3KPFA

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays
Total Genus 167
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
167
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 167
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kpfA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kpfA02
3QSMA 2JB1A 1ZDLA 1IUXA 2BC1A 3IHGA 3UKLA 4RG4A 2XFNA 3CNJA 4BK3A 1K4QA 4GR1A 4B67A 4XXGA 1B5QA 1H82A 3AE5A 4EMWA 2B7SA 2C70A 2XVHA 1GRFA 2R4JA 3KKJA 2WU5A 4B66A 1JRXA 2YLZA 3DGZA 1E1KA 5M0ZA 2OLOA 2XFOA 4ZCDA 2WP6A 3LZWA 1PS9A 3RHAA 1S3BA 1TDFA 2C65A 4GRTA 1DOCA 1JOAA 2GF3A 3CN8A 1PBEA 1VG0A 3QSSA 3DGHA 3K7TA 2XLUA 3H4KA 2ARDA 4TM1A 5BUKA 3REDA 4BJZA 3V3OA 1Y0PA 1YQ4A 4U2LA 3LB8A 3ICRA 3P1WA 2OALA 1XDIA 3GMCA 4K22A 2XLTA 3GWFA 1NHSA 2BACA 1BGNA 1H7WA 2GR3A 1VDCA 2GR0A 4EMJA 1JRYA 1DJNA 1DODA 5FMHA 3UTHA 4EQXA 4DSGA 5BULA 2APGA 5U25A 4NEWA 3V76A 1H6VA 5CKUA 1B4VA 3P4RA 5CQFA 1IUSA 3L1RA 4U8MA 2YG6A 5EOWA 3T37A 2BA9A 1NPXA 5DBJA 1S2QA 1SEZA 4LIIA 1X31B 3DK9A 4CCRA 1IUTA 1LVLA 2WDRA 3L8KA 3C4AA 4EQWA 3AEGA 3NH3X 4H4YA 2AAQA 1TDOA 3NK2X 5JCIA 2VVMA 1PBDA 2Q0LA 1D7LA 4H4QA 4BV6A 1OJ9A 1RP0A 1PBCA 2VVLA 3BI2A 4J36A 1E1LA 4U8IA 4APNA 3ABVA 2E1MA 2X3NA 2GQWA 2WOWA 3VRDB 2E5VA 2BK3A 3I6DA 3UTFA 2V61A 4A6NB 3LOVA 4EM3A 4OPUA 1JU2A 1GV4A 2YG5A 4J31A 2ZZBA 3BI4A 3DJDA 1BWCA 3QSEA 2XLPA 2WPCA 2JBVA 4USQA 4C3XA 2X50A 1ZX9A 3GSIA 2BCGG 4H2NA 1EL9A 3AEBA 1CJCA 2BXSA 3AYJA 3AYLA 2YM2A 4H4PA 4OPLA 4YT0A 2C75A 4TLXA 3G5SA 1EL8A 2R9ZA 2XFUA 1LQTA 2GMHA 5J7XA 3RP7A 3ITJA 2WDVA 3AXBA 1GT8A 1Z6LA 3AD8B 4IVOB 2R45A 2WETA 4K5RA 4A6NA 1JNRA 3BHFA 2TMDA 2YVJA 2HQMA 3VRBA 1L9EA 2XVFA 3IC9A 5JCNA 3F8PA 4TM0A 3EAOA 2F5ZA 2VRLA 4D03A 5IPYA 4J33A 3O0HA 4UDPA 4NEVA 3CPJG 1EL5A 3NT6A 3FPZA 2CDUA 2WPFA 1KFYA 4EIPA 2JKCA 4Y4LA 4U8LA 4BURA 2C76A 3SFEA 4B68A 3UKFA 3F8DA 4YXDA 3VR8A 1IJHA 1DNCA 3G5RA 3ATRA 5BVAA 5KRQA 4FDCB 1E7PA 3UKQA 2UZZA 3NYFA 4A9WA 1RSGA 1DXLA 3NGCX 4Z24A 1H84A 5EB5A 3ATQA 1TDEA 4B64A 1F8RA 2V6OA 3BHKA 3GYIA 4NTDA 1GESA 2WP5A 3FIMB 1NG3A 2WPEA 5IQ4A 3NG7X 2RGHA 3GD3A 4YSHA 1AOGA 1H81A 1FECA 4A7AA 1E6EA 2CVJA 4RG3A 1K0IA 4AT0A 1FEAA 1NAAA 3UKPA 5TR3A 1D7YA 5FS8A 3S61A 3KA7A 4GCMA 4H7UA 2X99A 2PYXA 4Z2RA 1CHUA 3BI5A 4IV9A 4I59A 3BNMA 2BS4A 3HZLA 4REKA 4EIQA 2VQ7A 4JNAA 3KD9A 4C3YA 1ZP0A 2B9WA 1BGJA 1V59A 4CY6A 4YTPA 5EB4A 3LZXA 3UTEA 1RYIA 4U2SA 4Y4MA 2V60A 3NNEA 3AEFA 5FS9A 2VZ2A 4YTNA 1GERA 1KSUA 4GUVA 3CNPA 2V5ZA 4NTCA 2VVLG 3AE7A 1LJ1A 4WX1A 3ALMA 1W4XA 1F6MA 1B8SA 4YKFA 4IA5A 5C2TA 1CF3A 2Y6QA 2OAMA 3VRAA 4OPTA 3UCLA 3NRNA 2B76A 5KOXA 4AOXA 2YLXA 1H7XA 2GV8A 4JY3A 4C74A 2WEUA 1E1MA 1D4CA 3CGBA 1TDNA 4XWZA 3SFDA 2ZBWA 2GH5A 2WDQA 4J34A 4U8KA 4YWOA 1PXCA 2YVFA 5GSNA 5KVIA 4H4RA 2VRMA 4U8JA 4TLZA 2YVGA 4KX6A 1COYA 5C3JA 2R0PA 1XANA 1D4EA 1L9CA 3QVPA 2W0HA 4OVIA 2YLSA 3UTGA 1GTEA 1S3EA 3IF9A 2WOIA 4UP3A 4U8NA 4Z26A 4ICYA 2C72A 5KWFA 2R4EA 4X9MA 5JCMA 1EL7A 1N1PA 4DSHA 1ONFA 4H50A 5HHFA 1GXFA 2IVEA 2YR4A 2BCPA 1LV0A 1LQUA 1YY5A 3GDPA 1VRQB 2WBAA 2X8HA 4HA6A 2YLTA 1NG4A 1JNZA 1PXBA 4X4JA 3NK1X 3RP8A 3NN0X 5JCLA 4NZHA 3FBSA 1OJCA 1CL0A 1FCDA 1MOKA 4Y4NA 2R0CA 3UKKA 4I58A 1DOEA 1O94A 3UOZA 2BK5A 2C67A 1UKVG 2QA1A 1M64A 1D4DA 3LJPA 3S5WA 2XVIA 4JN9A 5EBKA 1DJQA 1QJDA 1BKWA 1NDAA 2XLSA 3ALLA 3AEAA 4J57A 2E4GA 3GMBA 4Z25A 1KNPA 2EQ6A 5BRTA 5LV9A 1GALA 4FK1C 4B65A 3B6DA 5FS6A 5KVHA 2GR1A 2YR6A 3ISHA 3AEDA 1OJAA 3ICTA 4H4TA 4UDQA 1CJ3A 2QAEA 4Z44A 1P2HA 3GDNA 1HYUA 1NEKA 1CBOA 4AT2A 3R9UA 5L46A 4K7ZA 4A5LA 4NTEA 4EQSA 3GRSA 1D5TA 2O9ZA 3P4QA 1QLBA 1XPQA 1PBFA 2CFYA 2FJAA 2Q7VA 3CNTA 2XLRA 1O95A 1OJTA 2FJBA 3DMEA 3FG2P 5FS7A 3UP5A 4BJYA 4USRA 1CJ4A 1Q9IA 2Z5YA 4TM3A 2BYBA 3AE6A 3OZ2A 2WP9A 3NHOX 1E39A 2JAEA 3CNSA 1FEBA 2V3BA 1VQWA 3GYJA 4TM4A 1PDHA 1KSSA 4WCTA 1GNDA 3Q6JA 2XDOA 1NHPA 1ZOVA 3WE0A 3V3NA 3ALJA 2FBWA 1Q1RA 2YR5A 4OPDA 3EF6A 4K5SA 2GQFA 3CGCA 3SM8A 2C66A 1F3PA 1K0JA 1F8WA 2IIDA 4ADWA 3NYEA 2GEWA 3M12A 4B63A 1NHRA 4P9SA 4JNQA 1NENA 2AQJA 2NPXA 2QCUA 3GWDA 3URHA 1PXAA 1DOBA 2GMJA 2WU2A 4H2RA 3CPHG 2B7RA 2C3DA 2GAGB 4GDEA 2JK6A 2YWLA 3K30A 3SGLA 2NVKX 3RP6A 3P4PA 3I3LA 1GEUA 2RGJA 1IUUA 1PJ6A 2C73A 4O5UA 1ZKQA 1LPFA 2X8GA 4PAAA 2Z5XA 1KDGA 3AE4A 3DJGX 4A79A 4JQ9A 2OA1A 2WOVA 2X8CA 3NTAA 4J2WA 1FL2A 1GETA 1K0LA 1PHHA 1PJ5A 1GRGA 3VQRA 4JDRA 4HB9A 2YAUA 4C77A 1TYTA 2WESA 3NTDA 1FOHA 1P2EA 2ACZA 2JB3A 3ZYXA 2YM1A 2XYOA 3UOXA 2GRTA 2A89A 4CRTA 3CNDA 4CCQA 2YQUA 2CULA 3NN6X 3NK0X 4ZCCA 2XFPA 5JCKA 3EANA 1ELIA 1M6IA 3DK8A 4EQRA 3RNMA 2GVCA 2YG4A 3UOYA 1GRHA 3CIRA 4U8PA 1EBDA 4PABA 1H86A 5KOWA 3QVRA 1N4WA 5M10A 3AB1A 4EM4A 2EQ9A 1LTXR 3E1TA 4OPCA 4OPIA 4X9NA 1GTHA 4Z2UA 5KXJA 3DJJA 3D8XA 1Q1WA 3NIXA 1L0VA 2GAHB 3ICSA 2B9YA 3AE9A 3P4SA 3AE2A 2GB0A 4CY8A 3OC4A 2R46A 4Z2TA 4GF7A 3IHMA 2BABA 2VQBA 1XHCA 3AE3A 2EQ7A 3DH9A 4DNAA 1TDKA 3NLCA 3AECA 4GDPA 2YLWA 4H4SA 4H4VA 4FK1A 4UDRA 4B69A 1GPEA 1QO8A 2BXRA 2WS3A 3UKAA 4EMIA 1VG9A 2J3NA 1NHQA 2C64A 1MO9A 2DKHA 3NYCA 5IQ1A 4A65A 2WQYA 2XCGA 4CNJA 3GD4A 1TRBA 3Q9TA 4H2PA 2A87A 2QA2A 2ZZ0A 4AOSA 3QFAA 4H4ZA 2XVEA 4B1BA 3ADAB 1ZMDA 1ZY8A 2DKIA 3GRTA 2C7GA 4U2TA 2H88A 1IUWA 3AE1A 3CPIG 1ZK7A 2JB2A 3FMWA 2Q0KA 1PBBA 3PO7A 2BS2A 3G5QA 4YTMA 3II4A 2FJDA 2GR2A 2R0GA 2V3AA 3C4NA 2XVJA 3P9UA 4ZN0A 3IWAA 1TYPA 1YQ3A 1CC6A 4E0VA 1PJ7A 2YG3A 4M52A 3COXA 3AD7B 3DK4A 4H4WA 4K2XA 4H4UA 4XWRA 4C5OA 4YKGA 1GREA 1CC2A 4ECHA 5U1OA 5HYMA 2BC0A 1GSNA 1REOA 1H83A 4CNKA 3QFBA 1ZMCA 4KPRA 1YQZA 3B3RA 4LA1A 4U8OA 5J60A 1KNRA 4J56A 3BNUA 3ZDNA 1CC4A 3AE8A 1OJDA 1CJ2A 5HY5A 3CGEA 2BK4A 3KPFA 2C3CA 2RGOA 2EQ8A 1L9DA 2XFQA 1N4VA 4OPGA 5ER0A 2RABA 3UOVA 3C96A 4O5QA 3M0OA 4YSZA 3K7MX 1B37A 4A99A 1F8SA 2Y6RA 2VOUA 3K7QX 1BF3A 3KVEA 1IUVA 2YG7A 4LU6A 4AP1A 4YSXA 4Z43A 1GRBA 3DA1A 3DJEA 4OCGA 3D1CA 4CBQA 1Y56B 3M13A 2I0ZA 3LADA 5GRTA 1GRTA 2TPRA 1MXTA 3AEEA 3UP4A 3AWIA 1BZLA 3F8RA 4YSYA 5HXIA 3NKSA 4JY2A 2H89A 2A8XA 4IVMB 4RSLA 1O5WA 1N4UA 3KU9A 2PHHA 2BS3A 3PS9A 4H2QA 3LXDA 1GRAA 3CTYA 3UKHA 2FJEA 4FX9A 1YKJA 4DGKA 3H8LA 3KLJA 1JRZA 1ZOYA 2OLNA 3PVCA 4N9XA 3AD9B 3CGDA 3VR9A 2Q6UA 1JEHA 3JSKA 4H4XA 4IA6A 3QJ4A 1GOSA 2AR8A 2YLRA 3EPTA 4BK1A 3H8IA 2B9XA 3SQPA 3AYIA 4K8DA 4D04A 2WHDA 4AP3A 4BK2A 1Y56A 2IVDA 2ZZCA 1S2YA 5U63A 1PN0A 4MJWA 1E1NA 1KF6A
chains in the Genus database with same CATH superfamily
3QSMA 2JB1A 1ZDLA 1IUXA 2BC1A 3IHGA 3UKLA 4RG4A 2XFNA 3CNJA 4BK3A 1K4QA 4GR1A 4B67A 4XXGA 1B5QA 1H82A 3AE5A 4EMWA 2B7SA 2C70A 2XVHA 1GRFA 2R4JA 3KKJA 2WU5A 4B66A 1JRXA 3T2YA 2YLZA 3DGZA 1E1KA 5M0ZA 2OLOA 2XFOA 4ZCDA 2WP6A 3LZWA 1PS9A 3RHAA 1S3BA 3HYVA 1TDFA 2C65A 4GRTA 3SZWA 1DOCA 1JOAA 2GF3A 3CN8A 1PBEA 1VG0A 3QSSA 3DGHA 3K7TA 2XLUA 3H4KA 2ARDA 4TM1A 3HYWA 5BUKA 3REDA 4BJZA 3V3OA 1Y0PA 1YQ4A 4U2LA 3LB8A 3ICRA 3P1WA 2OALA 1XDIA 3GMCA 4K22A 2XLTA 3GWFA 1NHSA 2BACA 1BGNA 1H7WA 2GR3A 1VDCA 2GR0A 4G6GA 1JRYA 4EMJA 1DJNA 1DODA 5FMHA 3UTHA 4EQXA 4DSGA 5BULA 2APGA 5U25A 4NEWA 3V76A 1H6VA 5CKUA 1B4VA 3P4RA 5CQFA 1IUSA 3L1RA 4U8MA 2YG6A 5EOWA 3T37A 2BA9A 1NPXA 5DBJA 1S2QA 1SEZA 4LIIA 1X31B 3DK9A 4CCRA 1IUTA 1LVLA 2WDRA 3L8KA 3C4AA 4EQWA 3AEGA 3NH3X 4H4YA 2AAQA 1TDOA 3NK2X 5JCIA 2VVMA 1PBDA 2Q0LA 1D7LA 4H4QA 4BV6A 1OJ9A 1RP0A 1PBCA 2VVLA 3BI2A 4J36A 1E1LA 4U8IA 4APNA 3ABVA 2E1MA 2X3NA 2GQWA 2WOWA 3VRDB 2E5VA 2BK3A 3I6DA 3UTFA 2V61A 4A6NB 2BRYA 3LOVA 4EM3A 4OPUA 1JU2A 1GV4A 2YG5A 4J31A 2ZZBA 3BI4A 3DJDA 1BWCA 3QSEA 2XLPA 2WPCA 2JBVA 4USQA 4C3XA 2X50A 1ZX9A 3GSIA 2BCGG 4H2NA 1EL9A 3AEBA 1CJCA 2BXSA 3AYJA 3AYLA 2YM2A 4H4PA 4OPLA 4YT0A 2C75A 4TLXA 3G5SA 1EL8A 2R9ZA 2XFUA 1LQTA 2GMHA 5J7XA 3RP7A 3ITJA 2WDVA 3AXBA 1GT8A 1Z6LA 3AD8B 4IVOB 3T2KA 2R45A 2WETA 4K5RA 4A6NA 1JNRA 3BHFA 2TMDA 2YVJA 2HQMA 5KMQA 3VRBA 1L9EA 2XVFA 3IC9A 5JCNA 3F8PA 4TM0A 3EAOA 2F5ZA 2VRLA 4D03A 5IPYA 4J33A 3O0HA 4UDPA 4NEVA 3CPJG 1EL5A 3NT6A 3FPZA 2CDUA 2WPFA 1KFYA 4EIPA 2JKCA 4Y4LA 4U8LA 4BURA 2C76A 3SFEA 4B68A 3UKFA 3F8DA 4YXDA 3VR8A 1IJHA 1DNCA 3G5RA 3ATRA 5BVAA 5KRQA 4FDCB 1E7PA 3UKQA 2UZZA 3T2ZA 3NYFA 4GAPA 4A9WA 1RSGA 1DXLA 3NGCX 4Z24A 1H84A 4G6HA 5EB5A 3ATQA 1TDEA 4B64A 1F8RA 2V6OA 3BHKA 3GYIA 4NTDA 1GESA 2WP5A 3FIMB 1NG3A 2WPEA 5IQ4A 3NG7X 2RGHA 3GD3A 4YSHA 5KMSA 1AOGA 1H81A 3SZFA 1FECA 4A7AA 1E6EA 2CVJA 4RG3A 1K0IA 4AT0A 1FEAA 1NAAA 3UKPA 3KPKA 5TR3A 1D7YA 5FS8A 3S61A 3KA7A 4GCMA 4H7UA 2X99A 3T14A 2PYXA 4Z2RA 1CHUA 3BI5A 4IV9A 4I59A 3BNMA 2BS4A 3HZLA 4REKA 4EIQA 2VQ7A 4JNAA 3KD9A 4C3YA 1ZP0A 2B9WA 1BGJA 1V59A 4CY6A 4YTPA 5KMPA 5EB4A 3LZXA 3UTEA 1RYIA 4U2SA 4Y4MA 2V60A 3NNEA 3AEFA 5FS9A 2VZ2A 4YTNA 1GERA 1KSUA 4GUVA 3CNPA 2V5ZA 4NTCA 2VVLG 3AE7A 1LJ1A 4WX1A 3ALMA 1W4XA 1F6MA 1B8SA 4YKFA 4IA5A 5C2TA 1CF3A 2Y6QA 4G74A 2OAMA 3VRAA 4OPTA 3SZ0A 3UCLA 3NRNA 2B76A 5KOXA 4AOXA 2YLXA 1H7XA 2GV8A 4JY3A 3SYIA 4C74A 3T31A 2WEUA 1E1MA 1D4CA 3CGBA 1TDNA 4XWZA 3SFDA 2ZBWA 2GH5A 2WDQA 4J34A 4U8KA 4YWOA 1PXCA 2YVFA 5GSNA 5KVIA 4H4RA 2VRMA 4U8JA 4TLZA 2YVGA 4KX6A 1COYA 5C3JA 2R0PA 1XANA 1D4EA 1L9CA 3QVPA 2W0HA 4OVIA 2YLSA 3UTGA 1GTEA 1S3EA 3IF9A 2WOIA 4UP3A 5KNLA 4U8NA 4Z26A 4ICYA 2C72A 5KWFA 2R4EA 4X9MA 5JCMA 1EL7A 1N1PA 4DSHA 1ONFA 4H50A 5HHFA 1GXFA 2IVEA 2YR4A 2BCPA 1LV0A 1LQUA 1YY5A 3GDPA 1VRQB 2WBAA 2X8HA 4HA6A 2YLTA 1NG4A 1JNZA 1PXBA 4X4JA 3NK1X 3RP8A 3NN0X 5JCLA 2C4CA 4NZHA 3FBSA 1OJCA 4II3A 1CL0A 1FCDA 1MOKA 4Y4NA 2R0CA 3UKKA 3SZCA 4I58A 1DOEA 1O94A 3UOZA 2BK5A 2C67A 1UKVG 2QA1A 1M64A 1D4DA 3LJPA 3S5WA 2XVIA 4JN9A 5EBKA 1DJQA 1QJDA 1BKWA 1NDAA 2XLSA 3ALLA 3AEAA 4J57A 2E4GA 3GMBA 4Z25A 1KNPA 3CMMA 2EQ6A 5BRTA 5LV9A 1GALA 4FK1C 4B65A 3B6DA 5FS6A 5KVHA 2GR1A 2YR6A 3ISHA 3AEDA 1OJAA 3ICTA 4H4TA 4UDQA 3HYXA 1CJ3A 2QAEA 4Z44A 1P2HA 3GDNA 1HYUA 1NEKA 1CBOA 4AT2A 3R9UA 5L46A 4K7ZA 4A5LA 4NTEA 4EQSA 3GRSA 1D5TA 2O9ZA 3P4QA 1QLBA 1XPQA 1PBFA 2CFYA 2FJAA 2Q7VA 3CNTA 2XLRA 1O95A 1OJTA 2FJBA 3DMEA 3FG2P 5FS7A 3UP5A 4BJYA 4USRA 1CJ4A 1Q9IA 2Z5YA 4TM3A 2BYBA 3AE6A 3OZ2A 2WP9A 3NHOX 1E39A 2JAEA 3CNSA 1FEBA 2V3BA 1VQWA 3GYJA 4TM4A 1PDHA 1KSSA 4WCTA 1GNDA 3Q6JA 2XDOA 1NHPA 1ZOVA 3WE0A 3V3NA 3ALJA 2FBWA 1Q1RA 2YR5A 4OPDA 3EF6A 4K5SA 2GQFA 3CGCA 3SM8A 2C66A 1F3PA 1K0JA 1F8WA 2IIDA 4ADWA 3NYEA 4G73A 2GEWA 3M12A 4NNJA 4B63A 1NHRA 4P9SA 4JNQA 4GAVA 1NENA 2AQJA 2NPXA 2QCUA 3GWDA 3URHA 1PXAA 1DOBA 2GMJA 2WU2A 4H2RA 3CPHG 2B7RA 2C3DA 2GAGB 4GDEA 2JK6A 2YWLA 3K30A 3SGLA 2NVKX 3RP6A 3P4PA 3I3LA 1GEUA 2RGJA 1IUUA 1PJ6A 2C73A 4O5UA 1ZKQA 1LPFA 2X8GA 4PAAA 2Z5XA 1KDGA 3AE4A 3DJGX 4A79A 4JQ9A 2OA1A 2WOVA 2X8CA 3NTAA 4J2WA 1FL2A 1GETA 1K0LA 1PHHA 1PJ5A 1GRGA 3VQRA 4JDRA 4HB9A 2YAUA 4C77A 1TYTA 2WESA 3NTDA 1FOHA 1P2EA 2ACZA 2JB3A 3ZYXA 2YM1A 2XYOA 3UOXA 2GRTA 2A89A 4NWZA 4CRTA 3CNDA 4CCQA 2YQUA 2CULA 3NN6X 3NK0X 4ZCCA 2XFPA 5JCKA 3EANA 1ELIA 1M6IA 3DK8A 4EQRA 3RNMA 2GVCA 2YG4A 3UOYA 1GRHA 3CIRA 4U8PA 1EBDA 4PABA 1H86A 5KOWA 3QVRA 1N4WA 5M10A 3AB1A 4EM4A 2EQ9A 1LTXR 3E1TA 4OPCA 4OPIA 4X9NA 1GTHA 4Z2UA 5KXJA 3DJJA 3D8XA 1Q1WA 3NIXA 1L0VA 2GAHB 3ICSA 2B9YA 3AE9A 3P4SA 3AE2A 2GB0A 4CY8A 3OC4A 2R46A 4Z2TA 4GF7A 3IHMA 2BABA 2VQBA 3SX6A 1XHCA 3AE3A 2EQ7A 3DH9A 4DNAA 1TDKA 3NLCA 3AECA 4GDPA 2YLWA 4H4SA 4H4VA 4FK1A 4UDRA 4B69A 1GPEA 1QO8A 2BXRA 2WS3A 3UKAA 4EMIA 1VG9A 2J3NA 1NHQA 2C64A 1MO9A 2DKHA 3NYCA 5IQ1A 4A65A 2WQYA 2XCGA 4CNJA 3GD4A 1TRBA 3Q9TA 4H2PA 2A87A 2QA2A 2ZZ0A 4AOSA 3QFAA 4H4ZA 2XVEA 4B1BA 3ADAB 1ZMDA 1ZY8A 2DKIA 3GRTA 2C7GA 4U2TA 2H88A 1IUWA 3GYXA 3AE1A 3CPIG 1ZK7A 2JB2A 3FMWA 2Q0KA 1PBBA 3PO7A 2BS2A 3G5QA 4YTMA 3II4A 2FJDA 2GR2A 2R0GA 2V3AA 3C4NA 2XVJA 3P9UA 4ZN0A 3IWAA 1TYPA 1YQ3A 1CC6A 4E0VA 1PJ7A 2YG3A 4M52A 3COXA 3AD7B 3DK4A 4H4WA 4K2XA 4H4UA 4XWRA 4C5OA 4YKGA 1GREA 1CC2A 4ECHA 5U1OA 3SY4A 5HYMA 2BC0A 1GSNA 1REOA 1H83A 4CNKA 3QFBA 1ZMCA 4KPRA 1YQZA 3B3RA 4II2A 4LA1A 4U8OA 5J60A 1KNRA 4J56A 3BNUA 3ZDNA 1CC4A 3AE8A 1OJDA 1CJ2A 5HY5A 3CGEA 2BK4A 4G9KA 3KPFA 2C3CA 2RGOA 2EQ8A 1L9DA 2XFQA 5KMRA 1N4VA 4OPGA 5ER0A 2RABA 3UOVA 3C96A 4O5QA 3M0OA 4YSZA 3K7MX 1B37A 4A99A 1F8SA 2Y6RA 2VOUA 3K7QX 1BF3A 3KVEA 1IUVA 2YG7A 4LU6A 4AP1A 4YSXA 4Z43A 1GRBA 3DA1A 3DJEA 4OCGA 3D1CA 4CBQA 1Y56B 3M13A 2I0ZA 3LADA 5GRTA 1GRTA 2TPRA 1MXTA 3AEEA 3UP4A 3AWIA 1BZLA 3F8RA 4YSYA 5HXIA 3NKSA 4JY2A 2H89A 2A8XA 4IVMB 4RSLA 1O5WA 1N4UA 3KU9A 2BRAA 2PHHA 2BS3A 3PS9A 4H2QA 3T0KA 3LXDA 1GRAA 3CTYA 3UKHA 2FJEA 4FX9A 1YKJA 4DGKA 3H8LA 3SXIA 3KLJA 1JRZA 1ZOYA 2OLNA 3PVCA 4N9XA 3AD9B 3CGDA 3VR9A 2Q6UA 1JEHA 3JSKA 4H4XA 4IA6A 3QJ4A 1GOSA 2AR8A 2YLRA 3EPTA 4BK1A 3H8IA 2B9XA 3SQPA 3AYIA 4K8DA 4D04A 2WHDA 4AP3A 4BK2A 1Y56A 2IVDA 2ZZCA 1S2YA 5U63A 1PN0A 4MJWA 1E1NA 1KF6A
chains in the Genus database with same CATH topology
3QSMA 2JB1A 1ZDLA 1IUXA 2BC1A 3IHGA 3UKLA 4RG4A 2XFNA 3CNJA 4BK3A 1K4QA 4GR1A 4B67A 4XXGA 1B5QA 1H82A 3AE5A 4EMWA 2B7SA 2C70A 2XVHA 1GRFA 2R4JA 3KKJA 2WU5A 4B66A 1JRXA 3T2YA 2YLZA 3DGZA 1E1KA 5M0ZA 2OLOA 2XFOA 4ZCDA 2WP6A 3LZWA 1PS9A 3RHAA 1S3BA 3HYVA 1TDFA 2C65A 4GRTA 3SZWA 1DOCA 1JOAA 2GF3A 3CN8A 1PBEA 1VG0A 3QSSA 3DGHA 3K7TA 2XLUA 3H4KA 2ARDA 4TM1A 3HYWA 5BUKA 3REDA 4BJZA 3V3OA 1Y0PA 1YQ4A 4U2LA 3LB8A 3ICRA 3P1WA 2OALA 1XDIA 3GMCA 4K22A 2XLTA 3GWFA 1NHSA 2BACA 1BGNA 1H7WA 2GR3A 1VDCA 2GR0A 4G6GA 1JRYA 4EMJA 1DJNA 1DODA 5FMHA 3UTHA 4EQXA 4DSGA 5BULA 2APGA 5U25A 4NEWA 3V76A 1H6VA 5CKUA 1B4VA 3P4RA 5CQFA 1IUSA 3L1RA 4U8MA 2YG6A 5EOWA 3T37A 2BA9A 1NPXA 5DBJA 1S2QA 1SEZA 4LIIA 1X31B 3DK9A 4CCRA 1IUTA 1LVLA 2WDRA 3L8KA 3C4AA 4EQWA 3AEGA 3NH3X 4H4YA 2AAQA 1TDOA 3NK2X 5JCIA 2VVMA 1PBDA 2Q0LA 1D7LA 4H4QA 4BV6A 1OJ9A 1RP0A 1PBCA 2VVLA 3BI2A 4J36A 1E1LA 4U8IA 4APNA 3ABVA 2E1MA 2X3NA 2GQWA 2WOWA 3VRDB 2E5VA 2BK3A 3I6DA 3UTFA 2V61A 4A6NB 2BRYA 3LOVA 4EM3A 4OPUA 1JU2A 1GV4A 2YG5A 4J31A 2ZZBA 3BI4A 3DJDA 1BWCA 3QSEA 2XLPA 2WPCA 2JBVA 4USQA 4C3XA 2X50A 1ZX9A 3GSIA 2BCGG 4H2NA 1EL9A 3AEBA 1CJCA 2BXSA 3AYJA 3AYLA 2YM2A 4H4PA 4OPLA 4YT0A 2C75A 4TLXA 3G5SA 1EL8A 2R9ZA 2XFUA 1LQTA 2GMHA 5J7XA 3RP7A 3ITJA 2WDVA 3AXBA 1GT8A 1Z6LA 3AD8B 4IVOB 3T2KA 2R45A 2WETA 4K5RA 4A6NA 1JNRA 3BHFA 2TMDA 2YVJA 2HQMA 5KMQA 3VRBA 1L9EA 2XVFA 3IC9A 5JCNA 3F8PA 4TM0A 3EAOA 2F5ZA 2VRLA 4D03A 5IPYA 4J33A 3O0HA 4UDPA 4NEVA 3CPJG 1EL5A 3NT6A 3FPZA 2CDUA 2WPFA 1KFYA 4EIPA 2JKCA 4Y4LA 4U8LA 4BURA 2C76A 3SFEA 4B68A 3UKFA 3F8DA 4YXDA 3VR8A 1IJHA 1DNCA 3G5RA 3ATRA 5BVAA 5KRQA 4FDCB 1E7PA 3UKQA 2UZZA 3T2ZA 3NYFA 4GAPA 4A9WA 1RSGA 1DXLA 3NGCX 4Z24A 1H84A 4G6HA 5EB5A 3ATQA 1TDEA 4B64A 1F8RA 2V6OA 3BHKA 3GYIA 4NTDA 1GESA 2WP5A 3FIMB 1NG3A 2WPEA 5IQ4A 3NG7X 2RGHA 3GD3A 4YSHA 5KMSA 1AOGA 1H81A 3SZFA 1FECA 4A7AA 1E6EA 2CVJA 4RG3A 1K0IA 4AT0A 1FEAA 1NAAA 3UKPA 3KPKA 5TR3A 1D7YA 5FS8A 3S61A 3KA7A 4GCMA 4H7UA 2X99A 3T14A 2PYXA 4Z2RA 1CHUA 3BI5A 4IV9A 4I59A 3BNMA 2BS4A 3HZLA 4REKA 4EIQA 2VQ7A 4JNAA 3KD9A 4C3YA 1ZP0A 2B9WA 1BGJA 1V59A 4CY6A 4YTPA 5KMPA 5EB4A 3LZXA 3UTEA 1RYIA 4U2SA 4Y4MA 2V60A 3NNEA 3AEFA 5FS9A 2VZ2A 4YTNA 1GERA 1KSUA 4GUVA 3CNPA 2V5ZA 4NTCA 2VVLG 3AE7A 1LJ1A 4WX1A 3ALMA 1W4XA 1F6MA 1B8SA 4YKFA 4IA5A 5C2TA 1CF3A 2Y6QA 4G74A 2OAMA 3VRAA 4OPTA 3SZ0A 3UCLA 3NRNA 2B76A 5KOXA 4AOXA 2YLXA 1H7XA 2GV8A 4JY3A 3SYIA 4C74A 3T31A 2WEUA 1E1MA 1D4CA 3CGBA 1TDNA 4XWZA 3SFDA 2ZBWA 2GH5A 2WDQA 4J34A 4U8KA 4YWOA 1PXCA 2YVFA 5GSNA 5KVIA 4H4RA 2VRMA 4U8JA 4TLZA 2YVGA 4KX6A 1COYA 5C3JA 2R0PA 1XANA 1D4EA 1L9CA 3QVPA 2W0HA 4OVIA 2YLSA 3UTGA 1GTEA 1S3EA 3IF9A 2WOIA 4UP3A 5KNLA 4U8NA 4Z26A 4ICYA 2C72A 5KWFA 2R4EA 4X9MA 5JCMA 1EL7A 1N1PA 4DSHA 1ONFA 4H50A 5HHFA 1GXFA 2IVEA 2YR4A 2BCPA 1LV0A 1LQUA 1YY5A 3GDPA 1VRQB 2WBAA 2X8HA 4HA6A 2YLTA 1NG4A 1JNZA 1PXBA 4X4JA 3NK1X 3RP8A 3NN0X 5JCLA 2C4CA 4NZHA 3FBSA 1OJCA 4II3A 1CL0A 1FCDA 1MOKA 4Y4NA 2R0CA 3UKKA 3SZCA 4I58A 1DOEA 1O94A 3UOZA 2BK5A 2C67A 1UKVG 2QA1A 1M64A 1D4DA 3LJPA 3S5WA 2XVIA 4JN9A 5EBKA 1DJQA 1QJDA 1BKWA 1NDAA 2XLSA 3ALLA 3AEAA 4J57A 2E4GA 3GMBA 4Z25A 1KNPA 3CMMA 2EQ6A 5BRTA 5LV9A 1GALA 4FK1C 4B65A 3B6DA 5FS6A 5KVHA 2GR1A 2YR6A 3ISHA 3AEDA 1OJAA 3ICTA 4H4TA 4UDQA 3HYXA 1CJ3A 2QAEA 4Z44A 1P2HA 3GDNA 1HYUA 1NEKA 1CBOA 4AT2A 3R9UA 5L46A 4K7ZA 4A5LA 4NTEA 4EQSA 3GRSA 1D5TA 2O9ZA 3P4QA 1QLBA 1XPQA 1PBFA 2CFYA 2FJAA 2Q7VA 3CNTA 2XLRA 1O95A 1OJTA 2FJBA 3DMEA 3FG2P 5FS7A 3UP5A 4BJYA 4USRA 1CJ4A 1Q9IA 2Z5YA 4TM3A 2BYBA 3AE6A 3OZ2A 2WP9A 3NHOX 1E39A 2JAEA 3CNSA 1FEBA 2V3BA 1VQWA 3GYJA 4TM4A 1PDHA 1KSSA 4WCTA 1GNDA 3Q6JA 2XDOA 1NHPA 1ZOVA 3WE0A 3V3NA 3ALJA 2FBWA 1Q1RA 2YR5A 4OPDA 3EF6A 4K5SA 2GQFA 3CGCA 3SM8A 2C66A 1F3PA 1K0JA 1F8WA 2IIDA 4ADWA 3NYEA 4G73A 2GEWA 3M12A 4NNJA 4B63A 1NHRA 4P9SA 4JNQA 4GAVA 1NENA 2AQJA 2NPXA 2QCUA 3GWDA 3URHA 1PXAA 1DOBA 2GMJA 2WU2A 4H2RA 3CPHG 2B7RA 2C3DA 2GAGB 4GDEA 2JK6A 2YWLA 3K30A 3SGLA 2NVKX 3RP6A 3P4PA 3I3LA 1GEUA 2RGJA 1IUUA 1PJ6A 2C73A 4O5UA 1ZKQA 1LPFA 2X8GA 4PAAA 2Z5XA 1KDGA 3AE4A 3DJGX 4A79A 4JQ9A 2OA1A 2WOVA 2X8CA 3NTAA 4J2WA 1FL2A 1GETA 1K0LA 1PHHA 1PJ5A 1GRGA 3VQRA 4JDRA 4HB9A 2YAUA 4C77A 1TYTA 2WESA 3NTDA 1FOHA 1P2EA 2ACZA 2JB3A 3ZYXA 2YM1A 2XYOA 3UOXA 2GRTA 2A89A 4NWZA 4CRTA 3CNDA 4CCQA 2YQUA 2CULA 3NN6X 3NK0X 4ZCCA 2XFPA 5JCKA 3EANA 1ELIA 1M6IA 3DK8A 4EQRA 3RNMA 2GVCA 2YG4A 3UOYA 1GRHA 3CIRA 4U8PA 1EBDA 4PABA 1H86A 5KOWA 3QVRA 1N4WA 5M10A 3AB1A 4EM4A 2EQ9A 1LTXR 3E1TA 4OPCA 4OPIA 4X9NA 1GTHA 4Z2UA 5KXJA 3DJJA 3D8XA 1Q1WA 3NIXA 1L0VA 2GAHB 3ICSA 2B9YA 3AE9A 3P4SA 3AE2A 2GB0A 4CY8A 3OC4A 2R46A 4Z2TA 4GF7A 3IHMA 2BABA 2VQBA 3SX6A 1XHCA 3AE3A 2EQ7A 3DH9A 4DNAA 1TDKA 3NLCA 3AECA 4GDPA 2YLWA 4H4SA 4H4VA 4FK1A 4UDRA 4B69A 1GPEA 1QO8A 2BXRA 2WS3A 3UKAA 4EMIA 1VG9A 2J3NA 1NHQA 2C64A 1MO9A 2DKHA 3NYCA 5IQ1A 4A65A 2WQYA 2XCGA 4CNJA 3GD4A 1TRBA 3Q9TA 4H2PA 2A87A 2QA2A 2ZZ0A 4AOSA 3QFAA 4H4ZA 2XVEA 4B1BA 3ADAB 1ZMDA 1ZY8A 2DKIA 3GRTA 2C7GA 4U2TA 2H88A 1IUWA 3GYXA 3AE1A 3CPIG 1ZK7A 2JB2A 3FMWA 2Q0KA 1PBBA 3PO7A 2BS2A 3G5QA 4YTMA 3II4A 2FJDA 2GR2A 2R0GA 2V3AA 3C4NA 2XVJA 3P9UA 4ZN0A 3IWAA 1TYPA 1YQ3A 1CC6A 4E0VA 1PJ7A 2YG3A 4M52A 3COXA 3AD7B 3DK4A 4H4WA 4K2XA 4H4UA 4XWRA 4C5OA 4YKGA 1GREA 1CC2A 4ECHA 5U1OA 3SY4A 5HYMA 2BC0A 1GSNA 1REOA 1H83A 4CNKA 3QFBA 1ZMCA 4KPRA 1YQZA 3B3RA 4II2A 4LA1A 4U8OA 5J60A 1KNRA 4J56A 3BNUA 3ZDNA 1CC4A 3AE8A 1OJDA 1CJ2A 5HY5A 3CGEA 2BK4A 4G9KA 3KPFA 2C3CA 2RGOA 2EQ8A 1L9DA 2XFQA 5KMRA 1N4VA 4OPGA 5ER0A 2RABA 3UOVA 3C96A 4O5QA 3M0OA 4YSZA 3K7MX 1B37A 4A99A 1F8SA 2Y6RA 2VOUA 3K7QX 1BF3A 3KVEA 1IUVA 2YG7A 4LU6A 4AP1A 4YSXA 4Z43A 1GRBA 3DA1A 3DJEA 4OCGA 3D1CA 4CBQA 1Y56B 3M13A 2I0ZA 3LADA 5GRTA 1GRTA 2TPRA 1MXTA 3AEEA 3UP4A 3AWIA 1BZLA 3F8RA 4YSYA 5HXIA 3NKSA 4JY2A 2H89A 2A8XA 4IVMB 4RSLA 1O5WA 1N4UA 3KU9A 2BRAA 2PHHA 2BS3A 3PS9A 4H2QA 3T0KA 3LXDA 1GRAA 3CTYA 3UKHA 2FJEA 4FX9A 1YKJA 4DGKA 3H8LA 3SXIA 3KLJA 1JRZA 1ZOYA 2OLNA 3PVCA 4N9XA 3AD9B 3CGDA 3VR9A 2Q6UA 1JEHA 3JSKA 4H4XA 4IA6A 3QJ4A 1GOSA 2AR8A 2YLRA 3EPTA 4BK1A 3H8IA 2B9XA 3SQPA 3AYIA 4K8DA 4D04A 2WHDA 4AP3A 4BK2A 1Y56A 2IVDA 2ZZCA 1S2YA 5U63A 1PN0A 4MJWA 1E1NA 1KF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSM A;  2JB1 A;  1ZDL A;  1IUX A;  2BC1 A;  3IHG A;  3UKL A;  4RG4 A;  2XFN A;  3CNJ A;  4BK3 A;  1K4Q A;  4GR1 A;  4B67 A;  4XXG A;  1B5Q A;  1H82 A;  3AE5 A;  4EMW A;  2B7S A;  2C70 A;  2XVH A;  1GRF A;  2R4J A;  3KKJ A;  2WU5 A;  4B66 A;  1JRX A;  2YLZ A;  3DGZ A;  1E1K A;  5M0Z A;  2OLO A;  2XFO A;  4ZCD A;  2WP6 A;  3LZW A;  1PS9 A;  3RHA A;  1S3B A;  1TDF A;  2C65 A;  4GRT A;  1DOC A;  1JOA A;  2GF3 A;  3CN8 A;  1PBE A;  1VG0 A;  3QSS A;  3DGH A;  3K7T A;  2XLU A;  3H4K A;  2ARD A;  4TM1 A;  5BUK A;  3RED A;  4BJZ A;  3V3O A;  1Y0P A;  1YQ4 A;  4U2L A;  3LB8 A;  3ICR A;  3P1W A;  2OAL A;  1XDI A;  3GMC A;  4K22 A;  2XLT A;  3GWF A;  1NHS A;  2BAC A;  1BGN A;  1H7W A;  2GR3 A;  1VDC A;  2GR0 A;  4EMJ A;  1JRY A;  1DJN A;  1DOD A;  5FMH A;  3UTH A;  4EQX A;  4DSG A;  5BUL A;  2APG A;  5U25 A;  4NEW A;  3V76 A;  1H6V A;  5CKU A;  1B4V A;  3P4R A;  5CQF A;  1IUS A;  3L1R A;  4U8M A;  2YG6 A;  5EOW A;  3T37 A;  2BA9 A;  1NPX A;  5DBJ A;  1S2Q A;  1SEZ A;  4LII A;  1X31 B;  3DK9 A;  4CCR A;  1IUT A;  1LVL A;  2WDR A;  3L8K A;  3C4A A;  4EQW A;  3AEG A;  3NH3 X;  4H4Y A;  2AAQ A;  1TDO A;  3NK2 X;  5JCI A;  2VVM A;  1PBD A;  2Q0L A;  1D7L A;  4H4Q A;  4BV6 A;  1OJ9 A;  1RP0 A;  1PBC A;  2VVL A;  3BI2 A;  4J36 A;  1E1L A;  4U8I A;  4APN A;  3ABV A;  2E1M A;  2X3N A;  2GQW A;  2WOW A;  3VRD B;  2E5V A;  2BK3 A;  3I6D A;  3UTF A;  2V61 A;  4A6N B;  3LOV A;  4EM3 A;  4OPU A;  1JU2 A;  1GV4 A;  2YG5 A;  4J31 A;  2ZZB A;  3BI4 A;  3DJD A;  1BWC A;  3QSE A;  2XLP A;  2WPC A;  2JBV A;  4USQ A;  4C3X A;  2X50 A;  1ZX9 A;  3GSI A;  2BCG G;  4H2N A;  1EL9 A;  3AEB A;  1CJC A;  2BXS A;  3AYJ A;  3AYL A;  2YM2 A;  4H4P A;  4OPL A;  4YT0 A;  2C75 A;  4TLX A;  3G5S A;  1EL8 A;  2R9Z A;  2XFU A;  1LQT A;  2GMH A;  5J7X A;  3RP7 A;  3ITJ A;  2WDV A;  3AXB A;  1GT8 A;  1Z6L A;  3AD8 B;  4IVO B;  2R45 A;  2WET A;  4K5R A;  4A6N A;  1JNR A;  3BHF A;  2TMD A;  2YVJ A;  2HQM A;  3VRB A;  1L9E A;  2XVF A;  3IC9 A;  5JCN A;  3F8P A;  4TM0 A;  3EAO A;  2F5Z A;  2VRL A;  4D03 A;  5IPY A;  4J33 A;  3O0H A;  4UDP A;  4NEV A;  3CPJ G;  1EL5 A;  3NT6 A;  3FPZ A;  2CDU A;  2WPF A;  1KFY A;  4EIP A;  2JKC A;  4Y4L A;  4U8L A;  4BUR A;  2C76 A;  3SFE A;  4B68 A;  3UKF A;  3F8D A;  4YXD A;  3VR8 A;  1IJH A;  1DNC A;  3G5R A;  3ATR A;  5BVA A;  5KRQ A;  4FDC B;  1E7P A;  3UKQ A;  2UZZ A;  3NYF A;  4A9W A;  1RSG A;  1DXL A;  3NGC X;  4Z24 A;  1H84 A;  5EB5 A;  3ATQ A;  1TDE A;  4B64 A;  1F8R A;  2V6O A;  3BHK A;  3GYI A;  4NTD A;  1GES A;  2WP5 A;  3FIM B;  1NG3 A;  2WPE A;  5IQ4 A;  3NG7 X;  2RGH A;  3GD3 A;  4YSH A;  1AOG A;  1H81 A;  1FEC A;  4A7A A;  1E6E A;  2CVJ A;  4RG3 A;  1K0I A;  4AT0 A;  1FEA A;  1NAA A;  3UKP A;  5TR3 A;  1D7Y A;  5FS8 A;  3S61 A;  3KA7 A;  4GCM A;  4H7U A;  2X99 A;  2PYX A;  4Z2R A;  1CHU A;  3BI5 A;  4IV9 A;  4I59 A;  3BNM A;  2BS4 A;  3HZL A;  4REK A;  4EIQ A;  2VQ7 A;  4JNA A;  3KD9 A;  4C3Y A;  1ZP0 A;  2B9W A;  1BGJ A;  1V59 A;  4CY6 A;  4YTP A;  5EB4 A;  3LZX A;  3UTE A;  1RYI A;  4U2S A;  4Y4M A;  2V60 A;  3NNE A;  3AEF A;  5FS9 A;  2VZ2 A;  4YTN A;  1GER A;  1KSU A;  4GUV A;  3CNP A;  2V5Z A;  4NTC A;  2VVL G;  3AE7 A;  1LJ1 A;  4WX1 A;  3ALM A;  1W4X A;  1F6M A;  1B8S A;  4YKF A;  4IA5 A;  5C2T A;  1CF3 A;  2Y6Q A;  2OAM A;  3VRA A;  4OPT A;  3UCL A;  3NRN A;  2B76 A;  5KOX A;  4AOX A;  2YLX A;  1H7X A;  2GV8 A;  4JY3 A;  4C74 A;  2WEU A;  1E1M A;  1D4C A;  3CGB A;  1TDN A;  4XWZ A;  3SFD A;  2ZBW A;  2GH5 A;  2WDQ A;  4J34 A;  4U8K A;  4YWO A;  1PXC A;  2YVF A;  5GSN A;  5KVI A;  4H4R A;  2VRM A;  4U8J A;  4TLZ A;  2YVG A;  4KX6 A;  1COY A;  5C3J A;  2R0P A;  1XAN A;  1D4E A;  1L9C A;  3QVP A;  2W0H A;  4OVI A;  2YLS A;  3UTG A;  1GTE A;  1S3E A;  3IF9 A;  2WOI A;  4UP3 A;  4U8N A;  4Z26 A;  4ICY A;  2C72 A;  5KWF A;  2R4E A;  4X9M A;  5JCM A;  1EL7 A;  1N1P A;  4DSH A;  1ONF A;  4H50 A;  5HHF A;  1GXF A;  2IVE A;  2YR4 A;  2BCP A;  1LV0 A;  1LQU A;  1YY5 A;  3GDP A;  1VRQ B;  2WBA A;  2X8H A;  4HA6 A;  2YLT A;  1NG4 A;  1JNZ A;  1PXB A;  4X4J A;  3NK1 X;  3RP8 A;  3NN0 X;  5JCL A;  4NZH A;  3FBS A;  1OJC A;  1CL0 A;  1FCD A;  1MOK A;  4Y4N A;  2R0C A;  3UKK A;  4I58 A;  1DOE A;  1O94 A;  3UOZ A;  2BK5 A;  2C67 A;  1UKV G;  2QA1 A;  1M64 A;  1D4D A;  3LJP A;  3S5W A;  2XVI A;  4JN9 A;  5EBK A;  1DJQ A;  1QJD A;  1BKW A;  1NDA A;  2XLS A;  3ALL A;  3AEA A;  4J57 A;  2E4G A;  3GMB A;  4Z25 A;  1KNP A;  2EQ6 A;  5BRT A;  5LV9 A;  1GAL A;  4FK1 C;  4B65 A;  3B6D A;  5FS6 A;  5KVH A;  2GR1 A;  2YR6 A;  3ISH A;  3AED A;  1OJA A;  3ICT A;  4H4T A;  4UDQ A;  1CJ3 A;  2QAE A;  4Z44 A;  1P2H A;  3GDN A;  1HYU A;  1NEK A;  1CBO A;  4AT2 A;  3R9U A;  5L46 A;  4K7Z A;  4A5L A;  4NTE A;  4EQS A;  3GRS A;  1D5T A;  2O9Z A;  3P4Q A;  1QLB A;  1XPQ A;  1PBF A;  2CFY A;  2FJA A;  2Q7V A;  3CNT A;  2XLR A;  1O95 A;  1OJT A;  2FJB A;  3DME A;  3FG2 P;  5FS7 A;  3UP5 A;  4BJY A;  4USR A;  1CJ4 A;  1Q9I A;  2Z5Y A;  4TM3 A;  2BYB A;  3AE6 A;  3OZ2 A;  2WP9 A;  3NHO X;  1E39 A;  2JAE A;  3CNS A;  1FEB A;  2V3B A;  1VQW A;  3GYJ A;  4TM4 A;  1PDH A;  1KSS A;  4WCT A;  1GND A;  3Q6J A;  2XDO A;  1NHP A;  1ZOV A;  3WE0 A;  3V3N A;  3ALJ A;  2FBW A;  1Q1R A;  2YR5 A;  4OPD A;  3EF6 A;  4K5S A;  2GQF A;  3CGC A;  3SM8 A;  2C66 A;  1F3P A;  1K0J A;  1F8W A;  2IID A;  4ADW A;  3NYE A;  2GEW A;  3M12 A;  4B63 A;  1NHR A;  4P9S A;  4JNQ A;  1NEN A;  2AQJ A;  2NPX A;  2QCU A;  3GWD A;  3URH A;  1PXA A;  1DOB A;  2GMJ A;  2WU2 A;  4H2R A;  3CPH G;  2B7R A;  2C3D A;  2GAG B;  4GDE A;  2JK6 A;  2YWL A;  3K30 A;  3SGL A;  2NVK X;  3RP6 A;  3P4P A;  3I3L A;  1GEU A;  2RGJ A;  1IUU A;  1PJ6 A;  2C73 A;  4O5U A;  1ZKQ A;  1LPF A;  2X8G A;  4PAA A;  2Z5X A;  1KDG A;  3AE4 A;  3DJG X;  4A79 A;  4JQ9 A;  2OA1 A;  2WOV A;  2X8C A;  3NTA A;  4J2W A;  1FL2 A;  1GET A;  1K0L A;  1PHH A;  1PJ5 A;  1GRG A;  3VQR A;  4JDR A;  4HB9 A;  2YAU A;  4C77 A;  1TYT A;  2WES A;  3NTD A;  1FOH A;  1P2E A;  2ACZ A;  2JB3 A;  3ZYX A;  2YM1 A;  2XYO A;  3UOX A;  2GRT A;  2A89 A;  4CRT A;  3CND A;  4CCQ A;  2YQU A;  2CUL A;  3NN6 X;  3NK0 X;  4ZCC A;  2XFP A;  5JCK A;  3EAN A;  1ELI A;  1M6I A;  3DK8 A;  4EQR A;  3RNM A;  2GVC A;  2YG4 A;  3UOY A;  1GRH A;  3CIR A;  4U8P A;  1EBD A;  4PAB A;  1H86 A;  5KOW A;  3QVR A;  1N4W A;  5M10 A;  3AB1 A;  4EM4 A;  2EQ9 A;  1LTX R;  3E1T A;  4OPC A;  4OPI A;  4X9N A;  1GTH A;  4Z2U A;  5KXJ A;  3DJJ A;  3D8X A;  1Q1W A;  3NIX A;  1L0V A;  2GAH B;  3ICS A;  2B9Y A;  3AE9 A;  3P4S A;  3AE2 A;  2GB0 A;  4CY8 A;  3OC4 A;  2R46 A;  4Z2T A;  4GF7 A;  3IHM A;  2BAB A;  2VQB A;  1XHC A;  3AE3 A;  2EQ7 A;  3DH9 A;  4DNA A;  1TDK A;  3NLC A;  3AEC A;  4GDP A;  2YLW A;  4H4S A;  4H4V A;  4FK1 A;  4UDR A;  4B69 A;  1GPE A;  1QO8 A;  2BXR A;  2WS3 A;  3UKA A;  4EMI A;  1VG9 A;  2J3N A;  1NHQ A;  2C64 A;  1MO9 A;  2DKH A;  3NYC A;  5IQ1 A;  4A65 A;  2WQY A;  2XCG A;  4CNJ A;  3GD4 A;  1TRB A;  3Q9T A;  4H2P A;  2A87 A;  2QA2 A;  2ZZ0 A;  4AOS A;  3QFA A;  4H4Z A;  2XVE A;  4B1B A;  3ADA B;  1ZMD A;  1ZY8 A;  2DKI A;  3GRT A;  2C7G A;  4U2T A;  2H88 A;  1IUW A;  3AE1 A;  3CPI G;  1ZK7 A;  2JB2 A;  3FMW A;  2Q0K A;  1PBB A;  3PO7 A;  2BS2 A;  3G5Q A;  4YTM A;  3II4 A;  2FJD A;  2GR2 A;  2R0G A;  2V3A A;  3C4N A;  2XVJ A;  3P9U A;  4ZN0 A;  3IWA A;  1TYP A;  1YQ3 A;  1CC6 A;  4E0V A;  1PJ7 A;  2YG3 A;  4M52 A;  3COX A;  3AD7 B;  3DK4 A;  4H4W A;  4K2X A;  4H4U A;  4XWR A;  4C5O A;  4YKG A;  1GRE A;  1CC2 A;  4ECH A;  5U1O A;  5HYM A;  2BC0 A;  1GSN A;  1REO A;  1H83 A;  4CNK A;  3QFB A;  1ZMC A;  4KPR A;  1YQZ A;  3B3R A;  4LA1 A;  4U8O A;  5J60 A;  1KNR A;  4J56 A;  3BNU A;  3ZDN A;  1CC4 A;  3AE8 A;  1OJD A;  1CJ2 A;  5HY5 A;  3CGE A;  2BK4 A;  3KPF A;  2C3C A;  2RGO A;  2EQ8 A;  1L9D A;  2XFQ A;  1N4V A;  4OPG A;  5ER0 A;  2RAB A;  3UOV A;  3C96 A;  4O5Q A;  3M0O A;  4YSZ A;  3K7M X;  1B37 A;  4A99 A;  1F8S A;  2Y6R A;  2VOU A;  3K7Q X;  1BF3 A;  3KVE A;  1IUV A;  2YG7 A;  4LU6 A;  4AP1 A;  4YSX A;  4Z43 A;  1GRB A;  3DA1 A;  3DJE A;  4OCG A;  3D1C A;  4CBQ A;  1Y56 B;  3M13 A;  2I0Z A;  3LAD A;  5GRT A;  1GRT A;  2TPR A;  1MXT A;  3AEE A;  3UP4 A;  3AWI A;  1BZL A;  3F8R A;  4YSY A;  5HXI A;  3NKS A;  4JY2 A;  2H89 A;  2A8X A;  4IVM B;  4RSL A;  1O5W A;  1N4U A;  3KU9 A;  2PHH A;  2BS3 A;  3PS9 A;  4H2Q A;  3LXD A;  1GRA A;  3CTY A;  3UKH A;  2FJE A;  4FX9 A;  1YKJ A;  4DGK A;  3H8L A;  3KLJ A;  1JRZ A;  1ZOY A;  2OLN A;  3PVC A;  4N9X A;  3AD9 B;  3CGD A;  3VR9 A;  2Q6U A;  1JEH A;  3JSK A;  4H4X A;  4IA6 A;  3QJ4 A;  1GOS A;  2AR8 A;  2YLR A;  3EPT A;  4BK1 A;  3H8I A;  2B9X A;  3SQP A;  3AYI A;  4K8D A;  4D04 A;  2WHD A;  4AP3 A;  4BK2 A;  1Y56 A;  2IVD A;  2ZZC A;  1S2Y A;  5U63 A;  1PN0 A;  4MJW A;  1E1N A;  1KF6 A; 
#chains in the Genus database with same CATH topology
 3QSM A;  2JB1 A;  1ZDL A;  1IUX A;  2BC1 A;  3IHG A;  3UKL A;  4RG4 A;  2XFN A;  3CNJ A;  4BK3 A;  1K4Q A;  4GR1 A;  4B67 A;  4XXG A;  1B5Q A;  1H82 A;  3AE5 A;  4EMW A;  2B7S A;  2C70 A;  2XVH A;  1GRF A;  2R4J A;  3KKJ A;  2WU5 A;  4B66 A;  1JRX A;  3T2Y A;  2YLZ A;  3DGZ A;  1E1K A;  5M0Z A;  2OLO A;  2XFO A;  4ZCD A;  2WP6 A;  3LZW A;  1PS9 A;  3RHA A;  1S3B A;  3HYV A;  1TDF A;  2C65 A;  4GRT A;  3SZW A;  1DOC A;  1JOA A;  2GF3 A;  3CN8 A;  1PBE A;  1VG0 A;  3QSS A;  3DGH A;  3K7T A;  2XLU A;  3H4K A;  2ARD A;  4TM1 A;  3HYW A;  5BUK A;  3RED A;  4BJZ A;  3V3O A;  1Y0P A;  1YQ4 A;  4U2L A;  3LB8 A;  3ICR A;  3P1W A;  2OAL A;  1XDI A;  3GMC A;  4K22 A;  2XLT A;  3GWF A;  1NHS A;  2BAC A;  1BGN A;  1H7W A;  2GR3 A;  1VDC A;  2GR0 A;  4G6G A;  1JRY A;  4EMJ A;  1DJN A;  1DOD A;  5FMH A;  3UTH A;  4EQX A;  4DSG A;  5BUL A;  2APG A;  5U25 A;  4NEW A;  3V76 A;  1H6V A;  5CKU A;  1B4V A;  3P4R A;  5CQF A;  1IUS A;  3L1R A;  4U8M A;  2YG6 A;  5EOW A;  3T37 A;  2BA9 A;  1NPX A;  5DBJ A;  1S2Q A;  1SEZ A;  4LII A;  1X31 B;  3DK9 A;  4CCR A;  1IUT A;  1LVL A;  2WDR A;  3L8K A;  3C4A A;  4EQW A;  3AEG A;  3NH3 X;  4H4Y A;  2AAQ A;  1TDO A;  3NK2 X;  5JCI A;  2VVM A;  1PBD A;  2Q0L A;  1D7L A;  4H4Q A;  4BV6 A;  1OJ9 A;  1RP0 A;  1PBC A;  2VVL A;  3BI2 A;  4J36 A;  1E1L A;  4U8I A;  4APN A;  3ABV A;  2E1M A;  2X3N A;  2GQW A;  2WOW A;  3VRD B;  2E5V A;  2BK3 A;  3I6D A;  3UTF A;  2V61 A;  4A6N B;  2BRY A;  3LOV A;  4EM3 A;  4OPU A;  1JU2 A;  1GV4 A;  2YG5 A;  4J31 A;  2ZZB A;  3BI4 A;  3DJD A;  1BWC A;  3QSE A;  2XLP A;  2WPC A;  2JBV A;  4USQ A;  4C3X A;  2X50 A;  1ZX9 A;  3GSI A;  2BCG G;  4H2N A;  1EL9 A;  3AEB A;  1CJC A;  2BXS A;  3AYJ A;  3AYL A;  2YM2 A;  4H4P A;  4OPL A;  4YT0 A;  2C75 A;  4TLX A;  3G5S A;  1EL8 A;  2R9Z A;  2XFU A;  1LQT A;  2GMH A;  5J7X A;  3RP7 A;  3ITJ A;  2WDV A;  3AXB A;  1GT8 A;  1Z6L A;  3AD8 B;  4IVO B;  3T2K A;  2R45 A;  2WET A;  4K5R A;  4A6N A;  1JNR A;  3BHF A;  2TMD A;  2YVJ A;  2HQM A;  5KMQ A;  3VRB A;  1L9E A;  2XVF A;  3IC9 A;  5JCN A;  3F8P A;  4TM0 A;  3EAO A;  2F5Z A;  2VRL A;  4D03 A;  5IPY A;  4J33 A;  3O0H A;  4UDP A;  4NEV A;  3CPJ G;  1EL5 A;  3NT6 A;  3FPZ A;  2CDU A;  2WPF A;  1KFY A;  4EIP A;  2JKC A;  4Y4L A;  4U8L A;  4BUR A;  2C76 A;  3SFE A;  4B68 A;  3UKF A;  3F8D A;  4YXD A;  3VR8 A;  1IJH A;  1DNC A;  3G5R A;  3ATR A;  5BVA A;  5KRQ A;  4FDC B;  1E7P A;  3UKQ A;  2UZZ A;  3T2Z A;  3NYF A;  4GAP A;  4A9W A;  1RSG A;  1DXL A;  3NGC X;  4Z24 A;  1H84 A;  4G6H A;  5EB5 A;  3ATQ A;  1TDE A;  4B64 A;  1F8R A;  2V6O A;  3BHK A;  3GYI A;  4NTD A;  1GES A;  2WP5 A;  3FIM B;  1NG3 A;  2WPE A;  5IQ4 A;  3NG7 X;  2RGH A;  3GD3 A;  4YSH A;  5KMS A;  1AOG A;  1H81 A;  3SZF A;  1FEC A;  4A7A A;  1E6E A;  2CVJ A;  4RG3 A;  1K0I A;  4AT0 A;  1FEA A;  1NAA A;  3UKP A;  3KPK A;  5TR3 A;  1D7Y A;  5FS8 A;  3S61 A;  3KA7 A;  4GCM A;  4H7U A;  2X99 A;  3T14 A;  2PYX A;  4Z2R A;  1CHU A;  3BI5 A;  4IV9 A;  4I59 A;  3BNM A;  2BS4 A;  3HZL A;  4REK A;  4EIQ A;  2VQ7 A;  4JNA A;  3KD9 A;  4C3Y A;  1ZP0 A;  2B9W A;  1BGJ A;  1V59 A;  4CY6 A;  4YTP A;  5KMP A;  5EB4 A;  3LZX A;  3UTE A;  1RYI A;  4U2S A;  4Y4M A;  2V60 A;  3NNE A;  3AEF A;  5FS9 A;  2VZ2 A;  4YTN A;  1GER A;  1KSU A;  4GUV A;  3CNP A;  2V5Z A;  4NTC A;  2VVL G;  3AE7 A;  1LJ1 A;  4WX1 A;  3ALM A;  1W4X A;  1F6M A;  1B8S A;  4YKF A;  4IA5 A;  5C2T A;  1CF3 A;  2Y6Q A;  4G74 A;  2OAM A;  3VRA A;  4OPT A;  3SZ0 A;  3UCL A;  3NRN A;  2B76 A;  5KOX A;  4AOX A;  2YLX A;  1H7X A;  2GV8 A;  4JY3 A;  3SYI A;  4C74 A;  3T31 A;  2WEU A;  1E1M A;  1D4C A;  3CGB A;  1TDN A;  4XWZ A;  3SFD A;  2ZBW A;  2GH5 A;  2WDQ A;  4J34 A;  4U8K A;  4YWO A;  1PXC A;  2YVF A;  5GSN A;  5KVI A;  4H4R A;  2VRM A;  4U8J A;  4TLZ A;  2YVG A;  4KX6 A;  1COY A;  5C3J A;  2R0P A;  1XAN A;  1D4E A;  1L9C A;  3QVP A;  2W0H A;  4OVI A;  2YLS A;  3UTG A;  1GTE A;  1S3E A;  3IF9 A;  2WOI A;  4UP3 A;  5KNL A;  4U8N A;  4Z26 A;  4ICY A;  2C72 A;  5KWF A;  2R4E A;  4X9M A;  5JCM A;  1EL7 A;  1N1P A;  4DSH A;  1ONF A;  4H50 A;  5HHF A;  1GXF A;  2IVE A;  2YR4 A;  2BCP A;  1LV0 A;  1LQU A;  1YY5 A;  3GDP A;  1VRQ B;  2WBA A;  2X8H A;  4HA6 A;  2YLT A;  1NG4 A;  1JNZ A;  1PXB A;  4X4J A;  3NK1 X;  3RP8 A;  3NN0 X;  5JCL A;  2C4C A;  4NZH A;  3FBS A;  1OJC A;  4II3 A;  1CL0 A;  1FCD A;  1MOK A;  4Y4N A;  2R0C A;  3UKK A;  3SZC A;  4I58 A;  1DOE A;  1O94 A;  3UOZ A;  2BK5 A;  2C67 A;  1UKV G;  2QA1 A;  1M64 A;  1D4D A;  3LJP A;  3S5W A;  2XVI A;  4JN9 A;  5EBK A;  1DJQ A;  1QJD A;  1BKW A;  1NDA A;  2XLS A;  3ALL A;  3AEA A;  4J57 A;  2E4G A;  3GMB A;  4Z25 A;  1KNP A;  3CMM A;  2EQ6 A;  5BRT A;  5LV9 A;  1GAL A;  4FK1 C;  4B65 A;  3B6D A;  5FS6 A;  5KVH A;  2GR1 A;  2YR6 A;  3ISH A;  3AED A;  1OJA A;  3ICT A;  4H4T A;  4UDQ A;  3HYX A;  1CJ3 A;  2QAE A;  4Z44 A;  1P2H A;  3GDN A;  1HYU A;  1NEK A;  1CBO A;  4AT2 A;  3R9U A;  5L46 A;  4K7Z A;  4A5L A;  4NTE A;  4EQS A;  3GRS A;  1D5T A;  2O9Z A;  3P4Q A;  1QLB A;  1XPQ A;  1PBF A;  2CFY A;  2FJA A;  2Q7V A;  3CNT A;  2XLR A;  1O95 A;  1OJT A;  2FJB A;  3DME A;  3FG2 P;  5FS7 A;  3UP5 A;  4BJY A;  4USR A;  1CJ4 A;  1Q9I A;  2Z5Y A;  4TM3 A;  2BYB A;  3AE6 A;  3OZ2 A;  2WP9 A;  3NHO X;  1E39 A;  2JAE A;  3CNS A;  1FEB A;  2V3B A;  1VQW A;  3GYJ A;  4TM4 A;  1PDH A;  1KSS A;  4WCT A;  1GND A;  3Q6J A;  2XDO A;  1NHP A;  1ZOV A;  3WE0 A;  3V3N A;  3ALJ A;  2FBW A;  1Q1R A;  2YR5 A;  4OPD A;  3EF6 A;  4K5S A;  2GQF A;  3CGC A;  3SM8 A;  2C66 A;  1F3P A;  1K0J A;  1F8W A;  2IID A;  4ADW A;  3NYE A;  4G73 A;  2GEW A;  3M12 A;  4NNJ A;  4B63 A;  1NHR A;  4P9S A;  4JNQ A;  4GAV A;  1NEN A;  2AQJ A;  2NPX A;  2QCU A;  3GWD A;  3URH A;  1PXA A;  1DOB A;  2GMJ A;  2WU2 A;  4H2R A;  3CPH G;  2B7R A;  2C3D A;  2GAG B;  4GDE A;  2JK6 A;  2YWL A;  3K30 A;  3SGL A;  2NVK X;  3RP6 A;  3P4P A;  3I3L A;  1GEU A;  2RGJ A;  1IUU A;  1PJ6 A;  2C73 A;  4O5U A;  1ZKQ A;  1LPF A;  2X8G A;  4PAA A;  2Z5X A;  1KDG A;  3AE4 A;  3DJG X;  4A79 A;  4JQ9 A;  2OA1 A;  2WOV A;  2X8C A;  3NTA A;  4J2W A;  1FL2 A;  1GET A;  1K0L A;  1PHH A;  1PJ5 A;  1GRG A;  3VQR A;  4JDR A;  4HB9 A;  2YAU A;  4C77 A;  1TYT A;  2WES A;  3NTD A;  1FOH A;  1P2E A;  2ACZ A;  2JB3 A;  3ZYX A;  2YM1 A;  2XYO A;  3UOX A;  2GRT A;  2A89 A;  4NWZ A;  4CRT A;  3CND A;  4CCQ A;  2YQU A;  2CUL A;  3NN6 X;  3NK0 X;  4ZCC A;  2XFP A;  5JCK A;  3EAN A;  1ELI A;  1M6I A;  3DK8 A;  4EQR A;  3RNM A;  2GVC A;  2YG4 A;  3UOY A;  1GRH A;  3CIR A;  4U8P A;  1EBD A;  4PAB A;  1H86 A;  5KOW A;  3QVR A;  1N4W A;  5M10 A;  3AB1 A;  4EM4 A;  2EQ9 A;  1LTX R;  3E1T A;  4OPC A;  4OPI A;  4X9N A;  1GTH A;  4Z2U A;  5KXJ A;  3DJJ A;  3D8X A;  1Q1W A;  3NIX A;  1L0V A;  2GAH B;  3ICS A;  2B9Y A;  3AE9 A;  3P4S A;  3AE2 A;  2GB0 A;  4CY8 A;  3OC4 A;  2R46 A;  4Z2T A;  4GF7 A;  3IHM A;  2BAB A;  2VQB A;  3SX6 A;  1XHC A;  3AE3 A;  2EQ7 A;  3DH9 A;  4DNA A;  1TDK A;  3NLC A;  3AEC A;  4GDP A;  2YLW A;  4H4S A;  4H4V A;  4FK1 A;  4UDR A;  4B69 A;  1GPE A;  1QO8 A;  2BXR A;  2WS3 A;  3UKA A;  4EMI A;  1VG9 A;  2J3N A;  1NHQ A;  2C64 A;  1MO9 A;  2DKH A;  3NYC A;  5IQ1 A;  4A65 A;  2WQY A;  2XCG A;  4CNJ A;  3GD4 A;  1TRB A;  3Q9T A;  4H2P A;  2A87 A;  2QA2 A;  2ZZ0 A;  4AOS A;  3QFA A;  4H4Z A;  2XVE A;  4B1B A;  3ADA B;  1ZMD A;  1ZY8 A;  2DKI A;  3GRT A;  2C7G A;  4U2T A;  2H88 A;  1IUW A;  3GYX A;  3AE1 A;  3CPI G;  1ZK7 A;  2JB2 A;  3FMW A;  2Q0K A;  1PBB A;  3PO7 A;  2BS2 A;  3G5Q A;  4YTM A;  3II4 A;  2FJD A;  2GR2 A;  2R0G A;  2V3A A;  3C4N A;  2XVJ A;  3P9U A;  4ZN0 A;  3IWA A;  1TYP A;  1YQ3 A;  1CC6 A;  4E0V A;  1PJ7 A;  2YG3 A;  4M52 A;  3COX A;  3AD7 B;  3DK4 A;  4H4W A;  4K2X A;  4H4U A;  4XWR A;  4C5O A;  4YKG A;  1GRE A;  1CC2 A;  4ECH A;  5U1O A;  3SY4 A;  5HYM A;  2BC0 A;  1GSN A;  1REO A;  1H83 A;  4CNK A;  3QFB A;  1ZMC A;  4KPR A;  1YQZ A;  3B3R A;  4II2 A;  4LA1 A;  4U8O A;  5J60 A;  1KNR A;  4J56 A;  3BNU A;  3ZDN A;  1CC4 A;  3AE8 A;  1OJD A;  1CJ2 A;  5HY5 A;  3CGE A;  2BK4 A;  4G9K A;  3KPF A;  2C3C A;  2RGO A;  2EQ8 A;  1L9D A;  2XFQ A;  5KMR A;  1N4V A;  4OPG A;  5ER0 A;  2RAB A;  3UOV A;  3C96 A;  4O5Q A;  3M0O A;  4YSZ A;  3K7M X;  1B37 A;  4A99 A;  1F8S A;  2Y6R A;  2VOU A;  3K7Q X;  1BF3 A;  3KVE A;  1IUV A;  2YG7 A;  4LU6 A;  4AP1 A;  4YSX A;  4Z43 A;  1GRB A;  3DA1 A;  3DJE A;  4OCG A;  3D1C A;  4CBQ A;  1Y56 B;  3M13 A;  2I0Z A;  3LAD A;  5GRT A;  1GRT A;  2TPR A;  1MXT A;  3AEE A;  3UP4 A;  3AWI A;  1BZL A;  3F8R A;  4YSY A;  5HXI A;  3NKS A;  4JY2 A;  2H89 A;  2A8X A;  4IVM B;  4RSL A;  1O5W A;  1N4U A;  3KU9 A;  2BRA A;  2PHH A;  2BS3 A;  3PS9 A;  4H2Q A;  3T0K A;  3LXD A;  1GRA A;  3CTY A;  3UKH A;  2FJE A;  4FX9 A;  1YKJ A;  4DGK A;  3H8L A;  3SXI A;  3KLJ A;  1JRZ A;  1ZOY A;  2OLN A;  3PVC A;  4N9X A;  3AD9 B;  3CGD A;  3VR9 A;  2Q6U A;  1JEH A;  3JSK A;  4H4X A;  4IA6 A;  3QJ4 A;  1GOS A;  2AR8 A;  2YLR A;  3EPT A;  4BK1 A;  3H8I A;  2B9X A;  3SQP A;  3AYI A;  4K8D A;  4D04 A;  2WHD A;  4AP3 A;  4BK2 A;  1Y56 A;  2IVD A;  2ZZC A;  1S2Y A;  5U63 A;  1PN0 A;  4MJW A;  1E1N A;  1KF6 A; 
#chains in the Genus database with same CATH homology
 3QSM A;  2JB1 A;  1ZDL A;  1IUX A;  2BC1 A;  3IHG A;  3UKL A;  4RG4 A;  2XFN A;  3CNJ A;  4BK3 A;  1K4Q A;  4GR1 A;  4B67 A;  4XXG A;  1B5Q A;  1H82 A;  3AE5 A;  4EMW A;  2B7S A;  2C70 A;  2XVH A;  1GRF A;  2R4J A;  3KKJ A;  2WU5 A;  4B66 A;  1JRX A;  3T2Y A;  2YLZ A;  3DGZ A;  1E1K A;  5M0Z A;  2OLO A;  2XFO A;  4ZCD A;  2WP6 A;  3LZW A;  1PS9 A;  3RHA A;  1S3B A;  3HYV A;  1TDF A;  2C65 A;  4GRT A;  3SZW A;  1DOC A;  1JOA A;  2GF3 A;  3CN8 A;  1PBE A;  1VG0 A;  3QSS A;  3DGH A;  3K7T A;  2XLU A;  3H4K A;  2ARD A;  4TM1 A;  3HYW A;  5BUK A;  3RED A;  4BJZ A;  3V3O A;  1Y0P A;  1YQ4 A;  4U2L A;  3LB8 A;  3ICR A;  3P1W A;  2OAL A;  1XDI A;  3GMC A;  4K22 A;  2XLT A;  3GWF A;  1NHS A;  2BAC A;  1BGN A;  1H7W A;  2GR3 A;  1VDC A;  2GR0 A;  4G6G A;  1JRY A;  4EMJ A;  1DJN A;  1DOD A;  5FMH A;  3UTH A;  4EQX A;  4DSG A;  5BUL A;  2APG A;  5U25 A;  4NEW A;  3V76 A;  1H6V A;  5CKU A;  1B4V A;  3P4R A;  5CQF A;  1IUS A;  3L1R A;  4U8M A;  2YG6 A;  5EOW A;  3T37 A;  2BA9 A;  1NPX A;  5DBJ A;  1S2Q A;  1SEZ A;  4LII A;  1X31 B;  3DK9 A;  4CCR A;  1IUT A;  1LVL A;  2WDR A;  3L8K A;  3C4A A;  4EQW A;  3AEG A;  3NH3 X;  4H4Y A;  2AAQ A;  1TDO A;  3NK2 X;  5JCI A;  2VVM A;  1PBD A;  2Q0L A;  1D7L A;  4H4Q A;  4BV6 A;  1OJ9 A;  1RP0 A;  1PBC A;  2VVL A;  3BI2 A;  4J36 A;  1E1L A;  4U8I A;  4APN A;  3ABV A;  2E1M A;  2X3N A;  2GQW A;  2WOW A;  3VRD B;  2E5V A;  2BK3 A;  3I6D A;  3UTF A;  2V61 A;  4A6N B;  2BRY A;  3LOV A;  4EM3 A;  4OPU A;  1JU2 A;  1GV4 A;  2YG5 A;  4J31 A;  2ZZB A;  3BI4 A;  3DJD A;  1BWC A;  3QSE A;  2XLP A;  2WPC A;  2JBV A;  4USQ A;  4C3X A;  2X50 A;  1ZX9 A;  3GSI A;  2BCG G;  4H2N A;  1EL9 A;  3AEB A;  1CJC A;  2BXS A;  3AYJ A;  3AYL A;  2YM2 A;  4H4P A;  4OPL A;  4YT0 A;  2C75 A;  4TLX A;  3G5S A;  1EL8 A;  2R9Z A;  2XFU A;  1LQT A;  2GMH A;  5J7X A;  3RP7 A;  3ITJ A;  2WDV A;  3AXB A;  1GT8 A;  1Z6L A;  3AD8 B;  4IVO B;  3T2K A;  2R45 A;  2WET A;  4K5R A;  4A6N A;  1JNR A;  3BHF A;  2TMD A;  2YVJ A;  2HQM A;  5KMQ A;  3VRB A;  1L9E A;  2XVF A;  3IC9 A;  5JCN A;  3F8P A;  4TM0 A;  3EAO A;  2F5Z A;  2VRL A;  4D03 A;  5IPY A;  4J33 A;  3O0H A;  4UDP A;  4NEV A;  3CPJ G;  1EL5 A;  3NT6 A;  3FPZ A;  2CDU A;  2WPF A;  1KFY A;  4EIP A;  2JKC A;  4Y4L A;  4U8L A;  4BUR A;  2C76 A;  3SFE A;  4B68 A;  3UKF A;  3F8D A;  4YXD A;  3VR8 A;  1IJH A;  1DNC A;  3G5R A;  3ATR A;  5BVA A;  5KRQ A;  4FDC B;  1E7P A;  3UKQ A;  2UZZ A;  3T2Z A;  3NYF A;  4GAP A;  4A9W A;  1RSG A;  1DXL A;  3NGC X;  4Z24 A;  1H84 A;  4G6H A;  5EB5 A;  3ATQ A;  1TDE A;  4B64 A;  1F8R A;  2V6O A;  3BHK A;  3GYI A;  4NTD A;  1GES A;  2WP5 A;  3FIM B;  1NG3 A;  2WPE A;  5IQ4 A;  3NG7 X;  2RGH A;  3GD3 A;  4YSH A;  5KMS A;  1AOG A;  1H81 A;  3SZF A;  1FEC A;  4A7A A;  1E6E A;  2CVJ A;  4RG3 A;  1K0I A;  4AT0 A;  1FEA A;  1NAA A;  3UKP A;  3KPK A;  5TR3 A;  1D7Y A;  5FS8 A;  3S61 A;  3KA7 A;  4GCM A;  4H7U A;  2X99 A;  3T14 A;  2PYX A;  4Z2R A;  1CHU A;  3BI5 A;  4IV9 A;  4I59 A;  3BNM A;  2BS4 A;  3HZL A;  4REK A;  4EIQ A;  2VQ7 A;  4JNA A;  3KD9 A;  4C3Y A;  1ZP0 A;  2B9W A;  1BGJ A;  1V59 A;  4CY6 A;  4YTP A;  5KMP A;  5EB4 A;  3LZX A;  3UTE A;  1RYI A;  4U2S A;  4Y4M A;  2V60 A;  3NNE A;  3AEF A;  5FS9 A;  2VZ2 A;  4YTN A;  1GER A;  1KSU A;  4GUV A;  3CNP A;  2V5Z A;  4NTC A;  2VVL G;  3AE7 A;  1LJ1 A;  4WX1 A;  3ALM A;  1W4X A;  1F6M A;  1B8S A;  4YKF A;  4IA5 A;  5C2T A;  1CF3 A;  2Y6Q A;  4G74 A;  2OAM A;  3VRA A;  4OPT A;  3SZ0 A;  3UCL A;  3NRN A;  2B76 A;  5KOX A;  4AOX A;  2YLX A;  1H7X A;  2GV8 A;  4JY3 A;  3SYI A;  4C74 A;  3T31 A;  2WEU A;  1E1M A;  1D4C A;  3CGB A;  1TDN A;  4XWZ A;  3SFD A;  2ZBW A;  2GH5 A;  2WDQ A;  4J34 A;  4U8K A;  4YWO A;  1PXC A;  2YVF A;  5GSN A;  5KVI A;  4H4R A;  2VRM A;  4U8J A;  4TLZ A;  2YVG A;  4KX6 A;  1COY A;  5C3J A;  2R0P A;  1XAN A;  1D4E A;  1L9C A;  3QVP A;  2W0H A;  4OVI A;  2YLS A;  3UTG A;  1GTE A;  1S3E A;  3IF9 A;  2WOI A;  4UP3 A;  5KNL A;  4U8N A;  4Z26 A;  4ICY A;  2C72 A;  5KWF A;  2R4E A;  4X9M A;  5JCM A;  1EL7 A;  1N1P A;  4DSH A;  1ONF A;  4H50 A;  5HHF A;  1GXF A;  2IVE A;  2YR4 A;  2BCP A;  1LV0 A;  1LQU A;  1YY5 A;  3GDP A;  1VRQ B;  2WBA A;  2X8H A;  4HA6 A;  2YLT A;  1NG4 A;  1JNZ A;  1PXB A;  4X4J A;  3NK1 X;  3RP8 A;  3NN0 X;  5JCL A;  2C4C A;  4NZH A;  3FBS A;  1OJC A;  4II3 A;  1CL0 A;  1FCD A;  1MOK A;  4Y4N A;  2R0C A;  3UKK A;  3SZC A;  4I58 A;  1DOE A;  1O94 A;  3UOZ A;  2BK5 A;  2C67 A;  1UKV G;  2QA1 A;  1M64 A;  1D4D A;  3LJP A;  3S5W A;  2XVI A;  4JN9 A;  5EBK A;  1DJQ A;  1QJD A;  1BKW A;  1NDA A;  2XLS A;  3ALL A;  3AEA A;  4J57 A;  2E4G A;  3GMB A;  4Z25 A;  1KNP A;  3CMM A;  2EQ6 A;  5BRT A;  5LV9 A;  1GAL A;  4FK1 C;  4B65 A;  3B6D A;  5FS6 A;  5KVH A;  2GR1 A;  2YR6 A;  3ISH A;  3AED A;  1OJA A;  3ICT A;  4H4T A;  4UDQ A;  3HYX A;  1CJ3 A;  2QAE A;  4Z44 A;  1P2H A;  3GDN A;  1HYU A;  1NEK A;  1CBO A;  4AT2 A;  3R9U A;  5L46 A;  4K7Z A;  4A5L A;  4NTE A;  4EQS A;  3GRS A;  1D5T A;  2O9Z A;  3P4Q A;  1QLB A;  1XPQ A;  1PBF A;  2CFY A;  2FJA A;  2Q7V A;  3CNT A;  2XLR A;  1O95 A;  1OJT A;  2FJB A;  3DME A;  3FG2 P;  5FS7 A;  3UP5 A;  4BJY A;  4USR A;  1CJ4 A;  1Q9I A;  2Z5Y A;  4TM3 A;  2BYB A;  3AE6 A;  3OZ2 A;  2WP9 A;  3NHO X;  1E39 A;  2JAE A;  3CNS A;  1FEB A;  2V3B A;  1VQW A;  3GYJ A;  4TM4 A;  1PDH A;  1KSS A;  4WCT A;  1GND A;  3Q6J A;  2XDO A;  1NHP A;  1ZOV A;  3WE0 A;  3V3N A;  3ALJ A;  2FBW A;  1Q1R A;  2YR5 A;  4OPD A;  3EF6 A;  4K5S A;  2GQF A;  3CGC A;  3SM8 A;  2C66 A;  1F3P A;  1K0J A;  1F8W A;  2IID A;  4ADW A;  3NYE A;  4G73 A;  2GEW A;  3M12 A;  4NNJ A;  4B63 A;  1NHR A;  4P9S A;  4JNQ A;  4GAV A;  1NEN A;  2AQJ A;  2NPX A;  2QCU A;  3GWD A;  3URH A;  1PXA A;  1DOB A;  2GMJ A;  2WU2 A;  4H2R A;  3CPH G;  2B7R A;  2C3D A;  2GAG B;  4GDE A;  2JK6 A;  2YWL A;  3K30 A;  3SGL A;  2NVK X;  3RP6 A;  3P4P A;  3I3L A;  1GEU A;  2RGJ A;  1IUU A;  1PJ6 A;  2C73 A;  4O5U A;  1ZKQ A;  1LPF A;  2X8G A;  4PAA A;  2Z5X A;  1KDG A;  3AE4 A;  3DJG X;  4A79 A;  4JQ9 A;  2OA1 A;  2WOV A;  2X8C A;  3NTA A;  4J2W A;  1FL2 A;  1GET A;  1K0L A;  1PHH A;  1PJ5 A;  1GRG A;  3VQR A;  4JDR A;  4HB9 A;  2YAU A;  4C77 A;  1TYT A;  2WES A;  3NTD A;  1FOH A;  1P2E A;  2ACZ A;  2JB3 A;  3ZYX A;  2YM1 A;  2XYO A;  3UOX A;  2GRT A;  2A89 A;  4NWZ A;  4CRT A;  3CND A;  4CCQ A;  2YQU A;  2CUL A;  3NN6 X;  3NK0 X;  4ZCC A;  2XFP A;  5JCK A;  3EAN A;  1ELI A;  1M6I A;  3DK8 A;  4EQR A;  3RNM A;  2GVC A;  2YG4 A;  3UOY A;  1GRH A;  3CIR A;  4U8P A;  1EBD A;  4PAB A;  1H86 A;  5KOW A;  3QVR A;  1N4W A;  5M10 A;  3AB1 A;  4EM4 A;  2EQ9 A;  1LTX R;  3E1T A;  4OPC A;  4OPI A;  4X9N A;  1GTH A;  4Z2U A;  5KXJ A;  3DJJ A;  3D8X A;  1Q1W A;  3NIX A;  1L0V A;  2GAH B;  3ICS A;  2B9Y A;  3AE9 A;  3P4S A;  3AE2 A;  2GB0 A;  4CY8 A;  3OC4 A;  2R46 A;  4Z2T A;  4GF7 A;  3IHM A;  2BAB A;  2VQB A;  3SX6 A;  1XHC A;  3AE3 A;  2EQ7 A;  3DH9 A;  4DNA A;  1TDK A;  3NLC A;  3AEC A;  4GDP A;  2YLW A;  4H4S A;  4H4V A;  4FK1 A;  4UDR A;  4B69 A;  1GPE A;  1QO8 A;  2BXR A;  2WS3 A;  3UKA A;  4EMI A;  1VG9 A;  2J3N A;  1NHQ A;  2C64 A;  1MO9 A;  2DKH A;  3NYC A;  5IQ1 A;  4A65 A;  2WQY A;  2XCG A;  4CNJ A;  3GD4 A;  1TRB A;  3Q9T A;  4H2P A;  2A87 A;  2QA2 A;  2ZZ0 A;  4AOS A;  3QFA A;  4H4Z A;  2XVE A;  4B1B A;  3ADA B;  1ZMD A;  1ZY8 A;  2DKI A;  3GRT A;  2C7G A;  4U2T A;  2H88 A;  1IUW A;  3GYX A;  3AE1 A;  3CPI G;  1ZK7 A;  2JB2 A;  3FMW A;  2Q0K A;  1PBB A;  3PO7 A;  2BS2 A;  3G5Q A;  4YTM A;  3II4 A;  2FJD A;  2GR2 A;  2R0G A;  2V3A A;  3C4N A;  2XVJ A;  3P9U A;  4ZN0 A;  3IWA A;  1TYP A;  1YQ3 A;  1CC6 A;  4E0V A;  1PJ7 A;  2YG3 A;  4M52 A;  3COX A;  3AD7 B;  3DK4 A;  4H4W A;  4K2X A;  4H4U A;  4XWR A;  4C5O A;  4YKG A;  1GRE A;  1CC2 A;  4ECH A;  5U1O A;  3SY4 A;  5HYM A;  2BC0 A;  1GSN A;  1REO A;  1H83 A;  4CNK A;  3QFB A;  1ZMC A;  4KPR A;  1YQZ A;  3B3R A;  4II2 A;  4LA1 A;  4U8O A;  5J60 A;  1KNR A;  4J56 A;  3BNU A;  3ZDN A;  1CC4 A;  3AE8 A;  1OJD A;  1CJ2 A;  5HY5 A;  3CGE A;  2BK4 A;  4G9K A;  3KPF A;  2C3C A;  2RGO A;  2EQ8 A;  1L9D A;  2XFQ A;  5KMR A;  1N4V A;  4OPG A;  5ER0 A;  2RAB A;  3UOV A;  3C96 A;  4O5Q A;  3M0O A;  4YSZ A;  3K7M X;  1B37 A;  4A99 A;  1F8S A;  2Y6R A;  2VOU A;  3K7Q X;  1BF3 A;  3KVE A;  1IUV A;  2YG7 A;  4LU6 A;  4AP1 A;  4YSX A;  4Z43 A;  1GRB A;  3DA1 A;  3DJE A;  4OCG A;  3D1C A;  4CBQ A;  1Y56 B;  3M13 A;  2I0Z A;  3LAD A;  5GRT A;  1GRT A;  2TPR A;  1MXT A;  3AEE A;  3UP4 A;  3AWI A;  1BZL A;  3F8R A;  4YSY A;  5HXI A;  3NKS A;  4JY2 A;  2H89 A;  2A8X A;  4IVM B;  4RSL A;  1O5W A;  1N4U A;  3KU9 A;  2BRA A;  2PHH A;  2BS3 A;  3PS9 A;  4H2Q A;  3T0K A;  3LXD A;  1GRA A;  3CTY A;  3UKH A;  2FJE A;  4FX9 A;  1YKJ A;  4DGK A;  3H8L A;  3SXI A;  3KLJ A;  1JRZ A;  1ZOY A;  2OLN A;  3PVC A;  4N9X A;  3AD9 B;  3CGD A;  3VR9 A;  2Q6U A;  1JEH A;  3JSK A;  4H4X A;  4IA6 A;  3QJ4 A;  1GOS A;  2AR8 A;  2YLR A;  3EPT A;  4BK1 A;  3H8I A;  2B9X A;  3SQP A;  3AYI A;  4K8D A;  4D04 A;  2WHD A;  4AP3 A;  4BK2 A;  1Y56 A;  2IVD A;  2ZZC A;  1S2Y A;  5U63 A;  1PN0 A;  4MJW A;  1E1N A;  1KF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...