4CCQA

Crystal structure of the thioredoxin reductase from entamoeba histolytica with nadp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
313
structure length
313
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 95
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccqA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccqA02
1HYUA 1ZP0A 1QLBA 3ZYXA 1BZLA 3KD9A 3NIXA 3AEBA 3UKKA 2A87A 3DK9A 4XXGA 3ICSA 4LIIA 1GERA 2XYOA 2BC1A 2NPXA 3KLJA 4H4VA 2XFUA 3DMEA 4B64A 4C5OA 2XDOA 2YM2A 4JQ9A 1H6VA 2YG5A 3Q6JA 4D03A 3K30A 2YLWA 4H4UA 1B5QA 3UTEA 2PYXA 4J2WA 1CC2A 3F8PA 4A9WA 1FEAA 1NENA 4A79A 3BI2A 3UKPA 2WOIA 2VQ7A 2WQYA 4X9NA 1E1NA 2QA1A 2R0GA 4TLXA 4CBQA 2FJDA 1GETA 4U8JA 2C67A 3SGLA 4H2RA 1TDKA 4USRA 1NG3A 2YVGA 5JCIA 1ZK7A 2EQ6A 4K2XA 3AEAA 5KVHA 3VR9A 3AE2A 3NLCA 3REDA 1X31B 1PHHA 1LQTA 2E5VA 2X8GA 3ISHA 1OJDA 4H4RA 4CY8A 2X8HA 3AE3A 4H4QA 1E39A 4K7ZA 1L0VA 4OPLA 3NN0X 3K7MX 3NH3X 3P4QA 1S3EA 1NHSA 2YVJA 2V60A 3DA1A 1IJHA 5KOXA 2YVFA 3P1WA 1YY5A 4GR1A 4RG4A 2BXRA 3G5QA 3AE7A 1F8WA 4H4ZA 2YLXA 5KOWA 4J31A 1EL8A 3H8IA 4GCMA 1KNPA 3O0HA 4TM1A 4YTPA 1COYA 1K0JA 2OALA 1GXFA 3P4RA 1PBBA 4C74A 2PHHA 4YSXA 1DJNA 5EB5A 5J7XA 1PXBA 4H50A 5JCKA 2B76A 2WPEA 3BNMA 4A6NB 4B66A 5M0ZA 1NDAA 1D4DA 4LA1A 3LJPA 4U8OA 2C76A 4NTCA 2CFYA 3V3OA 4E0VA 1KF6A 1VQWA 1Z6LA 3E1TA 1Y56B 1Y0PA 2Z5XA 1CL0A 1B37A 3SFEA 1K4QA 3DJDA 3NK2X 1Q1RA 1TDNA 3KU9A 4U2LA 3GRSA 4NEVA 4U8IA 3GYJA 4JY2A 4A7AA 4K8DA 3DK8A 3D1CA 2WBAA 2A8XA 1JOAA 3AYJA 1H81A 4J56A 3LZWA 5C2TA 4YTMA 4BK3A 1OJ9A 1ZMDA 2WDQA 4ICYA 1EL5A 1IUSA 1CC4A 4YSYA 4B1BA 3RP8A 4EM3A 3GMBA 1XPQA 3AEDA 3CNDA 5DBJA 2RGJA 4AT2A 3H8LA 4K22A 3SM8A 3AB1A 4J36A 1GV4A 3L8KA 3DJGX 4IA5A 5CKUA 2JB1A 1LTXR 5IPYA 4YSHA 2WHDA 1N4UA 3I6DA 2R4EA 4A99A 1TDFA 3S61A 2XFNA 1VDCA 4EM4A 5LV9A 1JRZA 2XVFA 3DJJA 5HYMA 5JCMA 3UTGA 4NZHA 2OLOA 2XVHA 3P9UA 2HQMA 3F8DA 4GF7A 4U2SA 3EPTA 4AP1A 3CPHG 2XLUA 1RSGA 3ALMA 5U63A 3CNPA 4CCQA 2VRMA 2X50A 5CQFA 2YLZA 2B9YA 4BURA 1W4XA 2E4GA 1MXTA 1E1KA 1D4EA 3AEEA 4A65A 5HY5A 2WPCA 2XVJA 1PXCA 3UCLA 3UP5A 3AE8A 4HA6A 1PBCA 2VQBA 4Y4NA 3UP4A 4Z44A 3II4A 4CNKA 2O9ZA 4UDPA 4Z2RA 3UKFA 1DOBA 3JSKA 2YR5A 4H4WA 3CPJG 4NEWA 2C66A 1B4VA 4H7UA 2QAEA 5GSNA 3NYCA 1FEBA 3D8XA 5BUKA 2BS4A 1GOSA 2AR8A 1MOKA 2GAHB 3UKAA 2BS2A 4XWZA 3NYEA 4TM3A 4Y4MA 2C3DA 1CHUA 2R9ZA 2V6OA 4OPGA 1D4CA 1IUVA 1H7WA 1BWCA 3NTAA 1IUUA 1PJ6A 1N1PA 4K5SA 4Z43A 1CJCA 3GSIA 2IIDA 4YWOA 1PJ7A 1ZX9A 5IQ4A 1MO9A 1PBFA 1GESA 2B7SA 1ONFA 2F5ZA 3B6DA 4EIQA 3IHGA 1CC6A 1NG4A 2UZZA 3ATRA 2GQFA 1DNCA 4YTNA 3CGBA 5KWFA 1L9DA 1D7YA 3ALJA 2Z5YA 3CTYA 4D04A 4KPRA 4Z2UA 2YG6A 4TM0A 3VRBA 4ECHA 2FJAA 4U8LA 2OAMA 1PBDA 3ABVA 3K7QX 4BK1A 4YKFA 1YKJA 1JRYA 2BK5A 2WOVA 4RSLA 2BCGG 3HZLA 1GRHA 3NYFA 4DSGA 1FCDA 4LU6A 3K7TA 4RG3A 4C3YA 1Y56A 3CPIG 1NEKA 3AEFA 3LXDA 3NNEA 2VRLA 2JB2A 2R46A 2WESA 3V76A 1BF3A 4ZN0A 3ADAB 2VVLG 4J57A 1O95A 3SFDA 4C77A 1H7XA 3AE4A 5KRQA 2Q0KA 2TPRA 1CJ2A 1GT8A 2OLNA 4PABA 3AD7B 1GSNA 4B63A 1S3BA 2VVMA 2JB3A 1PS9A 1V59A 2ACZA 2BK4A 3EAOA 1BGNA 1GALA 1H82A 1PXAA 4Z24A 3T37A 1O5WA 1TDOA 2ZBWA 3GRTA 1IUWA 4OPUA 2DKIA 1M6IA 4MJWA 4EIPA 2GR3A 4EQSA 1EL9A 4H2QA 2BA9A 4GRTA 4H4YA 3RP6A 3BHKA 3NG7X 1L9CA 1CJ3A 1KSUA 4OPDA 4B65A 4U8NA 4AOXA 2BCPA 4OPCA 3VR8A 2OA1A 1YQZA 2WU5A 2BYBA 5FMHA 5FS7A 2TMDA 1FOHA 2BK3A 2XLPA 1GTHA 4JY3A 1IUXA 3G5SA 3VRDB 2YR6A 3AE6A 3UOYA 2FBWA 3AE9A 4J34A 5C3JA 1K0LA 4OPTA 4DNAA 4EMJA 2YAUA 3C4NA 4HB9A 1RYIA 2V5ZA 2YG7A 3GD3A 1VG9A 1YQ3A 2VVLA 2GR1A 2JK6A 3AE5A 3GMCA 2R0PA 1CF3A 1XDIA 3DJEA 2Y6RA 3LZXA 3Q9TA 3S5WA 4JNQA 3UOVA 2YLTA 4N9XA 4H2NA 1ZMCA 4M52A 5TR3A 3AD8B 2BC0A 3QJ4A 5HHFA 1E7PA 1NHRA 1PN0A 3ITJA 4BJYA 3CIRA 4FX9A 3DK4A 3GWDA 2R45A 4X4JA 5KVIA 3NRNA 3BNUA 4CNJA 2ZZCA 1LPFA 1LVLA 3NHOX 1CBOA 1UKVG 4K5RA 1DXLA 5HXIA 1GRFA 1N4WA 2C64A 3AEGA 1REOA 3NT6A 1NPXA 4U8KA 2WOWA 3FIMB 1OJCA 5EBKA 3LADA 3NK1X 2IVDA 2QCUA 1P2EA 1NAAA 2CDUA 5BRTA 3GWFA 4H4TA 1ZKQA 2GMJA 1JEHA 2E1MA 5FS9A 2AAQA 1P2HA 1GPEA 1H84A 2XVIA 3P4PA 3OC4A 3QFBA 4FK1A 4OCGA 3R9UA 3AXBA 4CCRA 2C75A 1GRTA 2B9WA 4ADWA 5FS6A 1DOEA 1SEZA 2YLRA 1E1MA 4TM4A 3QSEA 2C72A 4U8MA 4NTDA 1XANA 2ZZBA 2V3BA 3AECA 3CGEA 2H89A 1H83A 2BACA 2GQWA 1LJ1A 3FBSA 2R0CA 3IF9A 5EB4A 1OJTA 5U1OA 4DGKA 3M0OA 2H88A 3ATQA 2YQUA 3DGZA 1VG0A 4AP3A 1D5TA 3C4AA 3B3RA 1AOGA 3M12A 3QSMA 1Q9IA 1DODA 1DOCA 2XCGA 1FL2A 1GREA 2RABA 4YXDA 1RP0A 5BULA 3AYIA 3EANA 1KFYA 1GRAA 3KPFA 2VZ2A 1IUTA 4XWRA 2V3AA 4U8PA 3GDNA 3LB8A 3NTDA 1EL7A 1LV0A 4IVOB 2XVEA 3CN8A 4B67A 5JCNA 1BGJA 1F8RA 3UKQA 4U2TA 2WDVA 4B68A 2XLRA 4O5QA 1GTEA 1PJ5A 3QSSA 3UKHA 2C65A 2EQ7A 1D7LA 4A6NA 3G5RA 1S2YA 4UDRA 2BS3A 4YSZA 3DH9A 1CJ4A 2GMHA 2GV8A 4AT0A 5J60A 2WPFA 3VRAA 2B9XA 1QO8A 3IHMA 3LOVA 4USQA 1PDHA 4ZCDA 1ELIA 3OZ2A 2R4JA 3FPZA 1TYPA 1ZOVA 3IWAA 3CGDA 3QVRA 2B7RA 4O5UA 2J3NA 1JNRA 2WETA 2WEUA 4J33A 5ER0A 4B69A 2C7GA 3PO7A 4H4PA 5FS8A 1GRGA 2JKCA 3GYIA 4OPIA 2WP5A 3ZDNA 3DGHA 1TYTA 2AQJA 1E1LA 3BHFA 1GEUA 2BXSA 4PAAA 3KKJA 2FJBA 4Z25A 5L46A 2GR0A 2EQ8A 1ZY8A 2Q6UA 2V61A 2YG4A 1TDEA 4FDCB 2GB0A 3GDPA 3WE0A 1JRXA 4YT0A 2GF3A 4A5LA 2I0ZA 4Y4LA 2FJEA 4IVMB 3C96A 2Q7VA 2GVCA 3CGCA 5IQ1A 3COXA 3I3LA 4WX1A 2CVJA 3H4KA 3NN6X 3URHA 3UTHA 5BVAA 4JN9A 1NHPA 1OJAA 3FG2P 3ICRA 3FMWA 1KDGA 2GR2A 3UOXA 4FK1C 3ALLA 2VOUA 1H86A 2GEWA 2IVEA 4GDPA 4GUVA 4H2PA 3KVEA 3UOZA 3GD4A 4EMIA 3CNSA 2YLSA 1S2QA 2XLSA 3IC9A 4BJZA 4NTEA 2WS3A 2APGA 4IA6A 2GH5A 4UDQA 2YG3A 4EQXA 3AD9B 5U25A 2W0HA 4APNA 1JU2A 4JDRA 1L9EA 3PVCA 3PS9A 1N4VA 4I58A 3V3NA 1NHQA 2YR4A 4I59A 1K0IA 4KX6A 3VQRA 4GDEA 3UKLA 4BV6A 2BABA 2RGOA 2YM1A 2C70A 2EQ9A 1KNRA 1B8SA 2Q0LA 4Z26A 3NGCX 1VRQB 1PBEA 5M10A 2CULA 2RGHA 1BKWA 3F8RA 3RNMA 1DJQA 2XFPA 4EMWA 5GRTA 4X9MA 3AWIA 4DSHA 2GRTA 5EOWA 4REKA 2X99A 1KSSA 3NK0X 2DKHA 4EQWA 4TLZA 2WP9A 3SQPA 2NVKX 4ZCCA 3BI4A 2XFOA 2X3NA 3QFAA 1YQ4A 1FECA 4P9SA 1Q1WA 2XLTA 1QJDA 3UTFA 4WCTA 4Z2TA 4C3XA 1JNZA 4CRTA 4CY6A 1E6EA 2ZZ0A 5JCLA 2Y6QA 2GAGB 3AYLA 3EF6A 3RP7A 4BK2A 4JNAA 2XFQA 4H4SA 2WDRA 3L1RA 3M13A 1GRBA 4UP3A 3RHAA 3CNJA 2ARDA 2C73A 3ICTA 4AOSA 4YKGA 1XHCA 4H4XA 3P4SA 3AE1A 1ZDLA 2QA2A 1LQUA 1TRBA 5KXJA 1F6MA 4IV9A 2A89A 2X8CA 3NKSA 1ZOYA 3QVPA 1O94A 4OVIA 2JBVA 2WP6A 1GNDA 2WU2A 4EQRA 1F3PA 3CNTA 1M64A 2C3CA 2JAEA 1EBDA 1F8SA 2YWLA 3KA7A 3BI5A
chains in the Genus database with same CATH superfamily
1HYUA 1ZP0A 1QLBA 3ZYXA 1BZLA 3KD9A 3NIXA 3AEBA 3UKKA 2A87A 3DK9A 4XXGA 3ICSA 4LIIA 1GERA 2XYOA 2BC1A 2NPXA 3KLJA 4H4VA 2XFUA 3DMEA 4B64A 4C5OA 2XDOA 2YM2A 4JQ9A 1H6VA 2YG5A 3Q6JA 3SX6A 4D03A 3K30A 2YLWA 4H4UA 1B5QA 3UTEA 2PYXA 4J2WA 1CC2A 3F8PA 4A9WA 1FEAA 1NENA 4A79A 3BI2A 3UKPA 2WOIA 2VQ7A 2WQYA 3HYVA 4X9NA 1E1NA 2QA1A 2R0GA 4TLXA 4CBQA 2FJDA 1GETA 4U8JA 2C67A 3SGLA 4H2RA 1TDKA 4USRA 5KNLA 1NG3A 2YVGA 5JCIA 1ZK7A 2EQ6A 4K2XA 3AEAA 5KVHA 3VR9A 3AE2A 3NLCA 3REDA 1X31B 1PHHA 1LQTA 2E5VA 2X8GA 3SZCA 3ISHA 1OJDA 4H4RA 4CY8A 2X8HA 3AE3A 4H4QA 1E39A 4K7ZA 1L0VA 4OPLA 3NN0X 3K7MX 3NH3X 3P4QA 1S3EA 5KMQA 1NHSA 2YVJA 2V60A 3DA1A 1IJHA 5KOXA 2YVFA 3P1WA 1YY5A 4GR1A 4RG4A 2BXRA 3G5QA 3AE7A 1F8WA 4H4ZA 2YLXA 5KOWA 4J31A 1EL8A 3H8IA 4GCMA 1KNPA 4II3A 3O0HA 4TM1A 4YTPA 1COYA 1K0JA 2OALA 1GXFA 3P4RA 1PBBA 4C74A 2PHHA 3HYXA 4YSXA 1DJNA 5EB5A 5J7XA 1PXBA 4H50A 5JCKA 2B76A 2WPEA 3BNMA 4A6NB 4B66A 5M0ZA 1NDAA 1D4DA 4LA1A 3LJPA 4U8OA 2C76A 4NTCA 2CFYA 3V3OA 4E0VA 1KF6A 1VQWA 1Z6LA 3E1TA 1Y56B 1Y0PA 2Z5XA 1CL0A 1B37A 3SFEA 1K4QA 3DJDA 3NK2X 1Q1RA 1TDNA 3KU9A 4U2LA 3GRSA 4NEVA 4U8IA 3GYJA 4JY2A 4A7AA 4K8DA 3DK8A 3D1CA 2WBAA 2A8XA 1JOAA 3AYJA 1H81A 4J56A 3LZWA 5C2TA 4YTMA 4BK3A 1OJ9A 4BV6A 1ZMDA 2WDQA 4ICYA 1EL5A 1IUSA 1CC4A 4YSYA 4B1BA 3RP8A 4EM3A 3GMBA 1XPQA 3AEDA 3CNDA 5DBJA 2RGJA 4AT2A 3H8LA 4K22A 3SM8A 3AB1A 4J36A 1GV4A 3L8KA 3DJGX 4IA5A 5CKUA 2JB1A 1LTXR 5IPYA 4YSHA 2WHDA 1N4UA 3I6DA 2R4EA 4A99A 1TDFA 3S61A 2XFNA 1VDCA 4EM4A 5LV9A 1JRZA 2XVFA 3DJJA 5HYMA 5JCMA 3UTGA 4NZHA 2OLOA 2XVHA 3P9UA 2HQMA 3F8DA 4GF7A 4U2SA 3EPTA 4AP1A 3CPHG 2XLUA 1RSGA 3ALMA 5U63A 3CNPA 4CCQA 2VRMA 2X50A 5CQFA 2YLZA 2B9YA 4BURA 1W4XA 2E4GA 2BRAA 1MXTA 1E1KA 1D4EA 4II2A 3AEEA 4A65A 5HY5A 2WPCA 2XVJA 1PXCA 3UCLA 3UP5A 3AE8A 4HA6A 1PBCA 5KMPA 2VQBA 4Y4NA 3UP4A 4Z44A 3II4A 4CNKA 2O9ZA 4UDPA 4Z2RA 3UKFA 1DOBA 3JSKA 2YR5A 4H4WA 3CPJG 4NEWA 2C66A 1B4VA 4H7UA 2QAEA 5GSNA 3NYCA 1FEBA 3D8XA 5BUKA 2BS4A 1GOSA 2AR8A 1MOKA 3SZ0A 2GAHB 3UKAA 2BS2A 4XWZA 3NYEA 4TM3A 4Y4MA 2C3DA 1CHUA 2R9ZA 2V6OA 4OPGA 1D4CA 1IUVA 1H7WA 1BWCA 3NTAA 1IUUA 1PJ6A 1N1PA 4K5SA 4Z43A 1CJCA 3GSIA 2IIDA 4YWOA 1PJ7A 1ZX9A 4G6HA 5IQ4A 1MO9A 1PBFA 1GESA 2B7SA 1ONFA 2F5ZA 3B6DA 4EIQA 3IHGA 1CC6A 1NG4A 2UZZA 3ATRA 2GQFA 1DNCA 4YTNA 3CGBA 5KWFA 1L9DA 1D7YA 3ALJA 2Z5YA 3CTYA 4D04A 4KPRA 4Z2UA 2YG6A 4TM0A 3VRBA 4ECHA 2FJAA 4U8LA 2OAMA 1PBDA 3ABVA 3K7QX 4BK1A 4NWZA 4YKFA 4G9KA 1YKJA 1JRYA 2BK5A 2WOVA 4RSLA 2BCGG 3HZLA 1GRHA 3NYFA 4DSGA 1FCDA 4LU6A 3K7TA 4RG3A 4C3YA 1Y56A 3CPIG 1NEKA 3AEFA 3LXDA 3NNEA 2VRLA 2JB2A 2R46A 2WESA 3V76A 4GAVA 1BF3A 4ZN0A 3ADAB 2VVLG 4J57A 1O95A 3SFDA 3T0KA 4C77A 1H7XA 3AE4A 5KRQA 2Q0KA 3HYWA 2TPRA 1CJ2A 1GT8A 2OLNA 2BRYA 4PABA 3T2YA 3AD7B 1GSNA 4B63A 1S3BA 2VVMA 2JB3A 1PS9A 1V59A 2ACZA 2BK4A 3EAOA 1BGNA 1GALA 1H82A 1PXAA 4Z24A 3T37A 1O5WA 1TDOA 2ZBWA 3SZWA 3GRTA 1IUWA 4OPUA 2DKIA 1M6IA 4MJWA 4EIPA 2GR3A 4EQSA 1EL9A 4H2QA 2BA9A 4GRTA 4H4YA 3RP6A 3BHKA 3NG7X 1L9CA 1CJ3A 1KSUA 4OPDA 4B65A 4U8NA 4AOXA 2BCPA 4OPCA 3VR8A 2C4CA 1YQZA 2OA1A 2WU5A 2BYBA 5FMHA 5FS7A 2TMDA 1FOHA 2BK3A 2XLPA 1GTHA 4JY3A 1IUXA 3G5SA 3VRDB 2YR6A 3AE6A 3UOYA 2FBWA 3AE9A 4J34A 5C3JA 1K0LA 4OPTA 4DNAA 4EMJA 2YAUA 3C4NA 4HB9A 1RYIA 2V5ZA 2YG7A 3GD3A 1VG9A 1YQ3A 2VVLA 2GR1A 2JK6A 3AE5A 3GMCA 2R0PA 1CF3A 1XDIA 3DJEA 2Y6RA 3SY4A 3LZXA 3Q9TA 3S5WA 4JNQA 3UOVA 2YLTA 4N9XA 4H2NA 1ZMCA 4M52A 5TR3A 3AD8B 2BC0A 5KMRA 3QJ4A 5HHFA 1E7PA 1NHRA 1PN0A 4G74A 3ITJA 4BJYA 3CIRA 4FX9A 3DK4A 3GWDA 2R45A 4X4JA 5KVIA 3NRNA 3BNUA 4CNJA 2ZZCA 1LPFA 1LVLA 3NHOX 1CBOA 1UKVG 4K5RA 1DXLA 5KMSA 5HXIA 1GRFA 1N4WA 2C64A 3AEGA 1REOA 3NT6A 1NPXA 4U8KA 2WOWA 3FIMB 1OJCA 5EBKA 3LADA 3NK1X 2IVDA 2QCUA 1P2EA 1NAAA 2CDUA 5BRTA 3GWFA 4H4TA 1ZKQA 2GMJA 1JEHA 2E1MA 5FS9A 2AAQA 1P2HA 1GPEA 1H84A 2XVIA 3P4PA 3OC4A 3QFBA 4FK1A 4OCGA 3R9UA 3AXBA 4CCRA 2C75A 1GRTA 2B9WA 4G6GA 5FS6A 4ADWA 1DOEA 1SEZA 2YLRA 1E1MA 4TM4A 3QSEA 2C72A 4U8MA 4NTDA 1XANA 2ZZBA 2V3BA 3AECA 3CGEA 2H89A 1H83A 2BACA 2GQWA 1LJ1A 3FBSA 2R0CA 3IF9A 5EB4A 1OJTA 5U1OA 4DGKA 3M0OA 2H88A 3ATQA 2YQUA 3DGZA 1VG0A 4AP3A 1D5TA 3C4AA 3B3RA 1AOGA 3M12A 3QSMA 1Q9IA 1DODA 1DOCA 2XCGA 1FL2A 1GREA 2RABA 4YXDA 1RP0A 5BULA 3AYIA 3EANA 1KFYA 1GRAA 3KPFA 2VZ2A 1IUTA 4XWRA 2V3AA 4U8PA 3GDNA 3LB8A 3NTDA 1EL7A 1LV0A 4IVOB 2XVEA 3CN8A 4B67A 5JCNA 1BGJA 1F8RA 3UKQA 4U2TA 2WDVA 4B68A 2XLRA 4O5QA 1GTEA 1PJ5A 3QSSA 3UKHA 2C65A 2EQ7A 1D7LA 4A6NA 3G5RA 3KPKA 1S2YA 4UDRA 2BS3A 4YSZA 3DH9A 1CJ4A 2GMHA 2GV8A 4AT0A 5J60A 2WPFA 3VRAA 2B9XA 1QO8A 3IHMA 3LOVA 4USQA 1PDHA 4ZCDA 1ELIA 3OZ2A 3SYIA 2R4JA 3FPZA 3T2ZA 1TYPA 1ZOVA 3IWAA 3CGDA 3QVRA 2B7RA 4O5UA 2J3NA 1JNRA 2WETA 2WEUA 4J33A 5ER0A 4B69A 2C7GA 3PO7A 4H4PA 5FS8A 1GRGA 2JKCA 3GYIA 4OPIA 2WP5A 3ZDNA 3DGHA 1TYTA 2AQJA 1E1LA 3BHFA 1GEUA 2BXSA 4PAAA 3KKJA 2FJBA 4Z25A 5L46A 2GR0A 2EQ8A 1ZY8A 2Q6UA 2V61A 2YG4A 1TDEA 4FDCB 2GB0A 3GDPA 3WE0A 1JRXA 4YT0A 2GF3A 4A5LA 2I0ZA 4Y4LA 2FJEA 4IVMB 3C96A 2Q7VA 2GVCA 3CGCA 5IQ1A 3COXA 3I3LA 4WX1A 2CVJA 3H4KA 3NN6X 3URHA 3UTHA 5BVAA 4JN9A 1NHPA 1OJAA 3FG2P 3ICRA 3FMWA 1KDGA 2GR2A 3UOXA 4FK1C 4G73A 3ALLA 2VOUA 1H86A 2GEWA 2IVEA 4GDPA 4GUVA 4H2PA 3KVEA 3UOZA 3GD4A 4EMIA 3CNSA 2YLSA 1S2QA 2XLSA 3IC9A 3GYXA 4BJZA 4NTEA 2WS3A 2APGA 4IA6A 2GH5A 4UDQA 2YG3A 4EQXA 3SXIA 3AD9B 5U25A 2W0HA 4APNA 1JU2A 3T31A 4JDRA 1L9EA 3PVCA 3PS9A 1N4VA 4I58A 3V3NA 1NHQA 2YR4A 4I59A 1K0IA 4KX6A 3VQRA 4GDEA 3UKLA 4NNJA 3SZFA 2BABA 2RGOA 2YM1A 2C70A 2EQ9A 1KNRA 1B8SA 2Q0LA 4Z26A 3NGCX 1VRQB 1PBEA 5M10A 2CULA 2RGHA 1BKWA 3F8RA 3RNMA 1DJQA 2XFPA 4EMWA 5GRTA 4X9MA 3T14A 3AWIA 4DSHA 2GRTA 5EOWA 4REKA 2X99A 1KSSA 3NK0X 2DKHA 4EQWA 4TLZA 2WP9A 3SQPA 2NVKX 4ZCCA 3BI4A 2XFOA 2X3NA 3QFAA 1YQ4A 1FECA 4P9SA 1Q1WA 2XLTA 1QJDA 3UTFA 4WCTA 4Z2TA 4C3XA 1JNZA 4CRTA 4CY6A 1E6EA 2ZZ0A 3CMMA 2Y6QA 5JCLA 2GAGB 3AYLA 3EF6A 3RP7A 4BK2A 4JNAA 2XFQA 4H4SA 2WDRA 3L1RA 3M13A 1GRBA 4UP3A 3RHAA 3CNJA 2ARDA 2C73A 3ICTA 4AOSA 4YKGA 1XHCA 4H4XA 3P4SA 3AE1A 1ZDLA 4GAPA 2QA2A 1LQUA 1TRBA 5KXJA 1F6MA 4IV9A 2A89A 2X8CA 3NKSA 1ZOYA 3QVPA 1O94A 4OVIA 2JBVA 2WP6A 1GNDA 3T2KA 2WU2A 4EQRA 1F3PA 3CNTA 1M64A 2C3CA 2JAEA 1EBDA 1F8SA 2YWLA 3KA7A 3BI5A
chains in the Genus database with same CATH topology
1HYUA 1ZP0A 1QLBA 3ZYXA 1BZLA 3KD9A 3NIXA 3AEBA 3UKKA 2A87A 3DK9A 4XXGA 3ICSA 4LIIA 1GERA 2XYOA 2BC1A 2NPXA 3KLJA 4H4VA 2XFUA 3DMEA 4B64A 4C5OA 2XDOA 2YM2A 4JQ9A 1H6VA 2YG5A 3Q6JA 3SX6A 4D03A 3K30A 2YLWA 4H4UA 1B5QA 3UTEA 2PYXA 4J2WA 1CC2A 3F8PA 4A9WA 1FEAA 1NENA 4A79A 3BI2A 3UKPA 2WOIA 2VQ7A 2WQYA 3HYVA 4X9NA 1E1NA 2QA1A 2R0GA 4TLXA 4CBQA 2FJDA 1GETA 4U8JA 2C67A 3SGLA 4H2RA 1TDKA 4USRA 5KNLA 1NG3A 2YVGA 5JCIA 1ZK7A 2EQ6A 4K2XA 3AEAA 5KVHA 3VR9A 3AE2A 3NLCA 3REDA 1X31B 1PHHA 1LQTA 2E5VA 2X8GA 3SZCA 3ISHA 1OJDA 4H4RA 4CY8A 2X8HA 3AE3A 4H4QA 1E39A 4K7ZA 1L0VA 4OPLA 3NN0X 3K7MX 3NH3X 3P4QA 1S3EA 5KMQA 1NHSA 2YVJA 2V60A 3DA1A 1IJHA 5KOXA 2YVFA 3P1WA 1YY5A 4GR1A 4RG4A 2BXRA 3G5QA 3AE7A 1F8WA 4H4ZA 2YLXA 5KOWA 4J31A 1EL8A 3H8IA 4GCMA 1KNPA 4II3A 3O0HA 4TM1A 4YTPA 1COYA 1K0JA 2OALA 1GXFA 3P4RA 1PBBA 4C74A 2PHHA 3HYXA 4YSXA 1DJNA 5EB5A 5J7XA 1PXBA 4H50A 5JCKA 2B76A 2WPEA 3BNMA 4A6NB 4B66A 5M0ZA 1NDAA 1D4DA 4LA1A 3LJPA 4U8OA 2C76A 4NTCA 2CFYA 3V3OA 4E0VA 1KF6A 1VQWA 1Z6LA 3E1TA 1Y56B 1Y0PA 2Z5XA 1CL0A 1B37A 3SFEA 1K4QA 3DJDA 3NK2X 1Q1RA 1TDNA 3KU9A 4U2LA 3GRSA 4NEVA 4U8IA 3GYJA 4JY2A 4A7AA 4K8DA 3DK8A 3D1CA 2WBAA 2A8XA 1JOAA 3AYJA 1H81A 4J56A 3LZWA 5C2TA 4YTMA 4BK3A 1OJ9A 4BV6A 1ZMDA 2WDQA 4ICYA 1EL5A 1IUSA 1CC4A 4YSYA 4B1BA 3RP8A 4EM3A 3GMBA 1XPQA 3AEDA 3CNDA 5DBJA 2RGJA 4AT2A 3H8LA 4K22A 3SM8A 3AB1A 4J36A 1GV4A 3L8KA 3DJGX 4IA5A 5CKUA 2JB1A 1LTXR 5IPYA 4YSHA 2WHDA 1N4UA 3I6DA 2R4EA 4A99A 1TDFA 3S61A 2XFNA 1VDCA 4EM4A 5LV9A 1JRZA 2XVFA 3DJJA 5HYMA 5JCMA 3UTGA 4NZHA 2OLOA 2XVHA 3P9UA 2HQMA 3F8DA 4GF7A 4U2SA 3EPTA 4AP1A 3CPHG 2XLUA 1RSGA 3ALMA 5U63A 3CNPA 4CCQA 2VRMA 2X50A 5CQFA 2YLZA 2B9YA 4BURA 1W4XA 2E4GA 2BRAA 1MXTA 1E1KA 1D4EA 4II2A 3AEEA 4A65A 5HY5A 2WPCA 2XVJA 1PXCA 3UCLA 3UP5A 3AE8A 4HA6A 1PBCA 5KMPA 2VQBA 4Y4NA 3UP4A 4Z44A 3II4A 4CNKA 2O9ZA 4UDPA 4Z2RA 3UKFA 1DOBA 3JSKA 2YR5A 4H4WA 3CPJG 4NEWA 2C66A 1B4VA 4H7UA 2QAEA 5GSNA 3NYCA 1FEBA 3D8XA 5BUKA 2BS4A 1GOSA 2AR8A 1MOKA 3SZ0A 2GAHB 3UKAA 2BS2A 4XWZA 3NYEA 4TM3A 4Y4MA 2C3DA 1CHUA 2R9ZA 2V6OA 4OPGA 1D4CA 1IUVA 1H7WA 1BWCA 3NTAA 1IUUA 1PJ6A 1N1PA 4K5SA 4Z43A 1CJCA 3GSIA 2IIDA 4YWOA 1PJ7A 1ZX9A 4G6HA 5IQ4A 1MO9A 1PBFA 1GESA 2B7SA 1ONFA 2F5ZA 3B6DA 4EIQA 3IHGA 1CC6A 1NG4A 2UZZA 3ATRA 2GQFA 1DNCA 4YTNA 3CGBA 5KWFA 1L9DA 1D7YA 3ALJA 2Z5YA 3CTYA 4D04A 4KPRA 4Z2UA 2YG6A 4TM0A 3VRBA 4ECHA 2FJAA 4U8LA 2OAMA 1PBDA 3ABVA 3K7QX 4BK1A 4NWZA 4YKFA 4G9KA 1YKJA 1JRYA 2BK5A 2WOVA 4RSLA 2BCGG 3HZLA 1GRHA 3NYFA 4DSGA 1FCDA 4LU6A 3K7TA 4RG3A 4C3YA 1Y56A 3CPIG 1NEKA 3AEFA 3LXDA 3NNEA 2VRLA 2JB2A 2R46A 2WESA 3V76A 4GAVA 1BF3A 4ZN0A 3ADAB 2VVLG 4J57A 1O95A 3SFDA 3T0KA 4C77A 1H7XA 3AE4A 5KRQA 2Q0KA 3HYWA 2TPRA 1CJ2A 1GT8A 2OLNA 2BRYA 4PABA 3T2YA 3AD7B 1GSNA 4B63A 1S3BA 2VVMA 2JB3A 1PS9A 1V59A 2ACZA 2BK4A 3EAOA 1BGNA 1GALA 1H82A 1PXAA 4Z24A 3T37A 1O5WA 1TDOA 2ZBWA 3SZWA 3GRTA 1IUWA 4OPUA 2DKIA 1M6IA 4MJWA 4EIPA 2GR3A 4EQSA 1EL9A 4H2QA 2BA9A 4GRTA 4H4YA 3RP6A 3BHKA 3NG7X 1L9CA 1CJ3A 1KSUA 4OPDA 4B65A 4U8NA 4AOXA 2BCPA 4OPCA 3VR8A 2C4CA 1YQZA 2OA1A 2WU5A 2BYBA 5FMHA 5FS7A 2TMDA 1FOHA 2BK3A 2XLPA 1GTHA 4JY3A 1IUXA 3G5SA 3VRDB 2YR6A 3AE6A 3UOYA 2FBWA 3AE9A 4J34A 5C3JA 1K0LA 4OPTA 4DNAA 4EMJA 2YAUA 3C4NA 4HB9A 1RYIA 2V5ZA 2YG7A 3GD3A 1VG9A 1YQ3A 2VVLA 2GR1A 2JK6A 3AE5A 3GMCA 2R0PA 1CF3A 1XDIA 3DJEA 2Y6RA 3SY4A 3LZXA 3Q9TA 3S5WA 4JNQA 3UOVA 2YLTA 4N9XA 4H2NA 1ZMCA 4M52A 5TR3A 3AD8B 2BC0A 5KMRA 3QJ4A 5HHFA 1E7PA 1NHRA 1PN0A 4G74A 3ITJA 4BJYA 3CIRA 4FX9A 3DK4A 3GWDA 2R45A 4X4JA 5KVIA 3NRNA 3BNUA 4CNJA 2ZZCA 1LPFA 1LVLA 3NHOX 1CBOA 1UKVG 4K5RA 1DXLA 5KMSA 5HXIA 1GRFA 1N4WA 2C64A 3AEGA 1REOA 3NT6A 1NPXA 4U8KA 2WOWA 3FIMB 1OJCA 5EBKA 3LADA 3NK1X 2IVDA 2QCUA 1P2EA 1NAAA 2CDUA 5BRTA 3GWFA 4H4TA 1ZKQA 2GMJA 1JEHA 2E1MA 5FS9A 2AAQA 1P2HA 1GPEA 1H84A 2XVIA 3P4PA 3OC4A 3QFBA 4FK1A 4OCGA 3R9UA 3AXBA 4CCRA 2C75A 1GRTA 2B9WA 4G6GA 5FS6A 4ADWA 1DOEA 1SEZA 2YLRA 1E1MA 4TM4A 3QSEA 2C72A 4U8MA 4NTDA 1XANA 2ZZBA 2V3BA 3AECA 3CGEA 2H89A 1H83A 2BACA 2GQWA 1LJ1A 3FBSA 2R0CA 3IF9A 5EB4A 1OJTA 5U1OA 4DGKA 3M0OA 2H88A 3ATQA 2YQUA 3DGZA 1VG0A 4AP3A 1D5TA 3C4AA 3B3RA 1AOGA 3M12A 3QSMA 1Q9IA 1DODA 1DOCA 2XCGA 1FL2A 1GREA 2RABA 4YXDA 1RP0A 5BULA 3AYIA 3EANA 1KFYA 1GRAA 3KPFA 2VZ2A 1IUTA 4XWRA 2V3AA 4U8PA 3GDNA 3LB8A 3NTDA 1EL7A 1LV0A 4IVOB 2XVEA 3CN8A 4B67A 5JCNA 1BGJA 1F8RA 3UKQA 4U2TA 2WDVA 4B68A 2XLRA 4O5QA 1GTEA 1PJ5A 3QSSA 3UKHA 2C65A 2EQ7A 1D7LA 4A6NA 3G5RA 3KPKA 1S2YA 4UDRA 2BS3A 4YSZA 3DH9A 1CJ4A 2GMHA 2GV8A 4AT0A 5J60A 2WPFA 3VRAA 2B9XA 1QO8A 3IHMA 3LOVA 4USQA 1PDHA 4ZCDA 1ELIA 3OZ2A 3SYIA 2R4JA 3FPZA 3T2ZA 1TYPA 1ZOVA 3IWAA 3CGDA 3QVRA 2B7RA 4O5UA 2J3NA 1JNRA 2WETA 2WEUA 4J33A 5ER0A 4B69A 2C7GA 3PO7A 4H4PA 5FS8A 1GRGA 2JKCA 3GYIA 4OPIA 2WP5A 3ZDNA 3DGHA 1TYTA 2AQJA 1E1LA 3BHFA 1GEUA 2BXSA 4PAAA 3KKJA 2FJBA 4Z25A 5L46A 2GR0A 2EQ8A 1ZY8A 2Q6UA 2V61A 2YG4A 1TDEA 4FDCB 2GB0A 3GDPA 3WE0A 1JRXA 4YT0A 2GF3A 4A5LA 2I0ZA 4Y4LA 2FJEA 4IVMB 3C96A 2Q7VA 2GVCA 3CGCA 5IQ1A 3COXA 3I3LA 4WX1A 2CVJA 3H4KA 3NN6X 3URHA 3UTHA 5BVAA 4JN9A 1NHPA 1OJAA 3FG2P 3ICRA 3FMWA 1KDGA 2GR2A 3UOXA 4FK1C 4G73A 3ALLA 2VOUA 1H86A 2GEWA 2IVEA 4GDPA 4GUVA 4H2PA 3KVEA 3UOZA 3GD4A 4EMIA 3CNSA 2YLSA 1S2QA 2XLSA 3IC9A 3GYXA 4BJZA 4NTEA 2WS3A 2APGA 4IA6A 2GH5A 4UDQA 2YG3A 4EQXA 3SXIA 3AD9B 5U25A 2W0HA 4APNA 1JU2A 3T31A 4JDRA 1L9EA 3PVCA 3PS9A 1N4VA 4I58A 3V3NA 1NHQA 2YR4A 4I59A 1K0IA 4KX6A 3VQRA 4GDEA 3UKLA 4NNJA 3SZFA 2BABA 2RGOA 2YM1A 2C70A 2EQ9A 1KNRA 1B8SA 2Q0LA 4Z26A 3NGCX 1VRQB 1PBEA 5M10A 2CULA 2RGHA 1BKWA 3F8RA 3RNMA 1DJQA 2XFPA 4EMWA 5GRTA 4X9MA 3T14A 3AWIA 4DSHA 2GRTA 5EOWA 4REKA 2X99A 1KSSA 3NK0X 2DKHA 4EQWA 4TLZA 2WP9A 3SQPA 2NVKX 4ZCCA 3BI4A 2XFOA 2X3NA 3QFAA 1YQ4A 1FECA 4P9SA 1Q1WA 2XLTA 1QJDA 3UTFA 4WCTA 4Z2TA 4C3XA 1JNZA 4CRTA 4CY6A 1E6EA 2ZZ0A 3CMMA 2Y6QA 5JCLA 2GAGB 3AYLA 3EF6A 3RP7A 4BK2A 4JNAA 2XFQA 4H4SA 2WDRA 3L1RA 3M13A 1GRBA 4UP3A 3RHAA 3CNJA 2ARDA 2C73A 3ICTA 4AOSA 4YKGA 1XHCA 4H4XA 3P4SA 3AE1A 1ZDLA 4GAPA 2QA2A 1LQUA 1TRBA 5KXJA 1F6MA 4IV9A 2A89A 2X8CA 3NKSA 1ZOYA 3QVPA 1O94A 4OVIA 2JBVA 2WP6A 1GNDA 3T2KA 2WU2A 4EQRA 1F3PA 3CNTA 1M64A 2C3CA 2JAEA 1EBDA 1F8SA 2YWLA 3KA7A 3BI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HYU A;  1ZP0 A;  1QLB A;  3ZYX A;  1BZL A;  3KD9 A;  3NIX A;  3AEB A;  3UKK A;  2A87 A;  3DK9 A;  4XXG A;  3ICS A;  4LII A;  1GER A;  2XYO A;  2BC1 A;  2NPX A;  3KLJ A;  4H4V A;  2XFU A;  3DME A;  4B64 A;  4C5O A;  2XDO A;  2YM2 A;  4JQ9 A;  1H6V A;  2YG5 A;  3Q6J A;  4D03 A;  3K30 A;  2YLW A;  4H4U A;  1B5Q A;  3UTE A;  2PYX A;  4J2W A;  1CC2 A;  3F8P A;  4A9W A;  1FEA A;  1NEN A;  4A79 A;  3BI2 A;  3UKP A;  2WOI A;  2VQ7 A;  2WQY A;  4X9N A;  1E1N A;  2QA1 A;  2R0G A;  4TLX A;  4CBQ A;  2FJD A;  1GET A;  4U8J A;  2C67 A;  3SGL A;  4H2R A;  1TDK A;  4USR A;  1NG3 A;  2YVG A;  5JCI A;  1ZK7 A;  2EQ6 A;  4K2X A;  3AEA A;  5KVH A;  3VR9 A;  3AE2 A;  3NLC A;  3RED A;  1X31 B;  1PHH A;  1LQT A;  2E5V A;  2X8G A;  3ISH A;  1OJD A;  4H4R A;  4CY8 A;  2X8H A;  3AE3 A;  4H4Q A;  1E39 A;  4K7Z A;  1L0V A;  4OPL A;  3NN0 X;  3K7M X;  3NH3 X;  3P4Q A;  1S3E A;  1NHS A;  2YVJ A;  2V60 A;  3DA1 A;  1IJH A;  5KOX A;  2YVF A;  3P1W A;  1YY5 A;  4GR1 A;  4RG4 A;  2BXR A;  3G5Q A;  3AE7 A;  1F8W A;  4H4Z A;  2YLX A;  5KOW A;  4J31 A;  1EL8 A;  3H8I A;  4GCM A;  1KNP A;  3O0H A;  4TM1 A;  4YTP A;  1COY A;  1K0J A;  2OAL A;  1GXF A;  3P4R A;  1PBB A;  4C74 A;  2PHH A;  4YSX A;  1DJN A;  5EB5 A;  5J7X A;  1PXB A;  4H50 A;  5JCK A;  2B76 A;  2WPE A;  3BNM A;  4A6N B;  4B66 A;  5M0Z A;  1NDA A;  1D4D A;  4LA1 A;  3LJP A;  4U8O A;  2C76 A;  4NTC A;  2CFY A;  3V3O A;  4E0V A;  1KF6 A;  1VQW A;  1Z6L A;  3E1T A;  1Y56 B;  1Y0P A;  2Z5X A;  1CL0 A;  1B37 A;  3SFE A;  1K4Q A;  3DJD A;  3NK2 X;  1Q1R A;  1TDN A;  3KU9 A;  4U2L A;  3GRS A;  4NEV A;  4U8I A;  3GYJ A;  4JY2 A;  4A7A A;  4K8D A;  3DK8 A;  3D1C A;  2WBA A;  2A8X A;  1JOA A;  3AYJ A;  1H81 A;  4J56 A;  3LZW A;  5C2T A;  4YTM A;  4BK3 A;  1OJ9 A;  1ZMD A;  2WDQ A;  4ICY A;  1EL5 A;  1IUS A;  1CC4 A;  4YSY A;  4B1B A;  3RP8 A;  4EM3 A;  3GMB A;  1XPQ A;  3AED A;  3CND A;  5DBJ A;  2RGJ A;  4AT2 A;  3H8L A;  4K22 A;  3SM8 A;  3AB1 A;  4J36 A;  1GV4 A;  3L8K A;  3DJG X;  4IA5 A;  5CKU A;  2JB1 A;  1LTX R;  5IPY A;  4YSH A;  2WHD A;  1N4U A;  3I6D A;  2R4E A;  4A99 A;  1TDF A;  3S61 A;  2XFN A;  1VDC A;  4EM4 A;  5LV9 A;  1JRZ A;  2XVF A;  3DJJ A;  5HYM A;  5JCM A;  3UTG A;  4NZH A;  2OLO A;  2XVH A;  3P9U A;  2HQM A;  3F8D A;  4GF7 A;  4U2S A;  3EPT A;  4AP1 A;  3CPH G;  2XLU A;  1RSG A;  3ALM A;  5U63 A;  3CNP A;  4CCQ A;  2VRM A;  2X50 A;  5CQF A;  2YLZ A;  2B9Y A;  4BUR A;  1W4X A;  2E4G A;  1MXT A;  1E1K A;  1D4E A;  3AEE A;  4A65 A;  5HY5 A;  2WPC A;  2XVJ A;  1PXC A;  3UCL A;  3UP5 A;  3AE8 A;  4HA6 A;  1PBC A;  2VQB A;  4Y4N A;  3UP4 A;  4Z44 A;  3II4 A;  4CNK A;  2O9Z A;  4UDP A;  4Z2R A;  3UKF A;  1DOB A;  3JSK A;  2YR5 A;  4H4W A;  3CPJ G;  4NEW A;  2C66 A;  1B4V A;  4H7U A;  2QAE A;  5GSN A;  3NYC A;  1FEB A;  3D8X A;  5BUK A;  2BS4 A;  1GOS A;  2AR8 A;  1MOK A;  2GAH B;  3UKA A;  2BS2 A;  4XWZ A;  3NYE A;  4TM3 A;  4Y4M A;  2C3D A;  1CHU A;  2R9Z A;  2V6O A;  4OPG A;  1D4C A;  1IUV A;  1H7W A;  1BWC A;  3NTA A;  1IUU A;  1PJ6 A;  1N1P A;  4K5S A;  4Z43 A;  1CJC A;  3GSI A;  2IID A;  4YWO A;  1PJ7 A;  1ZX9 A;  5IQ4 A;  1MO9 A;  1PBF A;  1GES A;  2B7S A;  1ONF A;  2F5Z A;  3B6D A;  4EIQ A;  3IHG A;  1CC6 A;  1NG4 A;  2UZZ A;  3ATR A;  2GQF A;  1DNC A;  4YTN A;  3CGB A;  5KWF A;  1L9D A;  1D7Y A;  3ALJ A;  2Z5Y A;  3CTY A;  4D04 A;  4KPR A;  4Z2U A;  2YG6 A;  4TM0 A;  3VRB A;  4ECH A;  2FJA A;  4U8L A;  2OAM A;  1PBD A;  3ABV A;  3K7Q X;  4BK1 A;  4YKF A;  1YKJ A;  1JRY A;  2BK5 A;  2WOV A;  4RSL A;  2BCG G;  3HZL A;  1GRH A;  3NYF A;  4DSG A;  1FCD A;  4LU6 A;  3K7T A;  4RG3 A;  4C3Y A;  1Y56 A;  3CPI G;  1NEK A;  3AEF A;  3LXD A;  3NNE A;  2VRL A;  2JB2 A;  2R46 A;  2WES A;  3V76 A;  1BF3 A;  4ZN0 A;  3ADA B;  2VVL G;  4J57 A;  1O95 A;  3SFD A;  4C77 A;  1H7X A;  3AE4 A;  5KRQ A;  2Q0K A;  2TPR A;  1CJ2 A;  1GT8 A;  2OLN A;  4PAB A;  3AD7 B;  1GSN A;  4B63 A;  1S3B A;  2VVM A;  2JB3 A;  1PS9 A;  1V59 A;  2ACZ A;  2BK4 A;  3EAO A;  1BGN A;  1GAL A;  1H82 A;  1PXA A;  4Z24 A;  3T37 A;  1O5W A;  1TDO A;  2ZBW A;  3GRT A;  1IUW A;  4OPU A;  2DKI A;  1M6I A;  4MJW A;  4EIP A;  2GR3 A;  4EQS A;  1EL9 A;  4H2Q A;  2BA9 A;  4GRT A;  4H4Y A;  3RP6 A;  3BHK A;  3NG7 X;  1L9C A;  1CJ3 A;  1KSU A;  4OPD A;  4B65 A;  4U8N A;  4AOX A;  2BCP A;  4OPC A;  3VR8 A;  2OA1 A;  1YQZ A;  2WU5 A;  2BYB A;  5FMH A;  5FS7 A;  2TMD A;  1FOH A;  2BK3 A;  2XLP A;  1GTH A;  4JY3 A;  1IUX A;  3G5S A;  3VRD B;  2YR6 A;  3AE6 A;  3UOY A;  2FBW A;  3AE9 A;  4J34 A;  5C3J A;  1K0L A;  4OPT A;  4DNA A;  4EMJ A;  2YAU A;  3C4N A;  4HB9 A;  1RYI A;  2V5Z A;  2YG7 A;  3GD3 A;  1VG9 A;  1YQ3 A;  2VVL A;  2GR1 A;  2JK6 A;  3AE5 A;  3GMC A;  2R0P A;  1CF3 A;  1XDI A;  3DJE A;  2Y6R A;  3LZX A;  3Q9T A;  3S5W A;  4JNQ A;  3UOV A;  2YLT A;  4N9X A;  4H2N A;  1ZMC A;  4M52 A;  5TR3 A;  3AD8 B;  2BC0 A;  3QJ4 A;  5HHF A;  1E7P A;  1NHR A;  1PN0 A;  3ITJ A;  4BJY A;  3CIR A;  4FX9 A;  3DK4 A;  3GWD A;  2R45 A;  4X4J A;  5KVI A;  3NRN A;  3BNU A;  4CNJ A;  2ZZC A;  1LPF A;  1LVL A;  3NHO X;  1CBO A;  1UKV G;  4K5R A;  1DXL A;  5HXI A;  1GRF A;  1N4W A;  2C64 A;  3AEG A;  1REO A;  3NT6 A;  1NPX A;  4U8K A;  2WOW A;  3FIM B;  1OJC A;  5EBK A;  3LAD A;  3NK1 X;  2IVD A;  2QCU A;  1P2E A;  1NAA A;  2CDU A;  5BRT A;  3GWF A;  4H4T A;  1ZKQ A;  2GMJ A;  1JEH A;  2E1M A;  5FS9 A;  2AAQ A;  1P2H A;  1GPE A;  1H84 A;  2XVI A;  3P4P A;  3OC4 A;  3QFB A;  4FK1 A;  4OCG A;  3R9U A;  3AXB A;  4CCR A;  2C75 A;  1GRT A;  2B9W A;  4ADW A;  5FS6 A;  1DOE A;  1SEZ A;  2YLR A;  1E1M A;  4TM4 A;  3QSE A;  2C72 A;  4U8M A;  4NTD A;  1XAN A;  2ZZB A;  2V3B A;  3AEC A;  3CGE A;  2H89 A;  1H83 A;  2BAC A;  2GQW A;  1LJ1 A;  3FBS A;  2R0C A;  3IF9 A;  5EB4 A;  1OJT A;  5U1O A;  4DGK A;  3M0O A;  2H88 A;  3ATQ A;  2YQU A;  3DGZ A;  1VG0 A;  4AP3 A;  1D5T A;  3C4A A;  3B3R A;  1AOG A;  3M12 A;  3QSM A;  1Q9I A;  1DOD A;  1DOC A;  2XCG A;  1FL2 A;  1GRE A;  2RAB A;  4YXD A;  1RP0 A;  5BUL A;  3AYI A;  3EAN A;  1KFY A;  1GRA A;  3KPF A;  2VZ2 A;  1IUT A;  4XWR A;  2V3A A;  4U8P A;  3GDN A;  3LB8 A;  3NTD A;  1EL7 A;  1LV0 A;  4IVO B;  2XVE A;  3CN8 A;  4B67 A;  5JCN A;  1BGJ A;  1F8R A;  3UKQ A;  4U2T A;  2WDV A;  4B68 A;  2XLR A;  4O5Q A;  1GTE A;  1PJ5 A;  3QSS A;  3UKH A;  2C65 A;  2EQ7 A;  1D7L A;  4A6N A;  3G5R A;  1S2Y A;  4UDR A;  2BS3 A;  4YSZ A;  3DH9 A;  1CJ4 A;  2GMH A;  2GV8 A;  4AT0 A;  5J60 A;  2WPF A;  3VRA A;  2B9X A;  1QO8 A;  3IHM A;  3LOV A;  4USQ A;  1PDH A;  4ZCD A;  1ELI A;  3OZ2 A;  2R4J A;  3FPZ A;  1TYP A;  1ZOV A;  3IWA A;  3CGD A;  3QVR A;  2B7R A;  4O5U A;  2J3N A;  1JNR A;  2WET A;  2WEU A;  4J33 A;  5ER0 A;  4B69 A;  2C7G A;  3PO7 A;  4H4P A;  5FS8 A;  1GRG A;  2JKC A;  3GYI A;  4OPI A;  2WP5 A;  3ZDN A;  3DGH A;  1TYT A;  2AQJ A;  1E1L A;  3BHF A;  1GEU A;  2BXS A;  4PAA A;  3KKJ A;  2FJB A;  4Z25 A;  5L46 A;  2GR0 A;  2EQ8 A;  1ZY8 A;  2Q6U A;  2V61 A;  2YG4 A;  1TDE A;  4FDC B;  2GB0 A;  3GDP A;  3WE0 A;  1JRX A;  4YT0 A;  2GF3 A;  4A5L A;  2I0Z A;  4Y4L A;  2FJE A;  4IVM B;  3C96 A;  2Q7V A;  2GVC A;  3CGC A;  5IQ1 A;  3COX A;  3I3L A;  4WX1 A;  2CVJ A;  3H4K A;  3NN6 X;  3URH A;  3UTH A;  5BVA A;  4JN9 A;  1NHP A;  1OJA A;  3FG2 P;  3ICR A;  3FMW A;  1KDG A;  2GR2 A;  3UOX A;  4FK1 C;  3ALL A;  2VOU A;  1H86 A;  2GEW A;  2IVE A;  4GDP A;  4GUV A;  4H2P A;  3KVE A;  3UOZ A;  3GD4 A;  4EMI A;  3CNS A;  2YLS A;  1S2Q A;  2XLS A;  3IC9 A;  4BJZ A;  4NTE A;  2WS3 A;  2APG A;  4IA6 A;  2GH5 A;  4UDQ A;  2YG3 A;  4EQX A;  3AD9 B;  5U25 A;  2W0H A;  4APN A;  1JU2 A;  4JDR A;  1L9E A;  3PVC A;  3PS9 A;  1N4V A;  4I58 A;  3V3N A;  1NHQ A;  2YR4 A;  4I59 A;  1K0I A;  4KX6 A;  3VQR A;  4GDE A;  3UKL A;  4BV6 A;  2BAB A;  2RGO A;  2YM1 A;  2C70 A;  2EQ9 A;  1KNR A;  1B8S A;  2Q0L A;  4Z26 A;  3NGC X;  1VRQ B;  1PBE A;  5M10 A;  2CUL A;  2RGH A;  1BKW A;  3F8R A;  3RNM A;  1DJQ A;  2XFP A;  4EMW A;  5GRT A;  4X9M A;  3AWI A;  4DSH A;  2GRT A;  5EOW A;  4REK A;  2X99 A;  1KSS A;  3NK0 X;  2DKH A;  4EQW A;  4TLZ A;  2WP9 A;  3SQP A;  2NVK X;  4ZCC A;  3BI4 A;  2XFO A;  2X3N A;  3QFA A;  1YQ4 A;  1FEC A;  4P9S A;  1Q1W A;  2XLT A;  1QJD A;  3UTF A;  4WCT A;  4Z2T A;  4C3X A;  1JNZ A;  4CRT A;  4CY6 A;  1E6E A;  2ZZ0 A;  5JCL A;  2Y6Q A;  2GAG B;  3AYL A;  3EF6 A;  3RP7 A;  4BK2 A;  4JNA A;  2XFQ A;  4H4S A;  2WDR A;  3L1R A;  3M13 A;  1GRB A;  4UP3 A;  3RHA A;  3CNJ A;  2ARD A;  2C73 A;  3ICT A;  4AOS A;  4YKG A;  1XHC A;  4H4X A;  3P4S A;  3AE1 A;  1ZDL A;  2QA2 A;  1LQU A;  1TRB A;  5KXJ A;  1F6M A;  4IV9 A;  2A89 A;  2X8C A;  3NKS A;  1ZOY A;  3QVP A;  1O94 A;  4OVI A;  2JBV A;  2WP6 A;  1GND A;  2WU2 A;  4EQR A;  1F3P A;  3CNT A;  1M64 A;  2C3C A;  2JAE A;  1EBD A;  1F8S A;  2YWL A;  3KA7 A;  3BI5 A; 
#chains in the Genus database with same CATH topology
 1HYU A;  1ZP0 A;  1QLB A;  3ZYX A;  1BZL A;  3KD9 A;  3NIX A;  3AEB A;  3UKK A;  2A87 A;  3DK9 A;  4XXG A;  3ICS A;  4LII A;  1GER A;  2XYO A;  2BC1 A;  2NPX A;  3KLJ A;  4H4V A;  2XFU A;  3DME A;  4B64 A;  4C5O A;  2XDO A;  2YM2 A;  4JQ9 A;  1H6V A;  2YG5 A;  3Q6J A;  3SX6 A;  4D03 A;  3K30 A;  2YLW A;  4H4U A;  1B5Q A;  3UTE A;  2PYX A;  4J2W A;  1CC2 A;  3F8P A;  4A9W A;  1FEA A;  1NEN A;  4A79 A;  3BI2 A;  3UKP A;  2WOI A;  2VQ7 A;  2WQY A;  3HYV A;  4X9N A;  1E1N A;  2QA1 A;  2R0G A;  4TLX A;  4CBQ A;  2FJD A;  1GET A;  4U8J A;  2C67 A;  3SGL A;  4H2R A;  1TDK A;  4USR A;  5KNL A;  1NG3 A;  2YVG A;  5JCI A;  1ZK7 A;  2EQ6 A;  4K2X A;  3AEA A;  5KVH A;  3VR9 A;  3AE2 A;  3NLC A;  3RED A;  1X31 B;  1PHH A;  1LQT A;  2E5V A;  2X8G A;  3SZC A;  3ISH A;  1OJD A;  4H4R A;  4CY8 A;  2X8H A;  3AE3 A;  4H4Q A;  1E39 A;  4K7Z A;  1L0V A;  4OPL A;  3NN0 X;  3K7M X;  3NH3 X;  3P4Q A;  1S3E A;  5KMQ A;  1NHS A;  2YVJ A;  2V60 A;  3DA1 A;  1IJH A;  5KOX A;  2YVF A;  3P1W A;  1YY5 A;  4GR1 A;  4RG4 A;  2BXR A;  3G5Q A;  3AE7 A;  1F8W A;  4H4Z A;  2YLX A;  5KOW A;  4J31 A;  1EL8 A;  3H8I A;  4GCM A;  1KNP A;  4II3 A;  3O0H A;  4TM1 A;  4YTP A;  1COY A;  1K0J A;  2OAL A;  1GXF A;  3P4R A;  1PBB A;  4C74 A;  2PHH A;  3HYX A;  4YSX A;  1DJN A;  5EB5 A;  5J7X A;  1PXB A;  4H50 A;  5JCK A;  2B76 A;  2WPE A;  3BNM A;  4A6N B;  4B66 A;  5M0Z A;  1NDA A;  1D4D A;  4LA1 A;  3LJP A;  4U8O A;  2C76 A;  4NTC A;  2CFY A;  3V3O A;  4E0V A;  1KF6 A;  1VQW A;  1Z6L A;  3E1T A;  1Y56 B;  1Y0P A;  2Z5X A;  1CL0 A;  1B37 A;  3SFE A;  1K4Q A;  3DJD A;  3NK2 X;  1Q1R A;  1TDN A;  3KU9 A;  4U2L A;  3GRS A;  4NEV A;  4U8I A;  3GYJ A;  4JY2 A;  4A7A A;  4K8D A;  3DK8 A;  3D1C A;  2WBA A;  2A8X A;  1JOA A;  3AYJ A;  1H81 A;  4J56 A;  3LZW A;  5C2T A;  4YTM A;  4BK3 A;  1OJ9 A;  4BV6 A;  1ZMD A;  2WDQ A;  4ICY A;  1EL5 A;  1IUS A;  1CC4 A;  4YSY A;  4B1B A;  3RP8 A;  4EM3 A;  3GMB A;  1XPQ A;  3AED A;  3CND A;  5DBJ A;  2RGJ A;  4AT2 A;  3H8L A;  4K22 A;  3SM8 A;  3AB1 A;  4J36 A;  1GV4 A;  3L8K A;  3DJG X;  4IA5 A;  5CKU A;  2JB1 A;  1LTX R;  5IPY A;  4YSH A;  2WHD A;  1N4U A;  3I6D A;  2R4E A;  4A99 A;  1TDF A;  3S61 A;  2XFN A;  1VDC A;  4EM4 A;  5LV9 A;  1JRZ A;  2XVF A;  3DJJ A;  5HYM A;  5JCM A;  3UTG A;  4NZH A;  2OLO A;  2XVH A;  3P9U A;  2HQM A;  3F8D A;  4GF7 A;  4U2S A;  3EPT A;  4AP1 A;  3CPH G;  2XLU A;  1RSG A;  3ALM A;  5U63 A;  3CNP A;  4CCQ A;  2VRM A;  2X50 A;  5CQF A;  2YLZ A;  2B9Y A;  4BUR A;  1W4X A;  2E4G A;  2BRA A;  1MXT A;  1E1K A;  1D4E A;  4II2 A;  3AEE A;  4A65 A;  5HY5 A;  2WPC A;  2XVJ A;  1PXC A;  3UCL A;  3UP5 A;  3AE8 A;  4HA6 A;  1PBC A;  5KMP A;  2VQB A;  4Y4N A;  3UP4 A;  4Z44 A;  3II4 A;  4CNK A;  2O9Z A;  4UDP A;  4Z2R A;  3UKF A;  1DOB A;  3JSK A;  2YR5 A;  4H4W A;  3CPJ G;  4NEW A;  2C66 A;  1B4V A;  4H7U A;  2QAE A;  5GSN A;  3NYC A;  1FEB A;  3D8X A;  5BUK A;  2BS4 A;  1GOS A;  2AR8 A;  1MOK A;  3SZ0 A;  2GAH B;  3UKA A;  2BS2 A;  4XWZ A;  3NYE A;  4TM3 A;  4Y4M A;  2C3D A;  1CHU A;  2R9Z A;  2V6O A;  4OPG A;  1D4C A;  1IUV A;  1H7W A;  1BWC A;  3NTA A;  1IUU A;  1PJ6 A;  1N1P A;  4K5S A;  4Z43 A;  1CJC A;  3GSI A;  2IID A;  4YWO A;  1PJ7 A;  1ZX9 A;  4G6H A;  5IQ4 A;  1MO9 A;  1PBF A;  1GES A;  2B7S A;  1ONF A;  2F5Z A;  3B6D A;  4EIQ A;  3IHG A;  1CC6 A;  1NG4 A;  2UZZ A;  3ATR A;  2GQF A;  1DNC A;  4YTN A;  3CGB A;  5KWF A;  1L9D A;  1D7Y A;  3ALJ A;  2Z5Y A;  3CTY A;  4D04 A;  4KPR A;  4Z2U A;  2YG6 A;  4TM0 A;  3VRB A;  4ECH A;  2FJA A;  4U8L A;  2OAM A;  1PBD A;  3ABV A;  3K7Q X;  4BK1 A;  4NWZ A;  4YKF A;  4G9K A;  1YKJ A;  1JRY A;  2BK5 A;  2WOV A;  4RSL A;  2BCG G;  3HZL A;  1GRH A;  3NYF A;  4DSG A;  1FCD A;  4LU6 A;  3K7T A;  4RG3 A;  4C3Y A;  1Y56 A;  3CPI G;  1NEK A;  3AEF A;  3LXD A;  3NNE A;  2VRL A;  2JB2 A;  2R46 A;  2WES A;  3V76 A;  4GAV A;  1BF3 A;  4ZN0 A;  3ADA B;  2VVL G;  4J57 A;  1O95 A;  3SFD A;  3T0K A;  4C77 A;  1H7X A;  3AE4 A;  5KRQ A;  2Q0K A;  3HYW A;  2TPR A;  1CJ2 A;  1GT8 A;  2OLN A;  2BRY A;  4PAB A;  3T2Y A;  3AD7 B;  1GSN A;  4B63 A;  1S3B A;  2VVM A;  2JB3 A;  1PS9 A;  1V59 A;  2ACZ A;  2BK4 A;  3EAO A;  1BGN A;  1GAL A;  1H82 A;  1PXA A;  4Z24 A;  3T37 A;  1O5W A;  1TDO A;  2ZBW A;  3SZW A;  3GRT A;  1IUW A;  4OPU A;  2DKI A;  1M6I A;  4MJW A;  4EIP A;  2GR3 A;  4EQS A;  1EL9 A;  4H2Q A;  2BA9 A;  4GRT A;  4H4Y A;  3RP6 A;  3BHK A;  3NG7 X;  1L9C A;  1CJ3 A;  1KSU A;  4OPD A;  4B65 A;  4U8N A;  4AOX A;  2BCP A;  4OPC A;  3VR8 A;  2C4C A;  1YQZ A;  2OA1 A;  2WU5 A;  2BYB A;  5FMH A;  5FS7 A;  2TMD A;  1FOH A;  2BK3 A;  2XLP A;  1GTH A;  4JY3 A;  1IUX A;  3G5S A;  3VRD B;  2YR6 A;  3AE6 A;  3UOY A;  2FBW A;  3AE9 A;  4J34 A;  5C3J A;  1K0L A;  4OPT A;  4DNA A;  4EMJ A;  2YAU A;  3C4N A;  4HB9 A;  1RYI A;  2V5Z A;  2YG7 A;  3GD3 A;  1VG9 A;  1YQ3 A;  2VVL A;  2GR1 A;  2JK6 A;  3AE5 A;  3GMC A;  2R0P A;  1CF3 A;  1XDI A;  3DJE A;  2Y6R A;  3SY4 A;  3LZX A;  3Q9T A;  3S5W A;  4JNQ A;  3UOV A;  2YLT A;  4N9X A;  4H2N A;  1ZMC A;  4M52 A;  5TR3 A;  3AD8 B;  2BC0 A;  5KMR A;  3QJ4 A;  5HHF A;  1E7P A;  1NHR A;  1PN0 A;  4G74 A;  3ITJ A;  4BJY A;  3CIR A;  4FX9 A;  3DK4 A;  3GWD A;  2R45 A;  4X4J A;  5KVI A;  3NRN A;  3BNU A;  4CNJ A;  2ZZC A;  1LPF A;  1LVL A;  3NHO X;  1CBO A;  1UKV G;  4K5R A;  1DXL A;  5KMS A;  5HXI A;  1GRF A;  1N4W A;  2C64 A;  3AEG A;  1REO A;  3NT6 A;  1NPX A;  4U8K A;  2WOW A;  3FIM B;  1OJC A;  5EBK A;  3LAD A;  3NK1 X;  2IVD A;  2QCU A;  1P2E A;  1NAA A;  2CDU A;  5BRT A;  3GWF A;  4H4T A;  1ZKQ A;  2GMJ A;  1JEH A;  2E1M A;  5FS9 A;  2AAQ A;  1P2H A;  1GPE A;  1H84 A;  2XVI A;  3P4P A;  3OC4 A;  3QFB A;  4FK1 A;  4OCG A;  3R9U A;  3AXB A;  4CCR A;  2C75 A;  1GRT A;  2B9W A;  4G6G A;  5FS6 A;  4ADW A;  1DOE A;  1SEZ A;  2YLR A;  1E1M A;  4TM4 A;  3QSE A;  2C72 A;  4U8M A;  4NTD A;  1XAN A;  2ZZB A;  2V3B A;  3AEC A;  3CGE A;  2H89 A;  1H83 A;  2BAC A;  2GQW A;  1LJ1 A;  3FBS A;  2R0C A;  3IF9 A;  5EB4 A;  1OJT A;  5U1O A;  4DGK A;  3M0O A;  2H88 A;  3ATQ A;  2YQU A;  3DGZ A;  1VG0 A;  4AP3 A;  1D5T A;  3C4A A;  3B3R A;  1AOG A;  3M12 A;  3QSM A;  1Q9I A;  1DOD A;  1DOC A;  2XCG A;  1FL2 A;  1GRE A;  2RAB A;  4YXD A;  1RP0 A;  5BUL A;  3AYI A;  3EAN A;  1KFY A;  1GRA A;  3KPF A;  2VZ2 A;  1IUT A;  4XWR A;  2V3A A;  4U8P A;  3GDN A;  3LB8 A;  3NTD A;  1EL7 A;  1LV0 A;  4IVO B;  2XVE A;  3CN8 A;  4B67 A;  5JCN A;  1BGJ A;  1F8R A;  3UKQ A;  4U2T A;  2WDV A;  4B68 A;  2XLR A;  4O5Q A;  1GTE A;  1PJ5 A;  3QSS A;  3UKH A;  2C65 A;  2EQ7 A;  1D7L A;  4A6N A;  3G5R A;  3KPK A;  1S2Y A;  4UDR A;  2BS3 A;  4YSZ A;  3DH9 A;  1CJ4 A;  2GMH A;  2GV8 A;  4AT0 A;  5J60 A;  2WPF A;  3VRA A;  2B9X A;  1QO8 A;  3IHM A;  3LOV A;  4USQ A;  1PDH A;  4ZCD A;  1ELI A;  3OZ2 A;  3SYI A;  2R4J A;  3FPZ A;  3T2Z A;  1TYP A;  1ZOV A;  3IWA A;  3CGD A;  3QVR A;  2B7R A;  4O5U A;  2J3N A;  1JNR A;  2WET A;  2WEU A;  4J33 A;  5ER0 A;  4B69 A;  2C7G A;  3PO7 A;  4H4P A;  5FS8 A;  1GRG A;  2JKC A;  3GYI A;  4OPI A;  2WP5 A;  3ZDN A;  3DGH A;  1TYT A;  2AQJ A;  1E1L A;  3BHF A;  1GEU A;  2BXS A;  4PAA A;  3KKJ A;  2FJB A;  4Z25 A;  5L46 A;  2GR0 A;  2EQ8 A;  1ZY8 A;  2Q6U A;  2V61 A;  2YG4 A;  1TDE A;  4FDC B;  2GB0 A;  3GDP A;  3WE0 A;  1JRX A;  4YT0 A;  2GF3 A;  4A5L A;  2I0Z A;  4Y4L A;  2FJE A;  4IVM B;  3C96 A;  2Q7V A;  2GVC A;  3CGC A;  5IQ1 A;  3COX A;  3I3L A;  4WX1 A;  2CVJ A;  3H4K A;  3NN6 X;  3URH A;  3UTH A;  5BVA A;  4JN9 A;  1NHP A;  1OJA A;  3FG2 P;  3ICR A;  3FMW A;  1KDG A;  2GR2 A;  3UOX A;  4FK1 C;  4G73 A;  3ALL A;  2VOU A;  1H86 A;  2GEW A;  2IVE A;  4GDP A;  4GUV A;  4H2P A;  3KVE A;  3UOZ A;  3GD4 A;  4EMI A;  3CNS A;  2YLS A;  1S2Q A;  2XLS A;  3IC9 A;  3GYX A;  4BJZ A;  4NTE A;  2WS3 A;  2APG A;  4IA6 A;  2GH5 A;  4UDQ A;  2YG3 A;  4EQX A;  3SXI A;  3AD9 B;  5U25 A;  2W0H A;  4APN A;  1JU2 A;  3T31 A;  4JDR A;  1L9E A;  3PVC A;  3PS9 A;  1N4V A;  4I58 A;  3V3N A;  1NHQ A;  2YR4 A;  4I59 A;  1K0I A;  4KX6 A;  3VQR A;  4GDE A;  3UKL A;  4NNJ A;  3SZF A;  2BAB A;  2RGO A;  2YM1 A;  2C70 A;  2EQ9 A;  1KNR A;  1B8S A;  2Q0L A;  4Z26 A;  3NGC X;  1VRQ B;  1PBE A;  5M10 A;  2CUL A;  2RGH A;  1BKW A;  3F8R A;  3RNM A;  1DJQ A;  2XFP A;  4EMW A;  5GRT A;  4X9M A;  3T14 A;  3AWI A;  4DSH A;  2GRT A;  5EOW A;  4REK A;  2X99 A;  1KSS A;  3NK0 X;  2DKH A;  4EQW A;  4TLZ A;  2WP9 A;  3SQP A;  2NVK X;  4ZCC A;  3BI4 A;  2XFO A;  2X3N A;  3QFA A;  1YQ4 A;  1FEC A;  4P9S A;  1Q1W A;  2XLT A;  1QJD A;  3UTF A;  4WCT A;  4Z2T A;  4C3X A;  1JNZ A;  4CRT A;  4CY6 A;  1E6E A;  2ZZ0 A;  3CMM A;  2Y6Q A;  5JCL A;  2GAG B;  3AYL A;  3EF6 A;  3RP7 A;  4BK2 A;  4JNA A;  2XFQ A;  4H4S A;  2WDR A;  3L1R A;  3M13 A;  1GRB A;  4UP3 A;  3RHA A;  3CNJ A;  2ARD A;  2C73 A;  3ICT A;  4AOS A;  4YKG A;  1XHC A;  4H4X A;  3P4S A;  3AE1 A;  1ZDL A;  4GAP A;  2QA2 A;  1LQU A;  1TRB A;  5KXJ A;  1F6M A;  4IV9 A;  2A89 A;  2X8C A;  3NKS A;  1ZOY A;  3QVP A;  1O94 A;  4OVI A;  2JBV A;  2WP6 A;  1GND A;  3T2K A;  2WU2 A;  4EQR A;  1F3P A;  3CNT A;  1M64 A;  2C3C A;  2JAE A;  1EBD A;  1F8S A;  2YWL A;  3KA7 A;  3BI5 A; 
#chains in the Genus database with same CATH homology
 1HYU A;  1ZP0 A;  1QLB A;  3ZYX A;  1BZL A;  3KD9 A;  3NIX A;  3AEB A;  3UKK A;  2A87 A;  3DK9 A;  4XXG A;  3ICS A;  4LII A;  1GER A;  2XYO A;  2BC1 A;  2NPX A;  3KLJ A;  4H4V A;  2XFU A;  3DME A;  4B64 A;  4C5O A;  2XDO A;  2YM2 A;  4JQ9 A;  1H6V A;  2YG5 A;  3Q6J A;  3SX6 A;  4D03 A;  3K30 A;  2YLW A;  4H4U A;  1B5Q A;  3UTE A;  2PYX A;  4J2W A;  1CC2 A;  3F8P A;  4A9W A;  1FEA A;  1NEN A;  4A79 A;  3BI2 A;  3UKP A;  2WOI A;  2VQ7 A;  2WQY A;  3HYV A;  4X9N A;  1E1N A;  2QA1 A;  2R0G A;  4TLX A;  4CBQ A;  2FJD A;  1GET A;  4U8J A;  2C67 A;  3SGL A;  4H2R A;  1TDK A;  4USR A;  5KNL A;  1NG3 A;  2YVG A;  5JCI A;  1ZK7 A;  2EQ6 A;  4K2X A;  3AEA A;  5KVH A;  3VR9 A;  3AE2 A;  3NLC A;  3RED A;  1X31 B;  1PHH A;  1LQT A;  2E5V A;  2X8G A;  3SZC A;  3ISH A;  1OJD A;  4H4R A;  4CY8 A;  2X8H A;  3AE3 A;  4H4Q A;  1E39 A;  4K7Z A;  1L0V A;  4OPL A;  3NN0 X;  3K7M X;  3NH3 X;  3P4Q A;  1S3E A;  5KMQ A;  1NHS A;  2YVJ A;  2V60 A;  3DA1 A;  1IJH A;  5KOX A;  2YVF A;  3P1W A;  1YY5 A;  4GR1 A;  4RG4 A;  2BXR A;  3G5Q A;  3AE7 A;  1F8W A;  4H4Z A;  2YLX A;  5KOW A;  4J31 A;  1EL8 A;  3H8I A;  4GCM A;  1KNP A;  4II3 A;  3O0H A;  4TM1 A;  4YTP A;  1COY A;  1K0J A;  2OAL A;  1GXF A;  3P4R A;  1PBB A;  4C74 A;  2PHH A;  3HYX A;  4YSX A;  1DJN A;  5EB5 A;  5J7X A;  1PXB A;  4H50 A;  5JCK A;  2B76 A;  2WPE A;  3BNM A;  4A6N B;  4B66 A;  5M0Z A;  1NDA A;  1D4D A;  4LA1 A;  3LJP A;  4U8O A;  2C76 A;  4NTC A;  2CFY A;  3V3O A;  4E0V A;  1KF6 A;  1VQW A;  1Z6L A;  3E1T A;  1Y56 B;  1Y0P A;  2Z5X A;  1CL0 A;  1B37 A;  3SFE A;  1K4Q A;  3DJD A;  3NK2 X;  1Q1R A;  1TDN A;  3KU9 A;  4U2L A;  3GRS A;  4NEV A;  4U8I A;  3GYJ A;  4JY2 A;  4A7A A;  4K8D A;  3DK8 A;  3D1C A;  2WBA A;  2A8X A;  1JOA A;  3AYJ A;  1H81 A;  4J56 A;  3LZW A;  5C2T A;  4YTM A;  4BK3 A;  1OJ9 A;  4BV6 A;  1ZMD A;  2WDQ A;  4ICY A;  1EL5 A;  1IUS A;  1CC4 A;  4YSY A;  4B1B A;  3RP8 A;  4EM3 A;  3GMB A;  1XPQ A;  3AED A;  3CND A;  5DBJ A;  2RGJ A;  4AT2 A;  3H8L A;  4K22 A;  3SM8 A;  3AB1 A;  4J36 A;  1GV4 A;  3L8K A;  3DJG X;  4IA5 A;  5CKU A;  2JB1 A;  1LTX R;  5IPY A;  4YSH A;  2WHD A;  1N4U A;  3I6D A;  2R4E A;  4A99 A;  1TDF A;  3S61 A;  2XFN A;  1VDC A;  4EM4 A;  5LV9 A;  1JRZ A;  2XVF A;  3DJJ A;  5HYM A;  5JCM A;  3UTG A;  4NZH A;  2OLO A;  2XVH A;  3P9U A;  2HQM A;  3F8D A;  4GF7 A;  4U2S A;  3EPT A;  4AP1 A;  3CPH G;  2XLU A;  1RSG A;  3ALM A;  5U63 A;  3CNP A;  4CCQ A;  2VRM A;  2X50 A;  5CQF A;  2YLZ A;  2B9Y A;  4BUR A;  1W4X A;  2E4G A;  2BRA A;  1MXT A;  1E1K A;  1D4E A;  4II2 A;  3AEE A;  4A65 A;  5HY5 A;  2WPC A;  2XVJ A;  1PXC A;  3UCL A;  3UP5 A;  3AE8 A;  4HA6 A;  1PBC A;  5KMP A;  2VQB A;  4Y4N A;  3UP4 A;  4Z44 A;  3II4 A;  4CNK A;  2O9Z A;  4UDP A;  4Z2R A;  3UKF A;  1DOB A;  3JSK A;  2YR5 A;  4H4W A;  3CPJ G;  4NEW A;  2C66 A;  1B4V A;  4H7U A;  2QAE A;  5GSN A;  3NYC A;  1FEB A;  3D8X A;  5BUK A;  2BS4 A;  1GOS A;  2AR8 A;  1MOK A;  3SZ0 A;  2GAH B;  3UKA A;  2BS2 A;  4XWZ A;  3NYE A;  4TM3 A;  4Y4M A;  2C3D A;  1CHU A;  2R9Z A;  2V6O A;  4OPG A;  1D4C A;  1IUV A;  1H7W A;  1BWC A;  3NTA A;  1IUU A;  1PJ6 A;  1N1P A;  4K5S A;  4Z43 A;  1CJC A;  3GSI A;  2IID A;  4YWO A;  1PJ7 A;  1ZX9 A;  4G6H A;  5IQ4 A;  1MO9 A;  1PBF A;  1GES A;  2B7S A;  1ONF A;  2F5Z A;  3B6D A;  4EIQ A;  3IHG A;  1CC6 A;  1NG4 A;  2UZZ A;  3ATR A;  2GQF A;  1DNC A;  4YTN A;  3CGB A;  5KWF A;  1L9D A;  1D7Y A;  3ALJ A;  2Z5Y A;  3CTY A;  4D04 A;  4KPR A;  4Z2U A;  2YG6 A;  4TM0 A;  3VRB A;  4ECH A;  2FJA A;  4U8L A;  2OAM A;  1PBD A;  3ABV A;  3K7Q X;  4BK1 A;  4NWZ A;  4YKF A;  4G9K A;  1YKJ A;  1JRY A;  2BK5 A;  2WOV A;  4RSL A;  2BCG G;  3HZL A;  1GRH A;  3NYF A;  4DSG A;  1FCD A;  4LU6 A;  3K7T A;  4RG3 A;  4C3Y A;  1Y56 A;  3CPI G;  1NEK A;  3AEF A;  3LXD A;  3NNE A;  2VRL A;  2JB2 A;  2R46 A;  2WES A;  3V76 A;  4GAV A;  1BF3 A;  4ZN0 A;  3ADA B;  2VVL G;  4J57 A;  1O95 A;  3SFD A;  3T0K A;  4C77 A;  1H7X A;  3AE4 A;  5KRQ A;  2Q0K A;  3HYW A;  2TPR A;  1CJ2 A;  1GT8 A;  2OLN A;  2BRY A;  4PAB A;  3T2Y A;  3AD7 B;  1GSN A;  4B63 A;  1S3B A;  2VVM A;  2JB3 A;  1PS9 A;  1V59 A;  2ACZ A;  2BK4 A;  3EAO A;  1BGN A;  1GAL A;  1H82 A;  1PXA A;  4Z24 A;  3T37 A;  1O5W A;  1TDO A;  2ZBW A;  3SZW A;  3GRT A;  1IUW A;  4OPU A;  2DKI A;  1M6I A;  4MJW A;  4EIP A;  2GR3 A;  4EQS A;  1EL9 A;  4H2Q A;  2BA9 A;  4GRT A;  4H4Y A;  3RP6 A;  3BHK A;  3NG7 X;  1L9C A;  1CJ3 A;  1KSU A;  4OPD A;  4B65 A;  4U8N A;  4AOX A;  2BCP A;  4OPC A;  3VR8 A;  2C4C A;  1YQZ A;  2OA1 A;  2WU5 A;  2BYB A;  5FMH A;  5FS7 A;  2TMD A;  1FOH A;  2BK3 A;  2XLP A;  1GTH A;  4JY3 A;  1IUX A;  3G5S A;  3VRD B;  2YR6 A;  3AE6 A;  3UOY A;  2FBW A;  3AE9 A;  4J34 A;  5C3J A;  1K0L A;  4OPT A;  4DNA A;  4EMJ A;  2YAU A;  3C4N A;  4HB9 A;  1RYI A;  2V5Z A;  2YG7 A;  3GD3 A;  1VG9 A;  1YQ3 A;  2VVL A;  2GR1 A;  2JK6 A;  3AE5 A;  3GMC A;  2R0P A;  1CF3 A;  1XDI A;  3DJE A;  2Y6R A;  3SY4 A;  3LZX A;  3Q9T A;  3S5W A;  4JNQ A;  3UOV A;  2YLT A;  4N9X A;  4H2N A;  1ZMC A;  4M52 A;  5TR3 A;  3AD8 B;  2BC0 A;  5KMR A;  3QJ4 A;  5HHF A;  1E7P A;  1NHR A;  1PN0 A;  4G74 A;  3ITJ A;  4BJY A;  3CIR A;  4FX9 A;  3DK4 A;  3GWD A;  2R45 A;  4X4J A;  5KVI A;  3NRN A;  3BNU A;  4CNJ A;  2ZZC A;  1LPF A;  1LVL A;  3NHO X;  1CBO A;  1UKV G;  4K5R A;  1DXL A;  5KMS A;  5HXI A;  1GRF A;  1N4W A;  2C64 A;  3AEG A;  1REO A;  3NT6 A;  1NPX A;  4U8K A;  2WOW A;  3FIM B;  1OJC A;  5EBK A;  3LAD A;  3NK1 X;  2IVD A;  2QCU A;  1P2E A;  1NAA A;  2CDU A;  5BRT A;  3GWF A;  4H4T A;  1ZKQ A;  2GMJ A;  1JEH A;  2E1M A;  5FS9 A;  2AAQ A;  1P2H A;  1GPE A;  1H84 A;  2XVI A;  3P4P A;  3OC4 A;  3QFB A;  4FK1 A;  4OCG A;  3R9U A;  3AXB A;  4CCR A;  2C75 A;  1GRT A;  2B9W A;  4G6G A;  5FS6 A;  4ADW A;  1DOE A;  1SEZ A;  2YLR A;  1E1M A;  4TM4 A;  3QSE A;  2C72 A;  4U8M A;  4NTD A;  1XAN A;  2ZZB A;  2V3B A;  3AEC A;  3CGE A;  2H89 A;  1H83 A;  2BAC A;  2GQW A;  1LJ1 A;  3FBS A;  2R0C A;  3IF9 A;  5EB4 A;  1OJT A;  5U1O A;  4DGK A;  3M0O A;  2H88 A;  3ATQ A;  2YQU A;  3DGZ A;  1VG0 A;  4AP3 A;  1D5T A;  3C4A A;  3B3R A;  1AOG A;  3M12 A;  3QSM A;  1Q9I A;  1DOD A;  1DOC A;  2XCG A;  1FL2 A;  1GRE A;  2RAB A;  4YXD A;  1RP0 A;  5BUL A;  3AYI A;  3EAN A;  1KFY A;  1GRA A;  3KPF A;  2VZ2 A;  1IUT A;  4XWR A;  2V3A A;  4U8P A;  3GDN A;  3LB8 A;  3NTD A;  1EL7 A;  1LV0 A;  4IVO B;  2XVE A;  3CN8 A;  4B67 A;  5JCN A;  1BGJ A;  1F8R A;  3UKQ A;  4U2T A;  2WDV A;  4B68 A;  2XLR A;  4O5Q A;  1GTE A;  1PJ5 A;  3QSS A;  3UKH A;  2C65 A;  2EQ7 A;  1D7L A;  4A6N A;  3G5R A;  3KPK A;  1S2Y A;  4UDR A;  2BS3 A;  4YSZ A;  3DH9 A;  1CJ4 A;  2GMH A;  2GV8 A;  4AT0 A;  5J60 A;  2WPF A;  3VRA A;  2B9X A;  1QO8 A;  3IHM A;  3LOV A;  4USQ A;  1PDH A;  4ZCD A;  1ELI A;  3OZ2 A;  3SYI A;  2R4J A;  3FPZ A;  3T2Z A;  1TYP A;  1ZOV A;  3IWA A;  3CGD A;  3QVR A;  2B7R A;  4O5U A;  2J3N A;  1JNR A;  2WET A;  2WEU A;  4J33 A;  5ER0 A;  4B69 A;  2C7G A;  3PO7 A;  4H4P A;  5FS8 A;  1GRG A;  2JKC A;  3GYI A;  4OPI A;  2WP5 A;  3ZDN A;  3DGH A;  1TYT A;  2AQJ A;  1E1L A;  3BHF A;  1GEU A;  2BXS A;  4PAA A;  3KKJ A;  2FJB A;  4Z25 A;  5L46 A;  2GR0 A;  2EQ8 A;  1ZY8 A;  2Q6U A;  2V61 A;  2YG4 A;  1TDE A;  4FDC B;  2GB0 A;  3GDP A;  3WE0 A;  1JRX A;  4YT0 A;  2GF3 A;  4A5L A;  2I0Z A;  4Y4L A;  2FJE A;  4IVM B;  3C96 A;  2Q7V A;  2GVC A;  3CGC A;  5IQ1 A;  3COX A;  3I3L A;  4WX1 A;  2CVJ A;  3H4K A;  3NN6 X;  3URH A;  3UTH A;  5BVA A;  4JN9 A;  1NHP A;  1OJA A;  3FG2 P;  3ICR A;  3FMW A;  1KDG A;  2GR2 A;  3UOX A;  4FK1 C;  4G73 A;  3ALL A;  2VOU A;  1H86 A;  2GEW A;  2IVE A;  4GDP A;  4GUV A;  4H2P A;  3KVE A;  3UOZ A;  3GD4 A;  4EMI A;  3CNS A;  2YLS A;  1S2Q A;  2XLS A;  3IC9 A;  3GYX A;  4BJZ A;  4NTE A;  2WS3 A;  2APG A;  4IA6 A;  2GH5 A;  4UDQ A;  2YG3 A;  4EQX A;  3SXI A;  3AD9 B;  5U25 A;  2W0H A;  4APN A;  1JU2 A;  3T31 A;  4JDR A;  1L9E A;  3PVC A;  3PS9 A;  1N4V A;  4I58 A;  3V3N A;  1NHQ A;  2YR4 A;  4I59 A;  1K0I A;  4KX6 A;  3VQR A;  4GDE A;  3UKL A;  4NNJ A;  3SZF A;  2BAB A;  2RGO A;  2YM1 A;  2C70 A;  2EQ9 A;  1KNR A;  1B8S A;  2Q0L A;  4Z26 A;  3NGC X;  1VRQ B;  1PBE A;  5M10 A;  2CUL A;  2RGH A;  1BKW A;  3F8R A;  3RNM A;  1DJQ A;  2XFP A;  4EMW A;  5GRT A;  4X9M A;  3T14 A;  3AWI A;  4DSH A;  2GRT A;  5EOW A;  4REK A;  2X99 A;  1KSS A;  3NK0 X;  2DKH A;  4EQW A;  4TLZ A;  2WP9 A;  3SQP A;  2NVK X;  4ZCC A;  3BI4 A;  2XFO A;  2X3N A;  3QFA A;  1YQ4 A;  1FEC A;  4P9S A;  1Q1W A;  2XLT A;  1QJD A;  3UTF A;  4WCT A;  4Z2T A;  4C3X A;  1JNZ A;  4CRT A;  4CY6 A;  1E6E A;  2ZZ0 A;  3CMM A;  2Y6Q A;  5JCL A;  2GAG B;  3AYL A;  3EF6 A;  3RP7 A;  4BK2 A;  4JNA A;  2XFQ A;  4H4S A;  2WDR A;  3L1R A;  3M13 A;  1GRB A;  4UP3 A;  3RHA A;  3CNJ A;  2ARD A;  2C73 A;  3ICT A;  4AOS A;  4YKG A;  1XHC A;  4H4X A;  3P4S A;  3AE1 A;  1ZDL A;  4GAP A;  2QA2 A;  1LQU A;  1TRB A;  5KXJ A;  1F6M A;  4IV9 A;  2A89 A;  2X8C A;  3NKS A;  1ZOY A;  3QVP A;  1O94 A;  4OVI A;  2JBV A;  2WP6 A;  1GND A;  3T2K A;  2WU2 A;  4EQR A;  1F3P A;  3CNT A;  1M64 A;  2C3C A;  2JAE A;  1EBD A;  1F8S A;  2YWL A;  3KA7 A;  3BI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...