3KPFA

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 167
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kpfA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kpfA02
1OJ9A 5FS7A 2YG5A 4J56A 3Q6JA 4RSLA 3REDA 1IUUA 4C3YA 3CN8A 4BJZA 1GALA 4B65A 3UOVA 4GF7A 2GF3A 3UKQA 3P9UA 2C65A 5IQ1A 2RGHA 4CY8A 2WU2A 3O0HA 1X31B 2VVLG 2XFUA 4I59A 3ALJA 2AAQA 3AE2A 4N9XA 1IUSA 4KX6A 4Y4LA 4OPUA 3M0OA 3UTFA 3F8RA 4EQRA 4U8OA 4U2LA 2GB0A 2B76A 3ICTA 5KXJA 1AOGA 3QFBA 1TDEA 3KVEA 2GR3A 2GQWA 2WEUA 3SFEA 5FMHA 2JB3A 1YQZA 5GSNA 4B66A 2WS3A 2YQUA 1H86A 3AEBA 3AE4A 3JSKA 1D4DA 3CGEA 3IF9A 2X50A 5CKUA 2B7RA 3CNPA 3QFAA 3NT6A 4H4RA 4APNA 4YTPA 3B3RA 1YY5A 4X9NA 1IUWA 3CNSA 5KRQA 1LJ1A 3EPTA 4HA6A 4PAAA 1DNCA 1BGNA 2XCGA 4BK1A 1FCDA 3KPFA 1ZKQA 1H83A 4GCMA 1FL2A 1QJDA 2E1MA 3CIRA 2GR1A 2YVGA 4P9SA 2PHHA 4H2PA 1H7WA 3VRBA 4DSGA 2R4EA 4DGKA 5ER0A 2Q0LA 4LU6A 2Q0KA 3K7MX 1B5QA 2BK4A 3DJDA 4EMJA 1S3BA 1XDIA 5U63A 1ZMCA 4J2WA 4B69A 4J36A 3IC9A 3F8PA 2ARDA 3KA7A 4Z2TA 5IPYA 3VQRA 2YR5A 4H4VA 2WBAA 1IUXA 2XYOA 2XFNA 2BS2A 2YR6A 4EIPA 1ZDLA 3H8IA 1VG9A 1XHCA 2BYBA 3AE5A 1PXBA 1PBCA 1CC6A 1TYPA 1M6IA 3AEGA 3QJ4A 1S2QA 1MXTA 1VDCA 1Y56A 3NYCA 1F8WA 1VQWA 2VRLA 2YLRA 4JNAA 4EIQA 4H4SA 4BK3A 2VVMA 2OA1A 2OLNA 4Z24A 1RYIA 3VR8A 3G5QA 3VR9A 2YM1A 4UDPA 1DJNA 4K7ZA 2GQFA 2VQBA 3NG7X 2AQJA 1YQ3A 2WU5A 4XWRA 2GR0A 1ZMDA 2C67A 1D7YA 1NAAA 2H89A 4D03A 2BA9A 4NZHA 3UKLA 3GD4A 1NHPA 2R45A 1JNRA 3G5SA 2YLWA 3ATQA 2OALA 4A7AA 1JRYA 5BVAA 4GDEA 1GTEA 4USRA 4J34A 1H7XA 4O5QA 3AE9A 4FK1C 4B68A 3NYFA 1COYA 1QO8A 2GAHB 3SFDA 1F8SA 2GMJA 4U8IA 1DOEA 2A8XA 1REOA 3P4QA 2CVJA 1PBEA 1PS9A 1PDHA 3UOZA 4K8DA 3ADAB 4C74A 3C96A 3GRTA 4H2RA 4U2TA 3B6DA 4H4WA 3SM8A 1E7PA 2EQ6A 1FEAA 3FG2P 1E1MA 3I3LA 4Y4NA 1H81A 1M64A 2JAEA 1B8SA 3KLJA 2YVJA 3NK0X 2C73A 1FEBA 4ICYA 4J57A 2I0ZA 1JNZA 3BI2A 1KDGA 1F3PA 2R46A 1XANA 3NKSA 3RP7A 4C3XA 1GOSA 1Y56B 3I6DA 4OPCA 1KSUA 3CGBA 1ZOYA 3GMCA 1ZY8A 1MO9A 3EANA 3DK8A 2XFQA 4IVMB 2Q6UA 5M10A 1TDKA 2C70A 2RGOA 3GWFA 4JDRA 3R9UA 4USQA 3KU9A 2JB1A 2BCPA 2YG6A 3AE3A 1NDAA 3K7QX 3AEFA 5EB5A 4A65A 4BURA 4AP3A 1QLBA 3URHA 5KOWA 1NG4A 3V76A 4JN9A 2QA1A 2W0HA 3COXA 2R9ZA 3ALMA 4AT0A 2XVEA 2EQ7A 2WOVA 1GRBA 2ACZA 3E1TA 1EL5A 2A87A 2WOIA 2C75A 3DJJA 4GR1A 1GPEA 1N4VA 1O94A 2ZZ0A 3LB8A 4IA6A 4OCGA 1GRFA 4PABA 3AD8B 3CGCA 3M12A 1JOAA 1NHSA 4DNAA 4OPIA 4BK2A 1PJ5A 4OVIA 2YR4A 2BXRA 2FBWA 3ICRA 3LZXA 5FS8A 3UTHA 3VRDB 2ZBWA 4UP3A 1TDFA 5JCMA 2BS4A 3GYIA 2XFPA 1KNPA 3CPHG 3ALLA 5FS9A 4EQXA 1L9DA 4K22A 5J60A 3UP4A 4RG4A 2A89A 2GEWA 2CFYA 1F8RA 3NYEA 3VRAA 3UCLA 3UTEA 2Y6QA 3II4A 1B37A 2CDUA 2CULA 2GAGB 2C7GA 4Z25A 2XLPA 4C77A 2YLSA 3DJGX 2E5VA 3ZDNA 3DGHA 3GD3A 4BJYA 4YKGA 4YT0A 3M13A 4B67A 3OZ2A 4K5SA 2WESA 3AE6A 4IVOB 4A5LA 4H7UA 1NPXA 4Z43A 1K0LA 1VG0A 2BC0A 1RP0A 2R0GA 2VVLA 2QAEA 1F6MA 4AOXA 5M0ZA 4JY2A 4YKFA 2ZZBA 3V3NA 2V3AA 1E1KA 2O9ZA 4H2QA 1ZOVA 3ISHA 1TYTA 2Z5YA 3K30A 3NGCX 4H4UA 5IQ4A 5HXIA 1CL0A 1EL8A 3BHFA 3NIXA 2BK5A 2H88A 2WP9A 4UDRA 4C5OA 1N4WA 1DODA 1ZP0A 2B9XA 2YWLA 3UKFA 2XLRA 1D4CA 3PVCA 2YG4A 2XVFA 4A79A 3GWDA 1LQUA 4ZN0A 4AOSA 3NH3X 4EM3A 3PS9A 2OLOA 4K5RA 1B4VA 3CPJG 3RNMA 3D8XA 4A6NB 1BGJA 1CJCA 2WQYA 4GDPA 1CBOA 4BV6A 3P1WA 5C2TA 1GETA 3F8DA 3LZWA 3NN6X 2IIDA 4X4JA 2EQ9A 3IHGA 3NK2X 4H4XA 4IV9A 4CRTA 1Y0PA 5HY5A 4WCTA 3LOVA 1EL9A 3K7TA 2GVCA 1FECA 2C3CA 3BI4A 4JNQA 2GRTA 4U8MA 2V3BA 2YG7A 3C4NA 4NEWA 1DJQA 4EQWA 5C3JA 4H4ZA 4B64A 1RSGA 1GESA 4FK1A 4OPGA 5JCIA 1GRTA 1SEZA 4OPDA 3QVRA 1UKVG 3LJPA 1PBBA 1BKWA 2YLTA 1GRAA 3AEEA 4H4PA 4H4TA 3UKPA 4K2XA 1KFYA 4HB9A 4H50A 1E39A 2FJDA 4ADWA 1ZX9A 3CNTA 4MJWA 3AD7B 3NNEA 2WETA 4U8NA 4M52A 3IHMA 5J7XA 1LVLA 2V5ZA 1D7LA 3BI5A 5FS6A 4AP1A 1OJCA 1GEUA 1CC2A 2NVKX 2YAUA 2XLUA 1K4QA 4NTCA 3AWIA 3ITJA 2YG3A 2IVDA 5BRTA 3ABVA 3QSSA 4E0VA 2IVEA 4H4YA 2BCGG 1GTHA 3SQPA 4REKA 4CY6A 4YSZA 3QSEA 2E4GA 5BUKA 3LXDA 4GUVA 1OJDA 1E1NA 1YKJA 4Z44A 3NTDA 1IUVA 1PBFA 3GDPA 1PJ6A 4YSXA 3UKAA 2WP5A 1S3EA 3S5WA 4Y4MA 1BWCA 4JQ9A 1CHUA 5BULA 4TM3A 1Z6LA 2X8HA 3CTYA 4LA1A 4YXDA 2HQMA 4YSHA 1VRQB 4CNJA 3L1RA 1GT8A 1NG3A 1V59A 3ICSA 1IJHA 1GRHA 2XVJA 4EMIA 2AR8A 2WPFA 1LTXR 3IWAA 5U25A 1P2EA 3V3OA 5KWFA 1JRXA 3RP6A 5JCNA 2OAMA 2Y6RA 3WE0A 1Q9IA 1H6VA 2APGA 4J33A 4UDQA 1KF6A 1MOKA 2TMDA 2YVFA 3AD9B 1H84A 3AXBA 4KPRA 5EOWA 4CBQA 5KVHA 1DXLA 1W4XA 2GR2A 3FMWA 4IA5A 4RG3A 1PXAA 4ZCDA 1N4UA 4U8KA 3RHAA 5L46A 2WPEA 1O95A 3BNMA 3RP8A 4U8JA 1JEHA 2BS3A 2VRMA 4A6NA 1EBDA 3UOXA 3LADA 5JCKA 1S2YA 2R0PA 3AEAA 2XDOA 2WHDA 3DK4A 2WOWA 1FOHA 2WP6A 2C72A 3AB1A 2VOUA 2BC1A 3UOYA 2R0CA 1Q1WA 2X99A 3P4RA 3P4PA 3GMBA 4TLXA 4DSHA 2TPRA 4O5UA 2R4JA 3CPIG 2XFOA 3KKJA 4TM1A 1YQ4A 5DBJA 4EQSA 2JKCA 2V60A 2C76A 4B63A 1GSNA 2X3NA 1JRZA 3DK9A 4TM0A 1L9EA 2Z5XA 1CC4A 2YLXA 1NEKA 4LIIA 3NTAA 2BXSA 5KVIA 3AEDA 3AYLA 1CJ2A 2GH5A 4EM4A 2BACA 1K0JA 2X8GA 2XVIA 3S61A 2WDRA 1XPQA 3CNJA 1ONFA 2QCUA 2VQ7A 3UP5A 2DKIA 1PXCA 3GSIA 4A99A 4I58A 2GV8A 4YTMA 4ECHA 2ZZCA 2YLZA 1H82A 3ATRA 4NEVA 4H2NA 3BHKA 2X8CA 1GNDA 2XLTA 1ELIA 3NN0X 3P4SA 4TLZA 2YM2A 4YTNA 2RGJA 5CQFA 2WPCA 4X9MA 3NRNA 3KD9A 1GREA 2FJBA 3OC4A 4XXGA 2C66A 1HYUA 3D1CA 3AECA 1L0VA 2UZZA 3DGZA 3EF6A 2B7SA 1TDOA 2NPXA 1GXFA 3CNDA 4OPLA 3NLCA 1BF3A 4J31A 2PYXA 1GRGA 1BZLA 1K0IA 1P2HA 3HZLA 2RABA 4FDCB 4XWZA 3DMEA 3PO7A 2GMHA 3BNUA 2Q7VA 1IUTA 1TDNA 5EBKA 4CCRA 2B9WA 4JY3A 2FJAA 1OJAA 4U8LA 2V6OA 3AYJA 2BABA 3ZYXA 1NHRA 1PHHA 1Q1RA 4NTEA 3UKKA 4Z2UA 3GDNA 1N1PA 3EAOA 3QVPA 3NK1X 4ZCCA 3DH9A 4H4QA 2XLSA 1LPFA 3AE7A 4FX9A 4Z2RA 2C64A 2QA2A 3H8LA 4U2SA 1GERA 1CJ3A 1E1LA 5HYMA 2J3NA 2VZ2A 1OJTA 3UKHA 1LQTA 2B9YA 3Q9TA 4B1BA 2DKHA 4YWOA 3FBSA 4NTDA 3T37A 1O5WA 3CGDA 3FIMB 3FPZA 1KNRA 1L9CA 2EQ8A 1NHQA 2JK6A 4AT2A 4YSYA 5EB4A 1DOCA 3H4KA 3L8KA 1CF3A 1TRBA 2FJEA 3QSMA 4WX1A 1ZK7A 3UTGA 5HHFA 1E6EA 3DA1A 3DJEA 3GRSA 5U1OA 1JU2A 4OPTA 4A9WA 4Z26A 2JB2A 3GYJA 3G5RA 3NHOX 2F5ZA 3AE1A 3AE8A 1LV0A 2WDVA 1NENA 4EMWA 1EL7A 1D5TA 1D4EA 2XVHA 3C4AA 5TR3A 4D04A 5JCLA 2BK3A 4CNKA 4CCQA 5KOXA 1CJ4A 1GV4A 1PN0A 2V61A 1KSSA 1PBDA 1PJ7A 2WDQA 4U8PA 5GRTA 3SGLA 3AYIA 4TM4A 5LV9A 2C3DA 1DOBA 4GRTA 2JBVA
chains in the Genus database with same CATH superfamily
1OJ9A 5FS7A 2YG5A 4J56A 3HYWA 3Q6JA 4RSLA 3REDA 1IUUA 4C3YA 4G9KA 3CN8A 4BJZA 4GAPA 1GALA 4B65A 3UOVA 4GF7A 2GF3A 3UKQA 3P9UA 2C65A 5IQ1A 2RGHA 4CY8A 2WU2A 3O0HA 1X31B 2VVLG 2XFUA 4I59A 3ALJA 2AAQA 3AE2A 4N9XA 1IUSA 4KX6A 4Y4LA 4OPUA 3M0OA 3UTFA 3F8RA 4EQRA 4U8OA 4U2LA 2GB0A 2B76A 3ICTA 5KXJA 2BRYA 1AOGA 3QFBA 1TDEA 3KVEA 2GR3A 2GQWA 2WEUA 3SFEA 5FMHA 2JB3A 1YQZA 5GSNA 4B66A 2WS3A 2YQUA 1H86A 3AEBA 3SZFA 3AE4A 3HYXA 3JSKA 1D4DA 3CGEA 3IF9A 4G73A 2X50A 5CKUA 2B7RA 3CNPA 5KMRA 4II3A 3QFAA 3NT6A 4H4RA 4APNA 4YTPA 3B3RA 1YY5A 4X9NA 1IUWA 3CNSA 5KRQA 1LJ1A 3EPTA 4HA6A 4PAAA 1DNCA 1BGNA 2XCGA 4BK1A 1FCDA 3KPFA 1ZKQA 1H83A 4GCMA 1FL2A 1QJDA 2E1MA 3CIRA 2GR1A 2YVGA 4P9SA 2PHHA 4H2PA 1H7WA 3VRBA 5KNLA 4DSGA 2R4EA 4DGKA 5ER0A 2Q0LA 4LU6A 2Q0KA 3K7MX 1B5QA 2BK4A 3DJDA 4EMJA 1S3BA 1XDIA 5U63A 1ZMCA 4J2WA 4B69A 4J36A 3IC9A 3F8PA 2ARDA 3KA7A 4Z2TA 5IPYA 3VQRA 2YR5A 4H4VA 2WBAA 1IUXA 2XYOA 2XFNA 2BS2A 2YR6A 4EIPA 1ZDLA 3H8IA 1VG9A 1XHCA 2BYBA 3AE5A 1PXBA 1PBCA 1CC6A 1TYPA 1M6IA 3AEGA 3QJ4A 3SYIA 1S2QA 1MXTA 1VDCA 1Y56A 3NYCA 1F8WA 1VQWA 2VRLA 2YLRA 4JNAA 4EIQA 4H4SA 4BK3A 2VVMA 2OA1A 2OLNA 4Z24A 1RYIA 3VR8A 3G5QA 3VR9A 2YM1A 4UDPA 1DJNA 4K7ZA 2GQFA 2VQBA 3NG7X 2AQJA 1YQ3A 2WU5A 4XWRA 2GR0A 1ZMDA 2C67A 1D7YA 1NAAA 2H89A 4D03A 2BA9A 4NZHA 3UKLA 3GD4A 1NHPA 2R45A 1JNRA 3T2YA 3G5SA 2YLWA 3ATQA 2OALA 4A7AA 1JRYA 5BVAA 4GDEA 1GTEA 4USRA 4J34A 1H7XA 4O5QA 3AE9A 4FK1C 4B68A 3NYFA 1COYA 1QO8A 2GAHB 3SFDA 1F8SA 2GMJA 4U8IA 1DOEA 2A8XA 1REOA 3P4QA 2CVJA 1PBEA 3T2KA 1PS9A 1PDHA 3UOZA 4K8DA 3ADAB 4C74A 3C96A 3GRTA 4H2RA 4U2TA 3B6DA 4H4WA 3SM8A 1E7PA 2EQ6A 1FEAA 3FG2P 1E1MA 3I3LA 4Y4NA 1H81A 1M64A 2JAEA 1B8SA 3KLJA 2YVJA 3NK0X 2C73A 1FEBA 4ICYA 4J57A 5KMPA 2I0ZA 1JNZA 3BI2A 1KDGA 1F3PA 2R46A 1XANA 3NKSA 3RP7A 4C3XA 1GOSA 1Y56B 3I6DA 4OPCA 1KSUA 3CGBA 1ZOYA 3GMCA 1ZY8A 1MO9A 3EANA 3DK8A 2XFQA 4IVMB 2Q6UA 5M10A 1TDKA 2C70A 2RGOA 3GWFA 4JDRA 3R9UA 4USQA 3KU9A 2JB1A 2BCPA 2YG6A 3AE3A 1NDAA 3K7QX 3AEFA 5EB5A 4A65A 4BURA 4AP3A 1QLBA 3URHA 5KOWA 1NG4A 3V76A 4JN9A 2QA1A 2W0HA 3COXA 2R9ZA 3ALMA 4AT0A 2XVEA 2EQ7A 2WOVA 1GRBA 2ACZA 3E1TA 1EL5A 2A87A 2WOIA 2C75A 3DJJA 4GR1A 1GPEA 1N4VA 4G74A 1O94A 2ZZ0A 3LB8A 4IA6A 4OCGA 1GRFA 4PABA 3AD8B 3CGCA 3M12A 1JOAA 1NHSA 4DNAA 4OPIA 4BK2A 1PJ5A 4OVIA 2YR4A 2BXRA 2FBWA 3ICRA 3LZXA 5FS8A 3UTHA 3VRDB 2ZBWA 4UP3A 1TDFA 5JCMA 2BS4A 3GYIA 2XFPA 1KNPA 3CPHG 3ALLA 5FS9A 4EQXA 1L9DA 4K22A 5J60A 3UP4A 4RG4A 2A89A 2GEWA 2CFYA 1F8RA 3NYEA 3VRAA 3UCLA 3UTEA 2Y6QA 3II4A 4GAVA 1B37A 2CDUA 2CULA 2GAGB 2C7GA 4Z25A 2XLPA 4C77A 2YLSA 3DJGX 2E5VA 3ZDNA 3DGHA 3GD3A 4BJYA 4YKGA 4YT0A 3M13A 4B67A 3OZ2A 4K5SA 4II2A 2WESA 3AE6A 4IVOB 4A5LA 4H7UA 1NPXA 4G6GA 4Z43A 3SZ0A 1K0LA 1VG0A 2BC0A 1RP0A 2R0GA 2VVLA 2QAEA 1F6MA 4AOXA 5M0ZA 4JY2A 4YKFA 2ZZBA 3V3NA 2V3AA 4NWZA 1E1KA 2O9ZA 4H2QA 1ZOVA 3ISHA 1TYTA 2Z5YA 3K30A 3NGCX 4H4UA 5IQ4A 5HXIA 3SXIA 1CL0A 1EL8A 3BHFA 3NIXA 2BK5A 2H88A 2WP9A 4UDRA 4C5OA 1N4WA 1DODA 3SY4A 1ZP0A 2B9XA 2YWLA 3UKFA 2XLRA 1D4CA 3PVCA 2YG4A 2XVFA 4A79A 3GWDA 1LQUA 4ZN0A 4AOSA 3NH3X 4EM3A 3PS9A 2OLOA 4K5RA 1B4VA 3CPJG 3RNMA 3D8XA 4A6NB 1BGJA 1CJCA 2WQYA 4GDPA 1CBOA 4BV6A 3P1WA 5C2TA 1GETA 3F8DA 3LZWA 3NN6X 2IIDA 4X4JA 2EQ9A 3IHGA 3NK2X 4H4XA 4IV9A 4CRTA 1Y0PA 5HY5A 4WCTA 3LOVA 1EL9A 3K7TA 2GVCA 1FECA 2C3CA 3BI4A 4JNQA 2GRTA 4U8MA 2V3BA 2YG7A 3C4NA 4NEWA 1DJQA 4EQWA 5C3JA 4H4ZA 4B64A 1RSGA 1GESA 3T2ZA 4FK1A 4OPGA 5JCIA 1GRTA 1SEZA 4OPDA 3QVRA 1UKVG 3SZWA 3LJPA 1PBBA 1BKWA 2YLTA 1GRAA 3AEEA 4H4PA 4H4TA 3UKPA 4K2XA 1KFYA 4HB9A 4H50A 1E39A 2FJDA 4ADWA 1ZX9A 3CNTA 4MJWA 3AD7B 3NNEA 2WETA 4U8NA 4M52A 3IHMA 5J7XA 1LVLA 2V5ZA 1D7LA 3BI5A 5FS6A 4AP1A 1OJCA 1GEUA 1CC2A 2NVKX 2YAUA 2XLUA 1K4QA 4NTCA 3AWIA 3ITJA 2YG3A 2IVDA 5BRTA 3ABVA 3QSSA 4E0VA 2IVEA 4H4YA 2BCGG 1GTHA 3SQPA 4REKA 4CY6A 4YSZA 3QSEA 2E4GA 5BUKA 3LXDA 4GUVA 1OJDA 1E1NA 1YKJA 4Z44A 3NTDA 1IUVA 1PBFA 3GDPA 1PJ6A 4YSXA 3UKAA 2WP5A 3T14A 1S3EA 3S5WA 4Y4MA 1BWCA 4JQ9A 1CHUA 5BULA 4TM3A 1Z6LA 2X8HA 3CTYA 4LA1A 4YXDA 2HQMA 4YSHA 1VRQB 4CNJA 3L1RA 1GT8A 1NG3A 1V59A 3ICSA 1IJHA 1GRHA 2XVJA 4EMIA 2AR8A 5KMQA 2WPFA 1LTXR 3GYXA 3IWAA 1P2EA 5U25A 3V3OA 5KWFA 1JRXA 2C4CA 3RP6A 5JCNA 2OAMA 2Y6RA 3WE0A 1Q9IA 1H6VA 2APGA 4J33A 4UDQA 1KF6A 1MOKA 2TMDA 2YVFA 3AD9B 1H84A 3AXBA 4KPRA 5EOWA 4CBQA 5KVHA 1DXLA 1W4XA 2GR2A 3FMWA 4IA5A 4RG3A 1PXAA 4ZCDA 1N4UA 4U8KA 3RHAA 5L46A 2WPEA 1O95A 3BNMA 3RP8A 4U8JA 1JEHA 2BS3A 2VRMA 4A6NA 1EBDA 3UOXA 3LADA 5JCKA 1S2YA 2R0PA 3AEAA 2XDOA 2WHDA 3DK4A 2WOWA 1FOHA 2WP6A 2C72A 3AB1A 2VOUA 2BC1A 3SZCA 3UOYA 2R0CA 1Q1WA 2X99A 3P4RA 3P4PA 3GMBA 4TLXA 4DSHA 2TPRA 4O5UA 2R4JA 3CPIG 2XFOA 3KKJA 4TM1A 1YQ4A 5DBJA 3T31A 4EQSA 2JKCA 2V60A 2C76A 4B63A 1GSNA 2X3NA 1JRZA 5KMSA 3DK9A 4TM0A 1L9EA 2Z5XA 1CC4A 2YLXA 1NEKA 4LIIA 3NTAA 2BXSA 5KVIA 3CMMA 3AEDA 3AYLA 1CJ2A 2GH5A 4EM4A 2BACA 1K0JA 2X8GA 2XVIA 3S61A 2WDRA 1XPQA 3CNJA 1ONFA 2QCUA 2VQ7A 3UP5A 2DKIA 1PXCA 3GSIA 4A99A 4I58A 2GV8A 4YTMA 4ECHA 2ZZCA 2YLZA 1H82A 3ATRA 4NEVA 4H2NA 3BHKA 2X8CA 1GNDA 2XLTA 1ELIA 3NN0X 3P4SA 4TLZA 2YM2A 4YTNA 2RGJA 5CQFA 2WPCA 4X9MA 3NRNA 3KD9A 1GREA 2FJBA 3OC4A 4XXGA 2C66A 1HYUA 3D1CA 3AECA 1L0VA 2UZZA 3DGZA 3EF6A 4G6HA 2B7SA 1TDOA 2NPXA 1GXFA 3CNDA 4OPLA 3NLCA 1BF3A 4J31A 2PYXA 1GRGA 1BZLA 1K0IA 1P2HA 3HZLA 2RABA 4FDCB 4XWZA 3DMEA 3PO7A 3HYVA 2GMHA 3BNUA 2Q7VA 1IUTA 1TDNA 4NNJA 5EBKA 4CCRA 2B9WA 4JY3A 2FJAA 1OJAA 4U8LA 2V6OA 3AYJA 2BABA 3T0KA 3ZYXA 1NHRA 2BRAA 1PHHA 1Q1RA 4NTEA 3UKKA 4Z2UA 3GDNA 1N1PA 3EAOA 3QVPA 3NK1X 4ZCCA 3DH9A 4H4QA 2XLSA 1LPFA 3AE7A 4FX9A 4Z2RA 2C64A 2QA2A 3H8LA 4U2SA 1GERA 1CJ3A 1E1LA 5HYMA 2J3NA 2VZ2A 1OJTA 3UKHA 1LQTA 2B9YA 3Q9TA 4B1BA 2DKHA 4YWOA 3FBSA 4NTDA 3T37A 1O5WA 3CGDA 3FIMB 3FPZA 1KNRA 1L9CA 2EQ8A 1NHQA 2JK6A 4AT2A 4YSYA 5EB4A 1DOCA 3H4KA 3L8KA 1CF3A 1TRBA 2FJEA 3KPKA 3QSMA 1ZK7A 4WX1A 3SX6A 3UTGA 5HHFA 1E6EA 3DA1A 3DJEA 3GRSA 5U1OA 1JU2A 4OPTA 4A9WA 4Z26A 2JB2A 3GYJA 3G5RA 3NHOX 2F5ZA 3AE1A 3AE8A 1LV0A 2WDVA 1NENA 4EMWA 1EL7A 1D5TA 1D4EA 2XVHA 3C4AA 5TR3A 4D04A 5JCLA 2BK3A 4CNKA 4CCQA 5KOXA 1CJ4A 1GV4A 1PN0A 2V61A 1KSSA 1PBDA 1PJ7A 2WDQA 4U8PA 5GRTA 3SGLA 3AYIA 4TM4A 5LV9A 2C3DA 1DOBA 4GRTA 2JBVA
chains in the Genus database with same CATH topology
1OJ9A 5FS7A 2YG5A 4J56A 3HYWA 3Q6JA 4RSLA 3REDA 1IUUA 4C3YA 4G9KA 3CN8A 4BJZA 4GAPA 1GALA 4B65A 3UOVA 4GF7A 2GF3A 3UKQA 3P9UA 2C65A 5IQ1A 2RGHA 4CY8A 2WU2A 3O0HA 1X31B 2VVLG 2XFUA 4I59A 3ALJA 2AAQA 3AE2A 4N9XA 1IUSA 4KX6A 4Y4LA 4OPUA 3M0OA 3UTFA 3F8RA 4EQRA 4U8OA 4U2LA 2GB0A 2B76A 3ICTA 5KXJA 2BRYA 1AOGA 3QFBA 1TDEA 3KVEA 2GR3A 2GQWA 2WEUA 3SFEA 5FMHA 2JB3A 1YQZA 5GSNA 4B66A 2WS3A 2YQUA 1H86A 3AEBA 3SZFA 3AE4A 3HYXA 3JSKA 1D4DA 3CGEA 3IF9A 4G73A 2X50A 5CKUA 2B7RA 3CNPA 5KMRA 4II3A 3QFAA 3NT6A 4H4RA 4APNA 4YTPA 3B3RA 1YY5A 4X9NA 1IUWA 3CNSA 5KRQA 1LJ1A 3EPTA 4HA6A 4PAAA 1DNCA 1BGNA 2XCGA 4BK1A 1FCDA 3KPFA 1ZKQA 1H83A 4GCMA 1FL2A 1QJDA 2E1MA 3CIRA 2GR1A 2YVGA 4P9SA 2PHHA 4H2PA 1H7WA 3VRBA 5KNLA 4DSGA 2R4EA 4DGKA 5ER0A 2Q0LA 4LU6A 2Q0KA 3K7MX 1B5QA 2BK4A 3DJDA 4EMJA 1S3BA 1XDIA 5U63A 1ZMCA 4J2WA 4B69A 4J36A 3IC9A 3F8PA 2ARDA 3KA7A 4Z2TA 5IPYA 3VQRA 2YR5A 4H4VA 2WBAA 1IUXA 2XYOA 2XFNA 2BS2A 2YR6A 4EIPA 1ZDLA 3H8IA 1VG9A 1XHCA 2BYBA 3AE5A 1PXBA 1PBCA 1CC6A 1TYPA 1M6IA 3AEGA 3QJ4A 3SYIA 1S2QA 1MXTA 1VDCA 1Y56A 3NYCA 1F8WA 1VQWA 2VRLA 2YLRA 4JNAA 4EIQA 4H4SA 4BK3A 2VVMA 2OA1A 2OLNA 4Z24A 1RYIA 3VR8A 3G5QA 3VR9A 2YM1A 4UDPA 1DJNA 4K7ZA 2GQFA 2VQBA 3NG7X 2AQJA 1YQ3A 2WU5A 4XWRA 2GR0A 1ZMDA 2C67A 1D7YA 1NAAA 2H89A 4D03A 2BA9A 4NZHA 3UKLA 3GD4A 1NHPA 2R45A 1JNRA 3T2YA 3G5SA 2YLWA 3ATQA 2OALA 4A7AA 1JRYA 5BVAA 4GDEA 1GTEA 4USRA 4J34A 1H7XA 4O5QA 3AE9A 4FK1C 4B68A 3NYFA 1COYA 1QO8A 2GAHB 3SFDA 1F8SA 2GMJA 4U8IA 1DOEA 2A8XA 1REOA 3P4QA 2CVJA 1PBEA 3T2KA 1PS9A 1PDHA 3UOZA 4K8DA 3ADAB 4C74A 3C96A 3GRTA 4H2RA 4U2TA 3B6DA 4H4WA 3SM8A 1E7PA 2EQ6A 1FEAA 3FG2P 1E1MA 3I3LA 4Y4NA 1H81A 1M64A 2JAEA 1B8SA 3KLJA 2YVJA 3NK0X 2C73A 1FEBA 4ICYA 4J57A 5KMPA 2I0ZA 1JNZA 3BI2A 1KDGA 1F3PA 2R46A 1XANA 3NKSA 3RP7A 4C3XA 1GOSA 1Y56B 3I6DA 4OPCA 1KSUA 3CGBA 1ZOYA 3GMCA 1ZY8A 1MO9A 3EANA 3DK8A 2XFQA 4IVMB 2Q6UA 5M10A 1TDKA 2C70A 2RGOA 3GWFA 4JDRA 3R9UA 4USQA 3KU9A 2JB1A 2BCPA 2YG6A 3AE3A 1NDAA 3K7QX 3AEFA 5EB5A 4A65A 4BURA 4AP3A 1QLBA 3URHA 5KOWA 1NG4A 3V76A 4JN9A 2QA1A 2W0HA 3COXA 2R9ZA 3ALMA 4AT0A 2XVEA 2EQ7A 2WOVA 1GRBA 2ACZA 3E1TA 1EL5A 2A87A 2WOIA 2C75A 3DJJA 4GR1A 1GPEA 1N4VA 4G74A 1O94A 2ZZ0A 3LB8A 4IA6A 4OCGA 1GRFA 4PABA 3AD8B 3CGCA 3M12A 1JOAA 1NHSA 4DNAA 4OPIA 4BK2A 1PJ5A 4OVIA 2YR4A 2BXRA 2FBWA 3ICRA 3LZXA 5FS8A 3UTHA 3VRDB 2ZBWA 4UP3A 1TDFA 5JCMA 2BS4A 3GYIA 2XFPA 1KNPA 3CPHG 3ALLA 5FS9A 4EQXA 1L9DA 4K22A 5J60A 3UP4A 4RG4A 2A89A 2GEWA 2CFYA 1F8RA 3NYEA 3VRAA 3UCLA 3UTEA 2Y6QA 3II4A 4GAVA 1B37A 2CDUA 2CULA 2GAGB 2C7GA 4Z25A 2XLPA 4C77A 2YLSA 3DJGX 2E5VA 3ZDNA 3DGHA 3GD3A 4BJYA 4YKGA 4YT0A 3M13A 4B67A 3OZ2A 4K5SA 4II2A 2WESA 3AE6A 4IVOB 4A5LA 4H7UA 1NPXA 4G6GA 4Z43A 3SZ0A 1K0LA 1VG0A 2BC0A 1RP0A 2R0GA 2VVLA 2QAEA 1F6MA 4AOXA 5M0ZA 4JY2A 4YKFA 2ZZBA 3V3NA 2V3AA 4NWZA 1E1KA 2O9ZA 4H2QA 1ZOVA 3ISHA 1TYTA 2Z5YA 3K30A 3NGCX 4H4UA 5IQ4A 5HXIA 3SXIA 1CL0A 1EL8A 3BHFA 3NIXA 2BK5A 2H88A 2WP9A 4UDRA 4C5OA 1N4WA 1DODA 3SY4A 1ZP0A 2B9XA 2YWLA 3UKFA 2XLRA 1D4CA 3PVCA 2YG4A 2XVFA 4A79A 3GWDA 1LQUA 4ZN0A 4AOSA 3NH3X 4EM3A 3PS9A 2OLOA 4K5RA 1B4VA 3CPJG 3RNMA 3D8XA 4A6NB 1BGJA 1CJCA 2WQYA 4GDPA 1CBOA 4BV6A 3P1WA 5C2TA 1GETA 3F8DA 3LZWA 3NN6X 2IIDA 4X4JA 2EQ9A 3IHGA 3NK2X 4H4XA 4IV9A 4CRTA 1Y0PA 5HY5A 4WCTA 3LOVA 1EL9A 3K7TA 2GVCA 1FECA 2C3CA 3BI4A 4JNQA 2GRTA 4U8MA 2V3BA 2YG7A 3C4NA 4NEWA 1DJQA 4EQWA 5C3JA 4H4ZA 4B64A 1RSGA 1GESA 3T2ZA 4FK1A 4OPGA 5JCIA 1GRTA 1SEZA 4OPDA 3QVRA 1UKVG 3SZWA 3LJPA 1PBBA 1BKWA 2YLTA 1GRAA 3AEEA 4H4PA 4H4TA 3UKPA 4K2XA 1KFYA 4HB9A 4H50A 1E39A 2FJDA 4ADWA 1ZX9A 3CNTA 4MJWA 3AD7B 3NNEA 2WETA 4U8NA 4M52A 3IHMA 5J7XA 1LVLA 2V5ZA 1D7LA 3BI5A 5FS6A 4AP1A 1OJCA 1GEUA 1CC2A 2NVKX 2YAUA 2XLUA 1K4QA 4NTCA 3AWIA 3ITJA 2YG3A 2IVDA 5BRTA 3ABVA 3QSSA 4E0VA 2IVEA 4H4YA 2BCGG 1GTHA 3SQPA 4REKA 4CY6A 4YSZA 3QSEA 2E4GA 5BUKA 3LXDA 4GUVA 1OJDA 1E1NA 1YKJA 4Z44A 3NTDA 1IUVA 1PBFA 3GDPA 1PJ6A 4YSXA 3UKAA 2WP5A 3T14A 1S3EA 3S5WA 4Y4MA 1BWCA 4JQ9A 1CHUA 5BULA 4TM3A 1Z6LA 2X8HA 3CTYA 4LA1A 4YXDA 2HQMA 4YSHA 1VRQB 4CNJA 3L1RA 1GT8A 1NG3A 1V59A 3ICSA 1IJHA 1GRHA 2XVJA 4EMIA 2AR8A 5KMQA 2WPFA 1LTXR 3GYXA 3IWAA 1P2EA 5U25A 3V3OA 5KWFA 1JRXA 2C4CA 3RP6A 5JCNA 2OAMA 2Y6RA 3WE0A 1Q9IA 1H6VA 2APGA 4J33A 4UDQA 1KF6A 1MOKA 2TMDA 2YVFA 3AD9B 1H84A 3AXBA 4KPRA 5EOWA 4CBQA 5KVHA 1DXLA 1W4XA 2GR2A 3FMWA 4IA5A 4RG3A 1PXAA 4ZCDA 1N4UA 4U8KA 3RHAA 5L46A 2WPEA 1O95A 3BNMA 3RP8A 4U8JA 1JEHA 2BS3A 2VRMA 4A6NA 1EBDA 3UOXA 3LADA 5JCKA 1S2YA 2R0PA 3AEAA 2XDOA 2WHDA 3DK4A 2WOWA 1FOHA 2WP6A 2C72A 3AB1A 2VOUA 2BC1A 3SZCA 3UOYA 2R0CA 1Q1WA 2X99A 3P4RA 3P4PA 3GMBA 4TLXA 4DSHA 2TPRA 4O5UA 2R4JA 3CPIG 2XFOA 3KKJA 4TM1A 1YQ4A 5DBJA 3T31A 4EQSA 2JKCA 2V60A 2C76A 4B63A 1GSNA 2X3NA 1JRZA 5KMSA 3DK9A 4TM0A 1L9EA 2Z5XA 1CC4A 2YLXA 1NEKA 4LIIA 3NTAA 2BXSA 5KVIA 3CMMA 3AEDA 3AYLA 1CJ2A 2GH5A 4EM4A 2BACA 1K0JA 2X8GA 2XVIA 3S61A 2WDRA 1XPQA 3CNJA 1ONFA 2QCUA 2VQ7A 3UP5A 2DKIA 1PXCA 3GSIA 4A99A 4I58A 2GV8A 4YTMA 4ECHA 2ZZCA 2YLZA 1H82A 3ATRA 4NEVA 4H2NA 3BHKA 2X8CA 1GNDA 2XLTA 1ELIA 3NN0X 3P4SA 4TLZA 2YM2A 4YTNA 2RGJA 5CQFA 2WPCA 4X9MA 3NRNA 3KD9A 1GREA 2FJBA 3OC4A 4XXGA 2C66A 1HYUA 3D1CA 3AECA 1L0VA 2UZZA 3DGZA 3EF6A 4G6HA 2B7SA 1TDOA 2NPXA 1GXFA 3CNDA 4OPLA 3NLCA 1BF3A 4J31A 2PYXA 1GRGA 1BZLA 1K0IA 1P2HA 3HZLA 2RABA 4FDCB 4XWZA 3DMEA 3PO7A 3HYVA 2GMHA 3BNUA 2Q7VA 1IUTA 1TDNA 4NNJA 5EBKA 4CCRA 2B9WA 4JY3A 2FJAA 1OJAA 4U8LA 2V6OA 3AYJA 2BABA 3T0KA 3ZYXA 1NHRA 2BRAA 1PHHA 1Q1RA 4NTEA 3UKKA 4Z2UA 3GDNA 1N1PA 3EAOA 3QVPA 3NK1X 4ZCCA 3DH9A 4H4QA 2XLSA 1LPFA 3AE7A 4FX9A 4Z2RA 2C64A 2QA2A 3H8LA 4U2SA 1GERA 1CJ3A 1E1LA 5HYMA 2J3NA 2VZ2A 1OJTA 3UKHA 1LQTA 2B9YA 3Q9TA 4B1BA 2DKHA 4YWOA 3FBSA 4NTDA 3T37A 1O5WA 3CGDA 3FIMB 3FPZA 1KNRA 1L9CA 2EQ8A 1NHQA 2JK6A 4AT2A 4YSYA 5EB4A 1DOCA 3H4KA 3L8KA 1CF3A 1TRBA 2FJEA 3KPKA 3QSMA 1ZK7A 4WX1A 3SX6A 3UTGA 5HHFA 1E6EA 3DA1A 3DJEA 3GRSA 5U1OA 1JU2A 4OPTA 4A9WA 4Z26A 2JB2A 3GYJA 3G5RA 3NHOX 2F5ZA 3AE1A 3AE8A 1LV0A 2WDVA 1NENA 4EMWA 1EL7A 1D5TA 1D4EA 2XVHA 3C4AA 5TR3A 4D04A 5JCLA 2BK3A 4CNKA 4CCQA 5KOXA 1CJ4A 1GV4A 1PN0A 2V61A 1KSSA 1PBDA 1PJ7A 2WDQA 4U8PA 5GRTA 3SGLA 3AYIA 4TM4A 5LV9A 2C3DA 1DOBA 4GRTA 2JBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OJ9 A;  5FS7 A;  2YG5 A;  4J56 A;  3Q6J A;  4RSL A;  3RED A;  1IUU A;  4C3Y A;  3CN8 A;  4BJZ A;  1GAL A;  4B65 A;  3UOV A;  4GF7 A;  2GF3 A;  3UKQ A;  3P9U A;  2C65 A;  5IQ1 A;  2RGH A;  4CY8 A;  2WU2 A;  3O0H A;  1X31 B;  2VVL G;  2XFU A;  4I59 A;  3ALJ A;  2AAQ A;  3AE2 A;  4N9X A;  1IUS A;  4KX6 A;  4Y4L A;  4OPU A;  3M0O A;  3UTF A;  3F8R A;  4EQR A;  4U8O A;  4U2L A;  2GB0 A;  2B76 A;  3ICT A;  5KXJ A;  1AOG A;  3QFB A;  1TDE A;  3KVE A;  2GR3 A;  2GQW A;  2WEU A;  3SFE A;  5FMH A;  2JB3 A;  1YQZ A;  5GSN A;  4B66 A;  2WS3 A;  2YQU A;  1H86 A;  3AEB A;  3AE4 A;  3JSK A;  1D4D A;  3CGE A;  3IF9 A;  2X50 A;  5CKU A;  2B7R A;  3CNP A;  3QFA A;  3NT6 A;  4H4R A;  4APN A;  4YTP A;  3B3R A;  1YY5 A;  4X9N A;  1IUW A;  3CNS A;  5KRQ A;  1LJ1 A;  3EPT A;  4HA6 A;  4PAA A;  1DNC A;  1BGN A;  2XCG A;  4BK1 A;  1FCD A;  3KPF A;  1ZKQ A;  1H83 A;  4GCM A;  1FL2 A;  1QJD A;  2E1M A;  3CIR A;  2GR1 A;  2YVG A;  4P9S A;  2PHH A;  4H2P A;  1H7W A;  3VRB A;  4DSG A;  2R4E A;  4DGK A;  5ER0 A;  2Q0L A;  4LU6 A;  2Q0K A;  3K7M X;  1B5Q A;  2BK4 A;  3DJD A;  4EMJ A;  1S3B A;  1XDI A;  5U63 A;  1ZMC A;  4J2W A;  4B69 A;  4J36 A;  3IC9 A;  3F8P A;  2ARD A;  3KA7 A;  4Z2T A;  5IPY A;  3VQR A;  2YR5 A;  4H4V A;  2WBA A;  1IUX A;  2XYO A;  2XFN A;  2BS2 A;  2YR6 A;  4EIP A;  1ZDL A;  3H8I A;  1VG9 A;  1XHC A;  2BYB A;  3AE5 A;  1PXB A;  1PBC A;  1CC6 A;  1TYP A;  1M6I A;  3AEG A;  3QJ4 A;  1S2Q A;  1MXT A;  1VDC A;  1Y56 A;  3NYC A;  1F8W A;  1VQW A;  2VRL A;  2YLR A;  4JNA A;  4EIQ A;  4H4S A;  4BK3 A;  2VVM A;  2OA1 A;  2OLN A;  4Z24 A;  1RYI A;  3VR8 A;  3G5Q A;  3VR9 A;  2YM1 A;  4UDP A;  1DJN A;  4K7Z A;  2GQF A;  2VQB A;  3NG7 X;  2AQJ A;  1YQ3 A;  2WU5 A;  4XWR A;  2GR0 A;  1ZMD A;  2C67 A;  1D7Y A;  1NAA A;  2H89 A;  4D03 A;  2BA9 A;  4NZH A;  3UKL A;  3GD4 A;  1NHP A;  2R45 A;  1JNR A;  3G5S A;  2YLW A;  3ATQ A;  2OAL A;  4A7A A;  1JRY A;  5BVA A;  4GDE A;  1GTE A;  4USR A;  4J34 A;  1H7X A;  4O5Q A;  3AE9 A;  4FK1 C;  4B68 A;  3NYF A;  1COY A;  1QO8 A;  2GAH B;  3SFD A;  1F8S A;  2GMJ A;  4U8I A;  1DOE A;  2A8X A;  1REO A;  3P4Q A;  2CVJ A;  1PBE A;  1PS9 A;  1PDH A;  3UOZ A;  4K8D A;  3ADA B;  4C74 A;  3C96 A;  3GRT A;  4H2R A;  4U2T A;  3B6D A;  4H4W A;  3SM8 A;  1E7P A;  2EQ6 A;  1FEA A;  3FG2 P;  1E1M A;  3I3L A;  4Y4N A;  1H81 A;  1M64 A;  2JAE A;  1B8S A;  3KLJ A;  2YVJ A;  3NK0 X;  2C73 A;  1FEB A;  4ICY A;  4J57 A;  2I0Z A;  1JNZ A;  3BI2 A;  1KDG A;  1F3P A;  2R46 A;  1XAN A;  3NKS A;  3RP7 A;  4C3X A;  1GOS A;  1Y56 B;  3I6D A;  4OPC A;  1KSU A;  3CGB A;  1ZOY A;  3GMC A;  1ZY8 A;  1MO9 A;  3EAN A;  3DK8 A;  2XFQ A;  4IVM B;  2Q6U A;  5M10 A;  1TDK A;  2C70 A;  2RGO A;  3GWF A;  4JDR A;  3R9U A;  4USQ A;  3KU9 A;  2JB1 A;  2BCP A;  2YG6 A;  3AE3 A;  1NDA A;  3K7Q X;  3AEF A;  5EB5 A;  4A65 A;  4BUR A;  4AP3 A;  1QLB A;  3URH A;  5KOW A;  1NG4 A;  3V76 A;  4JN9 A;  2QA1 A;  2W0H A;  3COX A;  2R9Z A;  3ALM A;  4AT0 A;  2XVE A;  2EQ7 A;  2WOV A;  1GRB A;  2ACZ A;  3E1T A;  1EL5 A;  2A87 A;  2WOI A;  2C75 A;  3DJJ A;  4GR1 A;  1GPE A;  1N4V A;  1O94 A;  2ZZ0 A;  3LB8 A;  4IA6 A;  4OCG A;  1GRF A;  4PAB A;  3AD8 B;  3CGC A;  3M12 A;  1JOA A;  1NHS A;  4DNA A;  4OPI A;  4BK2 A;  1PJ5 A;  4OVI A;  2YR4 A;  2BXR A;  2FBW A;  3ICR A;  3LZX A;  5FS8 A;  3UTH A;  3VRD B;  2ZBW A;  4UP3 A;  1TDF A;  5JCM A;  2BS4 A;  3GYI A;  2XFP A;  1KNP A;  3CPH G;  3ALL A;  5FS9 A;  4EQX A;  1L9D A;  4K22 A;  5J60 A;  3UP4 A;  4RG4 A;  2A89 A;  2GEW A;  2CFY A;  1F8R A;  3NYE A;  3VRA A;  3UCL A;  3UTE A;  2Y6Q A;  3II4 A;  1B37 A;  2CDU A;  2CUL A;  2GAG B;  2C7G A;  4Z25 A;  2XLP A;  4C77 A;  2YLS A;  3DJG X;  2E5V A;  3ZDN A;  3DGH A;  3GD3 A;  4BJY A;  4YKG A;  4YT0 A;  3M13 A;  4B67 A;  3OZ2 A;  4K5S A;  2WES A;  3AE6 A;  4IVO B;  4A5L A;  4H7U A;  1NPX A;  4Z43 A;  1K0L A;  1VG0 A;  2BC0 A;  1RP0 A;  2R0G A;  2VVL A;  2QAE A;  1F6M A;  4AOX A;  5M0Z A;  4JY2 A;  4YKF A;  2ZZB A;  3V3N A;  2V3A A;  1E1K A;  2O9Z A;  4H2Q A;  1ZOV A;  3ISH A;  1TYT A;  2Z5Y A;  3K30 A;  3NGC X;  4H4U A;  5IQ4 A;  5HXI A;  1CL0 A;  1EL8 A;  3BHF A;  3NIX A;  2BK5 A;  2H88 A;  2WP9 A;  4UDR A;  4C5O A;  1N4W A;  1DOD A;  1ZP0 A;  2B9X A;  2YWL A;  3UKF A;  2XLR A;  1D4C A;  3PVC A;  2YG4 A;  2XVF A;  4A79 A;  3GWD A;  1LQU A;  4ZN0 A;  4AOS A;  3NH3 X;  4EM3 A;  3PS9 A;  2OLO A;  4K5R A;  1B4V A;  3CPJ G;  3RNM A;  3D8X A;  4A6N B;  1BGJ A;  1CJC A;  2WQY A;  4GDP A;  1CBO A;  4BV6 A;  3P1W A;  5C2T A;  1GET A;  3F8D A;  3LZW A;  3NN6 X;  2IID A;  4X4J A;  2EQ9 A;  3IHG A;  3NK2 X;  4H4X A;  4IV9 A;  4CRT A;  1Y0P A;  5HY5 A;  4WCT A;  3LOV A;  1EL9 A;  3K7T A;  2GVC A;  1FEC A;  2C3C A;  3BI4 A;  4JNQ A;  2GRT A;  4U8M A;  2V3B A;  2YG7 A;  3C4N A;  4NEW A;  1DJQ A;  4EQW A;  5C3J A;  4H4Z A;  4B64 A;  1RSG A;  1GES A;  4FK1 A;  4OPG A;  5JCI A;  1GRT A;  1SEZ A;  4OPD A;  3QVR A;  1UKV G;  3LJP A;  1PBB A;  1BKW A;  2YLT A;  1GRA A;  3AEE A;  4H4P A;  4H4T A;  3UKP A;  4K2X A;  1KFY A;  4HB9 A;  4H50 A;  1E39 A;  2FJD A;  4ADW A;  1ZX9 A;  3CNT A;  4MJW A;  3AD7 B;  3NNE A;  2WET A;  4U8N A;  4M52 A;  3IHM A;  5J7X A;  1LVL A;  2V5Z A;  1D7L A;  3BI5 A;  5FS6 A;  4AP1 A;  1OJC A;  1GEU A;  1CC2 A;  2NVK X;  2YAU A;  2XLU A;  1K4Q A;  4NTC A;  3AWI A;  3ITJ A;  2YG3 A;  2IVD A;  5BRT A;  3ABV A;  3QSS A;  4E0V A;  2IVE A;  4H4Y A;  2BCG G;  1GTH A;  3SQP A;  4REK A;  4CY6 A;  4YSZ A;  3QSE A;  2E4G A;  5BUK A;  3LXD A;  4GUV A;  1OJD A;  1E1N A;  1YKJ A;  4Z44 A;  3NTD A;  1IUV A;  1PBF A;  3GDP A;  1PJ6 A;  4YSX A;  3UKA A;  2WP5 A;  1S3E A;  3S5W A;  4Y4M A;  1BWC A;  4JQ9 A;  1CHU A;  5BUL A;  4TM3 A;  1Z6L A;  2X8H A;  3CTY A;  4LA1 A;  4YXD A;  2HQM A;  4YSH A;  1VRQ B;  4CNJ A;  3L1R A;  1GT8 A;  1NG3 A;  1V59 A;  3ICS A;  1IJH A;  1GRH A;  2XVJ A;  4EMI A;  2AR8 A;  2WPF A;  1LTX R;  3IWA A;  5U25 A;  1P2E A;  3V3O A;  5KWF A;  1JRX A;  3RP6 A;  5JCN A;  2OAM A;  2Y6R A;  3WE0 A;  1Q9I A;  1H6V A;  2APG A;  4J33 A;  4UDQ A;  1KF6 A;  1MOK A;  2TMD A;  2YVF A;  3AD9 B;  1H84 A;  3AXB A;  4KPR A;  5EOW A;  4CBQ A;  5KVH A;  1DXL A;  1W4X A;  2GR2 A;  3FMW A;  4IA5 A;  4RG3 A;  1PXA A;  4ZCD A;  1N4U A;  4U8K A;  3RHA A;  5L46 A;  2WPE A;  1O95 A;  3BNM A;  3RP8 A;  4U8J A;  1JEH A;  2BS3 A;  2VRM A;  4A6N A;  1EBD A;  3UOX A;  3LAD A;  5JCK A;  1S2Y A;  2R0P A;  3AEA A;  2XDO A;  2WHD A;  3DK4 A;  2WOW A;  1FOH A;  2WP6 A;  2C72 A;  3AB1 A;  2VOU A;  2BC1 A;  3UOY A;  2R0C A;  1Q1W A;  2X99 A;  3P4R A;  3P4P A;  3GMB A;  4TLX A;  4DSH A;  2TPR A;  4O5U A;  2R4J A;  3CPI G;  2XFO A;  3KKJ A;  4TM1 A;  1YQ4 A;  5DBJ A;  4EQS A;  2JKC A;  2V60 A;  2C76 A;  4B63 A;  1GSN A;  2X3N A;  1JRZ A;  3DK9 A;  4TM0 A;  1L9E A;  2Z5X A;  1CC4 A;  2YLX A;  1NEK A;  4LII A;  3NTA A;  2BXS A;  5KVI A;  3AED A;  3AYL A;  1CJ2 A;  2GH5 A;  4EM4 A;  2BAC A;  1K0J A;  2X8G A;  2XVI A;  3S61 A;  2WDR A;  1XPQ A;  3CNJ A;  1ONF A;  2QCU A;  2VQ7 A;  3UP5 A;  2DKI A;  1PXC A;  3GSI A;  4A99 A;  4I58 A;  2GV8 A;  4YTM A;  4ECH A;  2ZZC A;  2YLZ A;  1H82 A;  3ATR A;  4NEV A;  4H2N A;  3BHK A;  2X8C A;  1GND A;  2XLT A;  1ELI A;  3NN0 X;  3P4S A;  4TLZ A;  2YM2 A;  4YTN A;  2RGJ A;  5CQF A;  2WPC A;  4X9M A;  3NRN A;  3KD9 A;  1GRE A;  2FJB A;  3OC4 A;  4XXG A;  2C66 A;  1HYU A;  3D1C A;  3AEC A;  1L0V A;  2UZZ A;  3DGZ A;  3EF6 A;  2B7S A;  1TDO A;  2NPX A;  1GXF A;  3CND A;  4OPL A;  3NLC A;  1BF3 A;  4J31 A;  2PYX A;  1GRG A;  1BZL A;  1K0I A;  1P2H A;  3HZL A;  2RAB A;  4FDC B;  4XWZ A;  3DME A;  3PO7 A;  2GMH A;  3BNU A;  2Q7V A;  1IUT A;  1TDN A;  5EBK A;  4CCR A;  2B9W A;  4JY3 A;  2FJA A;  1OJA A;  4U8L A;  2V6O A;  3AYJ A;  2BAB A;  3ZYX A;  1NHR A;  1PHH A;  1Q1R A;  4NTE A;  3UKK A;  4Z2U A;  3GDN A;  1N1P A;  3EAO A;  3QVP A;  3NK1 X;  4ZCC A;  3DH9 A;  4H4Q A;  2XLS A;  1LPF A;  3AE7 A;  4FX9 A;  4Z2R A;  2C64 A;  2QA2 A;  3H8L A;  4U2S A;  1GER A;  1CJ3 A;  1E1L A;  5HYM A;  2J3N A;  2VZ2 A;  1OJT A;  3UKH A;  1LQT A;  2B9Y A;  3Q9T A;  4B1B A;  2DKH A;  4YWO A;  3FBS A;  4NTD A;  3T37 A;  1O5W A;  3CGD A;  3FIM B;  3FPZ A;  1KNR A;  1L9C A;  2EQ8 A;  1NHQ A;  2JK6 A;  4AT2 A;  4YSY A;  5EB4 A;  1DOC A;  3H4K A;  3L8K A;  1CF3 A;  1TRB A;  2FJE A;  3QSM A;  4WX1 A;  1ZK7 A;  3UTG A;  5HHF A;  1E6E A;  3DA1 A;  3DJE A;  3GRS A;  5U1O A;  1JU2 A;  4OPT A;  4A9W A;  4Z26 A;  2JB2 A;  3GYJ A;  3G5R A;  3NHO X;  2F5Z A;  3AE1 A;  3AE8 A;  1LV0 A;  2WDV A;  1NEN A;  4EMW A;  1EL7 A;  1D5T A;  1D4E A;  2XVH A;  3C4A A;  5TR3 A;  4D04 A;  5JCL A;  2BK3 A;  4CNK A;  4CCQ A;  5KOX A;  1CJ4 A;  1GV4 A;  1PN0 A;  2V61 A;  1KSS A;  1PBD A;  1PJ7 A;  2WDQ A;  4U8P A;  5GRT A;  3SGL A;  3AYI A;  4TM4 A;  5LV9 A;  2C3D A;  1DOB A;  4GRT A;  2JBV A; 
#chains in the Genus database with same CATH topology
 1OJ9 A;  5FS7 A;  2YG5 A;  4J56 A;  3HYW A;  3Q6J A;  4RSL A;  3RED A;  1IUU A;  4C3Y A;  4G9K A;  3CN8 A;  4BJZ A;  4GAP A;  1GAL A;  4B65 A;  3UOV A;  4GF7 A;  2GF3 A;  3UKQ A;  3P9U A;  2C65 A;  5IQ1 A;  2RGH A;  4CY8 A;  2WU2 A;  3O0H A;  1X31 B;  2VVL G;  2XFU A;  4I59 A;  3ALJ A;  2AAQ A;  3AE2 A;  4N9X A;  1IUS A;  4KX6 A;  4Y4L A;  4OPU A;  3M0O A;  3UTF A;  3F8R A;  4EQR A;  4U8O A;  4U2L A;  2GB0 A;  2B76 A;  3ICT A;  5KXJ A;  2BRY A;  1AOG A;  3QFB A;  1TDE A;  3KVE A;  2GR3 A;  2GQW A;  2WEU A;  3SFE A;  5FMH A;  2JB3 A;  1YQZ A;  5GSN A;  4B66 A;  2WS3 A;  2YQU A;  1H86 A;  3AEB A;  3SZF A;  3AE4 A;  3HYX A;  3JSK A;  1D4D A;  3CGE A;  3IF9 A;  4G73 A;  2X50 A;  5CKU A;  2B7R A;  3CNP A;  5KMR A;  4II3 A;  3QFA A;  3NT6 A;  4H4R A;  4APN A;  4YTP A;  3B3R A;  1YY5 A;  4X9N A;  1IUW A;  3CNS A;  5KRQ A;  1LJ1 A;  3EPT A;  4HA6 A;  4PAA A;  1DNC A;  1BGN A;  2XCG A;  4BK1 A;  1FCD A;  3KPF A;  1ZKQ A;  1H83 A;  4GCM A;  1FL2 A;  1QJD A;  2E1M A;  3CIR A;  2GR1 A;  2YVG A;  4P9S A;  2PHH A;  4H2P A;  1H7W A;  3VRB A;  5KNL A;  4DSG A;  2R4E A;  4DGK A;  5ER0 A;  2Q0L A;  4LU6 A;  2Q0K A;  3K7M X;  1B5Q A;  2BK4 A;  3DJD A;  4EMJ A;  1S3B A;  1XDI A;  5U63 A;  1ZMC A;  4J2W A;  4B69 A;  4J36 A;  3IC9 A;  3F8P A;  2ARD A;  3KA7 A;  4Z2T A;  5IPY A;  3VQR A;  2YR5 A;  4H4V A;  2WBA A;  1IUX A;  2XYO A;  2XFN A;  2BS2 A;  2YR6 A;  4EIP A;  1ZDL A;  3H8I A;  1VG9 A;  1XHC A;  2BYB A;  3AE5 A;  1PXB A;  1PBC A;  1CC6 A;  1TYP A;  1M6I A;  3AEG A;  3QJ4 A;  3SYI A;  1S2Q A;  1MXT A;  1VDC A;  1Y56 A;  3NYC A;  1F8W A;  1VQW A;  2VRL A;  2YLR A;  4JNA A;  4EIQ A;  4H4S A;  4BK3 A;  2VVM A;  2OA1 A;  2OLN A;  4Z24 A;  1RYI A;  3VR8 A;  3G5Q A;  3VR9 A;  2YM1 A;  4UDP A;  1DJN A;  4K7Z A;  2GQF A;  2VQB A;  3NG7 X;  2AQJ A;  1YQ3 A;  2WU5 A;  4XWR A;  2GR0 A;  1ZMD A;  2C67 A;  1D7Y A;  1NAA A;  2H89 A;  4D03 A;  2BA9 A;  4NZH A;  3UKL A;  3GD4 A;  1NHP A;  2R45 A;  1JNR A;  3T2Y A;  3G5S A;  2YLW A;  3ATQ A;  2OAL A;  4A7A A;  1JRY A;  5BVA A;  4GDE A;  1GTE A;  4USR A;  4J34 A;  1H7X A;  4O5Q A;  3AE9 A;  4FK1 C;  4B68 A;  3NYF A;  1COY A;  1QO8 A;  2GAH B;  3SFD A;  1F8S A;  2GMJ A;  4U8I A;  1DOE A;  2A8X A;  1REO A;  3P4Q A;  2CVJ A;  1PBE A;  3T2K A;  1PS9 A;  1PDH A;  3UOZ A;  4K8D A;  3ADA B;  4C74 A;  3C96 A;  3GRT A;  4H2R A;  4U2T A;  3B6D A;  4H4W A;  3SM8 A;  1E7P A;  2EQ6 A;  1FEA A;  3FG2 P;  1E1M A;  3I3L A;  4Y4N A;  1H81 A;  1M64 A;  2JAE A;  1B8S A;  3KLJ A;  2YVJ A;  3NK0 X;  2C73 A;  1FEB A;  4ICY A;  4J57 A;  5KMP A;  2I0Z A;  1JNZ A;  3BI2 A;  1KDG A;  1F3P A;  2R46 A;  1XAN A;  3NKS A;  3RP7 A;  4C3X A;  1GOS A;  1Y56 B;  3I6D A;  4OPC A;  1KSU A;  3CGB A;  1ZOY A;  3GMC A;  1ZY8 A;  1MO9 A;  3EAN A;  3DK8 A;  2XFQ A;  4IVM B;  2Q6U A;  5M10 A;  1TDK A;  2C70 A;  2RGO A;  3GWF A;  4JDR A;  3R9U A;  4USQ A;  3KU9 A;  2JB1 A;  2BCP A;  2YG6 A;  3AE3 A;  1NDA A;  3K7Q X;  3AEF A;  5EB5 A;  4A65 A;  4BUR A;  4AP3 A;  1QLB A;  3URH A;  5KOW A;  1NG4 A;  3V76 A;  4JN9 A;  2QA1 A;  2W0H A;  3COX A;  2R9Z A;  3ALM A;  4AT0 A;  2XVE A;  2EQ7 A;  2WOV A;  1GRB A;  2ACZ A;  3E1T A;  1EL5 A;  2A87 A;  2WOI A;  2C75 A;  3DJJ A;  4GR1 A;  1GPE A;  1N4V A;  4G74 A;  1O94 A;  2ZZ0 A;  3LB8 A;  4IA6 A;  4OCG A;  1GRF A;  4PAB A;  3AD8 B;  3CGC A;  3M12 A;  1JOA A;  1NHS A;  4DNA A;  4OPI A;  4BK2 A;  1PJ5 A;  4OVI A;  2YR4 A;  2BXR A;  2FBW A;  3ICR A;  3LZX A;  5FS8 A;  3UTH A;  3VRD B;  2ZBW A;  4UP3 A;  1TDF A;  5JCM A;  2BS4 A;  3GYI A;  2XFP A;  1KNP A;  3CPH G;  3ALL A;  5FS9 A;  4EQX A;  1L9D A;  4K22 A;  5J60 A;  3UP4 A;  4RG4 A;  2A89 A;  2GEW A;  2CFY A;  1F8R A;  3NYE A;  3VRA A;  3UCL A;  3UTE A;  2Y6Q A;  3II4 A;  4GAV A;  1B37 A;  2CDU A;  2CUL A;  2GAG B;  2C7G A;  4Z25 A;  2XLP A;  4C77 A;  2YLS A;  3DJG X;  2E5V A;  3ZDN A;  3DGH A;  3GD3 A;  4BJY A;  4YKG A;  4YT0 A;  3M13 A;  4B67 A;  3OZ2 A;  4K5S A;  4II2 A;  2WES A;  3AE6 A;  4IVO B;  4A5L A;  4H7U A;  1NPX A;  4G6G A;  4Z43 A;  3SZ0 A;  1K0L A;  1VG0 A;  2BC0 A;  1RP0 A;  2R0G A;  2VVL A;  2QAE A;  1F6M A;  4AOX A;  5M0Z A;  4JY2 A;  4YKF A;  2ZZB A;  3V3N A;  2V3A A;  4NWZ A;  1E1K A;  2O9Z A;  4H2Q A;  1ZOV A;  3ISH A;  1TYT A;  2Z5Y A;  3K30 A;  3NGC X;  4H4U A;  5IQ4 A;  5HXI A;  3SXI A;  1CL0 A;  1EL8 A;  3BHF A;  3NIX A;  2BK5 A;  2H88 A;  2WP9 A;  4UDR A;  4C5O A;  1N4W A;  1DOD A;  3SY4 A;  1ZP0 A;  2B9X A;  2YWL A;  3UKF A;  2XLR A;  1D4C A;  3PVC A;  2YG4 A;  2XVF A;  4A79 A;  3GWD A;  1LQU A;  4ZN0 A;  4AOS A;  3NH3 X;  4EM3 A;  3PS9 A;  2OLO A;  4K5R A;  1B4V A;  3CPJ G;  3RNM A;  3D8X A;  4A6N B;  1BGJ A;  1CJC A;  2WQY A;  4GDP A;  1CBO A;  4BV6 A;  3P1W A;  5C2T A;  1GET A;  3F8D A;  3LZW A;  3NN6 X;  2IID A;  4X4J A;  2EQ9 A;  3IHG A;  3NK2 X;  4H4X A;  4IV9 A;  4CRT A;  1Y0P A;  5HY5 A;  4WCT A;  3LOV A;  1EL9 A;  3K7T A;  2GVC A;  1FEC A;  2C3C A;  3BI4 A;  4JNQ A;  2GRT A;  4U8M A;  2V3B A;  2YG7 A;  3C4N A;  4NEW A;  1DJQ A;  4EQW A;  5C3J A;  4H4Z A;  4B64 A;  1RSG A;  1GES A;  3T2Z A;  4FK1 A;  4OPG A;  5JCI A;  1GRT A;  1SEZ A;  4OPD A;  3QVR A;  1UKV G;  3SZW A;  3LJP A;  1PBB A;  1BKW A;  2YLT A;  1GRA A;  3AEE A;  4H4P A;  4H4T A;  3UKP A;  4K2X A;  1KFY A;  4HB9 A;  4H50 A;  1E39 A;  2FJD A;  4ADW A;  1ZX9 A;  3CNT A;  4MJW A;  3AD7 B;  3NNE A;  2WET A;  4U8N A;  4M52 A;  3IHM A;  5J7X A;  1LVL A;  2V5Z A;  1D7L A;  3BI5 A;  5FS6 A;  4AP1 A;  1OJC A;  1GEU A;  1CC2 A;  2NVK X;  2YAU A;  2XLU A;  1K4Q A;  4NTC A;  3AWI A;  3ITJ A;  2YG3 A;  2IVD A;  5BRT A;  3ABV A;  3QSS A;  4E0V A;  2IVE A;  4H4Y A;  2BCG G;  1GTH A;  3SQP A;  4REK A;  4CY6 A;  4YSZ A;  3QSE A;  2E4G A;  5BUK A;  3LXD A;  4GUV A;  1OJD A;  1E1N A;  1YKJ A;  4Z44 A;  3NTD A;  1IUV A;  1PBF A;  3GDP A;  1PJ6 A;  4YSX A;  3UKA A;  2WP5 A;  3T14 A;  1S3E A;  3S5W A;  4Y4M A;  1BWC A;  4JQ9 A;  1CHU A;  5BUL A;  4TM3 A;  1Z6L A;  2X8H A;  3CTY A;  4LA1 A;  4YXD A;  2HQM A;  4YSH A;  1VRQ B;  4CNJ A;  3L1R A;  1GT8 A;  1NG3 A;  1V59 A;  3ICS A;  1IJH A;  1GRH A;  2XVJ A;  4EMI A;  2AR8 A;  5KMQ A;  2WPF A;  1LTX R;  3GYX A;  3IWA A;  1P2E A;  5U25 A;  3V3O A;  5KWF A;  1JRX A;  2C4C A;  3RP6 A;  5JCN A;  2OAM A;  2Y6R A;  3WE0 A;  1Q9I A;  1H6V A;  2APG A;  4J33 A;  4UDQ A;  1KF6 A;  1MOK A;  2TMD A;  2YVF A;  3AD9 B;  1H84 A;  3AXB A;  4KPR A;  5EOW A;  4CBQ A;  5KVH A;  1DXL A;  1W4X A;  2GR2 A;  3FMW A;  4IA5 A;  4RG3 A;  1PXA A;  4ZCD A;  1N4U A;  4U8K A;  3RHA A;  5L46 A;  2WPE A;  1O95 A;  3BNM A;  3RP8 A;  4U8J A;  1JEH A;  2BS3 A;  2VRM A;  4A6N A;  1EBD A;  3UOX A;  3LAD A;  5JCK A;  1S2Y A;  2R0P A;  3AEA A;  2XDO A;  2WHD A;  3DK4 A;  2WOW A;  1FOH A;  2WP6 A;  2C72 A;  3AB1 A;  2VOU A;  2BC1 A;  3SZC A;  3UOY A;  2R0C A;  1Q1W A;  2X99 A;  3P4R A;  3P4P A;  3GMB A;  4TLX A;  4DSH A;  2TPR A;  4O5U A;  2R4J A;  3CPI G;  2XFO A;  3KKJ A;  4TM1 A;  1YQ4 A;  5DBJ A;  3T31 A;  4EQS A;  2JKC A;  2V60 A;  2C76 A;  4B63 A;  1GSN A;  2X3N A;  1JRZ A;  5KMS A;  3DK9 A;  4TM0 A;  1L9E A;  2Z5X A;  1CC4 A;  2YLX A;  1NEK A;  4LII A;  3NTA A;  2BXS A;  5KVI A;  3CMM A;  3AED A;  3AYL A;  1CJ2 A;  2GH5 A;  4EM4 A;  2BAC A;  1K0J A;  2X8G A;  2XVI A;  3S61 A;  2WDR A;  1XPQ A;  3CNJ A;  1ONF A;  2QCU A;  2VQ7 A;  3UP5 A;  2DKI A;  1PXC A;  3GSI A;  4A99 A;  4I58 A;  2GV8 A;  4YTM A;  4ECH A;  2ZZC A;  2YLZ A;  1H82 A;  3ATR A;  4NEV A;  4H2N A;  3BHK A;  2X8C A;  1GND A;  2XLT A;  1ELI A;  3NN0 X;  3P4S A;  4TLZ A;  2YM2 A;  4YTN A;  2RGJ A;  5CQF A;  2WPC A;  4X9M A;  3NRN A;  3KD9 A;  1GRE A;  2FJB A;  3OC4 A;  4XXG A;  2C66 A;  1HYU A;  3D1C A;  3AEC A;  1L0V A;  2UZZ A;  3DGZ A;  3EF6 A;  4G6H A;  2B7S A;  1TDO A;  2NPX A;  1GXF A;  3CND A;  4OPL A;  3NLC A;  1BF3 A;  4J31 A;  2PYX A;  1GRG A;  1BZL A;  1K0I A;  1P2H A;  3HZL A;  2RAB A;  4FDC B;  4XWZ A;  3DME A;  3PO7 A;  3HYV A;  2GMH A;  3BNU A;  2Q7V A;  1IUT A;  1TDN A;  4NNJ A;  5EBK A;  4CCR A;  2B9W A;  4JY3 A;  2FJA A;  1OJA A;  4U8L A;  2V6O A;  3AYJ A;  2BAB A;  3T0K A;  3ZYX A;  1NHR A;  2BRA A;  1PHH A;  1Q1R A;  4NTE A;  3UKK A;  4Z2U A;  3GDN A;  1N1P A;  3EAO A;  3QVP A;  3NK1 X;  4ZCC A;  3DH9 A;  4H4Q A;  2XLS A;  1LPF A;  3AE7 A;  4FX9 A;  4Z2R A;  2C64 A;  2QA2 A;  3H8L A;  4U2S A;  1GER A;  1CJ3 A;  1E1L A;  5HYM A;  2J3N A;  2VZ2 A;  1OJT A;  3UKH A;  1LQT A;  2B9Y A;  3Q9T A;  4B1B A;  2DKH A;  4YWO A;  3FBS A;  4NTD A;  3T37 A;  1O5W A;  3CGD A;  3FIM B;  3FPZ A;  1KNR A;  1L9C A;  2EQ8 A;  1NHQ A;  2JK6 A;  4AT2 A;  4YSY A;  5EB4 A;  1DOC A;  3H4K A;  3L8K A;  1CF3 A;  1TRB A;  2FJE A;  3KPK A;  3QSM A;  1ZK7 A;  4WX1 A;  3SX6 A;  3UTG A;  5HHF A;  1E6E A;  3DA1 A;  3DJE A;  3GRS A;  5U1O A;  1JU2 A;  4OPT A;  4A9W A;  4Z26 A;  2JB2 A;  3GYJ A;  3G5R A;  3NHO X;  2F5Z A;  3AE1 A;  3AE8 A;  1LV0 A;  2WDV A;  1NEN A;  4EMW A;  1EL7 A;  1D5T A;  1D4E A;  2XVH A;  3C4A A;  5TR3 A;  4D04 A;  5JCL A;  2BK3 A;  4CNK A;  4CCQ A;  5KOX A;  1CJ4 A;  1GV4 A;  1PN0 A;  2V61 A;  1KSS A;  1PBD A;  1PJ7 A;  2WDQ A;  4U8P A;  5GRT A;  3SGL A;  3AYI A;  4TM4 A;  5LV9 A;  2C3D A;  1DOB A;  4GRT A;  2JBV A; 
#chains in the Genus database with same CATH homology
 1OJ9 A;  5FS7 A;  2YG5 A;  4J56 A;  3HYW A;  3Q6J A;  4RSL A;  3RED A;  1IUU A;  4C3Y A;  4G9K A;  3CN8 A;  4BJZ A;  4GAP A;  1GAL A;  4B65 A;  3UOV A;  4GF7 A;  2GF3 A;  3UKQ A;  3P9U A;  2C65 A;  5IQ1 A;  2RGH A;  4CY8 A;  2WU2 A;  3O0H A;  1X31 B;  2VVL G;  2XFU A;  4I59 A;  3ALJ A;  2AAQ A;  3AE2 A;  4N9X A;  1IUS A;  4KX6 A;  4Y4L A;  4OPU A;  3M0O A;  3UTF A;  3F8R A;  4EQR A;  4U8O A;  4U2L A;  2GB0 A;  2B76 A;  3ICT A;  5KXJ A;  2BRY A;  1AOG A;  3QFB A;  1TDE A;  3KVE A;  2GR3 A;  2GQW A;  2WEU A;  3SFE A;  5FMH A;  2JB3 A;  1YQZ A;  5GSN A;  4B66 A;  2WS3 A;  2YQU A;  1H86 A;  3AEB A;  3SZF A;  3AE4 A;  3HYX A;  3JSK A;  1D4D A;  3CGE A;  3IF9 A;  4G73 A;  2X50 A;  5CKU A;  2B7R A;  3CNP A;  5KMR A;  4II3 A;  3QFA A;  3NT6 A;  4H4R A;  4APN A;  4YTP A;  3B3R A;  1YY5 A;  4X9N A;  1IUW A;  3CNS A;  5KRQ A;  1LJ1 A;  3EPT A;  4HA6 A;  4PAA A;  1DNC A;  1BGN A;  2XCG A;  4BK1 A;  1FCD A;  3KPF A;  1ZKQ A;  1H83 A;  4GCM A;  1FL2 A;  1QJD A;  2E1M A;  3CIR A;  2GR1 A;  2YVG A;  4P9S A;  2PHH A;  4H2P A;  1H7W A;  3VRB A;  5KNL A;  4DSG A;  2R4E A;  4DGK A;  5ER0 A;  2Q0L A;  4LU6 A;  2Q0K A;  3K7M X;  1B5Q A;  2BK4 A;  3DJD A;  4EMJ A;  1S3B A;  1XDI A;  5U63 A;  1ZMC A;  4J2W A;  4B69 A;  4J36 A;  3IC9 A;  3F8P A;  2ARD A;  3KA7 A;  4Z2T A;  5IPY A;  3VQR A;  2YR5 A;  4H4V A;  2WBA A;  1IUX A;  2XYO A;  2XFN A;  2BS2 A;  2YR6 A;  4EIP A;  1ZDL A;  3H8I A;  1VG9 A;  1XHC A;  2BYB A;  3AE5 A;  1PXB A;  1PBC A;  1CC6 A;  1TYP A;  1M6I A;  3AEG A;  3QJ4 A;  3SYI A;  1S2Q A;  1MXT A;  1VDC A;  1Y56 A;  3NYC A;  1F8W A;  1VQW A;  2VRL A;  2YLR A;  4JNA A;  4EIQ A;  4H4S A;  4BK3 A;  2VVM A;  2OA1 A;  2OLN A;  4Z24 A;  1RYI A;  3VR8 A;  3G5Q A;  3VR9 A;  2YM1 A;  4UDP A;  1DJN A;  4K7Z A;  2GQF A;  2VQB A;  3NG7 X;  2AQJ A;  1YQ3 A;  2WU5 A;  4XWR A;  2GR0 A;  1ZMD A;  2C67 A;  1D7Y A;  1NAA A;  2H89 A;  4D03 A;  2BA9 A;  4NZH A;  3UKL A;  3GD4 A;  1NHP A;  2R45 A;  1JNR A;  3T2Y A;  3G5S A;  2YLW A;  3ATQ A;  2OAL A;  4A7A A;  1JRY A;  5BVA A;  4GDE A;  1GTE A;  4USR A;  4J34 A;  1H7X A;  4O5Q A;  3AE9 A;  4FK1 C;  4B68 A;  3NYF A;  1COY A;  1QO8 A;  2GAH B;  3SFD A;  1F8S A;  2GMJ A;  4U8I A;  1DOE A;  2A8X A;  1REO A;  3P4Q A;  2CVJ A;  1PBE A;  3T2K A;  1PS9 A;  1PDH A;  3UOZ A;  4K8D A;  3ADA B;  4C74 A;  3C96 A;  3GRT A;  4H2R A;  4U2T A;  3B6D A;  4H4W A;  3SM8 A;  1E7P A;  2EQ6 A;  1FEA A;  3FG2 P;  1E1M A;  3I3L A;  4Y4N A;  1H81 A;  1M64 A;  2JAE A;  1B8S A;  3KLJ A;  2YVJ A;  3NK0 X;  2C73 A;  1FEB A;  4ICY A;  4J57 A;  5KMP A;  2I0Z A;  1JNZ A;  3BI2 A;  1KDG A;  1F3P A;  2R46 A;  1XAN A;  3NKS A;  3RP7 A;  4C3X A;  1GOS A;  1Y56 B;  3I6D A;  4OPC A;  1KSU A;  3CGB A;  1ZOY A;  3GMC A;  1ZY8 A;  1MO9 A;  3EAN A;  3DK8 A;  2XFQ A;  4IVM B;  2Q6U A;  5M10 A;  1TDK A;  2C70 A;  2RGO A;  3GWF A;  4JDR A;  3R9U A;  4USQ A;  3KU9 A;  2JB1 A;  2BCP A;  2YG6 A;  3AE3 A;  1NDA A;  3K7Q X;  3AEF A;  5EB5 A;  4A65 A;  4BUR A;  4AP3 A;  1QLB A;  3URH A;  5KOW A;  1NG4 A;  3V76 A;  4JN9 A;  2QA1 A;  2W0H A;  3COX A;  2R9Z A;  3ALM A;  4AT0 A;  2XVE A;  2EQ7 A;  2WOV A;  1GRB A;  2ACZ A;  3E1T A;  1EL5 A;  2A87 A;  2WOI A;  2C75 A;  3DJJ A;  4GR1 A;  1GPE A;  1N4V A;  4G74 A;  1O94 A;  2ZZ0 A;  3LB8 A;  4IA6 A;  4OCG A;  1GRF A;  4PAB A;  3AD8 B;  3CGC A;  3M12 A;  1JOA A;  1NHS A;  4DNA A;  4OPI A;  4BK2 A;  1PJ5 A;  4OVI A;  2YR4 A;  2BXR A;  2FBW A;  3ICR A;  3LZX A;  5FS8 A;  3UTH A;  3VRD B;  2ZBW A;  4UP3 A;  1TDF A;  5JCM A;  2BS4 A;  3GYI A;  2XFP A;  1KNP A;  3CPH G;  3ALL A;  5FS9 A;  4EQX A;  1L9D A;  4K22 A;  5J60 A;  3UP4 A;  4RG4 A;  2A89 A;  2GEW A;  2CFY A;  1F8R A;  3NYE A;  3VRA A;  3UCL A;  3UTE A;  2Y6Q A;  3II4 A;  4GAV A;  1B37 A;  2CDU A;  2CUL A;  2GAG B;  2C7G A;  4Z25 A;  2XLP A;  4C77 A;  2YLS A;  3DJG X;  2E5V A;  3ZDN A;  3DGH A;  3GD3 A;  4BJY A;  4YKG A;  4YT0 A;  3M13 A;  4B67 A;  3OZ2 A;  4K5S A;  4II2 A;  2WES A;  3AE6 A;  4IVO B;  4A5L A;  4H7U A;  1NPX A;  4G6G A;  4Z43 A;  3SZ0 A;  1K0L A;  1VG0 A;  2BC0 A;  1RP0 A;  2R0G A;  2VVL A;  2QAE A;  1F6M A;  4AOX A;  5M0Z A;  4JY2 A;  4YKF A;  2ZZB A;  3V3N A;  2V3A A;  4NWZ A;  1E1K A;  2O9Z A;  4H2Q A;  1ZOV A;  3ISH A;  1TYT A;  2Z5Y A;  3K30 A;  3NGC X;  4H4U A;  5IQ4 A;  5HXI A;  3SXI A;  1CL0 A;  1EL8 A;  3BHF A;  3NIX A;  2BK5 A;  2H88 A;  2WP9 A;  4UDR A;  4C5O A;  1N4W A;  1DOD A;  3SY4 A;  1ZP0 A;  2B9X A;  2YWL A;  3UKF A;  2XLR A;  1D4C A;  3PVC A;  2YG4 A;  2XVF A;  4A79 A;  3GWD A;  1LQU A;  4ZN0 A;  4AOS A;  3NH3 X;  4EM3 A;  3PS9 A;  2OLO A;  4K5R A;  1B4V A;  3CPJ G;  3RNM A;  3D8X A;  4A6N B;  1BGJ A;  1CJC A;  2WQY A;  4GDP A;  1CBO A;  4BV6 A;  3P1W A;  5C2T A;  1GET A;  3F8D A;  3LZW A;  3NN6 X;  2IID A;  4X4J A;  2EQ9 A;  3IHG A;  3NK2 X;  4H4X A;  4IV9 A;  4CRT A;  1Y0P A;  5HY5 A;  4WCT A;  3LOV A;  1EL9 A;  3K7T A;  2GVC A;  1FEC A;  2C3C A;  3BI4 A;  4JNQ A;  2GRT A;  4U8M A;  2V3B A;  2YG7 A;  3C4N A;  4NEW A;  1DJQ A;  4EQW A;  5C3J A;  4H4Z A;  4B64 A;  1RSG A;  1GES A;  3T2Z A;  4FK1 A;  4OPG A;  5JCI A;  1GRT A;  1SEZ A;  4OPD A;  3QVR A;  1UKV G;  3SZW A;  3LJP A;  1PBB A;  1BKW A;  2YLT A;  1GRA A;  3AEE A;  4H4P A;  4H4T A;  3UKP A;  4K2X A;  1KFY A;  4HB9 A;  4H50 A;  1E39 A;  2FJD A;  4ADW A;  1ZX9 A;  3CNT A;  4MJW A;  3AD7 B;  3NNE A;  2WET A;  4U8N A;  4M52 A;  3IHM A;  5J7X A;  1LVL A;  2V5Z A;  1D7L A;  3BI5 A;  5FS6 A;  4AP1 A;  1OJC A;  1GEU A;  1CC2 A;  2NVK X;  2YAU A;  2XLU A;  1K4Q A;  4NTC A;  3AWI A;  3ITJ A;  2YG3 A;  2IVD A;  5BRT A;  3ABV A;  3QSS A;  4E0V A;  2IVE A;  4H4Y A;  2BCG G;  1GTH A;  3SQP A;  4REK A;  4CY6 A;  4YSZ A;  3QSE A;  2E4G A;  5BUK A;  3LXD A;  4GUV A;  1OJD A;  1E1N A;  1YKJ A;  4Z44 A;  3NTD A;  1IUV A;  1PBF A;  3GDP A;  1PJ6 A;  4YSX A;  3UKA A;  2WP5 A;  3T14 A;  1S3E A;  3S5W A;  4Y4M A;  1BWC A;  4JQ9 A;  1CHU A;  5BUL A;  4TM3 A;  1Z6L A;  2X8H A;  3CTY A;  4LA1 A;  4YXD A;  2HQM A;  4YSH A;  1VRQ B;  4CNJ A;  3L1R A;  1GT8 A;  1NG3 A;  1V59 A;  3ICS A;  1IJH A;  1GRH A;  2XVJ A;  4EMI A;  2AR8 A;  5KMQ A;  2WPF A;  1LTX R;  3GYX A;  3IWA A;  1P2E A;  5U25 A;  3V3O A;  5KWF A;  1JRX A;  2C4C A;  3RP6 A;  5JCN A;  2OAM A;  2Y6R A;  3WE0 A;  1Q9I A;  1H6V A;  2APG A;  4J33 A;  4UDQ A;  1KF6 A;  1MOK A;  2TMD A;  2YVF A;  3AD9 B;  1H84 A;  3AXB A;  4KPR A;  5EOW A;  4CBQ A;  5KVH A;  1DXL A;  1W4X A;  2GR2 A;  3FMW A;  4IA5 A;  4RG3 A;  1PXA A;  4ZCD A;  1N4U A;  4U8K A;  3RHA A;  5L46 A;  2WPE A;  1O95 A;  3BNM A;  3RP8 A;  4U8J A;  1JEH A;  2BS3 A;  2VRM A;  4A6N A;  1EBD A;  3UOX A;  3LAD A;  5JCK A;  1S2Y A;  2R0P A;  3AEA A;  2XDO A;  2WHD A;  3DK4 A;  2WOW A;  1FOH A;  2WP6 A;  2C72 A;  3AB1 A;  2VOU A;  2BC1 A;  3SZC A;  3UOY A;  2R0C A;  1Q1W A;  2X99 A;  3P4R A;  3P4P A;  3GMB A;  4TLX A;  4DSH A;  2TPR A;  4O5U A;  2R4J A;  3CPI G;  2XFO A;  3KKJ A;  4TM1 A;  1YQ4 A;  5DBJ A;  3T31 A;  4EQS A;  2JKC A;  2V60 A;  2C76 A;  4B63 A;  1GSN A;  2X3N A;  1JRZ A;  5KMS A;  3DK9 A;  4TM0 A;  1L9E A;  2Z5X A;  1CC4 A;  2YLX A;  1NEK A;  4LII A;  3NTA A;  2BXS A;  5KVI A;  3CMM A;  3AED A;  3AYL A;  1CJ2 A;  2GH5 A;  4EM4 A;  2BAC A;  1K0J A;  2X8G A;  2XVI A;  3S61 A;  2WDR A;  1XPQ A;  3CNJ A;  1ONF A;  2QCU A;  2VQ7 A;  3UP5 A;  2DKI A;  1PXC A;  3GSI A;  4A99 A;  4I58 A;  2GV8 A;  4YTM A;  4ECH A;  2ZZC A;  2YLZ A;  1H82 A;  3ATR A;  4NEV A;  4H2N A;  3BHK A;  2X8C A;  1GND A;  2XLT A;  1ELI A;  3NN0 X;  3P4S A;  4TLZ A;  2YM2 A;  4YTN A;  2RGJ A;  5CQF A;  2WPC A;  4X9M A;  3NRN A;  3KD9 A;  1GRE A;  2FJB A;  3OC4 A;  4XXG A;  2C66 A;  1HYU A;  3D1C A;  3AEC A;  1L0V A;  2UZZ A;  3DGZ A;  3EF6 A;  4G6H A;  2B7S A;  1TDO A;  2NPX A;  1GXF A;  3CND A;  4OPL A;  3NLC A;  1BF3 A;  4J31 A;  2PYX A;  1GRG A;  1BZL A;  1K0I A;  1P2H A;  3HZL A;  2RAB A;  4FDC B;  4XWZ A;  3DME A;  3PO7 A;  3HYV A;  2GMH A;  3BNU A;  2Q7V A;  1IUT A;  1TDN A;  4NNJ A;  5EBK A;  4CCR A;  2B9W A;  4JY3 A;  2FJA A;  1OJA A;  4U8L A;  2V6O A;  3AYJ A;  2BAB A;  3T0K A;  3ZYX A;  1NHR A;  2BRA A;  1PHH A;  1Q1R A;  4NTE A;  3UKK A;  4Z2U A;  3GDN A;  1N1P A;  3EAO A;  3QVP A;  3NK1 X;  4ZCC A;  3DH9 A;  4H4Q A;  2XLS A;  1LPF A;  3AE7 A;  4FX9 A;  4Z2R A;  2C64 A;  2QA2 A;  3H8L A;  4U2S A;  1GER A;  1CJ3 A;  1E1L A;  5HYM A;  2J3N A;  2VZ2 A;  1OJT A;  3UKH A;  1LQT A;  2B9Y A;  3Q9T A;  4B1B A;  2DKH A;  4YWO A;  3FBS A;  4NTD A;  3T37 A;  1O5W A;  3CGD A;  3FIM B;  3FPZ A;  1KNR A;  1L9C A;  2EQ8 A;  1NHQ A;  2JK6 A;  4AT2 A;  4YSY A;  5EB4 A;  1DOC A;  3H4K A;  3L8K A;  1CF3 A;  1TRB A;  2FJE A;  3KPK A;  3QSM A;  1ZK7 A;  4WX1 A;  3SX6 A;  3UTG A;  5HHF A;  1E6E A;  3DA1 A;  3DJE A;  3GRS A;  5U1O A;  1JU2 A;  4OPT A;  4A9W A;  4Z26 A;  2JB2 A;  3GYJ A;  3G5R A;  3NHO X;  2F5Z A;  3AE1 A;  3AE8 A;  1LV0 A;  2WDV A;  1NEN A;  4EMW A;  1EL7 A;  1D5T A;  1D4E A;  2XVH A;  3C4A A;  5TR3 A;  4D04 A;  5JCL A;  2BK3 A;  4CNK A;  4CCQ A;  5KOX A;  1CJ4 A;  1GV4 A;  1PN0 A;  2V61 A;  1KSS A;  1PBD A;  1PJ7 A;  2WDQ A;  4U8P A;  5GRT A;  3SGL A;  3AYI A;  4TM4 A;  5LV9 A;  2C3D A;  1DOB A;  4GRT A;  2JBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...