5 A;  3AEF A;  1O94 A;  3CIR A;  2GV8 A;  2B9Y A;  1MXT A;  3SM8 A;  4TM0 A;  1YQ3 A;  3RNM A;  1NEK A;  5HY5 A;  2CFY A;  1JOA A;  2R0G A;  4H2Q A;  3C4A A;  5HYM A;  3NK2 X;  4MJW A;  2BCP A;  1CJ3 A;  5GRT A;  1SEZ A;  1BF3 A;  5C3J A;  1EL7 A;  3UKP A;  3I6D A;  1FEC A;  3UKF A;  3QJ4 A;  2O9Z A;  3M0O A;  3OZ2 A;  4PAB A;  4IV9 A;  2H89 A;  1D4E A;  1Q1W A;  2BXS A;  5JCK A;  1GET A;  2ARD A;  2YR6 A;  1KNP A;  1IUX A;  1LQU A;  2C67 A;  3AE6 A;  4EIQ A;  4UDQ A;  3SZF A;  3F8R A;  5KMQ A;  4OCG A;  2C70 A;  3UP5 A;  3NRN A;  3GMC A;  2GR1 A;  3RP8 A;  2B9W A;  3VQR A;  5KXJ A;  1TDF A;  2V3A A;  3LAD A;  4NNJ A;  2XCG A;  4EQW A;  1PXC A;  4GUV A;  2BXR A;  1XAN A;  2WES A;  2Y6R A;  3BI2 A;  4H2N A;  4U8O A;  3QFA A;  3AD7 B;  2IVD A;  3M12 A;  3R9U A;  3E1T A;  5EBK A;  3DJE A;  3UKQ A;  3ICT A;  2BK4 A;  5EB5 A;  3IHG A;  5IQ1 A;  3NGC X;  3BI4 A;  2EQ7 A;  2V3B A;  4UDP A;  1K0J A;  4WCT A;  5EB4 A;  1PBE A;  3K30 A;  1Y0P A;  4FX9 A;  2EQ6 A;  4J56 A;  5FS6 A;  4RSL A;  4G6H A;  4XXG A;  3RP6 A;  2YWL A;  1JRZ A;  2AAQ A;  2XLU A;  4NEV A;  5J60 A;  5KMR A;  2Y6Q A;  3DH9 A;  1NHQ A;  3BNM A;  4OPL A;  4CNK A;  4LA1 A;  4Z26 A;  3AEE A;  3NLC A;  2GQF A;  3QVR A;  1PHH A;  1S3E A;  2E4G A;  2WBA A;  3SZC A;  1Q9I A;  2JB2 A;  3C4N A;  5CKU A;  1IUV A;  1RP0 A;  3CNP A;  2VVL G;  1BGJ A;  1OJD A;  2WOW A;  4YKF A;  3AEB A;  2BS4 A;  2JK6 A;  4DSH A;  1NG3 A;  1JEH A;  2C66 A;  1GRT A;  2CDU A;  4LII A;  3P4P A;  5CQF A;  5FS9 A;  3SZ0 A;  3GD4 A;  3SFE A;  1KSS A;  3NH3 X;  5U1O A;  4EM3 A;  4C74 A;  4EQS A;  2GB0 A;  1TDE A;  1H82 A;  3ALL A;  1EL5 A;  3UTH A;  1X31 B;  2XVI A;  3IF9 A;  4AT0 A;  4D04 A;  2XLS A;  2XVE A;  1CC4 A;  2WDV A;  3HZL A;  5KVH A;  4EQR A;  4YTP A;  2XVH A;  3LZW A;  3NN0 X;  2X8H A;  4BV6 A;  3GYI A;  2X3N A;  2OAL A;  2BK5 A;  1ELI A;  2XDO A;  1GV4 A; 
#chains in the Genus database with same CATH homology
 2YG4 A;  3AED A;  1K0I A;  4U8J A;  1M6I A;  2X50 A;  3SFD A;  3EAO A;  1RSG A;  1ZOY A;  2RGJ A;  2OA1 A;  4NTC A;  4JY3 A;  2GMJ A;  2A8X A;  2XLR A;  1E7P A;  4C3X A;  5EOW A;  4CNJ A;  1DOD A;  1VQW A;  2VOU A;  1CL0 A;  3CTY A;  4J2W A;  1GSN A;  4EM4 A;  2QA2 A;  2XFU A;  3CNJ A;  2YR4 A;  4DSG A;  5BRT A;  1E1L A;  2VVL A;  3KD9 A;  3G5R A;  2XFP A;  2ACZ A;  2QCU A;  4PAA A;  1F8W A;  4A5L A;  1H6V A;  5IPY A;  1KF6 A;  3UKK A;  3AE7 A;  4RG4 A;  1GRA A;  2WDR A;  1PN0 A;  2R0P A;  1P2H A;  2XFN A;  4JN9 A;  4TLZ A;  4REK A;  5J7X A;  1ZMC A;  3H8I A;  4U2L A;  3DGZ A;  3CNT A;  3NT6 A;  1FEB A;  2R0C A;  4AOX A;  3AE9 A;  3CPJ G;  1GOS A;  3AXB A;  3AE4 A;  4KX6 A;  4U8L A;  4A9W A;  3K7M X;  4EQX A;  3UOY A;  1Y56 A;  1F8S A;  2WEU A;  4ICY A;  4U8I A;  3HYW A;  2YQU A;  4O5Q A;  3AEG A;  5KOW A;  1QLB A;  2C65 A;  2H88 A;  4GCM A;  4NWZ A;  2GH5 A;  3F8D A;  3NN6 X;  1IJH A;  1E6E A;  2WDQ A;  2WPC A;  2WET A;  4K5S A;  4Y4M A;  1EBD A;  3P4R A;  2F5Z A;  5KNL A;  2VZ2 A;  3KKJ A;  1YQ4 A;  3UOV A;  2YVG A;  4WX1 A;  1EL9 A;  2R45 A;  5KMS A;  3AWI A;  4CRT A;  3V3O A;  2UZZ A;  1YKJ A;  1TYP A;  1DOC A;  2VVM A;  5FS8 A;  1EL8 A;  3NK1 X;  4C77 A;  1YQZ A;  3AE8 A;  2YVF A;  3G5S A;  1PBD A;  2GAG B;  3BHF A;  1Q1R A;  3GWF A;  3PS9 A;  3DGH A;  4K8D A;  3QVP A;  4P9S A;  1S3B A;  3VR8 A;  4APN A;  5BVA A;  2GAH B;  3IWA A;  4BK2 A;  3DA1 A;  2X99 A;  4YSX A;  1FL2 A;  4GR1 A;  1H83 A;  2Q0L A;  2Z5X A;  4Z2R A;  3FPZ A;  5BUL A;  3CPH G;  3LB8 A;  1NHR A;  3V3N A;  3AB1 A;  4UDR A;  1NDA A;  3KLJ A;  3AD9 B;  4IA5 A;  1UKV G;  2ZZ0 A;  4A7A A;  3CND A;  4AT2 A;  1TDO A;  1GTE A;  2AR8 A;  2E5V A;  4NTE A;  1IUU A;  2BAB A;  3BNU A;  5FS7 A;  4CBQ A;  4U2T A;  2V61 A;  1PBC A;  1ZY8 A;  1ZOV A;  4A65 A;  4H4X A;  4II2 A;  2WHD A;  2CUL A;  2NPX A;  4CCQ A;  2XYO A;  3K7Q X;  2IID A;  2C7G A;  1L9D A;  3P4S A;  2A89 A;  2GF3 A;  4FK1 C;  4GF7 A;  4H4R A;  4BK1 A;  4C3Y A;  2OLO A;  3BHK A;  1GAL A;  1K4Q A;  4OPT A;  4YTN A;  2VRM A;  2R46 A;  3NK0 X;  4II3 A;  2RGO A;  2XFO A;  2PHH A;  2PYX A;  5GSN A;  3CGE A;  3S61 A;  3UCL A;  3VRB A;  3BI5 A;  1ZX9 A;  4I59 A;  2I0Z A;  4Y4N A;  2DKI A;  2YLZ A;  1YY5 A;  1E1M A;  1LPF A;  1AOG A;  1GRB A;  1ZKQ A;  4ZCC A;  4A79 A;  4GAP A;  4U2S A;  4ADW A;  4B68 A;  2ZZB A;  3ZDN A;  1PJ7 A;  3P9U A;  3UTE A;  4I58 A;  2XFQ A;  3K7T A;  4AOS A;  1E39 A;  2BYB A;  3GDN A;  1PBB A;  2BRA A;  2BS2 A;  3B6D A;  4Z44 A;  3B3R A;  3H4K A;  3COX A;  4YTM A;  2E1M A;  2YLS A;  2R4J A;  5JCN A;  1CC2 A;  3GYJ A;  3T2K A;  4H4T A;  1PDH A;  4USQ A;  3O0H A;  3SYI A;  3GSI A;  3IHM A;  2RGH A;  1DOB A;  5U63 A;  3DJD A;  3SZW A;  4X9M A;  2R9Z A;  5KWF A;  2NVK X;  2C73 A;  4H4W A;  4OPI A;  2YM1 A;  3CPI G;  3LOV A;  1GER A;  1GND A;  3GRT A;  5DBJ A;  5KMP A;  3FBS A;  2EQ9 A;  2OLN A;  4EMW A;  1B4V A;  1GRE A;  1DJQ A;  3CGB A;  3NHO X;  3UKA A;  1GTH A;  2B7S A;  3DK9 A;  3NYC A;  4B63 A;  1ONF A;  1PXA A;  3AYI A;  1FOH A;  1REO A;  3NG7 X;  1O5W A;  3AE5 A;  4Z2U A;  1E1K A;  3AD8 B;  2GR0 A;  4TM4 A;  3M13 A;  4K2X A;  1VRQ B;  1KSU A;  2V60 A;  1KDG A;  1B8S A;  3UKL A;  3V76 A;  1Z6L A;  3VRD B;  1D7L A;  1H81 A;  1HYU A;  3LZX A;  1FEA A;  4ECH A;  5KVI A;  3NYF A;  4H2R A;  5FMH A;  1LQT A;  1NHS A;  3HYX A;  3UTF A;  4AP3 A;  1E1N A;  1ZMD A;  2Q7V A;  2BRY A;  4XWZ A;  4EMJ A;  4CCR A;  5M10 A;  1DNC A;  3Q6J A;  1BGN A;  2TMD A;  1ZP0 A;  1L0V A;  3AYJ A;  2YLW A;  2WP9 A;  3UP4 A;  3SXI A;  1NEN A;  1D7Y A;  1KNR A;  3AYL A;  3QSS A;  4TLX A;  4H4U A;  2XVJ A;  2EQ8 A;  1LV0 A;  2JB3 A;  3T31 A;  1GEU A;  3AEC A;  5BUK A;  3G5Q A;  3ATQ A;  4Z43 A;  4G9K A;  3T14 A;  2WU5 A;  3CMM A;  1N1P A;  1F3P A;  1H7X A;  3GD3 A;  4U8M A;  2BC1 A;  2JAE A;  5IQ4 A;  1D5T A;  3FMW A;  1CHU A;  3ICR A;  1L9C A;  3F8P A;  4B66 A;  4JDR A;  1FCD A;  3EAN A;  4TM3 A;  4YSZ A;  5JCM A;  4H4Q A;  4IVO B;  1F8R A;  2Q0K A;  2FBW A;  1CJ4 A;  3GYX A;  4GAV A;  4OPC A;  2GQW A;  2YG6 A;  3NIX A;  3DJJ A;  1L9E A;  3KVE A;  4JNQ A;  1CF3 A;  1GRG A;  3KPF A;  3LXD A;  3GDP A;  2WQY A;  2RAB A;  2Q6U A;  4J57 A;  3AE3 A;  3RED A;  2C3D A;  1PS9 A;  1XPQ A;  4Z24 A;  3NTD A;  2YG3 A;  4BK3 A;  1XDI A;  4XWR A;  3UOX A;  1NPX A;  4H50 A;  4B1B A;  1OJ9 A;  2OAM A;  3H8L A;  4HA6 A;  4NZH A;  4OPU A;  1P2E A;  1GRF A;  4A6N B;  2C64 A;  2FJD A;  4OPD A;  3PVC A;  4D03 A;  2FJB A;  3II4 A;  2TPR A;  3NTA A;  2BAC A;  5ER0 A;  4YSH A;  1COY A;  3SY4 A;  1JNR A;  1JRX A;  1DOE A;  2XLP A;  3VRA A;  3CGC A;  2B76 A;  1O95 A;  2XLT A;  2YLX A;  4JY2 A;  4OPG A;  4J31 A;  1TDK A;  1VDC A;  3KPK A;  2WU2 A;  1IUS A;  3RHA A;  1GES A;  2GVC A;  2JBV A;  4X4J A;  4N9X A;  2GRT A;  4G74 A;  1V59 A;  3AE2 A;  1N4W A;  3C96 A;  4J36 A;  4AP1 A;  1TYT A;  4U8P A;  2X8C A;  3GRS A;  1GRH A;  4K22 A;  1F6M A;  1KFY A;  2GMH A;  3ADA B;  4A99 A;  2JKC A;  4G6G A;  3T37 A;  3P4Q A;  2QAE A;  1H7W A;  1N4U A;  3ALJ A;  3QSM A;  1QO8 A;  1N4V A;  3EF6 A;  2HQM A;  1RYI A;  3CGD A;  5KOX A;  3ABV A;  2JB1 A;  1OJA A;  5TR3 A;  4H4Y A;  2C4C A;  3URH A;  1ZDL A;  4YSY A;  3T2Y A;  2B7R A;  2IVE A;  3ITJ A;  3LJP A;  1TDN A;  1JRY A;  1PJ5 A;  4EMI A;  2R4E A;  2BCG G;  1LVL A;  1LTX R;  4GRT A;  1W4X A;  1PBF A;  4YXD A;  3IC9 A;  1JU2 A;  2C3C A;  3L1R A;  2YR5 A;  3P1W A;  1S2Y A;  2X8G A;  1MO9 A;  4B69 A;  2J3N A;  4CY6 A;  1CJC A;  3QFB A;  4KPR A;  4JQ9 A;  1LJ1 A;  2WOV A;  3FIM B;  4H2P A;  2WS3 A;  3PO7 A;  4CY8 A;  1Y56 B;  2ZZC A;  4BUR A;  1JNZ A;  3DK8 A;  5JCI A;  4DGK A;  4IA6 A;  4TM1 A;  1H86 A;  3D1C A;  1M64 A;  3D8X A;  3FG2 P;  2WP6 A;  4GDE A;  4H4S A;  3HYV A;  4Y4L A;  3SGL A;  4K5R A;  1PJ6 A;  1NHP A;  2APG A;  4H4P A;  4IVM B;  2YLR A;  2YM2 A;  2W0H A;  2BA9 A;  2GR2 A;  4LU6 A;  1D4D A;  4FDC B;  1D4C A;  3ICS A;  5KRQ A;  3EPT A;  3T2Z A;  4Z25 A;  4YT0 A;  3JSK A;  1H84 A;  1VG9 A;  2DKH A;  2GEW A;  1B37 A;  4H7U A;  3L8K A;  3SQP A;  4BJZ A;  1NG4 A;  4C5O A;  4X9N A;  4U8N A;  1TRB A;  4YWO A;  4JNA A;  2AQJ A;  1GPE A;  5U25 A;  4EIP A;  4USR A;  2VRL A;  2C76 A;  2B9X A;  2WP5 A;  3Q9T A;  5C2T A;  3KU9 A;  4E0V A;  1GXF A;  5L46 A;  3CNS A;  4O5U A;  2GR3 A;  3CN8 A;  4RG3 A;  4B65 A;  1QJD A;  4ZN0 A;  2A87 A;  1IUT A;  1BWC A;  1CC6 A;  3I3L A;  2BC0 A;  3DJG X;  1BKW A;  2CVJ A;  3DME A;  2V5Z A;  1ZK7 A;  2FJE A;  4J33 A;  2C75 A;  3ISH A;  3SX6 A;  1CBO A;  1GT8 A;  1BZL A;  3DK4 A;  4NEW A;  3AE1 A;  2Z5Y A;  4J34 A;  4DNA A;  3ALM A;  4GDP A;  2WPE A;  4H4Z A;  4NTD A;  4OVI A;  1B5Q A;  1S2Q A;  1NAA A;  2VQ7 A;  1MOK A;  2ZBW A;  3GWD A;  3KA7 A;  1DXL A;  4Z2T A;  1XHC A;  4HB9 A;  5JCL A;  3VR9 A;  5HXI A;  1CJ2 A;  2WPF A;  4BJY A;  3QSE A;  2FJA A;  2YLT A;  1OJC A;  4UP3 A;  3OC4 A;  4B67 A;  1OJT A;  2VQB A;  2YAU A;  2XVF A;  2YVJ A;  3RP7 A;  1K0L A;  1DJN A;  3NKS A;  2V6O A;  4K7Z A;  3ATR A;  4FK1 A;  3NNE A;  5M0Z A;  3UOZ A;  5HHF A;  4G73 A;  3GMB A;  4M52 A;  4B64 A;  2WOI A;  1VG0 A;  4U8K A;  1IUW A;  3T0K A;  4YKG A;  5LV9 A;  3WE0 A;  2BK3 A;  3UTG A;  4A6N A;  2YG7 A;  3S5W A;  2BS3 A;  4ZCD A;  3NYE A;  3AEA A;  1PXB A;  3ZYX A;  2QA1 A;  4H4V A;  3UKH A;  2C72 A;  2YG5 A;  3AEF A;  1O94 A;  3CIR A;  2GV8 A;  2B9Y A;  1MXT A;  3SM8 A;  4TM0 A;  1YQ3 A;  3RNM A;  1NEK A;  5HY5 A;  2CFY A;  1JOA A;  2R0G A;  4H2Q A;  3C4A A;  5HYM A;  3NK2 X;  4MJW A;  2BCP A;  1CJ3 A;  5GRT A;  1SEZ A;  1BF3 A;  5C3J A;  1EL7 A;  3UKP A;  3I6D A;  1FEC A;  3UKF A;  3QJ4 A;  2O9Z A;  3M0O A;  3OZ2 A;  4PAB A;  4IV9 A;  2H89 A;  1D4E A;  1Q1W A;  2BXS A;  5JCK A;  1GET A;  2ARD A;  2YR6 A;  1KNP A;  1IUX A;  1LQU A;  2C67 A;  3AE6 A;  4EIQ A;  4UDQ A;  3SZF A;  3F8R A;  5KMQ A;  4OCG A;  2C70 A;  3UP5 A;  3NRN A;  3GMC A;  2GR1 A;  3RP8 A;  2B9W A;  3VQR A;  5KXJ A;  1TDF A;  2V3A A;  3LAD A;  4NNJ A;  2XCG A;  4EQW A;  1PXC A;  4GUV A;  2BXR A;  1XAN A;  2WES A;  2Y6R A;  3BI2 A;  4H2N A;  4U8O A;  3QFA A;  3AD7 B;  2IVD A;  3M12 A;  3R9U A;  3E1T A;  5EBK A;  3DJE A;  3UKQ A;  3ICT A;  2BK4 A;  5EB5 A;  3IHG A;  5IQ1 A;  3NGC X;  3BI4 A;  2EQ7 A;  2V3B A;  4UDP A;  1K0J A;  4WCT A;  5EB4 A;  1PBE A;  3K30 A;  1Y0P A;  4FX9 A;  2EQ6 A;  4J56 A;  5FS6 A;  4RSL A;  4G6H A;  4XXG A;  3RP6 A;  2YWL A;  1JRZ A;  2AAQ A;  2XLU A;  4NEV A;  5J60 A;  5KMR A;  2Y6Q A;  3DH9 A;  1NHQ A;  3BNM A;  4OPL A;  4CNK A;  4LA1 A;  4Z26 A;  3AEE A;  3NLC A;  2GQF A;  3QVR A;  1PHH A;  1S3E A;  2E4G A;  2WBA A;  3SZC A;  1Q9I A;  2JB2 A;  3C4N A;  5CKU A;  1IUV A;  1RP0 A;  3CNP A;  2VVL G;  1BGJ A;  1OJD A;  2WOW A;  4YKF A;  3AEB A;  2BS4 A;  2JK6 A;  4DSH A;  1NG3 A;  1JEH A;  2C66 A;  1GRT A;  2CDU A;  4LII A;  3P4P A;  5CQF A;  5FS9 A;  3SZ0 A;  3GD4 A;  3SFE A;  1KSS A;  3NH3 X;  5U1O A;  4EM3 A;  4C74 A;  4EQS A;  2GB0 A;  1TDE A;  1H82 A;  3ALL A;  1EL5 A;  3UTH A;  1X31 B;  2XVI A;  3IF9 A;  4AT0 A;  4D04 A;  2XLS A;  2XVE A;  1CC4 A;  2WDV A;  3HZL A;  5KVH A;  4EQR A;  4YTP A;  2XVH A;  3LZW A;  3NN0 X;  2X8H A;  4BV6 A;  3GYI A;  2X3N A;  2OAL A;  2BK5 A;  1ELI A;  2XDO A;  1GV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...