4CCQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
313
structure length
313
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 95
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccqA02
3BHKA 3UKAA 5EOWA 2ARDA 2YVJA 4H4YA 3C4AA 4H4QA 4OPGA 4O5UA 2R45A 4YTPA 5J60A 4YSHA 1F8SA 3CGEA 1NG4A 1S2QA 3DJGX 4RG3A 5IPYA 1PBDA 1QLBA 1ZY8A 3CIRA 3DK4A 2WPCA 5CQFA 2CVJA 3AD8B 2E1MA 2WDVA 3Q9TA 3RP7A 2E4GA 3ICSA 4H4SA 3CTYA 1CJ3A 1M6IA 3UKFA 3WE0A 2BK5A 2QAEA 1FL2A 2H89A 4A99A 2V3BA 2C7GA 4C5OA 3FG2P 1B37A 3NGCX 3RNMA 1GPEA 3UKHA 4H4UA 4Z43A 1GT8A 1PXAA 1P2EA 4Z24A 2DKIA 2YR4A 3ALMA 1NEKA 1PS9A 2X3NA 4H2NA 4J34A 4TLXA 2XFOA 5GSNA 2GH5A 4B65A 4H4TA 4PAAA 4EIQA 2BCPA 2XLPA 2R4EA 1K0LA 4H4RA 2B7SA 3KD9A 2GVCA 3BNUA 1AOGA 4JNQA 2JB1A 1LJ1A 1EBDA 5KOWA 2YLRA 1B4VA 5KOXA 1OJ9A 1MO9A 2BS3A 3AE1A 4A5LA 1CJ4A 1FEAA 1LVLA 1PJ5A 3DK8A 3DJJA 3NN0X 4U2LA 4YWOA 1GOSA 4J31A 2WU2A 4U2TA 3EAOA 3AE6A 2V6OA 3GYIA 4H2RA 1D7YA 3FMWA 1GEUA 4ECHA 2W0HA 2WOWA 2YR5A 3ZDNA 2YWLA 3BI5A 1BGJA 3I6DA 1DJNA 4CY8A 3RP6A 5FS7A 3UTHA 1NHSA 4YT0A 3AEBA 3AYLA 3NNEA 4K5SA 3UKQA 3VRBA 1H7XA 3NTDA 1FEBA 1GALA 3ALJA 3NT6A 3HZLA 2AAQA 4OPIA 3LXDA 3ALLA 2WETA 2BACA 3BNMA 3AE7A 2VZ2A 1DOEA 4J2WA 1ZX9A 1N4VA 2R0CA 3FBSA 2UZZA 2GR3A 3QSMA 3F8PA 3ZYXA 4YKGA 4J36A 3C4NA 4AP3A 2Q0LA 2R4JA 4H4ZA 3AYJA 1NHRA 1ZP0A 2WOIA 3NG7X 4B67A 3COXA 3AWIA 4BV6A 1XANA 1BF3A 1O5WA 2GR1A 1TDEA 2JBVA 4CY6A 3SGLA 4FX9A 2BYBA 2HQMA 5GRTA 4OPTA 5BULA 1S3EA 2WPEA 2OA1A 2AQJA 3K7TA 3LOVA 4UDQA 5EBKA 5BRTA 1JNRA 1PBCA 4GF7A 1CBOA 3VR8A 1YKJA 2JKCA 2FJDA 3NTAA 3GWFA 3K7MX 4GUVA 1GRGA 1N4UA 3O0HA 2BK3A 4Z2RA 1E1NA 3BI4A 1PJ7A 2AR8A 5KVHA 5J7XA 1PBEA 4CNJA 2BCGG 2R0GA 1VDCA 1EL7A 2WP9A 2YG7A 3NRNA 3GDNA 1UKVG 4OPDA 1OJCA 2WEUA 2Q7VA 2XLSA 3UKPA 3PO7A 3NH3X 1GREA 1D5TA 3REDA 2B9WA 4JY2A 1CJCA 2WBAA 3LZXA 4EQXA 1N1PA 2ZZCA 3DK9A 1H82A 4WX1A 3P4PA 3VRAA 4BJYA 2R46A 3K7QX 1ZOVA 4EMWA 2QA2A 2OALA 3GMBA 3UOVA 1Q1RA 1TDFA 2GAGB 1VG9A 2Q0KA 1L0VA 4A6NA 1TRBA 2JK6A 3LJPA 4ADWA 1ZMCA 4JN9A 2R9ZA 3ISHA 1GRHA 1JU2A 1JRZA 1XPQA 2GQWA 3AEGA 4UP3A 1GNDA 1RP0A 2RGHA 2WP5A 1NAAA 4I58A 1CJ2A 4GCMA 3VR9A 1QJDA 1CHUA 1GTEA 1KSSA 2YVFA 4USQA 5BVAA 1ELIA 4C74A 4J57A 5JCIA 4IVOB 3AEEA 3AEDA 4J33A 5U25A 1O94A 2YLWA 2YM1A 5HYMA 4U8NA 1PJ6A 3P4QA 2V3AA 2EQ8A 2WOVA 2WS3A 3PS9A 2XDOA 5FS6A 3LB8A 1W4XA 4EM4A 1TYPA 4Z26A 3AEAA 3QVRA 1E1KA 1H84A 3GDPA 1YQ3A 2BK4A 4O5QA 4WCTA 2APGA 3LADA 3M13A 1IJHA 2Q6UA 1DOBA 4NTCA 2BABA 4A79A 2OLNA 4UDPA 3CNSA 3KU9A 1FOHA 3AE2A 4NEWA 4X4JA 3NK0X 4JNAA 4IVMB 4BURA 4BK3A 4Y4NA 3IHMA 1TDOA 1IUTA 3Q6JA 4J56A 1IUUA 1K0JA 1PXCA 2YG4A 1ZOYA 3EF6A 1YQ4A 3B6DA 1CC4A 3F8RA 2VVLA 3IWAA 4B64A 4D04A 1Q1WA 2X8HA 1SEZA 1BGNA 3DA1A 5C2TA 3IHGA 1BWCA 2YLTA 4X9NA 4K5RA 4OPCA 3V3OA 2GR0A 2WESA 1DOCA 3CGBA 3P4SA 1KDGA 1VQWA 2C3CA 5L46A 3GD3A 5U63A 3GMCA 1ONFA 1GERA 1LQUA 3BI2A 4OPLA 3VRDB 4B68A 4C3XA 3DJEA 2V60A 1REOA 3SM8A 2WPFA 1IUVA 2C65A 4YSXA 1DNCA 1E1MA 1LPFA 1L9EA 1FCDA 1GRFA 2C64A 3C96A 5JCLA 3EANA 1E1LA 4CCQA 1D4DA 3JSKA 4DNAA 2WU5A 1LV0A 2B76A 3D8XA 4ZN0A 3RP8A 2GF3A 4EMIA 2BS2A 4YSZA 3G5SA 3L8KA 3B3RA 5FS8A 4KPRA 1YQZA 1KNPA 3URHA 1HYUA 4U8IA 4TLZA 2QCUA 2VVLG 4YSYA 4CNKA 3P9UA 2Y6QA 1LTXR 1K4QA 3G5QA 3UP4A 4B1BA 1COYA 5JCNA 4XWRA 2O9ZA 2Y6RA 2Z5XA 4AT0A 2X99A 4DGKA 2C66A 3G5RA 3ITJA 1NHQA 2XLRA 3KKJA 5M0ZA 4USRA 2GV8A 1NHPA 1IUXA 1D7LA 3AXBA 4U8KA 4AOXA 3GRTA 1RSGA 1TDKA 3NYFA 4EM3A 4C3YA 1CF3A 2CFYA 4YTNA 4KX6A 3GWDA 4D03A 1D4CA 5EB4A 1B8SA 4MJWA 4RG4A 3SQPA 3DH9A 3UKLA 2H88A 5JCKA 1IUSA 4APNA 1PDHA 4JY3A 5HXIA 2GQFA 3QVPA 1DJQA 1H86A 2ZZ0A 4NEVA 1F8RA 3KVEA 4C77A 5IQ1A 4GRTA 2C76A 4IA6A 2A89A 4U8JA 2IVDA 3UTEA 3V3NA 3AD9B 3OC4A 5EB5A 2YM2A 3D1CA 3AE5A 4GDPA 1P2HA 4REKA 2TMDA 1YY5A 2QA1A 3PVCA 3T37A 3AE4A 3GRSA 1L9CA 4TM4A 2OLOA 3M0OA 1H81A 1KSUA 2PHHA 4B63A 2B9XA 2GB0A 2FJBA 2YG6A 1GRBA 1OJAA 1CL0A 2BC0A 2C3DA 3CNTA 4H4XA 5FS9A 4H50A 4Z25A 3VQRA 1FECA 2EQ7A 4NTDA 1JNZA 2RABA 3GYJA 3UOYA 3CN8A 1GETA 2GMHA 3E1TA 3DJDA 3L1RA 4NTEA 3SFEA 1NDAA 3I3LA 1S2YA 2YR6A 4FDCB 1NPXA 1DXLA 3NIXA 2NPXA 2GEWA 1XHCA 1ZDLA 2XYOA 1GTHA 2XLUA 2FJEA 4A6NB 1ZKQA 4DSHA 2X8CA 2BXRA 2BXSA 3UP5A 2C67A 1XDIA 4Y4MA 3CGCA 4LA1A 3ATQA 4I59A 5LV9A 2TPRA 2JAEA 1GESA 1GSNA 2WDQA 1K0IA 3OZ2A 2XVIA 3NYCA 2J3NA 2RGJA 3CNDA 3AE3A 3FPZA 3QFAA 1KNRA 3AB1A 3UTGA 1MXTA 3ICRA 3KLJA 3KPFA 2FBWA 5DBJA 2C72A 4H4PA 4EIPA 4U8LA 1GV4A 2B7RA 2YG5A 3IC9A 2X8GA 4OPUA 2VQBA 1JRXA 3ADAB 1NENA 4DSGA 2GR2A 2XFNA 1E39A 1O95A 2WQYA 3DGHA 4U8MA 3AYIA 5U1OA 4A9WA 3UTFA 4K8DA 2VOUA 2XLTA 1Z6LA 4NZHA 2VRMA 4E0VA 1JEHA 4GR1A 3QJ4A 1VG0A 2V61A 4CBQA 1Q9IA 3NN6X 1E6EA 4H4WA 2BA9A 4EQRA 4YXDA 2RGOA 5BUKA 3AECA 1RYIA 1KF6A 5M10A 2R0PA 5C3JA 3II4A 4PABA 4Y4LA 1GRAA 1GXFA 2Z5YA 1QO8A 4OCGA 1KFYA 2YVGA 5KRQA 2YLSA 4N9XA 1F3PA 2CDUA 2YLXA 4K22A 1DODA 2B9YA 4AP1A 1S3BA 4P9SA 1L9DA 3NHOX 3P1WA 1JOAA 4UDRA 2WHDA 4BK2A 1VRQB 4GDEA 4M52A 4H4VA 4CRTA 3K30A 1IUWA 3AE9A 3RHAA 4AT2A 2GMJA 3FIMB 1F8WA 4TM3A 5TR3A 3QSEA 4YKFA 3R9UA 2C70A 2VQ7A 2X50A 4B69A 4XWZA 1CC6A 4X9MA 5CKUA 4BK1A 2XFQA 5HY5A 2GAHB 3H8IA 4U2SA 1H83A 3NK2X 3QFBA 2ZBWA 5IQ4A 1M64A 1TYTA 2EQ6A 1LQTA 1EL5A 3ICTA 3CNPA 2JB3A 1ZMDA 2VRLA 2OAMA 3AD7B 3UCLA 3P4RA 4XXGA 1V59A 2BS4A 2IVEA 4H2QA 2C73A 1PXBA 1MOKA 3LZWA 4LU6A 4U8OA 4LIIA 4IV9A 4K7ZA 3AEFA 2F5ZA 3KA7A 3H8LA 2VVMA 4IA5A 4A65A 2E5VA 4AOSA 1Y56A 1EL9A 1EL8A 2XFUA 3EPTA 1BKWA 1H7WA 2XFPA 4JQ9A 2C75A 3BHFA 1NG3A 2GRTA 3CPIG 2A87A 2NVKX 4H7UA 2YLZA 2CULA 4Z2TA 4HA6A 5KWFA 2XVFA 1OJTA 1Y56B 2XVHA 4JDRA 1TDNA 4TM1A 4YTMA 2ZZBA 3S5WA 5FMHA 2YG3A 1PN0A 2BC1A 3GD4A 2A8XA 1D4EA 1JRYA 5KVIA 3V76A 4Z44A 2EQ9A 3NK1X 4CCRA 3NYEA 4A7AA 4HB9A 1E7PA 1B5QA 4RSLA 4ZCCA 3SFDA 2XCGA 3CPHG 3DGZA 1BZLA 2DKHA 2WP6A 2JB2A 4ICYA 1CC2A 4EQWA 2YQUA 3CNJA 3M12A 1GRTA 1PHHA 5HHFA 3H4KA 3UKKA 4BJZA 1PBBA 4Z2UA 3ATRA 3S61A 1X31B 3DMEA 1F6MA 1PBFA 2V5ZA 2WDRA 4TM0A 1N4WA 3CPJG 4EMJA 1H6VA 3AE8A 3IF9A 3GSIA 4H2PA 2XVJA 3UOZA 3NKSA 4FK1C 3CGDA 4EQSA 5KXJA 3QSSA 2FJAA 3ABVA 2ACZA 4K2XA 1OJDA 4U8PA 4ZCDA 4FK1A 3UOXA 5JCMA 5ER0A 1Y0PA 2PYXA 1ZK7A 4OVIA 2I0ZA 3F8DA 4B66A 2XVEA 2IIDA 2YAUA 3NLCA
chains in the Genus database with same CATH superfamily
5KMRA 3BHKA 3UKAA 5EOWA 2ARDA 2YVJA 4H4YA 3C4AA 4H4QA 4OPGA 4O5UA 2R45A 4YTPA 5J60A 4YSHA 1F8SA 3CGEA 1NG4A 1S2QA 3DJGX 4RG3A 5IPYA 1PBDA 1QLBA 1ZY8A 3CIRA 3DK4A 2WPCA 5CQFA 2CVJA 3AD8B 2E1MA 2WDVA 3Q9TA 3RP7A 3T2ZA 2E4GA 3ICSA 3T0KA 4H4SA 3CTYA 1CJ3A 1M6IA 3UKFA 3WE0A 2BK5A 2QAEA 1FL2A 2H89A 4A99A 2V3BA 2C7GA 4C5OA 3FG2P 1B37A 3NGCX 3RNMA 1GPEA 3UKHA 4H4UA 4Z43A 1GT8A 1PXAA 1P2EA 4Z24A 2DKIA 2YR4A 3ALMA 1NEKA 1PS9A 2X3NA 4H2NA 4J34A 4TLXA 2XFOA 5GSNA 2GH5A 4B65A 4H4TA 4PAAA 4EIQA 2BCPA 2XLPA 2R4EA 1K0LA 4H4RA 2B7SA 3KD9A 2GVCA 3BNUA 3SZFA 1AOGA 4JNQA 2JB1A 1LJ1A 1EBDA 5KOWA 2YLRA 1B4VA 5KOXA 1OJ9A 1MO9A 2BS3A 3AE1A 4A5LA 1CJ4A 1FEAA 1LVLA 1PJ5A 3DK8A 3DJJA 3NN0X 4U2LA 4YWOA 1GOSA 4J31A 3SYIA 2WU2A 4U2TA 3EAOA 3AE6A 2V6OA 3GYIA 4H2RA 1D7YA 3FMWA 1GEUA 4ECHA 2W0HA 2WOWA 2YR5A 3ZDNA 2YWLA 3BI5A 1BGJA 3I6DA 1DJNA 4CY8A 3RP6A 5FS7A 3UTHA 1NHSA 4YT0A 3AEBA 3AYLA 3NNEA 4K5SA 3UKQA 3VRBA 1H7XA 3NTDA 1FEBA 1GALA 3ALJA 3NT6A 3HZLA 2AAQA 4OPIA 3LXDA 3ALLA 2WETA 4GAPA 2BACA 3BNMA 3AE7A 2VZ2A 1DOEA 4J2WA 1ZX9A 1N4VA 2R0CA 3FBSA 2UZZA 2GR3A 3QSMA 4II2A 3F8PA 3ZYXA 4YKGA 4J36A 3C4NA 4AP3A 2Q0LA 2R4JA 4H4ZA 3AYJA 1NHRA 1ZP0A 2WOIA 3NG7X 4B67A 3COXA 3AWIA 4BV6A 1XANA 1BF3A 1O5WA 2GR1A 1TDEA 2BRAA 2JBVA 4G74A 3SGLA 4CY6A 4FX9A 2BYBA 2HQMA 3HYXA 5GRTA 4OPTA 5BULA 1S3EA 2WPEA 2OA1A 2AQJA 3K7TA 3LOVA 4UDQA 5EBKA 5BRTA 1JNRA 1PBCA 4GF7A 1CBOA 3VR8A 1YKJA 2JKCA 3GYXA 2FJDA 3NTAA 3GWFA 3K7MX 4GUVA 1GRGA 1N4UA 3O0HA 2BK3A 4Z2RA 1E1NA 3BI4A 1PJ7A 2AR8A 5KVHA 5J7XA 1PBEA 4CNJA 2BCGG 2R0GA 1VDCA 1EL7A 2WP9A 2YG7A 3NRNA 3GDNA 1UKVG 4OPDA 1OJCA 2WEUA 2Q7VA 2XLSA 3UKPA 3PO7A 3NH3X 3SZWA 1GREA 1D5TA 3REDA 2B9WA 4JY2A 1CJCA 2WBAA 3LZXA 4EQXA 1N1PA 2ZZCA 3DK9A 1H82A 4WX1A 3P4PA 3VRAA 4BJYA 2R46A 3K7QX 1ZOVA 4EMWA 4G6GA 2QA2A 2OALA 3GMBA 3UOVA 1Q1RA 1TDFA 2GAGB 1VG9A 2Q0KA 1L0VA 4A6NA 1TRBA 2JK6A 3LJPA 4ADWA 1ZMCA 4JN9A 2R9ZA 3ISHA 1GRHA 1JU2A 1JRZA 1XPQA 2GQWA 3AEGA 4UP3A 1GNDA 1RP0A 2RGHA 2WP5A 1NAAA 4I58A 1CJ2A 4GCMA 3VR9A 1QJDA 1CHUA 1GTEA 1KSSA 2YVFA 4USQA 4G9KA 5BVAA 1ELIA 4C74A 4J57A 5JCIA 4IVOB 3AEEA 3AEDA 4J33A 5U25A 1O94A 2YLWA 2YM1A 5HYMA 4U8NA 1PJ6A 3P4QA 2V3AA 2EQ8A 2WOVA 2WS3A 3PS9A 2XDOA 5FS6A 4II3A 3LB8A 1W4XA 4EM4A 1TYPA 4Z26A 3AEAA 3QVRA 1E1KA 1H84A 3GDPA 1YQ3A 2BK4A 4O5QA 4WCTA 2APGA 3LADA 3M13A 1IJHA 2Q6UA 1DOBA 4NTCA 2BABA 4A79A 2OLNA 4UDPA 5KMPA 3CNSA 3KU9A 1FOHA 3AE2A 4NEWA 4X4JA 3NK0X 4JNAA 4IVMB 4BURA 4BK3A 4Y4NA 3IHMA 1TDOA 1IUTA 3Q6JA 4J56A 1IUUA 1K0JA 1PXCA 2YG4A 1ZOYA 3EF6A 1YQ4A 3B6DA 1CC4A 3F8RA 2VVLA 3IWAA 4B64A 4D04A 1Q1WA 2X8HA 1SEZA 1BGNA 3DA1A 5C2TA 3IHGA 1BWCA 2YLTA 4X9NA 4K5RA 4OPCA 3V3OA 2GR0A 2WESA 1DOCA 3CGBA 3P4SA 1KDGA 1VQWA 2C3CA 5L46A 3GD3A 5U63A 3SY4A 3GMCA 1ONFA 1GERA 1LQUA 3BI2A 4OPLA 3VRDB 4B68A 4C3XA 3DJEA 2V60A 1REOA 4NWZA 3SM8A 2WPFA 1IUVA 2C65A 4YSXA 1DNCA 1E1MA 1LPFA 1L9EA 1FCDA 1GRFA 2C64A 3C96A 5JCLA 3EANA 1E1LA 4CCQA 1D4DA 3JSKA 4DNAA 2WU5A 1LV0A 3SZ0A 2B76A 3D8XA 5KNLA 4ZN0A 3RP8A 2GF3A 4EMIA 2BS2A 4YSZA 3G5SA 3L8KA 3B3RA 5FS8A 4KPRA 1YQZA 1KNPA 3URHA 1HYUA 4U8IA 4TLZA 2QCUA 2VVLG 4YSYA 4CNKA 3P9UA 2Y6QA 1LTXR 1K4QA 3G5QA 3UP4A 4B1BA 1COYA 5JCNA 4XWRA 2O9ZA 2Y6RA 2Z5XA 5KMQA 2X99A 4AT0A 4DGKA 2C66A 3G5RA 3ITJA 1NHQA 2XLRA 3KKJA 5M0ZA 4USRA 2GV8A 1NHPA 1IUXA 1D7LA 3AXBA 4U8KA 4AOXA 3GRTA 1RSGA 1TDKA 3NYFA 4EM3A 4C3YA 1CF3A 2CFYA 4YTNA 4KX6A 3GWDA 4D03A 1D4CA 5EB4A 1B8SA 4MJWA 4RG4A 3SQPA 3DH9A 3UKLA 2H88A 5JCKA 1IUSA 4APNA 1PDHA 4JY3A 5HXIA 2GQFA 3QVPA 1DJQA 1H86A 2ZZ0A 4NEVA 1F8RA 3KVEA 4C77A 5IQ1A 4GRTA 2C76A 4IA6A 2A89A 4U8JA 2IVDA 3UTEA 3V3NA 3AD9B 3OC4A 5EB5A 2YM2A 3HYVA 3D1CA 3AE5A 4GDPA 1P2HA 4REKA 3T14A 2TMDA 1YY5A 2QA1A 3PVCA 3T37A 3AE4A 3GRSA 1L9CA 4TM4A 2OLOA 3M0OA 1H81A 2C4CA 1KSUA 2PHHA 4B63A 2B9XA 2GB0A 2FJBA 2YG6A 1GRBA 1OJAA 1CL0A 2BC0A 2C3DA 3CNTA 4H4XA 5FS9A 4H50A 4Z25A 2BRYA 3VQRA 1FECA 2EQ7A 4NTDA 1JNZA 2RABA 3GYJA 3UOYA 3CN8A 1GETA 2GMHA 3E1TA 3DJDA 3L1RA 4NTEA 3SFEA 1NDAA 3SX6A 3I3LA 1S2YA 4G6HA 2YR6A 4FDCB 1NPXA 1DXLA 3NIXA 2NPXA 2GEWA 1XHCA 1ZDLA 2XYOA 1GTHA 2XLUA 2FJEA 4A6NB 1ZKQA 4DSHA 2X8CA 2BXRA 2BXSA 3UP5A 2C67A 1XDIA 4Y4MA 3CGCA 4LA1A 3ATQA 4I59A 5LV9A 2TPRA 2JAEA 1GESA 1GSNA 2WDQA 1K0IA 3OZ2A 2XVIA 3NYCA 3CMMA 2J3NA 2RGJA 3CNDA 3AE3A 3FPZA 3QFAA 5KMSA 1KNRA 3AB1A 3UTGA 1MXTA 3ICRA 3KLJA 3KPFA 2FBWA 5DBJA 2C72A 4H4PA 4EIPA 4U8LA 1GV4A 2B7RA 2YG5A 3IC9A 2X8GA 4OPUA 2VQBA 1JRXA 3ADAB 1NENA 4DSGA 2GR2A 2XFNA 1E39A 1O95A 2WQYA 3DGHA 4U8MA 3AYIA 4GAVA 5U1OA 4A9WA 3UTFA 4K8DA 2VOUA 2XLTA 1Z6LA 4NZHA 2VRMA 4NNJA 4E0VA 1JEHA 4GR1A 3QJ4A 1VG0A 2V61A 3SZCA 4CBQA 1Q9IA 3NN6X 1E6EA 4H4WA 2BA9A 3T2YA 4EQRA 4YXDA 2RGOA 5BUKA 3AECA 1RYIA 1KF6A 5M10A 2R0PA 5C3JA 3II4A 4PABA 4Y4LA 1GRAA 1GXFA 2Z5YA 1QO8A 4OCGA 1KFYA 2YVGA 5KRQA 2YLSA 4N9XA 1F3PA 2CDUA 2YLXA 4K22A 1DODA 2B9YA 4AP1A 1S3BA 4P9SA 1L9DA 3NHOX 3P1WA 1JOAA 4UDRA 2WHDA 4BK2A 1VRQB 4GDEA 4M52A 4H4VA 4CRTA 3K30A 1IUWA 3AE9A 3RHAA 3T31A 4AT2A 2GMJA 3FIMB 1F8WA 4TM3A 5TR3A 3QSEA 4YKFA 3R9UA 2C70A 2VQ7A 2X50A 4B69A 4XWZA 1CC6A 4X9MA 5CKUA 4BK1A 2XFQA 3T2KA 2GAHB 3H8IA 5HY5A 4U2SA 1H83A 3NK2X 3QFBA 2ZBWA 5IQ4A 1M64A 1TYTA 2EQ6A 1LQTA 1EL5A 3ICTA 3CNPA 2JB3A 1ZMDA 2VRLA 2OAMA 3AD7B 3UCLA 3P4RA 4XXGA 1V59A 2BS4A 2IVEA 4H2QA 2C73A 1PXBA 1MOKA 3LZWA 4LU6A 4U8OA 4LIIA 4IV9A 4K7ZA 3AEFA 2F5ZA 3KA7A 3H8LA 2VVMA 4IA5A 4A65A 2E5VA 4AOSA 1Y56A 1EL9A 1EL8A 2XFUA 3EPTA 1BKWA 1H7WA 2XFPA 4JQ9A 2C75A 3BHFA 1NG3A 2GRTA 3CPIG 2A87A 2NVKX 4H7UA 2YLZA 2CULA 4Z2TA 4HA6A 5KWFA 2XVFA 1OJTA 1Y56B 2XVHA 4JDRA 1TDNA 4TM1A 4YTMA 2ZZBA 3S5WA 5FMHA 2YG3A 1PN0A 2BC1A 3GD4A 2A8XA 1D4EA 1JRYA 5KVIA 3V76A 4Z44A 2EQ9A 3NK1X 4CCRA 3NYEA 4A7AA 4HB9A 1E7PA 1B5QA 4RSLA 4ZCCA 3SFDA 2XCGA 3CPHG 3DGZA 1BZLA 2DKHA 2WP6A 2JB2A 4ICYA 1CC2A 4EQWA 2YQUA 3CNJA 3M12A 1GRTA 1PHHA 5HHFA 3H4KA 3SXIA 3UKKA 1PBBA 4BJZA 3ATRA 3S61A 4Z2UA 3KPKA 1X31B 3DMEA 1F6MA 1PBFA 2V5ZA 2WDRA 4TM0A 1N4WA 3CPJG 4EMJA 1H6VA 3AE8A 3HYWA 3IF9A 3GSIA 4H2PA 2XVJA 3UOZA 3NKSA 4FK1C 3CGDA 4EQSA 5KXJA 3QSSA 2FJAA 3ABVA 2ACZA 4K2XA 1OJDA 4U8PA 4ZCDA 4FK1A 3UOXA 5JCMA 5ER0A 1Y0PA 2PYXA 1ZK7A 4OVIA 2I0ZA 3F8DA 4B66A 4G73A 2XVEA 2IIDA 2YAUA 3NLCA
chains in the Genus database with same CATH topology
5KMRA 3BHKA 3UKAA 5EOWA 2ARDA 2YVJA 4H4YA 3C4AA 4H4QA 4OPGA 4O5UA 2R45A 4YTPA 5J60A 4YSHA 1F8SA 3CGEA 1NG4A 1S2QA 3DJGX 4RG3A 5IPYA 1PBDA 1QLBA 1ZY8A 3CIRA 3DK4A 2WPCA 5CQFA 2CVJA 3AD8B 2E1MA 2WDVA 3Q9TA 3RP7A 3T2ZA 2E4GA 3ICSA 3T0KA 4H4SA 3CTYA 1CJ3A 1M6IA 3UKFA 3WE0A 2BK5A 2QAEA 1FL2A 2H89A 4A99A 2V3BA 2C7GA 4C5OA 3FG2P 1B37A 3NGCX 3RNMA 1GPEA 3UKHA 4H4UA 4Z43A 1GT8A 1PXAA 1P2EA 4Z24A 2DKIA 2YR4A 3ALMA 1NEKA 1PS9A 2X3NA 4H2NA 4J34A 4TLXA 2XFOA 5GSNA 2GH5A 4B65A 4H4TA 4PAAA 4EIQA 2BCPA 2XLPA 2R4EA 1K0LA 4H4RA 2B7SA 3KD9A 2GVCA 3BNUA 3SZFA 1AOGA 4JNQA 2JB1A 1LJ1A 1EBDA 5KOWA 2YLRA 1B4VA 5KOXA 1OJ9A 1MO9A 2BS3A 3AE1A 4A5LA 1CJ4A 1FEAA 1LVLA 1PJ5A 3DK8A 3DJJA 3NN0X 4U2LA 4YWOA 1GOSA 4J31A 3SYIA 2WU2A 4U2TA 3EAOA 3AE6A 2V6OA 3GYIA 4H2RA 1D7YA 3FMWA 1GEUA 4ECHA 2W0HA 2WOWA 2YR5A 3ZDNA 2YWLA 3BI5A 1BGJA 3I6DA 1DJNA 4CY8A 3RP6A 5FS7A 3UTHA 1NHSA 4YT0A 3AEBA 3AYLA 3NNEA 4K5SA 3UKQA 3VRBA 1H7XA 3NTDA 1FEBA 1GALA 3ALJA 3NT6A 3HZLA 2AAQA 4OPIA 3LXDA 3ALLA 2WETA 4GAPA 2BACA 3BNMA 3AE7A 2VZ2A 1DOEA 4J2WA 1ZX9A 1N4VA 2R0CA 3FBSA 2UZZA 2GR3A 3QSMA 4II2A 3F8PA 3ZYXA 4YKGA 4J36A 3C4NA 4AP3A 2Q0LA 2R4JA 4H4ZA 3AYJA 1NHRA 1ZP0A 2WOIA 3NG7X 4B67A 3COXA 3AWIA 4BV6A 1XANA 1BF3A 1O5WA 2GR1A 1TDEA 2BRAA 2JBVA 4G74A 3SGLA 4CY6A 4FX9A 2BYBA 2HQMA 3HYXA 5GRTA 4OPTA 5BULA 1S3EA 2WPEA 2OA1A 2AQJA 3K7TA 3LOVA 4UDQA 5EBKA 5BRTA 1JNRA 1PBCA 4GF7A 1CBOA 3VR8A 1YKJA 2JKCA 3GYXA 2FJDA 3NTAA 3GWFA 3K7MX 4GUVA 1GRGA 1N4UA 3O0HA 2BK3A 4Z2RA 1E1NA 3BI4A 1PJ7A 2AR8A 5KVHA 5J7XA 1PBEA 4CNJA 2BCGG 2R0GA 1VDCA 1EL7A 2WP9A 2YG7A 3NRNA 3GDNA 1UKVG 4OPDA 1OJCA 2WEUA 2Q7VA 2XLSA 3UKPA 3PO7A 3NH3X 3SZWA 1GREA 1D5TA 3REDA 2B9WA 4JY2A 1CJCA 2WBAA 3LZXA 4EQXA 1N1PA 2ZZCA 3DK9A 1H82A 4WX1A 3P4PA 3VRAA 4BJYA 2R46A 3K7QX 1ZOVA 4EMWA 4G6GA 2QA2A 2OALA 3GMBA 3UOVA 1Q1RA 1TDFA 2GAGB 1VG9A 2Q0KA 1L0VA 4A6NA 1TRBA 2JK6A 3LJPA 4ADWA 1ZMCA 4JN9A 2R9ZA 3ISHA 1GRHA 1JU2A 1JRZA 1XPQA 2GQWA 3AEGA 4UP3A 1GNDA 1RP0A 2RGHA 2WP5A 1NAAA 4I58A 1CJ2A 4GCMA 3VR9A 1QJDA 1CHUA 1GTEA 1KSSA 2YVFA 4USQA 4G9KA 5BVAA 1ELIA 4C74A 4J57A 5JCIA 4IVOB 3AEEA 3AEDA 4J33A 5U25A 1O94A 2YLWA 2YM1A 5HYMA 4U8NA 1PJ6A 3P4QA 2V3AA 2EQ8A 2WOVA 2WS3A 3PS9A 2XDOA 5FS6A 4II3A 3LB8A 1W4XA 4EM4A 1TYPA 4Z26A 3AEAA 3QVRA 1E1KA 1H84A 3GDPA 1YQ3A 2BK4A 4O5QA 4WCTA 2APGA 3LADA 3M13A 1IJHA 2Q6UA 1DOBA 4NTCA 2BABA 4A79A 2OLNA 4UDPA 5KMPA 3CNSA 3KU9A 1FOHA 3AE2A 4NEWA 4X4JA 3NK0X 4JNAA 4IVMB 4BURA 4BK3A 4Y4NA 3IHMA 1TDOA 1IUTA 3Q6JA 4J56A 1IUUA 1K0JA 1PXCA 2YG4A 1ZOYA 3EF6A 1YQ4A 3B6DA 1CC4A 3F8RA 2VVLA 3IWAA 4B64A 4D04A 1Q1WA 2X8HA 1SEZA 1BGNA 3DA1A 5C2TA 3IHGA 1BWCA 2YLTA 4X9NA 4K5RA 4OPCA 3V3OA 2GR0A 2WESA 1DOCA 3CGBA 3P4SA 1KDGA 1VQWA 2C3CA 5L46A 3GD3A 5U63A 3SY4A 3GMCA 1ONFA 1GERA 1LQUA 3BI2A 4OPLA 3VRDB 4B68A 4C3XA 3DJEA 2V60A 1REOA 4NWZA 3SM8A 2WPFA 1IUVA 2C65A 4YSXA 1DNCA 1E1MA 1LPFA 1L9EA 1FCDA 1GRFA 2C64A 3C96A 5JCLA 3EANA 1E1LA 4CCQA 1D4DA 3JSKA 4DNAA 2WU5A 1LV0A 3SZ0A 2B76A 3D8XA 5KNLA 4ZN0A 3RP8A 2GF3A 4EMIA 2BS2A 4YSZA 3G5SA 3L8KA 3B3RA 5FS8A 4KPRA 1YQZA 1KNPA 3URHA 1HYUA 4U8IA 4TLZA 2QCUA 2VVLG 4YSYA 4CNKA 3P9UA 2Y6QA 1LTXR 1K4QA 3G5QA 3UP4A 4B1BA 1COYA 5JCNA 4XWRA 2O9ZA 2Y6RA 2Z5XA 5KMQA 2X99A 4AT0A 4DGKA 2C66A 3G5RA 3ITJA 1NHQA 2XLRA 3KKJA 5M0ZA 4USRA 2GV8A 1NHPA 1IUXA 1D7LA 3AXBA 4U8KA 4AOXA 3GRTA 1RSGA 1TDKA 3NYFA 4EM3A 4C3YA 1CF3A 2CFYA 4YTNA 4KX6A 3GWDA 4D03A 1D4CA 5EB4A 1B8SA 4MJWA 4RG4A 3SQPA 3DH9A 3UKLA 2H88A 5JCKA 1IUSA 4APNA 1PDHA 4JY3A 5HXIA 2GQFA 3QVPA 1DJQA 1H86A 2ZZ0A 4NEVA 1F8RA 3KVEA 4C77A 5IQ1A 4GRTA 2C76A 4IA6A 2A89A 4U8JA 2IVDA 3UTEA 3V3NA 3AD9B 3OC4A 5EB5A 2YM2A 3HYVA 3D1CA 3AE5A 4GDPA 1P2HA 4REKA 3T14A 2TMDA 1YY5A 2QA1A 3PVCA 3T37A 3AE4A 3GRSA 1L9CA 4TM4A 2OLOA 3M0OA 1H81A 2C4CA 1KSUA 2PHHA 4B63A 2B9XA 2GB0A 2FJBA 2YG6A 1GRBA 1OJAA 1CL0A 2BC0A 2C3DA 3CNTA 4H4XA 5FS9A 4H50A 4Z25A 2BRYA 3VQRA 1FECA 2EQ7A 4NTDA 1JNZA 2RABA 3GYJA 3UOYA 3CN8A 1GETA 2GMHA 3E1TA 3DJDA 3L1RA 4NTEA 3SFEA 1NDAA 3SX6A 3I3LA 1S2YA 4G6HA 2YR6A 4FDCB 1NPXA 1DXLA 3NIXA 2NPXA 2GEWA 1XHCA 1ZDLA 2XYOA 1GTHA 2XLUA 2FJEA 4A6NB 1ZKQA 4DSHA 2X8CA 2BXRA 2BXSA 3UP5A 2C67A 1XDIA 4Y4MA 3CGCA 4LA1A 3ATQA 4I59A 5LV9A 2TPRA 2JAEA 1GESA 1GSNA 2WDQA 1K0IA 3OZ2A 2XVIA 3NYCA 3CMMA 2J3NA 2RGJA 3CNDA 3AE3A 3FPZA 3QFAA 5KMSA 1KNRA 3AB1A 3UTGA 1MXTA 3ICRA 3KLJA 3KPFA 2FBWA 5DBJA 2C72A 4H4PA 4EIPA 4U8LA 1GV4A 2B7RA 2YG5A 3IC9A 2X8GA 4OPUA 2VQBA 1JRXA 3ADAB 1NENA 4DSGA 2GR2A 2XFNA 1E39A 1O95A 2WQYA 3DGHA 4U8MA 3AYIA 4GAVA 5U1OA 4A9WA 3UTFA 4K8DA 2VOUA 2XLTA 1Z6LA 4NZHA 2VRMA 4NNJA 4E0VA 1JEHA 4GR1A 3QJ4A 1VG0A 2V61A 3SZCA 4CBQA 1Q9IA 3NN6X 1E6EA 4H4WA 2BA9A 3T2YA 4EQRA 4YXDA 2RGOA 5BUKA 3AECA 1RYIA 1KF6A 5M10A 2R0PA 5C3JA 3II4A 4PABA 4Y4LA 1GRAA 1GXFA 2Z5YA 1QO8A 4OCGA 1KFYA 2YVGA 5KRQA 2YLSA 4N9XA 1F3PA 2CDUA 2YLXA 4K22A 1DODA 2B9YA 4AP1A 1S3BA 4P9SA 1L9DA 3NHOX 3P1WA 1JOAA 4UDRA 2WHDA 4BK2A 1VRQB 4GDEA 4M52A 4H4VA 4CRTA 3K30A 1IUWA 3AE9A 3RHAA 3T31A 4AT2A 2GMJA 3FIMB 1F8WA 4TM3A 5TR3A 3QSEA 4YKFA 3R9UA 2C70A 2VQ7A 2X50A 4B69A 4XWZA 1CC6A 4X9MA 5CKUA 4BK1A 2XFQA 3T2KA 2GAHB 3H8IA 5HY5A 4U2SA 1H83A 3NK2X 3QFBA 2ZBWA 5IQ4A 1M64A 1TYTA 2EQ6A 1LQTA 1EL5A 3ICTA 3CNPA 2JB3A 1ZMDA 2VRLA 2OAMA 3AD7B 3UCLA 3P4RA 4XXGA 1V59A 2BS4A 2IVEA 4H2QA 2C73A 1PXBA 1MOKA 3LZWA 4LU6A 4U8OA 4LIIA 4IV9A 4K7ZA 3AEFA 2F5ZA 3KA7A 3H8LA 2VVMA 4IA5A 4A65A 2E5VA 4AOSA 1Y56A 1EL9A 1EL8A 2XFUA 3EPTA 1BKWA 1H7WA 2XFPA 4JQ9A 2C75A 3BHFA 1NG3A 2GRTA 3CPIG 2A87A 2NVKX 4H7UA 2YLZA 2CULA 4Z2TA 4HA6A 5KWFA 2XVFA 1OJTA 1Y56B 2XVHA 4JDRA 1TDNA 4TM1A 4YTMA 2ZZBA 3S5WA 5FMHA 2YG3A 1PN0A 2BC1A 3GD4A 2A8XA 1D4EA 1JRYA 5KVIA 3V76A 4Z44A 2EQ9A 3NK1X 4CCRA 3NYEA 4A7AA 4HB9A 1E7PA 1B5QA 4RSLA 4ZCCA 3SFDA 2XCGA 3CPHG 3DGZA 1BZLA 2DKHA 2WP6A 2JB2A 4ICYA 1CC2A 4EQWA 2YQUA 3CNJA 3M12A 1GRTA 1PHHA 5HHFA 3H4KA 3SXIA 3UKKA 1PBBA 4BJZA 3ATRA 3S61A 4Z2UA 3KPKA 1X31B 3DMEA 1F6MA 1PBFA 2V5ZA 2WDRA 4TM0A 1N4WA 3CPJG 4EMJA 1H6VA 3AE8A 3HYWA 3IF9A 3GSIA 4H2PA 2XVJA 3UOZA 3NKSA 4FK1C 3CGDA 4EQSA 5KXJA 3QSSA 2FJAA 3ABVA 2ACZA 4K2XA 1OJDA 4U8PA 4ZCDA 4FK1A 3UOXA 5JCMA 5ER0A 1Y0PA 2PYXA 1ZK7A 4OVIA 2I0ZA 3F8DA 4B66A 4G73A 2XVEA 2IIDA 2YAUA 3NLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHK A;  3UKA A;  5EOW A;  2ARD A;  2YVJ A;  4H4Y A;  3C4A A;  4H4Q A;  4OPG A;  4O5U A;  2R45 A;  4YTP A;  5J60 A;  4YSH A;  1F8S A;  3CGE A;  1NG4 A;  1S2Q A;  3DJG X;  4RG3 A;  5IPY A;  1PBD A;  1QLB A;  1ZY8 A;  3CIR A;  3DK4 A;  2WPC A;  5CQF A;  2CVJ A;  3AD8 B;  2E1M A;  2WDV A;  3Q9T A;  3RP7 A;  2E4G A;  3ICS A;  4H4S A;  3CTY A;  1CJ3 A;  1M6I A;  3UKF A;  3WE0 A;  2BK5 A;  2QAE A;  1FL2 A;  2H89 A;  4A99 A;  2V3B A;  2C7G A;  4C5O A;  3FG2 P;  1B37 A;  3NGC X;  3RNM A;  1GPE A;  3UKH A;  4H4U A;  4Z43 A;  1GT8 A;  1PXA A;  1P2E A;  4Z24 A;  2DKI A;  2YR4 A;  3ALM A;  1NEK A;  1PS9 A;  2X3N A;  4H2N A;  4J34 A;  4TLX A;  2XFO A;  5GSN A;  2GH5 A;  4B65 A;  4H4T A;  4PAA A;  4EIQ A;  2BCP A;  2XLP A;  2R4E A;  1K0L A;  4H4R A;  2B7S A;  3KD9 A;  2GVC A;  3BNU A;  1AOG A;  4JNQ A;  2JB1 A;  1LJ1 A;  1EBD A;  5KOW A;  2YLR A;  1B4V A;  5KOX A;  1OJ9 A;  1MO9 A;  2BS3 A;  3AE1 A;  4A5L A;  1CJ4 A;  1FEA A;  1LVL A;  1PJ5 A;  3DK8 A;  3DJJ A;  3NN0 X;  4U2L A;  4YWO A;  1GOS A;  4J31 A;  2WU2 A;  4U2T A;  3EAO A;  3AE6 A;  2V6O A;  3GYI A;  4H2R A;  1D7Y A;  3FMW A;  1GEU A;  4ECH A;  2W0H A;  2WOW A;  2YR5 A;  3ZDN A;  2YWL A;  3BI5 A;  1BGJ A;  3I6D A;  1DJN A;  4CY8 A;  3RP6 A;  5FS7 A;  3UTH A;  1NHS A;  4YT0 A;  3AEB A;  3AYL A;  3NNE A;  4K5S A;  3UKQ A;  3VRB A;  1H7X A;  3NTD A;  1FEB A;  1GAL A;  3ALJ A;  3NT6 A;  3HZL A;  2AAQ A;  4OPI A;  3LXD A;  3ALL A;  2WET A;  2BAC A;  3BNM A;  3AE7 A;  2VZ2 A;  1DOE A;  4J2W A;  1ZX9 A;  1N4V A;  2R0C A;  3FBS A;  2UZZ A;  2GR3 A;  3QSM A;  3F8P A;  3ZYX A;  4YKG A;  4J36 A;  3C4N A;  4AP3 A;  2Q0L A;  2R4J A;  4H4Z A;  3AYJ A;  1NHR A;  1ZP0 A;  2WOI A;  3NG7 X;  4B67 A;  3COX A;  3AWI A;  4BV6 A;  1XAN A;  1BF3 A;  1O5W A;  2GR1 A;  1TDE A;  2JBV A;  4CY6 A;  3SGL A;  4FX9 A;  2BYB A;  2HQM A;  5GRT A;  4OPT A;  5BUL A;  1S3E A;  2WPE A;  2OA1 A;  2AQJ A;  3K7T A;  3LOV A;  4UDQ A;  5EBK A;  5BRT A;  1JNR A;  1PBC A;  4GF7 A;  1CBO A;  3VR8 A;  1YKJ A;  2JKC A;  2FJD A;  3NTA A;  3GWF A;  3K7M X;  4GUV A;  1GRG A;  1N4U A;  3O0H A;  2BK3 A;  4Z2R A;  1E1N A;  3BI4 A;  1PJ7 A;  2AR8 A;  5KVH A;  5J7X A;  1PBE A;  4CNJ A;  2BCG G;  2R0G A;  1VDC A;  1EL7 A;  2WP9 A;  2YG7 A;  3NRN A;  3GDN A;  1UKV G;  4OPD A;  1OJC A;  2WEU A;  2Q7V A;  2XLS A;  3UKP A;  3PO7 A;  3NH3 X;  1GRE A;  1D5T A;  3RED A;  2B9W A;  4JY2 A;  1CJC A;  2WBA A;  3LZX A;  4EQX A;  1N1P A;  2ZZC A;  3DK9 A;  1H82 A;  4WX1 A;  3P4P A;  3VRA A;  4BJY A;  2R46 A;  3K7Q X;  1ZOV A;  4EMW A;  2QA2 A;  2OAL A;  3GMB A;  3UOV A;  1Q1R A;  1TDF A;  2GAG B;  1VG9 A;  2Q0K A;  1L0V A;  4A6N A;  1TRB A;  2JK6 A;  3LJP A;  4ADW A;  1ZMC A;  4JN9 A;  2R9Z A;  3ISH A;  1GRH A;  1JU2 A;  1JRZ A;  1XPQ A;  2GQW A;  3AEG A;  4UP3 A;  1GND A;  1RP0 A;  2RGH A;  2WP5 A;  1NAA A;  4I58 A;  1CJ2 A;  4GCM A;  3VR9 A;  1QJD A;  1CHU A;  1GTE A;  1KSS A;  2YVF A;  4USQ A;  5BVA A;  1ELI A;  4C74 A;  4J57 A;  5JCI A;  4IVO B;  3AEE A;  3AED A;  4J33 A;  5U25 A;  1O94 A;  2YLW A;  2YM1 A;  5HYM A;  4U8N A;  1PJ6 A;  3P4Q A;  2V3A A;  2EQ8 A;  2WOV A;  2WS3 A;  3PS9 A;  2XDO A;  5FS6 A;  3LB8 A;  1W4X A;  4EM4 A;  1TYP A;  4Z26 A;  3AEA A;  3QVR A;  1E1K A;  1H84 A;  3GDP A;  1YQ3 A;  2BK4 A;  4O5Q A;  4WCT A;  2APG A;  3LAD A;  3M13 A;  1IJH A;  2Q6U A;  1DOB A;  4NTC A;  2BAB A;  4A79 A;  2OLN A;  4UDP A;  3CNS A;  3KU9 A;  1FOH A;  3AE2 A;  4NEW A;  4X4J A;  3NK0 X;  4JNA A;  4IVM B;  4BUR A;  4BK3 A;  4Y4N A;  3IHM A;  1TDO A;  1IUT A;  3Q6J A;  4J56 A;  1IUU A;  1K0J A;  1PXC A;  2YG4 A;  1ZOY A;  3EF6 A;  1YQ4 A;  3B6D A;  1CC4 A;  3F8R A;  2VVL A;  3IWA A;  4B64 A;  4D04 A;  1Q1W A;  2X8H A;  1SEZ A;  1BGN A;  3DA1 A;  5C2T A;  3IHG A;  1BWC A;  2YLT A;  4X9N A;  4K5R A;  4OPC A;  3V3O A;  2GR0 A;  2WES A;  1DOC A;  3CGB A;  3P4S A;  1KDG A;  1VQW A;  2C3C A;  5L46 A;  3GD3 A;  5U63 A;  3GMC A;  1ONF A;  1GER A;  1LQU A;  3BI2 A;  4OPL A;  3VRD B;  4B68 A;  4C3X A;  3DJE A;  2V60 A;  1REO A;  3SM8 A;  2WPF A;  1IUV A;  2C65 A;  4YSX A;  1DNC A;  1E1M A;  1LPF A;  1L9E A;  1FCD A;  1GRF A;  2C64 A;  3C96 A;  5JCL A;  3EAN A;  1E1L A;  4CCQ A;  1D4D A;  3JSK A;  4DNA A;  2WU5 A;  1LV0 A;  2B76 A;  3D8X A;  4ZN0 A;  3RP8 A;  2GF3 A;  4EMI A;  2BS2 A;  4YSZ A;  3G5S A;  3L8K A;  3B3R A;  5FS8 A;  4KPR A;  1YQZ A;  1KNP A;  3URH A;  1HYU A;  4U8I A;  4TLZ A;  2QCU A;  2VVL G;  4YSY A;  4CNK A;  3P9U A;  2Y6Q A;  1LTX R;  1K4Q A;  3G5Q A;  3UP4 A;  4B1B A;  1COY A;  5JCN A;  4XWR A;  2O9Z A;  2Y6R A;  2Z5X A;  4AT0 A;  2X99 A;  4DGK A;  2C66 A;  3G5R A;  3ITJ A;  1NHQ A;  2XLR A;  3KKJ A;  5M0Z A;  4USR A;  2GV8 A;  1NHP A;  1IUX A;  1D7L A;  3AXB A;  4U8K A;  4AOX A;  3GRT A;  1RSG A;  1TDK A;  3NYF A;  4EM3 A;  4C3Y A;  1CF3 A;  2CFY A;  4YTN A;  4KX6 A;  3GWD A;  4D03 A;  1D4C A;  5EB4 A;  1B8S A;  4MJW A;  4RG4 A;  3SQP A;  3DH9 A;  3UKL A;  2H88 A;  5JCK A;  1IUS A;  4APN A;  1PDH A;  4JY3 A;  5HXI A;  2GQF A;  3QVP A;  1DJQ A;  1H86 A;  2ZZ0 A;  4NEV A;  1F8R A;  3KVE A;  4C77 A;  5IQ1 A;  4GRT A;  2C76 A;  4IA6 A;  2A89 A;  4U8J A;  2IVD A;  3UTE A;  3V3N A;  3AD9 B;  3OC4 A;  5EB5 A;  2YM2 A;  3D1C A;  3AE5 A;  4GDP A;  1P2H A;  4REK A;  2TMD A;  1YY5 A;  2QA1 A;  3PVC A;  3T37 A;  3AE4 A;  3GRS A;  1L9C A;  4TM4 A;  2OLO A;  3M0O A;  1H81 A;  1KSU A;  2PHH A;  4B63 A;  2B9X A;  2GB0 A;  2FJB A;  2YG6 A;  1GRB A;  1OJA A;  1CL0 A;  2BC0 A;  2C3D A;  3CNT A;  4H4X A;  5FS9 A;  4H50 A;  4Z25 A;  3VQR A;  1FEC A;  2EQ7 A;  4NTD A;  1JNZ A;  2RAB A;  3GYJ A;  3UOY A;  3CN8 A;  1GET A;  2GMH A;  3E1T A;  3DJD A;  3L1R A;  4NTE A;  3SFE A;  1NDA A;  3I3L A;  1S2Y A;  2YR6 A;  4FDC B;  1NPX A;  1DXL A;  3NIX A;  2NPX A;  2GEW A;  1XHC A;  1ZDL A;  2XYO A;  1GTH A;  2XLU A;  2FJE A;  4A6N B;  1ZKQ A;  4DSH A;  2X8C A;  2BXR A;  2BXS A;  3UP5 A;  2C67 A;  1XDI A;  4Y4M A;  3CGC A;  4LA1 A;  3ATQ A;  4I59 A;  5LV9 A;  2TPR A;  2JAE A;  1GES A;  1GSN A;  2WDQ A;  1K0I A;  3OZ2 A;  2XVI A;  3NYC A;  2J3N A;  2RGJ A;  3CND A;  3AE3 A;  3FPZ A;  3QFA A;  1KNR A;  3AB1 A;  3UTG A;  1MXT A;  3ICR A;  3KLJ A;  3KPF A;  2FBW A;  5DBJ A;  2C72 A;  4H4P A;  4EIP A;  4U8L A;  1GV4 A;  2B7R A;  2YG5 A;  3IC9 A;  2X8G A;  4OPU A;  2VQB A;  1JRX A;  3ADA B;  1NEN A;  4DSG A;  2GR2 A;  2XFN A;  1E39 A;  1O95 A;  2WQY A;  3DGH A;  4U8M A;  3AYI A;  5U1O A;  4A9W A;  3UTF A;  4K8D A;  2VOU A;  2XLT A;  1Z6L A;  4NZH A;  2VRM A;  4E0V A;  1JEH A;  4GR1 A;  3QJ4 A;  1VG0 A;  2V61 A;  4CBQ A;  1Q9I A;  3NN6 X;  1E6E A;  4H4W A;  2BA9 A;  4EQR A;  4YXD A;  2RGO A;  5BUK A;  3AEC A;  1RYI A;  1KF6 A;  5M10 A;  2R0P A;  5C3J A;  3II4 A;  4PAB A;  4Y4L A;  1GRA A;  1GXF A;  2Z5Y A;  1QO8 A;  4OCG A;  1KFY A;  2YVG A;  5KRQ A;  2YLS A;  4N9X A;  1F3P A;  2CDU A;  2YLX A;  4K22 A;  1DOD A;  2B9Y A;  4AP1 A;  1S3B A;  4P9S A;  1L9D A;  3NHO X;  3P1W A;  1JOA A;  4UDR A;  2WHD A;  4BK2 A;  1VRQ B;  4GDE A;  4M52 A;  4H4V A;  4CRT A;  3K30 A;  1IUW A;  3AE9 A;  3RHA A;  4AT2 A;  2GMJ A;  3FIM B;  1F8W A;  4TM3 A;  5TR3 A;  3QSE A;  4YKF A;  3R9U A;  2C70 A;  2VQ7 A;  2X50 A;  4B69 A;  4XWZ A;  1CC6 A;  4X9M A;  5CKU A;  4BK1 A;  2XFQ A;  5HY5 A;  2GAH B;  3H8I A;  4U2S A;  1H83 A;  3NK2 X;  3QFB A;  2ZBW A;  5IQ4 A;  1M64 A;  1TYT A;  2EQ6 A;  1LQT A;  1EL5 A;  3ICT A;  3CNP A;  2JB3 A;  1ZMD A;  2VRL A;  2OAM A;  3AD7 B;  3UCL A;  3P4R A;  4XXG A;  1V59 A;  2BS4 A;  2IVE A;  4H2Q A;  2C73 A;  1PXB A;  1MOK A;  3LZW A;  4LU6 A;  4U8O A;  4LII A;  4IV9 A;  4K7Z A;  3AEF A;  2F5Z A;  3KA7 A;  3H8L A;  2VVM A;  4IA5 A;  4A65 A;  2E5V A;  4AOS A;  1Y56 A;  1EL9 A;  1EL8 A;  2XFU A;  3EPT A;  1BKW A;  1H7W A;  2XFP A;  4JQ9 A;  2C75 A;  3BHF A;  1NG3 A;  2GRT A;  3CPI G;  2A87 A;  2NVK X;  4H7U A;  2YLZ A;  2CUL A;  4Z2T A;  4HA6 A;  5KWF A;  2XVF A;  1OJT A;  1Y56 B;  2XVH A;  4JDR A;  1TDN A;  4TM1 A;  4YTM A;  2ZZB A;  3S5W A;  5FMH A;  2YG3 A;  1PN0 A;  2BC1 A;  3GD4 A;  2A8X A;  1D4E A;  1JRY A;  5KVI A;  3V76 A;  4Z44 A;  2EQ9 A;  3NK1 X;  4CCR A;  3NYE A;  4A7A A;  4HB9 A;  1E7P A;  1B5Q A;  4RSL A;  4ZCC A;  3SFD A;  2XCG A;  3CPH G;  3DGZ A;  1BZL A;  2DKH A;  2WP6 A;  2JB2 A;  4ICY A;  1CC2 A;  4EQW A;  2YQU A;  3CNJ A;  3M12 A;  1GRT A;  1PHH A;  5HHF A;  3H4K A;  3UKK A;  4BJZ A;  1PBB A;  4Z2U A;  3ATR A;  3S61 A;  1X31 B;  3DME A;  1F6M A;  1PBF A;  2V5Z A;  2WDR A;  4TM0 A;  1N4W A;  3CPJ G;  4EMJ A;  1H6V A;  3AE8 A;  3IF9 A;  3GSI A;  4H2P A;  2XVJ A;  3UOZ A;  3NKS A;  4FK1 C;  3CGD A;  4EQS A;  5KXJ A;  3QSS A;  2FJA A;  3ABV A;  2ACZ A;  4K2X A;  1OJD A;  4U8P A;  4ZCD A;  4FK1 A;  3UOX A;  5JCM A;  5ER0 A;  1Y0P A;  2PYX A;  1ZK7 A;  4OVI A;  2I0Z A;  3F8D A;  4B66 A;  2XVE A;  2IID A;  2YAU A;  3NLC A; 
#chains in the Genus database with same CATH topology
 5KMR A;  3BHK A;  3UKA A;  5EOW A;  2ARD A;  2YVJ A;  4H4Y A;  3C4A A;  4H4Q A;  4OPG A;  4O5U A;  2R45 A;  4YTP A;  5J60 A;  4YSH A;  1F8S A;  3CGE A;  1NG4 A;  1S2Q A;  3DJG X;  4RG3 A;  5IPY A;  1PBD A;  1QLB A;  1ZY8 A;  3CIR A;  3DK4 A;  2WPC A;  5CQF A;  2CVJ A;  3AD8 B;  2E1M A;  2WDV A;  3Q9T A;  3RP7 A;  3T2Z A;  2E4G A;  3ICS A;  3T0K A;  4H4S A;  3CTY A;  1CJ3 A;  1M6I A;  3UKF A;  3WE0 A;  2BK5 A;  2QAE A;  1FL2 A;  2H89 A;  4A99 A;  2V3B A;  2C7G A;  4C5O A;  3FG2 P;  1B37 A;  3NGC X;  3RNM A;  1GPE A;  3UKH A;  4H4U A;  4Z43 A;  1GT8 A;  1PXA A;  1P2E A;  4Z24 A;  2DKI A;  2YR4 A;  3ALM A;  1NEK A;  1PS9 A;  2X3N A;  4H2N A;  4J34 A;  4TLX A;  2XFO A;  5GSN A;  2GH5 A;  4B65 A;  4H4T A;  4PAA A;  4EIQ A;  2BCP A;  2XLP A;  2R4E A;  1K0L A;  4H4R A;  2B7S A;  3KD9 A;  2GVC A;  3BNU A;  3SZF A;  1AOG A;  4JNQ A;  2JB1 A;  1LJ1 A;  1EBD A;  5KOW A;  2YLR A;  1B4V A;  5KOX A;  1OJ9 A;  1MO9 A;  2BS3 A;  3AE1 A;  4A5L A;  1CJ4 A;  1FEA A;  1LVL A;  1PJ5 A;  3DK8 A;  3DJJ A;  3NN0 X;  4U2L A;  4YWO A;  1GOS A;  4J31 A;  3SYI A;  2WU2 A;  4U2T A;  3EAO A;  3AE6 A;  2V6O A;  3GYI A;  4H2R A;  1D7Y A;  3FMW A;  1GEU A;  4ECH A;  2W0H A;  2WOW A;  2YR5 A;  3ZDN A;  2YWL A;  3BI5 A;  1BGJ A;  3I6D A;  1DJN A;  4CY8 A;  3RP6 A;  5FS7 A;  3UTH A;  1NHS A;  4YT0 A;  3AEB A;  3AYL A;  3NNE A;  4K5S A;  3UKQ A;  3VRB A;  1H7X A;  3NTD A;  1FEB A;  1GAL A;  3ALJ A;  3NT6 A;  3HZL A;  2AAQ A;  4OPI A;  3LXD A;  3ALL A;  2WET A;  4GAP A;  2BAC A;  3BNM A;  3AE7 A;  2VZ2 A;  1DOE A;  4J2W A;  1ZX9 A;  1N4V A;  2R0C A;  3FBS A;  2UZZ A;  2GR3 A;  3QSM A;  4II2 A;  3F8P A;  3ZYX A;  4YKG A;  4J36 A;  3C4N A;  4AP3 A;  2Q0L A;  2R4J A;  4H4Z A;  3AYJ A;  1NHR A;  1ZP0 A;  2WOI A;  3NG7 X;  4B67 A;  3COX A;  3AWI A;  4BV6 A;  1XAN A;  1BF3 A;  1O5W A;  2GR1 A;  1TDE A;  2BRA A;  2JBV A;  4G74 A;  3SGL A;  4CY6 A;  4FX9 A;  2BYB A;  2HQM A;  3HYX A;  5GRT A;  4OPT A;  5BUL A;  1S3E A;  2WPE A;  2OA1 A;  2AQJ A;  3K7T A;  3LOV A;  4UDQ A;  5EBK A;  5BRT A;  1JNR A;  1PBC A;  4GF7 A;  1CBO A;  3VR8 A;  1YKJ A;  2JKC A;  3GYX A;  2FJD A;  3NTA A;  3GWF A;  3K7M X;  4GUV A;  1GRG A;  1N4U A;  3O0H A;  2BK3 A;  4Z2R A;  1E1N A;  3BI4 A;  1PJ7 A;  2AR8 A;  5KVH A;  5J7X A;  1PBE A;  4CNJ A;  2BCG G;  2R0G A;  1VDC A;  1EL7 A;  2WP9 A;  2YG7 A;  3NRN A;  3GDN A;  1UKV G;  4OPD A;  1OJC A;  2WEU A;  2Q7V A;  2XLS A;  3UKP A;  3PO7 A;  3NH3 X;  3SZW A;  1GRE A;  1D5T A;  3RED A;  2B9W A;  4JY2 A;  1CJC A;  2WBA A;  3LZX A;  4EQX A;  1N1P A;  2ZZC A;  3DK9 A;  1H82 A;  4WX1 A;  3P4P A;  3VRA A;  4BJY A;  2R46 A;  3K7Q X;  1ZOV A;  4EMW A;  4G6G A;  2QA2 A;  2OAL A;  3GMB A;  3UOV A;  1Q1R A;  1TDF A;  2GAG B;  1VG9 A;  2Q0K A;  1L0V A;  4A6N A;  1TRB A;  2JK6 A;  3LJP A;  4ADW A;  1ZMC A;  4JN9 A;  2R9Z A;  3ISH A;  1GRH A;  1JU2 A;  1JRZ A;  1XPQ A;  2GQW A;  3AEG A;  4UP3 A;  1GND A;  1RP0 A;  2RGH A;  2WP5 A;  1NAA A;  4I58 A;  1CJ2 A;  4GCM A;  3VR9 A;  1QJD A;  1CHU A;  1GTE A;  1KSS A;  2YVF A;  4USQ A;  4G9K A;  5BVA A;  1ELI A;  4C74 A;  4J57 A;  5JCI A;  4IVO B;  3AEE A;  3AED A;  4J33 A;  5U25 A;  1O94 A;  2YLW A;  2YM1 A;  5HYM A;  4U8N A;  1PJ6 A;  3P4Q A;  2V3A A;  2EQ8 A;  2WOV A;  2WS3 A;  3PS9 A;  2XDO A;  5FS6 A;  4II3 A;  3LB8 A;  1W4X A;  4EM4 A;  1TYP A;  4Z26 A;  3AEA A;  3QVR A;  1E1K A;  1H84 A;  3GDP A;  1YQ3 A;  2BK4 A;  4O5Q A;  4WCT A;  2APG A;  3LAD A;  3M13 A;  1IJH A;  2Q6U A;  1DOB A;  4NTC A;  2BAB A;  4A79 A;  2OLN A;  4UDP A;  5KMP A;  3CNS A;  3KU9 A;  1FOH A;  3AE2 A;  4NEW A;  4X4J A;  3NK0 X;  4JNA A;  4IVM B;  4BUR A;  4BK3 A;  4Y4N A;  3IHM A;  1TDO A;  1IUT A;  3Q6J A;  4J56 A;  1IUU A;  1K0J A;  1PXC A;  2YG4 A;  1ZOY A;  3EF6 A;  1YQ4 A;  3B6D A;  1CC4 A;  3F8R A;  2VVL A;  3IWA A;  4B64 A;  4D04 A;  1Q1W A;  2X8H A;  1SEZ A;  1BGN A;  3DA1 A;  5C2T A;  3IHG A;  1BWC A;  2YLT A;  4X9N A;  4K5R A;  4OPC A;  3V3O A;  2GR0 A;  2WES A;  1DOC A;  3CGB A;  3P4S A;  1KDG A;  1VQW A;  2C3C A;  5L46 A;  3GD3 A;  5U63 A;  3SY4 A;  3GMC A;  1ONF A;  1GER A;  1LQU A;  3BI2 A;  4OPL A;  3VRD B;  4B68 A;  4C3X A;  3DJE A;  2V60 A;  1REO A;  4NWZ A;  3SM8 A;  2WPF A;  1IUV A;  2C65 A;  4YSX A;  1DNC A;  1E1M A;  1LPF A;  1L9E A;  1FCD A;  1GRF A;  2C64 A;  3C96 A;  5JCL A;  3EAN A;  1E1L A;  4CCQ A;  1D4D A;  3JSK A;  4DNA A;  2WU5 A;  1LV0 A;  3SZ0 A;  2B76 A;  3D8X A;  5KNL A;  4ZN0 A;  3RP8 A;  2GF3 A;  4EMI A;  2BS2 A;  4YSZ A;  3G5S A;  3L8K A;  3B3R A;  5FS8 A;  4KPR A;  1YQZ A;  1KNP A;  3URH A;  1HYU A;  4U8I A;  4TLZ A;  2QCU A;  2VVL G;  4YSY A;  4CNK A;  3P9U A;  2Y6Q A;  1LTX R;  1K4Q A;  3G5Q A;  3UP4 A;  4B1B A;  1COY A;  5JCN A;  4XWR A;  2O9Z A;  2Y6R A;  2Z5X A;  5KMQ A;  2X99 A;  4AT0 A;  4DGK A;  2C66 A;  3G5R A;  3ITJ A;  1NHQ A;  2XLR A;  3KKJ A;  5M0Z A;  4USR A;  2GV8 A;  1NHP A;  1IUX A;  1D7L A;  3AXB A;  4U8K A;  4AOX A;  3GRT A;  1RSG A;  1TDK A;  3NYF A;  4EM3 A;  4C3Y A;  1CF3 A;  2CFY A;  4YTN A;  4KX6 A;  3GWD A;  4D03 A;  1D4C A;  5EB4 A;  1B8S A;  4MJW A;  4RG4 A;  3SQP A;  3DH9 A;  3UKL A;  2H88 A;  5JCK A;  1IUS A;  4APN A;  1PDH A;  4JY3 A;  5HXI A;  2GQF A;  3QVP A;  1DJQ A;  1H86 A;  2ZZ0 A;  4NEV A;  1F8R A;  3KVE A;  4C77 A;  5IQ1 A;  4GRT A;  2C76 A;  4IA6 A;  2A89 A;  4U8J A;  2IVD A;  3UTE A;  3V3N A;  3AD9 B;  3OC4 A;  5EB5 A;  2YM2 A;  3HYV A;  3D1C A;  3AE5 A;  4GDP A;  1P2H A;  4REK A;  3T14 A;  2TMD A;  1YY5 A;  2QA1 A;  3PVC A;  3T37 A;  3AE4 A;  3GRS A;  1L9C A;  4TM4 A;  2OLO A;  3M0O A;  1H81 A;  2C4C A;  1KSU A;  2PHH A;  4B63 A;  2B9X A;  2GB0 A;  2FJB A;  2YG6 A;  1GRB A;  1OJA A;  1CL0 A;  2BC0 A;  2C3D A;  3CNT A;  4H4X A;  5FS9 A;  4H50 A;  4Z25 A;  2BRY A;  3VQR A;  1FEC A;  2EQ7 A;  4NTD A;  1JNZ A;  2RAB A;  3GYJ A;  3UOY A;  3CN8 A;  1GET A;  2GMH A;  3E1T A;  3DJD A;  3L1R A;  4NTE A;  3SFE A;  1NDA A;  3SX6 A;  3I3L A;  1S2Y A;  4G6H A;  2YR6 A;  4FDC B;  1NPX A;  1DXL A;  3NIX A;  2NPX A;  2GEW A;  1XHC A;  1ZDL A;  2XYO A;  1GTH A;  2XLU A;  2FJE A;  4A6N B;  1ZKQ A;  4DSH A;  2X8C A;  2BXR A;  2BXS A;  3UP5 A;  2C67 A;  1XDI A;  4Y4M A;  3CGC A;  4LA1 A;  3ATQ A;  4I59 A;  5LV9 A;  2TPR A;  2JAE A;  1GES A;  1GSN A;  2WDQ A;  1K0I A;  3OZ2 A;  2XVI A;  3NYC A;  3CMM A;  2J3N A;  2RGJ A;  3CND A;  3AE3 A;  3FPZ A;  3QFA A;  5KMS A;  1KNR A;  3AB1 A;  3UTG A;  1MXT A;  3ICR A;  3KLJ A;  3KPF A;  2FBW A;  5DBJ A;  2C72 A;  4H4P A;  4EIP A;  4U8L A;  1GV4 A;  2B7R A;  2YG5 A;  3IC9 A;  2X8G A;  4OPU A;  2VQB A;  1JRX A;  3ADA B;  1NEN A;  4DSG A;  2GR2 A;  2XFN A;  1E39 A;  1O95 A;  2WQY A;  3DGH A;  4U8M A;  3AYI A;  4GAV A;  5U1O A;  4A9W A;  3UTF A;  4K8D A;  2VOU A;  2XLT A;  1Z6L A;  4NZH A;  2VRM A;  4NNJ A;  4E0V A;  1JEH A;  4GR1 A;  3QJ4 A;  1VG0 A;  2V61 A;  3SZC A;  4CBQ A;  1Q9I A;  3NN6 X;  1E6E A;  4H4W A;  2BA9 A;  3T2Y A;  4EQR A;  4YXD A;  2RGO A;  5BUK A;  3AEC A;  1RYI A;  1KF6 A;  5M10 A;  2R0P A;  5C3J A;  3II4 A;  4PAB A;  4Y4L A;  1GRA A;  1GXF A;  2Z5Y A;  1QO8 A;  4OCG A;  1KFY A;  2YVG A;  5KRQ A;  2YLS A;  4N9X A;  1F3P A;  2CDU A;  2YLX A;  4K22 A;  1DOD A;  2B9Y A;  4AP1 A;  1S3B A;  4P9S A;  1L9D A;  3NHO X;  3P1W A;  1JOA A;  4UDR A;  2WHD A;  4BK2 A;  1VRQ B;  4GDE A;  4M52 A;  4H4V A;  4CRT A;  3K30 A;  1IUW A;  3AE9 A;  3RHA A;  3T31 A;  4AT2 A;  2GMJ A;  3FIM B;  1F8W A;  4TM3 A;  5TR3 A;  3QSE A;  4YKF A;  3R9U A;  2C70 A;  2VQ7 A;  2X50 A;  4B69 A;  4XWZ A;  1CC6 A;  4X9M A;  5CKU A;  4BK1 A;  2XFQ A;  3T2K A;  2GAH B;  3H8I A;  5HY5 A;  4U2S A;  1H83 A;  3NK2 X;  3QFB A;  2ZBW A;  5IQ4 A;  1M64 A;  1TYT A;  2EQ6 A;  1LQT A;  1EL5 A;  3ICT A;  3CNP A;  2JB3 A;  1ZMD A;  2VRL A;  2OAM A;  3AD7 B;  3UCL A;  3P4R A;  4XXG A;  1V59 A;  2BS4 A;  2IVE A;  4H2Q A;  2C73 A;  1PXB A;  1MOK A;  3LZW A;  4LU6 A;  4U8O A;  4LII A;  4IV9 A;  4K7Z A;  3AEF A;  2F5Z A;  3KA7 A;  3H8L A;  2VVM A;  4IA5 A;  4A65 A;  2E5V A;  4AOS A;  1Y56 A;  1EL9 A;  1EL8 A;  2XFU A;  3EPT A;  1BKW A;  1H7W A;  2XFP A;  4JQ9 A;  2C75 A;  3BHF A;  1NG3 A;  2GRT A;  3CPI G;  2A87 A;  2NVK X;  4H7U A;  2YLZ A;  2CUL A;  4Z2T A;  4HA6 A;  5KWF A;  2XVF A;  1OJT A;  1Y56 B;  2XVH A;  4JDR A;  1TDN A;  4TM1 A;  4YTM A;  2ZZB A;  3S5W A;  5FMH A;  2YG3 A;  1PN0 A;  2BC1 A;  3GD4 A;  2A8X A;  1D4E A;  1JRY A;  5KVI A;  3V76 A;  4Z44 A;  2EQ9 A;  3NK1 X;  4CCR A;  3NYE A;  4A7A A;  4HB9 A;  1E7P A;  1B5Q A;  4RSL A;  4ZCC A;  3SFD A;  2XCG A;  3CPH G;  3DGZ A;  1BZL A;  2DKH A;  2WP6 A;  2JB2 A;  4ICY A;  1CC2 A;  4EQW A;  2YQU A;  3CNJ A;  3M12 A;  1GRT A;  1PHH A;  5HHF A;  3H4K A;  3SXI A;  3UKK A;  1PBB A;  4BJZ A;  3ATR A;  3S61 A;  4Z2U A;  3KPK A;  1X31 B;  3DME A;  1F6M A;  1PBF A;  2V5Z A;  2WDR A;  4TM0 A;  1N4W A;  3CPJ G;  4EMJ A;  1H6V A;  3AE8 A;  3HYW A;  3IF9 A;  3GSI A;  4H2P A;  2XVJ A;  3UOZ A;  3NKS A;  4FK1 C;  3CGD A;  4EQS A;  5KXJ A;  3QSS A;  2FJA A;  3ABV A;  2ACZ A;  4K2X A;  1OJD A;  4U8P A;  4ZCD A;  4FK1 A;  3UOX A;  5JCM A;  5ER0 A;  1Y0P A;  2PYX A;  1ZK7 A;  4OVI A;  2I0Z A;  3F8D A;  4B66 A;  4G73 A;  2XVE A;  2IID A;  2YAU A;  3NLC A; 
#chains in the Genus database with same CATH homology
 5KMR A;  3BHK A;  3UKA A;  5EOW A;  2ARD A;  2YVJ A;  4H4Y A;  3C4A A;  4H4Q A;  4OPG A;  4O5U A;  2R45 A;  4YTP A;  5J60 A;  4YSH A;  1F8S A;  3CGE A;  1NG4 A;  1S2Q A;  3DJG X;  4RG3 A;  5IPY A;  1PBD A;  1QLB A;  1ZY8 A;  3CIR A;  3DK4 A;  2WPC A;  5CQF A;  2CVJ A;  3AD8 B;  2E1M A;  2WDV A;  3Q9T A;  3RP7 A;  3T2Z A;  2E4G A;  3ICS A;  3T0K A;  4H4S A;  3CTY A;  1CJ3 A;  1M6I A;  3UKF A;  3WE0 A;  2BK5 A;  2QAE A;  1FL2 A;  2H89 A;  4A99 A;  2V3B A;  2C7G A;  4C5O A;  3FG2 P;  1B37 A;  3NGC X;  3RNM A;  1GPE A;  3UKH A;  4H4U A;  4Z43 A;  1GT8 A;  1PXA A;  1P2E A;  4Z24 A;  2DKI A;  2YR4 A;  3ALM A;  1NEK A;  1PS9 A;  2X3N A;  4H2N A;  4J34 A;  4TLX A;  2XFO A;  5GSN A;  2GH5 A;  4B65 A;  4H4T A;  4PAA A;  4EIQ A;  2BCP A;  2XLP A;  2R4E A;  1K0L A;  4H4R A;  2B7S A;  3KD9 A;  2GVC A;  3BNU A;  3SZF A;  1AOG A;  4JNQ A;  2JB1 A;  1LJ1 A;  1EBD A;  5KOW A;  2YLR A;  1B4V A;  5KOX A;  1OJ9 A;  1MO9 A;  2BS3 A;  3AE1 A;  4A5L A;  1CJ4 A;  1FEA A;  1LVL A;  1PJ5 A;  3DK8 A;  3DJJ A;  3NN0 X;  4U2L A;  4YWO A;  1GOS A;  4J31 A;  3SYI A;  2WU2 A;  4U2T A;  3EAO A;  3AE6 A;  2V6O A;  3GYI A;  4H2R A;  1D7Y A;  3FMW A;  1GEU A;  4ECH A;  2W0H A;  2WOW A;  2YR5 A;  3ZDN A;  2YWL A;  3BI5 A;  1BGJ A;  3I6D A;  1DJN A;  4CY8 A;  3RP6 A;  5FS7 A;  3UTH A;  1NHS A;  4YT0 A;  3AEB A;  3AYL A;  3NNE A;  4K5S A;  3UKQ A;  3VRB A;  1H7X A;  3NTD A;  1FEB A;  1GAL A;  3ALJ A;  3NT6 A;  3HZL A;  2AAQ A;  4OPI A;  3LXD A;  3ALL A;  2WET A;  4GAP A;  2BAC A;  3BNM A;  3AE7 A;  2VZ2 A;  1DOE A;  4J2W A;  1ZX9 A;  1N4V A;  2R0C A;  3FBS A;  2UZZ A;  2GR3 A;  3QSM A;  4II2 A;  3F8P A;  3ZYX A;  4YKG A;  4J36 A;  3C4N A;  4AP3 A;  2Q0L A;  2R4J A;  4H4Z A;  3AYJ A;  1NHR A;  1ZP0 A;  2WOI A;  3NG7 X;  4B67 A;  3COX A;  3AWI A;  4BV6 A;  1XAN A;  1BF3 A;  1O5W A;  2GR1 A;  1TDE A;  2BRA A;  2JBV A;  4G74 A;  3SGL A;  4CY6 A;  4FX9 A;  2BYB A;  2HQM A;  3HYX A;  5GRT A;  4OPT A;  5BUL A;  1S3E A;  2WPE A;  2OA1 A;  2AQJ A;  3K7T A;  3LOV A;  4UDQ A;  5EBK A;  5BRT A;  1JNR A;  1PBC A;  4GF7 A;  1CBO A;  3VR8 A;  1YKJ A;  2JKC A;  3GYX A;  2FJD A;  3NTA A;  3GWF A;  3K7M X;  4GUV A;  1GRG A;  1N4U A;  3O0H A;  2BK3 A;  4Z2R A;  1E1N A;  3BI4 A;  1PJ7 A;  2AR8 A;  5KVH A;  5J7X A;  1PBE A;  4CNJ A;  2BCG G;  2R0G A;  1VDC A;  1EL7 A;  2WP9 A;  2YG7 A;  3NRN A;  3GDN A;  1UKV G;  4OPD A;  1OJC A;  2WEU A;  2Q7V A;  2XLS A;  3UKP A;  3PO7 A;  3NH3 X;  3SZW A;  1GRE A;  1D5T A;  3RED A;  2B9W A;  4JY2 A;  1CJC A;  2WBA A;  3LZX A;  4EQX A;  1N1P A;  2ZZC A;  3DK9 A;  1H82 A;  4WX1 A;  3P4P A;  3VRA A;  4BJY A;  2R46 A;  3K7Q X;  1ZOV A;  4EMW A;  4G6G A;  2QA2 A;  2OAL A;  3GMB A;  3UOV A;  1Q1R A;  1TDF A;  2GAG B;  1VG9 A;  2Q0K A;  1L0V A;  4A6N A;  1TRB A;  2JK6 A;  3LJP A;  4ADW A;  1ZMC A;  4JN9 A;  2R9Z A;  3ISH A;  1GRH A;  1JU2 A;  1JRZ A;  1XPQ A;  2GQW A;  3AEG A;  4UP3 A;  1GND A;  1RP0 A;  2RGH A;  2WP5 A;  1NAA A;  4I58 A;  1CJ2 A;  4GCM A;  3VR9 A;  1QJD A;  1CHU A;  1GTE A;  1KSS A;  2YVF A;  4USQ A;  4G9K A;  5BVA A;  1ELI A;  4C74 A;  4J57 A;  5JCI A;  4IVO B;  3AEE A;  3AED A;  4J33 A;  5U25 A;  1O94 A;  2YLW A;  2YM1 A;  5HYM A;  4U8N A;  1PJ6 A;  3P4Q A;  2V3A A;  2EQ8 A;  2WOV A;  2WS3 A;  3PS9 A;  2XDO A;  5FS6 A;  4II3 A;  3LB8 A;  1W4X A;  4EM4 A;  1TYP A;  4Z26 A;  3AEA A;  3QVR A;  1E1K A;  1H84 A;  3GDP A;  1YQ3 A;  2BK4 A;  4O5Q A;  4WCT A;  2APG A;  3LAD A;  3M13 A;  1IJH A;  2Q6U A;  1DOB A;  4NTC A;  2BAB A;  4A79 A;  2OLN A;  4UDP A;  5KMP A;  3CNS A;  3KU9 A;  1FOH A;  3AE2 A;  4NEW A;  4X4J A;  3NK0 X;  4JNA A;  4IVM B;  4BUR A;  4BK3 A;  4Y4N A;  3IHM A;  1TDO A;  1IUT A;  3Q6J A;  4J56 A;  1IUU A;  1K0J A;  1PXC A;  2YG4 A;  1ZOY A;  3EF6 A;  1YQ4 A;  3B6D A;  1CC4 A;  3F8R A;  2VVL A;  3IWA A;  4B64 A;  4D04 A;  1Q1W A;  2X8H A;  1SEZ A;  1BGN A;  3DA1 A;  5C2T A;  3IHG A;  1BWC A;  2YLT A;  4X9N A;  4K5R A;  4OPC A;  3V3O A;  2GR0 A;  2WES A;  1DOC A;  3CGB A;  3P4S A;  1KDG A;  1VQW A;  2C3C A;  5L46 A;  3GD3 A;  5U63 A;  3SY4 A;  3GMC A;  1ONF A;  1GER A;  1LQU A;  3BI2 A;  4OPL A;  3VRD B;  4B68 A;  4C3X A;  3DJE A;  2V60 A;  1REO A;  4NWZ A;  3SM8 A;  2WPF A;  1IUV A;  2C65 A;  4YSX A;  1DNC A;  1E1M A;  1LPF A;  1L9E A;  1FCD A;  1GRF A;  2C64 A;  3C96 A;  5JCL A;  3EAN A;  1E1L A;  4CCQ A;  1D4D A;  3JSK A;  4DNA A;  2WU5 A;  1LV0 A;  3SZ0 A;  2B76 A;  3D8X A;  5KNL A;  4ZN0 A;  3RP8 A;  2GF3 A;  4EMI A;  2BS2 A;  4YSZ A;  3G5S A;  3L8K A;  3B3R A;  5FS8 A;  4KPR A;  1YQZ A;  1KNP A;  3URH A;  1HYU A;  4U8I A;  4TLZ A;  2QCU A;  2VVL G;  4YSY A;  4CNK A;  3P9U A;  2Y6Q A;  1LTX R;  1K4Q A;  3G5Q A;  3UP4 A;  4B1B A;  1COY A;  5JCN A;  4XWR A;  2O9Z A;  2Y6R A;  2Z5X A;  5KMQ A;  2X99 A;  4AT0 A;  4DGK A;  2C66 A;  3G5R A;  3ITJ A;  1NHQ A;  2XLR A;  3KKJ A;  5M0Z A;  4USR A;  2GV8 A;  1NHP A;  1IUX A;  1D7L A;  3AXB A;  4U8K A;  4AOX A;  3GRT A;  1RSG A;  1TDK A;  3NYF A;  4EM3 A;  4C3Y A;  1CF3 A;  2CFY A;  4YTN A;  4KX6 A;  3GWD A;  4D03 A;  1D4C A;  5EB4 A;  1B8S A;  4MJW A;  4RG4 A;  3SQP A;  3DH9 A;  3UKL A;  2H88 A;  5JCK A;  1IUS A;  4APN A;  1PDH A;  4JY3 A;  5HXI A;  2GQF A;  3QVP A;  1DJQ A;  1H86 A;  2ZZ0 A;  4NEV A;  1F8R A;  3KVE A;  4C77 A;  5IQ1 A;  4GRT A;  2C76 A;  4IA6 A;  2A89 A;  4U8J A;  2IVD A;  3UTE A;  3V3N A;  3AD9 B;  3OC4 A;  5EB5 A;  2YM2 A;  3HYV A;  3D1C A;  3AE5 A;  4GDP A;  1P2H A;  4REK A;  3T14 A;  2TMD A;  1YY5 A;  2QA1 A;  3PVC A;  3T37 A;  3AE4 A;  3GRS A;  1L9C A;  4TM4 A;  2OLO A;  3M0O A;  1H81 A;  2C4C A;  1KSU A;  2PHH A;  4B63 A;  2B9X A;  2GB0 A;  2FJB A;  2YG6 A;  1GRB A;  1OJA A;  1CL0 A;  2BC0 A;  2C3D A;  3CNT A;  4H4X A;  5FS9 A;  4H50 A;  4Z25 A;  2BRY A;  3VQR A;  1FEC A;  2EQ7 A;  4NTD A;  1JNZ A;  2RAB A;  3GYJ A;  3UOY A;  3CN8 A;  1GET A;  2GMH A;  3E1T A;  3DJD A;  3L1R A;  4NTE A;  3SFE A;  1NDA A;  3SX6 A;  3I3L A;  1S2Y A;  4G6H A;  2YR6 A;  4FDC B;  1NPX A;  1DXL A;  3NIX A;  2NPX A;  2GEW A;  1XHC A;  1ZDL A;  2XYO A;  1GTH A;  2XLU A;  2FJE A;  4A6N B;  1ZKQ A;  4DSH A;  2X8C A;  2BXR A;  2BXS A;  3UP5 A;  2C67 A;  1XDI A;  4Y4M A;  3CGC A;  4LA1 A;  3ATQ A;  4I59 A;  5LV9 A;  2TPR A;  2JAE A;  1GES A;  1GSN A;  2WDQ A;  1K0I A;  3OZ2 A;  2XVI A;  3NYC A;  3CMM A;  2J3N A;  2RGJ A;  3CND A;  3AE3 A;  3FPZ A;  3QFA A;  5KMS A;  1KNR A;  3AB1 A;  3UTG A;  1MXT A;  3ICR A;  3KLJ A;  3KPF A;  2FBW A;  5DBJ A;  2C72 A;  4H4P A;  4EIP A;  4U8L A;  1GV4 A;  2B7R A;  2YG5 A;  3IC9 A;  2X8G A;  4OPU A;  2VQB A;  1JRX A;  3ADA B;  1NEN A;  4DSG A;  2GR2 A;  2XFN A;  1E39 A;  1O95 A;  2WQY A;  3DGH A;  4U8M A;  3AYI A;  4GAV A;  5U1O A;  4A9W A;  3UTF A;  4K8D A;  2VOU A;  2XLT A;  1Z6L A;  4NZH A;  2VRM A;  4NNJ A;  4E0V A;  1JEH A;  4GR1 A;  3QJ4 A;  1VG0 A;  2V61 A;  3SZC A;  4CBQ A;  1Q9I A;  3NN6 X;  1E6E A;  4H4W A;  2BA9 A;  3T2Y A;  4EQR A;  4YXD A;  2RGO A;  5BUK A;  3AEC A;  1RYI A;  1KF6 A;  5M10 A;  2R0P A;  5C3J A;  3II4 A;  4PAB A;  4Y4L A;  1GRA A;  1GXF A;  2Z5Y A;  1QO8 A;  4OCG A;  1KFY A;  2YVG A;  5KRQ A;  2YLS A;  4N9X A;  1F3P A;  2CDU A;  2YLX A;  4K22 A;  1DOD A;  2B9Y A;  4AP1 A;  1S3B A;  4P9S A;  1L9D A;  3NHO X;  3P1W A;  1JOA A;  4UDR A;  2WHD A;  4BK2 A;  1VRQ B;  4GDE A;  4M52 A;  4H4V A;  4CRT A;  3K30 A;  1IUW A;  3AE9 A;  3RHA A;  3T31 A;  4AT2 A;  2GMJ A;  3FIM B;  1F8W A;  4TM3 A;  5TR3 A;  3QSE A;  4YKF A;  3R9U A;  2C70 A;  2VQ7 A;  2X50 A;  4B69 A;  4XWZ A;  1CC6 A;  4X9M A;  5CKU A;  4BK1 A;  2XFQ A;  3T2K A;  2GAH B;  3H8I A;  5HY5 A;  4U2S A;  1H83 A;  3NK2 X;  3QFB A;  2ZBW A;  5IQ4 A;  1M64 A;  1TYT A;  2EQ6 A;  1LQT A;  1EL5 A;  3ICT A;  3CNP A;  2JB3 A;  1ZMD A;  2VRL A;  2OAM A;  3AD7 B;  3UCL A;  3P4R A;  4XXG A;  1V59 A;  2BS4 A;  2IVE A;  4H2Q A;  2C73 A;  1PXB A;  1MOK A;  3LZW A;  4LU6 A;  4U8O A;  4LII A;  4IV9 A;  4K7Z A;  3AEF A;  2F5Z A;  3KA7 A;  3H8L A;  2VVM A;  4IA5 A;  4A65 A;  2E5V A;  4AOS A;  1Y56 A;  1EL9 A;  1EL8 A;  2XFU A;  3EPT A;  1BKW A;  1H7W A;  2XFP A;  4JQ9 A;  2C75 A;  3BHF A;  1NG3 A;  2GRT A;  3CPI G;  2A87 A;  2NVK X;  4H7U A;  2YLZ A;  2CUL A;  4Z2T A;  4HA6 A;  5KWF A;  2XVF A;  1OJT A;  1Y56 B;  2XVH A;  4JDR A;  1TDN A;  4TM1 A;  4YTM A;  2ZZB A;  3S5W A;  5FMH A;  2YG3 A;  1PN0 A;  2BC1 A;  3GD4 A;  2A8X A;  1D4E A;  1JRY A;  5KVI A;  3V76 A;  4Z44 A;  2EQ9 A;  3NK1 X;  4CCR A;  3NYE A;  4A7A A;  4HB9 A;  1E7P A;  1B5Q A;  4RSL A;  4ZCC A;  3SFD A;  2XCG A;  3CPH G;  3DGZ A;  1BZL A;  2DKH A;  2WP6 A;  2JB2 A;  4ICY A;  1CC2 A;  4EQW A;  2YQU A;  3CNJ A;  3M12 A;  1GRT A;  1PHH A;  5HHF A;  3H4K A;  3SXI A;  3UKK A;  1PBB A;  4BJZ A;  3ATR A;  3S61 A;  4Z2U A;  3KPK A;  1X31 B;  3DME A;  1F6M A;  1PBF A;  2V5Z A;  2WDR A;  4TM0 A;  1N4W A;  3CPJ G;  4EMJ A;  1H6V A;  3AE8 A;  3HYW A;  3IF9 A;  3GSI A;  4H2P A;  2XVJ A;  3UOZ A;  3NKS A;  4FK1 C;  3CGD A;  4EQS A;  5KXJ A;  3QSS A;  2FJA A;  3ABV A;  2ACZ A;  4K2X A;  1OJD A;  4U8P A;  4ZCD A;  4FK1 A;  3UOX A;  5JCM A;  5ER0 A;  1Y0P A;  2PYX A;  1ZK7 A;  4OVI A;  2I0Z A;  3F8D A;  4B66 A;  4G73 A;  2XVE A;  2IID A;  2YAU A;  3NLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...