3NYFA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-histidine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 122
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyfA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyfA01
4B66A 3NK1X 4X9MA 1H84A 2RGHA 2Z5YA 1JRZA 4OPLA 4JY2A 5IPYA 2XFNA 1PXCA 2XDOA 2R45A 4YSYA 3UTGA 1NAAA 1Y56B 4A6NA 3QSSA 1PJ5A 3AYJA 1IUVA 2BK3A 3NHOX 1EBDA 4JN9A 4DNAA 3EF6A 2GB0A 3BNMA 1NENA 1C0IA 2R0CA 3V3NA 1NDAA 2GQWA 2BCPA 3AE9A 5EB4A 5JCMA 3AB1A 3NYFA 3H4KA 1DDOA 3CNSA 1B8SA 1ZK7A 3L8KA 4D03A 1EVIA 2QA1A 2VRMA 1KFYA 1GV4A 4OPGA 4YJHA 2X8CA 3I6DA 3NN6X 3AD9B 1C0KA 4EQXA 3C4NA 1JOAA 1QO8A 1TYTA 5HYMA 2YG5A 1DJQA 3BI2A 2IVEA 3AE2A 4CY8A 4H50A 4GUVA 4IVMB 4BJZA 1CF3A 4NTDA 4BJYA 3IC9A 1CJCA 2RGOA 4EIPA 3BI4A 5TR3A 3S61A 4H4SA 4U8LA 1NG3A 1K4QA 1P2EA 4M52A 3IF9A 1GRTA 1RSGA 2YR4A 4DSGA 3BNUA 4Z44A 1FEBA 1NG4A 2JB3A 2YM2A 4TM1A 4YJFB 2B76A 1VE9A 2YLTA 2B7SA 4H4PA 4Z2TA 3GWFA 3IHGA 1XPQA 3GYJA 1O95A 3AEAA 2EQ6A 2X99A 3LZWA 2YM1A 4ADWA 4NTCA 4ZN0A 3GDPA 4IA6A 1Z6LA 4AP1A 4B67A 3DK9A 3AEEA 3EANA 4C3YA 1E1NA 3B6DA 2EQ9A 2XLRA 4RG4A 1AOGA 4E0VA 5IQ1A 2YLZA 1V59A 1ZP0A 2BCGG 4O5UA 2Y6RA 3AEDA 2GVCA 2E48A 3IWAA 4C77A 1B4VA 3W4KA 2R4EA 3CNJA 3QJ4A 1ZDLA 1OJCA 3KVEA 2JAEA 4XWRA 1DODA 1IJHA 3QFBA 1O94A 1W4XA 1EL9A 3UKHA 4B64A 1CC6A 1JEHA 2QA2A 4H2PA 2DU8A 3LXDA 2W0HA 2WDRA 3JSKA 2YLRA 3ZNPA 2DKIA 2I0ZA 2YVJA 2YVGA 2YR6A 2C70A 5JCLA 2GR3A 3AYLA 2V3AA 3L1RA 4AT2A 4GR1A 2BXRA 2YWLA 3SFEA 1OJAA 4H4ZA 5EOWA 4EQRA 3ZNNA 4PAAA 4A6NB 2X50A 4EMIA 3GRSA 1M64A 2F5ZA 5C3JA 3QSMA 4D04A 2H89A 4U8OA 1BGJA 1IUSA 4OCGA 2A87A 3QVRA 1PBFA 4NZHA 3AE4A 3B3RA 3DH9A 2E1MA 1PBCA 4A79A 3GD4A 4K5SA 1JRYA 2Q0LA 5EBKA 1E1LA 4GDPA 4YKFA 4H2RA 5BULA 4EMWA 4GRTA 2BXSA 2WPEA 4A7AA 1D5TA 4BK2A 1DXLA 3UKKA 4YJHB 1L9EA 1JU2A 2BYBA 1ZMDA 3F8DA 3CPJG 4HB9A 4J34A 5C2TA 3AEGA 4OPTA 4J57A 1YKJA 2V3BA 1GNDA 3NRNA 1Q1RA 4H4YA 3FG2P 3AECA 3AWIA 4KPRA 4UDPA 2TPRA 2YAUA 5KXJA 2WOWA 2B9XA 2GEWA 2HQMA 2WP9A 1N4WA 3K7TA 2OLNA 1S2QA 3H8IA 4EM3A 5FS7A 1LQUA 3ALMA 1KDGA 1X31B 1ZKQA 4YJGA 4A9WA 3SGLA 1N4UA 1KSSA 5DBJA 5JCNA 4K5RA 4X9NA 3ATRA 3DGZA 2XVIA 5FS6A 1S3BA 3ICTA 2WPFA 2YLSA 5KWFA 2CULA 3CGDA 3CPIG 3NN0X 3WGTA 3CTYA 3UKAA 3CGCA 2AAQA 3ZYXA 2YR5A 1CJ4A 3P4PA 3NYEA 4FK1C 4JQ9A 1XHCA 4N9XA 2EQ7A 4B63A 1GPEA 2OA1A 2PYXA 3BHFA 2C66A 2WOVA 3ISHA 1GXFA 2WBAA 1LJ1A 1ZMCA 2BK5A 2H88A 2WS3A 1K0JA 1O5WA 1YQZA 4WX1A 3WE0A 3EPTA 4CRTA 1QLBA 3ZDNA 2Z5XA 2OLOA 2OALA 2V6OA 4IV9A 3G3EA 1B5QA 3CN8A 3K7QX 1NEKA 3NG7X 2WDQA 2VRLA 1DOEA 1TDEA 5JCIA 5BUKA 4IVOB 1L9CA 3ALJA 4FK1A 2YLXA 3NYCA 4H4RA 1B37A 4AP3A 1H86A 2XLPA 2XYOA 4BK3A 3QSEA 1ONFA 2JBVA 4A65A 4H4UA 3AE7A 1DAOA 3UTEA 3P4RA 4QFCA 1GSNA 3ZNOA 1GEUA 2VQBA 1NHSA 2VQ7A 2UZZA 4J2WA 2E4AA 3GSIA 2E5VA 4EIQA 3URHA 3DJJA 1QJDA 1S2YA 2C72A 3ICSA 2C76A 3DGHA 3LOVA 3ICRA 1N4VA 4U8IA 1VRQB 1GESA 3T37A 2X3NA 4CY6A 4LA1A 4CCRA 1VG9A 1H7XA 5GSNA 1OJ9A 4K8DA 4USRA 4Y4MA 1NHQA 5KVHA 4U8KA 4PABA 2WU5A 1K0IA 4GF7A 5KRQA 4YTPA 2V5ZA 2XLUA 3GDNA 2WP6A 4UDQA 1PXAA 4I58A 1ELIA 5HY5A 4EQSA 1CJ3A 1F8WA 4YJGB 5BRTA 2GAHB 1BWCA 3CGEA 4YWOA 4K7ZA 3PVCA 2O9ZA 4OPDA 5U1OA 4CBQA 2FBWA 1GRHA 3ITJA 1D7YA 3AXBA 3GRTA 1PBBA 3UOYA 4EM4A 2B9YA 1PXBA 1H83A 3LB8A 1SEZA 3RP6A 5J60A 3K7MX 1D4CA 3UTFA 3AE3A 4C74A 1PDHA 4RSLA 2VOUA 4Z25A 2JK6A 2A89A 2ACZA 1K0LA 1LPFA 2E4GA 3VRDB 4TLZA 3KA7A 3RP8A 1F3PA 2DKHA 2QAEA 3NT6A 4O5QA 1ZOYA 3LJPA 3P4SA 1JNRA 3ATQA 1DOCA 4JNQA 4YXDA 2C64A 2WQYA 2NVKX 1P2HA 3NTAA 3M12A 3SM8A 4RG3A 3P4QA 4HA6A 3DJGX 2WPCA 2Y6QA 2YG4A 3G5QA 4YJDA 1H6VA 1CC4A 2XFPA 1H7WA 3GD3A 4ZCCA 2BA9A 4Z2RA 5J7XA 1E7PA 4U2LA 3DA1A 2X8GA 1AN9A 1H82A 3F8RA 2VVLG 3UOZA 2YG6A 5KOWA 3QVPA 2IVDA 1VDCA 1PJ7A 1TDNA 4XWZA 1S3EA 2WU2A 1MO9A 2GF3A 4EMJA 2FJDA 1EL5A 1GRGA 1Q9IA 1UKVG 2GMJA 3F8PA 3HZLA 4EQWA 1F8RA 2WDVA 1VQWA 1F8SA 4A5LA 2WHDA 3BHKA 3OC4A 1EL7A 4AOXA 1TDOA 1ZX9A 2R0PA 1C0LA 3G5RA 3D8XA 5U63A 1N1PA 1YQ3A 3W4IA 3FMWA 3NGCX 3Q6JA 4B68A 3UKQA 4P9SA 3S5WA 2IIDA 2XFUA 4YKGA 2E49A 2C3CA 4YSZA 2C65A 2ZZBA 3VR9A 2YLWA 2XVJA 4B69A 3UCLA 3PS9A 3G5SA 4CNKA 4H4QA 2A8XA 2JB2A 2XLTA 4NEVA 2Q7VA 4H4VA 3UOVA 1CBOA 3P1WA 1FECA 4CCQA 2BABA 4H2QA 4MJWA 2R46A 5EB5A 3IHMA 2WP5A 2GV8A 4J31A 1PBEA 1FCDA 3KKJA 4ZCDA 4REKA 5M0ZA 1BKWA 3UP4A 4U8JA 3DJDA 4BV6A 3NLCA 2WESA 5FS9A 4C5OA 2BK4A 2XVFA 4WCTA 4K22A 2XVHA 2ZZCA 3UKPA 2OAMA 4YSHA 2AR8A 3GWDA 2JB1A 4ICYA 1GRAA 3EAOA 5L46A 1KNRA 1NPXA 4J36A 2C73A 4QFDA 2QCUA 1CL0A 1LQTA 3AE8A 4FDCB 4H4TA 3KU9A 1PN0A 1PJ6A 2FJEA 1KNPA 5FS8A 4BK1A 2B9WA 2GR1A 4GDEA 1D4EA 2YVFA 4DGKA 3FBSA 3CPHG 2E82A 5IQ4A 3M13A 4YSXA 1E1MA 3VRBA 3ZNQA 2C3DA 2GH5A 1L0VA 3AE6A 3QFAA 3R9UA 1PS9A 4Z26A 3KLJA 2Q6UA 1DOBA 4H2NA 4U8NA 3NK0X 4YT0A 1OJTA 2GQFA 2ARDA 4GCMA 3AEFA 3LADA 3UKFA 3LZXA 3UTHA 5KOXA 1LV0A 1GALA 4OPCA 3II4A 4BURA 1FEAA 1NHRA 1F6MA 1RYIA 3NK2X 4I59A 3KD9A 5CQFA 2JKCA 2PHHA 3CUKA 1MOKA 2BS2A 3NIXA 4TLXA 2V61A 2ZZ0A 3CNTA 4J33A 4TM0A 3VRAA 2TMDA 2WEUA 1GTEA 4JDRA 4TM4A 1OJDA 1Y0PA 1XANA 2FJAA 1PHHA 3ABVA 3E1TA 4K2XA 5HHFA 1E6EA 3RNMA 1HYUA 4A99A 5CKUA 3Q9TA 2XCGA 4IA5A 4LU6A 3VQRA 2VVMA 3UP5A 2BACA 4TM3A 3CGBA 5U25A 5KVIA 1YY5A 3D1CA 2GMHA 3BI5A 4NEWA 1E1KA 2J3NA 1DJNA 3ADAB 1D7LA 3AD8B 1RP0A 3AE1A 4H4XA 1DNCA 3DJEA 4B65A 2NPXA 4H4WA 4NTEA 1KSUA 2C67A 4U8MA 4B1BA 1BF3A 1D4DA 1E39A 1LVLA 1TYPA 2BC0A 1C0PA 1GOSA 1Y56A 3PO7A 3CIRA 3OZ2A 3O0HA 4UDRA 5M10A 3NH3X 2GR0A 3REDA 3SFDA 1L9DA 2WETA 4JNAA 4U2TA 3CNDA 3UKLA 4Z24A 3FIMB 2GRTA 5JCKA 1FL2A 1CC2A 1M6IA 1REOA 5HXIA 2YQUA 4KX6A 3M0OA 1IUUA 2XFQA 3C4AA 3H8LA 3KPFA 1GETA 4U8PA 4AT0A 4Z43A 3V3OA 5GRTA 2AQJA 2CDUA 2XVEA 3AYIA 4Y4LA 1IUXA 2C7GA 4C3XA 1BGNA 4AOSA 2WOIA 2R9ZA 3AE5A 1BZLA 1GERA 4OPUA 1MXTA 1LTXR 2X8HA 4USQA 4CNJA 1GREA 2R4JA 3DK4A 3NTDA 2R0GA 3CNPA 3I3LA 3P9UA 4X4JA 4ECHA 1KIFA 4UP3A 1H81A 1XDIA 2XFOA 1ZY8A 1JRXA 4JY3A 3GMBA 4APNA 1CJ2A 3FPZA 2RABA 2Q0KA 3AEBA 2BS4A 4YJFA 1Q1WA 2XLSA 4XXGA 1TDFA 2GR2A 2ZBWA 2BC1A 3GMCA 3C96A 3NKSA 4OPIA 2V60A 4YTNA 2APGA 2CVJA 2GAGB 3NNEA 5ER0A 5BVAA 2VVLA 2CFYA 5FMHA 4YTMA 4LIIA 3DK8A 4U2SA 3V76A 4H7UA 2VZ2A 3RP7A 1IUWA 2BS3A 1EL8A 1KF6A 2YG7A 1TDKA 2B7RA 1ZOVA 3W4JA 3K30A 4FX9A 3SQPA 3RHAA 5LV9A 3COXA 1YQ4A 2EQ8A 1GTHA 2YG3A 3VR8A 1VG0A 1NHPA 1CHUA 3ALLA 1GRBA 4DSHA 1GRFA 4OVIA 1FOHA 1GT8A 3GYIA 1TRBA 2RGJA 1IUTA 3AD7B 2C75A 4J56A 1JNZA 2FJBA 4Y4NA 4Z2UA 3DMEA 1COYA 1PBDA 3UOXA
chains in the Genus database with same CATH superfamily
4B66A 3NK1X 4X9MA 1H84A 2RGHA 2Z5YA 1JRZA 4OPLA 4JY2A 5KNLA 5IPYA 2XFNA 1PXCA 2XDOA 2R45A 4YSYA 3UTGA 1NAAA 1Y56B 4A6NA 3QSSA 1PJ5A 3AYJA 1IUVA 2BK3A 3NHOX 1EBDA 4JN9A 4DNAA 3EF6A 3SZWA 2GB0A 3BNMA 3T14A 1NENA 1C0IA 2R0CA 3V3NA 1NDAA 2GQWA 2BCPA 3AE9A 5EB4A 5JCMA 3AB1A 4GAVA 3NYFA 3H4KA 1DDOA 3CNSA 1B8SA 1ZK7A 3L8KA 4D03A 1EVIA 2QA1A 2VRMA 1KFYA 1GV4A 4OPGA 4YJHA 2X8CA 3I6DA 3NN6X 3AD9B 1C0KA 4EQXA 3C4NA 1JOAA 1QO8A 1TYTA 5HYMA 2YG5A 1DJQA 3BI2A 3SYIA 2IVEA 3AE2A 3HYWA 4CY8A 4H50A 4GUVA 4IVMB 4BJZA 1CF3A 4NTDA 4BJYA 3IC9A 1CJCA 2RGOA 4EIPA 3BI4A 5TR3A 3S61A 4H4SA 4U8LA 1NG3A 1K4QA 1P2EA 4M52A 3IF9A 1GRTA 1RSGA 2YR4A 4DSGA 3BNUA 4Z44A 1FEBA 1NG4A 2JB3A 2YM2A 4TM1A 4YJFB 2B76A 1VE9A 2YLTA 2B7SA 4H4PA 4Z2TA 3GWFA 3IHGA 1XPQA 3GYJA 1O95A 3AEAA 2EQ6A 2X99A 3LZWA 2YM1A 4ADWA 3SY4A 4NTCA 4ZN0A 3GDPA 2BRAA 4IA6A 1Z6LA 4AP1A 4B67A 3DK9A 3AEEA 3EANA 4C3YA 1E1NA 3B6DA 2EQ9A 2XLRA 4RG4A 1AOGA 4E0VA 5IQ1A 2YLZA 1V59A 1ZP0A 2BCGG 3GYXA 4O5UA 2Y6RA 3AEDA 2GVCA 2E48A 3IWAA 4C77A 1B4VA 3W4KA 2R4EA 3CNJA 3QJ4A 1ZDLA 1OJCA 3KVEA 4NWZA 2JAEA 4XWRA 1DODA 1IJHA 3QFBA 1O94A 1W4XA 1EL9A 3T2YA 3UKHA 1CC6A 3CMMA 4B64A 1JEHA 4H2PA 2QA2A 2DU8A 3LXDA 2W0HA 2WDRA 3JSKA 2YLRA 2DKIA 3ZNPA 2I0ZA 2YVJA 2YVGA 2YR6A 2C70A 5JCLA 2GR3A 3AYLA 2V3AA 3L1RA 4AT2A 4GR1A 2BXRA 2YWLA 3SFEA 1OJAA 4H4ZA 5EOWA 4EQRA 3ZNNA 4PAAA 4A6NB 2X50A 4EMIA 3GRSA 1M64A 2F5ZA 5C3JA 3QSMA 4D04A 2H89A 4U8OA 1BGJA 1IUSA 4OCGA 4NNJA 2A87A 3QVRA 1PBFA 5KMRA 4NZHA 3AE4A 3B3RA 3DH9A 2E1MA 1PBCA 4A79A 3GD4A 4K5SA 1JRYA 2Q0LA 5EBKA 1E1LA 4GDPA 4YKFA 4H2RA 5BULA 4EMWA 4GRTA 2BXSA 2WPEA 4A7AA 1D5TA 4BK2A 1DXLA 3UKKA 4YJHB 3SZCA 1L9EA 1JU2A 2BYBA 1ZMDA 3F8DA 3CPJG 4HB9A 4J34A 5C2TA 3AEGA 4OPTA 3T2ZA 4J57A 1YKJA 2V3BA 1GNDA 3NRNA 1Q1RA 4H4YA 3FG2P 3AECA 3AWIA 4KPRA 4UDPA 2TPRA 2YAUA 5KXJA 2WOWA 2B9XA 2GEWA 2HQMA 2WP9A 1N4WA 3K7TA 2OLNA 1S2QA 3H8IA 4EM3A 5FS7A 1LQUA 3ALMA 1KDGA 1X31B 1ZKQA 4YJGA 4A9WA 3SGLA 1N4UA 1KSSA 5DBJA 5JCNA 4K5RA 4X9NA 3ATRA 3DGZA 2XVIA 5FS6A 1S3BA 3ICTA 2WPFA 2YLSA 5KWFA 2CULA 3CGDA 3CPIG 3NN0X 3WGTA 3T31A 3CTYA 3UKAA 3CGCA 2AAQA 3ZYXA 2YR5A 1CJ4A 3P4PA 3NYEA 4FK1C 4JQ9A 1XHCA 4N9XA 2EQ7A 4B63A 1GPEA 2OA1A 2PYXA 3BHFA 2C66A 2WOVA 3ISHA 1GXFA 2WBAA 1LJ1A 1ZMCA 2BK5A 2H88A 2WS3A 3KPKA 1K0JA 1O5WA 1YQZA 4WX1A 3WE0A 3EPTA 4CRTA 1QLBA 3ZDNA 2Z5XA 2OLOA 2OALA 2V6OA 3T2KA 4IV9A 3G3EA 1B5QA 3CN8A 3K7QX 1NEKA 3NG7X 2WDQA 2VRLA 1DOEA 1TDEA 5JCIA 5BUKA 4IVOB 1L9CA 3ALJA 4FK1A 2YLXA 3NYCA 4H4RA 1B37A 4AP3A 1H86A 4BK3A 2XLPA 2XYOA 3QSEA 1ONFA 2JBVA 4A65A 4H4UA 3AE7A 1DAOA 3UTEA 3P4RA 4QFCA 1GSNA 3ZNOA 1GEUA 2VQBA 1NHSA 2VQ7A 2UZZA 4J2WA 2E4AA 3GSIA 2E5VA 4EIQA 3URHA 3DJJA 1QJDA 1S2YA 2C72A 3ICSA 2C76A 3DGHA 3LOVA 3ICRA 1N4VA 4U8IA 1VRQB 1GESA 3T37A 2X3NA 4CY6A 4LA1A 4CCRA 1VG9A 1H7XA 5GSNA 1OJ9A 4K8DA 4USRA 4Y4MA 1NHQA 5KVHA 4U8KA 4PABA 2WU5A 1K0IA 4GF7A 5KRQA 4YTPA 2V5ZA 2XLUA 3GDNA 2WP6A 4UDQA 1PXAA 4I58A 1ELIA 5HY5A 4EQSA 1CJ3A 1F8WA 4YJGB 5BRTA 2GAHB 1BWCA 3CGEA 4YWOA 4K7ZA 3PVCA 2O9ZA 4OPDA 5U1OA 4CBQA 2FBWA 1GRHA 3ITJA 1D7YA 3AXBA 3GRTA 1PBBA 3UOYA 4EM4A 2B9YA 1PXBA 1H83A 3RP6A 1SEZA 3LB8A 5J60A 3K7MX 1D4CA 3SXIA 3AE3A 3UTFA 1PDHA 2VOUA 4RSLA 4C74A 2JK6A 4Z25A 2A89A 2ACZA 1K0LA 1LPFA 2E4GA 3VRDB 4TLZA 3KA7A 3RP8A 2DKHA 1F3PA 2QAEA 3NT6A 4O5QA 1ZOYA 3LJPA 3P4SA 1JNRA 3ATQA 1DOCA 4JNQA 4YXDA 2C64A 2WQYA 2NVKX 1P2HA 3NTAA 3M12A 3SM8A 4RG3A 3P4QA 4HA6A 3DJGX 2WPCA 2Y6QA 2YG4A 3G5QA 4YJDA 1H6VA 1CC4A 2XFPA 1H7WA 3GD3A 4ZCCA 2BA9A 4Z2RA 5J7XA 1E7PA 4U2LA 3DA1A 2X8GA 1AN9A 1H82A 3F8RA 2VVLG 3UOZA 2YG6A 5KMSA 3QVPA 2IVDA 5KOWA 1VDCA 1PJ7A 4XWZA 1S3EA 1TDNA 2WU2A 1MO9A 2GF3A 4G74A 2FJDA 1EL5A 4EMJA 1GRGA 1Q9IA 1UKVG 2GMJA 3F8PA 3HZLA 4EQWA 1F8RA 2WDVA 1VQWA 1F8SA 4A5LA 2WHDA 3BHKA 3OC4A 4G6GA 1EL7A 3SX6A 4AOXA 1TDOA 1ZX9A 2R0PA 1C0LA 3G5RA 3D8XA 3HYXA 5U63A 1N1PA 1YQ3A 3W4IA 3FMWA 3NGCX 3Q6JA 4B68A 3UKQA 4P9SA 3S5WA 2IIDA 2XFUA 4YKGA 2E49A 2C3CA 4YSZA 2C65A 2ZZBA 3VR9A 2YLWA 2XVJA 4B69A 3UCLA 3PS9A 3G5SA 4CNKA 4H4QA 2A8XA 2JB2A 2XLTA 4NEVA 2Q7VA 4H4VA 3UOVA 1CBOA 3P1WA 1FECA 4CCQA 4H2QA 2BABA 4MJWA 2R46A 5EB5A 3IHMA 3SZFA 2WP5A 2GV8A 4J31A 5KMQA 1PBEA 1FCDA 3KKJA 4ZCDA 4REKA 5M0ZA 1BKWA 3UP4A 4U8JA 3DJDA 4BV6A 3NLCA 2WESA 5FS9A 4C5OA 2BK4A 2XVFA 4WCTA 4K22A 2XVHA 2ZZCA 3UKPA 2OAMA 4YSHA 2AR8A 3GWDA 2JB1A 4ICYA 1GRAA 3EAOA 5L46A 1KNRA 1NPXA 4J36A 2C73A 4QFDA 2QCUA 1CL0A 1LQTA 3AE8A 4FDCB 4H4TA 3KU9A 1PN0A 1PJ6A 2FJEA 1KNPA 5FS8A 4BK1A 2B9WA 2GR1A 4GDEA 1D4EA 2YVFA 4DGKA 3FBSA 3CPHG 2E82A 5IQ4A 3M13A 4YSXA 1E1MA 3VRBA 3ZNQA 2C3DA 2GH5A 1L0VA 3AE6A 3QFAA 3R9UA 4II3A 1PS9A 4Z26A 4H2NA 2Q6UA 1DOBA 3KLJA 4U8NA 3NK0X 4YT0A 1OJTA 2GQFA 2ARDA 4GCMA 3AEFA 3LADA 3UKFA 3LZXA 3UTHA 5KOXA 1LV0A 1GALA 4OPCA 3II4A 4BURA 1FEAA 1NHRA 1F6MA 1RYIA 3NK2X 4I59A 3KD9A 5CQFA 2JKCA 2PHHA 3CUKA 1MOKA 2BS2A 3NIXA 4TLXA 2V61A 2ZZ0A 3CNTA 4J33A 4TM0A 3VRAA 2TMDA 2WEUA 4G9KA 1GTEA 4JDRA 4TM4A 1OJDA 1Y0PA 1XANA 2FJAA 1PHHA 3E1TA 3ABVA 4K2XA 5HHFA 1E6EA 3RNMA 1HYUA 4A99A 5CKUA 4IA5A 2XCGA 3Q9TA 4LU6A 3VQRA 2VVMA 3UP5A 3SZ0A 2BACA 4TM3A 3CGBA 5U25A 5KVIA 1YY5A 3D1CA 2GMHA 3BI5A 4NEWA 1E1KA 2J3NA 1DJNA 3ADAB 1D7LA 3AD8B 1RP0A 3AE1A 4H4XA 1DNCA 3DJEA 4B65A 2NPXA 4H4WA 4NTEA 1KSUA 2C67A 4U8MA 4B1BA 1BF3A 1D4DA 1E39A 1LVLA 1TYPA 2BC0A 1C0PA 1GOSA 1Y56A 3PO7A 3CIRA 3OZ2A 3O0HA 4UDRA 5M10A 3NH3X 2GR0A 3REDA 3SFDA 1L9DA 2WETA 4JNAA 4U2TA 3CNDA 3UKLA 4GAPA 4Z24A 3FIMB 2GRTA 5JCKA 1FL2A 5HXIA 1CC2A 1M6IA 1REOA 2YQUA 4KX6A 3M0OA 1IUUA 2XFQA 3C4AA 3H8LA 3KPFA 1GETA 4U8PA 4AT0A 4Z43A 3V3OA 5GRTA 2AQJA 2CDUA 2XVEA 3AYIA 4Y4LA 1IUXA 2C7GA 4C3XA 1BGNA 4AOSA 2BRYA 2WOIA 2R9ZA 3AE5A 5KMPA 1BZLA 1GERA 4OPUA 1MXTA 1LTXR 2X8HA 4USQA 3HYVA 4CNJA 3T0KA 1GREA 2R4JA 3DK4A 3NTDA 2R0GA 4G73A 3CNPA 3I3LA 3P9UA 4X4JA 4ECHA 1KIFA 4UP3A 1H81A 1XDIA 2XFOA 2C4CA 1ZY8A 1JRXA 4JY3A 3GMBA 4APNA 1CJ2A 3FPZA 2RABA 2Q0KA 3AEBA 2BS4A 4YJFA 1Q1WA 2XLSA 4II2A 4XXGA 1TDFA 2GR2A 2ZBWA 2BC1A 3GMCA 3C96A 3NKSA 4OPIA 2V60A 4YTNA 2APGA 2CVJA 2GAGB 3NNEA 5ER0A 5BVAA 2VVLA 2CFYA 5FMHA 4YTMA 4LIIA 3DK8A 4U2SA 3V76A 4H7UA 3RP7A 2VZ2A 1IUWA 2BS3A 1EL8A 1KF6A 2YG7A 1TDKA 2B7RA 1ZOVA 3W4JA 3K30A 4FX9A 3SQPA 3RHAA 5LV9A 4G6HA 3COXA 1YQ4A 2EQ8A 1GTHA 2YG3A 3VR8A 1VG0A 1NHPA 1CHUA 3ALLA 1GRBA 4DSHA 1GRFA 4OVIA 1FOHA 1GT8A 3GYIA 1TRBA 2RGJA 1IUTA 3AD7B 2C75A 4J56A 1JNZA 2FJBA 4Y4NA 4Z2UA 3DMEA 1COYA 1PBDA 3UOXA
chains in the Genus database with same CATH topology
4B66A 3NK1X 4X9MA 1H84A 2RGHA 2Z5YA 1JRZA 4OPLA 4JY2A 5KNLA 5IPYA 2XFNA 1PXCA 2XDOA 2R45A 4YSYA 3UTGA 1NAAA 1Y56B 4A6NA 3QSSA 1PJ5A 3AYJA 1IUVA 2BK3A 3NHOX 1EBDA 4JN9A 4DNAA 3EF6A 3SZWA 2GB0A 3BNMA 3T14A 1NENA 1C0IA 2R0CA 3V3NA 1NDAA 2GQWA 2BCPA 3AE9A 5EB4A 5JCMA 3AB1A 4GAVA 3NYFA 3H4KA 1DDOA 3CNSA 1B8SA 1ZK7A 3L8KA 4D03A 1EVIA 2QA1A 2VRMA 1KFYA 1GV4A 4OPGA 4YJHA 2X8CA 3I6DA 3NN6X 3AD9B 1C0KA 4EQXA 3C4NA 1JOAA 1QO8A 1TYTA 5HYMA 2YG5A 1DJQA 3BI2A 3SYIA 2IVEA 3AE2A 3HYWA 4CY8A 4H50A 4GUVA 4IVMB 4BJZA 1CF3A 4NTDA 4BJYA 3IC9A 1CJCA 2RGOA 4EIPA 3BI4A 5TR3A 3S61A 4H4SA 4U8LA 1NG3A 1K4QA 1P2EA 4M52A 3IF9A 1GRTA 1RSGA 2YR4A 4DSGA 3BNUA 4Z44A 1FEBA 1NG4A 2JB3A 2YM2A 4TM1A 4YJFB 2B76A 1VE9A 2YLTA 2B7SA 4H4PA 4Z2TA 3GWFA 3IHGA 1XPQA 3GYJA 1O95A 3AEAA 2EQ6A 2X99A 3LZWA 2YM1A 4ADWA 3SY4A 4NTCA 4ZN0A 3GDPA 2BRAA 4IA6A 1Z6LA 4AP1A 4B67A 3DK9A 3AEEA 3EANA 4C3YA 1E1NA 3B6DA 2EQ9A 2XLRA 4RG4A 1AOGA 4E0VA 5IQ1A 2YLZA 1V59A 1ZP0A 2BCGG 3GYXA 4O5UA 2Y6RA 3AEDA 2GVCA 2E48A 3IWAA 4C77A 1B4VA 3W4KA 2R4EA 3CNJA 3QJ4A 1ZDLA 1OJCA 3KVEA 4NWZA 2JAEA 4XWRA 1DODA 1IJHA 3QFBA 1O94A 1W4XA 1EL9A 3T2YA 3UKHA 1CC6A 3CMMA 4B64A 1JEHA 2QA2A 4H2PA 2DU8A 3LXDA 2W0HA 2WDRA 3JSKA 2YLRA 3ZNPA 2DKIA 2I0ZA 2YVJA 2YVGA 2YR6A 2C70A 5JCLA 2GR3A 3AYLA 2V3AA 3L1RA 4AT2A 4GR1A 2BXRA 2YWLA 3SFEA 1OJAA 4H4ZA 5EOWA 4EQRA 3ZNNA 4PAAA 4A6NB 2X50A 4EMIA 3GRSA 1M64A 2F5ZA 5C3JA 3QSMA 4D04A 2H89A 4U8OA 1BGJA 1IUSA 4OCGA 4NNJA 2A87A 3QVRA 1PBFA 5KMRA 4NZHA 3AE4A 3B3RA 3DH9A 2E1MA 1PBCA 4A79A 3GD4A 4K5SA 1JRYA 2Q0LA 5EBKA 1E1LA 4GDPA 4YKFA 4H2RA 5BULA 4EMWA 4GRTA 2BXSA 2WPEA 4A7AA 1D5TA 4BK2A 1DXLA 3UKKA 4YJHB 3SZCA 1L9EA 1JU2A 2BYBA 1ZMDA 3F8DA 3CPJG 4HB9A 4J34A 5C2TA 3AEGA 4OPTA 3T2ZA 4J57A 1YKJA 2V3BA 1GNDA 3NRNA 1Q1RA 4H4YA 3FG2P 3AECA 3AWIA 4KPRA 4UDPA 2TPRA 2YAUA 5KXJA 2WOWA 2B9XA 2GEWA 2HQMA 2WP9A 1N4WA 3K7TA 2OLNA 1S2QA 3H8IA 4EM3A 5FS7A 1LQUA 3ALMA 1KDGA 1X31B 1ZKQA 4YJGA 4A9WA 3SGLA 1N4UA 1KSSA 5DBJA 5JCNA 4K5RA 4X9NA 3ATRA 3DGZA 2XVIA 5FS6A 1S3BA 3ICTA 2WPFA 2YLSA 5KWFA 2CULA 3CGDA 3CPIG 3NN0X 3WGTA 3T31A 3CTYA 3UKAA 3CGCA 2AAQA 3ZYXA 2YR5A 1CJ4A 3P4PA 3NYEA 4FK1C 4JQ9A 1XHCA 4N9XA 2EQ7A 4B63A 1GPEA 2OA1A 2PYXA 3BHFA 2C66A 2WOVA 3ISHA 1GXFA 2WBAA 1LJ1A 1ZMCA 2BK5A 2H88A 2WS3A 3KPKA 1K0JA 1O5WA 1YQZA 4WX1A 3WE0A 3EPTA 4CRTA 1QLBA 3ZDNA 2Z5XA 2OLOA 2OALA 2V6OA 3T2KA 4IV9A 3G3EA 1B5QA 3CN8A 3K7QX 1NEKA 3NG7X 2WDQA 2VRLA 1DOEA 1TDEA 5JCIA 5BUKA 4IVOB 1L9CA 3ALJA 4FK1A 2YLXA 3NYCA 4H4RA 1B37A 4AP3A 1H86A 2XLPA 2XYOA 4BK3A 3QSEA 1ONFA 2JBVA 4A65A 4H4UA 3AE7A 1DAOA 3UTEA 3P4RA 4QFCA 1GSNA 3ZNOA 1GEUA 2VQBA 1NHSA 2VQ7A 2UZZA 4J2WA 2E4AA 3GSIA 2E5VA 4EIQA 3URHA 3DJJA 1QJDA 1S2YA 2C72A 3ICSA 2C76A 3DGHA 3LOVA 3ICRA 1N4VA 4U8IA 1VRQB 1GESA 3T37A 2X3NA 4CY6A 4LA1A 4CCRA 1VG9A 1H7XA 5GSNA 1OJ9A 4K8DA 4USRA 4Y4MA 1NHQA 5KVHA 4U8KA 4PABA 2WU5A 1K0IA 4GF7A 5KRQA 4YTPA 2V5ZA 2XLUA 3GDNA 2WP6A 4UDQA 1PXAA 4I58A 1ELIA 5HY5A 4EQSA 1CJ3A 1F8WA 4YJGB 5BRTA 2GAHB 1BWCA 3CGEA 4YWOA 4K7ZA 3PVCA 2O9ZA 4OPDA 5U1OA 4CBQA 2FBWA 1GRHA 3ITJA 1D7YA 3AXBA 3GRTA 1PBBA 3UOYA 4EM4A 2B9YA 1PXBA 1H83A 3LB8A 1SEZA 3RP6A 5J60A 3K7MX 1D4CA 3SXIA 3AE3A 3UTFA 1PDHA 4RSLA 2VOUA 4C74A 2JK6A 4Z25A 2A89A 2ACZA 1K0LA 1LPFA 2E4GA 3VRDB 4TLZA 3KA7A 3RP8A 1F3PA 2DKHA 2QAEA 3NT6A 4O5QA 1ZOYA 3LJPA 3P4SA 1JNRA 3ATQA 1DOCA 4JNQA 4YXDA 2C64A 2WQYA 2NVKX 1P2HA 3NTAA 3M12A 3SM8A 4RG3A 3P4QA 4HA6A 3DJGX 2WPCA 2Y6QA 2YG4A 3G5QA 4YJDA 1H6VA 1CC4A 2XFPA 1H7WA 3GD3A 4ZCCA 2BA9A 4Z2RA 5J7XA 1E7PA 4U2LA 3DA1A 2X8GA 1AN9A 1H82A 3F8RA 2VVLG 3UOZA 2YG6A 5KMSA 3QVPA 2IVDA 5KOWA 1VDCA 1PJ7A 1TDNA 4XWZA 1S3EA 2WU2A 1MO9A 2GF3A 4G74A 2FJDA 1EL5A 4EMJA 1GRGA 1Q9IA 1UKVG 2GMJA 3F8PA 3HZLA 4EQWA 1F8RA 2WDVA 1VQWA 1F8SA 4A5LA 2WHDA 3BHKA 3OC4A 4G6GA 1EL7A 3SX6A 4AOXA 1TDOA 1ZX9A 2R0PA 1C0LA 3G5RA 3D8XA 3HYXA 5U63A 1N1PA 1YQ3A 3W4IA 3FMWA 3NGCX 3Q6JA 4B68A 3UKQA 4P9SA 3S5WA 2IIDA 2XFUA 4YKGA 2E49A 2C3CA 4YSZA 2C65A 2ZZBA 3VR9A 2YLWA 2XVJA 4B69A 3UCLA 3PS9A 3G5SA 4CNKA 4H4QA 2A8XA 2JB2A 2XLTA 4NEVA 2Q7VA 4H4VA 3UOVA 1CBOA 3P1WA 1FECA 4CCQA 2BABA 4H2QA 4MJWA 2R46A 5EB5A 3IHMA 3SZFA 2WP5A 2GV8A 4J31A 5KMQA 1PBEA 1FCDA 3KKJA 4ZCDA 4REKA 5M0ZA 1BKWA 3UP4A 4U8JA 3DJDA 4BV6A 3NLCA 2WESA 5FS9A 4C5OA 2BK4A 2XVFA 4WCTA 4K22A 2XVHA 2ZZCA 3UKPA 2OAMA 4YSHA 2AR8A 3GWDA 2JB1A 4ICYA 1GRAA 3EAOA 5L46A 1KNRA 1NPXA 4J36A 2C73A 4QFDA 2QCUA 1CL0A 1LQTA 3AE8A 4FDCB 4H4TA 3KU9A 1PN0A 1PJ6A 2FJEA 1KNPA 5FS8A 4BK1A 2B9WA 2GR1A 4GDEA 1D4EA 2YVFA 4DGKA 3FBSA 3CPHG 2E82A 5IQ4A 3M13A 4YSXA 1E1MA 3VRBA 3ZNQA 2C3DA 2GH5A 1L0VA 3AE6A 3QFAA 3R9UA 4II3A 1PS9A 4Z26A 3KLJA 2Q6UA 1DOBA 4H2NA 4U8NA 3NK0X 4YT0A 1OJTA 2GQFA 2ARDA 4GCMA 3AEFA 3LADA 3UKFA 3LZXA 3UTHA 5KOXA 1LV0A 1GALA 4OPCA 3II4A 4BURA 1FEAA 1NHRA 1F6MA 1RYIA 3NK2X 4I59A 3KD9A 5CQFA 2JKCA 2PHHA 3CUKA 1MOKA 2BS2A 3NIXA 4TLXA 2V61A 2ZZ0A 3CNTA 4J33A 4TM0A 3VRAA 2TMDA 2WEUA 4G9KA 1GTEA 4JDRA 4TM4A 1OJDA 1Y0PA 1XANA 2FJAA 1PHHA 3ABVA 3E1TA 4K2XA 5HHFA 1E6EA 3RNMA 1HYUA 4A99A 5CKUA 3Q9TA 2XCGA 4IA5A 4LU6A 3VQRA 2VVMA 3UP5A 3SZ0A 2BACA 4TM3A 3CGBA 5U25A 5KVIA 1YY5A 3D1CA 2GMHA 3BI5A 4NEWA 1E1KA 2J3NA 1DJNA 3ADAB 1D7LA 3AD8B 1RP0A 3AE1A 4H4XA 1DNCA 3DJEA 4B65A 2NPXA 4H4WA 4NTEA 1KSUA 2C67A 4U8MA 4B1BA 1BF3A 1D4DA 1E39A 1LVLA 1TYPA 2BC0A 1C0PA 1GOSA 1Y56A 3PO7A 3CIRA 3OZ2A 3O0HA 4UDRA 5M10A 3NH3X 2GR0A 3REDA 3SFDA 1L9DA 2WETA 4JNAA 4U2TA 3CNDA 3UKLA 4GAPA 4Z24A 3FIMB 2GRTA 5JCKA 1FL2A 1CC2A 1M6IA 1REOA 5HXIA 2YQUA 4KX6A 3M0OA 1IUUA 2XFQA 3C4AA 3H8LA 3KPFA 1GETA 4U8PA 4AT0A 4Z43A 3V3OA 5GRTA 2AQJA 2CDUA 2XVEA 3AYIA 4Y4LA 1IUXA 2C7GA 4C3XA 1BGNA 4AOSA 2BRYA 2WOIA 2R9ZA 3AE5A 5KMPA 1BZLA 1GERA 4OPUA 1MXTA 1LTXR 2X8HA 4USQA 3HYVA 4CNJA 3T0KA 1GREA 2R4JA 3DK4A 3NTDA 2R0GA 4G73A 3CNPA 3I3LA 3P9UA 4X4JA 4ECHA 1KIFA 4UP3A 1H81A 1XDIA 2XFOA 2C4CA 1ZY8A 1JRXA 4JY3A 3GMBA 4APNA 1CJ2A 3FPZA 2RABA 2Q0KA 3AEBA 2BS4A 4YJFA 1Q1WA 2XLSA 4II2A 4XXGA 1TDFA 2GR2A 2ZBWA 2BC1A 3GMCA 3C96A 3NKSA 4OPIA 2V60A 4YTNA 2APGA 2CVJA 2GAGB 3NNEA 5ER0A 5BVAA 2VVLA 2CFYA 5FMHA 4YTMA 4LIIA 3DK8A 4U2SA 3V76A 4H7UA 2VZ2A 3RP7A 1IUWA 2BS3A 1EL8A 1KF6A 2YG7A 1TDKA 2B7RA 1ZOVA 3W4JA 3K30A 4FX9A 3SQPA 3RHAA 5LV9A 4G6HA 3COXA 1YQ4A 2EQ8A 1GTHA 2YG3A 3VR8A 1VG0A 1NHPA 1CHUA 3ALLA 1GRBA 4DSHA 1GRFA 4OVIA 1FOHA 1GT8A 3GYIA 1TRBA 2RGJA 1IUTA 3AD7B 2C75A 4J56A 1JNZA 2FJBA 4Y4NA 4Z2UA 3DMEA 1COYA 1PBDA 3UOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B66 A;  3NK1 X;  4X9M A;  1H84 A;  2RGH A;  2Z5Y A;  1JRZ A;  4OPL A;  4JY2 A;  5IPY A;  2XFN A;  1PXC A;  2XDO A;  2R45 A;  4YSY A;  3UTG A;  1NAA A;  1Y56 B;  4A6N A;  3QSS A;  1PJ5 A;  3AYJ A;  1IUV A;  2BK3 A;  3NHO X;  1EBD A;  4JN9 A;  4DNA A;  3EF6 A;  2GB0 A;  3BNM A;  1NEN A;  1C0I A;  2R0C A;  3V3N A;  1NDA A;  2GQW A;  2BCP A;  3AE9 A;  5EB4 A;  5JCM A;  3AB1 A;  3NYF A;  3H4K A;  1DDO A;  3CNS A;  1B8S A;  1ZK7 A;  3L8K A;  4D03 A;  1EVI A;  2QA1 A;  2VRM A;  1KFY A;  1GV4 A;  4OPG A;  4YJH A;  2X8C A;  3I6D A;  3NN6 X;  3AD9 B;  1C0K A;  4EQX A;  3C4N A;  1JOA A;  1QO8 A;  1TYT A;  5HYM A;  2YG5 A;  1DJQ A;  3BI2 A;  2IVE A;  3AE2 A;  4CY8 A;  4H50 A;  4GUV A;  4IVM B;  4BJZ A;  1CF3 A;  4NTD A;  4BJY A;  3IC9 A;  1CJC A;  2RGO A;  4EIP A;  3BI4 A;  5TR3 A;  3S61 A;  4H4S A;  4U8L A;  1NG3 A;  1K4Q A;  1P2E A;  4M52 A;  3IF9 A;  1GRT A;  1RSG A;  2YR4 A;  4DSG A;  3BNU A;  4Z44 A;  1FEB A;  1NG4 A;  2JB3 A;  2YM2 A;  4TM1 A;  4YJF B;  2B76 A;  1VE9 A;  2YLT A;  2B7S A;  4H4P A;  4Z2T A;  3GWF A;  3IHG A;  1XPQ A;  3GYJ A;  1O95 A;  3AEA A;  2EQ6 A;  2X99 A;  3LZW A;  2YM1 A;  4ADW A;  4NTC A;  4ZN0 A;  3GDP A;  4IA6 A;  1Z6L A;  4AP1 A;  4B67 A;  3DK9 A;  3AEE A;  3EAN A;  4C3Y A;  1E1N A;  3B6D A;  2EQ9 A;  2XLR A;  4RG4 A;  1AOG A;  4E0V A;  5IQ1 A;  2YLZ A;  1V59 A;  1ZP0 A;  2BCG G;  4O5U A;  2Y6R A;  3AED A;  2GVC A;  2E48 A;  3IWA A;  4C77 A;  1B4V A;  3W4K A;  2R4E A;  3CNJ A;  3QJ4 A;  1ZDL A;  1OJC A;  3KVE A;  2JAE A;  4XWR A;  1DOD A;  1IJH A;  3QFB A;  1O94 A;  1W4X A;  1EL9 A;  3UKH A;  4B64 A;  1CC6 A;  1JEH A;  2QA2 A;  4H2P A;  2DU8 A;  3LXD A;  2W0H A;  2WDR A;  3JSK A;  2YLR A;  3ZNP A;  2DKI A;  2I0Z A;  2YVJ A;  2YVG A;  2YR6 A;  2C70 A;  5JCL A;  2GR3 A;  3AYL A;  2V3A A;  3L1R A;  4AT2 A;  4GR1 A;  2BXR A;  2YWL A;  3SFE A;  1OJA A;  4H4Z A;  5EOW A;  4EQR A;  3ZNN A;  4PAA A;  4A6N B;  2X50 A;  4EMI A;  3GRS A;  1M64 A;  2F5Z A;  5C3J A;  3QSM A;  4D04 A;  2H89 A;  4U8O A;  1BGJ A;  1IUS A;  4OCG A;  2A87 A;  3QVR A;  1PBF A;  4NZH A;  3AE4 A;  3B3R A;  3DH9 A;  2E1M A;  1PBC A;  4A79 A;  3GD4 A;  4K5S A;  1JRY A;  2Q0L A;  5EBK A;  1E1L A;  4GDP A;  4YKF A;  4H2R A;  5BUL A;  4EMW A;  4GRT A;  2BXS A;  2WPE A;  4A7A A;  1D5T A;  4BK2 A;  1DXL A;  3UKK A;  4YJH B;  1L9E A;  1JU2 A;  2BYB A;  1ZMD A;  3F8D A;  3CPJ G;  4HB9 A;  4J34 A;  5C2T A;  3AEG A;  4OPT A;  4J57 A;  1YKJ A;  2V3B A;  1GND A;  3NRN A;  1Q1R A;  4H4Y A;  3FG2 P;  3AEC A;  3AWI A;  4KPR A;  4UDP A;  2TPR A;  2YAU A;  5KXJ A;  2WOW A;  2B9X A;  2GEW A;  2HQM A;  2WP9 A;  1N4W A;  3K7T A;  2OLN A;  1S2Q A;  3H8I A;  4EM3 A;  5FS7 A;  1LQU A;  3ALM A;  1KDG A;  1X31 B;  1ZKQ A;  4YJG A;  4A9W A;  3SGL A;  1N4U A;  1KSS A;  5DBJ A;  5JCN A;  4K5R A;  4X9N A;  3ATR A;  3DGZ A;  2XVI A;  5FS6 A;  1S3B A;  3ICT A;  2WPF A;  2YLS A;  5KWF A;  2CUL A;  3CGD A;  3CPI G;  3NN0 X;  3WGT A;  3CTY A;  3UKA A;  3CGC A;  2AAQ A;  3ZYX A;  2YR5 A;  1CJ4 A;  3P4P A;  3NYE A;  4FK1 C;  4JQ9 A;  1XHC A;  4N9X A;  2EQ7 A;  4B63 A;  1GPE A;  2OA1 A;  2PYX A;  3BHF A;  2C66 A;  2WOV A;  3ISH A;  1GXF A;  2WBA A;  1LJ1 A;  1ZMC A;  2BK5 A;  2H88 A;  2WS3 A;  1K0J A;  1O5W A;  1YQZ A;  4WX1 A;  3WE0 A;  3EPT A;  4CRT A;  1QLB A;  3ZDN A;  2Z5X A;  2OLO A;  2OAL A;  2V6O A;  4IV9 A;  3G3E A;  1B5Q A;  3CN8 A;  3K7Q X;  1NEK A;  3NG7 X;  2WDQ A;  2VRL A;  1DOE A;  1TDE A;  5JCI A;  5BUK A;  4IVO B;  1L9C A;  3ALJ A;  4FK1 A;  2YLX A;  3NYC A;  4H4R A;  1B37 A;  4AP3 A;  1H86 A;  2XLP A;  2XYO A;  4BK3 A;  3QSE A;  1ONF A;  2JBV A;  4A65 A;  4H4U A;  3AE7 A;  1DAO A;  3UTE A;  3P4R A;  4QFC A;  1GSN A;  3ZNO A;  1GEU A;  2VQB A;  1NHS A;  2VQ7 A;  2UZZ A;  4J2W A;  2E4A A;  3GSI A;  2E5V A;  4EIQ A;  3URH A;  3DJJ A;  1QJD A;  1S2Y A;  2C72 A;  3ICS A;  2C76 A;  3DGH A;  3LOV A;  3ICR A;  1N4V A;  4U8I A;  1VRQ B;  1GES A;  3T37 A;  2X3N A;  4CY6 A;  4LA1 A;  4CCR A;  1VG9 A;  1H7X A;  5GSN A;  1OJ9 A;  4K8D A;  4USR A;  4Y4M A;  1NHQ A;  5KVH A;  4U8K A;  4PAB A;  2WU5 A;  1K0I A;  4GF7 A;  5KRQ A;  4YTP A;  2V5Z A;  2XLU A;  3GDN A;  2WP6 A;  4UDQ A;  1PXA A;  4I58 A;  1ELI A;  5HY5 A;  4EQS A;  1CJ3 A;  1F8W A;  4YJG B;  5BRT A;  2GAH B;  1BWC A;  3CGE A;  4YWO A;  4K7Z A;  3PVC A;  2O9Z A;  4OPD A;  5U1O A;  4CBQ A;  2FBW A;  1GRH A;  3ITJ A;  1D7Y A;  3AXB A;  3GRT A;  1PBB A;  3UOY A;  4EM4 A;  2B9Y A;  1PXB A;  1H83 A;  3LB8 A;  1SEZ A;  3RP6 A;  5J60 A;  3K7M X;  1D4C A;  3UTF A;  3AE3 A;  4C74 A;  1PDH A;  4RSL A;  2VOU A;  4Z25 A;  2JK6 A;  2A89 A;  2ACZ A;  1K0L A;  1LPF A;  2E4G A;  3VRD B;  4TLZ A;  3KA7 A;  3RP8 A;  1F3P A;  2DKH A;  2QAE A;  3NT6 A;  4O5Q A;  1ZOY A;  3LJP A;  3P4S A;  1JNR A;  3ATQ A;  1DOC A;  4JNQ A;  4YXD A;  2C64 A;  2WQY A;  2NVK X;  1P2H A;  3NTA A;  3M12 A;  3SM8 A;  4RG3 A;  3P4Q A;  4HA6 A;  3DJG X;  2WPC A;  2Y6Q A;  2YG4 A;  3G5Q A;  4YJD A;  1H6V A;  1CC4 A;  2XFP A;  1H7W A;  3GD3 A;  4ZCC A;  2BA9 A;  4Z2R A;  5J7X A;  1E7P A;  4U2L A;  3DA1 A;  2X8G A;  1AN9 A;  1H82 A;  3F8R A;  2VVL G;  3UOZ A;  2YG6 A;  5KOW A;  3QVP A;  2IVD A;  1VDC A;  1PJ7 A;  1TDN A;  4XWZ A;  1S3E A;  2WU2 A;  1MO9 A;  2GF3 A;  4EMJ A;  2FJD A;  1EL5 A;  1GRG A;  1Q9I A;  1UKV G;  2GMJ A;  3F8P A;  3HZL A;  4EQW A;  1F8R A;  2WDV A;  1VQW A;  1F8S A;  4A5L A;  2WHD A;  3BHK A;  3OC4 A;  1EL7 A;  4AOX A;  1TDO A;  1ZX9 A;  2R0P A;  1C0L A;  3G5R A;  3D8X A;  5U63 A;  1N1P A;  1YQ3 A;  3W4I A;  3FMW A;  3NGC X;  3Q6J A;  4B68 A;  3UKQ A;  4P9S A;  3S5W A;  2IID A;  2XFU A;  4YKG A;  2E49 A;  2C3C A;  4YSZ A;  2C65 A;  2ZZB A;  3VR9 A;  2YLW A;  2XVJ A;  4B69 A;  3UCL A;  3PS9 A;  3G5S A;  4CNK A;  4H4Q A;  2A8X A;  2JB2 A;  2XLT A;  4NEV A;  2Q7V A;  4H4V A;  3UOV A;  1CBO A;  3P1W A;  1FEC A;  4CCQ A;  2BAB A;  4H2Q A;  4MJW A;  2R46 A;  5EB5 A;  3IHM A;  2WP5 A;  2GV8 A;  4J31 A;  1PBE A;  1FCD A;  3KKJ A;  4ZCD A;  4REK A;  5M0Z A;  1BKW A;  3UP4 A;  4U8J A;  3DJD A;  4BV6 A;  3NLC A;  2WES A;  5FS9 A;  4C5O A;  2BK4 A;  2XVF A;  4WCT A;  4K22 A;  2XVH A;  2ZZC A;  3UKP A;  2OAM A;  4YSH A;  2AR8 A;  3GWD A;  2JB1 A;  4ICY A;  1GRA A;  3EAO A;  5L46 A;  1KNR A;  1NPX A;  4J36 A;  2C73 A;  4QFD A;  2QCU A;  1CL0 A;  1LQT A;  3AE8 A;  4FDC B;  4H4T A;  3KU9 A;  1PN0 A;  1PJ6 A;  2FJE A;  1KNP A;  5FS8 A;  4BK1 A;  2B9W A;  2GR1 A;  4GDE A;  1D4E A;  2YVF A;  4DGK A;  3FBS A;  3CPH G;  2E82 A;  5IQ4 A;  3M13 A;  4YSX A;  1E1M A;  3VRB A;  3ZNQ A;  2C3D A;  2GH5 A;  1L0V A;  3AE6 A;  3QFA A;  3R9U A;  1PS9 A;  4Z26 A;  3KLJ A;  2Q6U A;  1DOB A;  4H2N A;  4U8N A;  3NK0 X;  4YT0 A;  1OJT A;  2GQF A;  2ARD A;  4GCM A;  3AEF A;  3LAD A;  3UKF A;  3LZX A;  3UTH A;  5KOX A;  1LV0 A;  1GAL A;  4OPC A;  3II4 A;  4BUR A;  1FEA A;  1NHR A;  1F6M A;  1RYI A;  3NK2 X;  4I59 A;  3KD9 A;  5CQF A;  2JKC A;  2PHH A;  3CUK A;  1MOK A;  2BS2 A;  3NIX A;  4TLX A;  2V61 A;  2ZZ0 A;  3CNT A;  4J33 A;  4TM0 A;  3VRA A;  2TMD A;  2WEU A;  1GTE A;  4JDR A;  4TM4 A;  1OJD A;  1Y0P A;  1XAN A;  2FJA A;  1PHH A;  3ABV A;  3E1T A;  4K2X A;  5HHF A;  1E6E A;  3RNM A;  1HYU A;  4A99 A;  5CKU A;  3Q9T A;  2XCG A;  4IA5 A;  4LU6 A;  3VQR A;  2VVM A;  3UP5 A;  2BAC A;  4TM3 A;  3CGB A;  5U25 A;  5KVI A;  1YY5 A;  3D1C A;  2GMH A;  3BI5 A;  4NEW A;  1E1K A;  2J3N A;  1DJN A;  3ADA B;  1D7L A;  3AD8 B;  1RP0 A;  3AE1 A;  4H4X A;  1DNC A;  3DJE A;  4B65 A;  2NPX A;  4H4W A;  4NTE A;  1KSU A;  2C67 A;  4U8M A;  4B1B A;  1BF3 A;  1D4D A;  1E39 A;  1LVL A;  1TYP A;  2BC0 A;  1C0P A;  1GOS A;  1Y56 A;  3PO7 A;  3CIR A;  3OZ2 A;  3O0H A;  4UDR A;  5M10 A;  3NH3 X;  2GR0 A;  3RED A;  3SFD A;  1L9D A;  2WET A;  4JNA A;  4U2T A;  3CND A;  3UKL A;  4Z24 A;  3FIM B;  2GRT A;  5JCK A;  1FL2 A;  1CC2 A;  1M6I A;  1REO A;  5HXI A;  2YQU A;  4KX6 A;  3M0O A;  1IUU A;  2XFQ A;  3C4A A;  3H8L A;  3KPF A;  1GET A;  4U8P A;  4AT0 A;  4Z43 A;  3V3O A;  5GRT A;  2AQJ A;  2CDU A;  2XVE A;  3AYI A;  4Y4L A;  1IUX A;  2C7G A;  4C3X A;  1BGN A;  4AOS A;  2WOI A;  2R9Z A;  3AE5 A;  1BZL A;  1GER A;  4OPU A;  1MXT A;  1LTX R;  2X8H A;  4USQ A;  4CNJ A;  1GRE A;  2R4J A;  3DK4 A;  3NTD A;  2R0G A;  3CNP A;  3I3L A;  3P9U A;  4X4J A;  4ECH A;  1KIF A;  4UP3 A;  1H81 A;  1XDI A;  2XFO A;  1ZY8 A;  1JRX A;  4JY3 A;  3GMB A;  4APN A;  1CJ2 A;  3FPZ A;  2RAB A;  2Q0K A;  3AEB A;  2BS4 A;  4YJF A;  1Q1W A;  2XLS A;  4XXG A;  1TDF A;  2GR2 A;  2ZBW A;  2BC1 A;  3GMC A;  3C96 A;  3NKS A;  4OPI A;  2V60 A;  4YTN A;  2APG A;  2CVJ A;  2GAG B;  3NNE A;  5ER0 A;  5BVA A;  2VVL A;  2CFY A;  5FMH A;  4YTM A;  4LII A;  3DK8 A;  4U2S A;  3V76 A;  4H7U A;  2VZ2 A;  3RP7 A;  1IUW A;  2BS3 A;  1EL8 A;  1KF6 A;  2YG7 A;  1TDK A;  2B7R A;  1ZOV A;  3W4J A;  3K30 A;  4FX9 A;  3SQP A;  3RHA A;  5LV9 A;  3COX A;  1YQ4 A;  2EQ8 A;  1GTH A;  2YG3 A;  3VR8 A;  1VG0 A;  1NHP A;  1CHU A;  3ALL A;  1GRB A;  4DSH A;  1GRF A;  4OVI A;  1FOH A;  1GT8 A;  3GYI A;  1TRB A;  2RGJ A;  1IUT A;  3AD7 B;  2C75 A;  4J56 A;  1JNZ A;  2FJB A;  4Y4N A;  4Z2U A;  3DME A;  1COY A;  1PBD A;  3UOX A; 
#chains in the Genus database with same CATH topology
 4B66 A;  3NK1 X;  4X9M A;  1H84 A;  2RGH A;  2Z5Y A;  1JRZ A;  4OPL A;  4JY2 A;  5KNL A;  5IPY A;  2XFN A;  1PXC A;  2XDO A;  2R45 A;  4YSY A;  3UTG A;  1NAA A;  1Y56 B;  4A6N A;  3QSS A;  1PJ5 A;  3AYJ A;  1IUV A;  2BK3 A;  3NHO X;  1EBD A;  4JN9 A;  4DNA A;  3EF6 A;  3SZW A;  2GB0 A;  3BNM A;  3T14 A;  1NEN A;  1C0I A;  2R0C A;  3V3N A;  1NDA A;  2GQW A;  2BCP A;  3AE9 A;  5EB4 A;  5JCM A;  3AB1 A;  4GAV A;  3NYF A;  3H4K A;  1DDO A;  3CNS A;  1B8S A;  1ZK7 A;  3L8K A;  4D03 A;  1EVI A;  2QA1 A;  2VRM A;  1KFY A;  1GV4 A;  4OPG A;  4YJH A;  2X8C A;  3I6D A;  3NN6 X;  3AD9 B;  1C0K A;  4EQX A;  3C4N A;  1JOA A;  1QO8 A;  1TYT A;  5HYM A;  2YG5 A;  1DJQ A;  3BI2 A;  3SYI A;  2IVE A;  3AE2 A;  3HYW A;  4CY8 A;  4H50 A;  4GUV A;  4IVM B;  4BJZ A;  1CF3 A;  4NTD A;  4BJY A;  3IC9 A;  1CJC A;  2RGO A;  4EIP A;  3BI4 A;  5TR3 A;  3S61 A;  4H4S A;  4U8L A;  1NG3 A;  1K4Q A;  1P2E A;  4M52 A;  3IF9 A;  1GRT A;  1RSG A;  2YR4 A;  4DSG A;  3BNU A;  4Z44 A;  1FEB A;  1NG4 A;  2JB3 A;  2YM2 A;  4TM1 A;  4YJF B;  2B76 A;  1VE9 A;  2YLT A;  2B7S A;  4H4P A;  4Z2T A;  3GWF A;  3IHG A;  1XPQ A;  3GYJ A;  1O95 A;  3AEA A;  2EQ6 A;  2X99 A;  3LZW A;  2YM1 A;  4ADW A;  3SY4 A;  4NTC A;  4ZN0 A;  3GDP A;  2BRA A;  4IA6 A;  1Z6L A;  4AP1 A;  4B67 A;  3DK9 A;  3AEE A;  3EAN A;  4C3Y A;  1E1N A;  3B6D A;  2EQ9 A;  2XLR A;  4RG4 A;  1AOG A;  4E0V A;  5IQ1 A;  2YLZ A;  1V59 A;  1ZP0 A;  2BCG G;  3GYX A;  4O5U A;  2Y6R A;  3AED A;  2GVC A;  2E48 A;  3IWA A;  4C77 A;  1B4V A;  3W4K A;  2R4E A;  3CNJ A;  3QJ4 A;  1ZDL A;  1OJC A;  3KVE A;  4NWZ A;  2JAE A;  4XWR A;  1DOD A;  1IJH A;  3QFB A;  1O94 A;  1W4X A;  1EL9 A;  3T2Y A;  3UKH A;  1CC6 A;  3CMM A;  4B64 A;  1JEH A;  4H2P A;  2QA2 A;  2DU8 A;  3LXD A;  2W0H A;  2WDR A;  3JSK A;  2YLR A;  2DKI A;  3ZNP A;  2I0Z A;  2YVJ A;  2YVG A;  2YR6 A;  2C70 A;  5JCL A;  2GR3 A;  3AYL A;  2V3A A;  3L1R A;  4AT2 A;  4GR1 A;  2BXR A;  2YWL A;  3SFE A;  1OJA A;  4H4Z A;  5EOW A;  4EQR A;  3ZNN A;  4PAA A;  4A6N B;  2X50 A;  4EMI A;  3GRS A;  1M64 A;  2F5Z A;  5C3J A;  3QSM A;  4D04 A;  2H89 A;  4U8O A;  1BGJ A;  1IUS A;  4OCG A;  4NNJ A;  2A87 A;  3QVR A;  1PBF A;  5KMR A;  4NZH A;  3AE4 A;  3B3R A;  3DH9 A;  2E1M A;  1PBC A;  4A79 A;  3GD4 A;  4K5S A;  1JRY A;  2Q0L A;  5EBK A;  1E1L A;  4GDP A;  4YKF A;  4H2R A;  5BUL A;  4EMW A;  4GRT A;  2BXS A;  2WPE A;  4A7A A;  1D5T A;  4BK2 A;  1DXL A;  3UKK A;  4YJH B;  3SZC A;  1L9E A;  1JU2 A;  2BYB A;  1ZMD A;  3F8D A;  3CPJ G;  4HB9 A;  4J34 A;  5C2T A;  3AEG A;  4OPT A;  3T2Z A;  4J57 A;  1YKJ A;  2V3B A;  1GND A;  3NRN A;  1Q1R A;  4H4Y A;  3FG2 P;  3AEC A;  3AWI A;  4KPR A;  4UDP A;  2TPR A;  2YAU A;  5KXJ A;  2WOW A;  2B9X A;  2GEW A;  2HQM A;  2WP9 A;  1N4W A;  3K7T A;  2OLN A;  1S2Q A;  3H8I A;  4EM3 A;  5FS7 A;  1LQU A;  3ALM A;  1KDG A;  1X31 B;  1ZKQ A;  4YJG A;  4A9W A;  3SGL A;  1N4U A;  1KSS A;  5DBJ A;  5JCN A;  4K5R A;  4X9N A;  3ATR A;  3DGZ A;  2XVI A;  5FS6 A;  1S3B A;  3ICT A;  2WPF A;  2YLS A;  5KWF A;  2CUL A;  3CGD A;  3CPI G;  3NN0 X;  3WGT A;  3T31 A;  3CTY A;  3UKA A;  3CGC A;  2AAQ A;  3ZYX A;  2YR5 A;  1CJ4 A;  3P4P A;  3NYE A;  4FK1 C;  4JQ9 A;  1XHC A;  4N9X A;  2EQ7 A;  4B63 A;  1GPE A;  2OA1 A;  2PYX A;  3BHF A;  2C66 A;  2WOV A;  3ISH A;  1GXF A;  2WBA A;  1LJ1 A;  1ZMC A;  2BK5 A;  2H88 A;  2WS3 A;  3KPK A;  1K0J A;  1O5W A;  1YQZ A;  4WX1 A;  3WE0 A;  3EPT A;  4CRT A;  1QLB A;  3ZDN A;  2Z5X A;  2OLO A;  2OAL A;  2V6O A;  3T2K A;  4IV9 A;  3G3E A;  1B5Q A;  3CN8 A;  3K7Q X;  1NEK A;  3NG7 X;  2WDQ A;  2VRL A;  1DOE A;  1TDE A;  5JCI A;  5BUK A;  4IVO B;  1L9C A;  3ALJ A;  4FK1 A;  2YLX A;  3NYC A;  4H4R A;  1B37 A;  4AP3 A;  1H86 A;  4BK3 A;  2XLP A;  2XYO A;  3QSE A;  1ONF A;  2JBV A;  4A65 A;  4H4U A;  3AE7 A;  1DAO A;  3UTE A;  3P4R A;  4QFC A;  1GSN A;  3ZNO A;  1GEU A;  2VQB A;  1NHS A;  2VQ7 A;  2UZZ A;  4J2W A;  2E4A A;  3GSI A;  2E5V A;  4EIQ A;  3URH A;  3DJJ A;  1QJD A;  1S2Y A;  2C72 A;  3ICS A;  2C76 A;  3DGH A;  3LOV A;  3ICR A;  1N4V A;  4U8I A;  1VRQ B;  1GES A;  3T37 A;  2X3N A;  4CY6 A;  4LA1 A;  4CCR A;  1VG9 A;  1H7X A;  5GSN A;  1OJ9 A;  4K8D A;  4USR A;  4Y4M A;  1NHQ A;  5KVH A;  4U8K A;  4PAB A;  2WU5 A;  1K0I A;  4GF7 A;  5KRQ A;  4YTP A;  2V5Z A;  2XLU A;  3GDN A;  2WP6 A;  4UDQ A;  1PXA A;  4I58 A;  1ELI A;  5HY5 A;  4EQS A;  1CJ3 A;  1F8W A;  4YJG B;  5BRT A;  2GAH B;  1BWC A;  3CGE A;  4YWO A;  4K7Z A;  3PVC A;  2O9Z A;  4OPD A;  5U1O A;  4CBQ A;  2FBW A;  1GRH A;  3ITJ A;  1D7Y A;  3AXB A;  3GRT A;  1PBB A;  3UOY A;  4EM4 A;  2B9Y A;  1PXB A;  1H83 A;  3RP6 A;  1SEZ A;  3LB8 A;  5J60 A;  3K7M X;  1D4C A;  3SXI A;  3AE3 A;  3UTF A;  1PDH A;  2VOU A;  4RSL A;  4C74 A;  2JK6 A;  4Z25 A;  2A89 A;  2ACZ A;  1K0L A;  1LPF A;  2E4G A;  3VRD B;  4TLZ A;  3KA7 A;  3RP8 A;  2DKH A;  1F3P A;  2QAE A;  3NT6 A;  4O5Q A;  1ZOY A;  3LJP A;  3P4S A;  1JNR A;  3ATQ A;  1DOC A;  4JNQ A;  4YXD A;  2C64 A;  2WQY A;  2NVK X;  1P2H A;  3NTA A;  3M12 A;  3SM8 A;  4RG3 A;  3P4Q A;  4HA6 A;  3DJG X;  2WPC A;  2Y6Q A;  2YG4 A;  3G5Q A;  4YJD A;  1H6V A;  1CC4 A;  2XFP A;  1H7W A;  3GD3 A;  4ZCC A;  2BA9 A;  4Z2R A;  5J7X A;  1E7P A;  4U2L A;  3DA1 A;  2X8G A;  1AN9 A;  1H82 A;  3F8R A;  2VVL G;  3UOZ A;  2YG6 A;  5KMS A;  3QVP A;  2IVD A;  5KOW A;  1VDC A;  1PJ7 A;  4XWZ A;  1S3E A;  1TDN A;  2WU2 A;  1MO9 A;  2GF3 A;  4G74 A;  2FJD A;  1EL5 A;  4EMJ A;  1GRG A;  1Q9I A;  1UKV G;  2GMJ A;  3F8P A;  3HZL A;  4EQW A;  1F8R A;  2WDV A;  1VQW A;  1F8S A;  4A5L A;  2WHD A;  3BHK A;  3OC4 A;  4G6G A;  1EL7 A;  3SX6 A;  4AOX A;  1TDO A;  1ZX9 A;  2R0P A;  1C0L A;  3G5R A;  3D8X A;  3HYX A;  5U63 A;  1N1P A;  1YQ3 A;  3W4I A;  3FMW A;  3NGC X;  3Q6J A;  4B68 A;  3UKQ A;  4P9S A;  3S5W A;  2IID A;  2XFU A;  4YKG A;  2E49 A;  2C3C A;  4YSZ A;  2C65 A;  2ZZB A;  3VR9 A;  2YLW A;  2XVJ A;  4B69 A;  3UCL A;  3PS9 A;  3G5S A;  4CNK A;  4H4Q A;  2A8X A;  2JB2 A;  2XLT A;  4NEV A;  2Q7V A;  4H4V A;  3UOV A;  1CBO A;  3P1W A;  1FEC A;  4CCQ A;  4H2Q A;  2BAB A;  4MJW A;  2R46 A;  5EB5 A;  3IHM A;  3SZF A;  2WP5 A;  2GV8 A;  4J31 A;  5KMQ A;  1PBE A;  1FCD A;  3KKJ A;  4ZCD A;  4REK A;  5M0Z A;  1BKW A;  3UP4 A;  4U8J A;  3DJD A;  4BV6 A;  3NLC A;  2WES A;  5FS9 A;  4C5O A;  2BK4 A;  2XVF A;  4WCT A;  4K22 A;  2XVH A;  2ZZC A;  3UKP A;  2OAM A;  4YSH A;  2AR8 A;  3GWD A;  2JB1 A;  4ICY A;  1GRA A;  3EAO A;  5L46 A;  1KNR A;  1NPX A;  4J36 A;  2C73 A;  4QFD A;  2QCU A;  1CL0 A;  1LQT A;  3AE8 A;  4FDC B;  4H4T A;  3KU9 A;  1PN0 A;  1PJ6 A;  2FJE A;  1KNP A;  5FS8 A;  4BK1 A;  2B9W A;  2GR1 A;  4GDE A;  1D4E A;  2YVF A;  4DGK A;  3FBS A;  3CPH G;  2E82 A;  5IQ4 A;  3M13 A;  4YSX A;  1E1M A;  3VRB A;  3ZNQ A;  2C3D A;  2GH5 A;  1L0V A;  3AE6 A;  3QFA A;  3R9U A;  4II3 A;  1PS9 A;  4Z26 A;  4H2N A;  2Q6U A;  1DOB A;  3KLJ A;  4U8N A;  3NK0 X;  4YT0 A;  1OJT A;  2GQF A;  2ARD A;  4GCM A;  3AEF A;  3LAD A;  3UKF A;  3LZX A;  3UTH A;  5KOX A;  1LV0 A;  1GAL A;  4OPC A;  3II4 A;  4BUR A;  1FEA A;  1NHR A;  1F6M A;  1RYI A;  3NK2 X;  4I59 A;  3KD9 A;  5CQF A;  2JKC A;  2PHH A;  3CUK A;  1MOK A;  2BS2 A;  3NIX A;  4TLX A;  2V61 A;  2ZZ0 A;  3CNT A;  4J33 A;  4TM0 A;  3VRA A;  2TMD A;  2WEU A;  4G9K A;  1GTE A;  4JDR A;  4TM4 A;  1OJD A;  1Y0P A;  1XAN A;  2FJA A;  1PHH A;  3E1T A;  3ABV A;  4K2X A;  5HHF A;  1E6E A;  3RNM A;  1HYU A;  4A99 A;  5CKU A;  4IA5 A;  2XCG A;  3Q9T A;  4LU6 A;  3VQR A;  2VVM A;  3UP5 A;  3SZ0 A;  2BAC A;  4TM3 A;  3CGB A;  5U25 A;  5KVI A;  1YY5 A;  3D1C A;  2GMH A;  3BI5 A;  4NEW A;  1E1K A;  2J3N A;  1DJN A;  3ADA B;  1D7L A;  3AD8 B;  1RP0 A;  3AE1 A;  4H4X A;  1DNC A;  3DJE A;  4B65 A;  2NPX A;  4H4W A;  4NTE A;  1KSU A;  2C67 A;  4U8M A;  4B1B A;  1BF3 A;  1D4D A;  1E39 A;  1LVL A;  1TYP A;  2BC0 A;  1C0P A;  1GOS A;  1Y56 A;  3PO7 A;  3CIR A;  3OZ2 A;  3O0H A;  4UDR A;  5M10 A;  3NH3 X;  2GR0 A;  3RED A;  3SFD A;  1L9D A;  2WET A;  4JNA A;  4U2T A;  3CND A;  3UKL A;  4GAP A;  4Z24 A;  3FIM B;  2GRT A;  5JCK A;  1FL2 A;  5HXI A;  1CC2 A;  1M6I A;  1REO A;  2YQU A;  4KX6 A;  3M0O A;  1IUU A;  2XFQ A;  3C4A A;  3H8L A;  3KPF A;  1GET A;  4U8P A;  4AT0 A;  4Z43 A;  3V3O A;  5GRT A;  2AQJ A;  2CDU A;  2XVE A;  3AYI A;  4Y4L A;  1IUX A;  2C7G A;  4C3X A;  1BGN A;  4AOS A;  2BRY A;  2WOI A;  2R9Z A;  3AE5 A;  5KMP A;  1BZL A;  1GER A;  4OPU A;  1MXT A;  1LTX R;  2X8H A;  4USQ A;  3HYV A;  4CNJ A;  3T0K A;  1GRE A;  2R4J A;  3DK4 A;  3NTD A;  2R0G A;  4G73 A;  3CNP A;  3I3L A;  3P9U A;  4X4J A;  4ECH A;  1KIF A;  4UP3 A;  1H81 A;  1XDI A;  2XFO A;  2C4C A;  1ZY8 A;  1JRX A;  4JY3 A;  3GMB A;  4APN A;  1CJ2 A;  3FPZ A;  2RAB A;  2Q0K A;  3AEB A;  2BS4 A;  4YJF A;  1Q1W A;  2XLS A;  4II2 A;  4XXG A;  1TDF A;  2GR2 A;  2ZBW A;  2BC1 A;  3GMC A;  3C96 A;  3NKS A;  4OPI A;  2V60 A;  4YTN A;  2APG A;  2CVJ A;  2GAG B;  3NNE A;  5ER0 A;  5BVA A;  2VVL A;  2CFY A;  5FMH A;  4YTM A;  4LII A;  3DK8 A;  4U2S A;  3V76 A;  4H7U A;  3RP7 A;  2VZ2 A;  1IUW A;  2BS3 A;  1EL8 A;  1KF6 A;  2YG7 A;  1TDK A;  2B7R A;  1ZOV A;  3W4J A;  3K30 A;  4FX9 A;  3SQP A;  3RHA A;  5LV9 A;  4G6H A;  3COX A;  1YQ4 A;  2EQ8 A;  1GTH A;  2YG3 A;  3VR8 A;  1VG0 A;  1NHP A;  1CHU A;  3ALL A;  1GRB A;  4DSH A;  1GRF A;  4OVI A;  1FOH A;  1GT8 A;  3GYI A;  1TRB A;  2RGJ A;  1IUT A;  3AD7 B;  2C75 A;  4J56 A;  1JNZ A;  2FJB A;  4Y4N A;  4Z2U A;  3DME A;  1COY A;  1PBD A;  3UOX A; 
#chains in the Genus database with same CATH homology
 4B66 A;  3NK1 X;  4X9M A;  1H84 A;  2RGH A;  2Z5Y A;  1JRZ A;  4OPL A;  4JY2 A;  5KNL A;  5IPY A;  2XFN A;  1PXC A;  2XDO A;  2R45 A;  4YSY A;  3UTG A;  1NAA A;  1Y56 B;  4A6N A;  3QSS A;  1PJ5 A;  3AYJ A;  1IUV A;  2BK3 A;  3NHO X;  1EBD A;  4JN9 A;  4DNA A;  3EF6 A;  3SZW A;  2GB0 A;  3BNM A;  3T14 A;  1NEN A;  1C0I A;  2R0C A;  3V3N A;  1NDA A;  2GQW A;  2BCP A;  3AE9 A;  5EB4 A;  5JCM A;  3AB1 A;  4GAV A;  3NYF A;  3H4K A;  1DDO A;  3CNS A;  1B8S A;  1ZK7 A;  3L8K A;  4D03 A;  1EVI A;  2QA1 A;  2VRM A;  1KFY A;  1GV4 A;  4OPG A;  4YJH A;  2X8C A;  3I6D A;  3NN6 X;  3AD9 B;  1C0K A;  4EQX A;  3C4N A;  1JOA A;  1QO8 A;  1TYT A;  5HYM A;  2YG5 A;  1DJQ A;  3BI2 A;  3SYI A;  2IVE A;  3AE2 A;  3HYW A;  4CY8 A;  4H50 A;  4GUV A;  4IVM B;  4BJZ A;  1CF3 A;  4NTD A;  4BJY A;  3IC9 A;  1CJC A;  2RGO A;  4EIP A;  3BI4 A;  5TR3 A;  3S61 A;  4H4S A;  4U8L A;  1NG3 A;  1K4Q A;  1P2E A;  4M52 A;  3IF9 A;  1GRT A;  1RSG A;  2YR4 A;  4DSG A;  3BNU A;  4Z44 A;  1FEB A;  1NG4 A;  2JB3 A;  2YM2 A;  4TM1 A;  4YJF B;  2B76 A;  1VE9 A;  2YLT A;  2B7S A;  4H4P A;  4Z2T A;  3GWF A;  3IHG A;  1XPQ A;  3GYJ A;  1O95 A;  3AEA A;  2EQ6 A;  2X99 A;  3LZW A;  2YM1 A;  4ADW A;  3SY4 A;  4NTC A;  4ZN0 A;  3GDP A;  2BRA A;  4IA6 A;  1Z6L A;  4AP1 A;  4B67 A;  3DK9 A;  3AEE A;  3EAN A;  4C3Y A;  1E1N A;  3B6D A;  2EQ9 A;  2XLR A;  4RG4 A;  1AOG A;  4E0V A;  5IQ1 A;  2YLZ A;  1V59 A;  1ZP0 A;  2BCG G;  3GYX A;  4O5U A;  2Y6R A;  3AED A;  2GVC A;  2E48 A;  3IWA A;  4C77 A;  1B4V A;  3W4K A;  2R4E A;  3CNJ A;  3QJ4 A;  1ZDL A;  1OJC A;  3KVE A;  4NWZ A;  2JAE A;  4XWR A;  1DOD A;  1IJH A;  3QFB A;  1O94 A;  1W4X A;  1EL9 A;  3T2Y A;  3UKH A;  1CC6 A;  3CMM A;  4B64 A;  1JEH A;  2QA2 A;  4H2P A;  2DU8 A;  3LXD A;  2W0H A;  2WDR A;  3JSK A;  2YLR A;  3ZNP A;  2DKI A;  2I0Z A;  2YVJ A;  2YVG A;  2YR6 A;  2C70 A;  5JCL A;  2GR3 A;  3AYL A;  2V3A A;  3L1R A;  4AT2 A;  4GR1 A;  2BXR A;  2YWL A;  3SFE A;  1OJA A;  4H4Z A;  5EOW A;  4EQR A;  3ZNN A;  4PAA A;  4A6N B;  2X50 A;  4EMI A;  3GRS A;  1M64 A;  2F5Z A;  5C3J A;  3QSM A;  4D04 A;  2H89 A;  4U8O A;  1BGJ A;  1IUS A;  4OCG A;  4NNJ A;  2A87 A;  3QVR A;  1PBF A;  5KMR A;  4NZH A;  3AE4 A;  3B3R A;  3DH9 A;  2E1M A;  1PBC A;  4A79 A;  3GD4 A;  4K5S A;  1JRY A;  2Q0L A;  5EBK A;  1E1L A;  4GDP A;  4YKF A;  4H2R A;  5BUL A;  4EMW A;  4GRT A;  2BXS A;  2WPE A;  4A7A A;  1D5T A;  4BK2 A;  1DXL A;  3UKK A;  4YJH B;  3SZC A;  1L9E A;  1JU2 A;  2BYB A;  1ZMD A;  3F8D A;  3CPJ G;  4HB9 A;  4J34 A;  5C2T A;  3AEG A;  4OPT A;  3T2Z A;  4J57 A;  1YKJ A;  2V3B A;  1GND A;  3NRN A;  1Q1R A;  4H4Y A;  3FG2 P;  3AEC A;  3AWI A;  4KPR A;  4UDP A;  2TPR A;  2YAU A;  5KXJ A;  2WOW A;  2B9X A;  2GEW A;  2HQM A;  2WP9 A;  1N4W A;  3K7T A;  2OLN A;  1S2Q A;  3H8I A;  4EM3 A;  5FS7 A;  1LQU A;  3ALM A;  1KDG A;  1X31 B;  1ZKQ A;  4YJG A;  4A9W A;  3SGL A;  1N4U A;  1KSS A;  5DBJ A;  5JCN A;  4K5R A;  4X9N A;  3ATR A;  3DGZ A;  2XVI A;  5FS6 A;  1S3B A;  3ICT A;  2WPF A;  2YLS A;  5KWF A;  2CUL A;  3CGD A;  3CPI G;  3NN0 X;  3WGT A;  3T31 A;  3CTY A;  3UKA A;  3CGC A;  2AAQ A;  3ZYX A;  2YR5 A;  1CJ4 A;  3P4P A;  3NYE A;  4FK1 C;  4JQ9 A;  1XHC A;  4N9X A;  2EQ7 A;  4B63 A;  1GPE A;  2OA1 A;  2PYX A;  3BHF A;  2C66 A;  2WOV A;  3ISH A;  1GXF A;  2WBA A;  1LJ1 A;  1ZMC A;  2BK5 A;  2H88 A;  2WS3 A;  3KPK A;  1K0J A;  1O5W A;  1YQZ A;  4WX1 A;  3WE0 A;  3EPT A;  4CRT A;  1QLB A;  3ZDN A;  2Z5X A;  2OLO A;  2OAL A;  2V6O A;  3T2K A;  4IV9 A;  3G3E A;  1B5Q A;  3CN8 A;  3K7Q X;  1NEK A;  3NG7 X;  2WDQ A;  2VRL A;  1DOE A;  1TDE A;  5JCI A;  5BUK A;  4IVO B;  1L9C A;  3ALJ A;  4FK1 A;  2YLX A;  3NYC A;  4H4R A;  1B37 A;  4AP3 A;  1H86 A;  2XLP A;  2XYO A;  4BK3 A;  3QSE A;  1ONF A;  2JBV A;  4A65 A;  4H4U A;  3AE7 A;  1DAO A;  3UTE A;  3P4R A;  4QFC A;  1GSN A;  3ZNO A;  1GEU A;  2VQB A;  1NHS A;  2VQ7 A;  2UZZ A;  4J2W A;  2E4A A;  3GSI A;  2E5V A;  4EIQ A;  3URH A;  3DJJ A;  1QJD A;  1S2Y A;  2C72 A;  3ICS A;  2C76 A;  3DGH A;  3LOV A;  3ICR A;  1N4V A;  4U8I A;  1VRQ B;  1GES A;  3T37 A;  2X3N A;  4CY6 A;  4LA1 A;  4CCR A;  1VG9 A;  1H7X A;  5GSN A;  1OJ9 A;  4K8D A;  4USR A;  4Y4M A;  1NHQ A;  5KVH A;  4U8K A;  4PAB A;  2WU5 A;  1K0I A;  4GF7 A;  5KRQ A;  4YTP A;  2V5Z A;  2XLU A;  3GDN A;  2WP6 A;  4UDQ A;  1PXA A;  4I58 A;  1ELI A;  5HY5 A;  4EQS A;  1CJ3 A;  1F8W A;  4YJG B;  5BRT A;  2GAH B;  1BWC A;  3CGE A;  4YWO A;  4K7Z A;  3PVC A;  2O9Z A;  4OPD A;  5U1O A;  4CBQ A;  2FBW A;  1GRH A;  3ITJ A;  1D7Y A;  3AXB A;  3GRT A;  1PBB A;  3UOY A;  4EM4 A;  2B9Y A;  1PXB A;  1H83 A;  3LB8 A;  1SEZ A;  3RP6 A;  5J60 A;  3K7M X;  1D4C A;  3SXI A;  3AE3 A;  3UTF A;  1PDH A;  4RSL A;  2VOU A;  4C74 A;  2JK6 A;  4Z25 A;  2A89 A;  2ACZ A;  1K0L A;  1LPF A;  2E4G A;  3VRD B;  4TLZ A;  3KA7 A;  3RP8 A;  1F3P A;  2DKH A;  2QAE A;  3NT6 A;  4O5Q A;  1ZOY A;  3LJP A;  3P4S A;  1JNR A;  3ATQ A;  1DOC A;  4JNQ A;  4YXD A;  2C64 A;  2WQY A;  2NVK X;  1P2H A;  3NTA A;  3M12 A;  3SM8 A;  4RG3 A;  3P4Q A;  4HA6 A;  3DJG X;  2WPC A;  2Y6Q A;  2YG4 A;  3G5Q A;  4YJD A;  1H6V A;  1CC4 A;  2XFP A;  1H7W A;  3GD3 A;  4ZCC A;  2BA9 A;  4Z2R A;  5J7X A;  1E7P A;  4U2L A;  3DA1 A;  2X8G A;  1AN9 A;  1H82 A;  3F8R A;  2VVL G;  3UOZ A;  2YG6 A;  5KMS A;  3QVP A;  2IVD A;  5KOW A;  1VDC A;  1PJ7 A;  1TDN A;  4XWZ A;  1S3E A;  2WU2 A;  1MO9 A;  2GF3 A;  4G74 A;  2FJD A;  1EL5 A;  4EMJ A;  1GRG A;  1Q9I A;  1UKV G;  2GMJ A;  3F8P A;  3HZL A;  4EQW A;  1F8R A;  2WDV A;  1VQW A;  1F8S A;  4A5L A;  2WHD A;  3BHK A;  3OC4 A;  4G6G A;  1EL7 A;  3SX6 A;  4AOX A;  1TDO A;  1ZX9 A;  2R0P A;  1C0L A;  3G5R A;  3D8X A;  3HYX A;  5U63 A;  1N1P A;  1YQ3 A;  3W4I A;  3FMW A;  3NGC X;  3Q6J A;  4B68 A;  3UKQ A;  4P9S A;  3S5W A;  2IID A;  2XFU A;  4YKG A;  2E49 A;  2C3C A;  4YSZ A;  2C65 A;  2ZZB A;  3VR9 A;  2YLW A;  2XVJ A;  4B69 A;  3UCL A;  3PS9 A;  3G5S A;  4CNK A;  4H4Q A;  2A8X A;  2JB2 A;  2XLT A;  4NEV A;  2Q7V A;  4H4V A;  3UOV A;  1CBO A;  3P1W A;  1FEC A;  4CCQ A;  2BAB A;  4H2Q A;  4MJW A;  2R46 A;  5EB5 A;  3IHM A;  3SZF A;  2WP5 A;  2GV8 A;  4J31 A;  5KMQ A;  1PBE A;  1FCD A;  3KKJ A;  4ZCD A;  4REK A;  5M0Z A;  1BKW A;  3UP4 A;  4U8J A;  3DJD A;  4BV6 A;  3NLC A;  2WES A;  5FS9 A;  4C5O A;  2BK4 A;  2XVF A;  4WCT A;  4K22 A;  2XVH A;  2ZZC A;  3UKP A;  2OAM A;  4YSH A;  2AR8 A;  3GWD A;  2JB1 A;  4ICY A;  1GRA A;  3EAO A;  5L46 A;  1KNR A;  1NPX A;  4J36 A;  2C73 A;  4QFD A;  2QCU A;  1CL0 A;  1LQT A;  3AE8 A;  4FDC B;  4H4T A;  3KU9 A;  1PN0 A;  1PJ6 A;  2FJE A;  1KNP A;  5FS8 A;  4BK1 A;  2B9W A;  2GR1 A;  4GDE A;  1D4E A;  2YVF A;  4DGK A;  3FBS A;  3CPH G;  2E82 A;  5IQ4 A;  3M13 A;  4YSX A;  1E1M A;  3VRB A;  3ZNQ A;  2C3D A;  2GH5 A;  1L0V A;  3AE6 A;  3QFA A;  3R9U A;  4II3 A;  1PS9 A;  4Z26 A;  3KLJ A;  2Q6U A;  1DOB A;  4H2N A;  4U8N A;  3NK0 X;  4YT0 A;  1OJT A;  2GQF A;  2ARD A;  4GCM A;  3AEF A;  3LAD A;  3UKF A;  3LZX A;  3UTH A;  5KOX A;  1LV0 A;  1GAL A;  4OPC A;  3II4 A;  4BUR A;  1FEA A;  1NHR A;  1F6M A;  1RYI A;  3NK2 X;  4I59 A;  3KD9 A;  5CQF A;  2JKC A;  2PHH A;  3CUK A;  1MOK A;  2BS2 A;  3NIX A;  4TLX A;  2V61 A;  2ZZ0 A;  3CNT A;  4J33 A;  4TM0 A;  3VRA A;  2TMD A;  2WEU A;  4G9K A;  1GTE A;  4JDR A;  4TM4 A;  1OJD A;  1Y0P A;  1XAN A;  2FJA A;  1PHH A;  3ABV A;  3E1T A;  4K2X A;  5HHF A;  1E6E A;  3RNM A;  1HYU A;  4A99 A;  5CKU A;  3Q9T A;  2XCG A;  4IA5 A;  4LU6 A;  3VQR A;  2VVM A;  3UP5 A;  3SZ0 A;  2BAC A;  4TM3 A;  3CGB A;  5U25 A;  5KVI A;  1YY5 A;  3D1C A;  2GMH A;  3BI5 A;  4NEW A;  1E1K A;  2J3N A;  1DJN A;  3ADA B;  1D7L A;  3AD8 B;  1RP0 A;  3AE1 A;  4H4X A;  1DNC A;  3DJE A;  4B65 A;  2NPX A;  4H4W A;  4NTE A;  1KSU A;  2C67 A;  4U8M A;  4B1B A;  1BF3 A;  1D4D A;  1E39 A;  1LVL A;  1TYP A;  2BC0 A;  1C0P A;  1GOS A;  1Y56 A;  3PO7 A;  3CIR A;  3OZ2 A;  3O0H A;  4UDR A;  5M10 A;  3NH3 X;  2GR0 A;  3RED A;  3SFD A;  1L9D A;  2WET A;  4JNA A;  4U2T A;  3CND A;  3UKL A;  4GAP A;  4Z24 A;  3FIM B;  2GRT A;  5JCK A;  1FL2 A;  1CC2 A;  1M6I A;  1REO A;  5HXI A;  2YQU A;  4KX6 A;  3M0O A;  1IUU A;  2XFQ A;  3C4A A;  3H8L A;  3KPF A;  1GET A;  4U8P A;  4AT0 A;  4Z43 A;  3V3O A;  5GRT A;  2AQJ A;  2CDU A;  2XVE A;  3AYI A;  4Y4L A;  1IUX A;  2C7G A;  4C3X A;  1BGN A;  4AOS A;  2BRY A;  2WOI A;  2R9Z A;  3AE5 A;  5KMP A;  1BZL A;  1GER A;  4OPU A;  1MXT A;  1LTX R;  2X8H A;  4USQ A;  3HYV A;  4CNJ A;  3T0K A;  1GRE A;  2R4J A;  3DK4 A;  3NTD A;  2R0G A;  4G73 A;  3CNP A;  3I3L A;  3P9U A;  4X4J A;  4ECH A;  1KIF A;  4UP3 A;  1H81 A;  1XDI A;  2XFO A;  2C4C A;  1ZY8 A;  1JRX A;  4JY3 A;  3GMB A;  4APN A;  1CJ2 A;  3FPZ A;  2RAB A;  2Q0K A;  3AEB A;  2BS4 A;  4YJF A;  1Q1W A;  2XLS A;  4II2 A;  4XXG A;  1TDF A;  2GR2 A;  2ZBW A;  2BC1 A;  3GMC A;  3C96 A;  3NKS A;  4OPI A;  2V60 A;  4YTN A;  2APG A;  2CVJ A;  2GAG B;  3NNE A;  5ER0 A;  5BVA A;  2VVL A;  2CFY A;  5FMH A;  4YTM A;  4LII A;  3DK8 A;  4U2S A;  3V76 A;  4H7U A;  2VZ2 A;  3RP7 A;  1IUW A;  2BS3 A;  1EL8 A;  1KF6 A;  2YG7 A;  1TDK A;  2B7R A;  1ZOV A;  3W4J A;  3K30 A;  4FX9 A;  3SQP A;  3RHA A;  5LV9 A;  4G6H A;  3COX A;  1YQ4 A;  2EQ8 A;  1GTH A;  2YG3 A;  3VR8 A;  1VG0 A;  1NHP A;  1CHU A;  3ALL A;  1GRB A;  4DSH A;  1GRF A;  4OVI A;  1FOH A;  1GT8 A;  3GYI A;  1TRB A;  2RGJ A;  1IUT A;  3AD7 B;  2C75 A;  4J56 A;  1JNZ A;  2FJB A;  4Y4N A;  4Z2U A;  3DME A;  1COY A;  1PBD A;  3UOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...