3KPFA

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
total genus 167
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kpfA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kpfA02
2E5VA 1E1LA 4PABA 5FS6A 4FX9A 4JQ9A 1H7XA 2ZBWA 1KDGA 2WP9A 3G5SA 4H4VA 4EIPA 3AEGA 2YM1A 4JY2A 5IPYA 2YG4A 1IUTA 2YQUA 3DK8A 4XXGA 1REOA 2I0ZA 3SGLA 1CC2A 4A65A 1MO9A 1B37A 2V5ZA 4KPRA 5HYMA 1GREA 1Y0PA 3VRDB 1VG0A 4Z43A 2ZZBA 3UCLA 2R0GA 2GEWA 3UOZA 4HA6A 2C67A 2E4GA 2YLZA 1XANA 1N4UA 1KNPA 5FMHA 3UOVA 4IA5A 3GRTA 4BJZA 4A6NB 1JU2A 2J3NA 3DGHA 5JCMA 3K7TA 3P9UA 4U8IA 1PS9A 3DH9A 2X99A 4CY6A 1PBEA 1GRGA 2GR1A 2TPRA 2XVFA 3EAOA 5KWFA 3II4A 2NPXA 4B66A 4OPGA 3ISHA 2C66A 2R4JA 1ONFA 4TM3A 4Z44A 1GEUA 5U25A 2BXRA 3PO7A 4H2PA 2F5ZA 2TMDA 3UKKA 3FG2P 3AE8A 1LV0A 4TM4A 1XDIA 4E0VA 1PBCA 4YT0A 4TLZA 3FIMB 3C96A 1PXCA 3UP4A 1E1MA 4FK1C 2Q6UA 2XFUA 4KX6A 5HXIA 3K7MX 1EL8A 3GSIA 1L9DA 2WDRA 2XFNA 2YLWA 1GPEA 4H2NA 3QFBA 2C3CA 4H4SA 4AOSA 3KVEA 4B63A 4A79A 4BK1A 4O5UA 5BULA 1E6EA 1K0IA 2C64A 3ALLA 4K7ZA 1GETA 4CCQA 5KOWA 1D4EA 4J2WA 3FPZA 3NIXA 2GF3A 3ZDNA 1H6VA 3DJGX 1HYUA 1NENA 2BK3A 3REDA 1BF3A 1ELIA 1FEBA 1D4DA 1JNRA 4YWOA 4B1BA 5J60A 4AOXA 3BI2A 3AE2A 4YSXA 1GT8A 1LTXR 1KFYA 2BYBA 3UKPA 4DGKA 3AE6A 3LZWA 1CL0A 4IV9A 3H4KA 3DJDA 4RG4A 1NPXA 2C72A 2X3NA 4I58A 1Z6LA 3EANA 4JN9A 3UTGA 2YLXA 4U8OA 2BCGG 1YY5A 3G5QA 4H7UA 4LA1A 3F8PA 5C3JA 1H81A 1TDOA 3DJEA 3ICSA 1OJAA 3IWAA 3UTHA 3VRAA 1MOKA 1SEZA 4P9SA 1TYTA 2GQWA 2WPCA 2HQMA 1VG9A 4J31A 4OPLA 4Y4MA 5TR3A 1D7YA 1VDCA 2DKHA 3PS9A 4OPIA 4B68A 4YXDA 5BVAA 4YSHA 4J56A 3NYCA 3VR9A 2GB0A 5FS7A 2CVJA 1NEKA 1P2EA 1H83A 1B8SA 1CJ2A 2BS2A 2Q7VA 3NLCA 3QSSA 2H88A 5EOWA 4AT2A 4B65A 1L9EA 3CGCA 2ZZCA 1PXAA 2WDVA 2UZZA 1PDHA 2VVLG 2XFOA 2V3AA 3KLJA 1IUUA 3LADA 4ICYA 3NYEA 4OPUA 5KVHA 4CNJA 1ZMCA 4TLXA 1W4XA 4H4RA 3CNPA 2YR5A 4K22A 3CTYA 2Y6RA 3AD9B 2R9ZA 3CNSA 3EF6A 3H8LA 3ITJA 1CJCA 3GWDA 3M12A 3S61A 1PBFA 3AXBA 3UTEA 1S3BA 2V61A 3GD3A 3NK0X 3NH3X 4BURA 1BGNA 3QFAA 2YLRA 3CPHG 5J7XA 1BKWA 3GWFA 3KD9A 2C65A 3LXDA 3P4QA 2BK4A 3NG7X 1FECA 3VQRA 5JCIA 3DGZA 1NG4A 4NTDA 4NTEA 1ZP0A 4LU6A 5M0ZA 2RGHA 2YG3A 2NVKX 3CGEA 4U8NA 1L9CA 1PJ7A 4EM3A 2WPFA 3AE4A 3GDNA 3LZXA 3AB1A 4U8KA 5HHFA 2FJDA 2QA2A 4Z24A 3AEAA 1JNZA 3BNMA 3AYIA 1DNCA 4UDRA 2X8CA 4USRA 4JDRA 2YVFA 2YLSA 3O0HA 4H4UA 1CF3A 1TDFA 2YLTA 1JRYA 3F8RA 1LPFA 4JNAA 1NHRA 2R0CA 1GRAA 3ATQA 4REKA 2JKCA 1RYIA 1B4VA 4ZCDA 2C7GA 2X8HA 2V3BA 2XLUA 5GSNA 1YKJA 1FCDA 2FBWA 2WP5A 3B6DA 1GERA 1H84A 3AE3A 4IVOB 1LQUA 3GD4A 3P4RA 3GRSA 3AE7A 3AD7B 1KSSA 1JOAA 2WOWA 1PBBA 1IUVA 1KNRA 2B9YA 2OAMA 5IQ1A 4K2XA 4CRTA 1VQWA 1TDNA 1TRBA 3QVPA 4OVIA 5U1OA 1QO8A 4UDPA 2WPEA 3B3RA 1D5TA 1JRZA 4X4JA 3RP7A 4A9WA 4YKGA 4Z2RA 3DK4A 2RGJA 4BK2A 1F6MA 1NHQA 3RP8A 4EQSA 1PJ5A 4EQWA 3AYJA 2A8XA 1O5WA 1BGJA 4J57A 4TM0A 4H4YA 5FS9A 3BHFA 2FJEA 3CGBA 2XCGA 2OA1A 1ZDLA 3P4PA 4USQA 2ARDA 4Z26A 2VRLA 3I6DA 4Z2TA 2BS4A 3BNUA 1H82A 4PAAA 2XVHA 2YM2A 3CNJA 4BV6A 2Z5XA 1GRFA 4EMWA 3HZLA 1GRBA 1GALA 3I3LA 4FK1A 1CHUA 2B7SA 1F8RA 3H8IA 3ICTA 2APGA 2RABA 4DSGA 1NG3A 3ALJA 4YSZA 2WU5A 1K4QA 1GXFA 2YR6A 3UKHA 3SQPA 1N4WA 3COXA 4M52A 4B67A 2VOUA 4UDQA 4NEVA 5GRTA 2RGOA 4CY8A 4YSYA 2VQ7A 5KRQA 4RG3A 2V60A 1E7PA 3P4SA 1JRXA 5DBJA 2V6OA 5JCKA 1EL7A 2QCUA 3DA1A 4GF7A 4IA6A 3C4NA 3IHMA 3KU9A 4H4WA 1IUXA 2BC1A 2XYOA 3OZ2A 3CGDA 1OJCA 3LOVA 4WX1A 3UOYA 1XHCA 3AD8B 4IVMB 1EL5A 4K5RA 1DOCA 4GR1A 3V76A 4ZN0A 3G5RA 3NK2X 2AR8A 2QAEA 4OPDA 1TYPA 3CPIG 4RSLA 4H4ZA 2VVLA 3GMCA 4U8PA 3QJ4A 2CDUA 5IQ4A 1GTHA 5JCLA 2XLSA 4A7AA 1O95A 5HY5A 2BCPA 1TDKA 2GRTA 1YQ3A 2Q0LA 1S2YA 2XLRA 3BI5A 4I59A 2R45A 4YKFA 1BWCA 2CULA 3VR8A 1UKVG 3QVRA 1CC6A 2JAEA 1Y56A 1GESA 2JB2A 1GNDA 3NN6X 2GAGB 3NNEA 1EL9A 1B5QA 2XFPA 4X9NA 4YTNA 1YQ4A 4OPCA 2YVJA 3FBSA 4TM1A 2PYXA 3CIRA 3SFDA 4C5OA 1LVLA 2BACA 3T37A 3IF9A 5KOXA 3GYJA 1GTEA 2IIDA 3NT6A 2B9XA 4AP1A 2XVEA 4K8DA 1OJTA 3R9UA 1QJDA 3QSMA 2VRMA 3NRNA 4B64A 3IC9A 1GRHA 5EBKA 1XPQA 3AYLA 2FJBA 1VRQB 3CPJG 1S2QA 2WP6A 3RP6A 3L1RA 1N1PA 4U8LA 1NHSA 2VZ2A 3FMWA 3D1CA 1NHPA 3RNMA 3JSKA 3UKAA 1L0VA 2VVMA 3NHOX 4D04A 1AOGA 2BS3A 4DSHA 1PHHA 4EQRA 4XWZA 2OLNA 2WOVA 2DKIA 5BUKA 4EIQA 3WE0A 3S5WA 3UP5A 3AWIA 3AEBA 1FL2A 3LB8A 1X31B 4MJWA 3CNDA 2A89A 2E1MA 3V3NA 3QSEA 4AP3A 1KF6A 3NTDA 2IVDA 3NTAA 1CJ4A 1KSUA 4HB9A 2JK6A 2O9ZA 4A5LA 2VQBA 4H2QA 1OJDA 4NEWA 5KVIA 3UKQA 2EQ9A 1F8SA 3URHA 3SFEA 1K0LA 1E1NA 4WCTA 3DK9A 2BXSA 1DOEA 1CC4A 2W0HA 4EQXA 4C3XA 1PJ6A 1V59A 2WBAA 4U2TA 4EMIA 2XVJA 5EB4A 1FEAA 4Y4LA 2AQJA 2WU2A 3RHAA 4APNA 1GOSA 1E39A 1IJHA 2IVEA 1DJQA 2OLOA 1DODA 1ZK7A 2Y6QA 2C3DA 3ABVA 4H4TA 5CQFA 2GAHB 2X50A 3AEEA 3DJJA 4C77A 1H86A 1F8WA 2WESA 2WETA 3AEDA 1ZKQA 2YR4A 1ZOYA 2GVCA 1FOHA 1QLBA 4FDCB 4CNKA 1RSGA 1PN0A 4NZHA 2C76A 2XLPA 1EBDA 3NK1X 1JEHA 2AAQA 2GMJA 2OALA 3ALMA 3AE1A 3AECA 3EPTA 3BI4A 4K5SA 4A99A 2WDQA 2WEUA 3IHGA 1M6IA 2BC0A 4OPTA 1GSNA 1H7WA 3OC4A 1O94A 4OCGA 1Q1RA 5BRTA 1D4CA 1Y56B 2Z5YA 5FS8A 2C75A 3UKFA 4LIIA 2JBVA 2B76A 2C73A 3AEFA 4GCMA 4YTMA 4ZCCA 4GDPA 2ACZA 2WOIA 1CJ3A 1N4VA 3GMBA 1MXTA 1IUWA 1DXLA 1E1KA 1K0JA 1NDAA 2GMHA 3SM8A 2CFYA 2YAUA 4EM4A 1PBDA 3AE5A 4H50A 2H89A 3BHKA 4EMJA 3K30A 3F8DA 2WHDA 2PHHA 2YG6A 2X8GA 2YVGA 4UP3A 3M0OA 3CNTA 3K7QX 2QA1A 2JB1A 4YTPA 2EQ7A 4J34A 4A6NA 2WS3A 4BK3A 4J33A 3LJPA 3KA7A 5C2TA 3CN8A 1NAAA 4H4PA 4CCRA 3P1WA 1DJNA 1DOBA 2XVIA 4X9MA 2Q0KA 3Q9TA 4D03A 2JB3A 4O5QA 4U8MA 2YG5A 1RP0A 1GRTA 2GV8A 2XDOA 2XLTA 1PXBA 4JNQA 4H4XA 3L8KA 3V3OA 4C74A 2GQFA 4H4QA 1P2HA 1Q9IA 1TDEA 3GDPA 1CBOA 2C70A 2EQ8A 4XWRA 1Q1WA 4Y4NA 1BZLA 2BABA 3ADAB 4ADWA 1LQTA 1GV4A 3D8XA 4GRTA 3UKLA 2EQ6A 4JY3A 4U2LA 2XFQA 4J36A 4GUVA 4U8JA 2FJAA 2YWLA 2BA9A 3ZYXA 5L46A 5ER0A 4BJYA 2YG7A 5LV9A 2WQYA 1ZMDA 3DMEA 1YQZA 4N9XA 1COYA 2GR0A 2GR3A 2R0PA 4CBQA 4DNAA 1IUSA 5U63A 2GR2A 3VRBA 3ICRA 2GH5A 3AE9A 1D7LA 3E1TA 5EB5A 5KXJA 2B7RA 3KPFA 5JCNA 3M13A 1ZOVA 1M64A 1ZX9A 3Q6JA 2R4EA 4Z2UA 4ECHA 4C3YA 3KKJA 4GDEA 3NGCX 5M10A 1F3PA 4NTCA 1OJ9A 5CKUA 3UTFA 4AT0A 1S3EA 3PVCA 1LJ1A 3C4AA 3NYFA 4U2SA 3UOXA 2ZZ0A 3NKSA 2BK5A 1ZY8A 2R46A 3ATRA 3NN0X 2A87A 4H2RA 4Z25A 2B9WA 3GYIA 4B69A
chains in the Genus database with same CATH superfamily
2E5VA 1E1LA 4PABA 5FS6A 4FX9A 4JQ9A 1H7XA 2ZBWA 1KDGA 2WP9A 3G5SA 4H4VA 3GYXA 4EIPA 3AEGA 2YM1A 4JY2A 5IPYA 3KPKA 2YG4A 1IUTA 2YQUA 3DK8A 4XXGA 1REOA 2I0ZA 3SGLA 1CC2A 4A65A 1MO9A 1B37A 2V5ZA 4KPRA 5HYMA 1GREA 1Y0PA 3VRDB 1VG0A 3HYVA 4Z43A 2BRYA 2ZZBA 3UCLA 2R0GA 2GEWA 3UOZA 4HA6A 2C67A 2E4GA 2YLZA 1XANA 1N4UA 1KNPA 5FMHA 3UOVA 4IA5A 3CMMA 3GRTA 4BJZA 4A6NB 1JU2A 2J3NA 3DGHA 5JCMA 3K7TA 3P9UA 4U8IA 1PS9A 3DH9A 4G6HA 2X99A 4CY6A 1PBEA 1GRGA 2GR1A 2TPRA 2XVFA 3EAOA 5KWFA 3II4A 2NPXA 4B66A 4OPGA 3ISHA 2C66A 2R4JA 1ONFA 4TM3A 3HYXA 1GEUA 4Z44A 2BXRA 3PO7A 5U25A 4H2PA 2F5ZA 3SZFA 2TMDA 3UKKA 3FG2P 3AE8A 1LV0A 4TM4A 1XDIA 4E0VA 1PBCA 4YT0A 4TLZA 3FIMB 3C96A 1PXCA 3UP4A 1E1MA 4FK1C 2Q6UA 2XFUA 4KX6A 5HXIA 3K7MX 1EL8A 3GSIA 1L9DA 2WDRA 2XFNA 2YLWA 1GPEA 4H2NA 3QFBA 2C3CA 4H4SA 4AOSA 3KVEA 4B63A 5KNLA 4A79A 4BK1A 4O5UA 5BULA 1E6EA 1K0IA 2C64A 3ALLA 4K7ZA 1GETA 4CCQA 3HYWA 5KOWA 1D4EA 4J2WA 3FPZA 3NIXA 2GF3A 3ZDNA 1H6VA 3DJGX 1HYUA 1NENA 2BK3A 3REDA 1BF3A 1ELIA 1FEBA 1D4DA 1JNRA 4YWOA 4B1BA 5J60A 4AOXA 3BI2A 3AE2A 4YSXA 1GT8A 1LTXR 1KFYA 2BYBA 3UKPA 4DGKA 3AE6A 3LZWA 1CL0A 4IV9A 3H4KA 3DJDA 4RG4A 1NPXA 2C72A 2X3NA 4I58A 1Z6LA 3EANA 4JN9A 3UTGA 2YLXA 4U8OA 2BCGG 1YY5A 3G5QA 4H7UA 4LA1A 3F8PA 5C3JA 1H81A 1TDOA 3DJEA 3ICSA 1OJAA 3IWAA 3UTHA 3VRAA 1MOKA 1SEZA 4P9SA 1TYTA 2GQWA 2WPCA 2HQMA 1VG9A 4J31A 4OPLA 4Y4MA 5TR3A 1D7YA 1VDCA 2DKHA 3PS9A 4OPIA 3SXIA 4B68A 4YXDA 5BVAA 4YSHA 4J56A 3NYCA 3VR9A 2GB0A 5FS7A 2CVJA 1NEKA 1P2EA 1H83A 1B8SA 1CJ2A 2BS2A 2Q7VA 3NLCA 3QSSA 2H88A 5EOWA 4AT2A 4B65A 1L9EA 3CGCA 2ZZCA 1PXAA 2WDVA 2UZZA 1PDHA 2VVLG 2XFOA 2V3AA 3KLJA 4NWZA 1IUUA 3LADA 4ICYA 3NYEA 4OPUA 5KVHA 4CNJA 1ZMCA 4TLXA 1W4XA 4H4RA 3CNPA 2YR5A 4K22A 3CTYA 2Y6RA 3AD9B 2R9ZA 3CNSA 3EF6A 3H8LA 3ITJA 1CJCA 3GWDA 3M12A 3S61A 1PBFA 3AXBA 3UTEA 1S3BA 2V61A 3GD3A 3NK0X 3NH3X 4BURA 1BGNA 3QFAA 2YLRA 3CPHG 5J7XA 1BKWA 3GWFA 3KD9A 2C65A 3LXDA 3P4QA 2BK4A 3NG7X 1FECA 3VQRA 5JCIA 3DGZA 1NG4A 4NTDA 4NTEA 1ZP0A 4LU6A 5M0ZA 2RGHA 2YG3A 2NVKX 3CGEA 4U8NA 1L9CA 1PJ7A 4EM3A 2WPFA 3AE4A 3GDNA 3LZXA 3AB1A 4U8KA 5HHFA 2FJDA 2QA2A 4Z24A 3AEAA 1JNZA 3T14A 3BNMA 3AYIA 1DNCA 4UDRA 2X8CA 4USRA 4JDRA 2YVFA 2YLSA 3O0HA 4H4UA 1CF3A 1TDFA 2YLTA 1JRYA 3F8RA 1LPFA 4JNAA 1NHRA 2R0CA 1GRAA 3ATQA 4REKA 2JKCA 1RYIA 1B4VA 4ZCDA 2C7GA 2X8HA 2V3BA 2XLUA 5GSNA 1YKJA 1FCDA 2FBWA 2WP5A 3B6DA 1GERA 1H84A 3AE3A 4IVOB 1LQUA 3GD4A 3P4RA 3GRSA 3AE7A 3AD7B 1KSSA 1JOAA 2WOWA 1PBBA 3SYIA 1IUVA 1KNRA 2B9YA 3SX6A 2OAMA 5IQ1A 4K2XA 4CRTA 1VQWA 1TDNA 1TRBA 3QVPA 4OVIA 5U1OA 1QO8A 4UDPA 2WPEA 3B3RA 1D5TA 1JRZA 4X4JA 3RP7A 4A9WA 4YKGA 4Z2RA 3DK4A 2RGJA 4BK2A 1F6MA 3SZCA 1NHQA 3RP8A 4EQSA 1PJ5A 4EQWA 3AYJA 2A8XA 1O5WA 1BGJA 4J57A 4TM0A 4H4YA 5FS9A 3BHFA 2FJEA 3CGBA 2XCGA 2OA1A 1ZDLA 3P4PA 4USQA 2ARDA 4Z26A 2VRLA 3I6DA 4Z2TA 2BS4A 3BNUA 1H82A 4PAAA 2XVHA 2YM2A 3CNJA 4BV6A 2Z5XA 1GRFA 4EMWA 3HZLA 1GRBA 1GALA 3I3LA 4FK1A 3T0KA 1CHUA 2B7SA 1F8RA 3H8IA 3ICTA 2APGA 2RABA 4DSGA 1NG3A 3ALJA 4YSZA 2WU5A 1K4QA 1GXFA 2YR6A 3UKHA 3SQPA 1N4WA 3COXA 4M52A 4B67A 2VOUA 4UDQA 4NEVA 5GRTA 2RGOA 4CY8A 4YSYA 2VQ7A 5KRQA 4RG3A 2V60A 1E7PA 3P4SA 1JRXA 5DBJA 2V6OA 5JCKA 1EL7A 2QCUA 3DA1A 4GF7A 4IA6A 3C4NA 3IHMA 3KU9A 4H4WA 1IUXA 2BC1A 2XYOA 3OZ2A 3CGDA 1OJCA 3LOVA 4WX1A 3UOYA 1XHCA 3AD8B 4IVMB 1EL5A 4K5RA 4NNJA 1DOCA 4GR1A 3V76A 4ZN0A 3G5RA 3NK2X 2AR8A 2QAEA 4OPDA 1TYPA 3CPIG 4GAVA 4RSLA 4H4ZA 2VVLA 3GMCA 4U8PA 3QJ4A 2CDUA 5IQ4A 1GTHA 5JCLA 2XLSA 4A7AA 1O95A 5HY5A 2BCPA 1TDKA 2GRTA 1YQ3A 2Q0LA 1S2YA 2XLRA 3BI5A 4I59A 3SZWA 2R45A 4YKFA 1BWCA 2CULA 3VR8A 1UKVG 3QVRA 1CC6A 2JAEA 1Y56A 1GESA 2JB2A 1GNDA 3NN6X 2GAGB 3NNEA 1EL9A 1B5QA 2XFPA 4X9NA 4YTNA 1YQ4A 4OPCA 2YVJA 3FBSA 4TM1A 2PYXA 3CIRA 3SFDA 4C5OA 1LVLA 2BACA 3T37A 3IF9A 5KOXA 3GYJA 1GTEA 2IIDA 3NT6A 2B9XA 4AP1A 2XVEA 4K8DA 1OJTA 5KMRA 3R9UA 1QJDA 3QSMA 2VRMA 3NRNA 4B64A 3IC9A 1GRHA 5EBKA 1XPQA 3AYLA 2FJBA 1VRQB 3CPJG 1S2QA 2WP6A 3RP6A 3L1RA 1N1PA 4U8LA 1NHSA 2VZ2A 4GAPA 3FMWA 3D1CA 1NHPA 3RNMA 3JSKA 3UKAA 1L0VA 2VVMA 3NHOX 4D04A 1AOGA 2BS3A 4DSHA 1PHHA 4G9KA 4XWZA 2OLNA 4EQRA 2WOVA 2DKIA 5BUKA 4EIQA 3WE0A 3S5WA 3UP5A 3AWIA 3AEBA 1FL2A 3LB8A 4G6GA 1X31B 4MJWA 3CNDA 2A89A 2E1MA 3V3NA 3QSEA 4AP3A 1KF6A 3NTDA 2IVDA 3NTAA 1CJ4A 1KSUA 4HB9A 2JK6A 2O9ZA 4A5LA 2VQBA 4H2QA 1OJDA 4NEWA 5KVIA 3UKQA 2EQ9A 1F8SA 3URHA 3SFEA 1K0LA 1E1NA 4WCTA 3DK9A 2BXSA 5KMPA 1DOEA 1CC4A 2W0HA 4EQXA 4C3XA 1PJ6A 1V59A 2WBAA 4U2TA 4EMIA 2XVJA 5EB4A 1FEAA 4Y4LA 2AQJA 2WU2A 3RHAA 4APNA 1GOSA 1E39A 1IJHA 2IVEA 1DJQA 2OLOA 1DODA 1ZK7A 2Y6QA 2C3DA 3ABVA 4H4TA 5CQFA 2GAHB 2X50A 3AEEA 3DJJA 4C77A 1H86A 1F8WA 2WESA 2WETA 3AEDA 1ZKQA 2YR4A 1ZOYA 2GVCA 1FOHA 1QLBA 4FDCB 4CNKA 1RSGA 1PN0A 4NZHA 2C76A 2XLPA 1EBDA 3NK1X 1JEHA 2AAQA 2GMJA 2OALA 3ALMA 3AE1A 3AECA 3EPTA 3BI4A 4K5SA 4A99A 4II2A 2WDQA 2WEUA 3IHGA 1M6IA 2BC0A 4OPTA 1GSNA 1H7WA 3SY4A 3OC4A 1O94A 4OCGA 1Q1RA 5BRTA 1D4CA 1Y56B 2Z5YA 5FS8A 2C75A 3UKFA 4LIIA 2JBVA 2B76A 2C73A 3AEFA 4GCMA 4YTMA 4ZCCA 4GDPA 2ACZA 2WOIA 1CJ3A 1N4VA 3GMBA 3T31A 1MXTA 1IUWA 1DXLA 1E1KA 1K0JA 1NDAA 2GMHA 3SM8A 2CFYA 2YAUA 4EM4A 1PBDA 3AE5A 4H50A 2H89A 3BHKA 4EMJA 3K30A 2BRAA 2WHDA 2PHHA 2YG6A 2X8GA 2YVGA 3F8DA 4UP3A 3M0OA 3CNTA 3K7QX 2QA1A 2JB1A 4YTPA 2EQ7A 4J34A 4A6NA 2WS3A 4G73A 4BK3A 4J33A 3LJPA 3KA7A 5C2TA 3CN8A 1NAAA 4H4PA 4CCRA 3P1WA 1DJNA 1DOBA 2XVIA 4X9MA 2Q0KA 3Q9TA 4D03A 2JB3A 4O5QA 4U8MA 2YG5A 1RP0A 1GRTA 2GV8A 2XDOA 2XLTA 1PXBA 4JNQA 4H4XA 4II3A 5KMQA 3L8KA 3V3OA 4C74A 2GQFA 4H4QA 1P2HA 1Q9IA 1TDEA 3GDPA 1CBOA 2C70A 2EQ8A 4XWRA 1Q1WA 4Y4NA 1BZLA 2BABA 3ADAB 4ADWA 1LQTA 1GV4A 3D8XA 4GRTA 3UKLA 2EQ6A 4JY3A 4U2LA 2XFQA 4J36A 4GUVA 4U8JA 2FJAA 2YWLA 2BA9A 3ZYXA 5L46A 2C4CA 3T2ZA 5ER0A 4BJYA 2YG7A 5LV9A 2WQYA 1ZMDA 3DMEA 1YQZA 4N9XA 1COYA 2GR0A 2GR3A 2R0PA 4CBQA 4DNAA 1IUSA 3T2YA 5U63A 2GR2A 3VRBA 3ICRA 2GH5A 3AE9A 1D7LA 3E1TA 5EB5A 5KXJA 2B7RA 3KPFA 4G74A 3M13A 5JCNA 1ZOVA 1M64A 3SZ0A 1ZX9A 3Q6JA 2R4EA 4Z2UA 4ECHA 4C3YA 3KKJA 4GDEA 3NGCX 5M10A 1F3PA 4NTCA 1OJ9A 5CKUA 3T2KA 3UTFA 4AT0A 1S3EA 3PVCA 5KMSA 1LJ1A 3C4AA 3NYFA 4U2SA 3UOXA 2ZZ0A 3NKSA 2BK5A 1ZY8A 2R46A 3ATRA 3NN0X 2A87A 4H2RA 4Z25A 2B9WA 3GYIA 4B69A
chains in the Genus database with same CATH topology
2E5VA 1E1LA 4PABA 5FS6A 4FX9A 4JQ9A 1H7XA 2ZBWA 1KDGA 2WP9A 3G5SA 4H4VA 3GYXA 4EIPA 3AEGA 2YM1A 4JY2A 5IPYA 3KPKA 2YG4A 1IUTA 2YQUA 3DK8A 4XXGA 1REOA 2I0ZA 3SGLA 1CC2A 4A65A 1MO9A 1B37A 2V5ZA 4KPRA 5HYMA 1GREA 1Y0PA 3VRDB 1VG0A 3HYVA 4Z43A 2BRYA 2ZZBA 3UCLA 2R0GA 2GEWA 3UOZA 4HA6A 2C67A 2E4GA 2YLZA 1XANA 1N4UA 1KNPA 5FMHA 3UOVA 4IA5A 3CMMA 3GRTA 4BJZA 4A6NB 1JU2A 2J3NA 3DGHA 5JCMA 3K7TA 3P9UA 4U8IA 1PS9A 3DH9A 4G6HA 2X99A 4CY6A 1PBEA 1GRGA 2GR1A 2TPRA 2XVFA 3EAOA 5KWFA 3II4A 2NPXA 4B66A 4OPGA 3ISHA 2C66A 2R4JA 1ONFA 4TM3A 3HYXA 1GEUA 4Z44A 2BXRA 3PO7A 5U25A 4H2PA 2F5ZA 3SZFA 2TMDA 3UKKA 3FG2P 3AE8A 1LV0A 4TM4A 1XDIA 4E0VA 1PBCA 4YT0A 4TLZA 3FIMB 3C96A 1PXCA 3UP4A 1E1MA 4FK1C 2Q6UA 2XFUA 4KX6A 5HXIA 3K7MX 1EL8A 3GSIA 1L9DA 2WDRA 2XFNA 2YLWA 1GPEA 4H2NA 3QFBA 2C3CA 4H4SA 4AOSA 3KVEA 4B63A 5KNLA 4A79A 4BK1A 4O5UA 5BULA 1E6EA 1K0IA 2C64A 3ALLA 4K7ZA 1GETA 4CCQA 3HYWA 5KOWA 1D4EA 4J2WA 3FPZA 3NIXA 2GF3A 3ZDNA 1H6VA 3DJGX 1HYUA 1NENA 2BK3A 3REDA 1BF3A 1ELIA 1FEBA 1D4DA 1JNRA 4YWOA 4B1BA 5J60A 4AOXA 3BI2A 3AE2A 4YSXA 1GT8A 1LTXR 1KFYA 2BYBA 3UKPA 4DGKA 3AE6A 3LZWA 1CL0A 4IV9A 3H4KA 3DJDA 4RG4A 1NPXA 2C72A 2X3NA 4I58A 1Z6LA 3EANA 4JN9A 3UTGA 2YLXA 4U8OA 2BCGG 1YY5A 3G5QA 4H7UA 4LA1A 3F8PA 5C3JA 1H81A 1TDOA 3DJEA 3ICSA 1OJAA 3IWAA 3UTHA 3VRAA 1MOKA 1SEZA 4P9SA 1TYTA 2GQWA 2WPCA 2HQMA 1VG9A 4J31A 4OPLA 4Y4MA 5TR3A 1D7YA 1VDCA 2DKHA 3PS9A 4OPIA 3SXIA 4B68A 4YXDA 5BVAA 4YSHA 4J56A 3NYCA 3VR9A 2GB0A 5FS7A 2CVJA 1NEKA 1P2EA 1H83A 1B8SA 1CJ2A 2BS2A 2Q7VA 3NLCA 3QSSA 2H88A 5EOWA 4AT2A 4B65A 1L9EA 3CGCA 2ZZCA 1PXAA 2WDVA 2UZZA 1PDHA 2VVLG 2XFOA 2V3AA 3KLJA 4NWZA 1IUUA 3LADA 4ICYA 3NYEA 4OPUA 5KVHA 4CNJA 1ZMCA 4TLXA 1W4XA 4H4RA 3CNPA 2YR5A 4K22A 3CTYA 2Y6RA 3AD9B 2R9ZA 3CNSA 3EF6A 3H8LA 3ITJA 1CJCA 3GWDA 3M12A 3S61A 1PBFA 3AXBA 3UTEA 1S3BA 2V61A 3GD3A 3NK0X 3NH3X 4BURA 1BGNA 3QFAA 2YLRA 3CPHG 5J7XA 1BKWA 3GWFA 3KD9A 2C65A 3LXDA 3P4QA 2BK4A 3NG7X 1FECA 3VQRA 5JCIA 3DGZA 1NG4A 4NTDA 4NTEA 1ZP0A 4LU6A 5M0ZA 2RGHA 2YG3A 2NVKX 3CGEA 4U8NA 1L9CA 1PJ7A 4EM3A 2WPFA 3AE4A 3GDNA 3LZXA 3AB1A 4U8KA 5HHFA 2FJDA 2QA2A 4Z24A 3AEAA 1JNZA 3T14A 3BNMA 3AYIA 1DNCA 4UDRA 2X8CA 4USRA 4JDRA 2YVFA 2YLSA 3O0HA 4H4UA 1CF3A 1TDFA 2YLTA 1JRYA 3F8RA 1LPFA 4JNAA 1NHRA 2R0CA 1GRAA 3ATQA 4REKA 2JKCA 1RYIA 1B4VA 4ZCDA 2C7GA 2X8HA 2V3BA 2XLUA 5GSNA 1YKJA 1FCDA 2FBWA 2WP5A 3B6DA 1GERA 1H84A 3AE3A 4IVOB 1LQUA 3GD4A 3P4RA 3GRSA 3AE7A 3AD7B 1KSSA 1JOAA 2WOWA 1PBBA 3SYIA 1IUVA 1KNRA 2B9YA 3SX6A 2OAMA 5IQ1A 4K2XA 4CRTA 1VQWA 1TDNA 1TRBA 3QVPA 4OVIA 5U1OA 1QO8A 4UDPA 2WPEA 3B3RA 1D5TA 1JRZA 4X4JA 3RP7A 4A9WA 4YKGA 4Z2RA 3DK4A 2RGJA 4BK2A 1F6MA 3SZCA 1NHQA 3RP8A 4EQSA 1PJ5A 4EQWA 3AYJA 2A8XA 1O5WA 1BGJA 4J57A 4TM0A 4H4YA 5FS9A 3BHFA 2FJEA 3CGBA 2XCGA 2OA1A 1ZDLA 3P4PA 4USQA 2ARDA 4Z26A 2VRLA 3I6DA 4Z2TA 2BS4A 3BNUA 1H82A 4PAAA 2XVHA 2YM2A 3CNJA 4BV6A 2Z5XA 1GRFA 4EMWA 3HZLA 1GRBA 1GALA 3I3LA 4FK1A 3T0KA 1CHUA 2B7SA 1F8RA 3H8IA 3ICTA 2APGA 2RABA 4DSGA 1NG3A 3ALJA 4YSZA 2WU5A 1K4QA 1GXFA 2YR6A 3UKHA 3SQPA 1N4WA 3COXA 4M52A 4B67A 2VOUA 4UDQA 4NEVA 5GRTA 2RGOA 4CY8A 4YSYA 2VQ7A 5KRQA 4RG3A 2V60A 1E7PA 3P4SA 1JRXA 5DBJA 2V6OA 5JCKA 1EL7A 2QCUA 3DA1A 4GF7A 4IA6A 3C4NA 3IHMA 3KU9A 4H4WA 1IUXA 2BC1A 2XYOA 3OZ2A 3CGDA 1OJCA 3LOVA 4WX1A 3UOYA 1XHCA 3AD8B 4IVMB 1EL5A 4K5RA 4NNJA 1DOCA 4GR1A 3V76A 4ZN0A 3G5RA 3NK2X 2AR8A 2QAEA 4OPDA 1TYPA 3CPIG 4GAVA 4RSLA 4H4ZA 2VVLA 3GMCA 4U8PA 3QJ4A 2CDUA 5IQ4A 1GTHA 5JCLA 2XLSA 4A7AA 1O95A 5HY5A 2BCPA 1TDKA 2GRTA 1YQ3A 2Q0LA 1S2YA 2XLRA 3BI5A 4I59A 3SZWA 2R45A 4YKFA 1BWCA 2CULA 3VR8A 1UKVG 3QVRA 1CC6A 2JAEA 1Y56A 1GESA 2JB2A 1GNDA 3NN6X 2GAGB 3NNEA 1EL9A 1B5QA 2XFPA 4X9NA 4YTNA 1YQ4A 4OPCA 2YVJA 3FBSA 4TM1A 2PYXA 3CIRA 3SFDA 4C5OA 1LVLA 2BACA 3T37A 3IF9A 5KOXA 3GYJA 1GTEA 2IIDA 3NT6A 2B9XA 4AP1A 2XVEA 4K8DA 1OJTA 5KMRA 3R9UA 1QJDA 3QSMA 2VRMA 3NRNA 4B64A 3IC9A 1GRHA 5EBKA 1XPQA 3AYLA 2FJBA 1VRQB 3CPJG 1S2QA 2WP6A 3RP6A 3L1RA 1N1PA 4U8LA 1NHSA 2VZ2A 4GAPA 3FMWA 3D1CA 1NHPA 3RNMA 3JSKA 3UKAA 1L0VA 2VVMA 3NHOX 4D04A 1AOGA 2BS3A 4DSHA 1PHHA 4G9KA 4XWZA 2OLNA 4EQRA 2WOVA 2DKIA 5BUKA 4EIQA 3WE0A 3S5WA 3UP5A 3AWIA 3AEBA 1FL2A 3LB8A 4G6GA 1X31B 4MJWA 3CNDA 2A89A 2E1MA 3V3NA 3QSEA 4AP3A 1KF6A 3NTDA 2IVDA 3NTAA 1CJ4A 1KSUA 4HB9A 2JK6A 2O9ZA 4A5LA 2VQBA 4H2QA 1OJDA 4NEWA 5KVIA 3UKQA 2EQ9A 1F8SA 3URHA 3SFEA 1K0LA 1E1NA 4WCTA 3DK9A 2BXSA 5KMPA 1DOEA 1CC4A 2W0HA 4EQXA 4C3XA 1PJ6A 1V59A 2WBAA 4U2TA 4EMIA 2XVJA 5EB4A 1FEAA 4Y4LA 2AQJA 2WU2A 3RHAA 4APNA 1GOSA 1E39A 1IJHA 2IVEA 1DJQA 2OLOA 1DODA 1ZK7A 2Y6QA 2C3DA 3ABVA 4H4TA 5CQFA 2GAHB 2X50A 3AEEA 3DJJA 4C77A 1H86A 1F8WA 2WESA 2WETA 3AEDA 1ZKQA 2YR4A 1ZOYA 2GVCA 1FOHA 1QLBA 4FDCB 4CNKA 1RSGA 1PN0A 4NZHA 2C76A 2XLPA 1EBDA 3NK1X 1JEHA 2AAQA 2GMJA 2OALA 3ALMA 3AE1A 3AECA 3EPTA 3BI4A 4K5SA 4A99A 4II2A 2WDQA 2WEUA 3IHGA 1M6IA 2BC0A 4OPTA 1GSNA 1H7WA 3SY4A 3OC4A 1O94A 4OCGA 1Q1RA 5BRTA 1D4CA 1Y56B 2Z5YA 5FS8A 2C75A 3UKFA 4LIIA 2JBVA 2B76A 2C73A 3AEFA 4GCMA 4YTMA 4ZCCA 4GDPA 2ACZA 2WOIA 1CJ3A 1N4VA 3GMBA 3T31A 1MXTA 1IUWA 1DXLA 1E1KA 1K0JA 1NDAA 2GMHA 3SM8A 2CFYA 2YAUA 4EM4A 1PBDA 3AE5A 4H50A 2H89A 3BHKA 4EMJA 3K30A 2BRAA 2WHDA 2PHHA 2YG6A 2X8GA 2YVGA 3F8DA 4UP3A 3M0OA 3CNTA 3K7QX 2QA1A 2JB1A 4YTPA 2EQ7A 4J34A 4A6NA 2WS3A 4G73A 4BK3A 4J33A 3LJPA 3KA7A 5C2TA 3CN8A 1NAAA 4H4PA 4CCRA 3P1WA 1DJNA 1DOBA 2XVIA 4X9MA 2Q0KA 3Q9TA 4D03A 2JB3A 4O5QA 4U8MA 2YG5A 1RP0A 1GRTA 2GV8A 2XDOA 2XLTA 1PXBA 4JNQA 4H4XA 4II3A 5KMQA 3L8KA 3V3OA 4C74A 2GQFA 4H4QA 1P2HA 1Q9IA 1TDEA 3GDPA 1CBOA 2C70A 2EQ8A 4XWRA 1Q1WA 4Y4NA 1BZLA 2BABA 3ADAB 4ADWA 1LQTA 1GV4A 3D8XA 4GRTA 3UKLA 2EQ6A 4JY3A 4U2LA 2XFQA 4J36A 4GUVA 4U8JA 2FJAA 2YWLA 2BA9A 3ZYXA 5L46A 2C4CA 3T2ZA 5ER0A 4BJYA 2YG7A 5LV9A 2WQYA 1ZMDA 3DMEA 1YQZA 4N9XA 1COYA 2GR0A 2GR3A 2R0PA 4CBQA 4DNAA 1IUSA 3T2YA 5U63A 2GR2A 3VRBA 3ICRA 2GH5A 3AE9A 1D7LA 3E1TA 5EB5A 5KXJA 2B7RA 3KPFA 4G74A 3M13A 5JCNA 1ZOVA 1M64A 3SZ0A 1ZX9A 3Q6JA 2R4EA 4Z2UA 4ECHA 4C3YA 3KKJA 4GDEA 3NGCX 5M10A 1F3PA 4NTCA 1OJ9A 5CKUA 3T2KA 3UTFA 4AT0A 1S3EA 3PVCA 5KMSA 1LJ1A 3C4AA 3NYFA 4U2SA 3UOXA 2ZZ0A 3NKSA 2BK5A 1ZY8A 2R46A 3ATRA 3NN0X 2A87A 4H2RA 4Z25A 2B9WA 3GYIA 4B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5V A;  1E1L A;  4PAB A;  5FS6 A;  4FX9 A;  4JQ9 A;  1H7X A;  2ZBW A;  1KDG A;  2WP9 A;  3G5S A;  4H4V A;  4EIP A;  3AEG A;  2YM1 A;  4JY2 A;  5IPY A;  2YG4 A;  1IUT A;  2YQU A;  3DK8 A;  4XXG A;  1REO A;  2I0Z A;  3SGL A;  1CC2 A;  4A65 A;  1MO9 A;  1B37 A;  2V5Z A;  4KPR A;  5HYM A;  1GRE A;  1Y0P A;  3VRD B;  1VG0 A;  4Z43 A;  2ZZB A;  3UCL A;  2R0G A;  2GEW A;  3UOZ A;  4HA6 A;  2C67 A;  2E4G A;  2YLZ A;  1XAN A;  1N4U A;  1KNP A;  5FMH A;  3UOV A;  4IA5 A;  3GRT A;  4BJZ A;  4A6N B;  1JU2 A;  2J3N A;  3DGH A;  5JCM A;  3K7T A;  3P9U A;  4U8I A;  1PS9 A;  3DH9 A;  2X99 A;  4CY6 A;  1PBE A;  1GRG A;  2GR1 A;  2TPR A;  2XVF A;  3EAO A;  5KWF A;  3II4 A;  2NPX A;  4B66 A;  4OPG A;  3ISH A;  2C66 A;  2R4J A;  1ONF A;  4TM3 A;  4Z44 A;  1GEU A;  5U25 A;  2BXR A;  3PO7 A;  4H2P A;  2F5Z A;  2TMD A;  3UKK A;  3FG2 P;  3AE8 A;  1LV0 A;  4TM4 A;  1XDI A;  4E0V A;  1PBC A;  4YT0 A;  4TLZ A;  3FIM B;  3C96 A;  1PXC A;  3UP4 A;  1E1M A;  4FK1 C;  2Q6U A;  2XFU A;  4KX6 A;  5HXI A;  3K7M X;  1EL8 A;  3GSI A;  1L9D A;  2WDR A;  2XFN A;  2YLW A;  1GPE A;  4H2N A;  3QFB A;  2C3C A;  4H4S A;  4AOS A;  3KVE A;  4B63 A;  4A79 A;  4BK1 A;  4O5U A;  5BUL A;  1E6E A;  1K0I A;  2C64 A;  3ALL A;  4K7Z A;  1GET A;  4CCQ A;  5KOW A;  1D4E A;  4J2W A;  3FPZ A;  3NIX A;  2GF3 A;  3ZDN A;  1H6V A;  3DJG X;  1HYU A;  1NEN A;  2BK3 A;  3RED A;  1BF3 A;  1ELI A;  1FEB A;  1D4D A;  1JNR A;  4YWO A;  4B1B A;  5J60 A;  4AOX A;  3BI2 A;  3AE2 A;  4YSX A;  1GT8 A;  1LTX R;  1KFY A;  2BYB A;  3UKP A;  4DGK A;  3AE6 A;  3LZW A;  1CL0 A;  4IV9 A;  3H4K A;  3DJD A;  4RG4 A;  1NPX A;  2C72 A;  2X3N A;  4I58 A;  1Z6L A;  3EAN A;  4JN9 A;  3UTG A;  2YLX A;  4U8O A;  2BCG G;  1YY5 A;  3G5Q A;  4H7U A;  4LA1 A;  3F8P A;  5C3J A;  1H81 A;  1TDO A;  3DJE A;  3ICS A;  1OJA A;  3IWA A;  3UTH A;  3VRA A;  1MOK A;  1SEZ A;  4P9S A;  1TYT A;  2GQW A;  2WPC A;  2HQM A;  1VG9 A;  4J31 A;  4OPL A;  4Y4M A;  5TR3 A;  1D7Y A;  1VDC A;  2DKH A;  3PS9 A;  4OPI A;  4B68 A;  4YXD A;  5BVA A;  4YSH A;  4J56 A;  3NYC A;  3VR9 A;  2GB0 A;  5FS7 A;  2CVJ A;  1NEK A;  1P2E A;  1H83 A;  1B8S A;  1CJ2 A;  2BS2 A;  2Q7V A;  3NLC A;  3QSS A;  2H88 A;  5EOW A;  4AT2 A;  4B65 A;  1L9E A;  3CGC A;  2ZZC A;  1PXA A;  2WDV A;  2UZZ A;  1PDH A;  2VVL G;  2XFO A;  2V3A A;  3KLJ A;  1IUU A;  3LAD A;  4ICY A;  3NYE A;  4OPU A;  5KVH A;  4CNJ A;  1ZMC A;  4TLX A;  1W4X A;  4H4R A;  3CNP A;  2YR5 A;  4K22 A;  3CTY A;  2Y6R A;  3AD9 B;  2R9Z A;  3CNS A;  3EF6 A;  3H8L A;  3ITJ A;  1CJC A;  3GWD A;  3M12 A;  3S61 A;  1PBF A;  3AXB A;  3UTE A;  1S3B A;  2V61 A;  3GD3 A;  3NK0 X;  3NH3 X;  4BUR A;  1BGN A;  3QFA A;  2YLR A;  3CPH G;  5J7X A;  1BKW A;  3GWF A;  3KD9 A;  2C65 A;  3LXD A;  3P4Q A;  2BK4 A;  3NG7 X;  1FEC A;  3VQR A;  5JCI A;  3DGZ A;  1NG4 A;  4NTD A;  4NTE A;  1ZP0 A;  4LU6 A;  5M0Z A;  2RGH A;  2YG3 A;  2NVK X;  3CGE A;  4U8N A;  1L9C A;  1PJ7 A;  4EM3 A;  2WPF A;  3AE4 A;  3GDN A;  3LZX A;  3AB1 A;  4U8K A;  5HHF A;  2FJD A;  2QA2 A;  4Z24 A;  3AEA A;  1JNZ A;  3BNM A;  3AYI A;  1DNC A;  4UDR A;  2X8C A;  4USR A;  4JDR A;  2YVF A;  2YLS A;  3O0H A;  4H4U A;  1CF3 A;  1TDF A;  2YLT A;  1JRY A;  3F8R A;  1LPF A;  4JNA A;  1NHR A;  2R0C A;  1GRA A;  3ATQ A;  4REK A;  2JKC A;  1RYI A;  1B4V A;  4ZCD A;  2C7G A;  2X8H A;  2V3B A;  2XLU A;  5GSN A;  1YKJ A;  1FCD A;  2FBW A;  2WP5 A;  3B6D A;  1GER A;  1H84 A;  3AE3 A;  4IVO B;  1LQU A;  3GD4 A;  3P4R A;  3GRS A;  3AE7 A;  3AD7 B;  1KSS A;  1JOA A;  2WOW A;  1PBB A;  1IUV A;  1KNR A;  2B9Y A;  2OAM A;  5IQ1 A;  4K2X A;  4CRT A;  1VQW A;  1TDN A;  1TRB A;  3QVP A;  4OVI A;  5U1O A;  1QO8 A;  4UDP A;  2WPE A;  3B3R A;  1D5T A;  1JRZ A;  4X4J A;  3RP7 A;  4A9W A;  4YKG A;  4Z2R A;  3DK4 A;  2RGJ A;  4BK2 A;  1F6M A;  1NHQ A;  3RP8 A;  4EQS A;  1PJ5 A;  4EQW A;  3AYJ A;  2A8X A;  1O5W A;  1BGJ A;  4J57 A;  4TM0 A;  4H4Y A;  5FS9 A;  3BHF A;  2FJE A;  3CGB A;  2XCG A;  2OA1 A;  1ZDL A;  3P4P A;  4USQ A;  2ARD A;  4Z26 A;  2VRL A;  3I6D A;  4Z2T A;  2BS4 A;  3BNU A;  1H82 A;  4PAA A;  2XVH A;  2YM2 A;  3CNJ A;  4BV6 A;  2Z5X A;  1GRF A;  4EMW A;  3HZL A;  1GRB A;  1GAL A;  3I3L A;  4FK1 A;  1CHU A;  2B7S A;  1F8R A;  3H8I A;  3ICT A;  2APG A;  2RAB A;  4DSG A;  1NG3 A;  3ALJ A;  4YSZ A;  2WU5 A;  1K4Q A;  1GXF A;  2YR6 A;  3UKH A;  3SQP A;  1N4W A;  3COX A;  4M52 A;  4B67 A;  2VOU A;  4UDQ A;  4NEV A;  5GRT A;  2RGO A;  4CY8 A;  4YSY A;  2VQ7 A;  5KRQ A;  4RG3 A;  2V60 A;  1E7P A;  3P4S A;  1JRX A;  5DBJ A;  2V6O A;  5JCK A;  1EL7 A;  2QCU A;  3DA1 A;  4GF7 A;  4IA6 A;  3C4N A;  3IHM A;  3KU9 A;  4H4W A;  1IUX A;  2BC1 A;  2XYO A;  3OZ2 A;  3CGD A;  1OJC A;  3LOV A;  4WX1 A;  3UOY A;  1XHC A;  3AD8 B;  4IVM B;  1EL5 A;  4K5R A;  1DOC A;  4GR1 A;  3V76 A;  4ZN0 A;  3G5R A;  3NK2 X;  2AR8 A;  2QAE A;  4OPD A;  1TYP A;  3CPI G;  4RSL A;  4H4Z A;  2VVL A;  3GMC A;  4U8P A;  3QJ4 A;  2CDU A;  5IQ4 A;  1GTH A;  5JCL A;  2XLS A;  4A7A A;  1O95 A;  5HY5 A;  2BCP A;  1TDK A;  2GRT A;  1YQ3 A;  2Q0L A;  1S2Y A;  2XLR A;  3BI5 A;  4I59 A;  2R45 A;  4YKF A;  1BWC A;  2CUL A;  3VR8 A;  1UKV G;  3QVR A;  1CC6 A;  2JAE A;  1Y56 A;  1GES A;  2JB2 A;  1GND A;  3NN6 X;  2GAG B;  3NNE A;  1EL9 A;  1B5Q A;  2XFP A;  4X9N A;  4YTN A;  1YQ4 A;  4OPC A;  2YVJ A;  3FBS A;  4TM1 A;  2PYX A;  3CIR A;  3SFD A;  4C5O A;  1LVL A;  2BAC A;  3T37 A;  3IF9 A;  5KOX A;  3GYJ A;  1GTE A;  2IID A;  3NT6 A;  2B9X A;  4AP1 A;  2XVE A;  4K8D A;  1OJT A;  3R9U A;  1QJD A;  3QSM A;  2VRM A;  3NRN A;  4B64 A;  3IC9 A;  1GRH A;  5EBK A;  1XPQ A;  3AYL A;  2FJB A;  1VRQ B;  3CPJ G;  1S2Q A;  2WP6 A;  3RP6 A;  3L1R A;  1N1P A;  4U8L A;  1NHS A;  2VZ2 A;  3FMW A;  3D1C A;  1NHP A;  3RNM A;  3JSK A;  3UKA A;  1L0V A;  2VVM A;  3NHO X;  4D04 A;  1AOG A;  2BS3 A;  4DSH A;  1PHH A;  4EQR A;  4XWZ A;  2OLN A;  2WOV A;  2DKI A;  5BUK A;  4EIQ A;  3WE0 A;  3S5W A;  3UP5 A;  3AWI A;  3AEB A;  1FL2 A;  3LB8 A;  1X31 B;  4MJW A;  3CND A;  2A89 A;  2E1M A;  3V3N A;  3QSE A;  4AP3 A;  1KF6 A;  3NTD A;  2IVD A;  3NTA A;  1CJ4 A;  1KSU A;  4HB9 A;  2JK6 A;  2O9Z A;  4A5L A;  2VQB A;  4H2Q A;  1OJD A;  4NEW A;  5KVI A;  3UKQ A;  2EQ9 A;  1F8S A;  3URH A;  3SFE A;  1K0L A;  1E1N A;  4WCT A;  3DK9 A;  2BXS A;  1DOE A;  1CC4 A;  2W0H A;  4EQX A;  4C3X A;  1PJ6 A;  1V59 A;  2WBA A;  4U2T A;  4EMI A;  2XVJ A;  5EB4 A;  1FEA A;  4Y4L A;  2AQJ A;  2WU2 A;  3RHA A;  4APN A;  1GOS A;  1E39 A;  1IJH A;  2IVE A;  1DJQ A;  2OLO A;  1DOD A;  1ZK7 A;  2Y6Q A;  2C3D A;  3ABV A;  4H4T A;  5CQF A;  2GAH B;  2X50 A;  3AEE A;  3DJJ A;  4C77 A;  1H86 A;  1F8W A;  2WES A;  2WET A;  3AED A;  1ZKQ A;  2YR4 A;  1ZOY A;  2GVC A;  1FOH A;  1QLB A;  4FDC B;  4CNK A;  1RSG A;  1PN0 A;  4NZH A;  2C76 A;  2XLP A;  1EBD A;  3NK1 X;  1JEH A;  2AAQ A;  2GMJ A;  2OAL A;  3ALM A;  3AE1 A;  3AEC A;  3EPT A;  3BI4 A;  4K5S A;  4A99 A;  2WDQ A;  2WEU A;  3IHG A;  1M6I A;  2BC0 A;  4OPT A;  1GSN A;  1H7W A;  3OC4 A;  1O94 A;  4OCG A;  1Q1R A;  5BRT A;  1D4C A;  1Y56 B;  2Z5Y A;  5FS8 A;  2C75 A;  3UKF A;  4LII A;  2JBV A;  2B76 A;  2C73 A;  3AEF A;  4GCM A;  4YTM A;  4ZCC A;  4GDP A;  2ACZ A;  2WOI A;  1CJ3 A;  1N4V A;  3GMB A;  1MXT A;  1IUW A;  1DXL A;  1E1K A;  1K0J A;  1NDA A;  2GMH A;  3SM8 A;  2CFY A;  2YAU A;  4EM4 A;  1PBD A;  3AE5 A;  4H50 A;  2H89 A;  3BHK A;  4EMJ A;  3K30 A;  3F8D A;  2WHD A;  2PHH A;  2YG6 A;  2X8G A;  2YVG A;  4UP3 A;  3M0O A;  3CNT A;  3K7Q X;  2QA1 A;  2JB1 A;  4YTP A;  2EQ7 A;  4J34 A;  4A6N A;  2WS3 A;  4BK3 A;  4J33 A;  3LJP A;  3KA7 A;  5C2T A;  3CN8 A;  1NAA A;  4H4P A;  4CCR A;  3P1W A;  1DJN A;  1DOB A;  2XVI A;  4X9M A;  2Q0K A;  3Q9T A;  4D03 A;  2JB3 A;  4O5Q A;  4U8M A;  2YG5 A;  1RP0 A;  1GRT A;  2GV8 A;  2XDO A;  2XLT A;  1PXB A;  4JNQ A;  4H4X A;  3L8K A;  3V3O A;  4C74 A;  2GQF A;  4H4Q A;  1P2H A;  1Q9I A;  1TDE A;  3GDP A;  1CBO A;  2C70 A;  2EQ8 A;  4XWR A;  1Q1W A;  4Y4N A;  1BZL A;  2BAB A;  3ADA B;  4ADW A;  1LQT A;  1GV4 A;  3D8X A;  4GRT A;  3UKL A;  2EQ6 A;  4JY3 A;  4U2L A;  2XFQ A;  4J36 A;  4GUV A;  4U8J A;  2FJA A;  2YWL A;  2BA9 A;  3ZYX A;  5L46 A;  5ER0 A;  4BJY A;  2YG7 A;  5LV9 A;  2WQY A;  1ZMD A;  3DME A;  1YQZ A;  4N9X A;  1COY A;  2GR0 A;  2GR3 A;  2R0P A;  4CBQ A;  4DNA A;  1IUS A;  5U63 A;  2GR2 A;  3VRB A;  3ICR A;  2GH5 A;  3AE9 A;  1D7L A;  3E1T A;  5EB5 A;  5KXJ A;  2B7R A;  3KPF A;  5JCN A;  3M13 A;  1ZOV A;  1M64 A;  1ZX9 A;  3Q6J A;  2R4E A;  4Z2U A;  4ECH A;  4C3Y A;  3KKJ A;  4GDE A;  3NGC X;  5M10 A;  1F3P A;  4NTC A;  1OJ9 A;  5CKU A;  3UTF A;  4AT0 A;  1S3E A;  3PVC A;  1LJ1 A;  3C4A A;  3NYF A;  4U2S A;  3UOX A;  2ZZ0 A;  3NKS A;  2BK5 A;  1ZY8 A;  2R46 A;  3ATR A;  3NN0 X;  2A87 A;  4H2R A;  4Z25 A;  2B9W A;  3GYI A;  4B69 A; 
#chains in the Genus database with same CATH topology
 2E5V A;  1E1L A;  4PAB A;  5FS6 A;  4FX9 A;  4JQ9 A;  1H7X A;  2ZBW A;  1KDG A;  2WP9 A;  3G5S A;  4H4V A;  3GYX A;  4EIP A;  3AEG A;  2YM1 A;  4JY2 A;  5IPY A;  3KPK A;  2YG4 A;  1IUT A;  2YQU A;  3DK8 A;  4XXG A;  1REO A;  2I0Z A;  3SGL A;  1CC2 A;  4A65 A;  1MO9 A;  1B37 A;  2V5Z A;  4KPR A;  5HYM A;  1GRE A;  1Y0P A;  3VRD B;  1VG0 A;  3HYV A;  4Z43 A;  2BRY A;  2ZZB A;  3UCL A;  2R0G A;  2GEW A;  3UOZ A;  4HA6 A;  2C67 A;  2E4G A;  2YLZ A;  1XAN A;  1N4U A;  1KNP A;  5FMH A;  3UOV A;  4IA5 A;  3CMM A;  3GRT A;  4BJZ A;  4A6N B;  1JU2 A;  2J3N A;  3DGH A;  5JCM A;  3K7T A;  3P9U A;  4U8I A;  1PS9 A;  3DH9 A;  4G6H A;  2X99 A;  4CY6 A;  1PBE A;  1GRG A;  2GR1 A;  2TPR A;  2XVF A;  3EAO A;  5KWF A;  3II4 A;  2NPX A;  4B66 A;  4OPG A;  3ISH A;  2C66 A;  2R4J A;  1ONF A;  4TM3 A;  3HYX A;  1GEU A;  4Z44 A;  2BXR A;  3PO7 A;  5U25 A;  4H2P A;  2F5Z A;  3SZF A;  2TMD A;  3UKK A;  3FG2 P;  3AE8 A;  1LV0 A;  4TM4 A;  1XDI A;  4E0V A;  1PBC A;  4YT0 A;  4TLZ A;  3FIM B;  3C96 A;  1PXC A;  3UP4 A;  1E1M A;  4FK1 C;  2Q6U A;  2XFU A;  4KX6 A;  5HXI A;  3K7M X;  1EL8 A;  3GSI A;  1L9D A;  2WDR A;  2XFN A;  2YLW A;  1GPE A;  4H2N A;  3QFB A;  2C3C A;  4H4S A;  4AOS A;  3KVE A;  4B63 A;  5KNL A;  4A79 A;  4BK1 A;  4O5U A;  5BUL A;  1E6E A;  1K0I A;  2C64 A;  3ALL A;  4K7Z A;  1GET A;  4CCQ A;  3HYW A;  5KOW A;  1D4E A;  4J2W A;  3FPZ A;  3NIX A;  2GF3 A;  3ZDN A;  1H6V A;  3DJG X;  1HYU A;  1NEN A;  2BK3 A;  3RED A;  1BF3 A;  1ELI A;  1FEB A;  1D4D A;  1JNR A;  4YWO A;  4B1B A;  5J60 A;  4AOX A;  3BI2 A;  3AE2 A;  4YSX A;  1GT8 A;  1LTX R;  1KFY A;  2BYB A;  3UKP A;  4DGK A;  3AE6 A;  3LZW A;  1CL0 A;  4IV9 A;  3H4K A;  3DJD A;  4RG4 A;  1NPX A;  2C72 A;  2X3N A;  4I58 A;  1Z6L A;  3EAN A;  4JN9 A;  3UTG A;  2YLX A;  4U8O A;  2BCG G;  1YY5 A;  3G5Q A;  4H7U A;  4LA1 A;  3F8P A;  5C3J A;  1H81 A;  1TDO A;  3DJE A;  3ICS A;  1OJA A;  3IWA A;  3UTH A;  3VRA A;  1MOK A;  1SEZ A;  4P9S A;  1TYT A;  2GQW A;  2WPC A;  2HQM A;  1VG9 A;  4J31 A;  4OPL A;  4Y4M A;  5TR3 A;  1D7Y A;  1VDC A;  2DKH A;  3PS9 A;  4OPI A;  3SXI A;  4B68 A;  4YXD A;  5BVA A;  4YSH A;  4J56 A;  3NYC A;  3VR9 A;  2GB0 A;  5FS7 A;  2CVJ A;  1NEK A;  1P2E A;  1H83 A;  1B8S A;  1CJ2 A;  2BS2 A;  2Q7V A;  3NLC A;  3QSS A;  2H88 A;  5EOW A;  4AT2 A;  4B65 A;  1L9E A;  3CGC A;  2ZZC A;  1PXA A;  2WDV A;  2UZZ A;  1PDH A;  2VVL G;  2XFO A;  2V3A A;  3KLJ A;  4NWZ A;  1IUU A;  3LAD A;  4ICY A;  3NYE A;  4OPU A;  5KVH A;  4CNJ A;  1ZMC A;  4TLX A;  1W4X A;  4H4R A;  3CNP A;  2YR5 A;  4K22 A;  3CTY A;  2Y6R A;  3AD9 B;  2R9Z A;  3CNS A;  3EF6 A;  3H8L A;  3ITJ A;  1CJC A;  3GWD A;  3M12 A;  3S61 A;  1PBF A;  3AXB A;  3UTE A;  1S3B A;  2V61 A;  3GD3 A;  3NK0 X;  3NH3 X;  4BUR A;  1BGN A;  3QFA A;  2YLR A;  3CPH G;  5J7X A;  1BKW A;  3GWF A;  3KD9 A;  2C65 A;  3LXD A;  3P4Q A;  2BK4 A;  3NG7 X;  1FEC A;  3VQR A;  5JCI A;  3DGZ A;  1NG4 A;  4NTD A;  4NTE A;  1ZP0 A;  4LU6 A;  5M0Z A;  2RGH A;  2YG3 A;  2NVK X;  3CGE A;  4U8N A;  1L9C A;  1PJ7 A;  4EM3 A;  2WPF A;  3AE4 A;  3GDN A;  3LZX A;  3AB1 A;  4U8K A;  5HHF A;  2FJD A;  2QA2 A;  4Z24 A;  3AEA A;  1JNZ A;  3T14 A;  3BNM A;  3AYI A;  1DNC A;  4UDR A;  2X8C A;  4USR A;  4JDR A;  2YVF A;  2YLS A;  3O0H A;  4H4U A;  1CF3 A;  1TDF A;  2YLT A;  1JRY A;  3F8R A;  1LPF A;  4JNA A;  1NHR A;  2R0C A;  1GRA A;  3ATQ A;  4REK A;  2JKC A;  1RYI A;  1B4V A;  4ZCD A;  2C7G A;  2X8H A;  2V3B A;  2XLU A;  5GSN A;  1YKJ A;  1FCD A;  2FBW A;  2WP5 A;  3B6D A;  1GER A;  1H84 A;  3AE3 A;  4IVO B;  1LQU A;  3GD4 A;  3P4R A;  3GRS A;  3AE7 A;  3AD7 B;  1KSS A;  1JOA A;  2WOW A;  1PBB A;  3SYI A;  1IUV A;  1KNR A;  2B9Y A;  3SX6 A;  2OAM A;  5IQ1 A;  4K2X A;  4CRT A;  1VQW A;  1TDN A;  1TRB A;  3QVP A;  4OVI A;  5U1O A;  1QO8 A;  4UDP A;  2WPE A;  3B3R A;  1D5T A;  1JRZ A;  4X4J A;  3RP7 A;  4A9W A;  4YKG A;  4Z2R A;  3DK4 A;  2RGJ A;  4BK2 A;  1F6M A;  3SZC A;  1NHQ A;  3RP8 A;  4EQS A;  1PJ5 A;  4EQW A;  3AYJ A;  2A8X A;  1O5W A;  1BGJ A;  4J57 A;  4TM0 A;  4H4Y A;  5FS9 A;  3BHF A;  2FJE A;  3CGB A;  2XCG A;  2OA1 A;  1ZDL A;  3P4P A;  4USQ A;  2ARD A;  4Z26 A;  2VRL A;  3I6D A;  4Z2T A;  2BS4 A;  3BNU A;  1H82 A;  4PAA A;  2XVH A;  2YM2 A;  3CNJ A;  4BV6 A;  2Z5X A;  1GRF A;  4EMW A;  3HZL A;  1GRB A;  1GAL A;  3I3L A;  4FK1 A;  3T0K A;  1CHU A;  2B7S A;  1F8R A;  3H8I A;  3ICT A;  2APG A;  2RAB A;  4DSG A;  1NG3 A;  3ALJ A;  4YSZ A;  2WU5 A;  1K4Q A;  1GXF A;  2YR6 A;  3UKH A;  3SQP A;  1N4W A;  3COX A;  4M52 A;  4B67 A;  2VOU A;  4UDQ A;  4NEV A;  5GRT A;  2RGO A;  4CY8 A;  4YSY A;  2VQ7 A;  5KRQ A;  4RG3 A;  2V60 A;  1E7P A;  3P4S A;  1JRX A;  5DBJ A;  2V6O A;  5JCK A;  1EL7 A;  2QCU A;  3DA1 A;  4GF7 A;  4IA6 A;  3C4N A;  3IHM A;  3KU9 A;  4H4W A;  1IUX A;  2BC1 A;  2XYO A;  3OZ2 A;  3CGD A;  1OJC A;  3LOV A;  4WX1 A;  3UOY A;  1XHC A;  3AD8 B;  4IVM B;  1EL5 A;  4K5R A;  4NNJ A;  1DOC A;  4GR1 A;  3V76 A;  4ZN0 A;  3G5R A;  3NK2 X;  2AR8 A;  2QAE A;  4OPD A;  1TYP A;  3CPI G;  4GAV A;  4RSL A;  4H4Z A;  2VVL A;  3GMC A;  4U8P A;  3QJ4 A;  2CDU A;  5IQ4 A;  1GTH A;  5JCL A;  2XLS A;  4A7A A;  1O95 A;  5HY5 A;  2BCP A;  1TDK A;  2GRT A;  1YQ3 A;  2Q0L A;  1S2Y A;  2XLR A;  3BI5 A;  4I59 A;  3SZW A;  2R45 A;  4YKF A;  1BWC A;  2CUL A;  3VR8 A;  1UKV G;  3QVR A;  1CC6 A;  2JAE A;  1Y56 A;  1GES A;  2JB2 A;  1GND A;  3NN6 X;  2GAG B;  3NNE A;  1EL9 A;  1B5Q A;  2XFP A;  4X9N A;  4YTN A;  1YQ4 A;  4OPC A;  2YVJ A;  3FBS A;  4TM1 A;  2PYX A;  3CIR A;  3SFD A;  4C5O A;  1LVL A;  2BAC A;  3T37 A;  3IF9 A;  5KOX A;  3GYJ A;  1GTE A;  2IID A;  3NT6 A;  2B9X A;  4AP1 A;  2XVE A;  4K8D A;  1OJT A;  5KMR A;  3R9U A;  1QJD A;  3QSM A;  2VRM A;  3NRN A;  4B64 A;  3IC9 A;  1GRH A;  5EBK A;  1XPQ A;  3AYL A;  2FJB A;  1VRQ B;  3CPJ G;  1S2Q A;  2WP6 A;  3RP6 A;  3L1R A;  1N1P A;  4U8L A;  1NHS A;  2VZ2 A;  4GAP A;  3FMW A;  3D1C A;  1NHP A;  3RNM A;  3JSK A;  3UKA A;  1L0V A;  2VVM A;  3NHO X;  4D04 A;  1AOG A;  2BS3 A;  4DSH A;  1PHH A;  4G9K A;  4XWZ A;  2OLN A;  4EQR A;  2WOV A;  2DKI A;  5BUK A;  4EIQ A;  3WE0 A;  3S5W A;  3UP5 A;  3AWI A;  3AEB A;  1FL2 A;  3LB8 A;  4G6G A;  1X31 B;  4MJW A;  3CND A;  2A89 A;  2E1M A;  3V3N A;  3QSE A;  4AP3 A;  1KF6 A;  3NTD A;  2IVD A;  3NTA A;  1CJ4 A;  1KSU A;  4HB9 A;  2JK6 A;  2O9Z A;  4A5L A;  2VQB A;  4H2Q A;  1OJD A;  4NEW A;  5KVI A;  3UKQ A;  2EQ9 A;  1F8S A;  3URH A;  3SFE A;  1K0L A;  1E1N A;  4WCT A;  3DK9 A;  2BXS A;  5KMP A;  1DOE A;  1CC4 A;  2W0H A;  4EQX A;  4C3X A;  1PJ6 A;  1V59 A;  2WBA A;  4U2T A;  4EMI A;  2XVJ A;  5EB4 A;  1FEA A;  4Y4L A;  2AQJ A;  2WU2 A;  3RHA A;  4APN A;  1GOS A;  1E39 A;  1IJH A;  2IVE A;  1DJQ A;  2OLO A;  1DOD A;  1ZK7 A;  2Y6Q A;  2C3D A;  3ABV A;  4H4T A;  5CQF A;  2GAH B;  2X50 A;  3AEE A;  3DJJ A;  4C77 A;  1H86 A;  1F8W A;  2WES A;  2WET A;  3AED A;  1ZKQ A;  2YR4 A;  1ZOY A;  2GVC A;  1FOH A;  1QLB A;  4FDC B;  4CNK A;  1RSG A;  1PN0 A;  4NZH A;  2C76 A;  2XLP A;  1EBD A;  3NK1 X;  1JEH A;  2AAQ A;  2GMJ A;  2OAL A;  3ALM A;  3AE1 A;  3AEC A;  3EPT A;  3BI4 A;  4K5S A;  4A99 A;  4II2 A;  2WDQ A;  2WEU A;  3IHG A;  1M6I A;  2BC0 A;  4OPT A;  1GSN A;  1H7W A;  3SY4 A;  3OC4 A;  1O94 A;  4OCG A;  1Q1R A;  5BRT A;  1D4C A;  1Y56 B;  2Z5Y A;  5FS8 A;  2C75 A;  3UKF A;  4LII A;  2JBV A;  2B76 A;  2C73 A;  3AEF A;  4GCM A;  4YTM A;  4ZCC A;  4GDP A;  2ACZ A;  2WOI A;  1CJ3 A;  1N4V A;  3GMB A;  3T31 A;  1MXT A;  1IUW A;  1DXL A;  1E1K A;  1K0J A;  1NDA A;  2GMH A;  3SM8 A;  2CFY A;  2YAU A;  4EM4 A;  1PBD A;  3AE5 A;  4H50 A;  2H89 A;  3BHK A;  4EMJ A;  3K30 A;  2BRA A;  2WHD A;  2PHH A;  2YG6 A;  2X8G A;  2YVG A;  3F8D A;  4UP3 A;  3M0O A;  3CNT A;  3K7Q X;  2QA1 A;  2JB1 A;  4YTP A;  2EQ7 A;  4J34 A;  4A6N A;  2WS3 A;  4G73 A;  4BK3 A;  4J33 A;  3LJP A;  3KA7 A;  5C2T A;  3CN8 A;  1NAA A;  4H4P A;  4CCR A;  3P1W A;  1DJN A;  1DOB A;  2XVI A;  4X9M A;  2Q0K A;  3Q9T A;  4D03 A;  2JB3 A;  4O5Q A;  4U8M A;  2YG5 A;  1RP0 A;  1GRT A;  2GV8 A;  2XDO A;  2XLT A;  1PXB A;  4JNQ A;  4H4X A;  4II3 A;  5KMQ A;  3L8K A;  3V3O A;  4C74 A;  2GQF A;  4H4Q A;  1P2H A;  1Q9I A;  1TDE A;  3GDP A;  1CBO A;  2C70 A;  2EQ8 A;  4XWR A;  1Q1W A;  4Y4N A;  1BZL A;  2BAB A;  3ADA B;  4ADW A;  1LQT A;  1GV4 A;  3D8X A;  4GRT A;  3UKL A;  2EQ6 A;  4JY3 A;  4U2L A;  2XFQ A;  4J36 A;  4GUV A;  4U8J A;  2FJA A;  2YWL A;  2BA9 A;  3ZYX A;  5L46 A;  2C4C A;  3T2Z A;  5ER0 A;  4BJY A;  2YG7 A;  5LV9 A;  2WQY A;  1ZMD A;  3DME A;  1YQZ A;  4N9X A;  1COY A;  2GR0 A;  2GR3 A;  2R0P A;  4CBQ A;  4DNA A;  1IUS A;  3T2Y A;  5U63 A;  2GR2 A;  3VRB A;  3ICR A;  2GH5 A;  3AE9 A;  1D7L A;  3E1T A;  5EB5 A;  5KXJ A;  2B7R A;  3KPF A;  4G74 A;  3M13 A;  5JCN A;  1ZOV A;  1M64 A;  3SZ0 A;  1ZX9 A;  3Q6J A;  2R4E A;  4Z2U A;  4ECH A;  4C3Y A;  3KKJ A;  4GDE A;  3NGC X;  5M10 A;  1F3P A;  4NTC A;  1OJ9 A;  5CKU A;  3T2K A;  3UTF A;  4AT0 A;  1S3E A;  3PVC A;  5KMS A;  1LJ1 A;  3C4A A;  3NYF A;  4U2S A;  3UOX A;  2ZZ0 A;  3NKS A;  2BK5 A;  1ZY8 A;  2R46 A;  3ATR A;  3NN0 X;  2A87 A;  4H2R A;  4Z25 A;  2B9W A;  3GYI A;  4B69 A; 
#chains in the Genus database with same CATH homology
 2E5V A;  1E1L A;  4PAB A;  5FS6 A;  4FX9 A;  4JQ9 A;  1H7X A;  2ZBW A;  1KDG A;  2WP9 A;  3G5S A;  4H4V A;  3GYX A;  4EIP A;  3AEG A;  2YM1 A;  4JY2 A;  5IPY A;  3KPK A;  2YG4 A;  1IUT A;  2YQU A;  3DK8 A;  4XXG A;  1REO A;  2I0Z A;  3SGL A;  1CC2 A;  4A65 A;  1MO9 A;  1B37 A;  2V5Z A;  4KPR A;  5HYM A;  1GRE A;  1Y0P A;  3VRD B;  1VG0 A;  3HYV A;  4Z43 A;  2BRY A;  2ZZB A;  3UCL A;  2R0G A;  2GEW A;  3UOZ A;  4HA6 A;  2C67 A;  2E4G A;  2YLZ A;  1XAN A;  1N4U A;  1KNP A;  5FMH A;  3UOV A;  4IA5 A;  3CMM A;  3GRT A;  4BJZ A;  4A6N B;  1JU2 A;  2J3N A;  3DGH A;  5JCM A;  3K7T A;  3P9U A;  4U8I A;  1PS9 A;  3DH9 A;  4G6H A;  2X99 A;  4CY6 A;  1PBE A;  1GRG A;  2GR1 A;  2TPR A;  2XVF A;  3EAO A;  5KWF A;  3II4 A;  2NPX A;  4B66 A;  4OPG A;  3ISH A;  2C66 A;  2R4J A;  1ONF A;  4TM3 A;  3HYX A;  1GEU A;  4Z44 A;  2BXR A;  3PO7 A;  5U25 A;  4H2P A;  2F5Z A;  3SZF A;  2TMD A;  3UKK A;  3FG2 P;  3AE8 A;  1LV0 A;  4TM4 A;  1XDI A;  4E0V A;  1PBC A;  4YT0 A;  4TLZ A;  3FIM B;  3C96 A;  1PXC A;  3UP4 A;  1E1M A;  4FK1 C;  2Q6U A;  2XFU A;  4KX6 A;  5HXI A;  3K7M X;  1EL8 A;  3GSI A;  1L9D A;  2WDR A;  2XFN A;  2YLW A;  1GPE A;  4H2N A;  3QFB A;  2C3C A;  4H4S A;  4AOS A;  3KVE A;  4B63 A;  5KNL A;  4A79 A;  4BK1 A;  4O5U A;  5BUL A;  1E6E A;  1K0I A;  2C64 A;  3ALL A;  4K7Z A;  1GET A;  4CCQ A;  3HYW A;  5KOW A;  1D4E A;  4J2W A;  3FPZ A;  3NIX A;  2GF3 A;  3ZDN A;  1H6V A;  3DJG X;  1HYU A;  1NEN A;  2BK3 A;  3RED A;  1BF3 A;  1ELI A;  1FEB A;  1D4D A;  1JNR A;  4YWO A;  4B1B A;  5J60 A;  4AOX A;  3BI2 A;  3AE2 A;  4YSX A;  1GT8 A;  1LTX R;  1KFY A;  2BYB A;  3UKP A;  4DGK A;  3AE6 A;  3LZW A;  1CL0 A;  4IV9 A;  3H4K A;  3DJD A;  4RG4 A;  1NPX A;  2C72 A;  2X3N A;  4I58 A;  1Z6L A;  3EAN A;  4JN9 A;  3UTG A;  2YLX A;  4U8O A;  2BCG G;  1YY5 A;  3G5Q A;  4H7U A;  4LA1 A;  3F8P A;  5C3J A;  1H81 A;  1TDO A;  3DJE A;  3ICS A;  1OJA A;  3IWA A;  3UTH A;  3VRA A;  1MOK A;  1SEZ A;  4P9S A;  1TYT A;  2GQW A;  2WPC A;  2HQM A;  1VG9 A;  4J31 A;  4OPL A;  4Y4M A;  5TR3 A;  1D7Y A;  1VDC A;  2DKH A;  3PS9 A;  4OPI A;  3SXI A;  4B68 A;  4YXD A;  5BVA A;  4YSH A;  4J56 A;  3NYC A;  3VR9 A;  2GB0 A;  5FS7 A;  2CVJ A;  1NEK A;  1P2E A;  1H83 A;  1B8S A;  1CJ2 A;  2BS2 A;  2Q7V A;  3NLC A;  3QSS A;  2H88 A;  5EOW A;  4AT2 A;  4B65 A;  1L9E A;  3CGC A;  2ZZC A;  1PXA A;  2WDV A;  2UZZ A;  1PDH A;  2VVL G;  2XFO A;  2V3A A;  3KLJ A;  4NWZ A;  1IUU A;  3LAD A;  4ICY A;  3NYE A;  4OPU A;  5KVH A;  4CNJ A;  1ZMC A;  4TLX A;  1W4X A;  4H4R A;  3CNP A;  2YR5 A;  4K22 A;  3CTY A;  2Y6R A;  3AD9 B;  2R9Z A;  3CNS A;  3EF6 A;  3H8L A;  3ITJ A;  1CJC A;  3GWD A;  3M12 A;  3S61 A;  1PBF A;  3AXB A;  3UTE A;  1S3B A;  2V61 A;  3GD3 A;  3NK0 X;  3NH3 X;  4BUR A;  1BGN A;  3QFA A;  2YLR A;  3CPH G;  5J7X A;  1BKW A;  3GWF A;  3KD9 A;  2C65 A;  3LXD A;  3P4Q A;  2BK4 A;  3NG7 X;  1FEC A;  3VQR A;  5JCI A;  3DGZ A;  1NG4 A;  4NTD A;  4NTE A;  1ZP0 A;  4LU6 A;  5M0Z A;  2RGH A;  2YG3 A;  2NVK X;  3CGE A;  4U8N A;  1L9C A;  1PJ7 A;  4EM3 A;  2WPF A;  3AE4 A;  3GDN A;  3LZX A;  3AB1 A;  4U8K A;  5HHF A;  2FJD A;  2QA2 A;  4Z24 A;  3AEA A;  1JNZ A;  3T14 A;  3BNM A;  3AYI A;  1DNC A;  4UDR A;  2X8C A;  4USR A;  4JDR A;  2YVF A;  2YLS A;  3O0H A;  4H4U A;  1CF3 A;  1TDF A;  2YLT A;  1JRY A;  3F8R A;  1LPF A;  4JNA A;  1NHR A;  2R0C A;  1GRA A;  3ATQ A;  4REK A;  2JKC A;  1RYI A;  1B4V A;  4ZCD A;  2C7G A;  2X8H A;  2V3B A;  2XLU A;  5GSN A;  1YKJ A;  1FCD A;  2FBW A;  2WP5 A;  3B6D A;  1GER A;  1H84 A;  3AE3 A;  4IVO B;  1LQU A;  3GD4 A;  3P4R A;  3GRS A;  3AE7 A;  3AD7 B;  1KSS A;  1JOA A;  2WOW A;  1PBB A;  3SYI A;  1IUV A;  1KNR A;  2B9Y A;  3SX6 A;  2OAM A;  5IQ1 A;  4K2X A;  4CRT A;  1VQW A;  1TDN A;  1TRB A;  3QVP A;  4OVI A;  5U1O A;  1QO8 A;  4UDP A;  2WPE A;  3B3R A;  1D5T A;  1JRZ A;  4X4J A;  3RP7 A;  4A9W A;  4YKG A;  4Z2R A;  3DK4 A;  2RGJ A;  4BK2 A;  1F6M A;  3SZC A;  1NHQ A;  3RP8 A;  4EQS A;  1PJ5 A;  4EQW A;  3AYJ A;  2A8X A;  1O5W A;  1BGJ A;  4J57 A;  4TM0 A;  4H4Y A;  5FS9 A;  3BHF A;  2FJE A;  3CGB A;  2XCG A;  2OA1 A;  1ZDL A;  3P4P A;  4USQ A;  2ARD A;  4Z26 A;  2VRL A;  3I6D A;  4Z2T A;  2BS4 A;  3BNU A;  1H82 A;  4PAA A;  2XVH A;  2YM2 A;  3CNJ A;  4BV6 A;  2Z5X A;  1GRF A;  4EMW A;  3HZL A;  1GRB A;  1GAL A;  3I3L A;  4FK1 A;  3T0K A;  1CHU A;  2B7S A;  1F8R A;  3H8I A;  3ICT A;  2APG A;  2RAB A;  4DSG A;  1NG3 A;  3ALJ A;  4YSZ A;  2WU5 A;  1K4Q A;  1GXF A;  2YR6 A;  3UKH A;  3SQP A;  1N4W A;  3COX A;  4M52 A;  4B67 A;  2VOU A;  4UDQ A;  4NEV A;  5GRT A;  2RGO A;  4CY8 A;  4YSY A;  2VQ7 A;  5KRQ A;  4RG3 A;  2V60 A;  1E7P A;  3P4S A;  1JRX A;  5DBJ A;  2V6O A;  5JCK A;  1EL7 A;  2QCU A;  3DA1 A;  4GF7 A;  4IA6 A;  3C4N A;  3IHM A;  3KU9 A;  4H4W A;  1IUX A;  2BC1 A;  2XYO A;  3OZ2 A;  3CGD A;  1OJC A;  3LOV A;  4WX1 A;  3UOY A;  1XHC A;  3AD8 B;  4IVM B;  1EL5 A;  4K5R A;  4NNJ A;  1DOC A;  4GR1 A;  3V76 A;  4ZN0 A;  3G5R A;  3NK2 X;  2AR8 A;  2QAE A;  4OPD A;  1TYP A;  3CPI G;  4GAV A;  4RSL A;  4H4Z A;  2VVL A;  3GMC A;  4U8P A;  3QJ4 A;  2CDU A;  5IQ4 A;  1GTH A;  5JCL A;  2XLS A;  4A7A A;  1O95 A;  5HY5 A;  2BCP A;  1TDK A;  2GRT A;  1YQ3 A;  2Q0L A;  1S2Y A;  2XLR A;  3BI5 A;  4I59 A;  3SZW A;  2R45 A;  4YKF A;  1BWC A;  2CUL A;  3VR8 A;  1UKV G;  3QVR A;  1CC6 A;  2JAE A;  1Y56 A;  1GES A;  2JB2 A;  1GND A;  3NN6 X;  2GAG B;  3NNE A;  1EL9 A;  1B5Q A;  2XFP A;  4X9N A;  4YTN A;  1YQ4 A;  4OPC A;  2YVJ A;  3FBS A;  4TM1 A;  2PYX A;  3CIR A;  3SFD A;  4C5O A;  1LVL A;  2BAC A;  3T37 A;  3IF9 A;  5KOX A;  3GYJ A;  1GTE A;  2IID A;  3NT6 A;  2B9X A;  4AP1 A;  2XVE A;  4K8D A;  1OJT A;  5KMR A;  3R9U A;  1QJD A;  3QSM A;  2VRM A;  3NRN A;  4B64 A;  3IC9 A;  1GRH A;  5EBK A;  1XPQ A;  3AYL A;  2FJB A;  1VRQ B;  3CPJ G;  1S2Q A;  2WP6 A;  3RP6 A;  3L1R A;  1N1P A;  4U8L A;  1NHS A;  2VZ2 A;  4GAP A;  3FMW A;  3D1C A;  1NHP A;  3RNM A;  3JSK A;  3UKA A;  1L0V A;  2VVM A;  3NHO X;  4D04 A;  1AOG A;  2BS3 A;  4DSH A;  1PHH A;  4G9K A;  4XWZ A;  2OLN A;  4EQR A;  2WOV A;  2DKI A;  5BUK A;  4EIQ A;  3WE0 A;  3S5W A;  3UP5 A;  3AWI A;  3AEB A;  1FL2 A;  3LB8 A;  4G6G A;  1X31 B;  4MJW A;  3CND A;  2A89 A;  2E1M A;  3V3N A;  3QSE A;  4AP3 A;  1KF6 A;  3NTD A;  2IVD A;  3NTA A;  1CJ4 A;  1KSU A;  4HB9 A;  2JK6 A;  2O9Z A;  4A5L A;  2VQB A;  4H2Q A;  1OJD A;  4NEW A;  5KVI A;  3UKQ A;  2EQ9 A;  1F8S A;  3URH A;  3SFE A;  1K0L A;  1E1N A;  4WCT A;  3DK9 A;  2BXS A;  5KMP A;  1DOE A;  1CC4 A;  2W0H A;  4EQX A;  4C3X A;  1PJ6 A;  1V59 A;  2WBA A;  4U2T A;  4EMI A;  2XVJ A;  5EB4 A;  1FEA A;  4Y4L A;  2AQJ A;  2WU2 A;  3RHA A;  4APN A;  1GOS A;  1E39 A;  1IJH A;  2IVE A;  1DJQ A;  2OLO A;  1DOD A;  1ZK7 A;  2Y6Q A;  2C3D A;  3ABV A;  4H4T A;  5CQF A;  2GAH B;  2X50 A;  3AEE A;  3DJJ A;  4C77 A;  1H86 A;  1F8W A;  2WES A;  2WET A;  3AED A;  1ZKQ A;  2YR4 A;  1ZOY A;  2GVC A;  1FOH A;  1QLB A;  4FDC B;  4CNK A;  1RSG A;  1PN0 A;  4NZH A;  2C76 A;  2XLP A;  1EBD A;  3NK1 X;  1JEH A;  2AAQ A;  2GMJ A;  2OAL A;  3ALM A;  3AE1 A;  3AEC A;  3EPT A;  3BI4 A;  4K5S A;  4A99 A;  4II2 A;  2WDQ A;  2WEU A;  3IHG A;  1M6I A;  2BC0 A;  4OPT A;  1GSN A;  1H7W A;  3SY4 A;  3OC4 A;  1O94 A;  4OCG A;  1Q1R A;  5BRT A;  1D4C A;  1Y56 B;  2Z5Y A;  5FS8 A;  2C75 A;  3UKF A;  4LII A;  2JBV A;  2B76 A;  2C73 A;  3AEF A;  4GCM A;  4YTM A;  4ZCC A;  4GDP A;  2ACZ A;  2WOI A;  1CJ3 A;  1N4V A;  3GMB A;  3T31 A;  1MXT A;  1IUW A;  1DXL A;  1E1K A;  1K0J A;  1NDA A;  2GMH A;  3SM8 A;  2CFY A;  2YAU A;  4EM4 A;  1PBD A;  3AE5 A;  4H50 A;  2H89 A;  3BHK A;  4EMJ A;  3K30 A;  2BRA A;  2WHD A;  2PHH A;  2YG6 A;  2X8G A;  2YVG A;  3F8D A;  4UP3 A;  3M0O A;  3CNT A;  3K7Q X;  2QA1 A;  2JB1 A;  4YTP A;  2EQ7 A;  4J34 A;  4A6N A;  2WS3 A;  4G73 A;  4BK3 A;  4J33 A;  3LJP A;  3KA7 A;  5C2T A;  3CN8 A;  1NAA A;  4H4P A;  4CCR A;  3P1W A;  1DJN A;  1DOB A;  2XVI A;  4X9M A;  2Q0K A;  3Q9T A;  4D03 A;  2JB3 A;  4O5Q A;  4U8M A;  2YG5 A;  1RP0 A;  1GRT A;  2GV8 A;  2XDO A;  2XLT A;  1PXB A;  4JNQ A;  4H4X A;  4II3 A;  5KMQ A;  3L8K A;  3V3O A;  4C74 A;  2GQF A;  4H4Q A;  1P2H A;  1Q9I A;  1TDE A;  3GDP A;  1CBO A;  2C70 A;  2EQ8 A;  4XWR A;  1Q1W A;  4Y4N A;  1BZL A;  2BAB A;  3ADA B;  4ADW A;  1LQT A;  1GV4 A;  3D8X A;  4GRT A;  3UKL A;  2EQ6 A;  4JY3 A;  4U2L A;  2XFQ A;  4J36 A;  4GUV A;  4U8J A;  2FJA A;  2YWL A;  2BA9 A;  3ZYX A;  5L46 A;  2C4C A;  3T2Z A;  5ER0 A;  4BJY A;  2YG7 A;  5LV9 A;  2WQY A;  1ZMD A;  3DME A;  1YQZ A;  4N9X A;  1COY A;  2GR0 A;  2GR3 A;  2R0P A;  4CBQ A;  4DNA A;  1IUS A;  3T2Y A;  5U63 A;  2GR2 A;  3VRB A;  3ICR A;  2GH5 A;  3AE9 A;  1D7L A;  3E1T A;  5EB5 A;  5KXJ A;  2B7R A;  3KPF A;  4G74 A;  3M13 A;  5JCN A;  1ZOV A;  1M64 A;  3SZ0 A;  1ZX9 A;  3Q6J A;  2R4E A;  4Z2U A;  4ECH A;  4C3Y A;  3KKJ A;  4GDE A;  3NGC X;  5M10 A;  1F3P A;  4NTC A;  1OJ9 A;  5CKU A;  3T2K A;  3UTF A;  4AT0 A;  1S3E A;  3PVC A;  5KMS A;  1LJ1 A;  3C4A A;  3NYF A;  4U2S A;  3UOX A;  2ZZ0 A;  3NKS A;  2BK5 A;  1ZY8 A;  2R46 A;  3ATR A;  3NN0 X;  2A87 A;  4H2R A;  4Z25 A;  2B9W A;  3GYI A;  4B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...