3NYFA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-histidine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
381
Chain Sequence
b'HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 122
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyfA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyfA01
4YJFA 3IF9A 1PJ5A 1CHUA 2YVGA 3AE1A 3UKKA 1FOHA 2VRMA 3NK0X 3ZYXA 4IVOB 1B8SA 1SEZA 1D4EA 4OCGA 4U8OA 1ZX9A 2IVDA 4EQRA 3OZ2A 1GRTA 1ONFA 4QFCA 2JK6A 4NTEA 3VRAA 4AOXA 4BK3A 4D03A 1GERA 1H83A 4Z25A 1KNPA 4O5UA 4OPDA 3UOYA 3B3RA 4H2RA 1GV4A 3AWIA 2XLSA 1C0KA 3QSMA 1BF3A 3GWFA 3CPJG 3H8IA 4U8LA 3SM8A 1BGJA 4YJGB 2WESA 5IQ1A 3NKSA 2XFNA 3NN6X 1PJ7A 1B5QA 3P4QA 1D5TA 4C77A 1NHPA 3KA7A 2R45A 2WPFA 4Z2RA 1ZMCA 1PXCA 3AEDA 3NIXA 3FMWA 1EBDA 1OJAA 3LZWA 4IV9A 2E82A 2JB2A 2WOIA 4HA6A 3ADAB 1GESA 3DJDA 3M13A 4A99A 1K0LA 2GQFA 1CJ4A 1TDFA 2YWLA 3K7QX 1D7LA 3UP4A 2HQMA 1S3EA 3ICRA 3QVRA 4TM4A 4A65A 3LADA 1GRBA 4K2XA 3V3OA 3P1WA 1KFYA 1H6VA 3C4AA 1PXAA 4GRTA 1L9DA 2OLOA 3NYCA 3S61A 3AYJA 1D4DA 3KLJA 4J56A 5JCNA 1DXLA 2VVMA 1GRAA 1DOBA 3W4IA 2WQYA 4NTDA 3NT6A 4ZCCA 2AR8A 1M64A 1L9EA 3ABVA 4AT0A 4A6NA 3BHKA 2C3CA 1F8RA 2YQUA 3NNEA 4Z24A 4YSYA 5J60A 4GDPA 2GAHB 1FEAA 2B7SA 1E1NA 1Y56A 2CDUA 5JCLA 3DK4A 3E1TA 1X31B 5HY5A 2PYXA 1P2HA 1DAOA 2OAMA 2BA9A 2WP6A 2C3DA 3QSEA 4H4PA 3Q6JA 2WDRA 4IA5A 2R0PA 1O95A 1IJHA 2C73A 2GF3A 2UZZA 3QVPA 4EMWA 3NK1X 1OJCA 4ICYA 2W0HA 3HZLA 2WU2A 2E49A 5FMHA 3II4A 2Z5XA 2BK3A 4AT2A 2A89A 4Y4LA 3FG2P 2Q0KA 2GMJA 3GDPA 1VE9A 2F5ZA 2V3AA 3ZDNA 3AE3A 2BS2A 2XVFA 3FBSA 4B64A 1KSSA 2WETA 2YLWA 3K30A 2JB3A 1PBBA 5ER0A 4J34A 3VRDB 4K5RA 2R4JA 4H50A 4ZCDA 4ZN0A 1E1LA 1ZP0A 1RYIA 3UCLA 1KIFA 3CTYA 4TLZA 1OJ9A 1GRFA 2I0ZA 5EOWA 3K7TA 1FCDA 3M0OA 2OALA 2YLRA 4U8IA 3AXBA 2BCPA 1B4VA 1LQTA 2YR5A 3P4PA 5FS6A 5U63A 3REDA 2GH5A 1TYPA 3UTGA 2OA1A 1PXBA 1DJQA 1VG9A 3AE4A 3ISHA 4YSXA 4Z26A 4H2PA 2NPXA 1KNRA 3CIRA 3CGEA 3ALJA 1DDOA 4A6NB 1BZLA 4B67A 3UKPA 3UOXA 2DU8A 3ZNQA 4H4VA 2BK5A 1LPFA 4UDRA 4YJDA 1EL5A 1Y56B 1TDOA 2E4AA 1DOEA 2FJEA 5FS9A 1RSGA 3PS9A 1ZY8A 3ICSA 1FL2A 5C2TA 3ALLA 3NTAA 4H4TA 2YLTA 4PABA 2X99A 3IWAA 2WP5A 4RG3A 1GALA 5DBJA 3VR8A 5IQ4A 4UP3A 2ZZ0A 2BACA 3UTEA 4U8MA 4JY3A 1BWCA 3SGLA 3C4NA 1P2EA 1JRZA 2YVFA 3PO7A 4XWRA 2GR2A 3NN0X 2YR4A 4J2WA 1PHHA 4EQXA 1JU2A 1Z6LA 3GDNA 1VRQB 3LZXA 4CCQA 1JEHA 2XVEA 1IUXA 4FK1A 4REKA 5IPYA 3FIMB 2BS4A 2YAUA 3KPFA 3ZNOA 2JB1A 4CNJA 4OVIA 2GV8A 4H4YA 1GXFA 2O9ZA 1ZOVA 4C3YA 4UDPA 2YLSA 2Y6QA 3ALMA 3ICTA 4GDEA 4U2TA 4X4JA 1TRBA 3DJGX 4UDQA 3BHFA 4D04A 2C65A 1JOAA 3QFBA 2X8HA 3F8DA 4EMIA 2BS3A 4NTCA 4OPIA 1F8SA 2YLZA 4A79A 1GT8A 2VRLA 1GTEA 3QJ4A 2BYBA 3NHOX 3F8PA 4YKFA 1E1MA 3UKHA 2AAQA 3EANA 1IUUA 3UP5A 1F8WA 4CY6A 1AN9A 3L8KA 1IUTA 1O5WA 4EM3A 2B9XA 5HHFA 5JCIA 2R9ZA 2QAEA 2GAGB 2R46A 1K0IA 3DMEA 4B66A 2WU5A 1K0JA 2A8XA 3NTDA 3UTHA 4RG4A 3I3LA 4WX1A 1D7YA 3DA1A 2FBWA 4EIPA 1N4VA 2QA1A 3QSSA 4CCRA 1QLBA 5C3JA 3CPHG 2R0GA 2QA2A 3RNMA 4N9XA 1BGNA 4TLXA 2WS3A 4YJFB 2VQBA 2YG7A 1E7PA 3BNUA 3AEGA 4GCMA 3NLCA 3OC4A 1F3PA 1OJTA 1N1PA 1XDIA 1O94A 1C0IA 3CNJA 3AD9B 2YG5A 1YQ3A 2E1MA 1TYTA 1NENA 2VOUA 2XFPA 2XYOA 1C0LA 3AYLA 2WDQA 1QO8A 1GEUA 3AD7B 1NEKA 5CQFA 2ACZA 3P4RA 3NH3X 1IUVA 4U8NA 4J57A 1VG0A 3AECA 3DGHA 4HB9A 5BULA 2J3NA 1NHSA 4FK1C 1H82A 1ZK7A 1EVIA 4H4SA 1LQUA 2VVLA 3GRTA 3AEEA 1PJ6A 2Z5YA 4AP3A 4Z44A 2XLUA 2JKCA 2ZZBA 2YLXA 3AEAA 3GD3A 1JNRA 4B63A 5JCKA 2VVLG 3H8LA 3CGCA 2C64A 3T37A 3DGZA 4ECHA 1ZKQA 2B9WA 3UOVA 3CPIG 4M52A 4LA1A 3R9UA 5EB5A 4NEVA 1NHQA 2DKHA 4K22A 1YQZA 1H81A 2PHHA 2E4GA 2XFOA 4CBQA 1CC4A 2H89A 4BURA 1FEBA 3CNTA 3NG7X 4CRTA 4MJWA 3NGCX 1CJ3A 1DJNA 4X9NA 1JNZA 1KF6A 1DOCA 3GRSA 2GB0A 4KX6A 1PDHA 3COXA 4JNAA 2Q7VA 2WP9A 2XLPA 1H7WA 5EBKA 1ELIA 2BC1A 2TMDA 2WOVA 3DK9A 3L1RA 1CL0A 3RP6A 3RP8A 3D8XA 4J33A 1CBOA 1EL7A 2FJBA 1B37A 3O0HA 5KWFA 1KDGA 4DSGA 4YTNA 3G5RA 5U25A 2GMHA 2CVJA 1CJ2A 1CC2A 3GSIA 2XFUA 4Z2UA 1S3BA 4A9WA 3NK2X 3QFAA 4KPRA 1XHCA 2GR0A 2GRTA 3G3EA 2BK4A 3I6DA 4GF7A 4TM0A 3UKQA 1NDAA 1GPEA 4GR1A 3LXDA 2JAEA 4TM1A 4X9MA 1REOA 1JRXA 3DJEA 5KRQA 2Q6UA 2H88A 4DGKA 2Y6RA 3W4JA 3UKFA 2V6OA 5GRTA 3LB8A 4Z43A 5HYMA 4NZHA 5JCMA 3AE8A 3AYIA 4JY2A 2R4EA 3LOVA 3H4KA 4C5OA 2VZ2A 2GQWA 2XLTA 2XCGA 3B6DA 4IA6A 1MO9A 2FJDA 3ZNPA 2X3NA 2C76A 2C67A 3ZNNA 3BI5A 3CGDA 3RP7A 2ZZCA 3GD4A 3GMBA 1L9CA 2WBAA 4LIIA 4EMJA 4YJHA 2ZBWA 3LJPA 2BXSA 3AE6A 2CFYA 2GR1A 4USRA 3S5WA 1PS9A 3IHMA 2C72A 2BC0A 2XFQA 4Y4NA 1NG3A 3PVCA 2AQJA 2WPEA 4H2QA 4H4XA 4NEWA 4OPLA 3VQRA 3CUKA 1V59A 4YSZA 4J31A 1N4UA 5U1OA 3FPZA 4C74A 2WPCA 2C66A 4O5QA 1YY5A 2B9YA 4P9SA 5BUKA 5M0ZA 1HYUA 4GUVA 3AB1A 4USQA 1YKJA 1JRYA 3WGTA 1GOSA 4LU6A 2GEWA 5LV9A 2GR3A 3DH9A 4YKGA 1XANA 3D1CA 1GETA 4CY8A 2APGA 4I58A 1LJ1A 4U8JA 2V61A 1NG4A 4YWOA 3AD8B 5TR3A 1GSNA 4K5SA 1NHRA 1H84A 3SQPA 1K4QA 5KVIA 2YG4A 4APNA 4TM3A 5KXJA 5EB4A 2XVIA 1C0PA 2A87A 1OJDA 2BXRA 1E39A 3NYFA 4CNKA 1F6MA 2BCGG 2FJAA 1UKVG 2VQ7A 3CN8A 3GMCA 4YTPA 2WEUA 4Z2TA 1CF3A 1GNDA 4DNAA 4PAAA 4U8KA 3GYIA 4OPCA 5BVAA 1LVLA 4H4RA 4JN9A 2C70A 1RP0A 1Q1RA 4U2SA 1AOGA 2EQ6A 1DNCA 2E5VA 3BI4A 4K7ZA 3VRBA 4YJHB 2YG6A 4JDRA 2WDVA 1PBDA 2NVKX 1XPQA 2X50A 3KU9A 2RGOA 3WE0A 2B7RA 3KVEA 1CJCA 2YM1A 4AOSA 4EM4A 2XDOA 3EAOA 3AEFA 4J36A 1H7XA 1D4CA 2XLRA 4FDCB 3CNSA 4JNQA 4EQSA 4IVMB 1VDCA 4WCTA 1YQ4A 2YG3A 2YM2A 3ITJA 3RHAA 1ZOYA 2Q0LA 3G5SA 3ATRA 1GRGA 4EQWA 3P4SA 2C7GA 4A5LA 1H86A 4I59A 3G5QA 3CNDA 2RGJA 4FX9A 1TDEA 3UKLA 1LTXR 1GTHA 3GWDA 3IC9A 5KOXA 1Q9IA 4DSHA 2DKIA 1GRHA 2BABA 3AE2A 2C75A 3IHGA 2RABA 1IUSA 4B68A 2XVHA 2IIDA 1S2QA 4U8PA 3V76A 4QFDA 3NYEA 4RSLA 4YSHA 2XVJA 2R0CA 4AP1A 2OLNA 3Q9TA 3AE7A 1FECA 1W4XA 3NRNA 3UKAA 2EQ9A 3VR9A 3W4KA 1Q1WA 3K7MX 4U2LA 4BK1A 3CNPA 5KVHA 2IVEA 4H2NA 4H4QA 2RGHA 3P9UA 4H4ZA 3UTFA 3V3NA 3SFDA 1ZMDA 5J7XA 1EL8A 4B1BA 2X8CA 1BKWA 1GREA 1MOKA 1QJDA 2E48A 1PBFA 2CULA 1L0VA 1KSUA 4A7AA 4ADWA 4YXDA 5M10A 4H4WA 2WOWA 2V5ZA 1COYA 1LV0A 2YVJA 4Y4MA 2EQ7A 3C96A 3KD9A 2ARDA 2QCUA 4OPGA 5L46A 1PBEA 3EF6A 3JSKA 3BNMA 3GYJA 3UOZA 1S2YA 1TDNA 4B69A 4K8DA 4BJZA 4B65A 5KOWA 1EL9A 1PN0A 3M12A 4YJGA 2EQ8A 3BI2A 5CKUA 3SFEA 3URHA 4XWZA 2YR6A 4YT0A 1PBCA 1NAAA 4C3XA 1ZDLA 2V3BA 4BV6A 2TPRA 2GVCA 1IUWA 1CC6A 1NPXA 4OPTA 4JQ9A 1N4WA 3DJJA 3DK8A 4H7UA 1E1KA 4XXGA 5BRTA 4OPUA 2V60A 5GSNA 4H4UA 4BK2A 4EIQA 3CGBA 2X8GA 4BJYA 1Y0PA 2B76A 3KKJA 2JBVA 4E0VA 1E6EA 3EPTA 3ATQA 3AE5A 1VQWA 5HXIA 3AEBA 3AE9A 1DODA 4YTMA 1MXTA 5FS8A 2WHDA 5FS7A 1M6IA 3F8RA 1TDKA
chains in the Genus database with same CATH superfamily
4YJFA 3IF9A 1PJ5A 1CHUA 2YVGA 3AE1A 3UKKA 1FOHA 2VRMA 3NK0X 3ZYXA 4IVOB 1B8SA 3T14A 1SEZA 1D4EA 4OCGA 4U8OA 1ZX9A 4II3A 2IVDA 4EQRA 3OZ2A 1GRTA 4BK3A 4QFCA 1ONFA 2JK6A 4NTEA 3VRAA 4AOXA 4D03A 1GERA 1H83A 4Z25A 1KNPA 4O5UA 4OPDA 3UOYA 3B3RA 4H2RA 1GV4A 3AWIA 2XLSA 1C0KA 3QSMA 1BF3A 3GWFA 3CPJG 3H8IA 4U8LA 3SM8A 1BGJA 4YJGB 2WESA 5IQ1A 3NKSA 2XFNA 3NN6X 1PJ7A 1B5QA 3P4QA 1D5TA 4C77A 1NHPA 3KA7A 2R45A 2WPFA 4Z2RA 1ZMCA 1PXCA 3AEDA 3NIXA 3FMWA 1EBDA 1OJAA 3LZWA 4IV9A 2E82A 2JB2A 2WOIA 4HA6A 3ADAB 1GESA 3DJDA 3M13A 4A99A 1K0LA 2GQFA 1CJ4A 1TDFA 2YWLA 3HYWA 1D7LA 3K7QX 3UP4A 5KMRA 2HQMA 1S3EA 3ICRA 3QVRA 4TM4A 4A65A 3LADA 1GRBA 4K2XA 3V3OA 3P1WA 1KFYA 1H6VA 3C4AA 1PXAA 4GRTA 1L9DA 2OLOA 3NYCA 3S61A 3AYJA 1D4DA 3KLJA 4G73A 4J56A 5JCNA 1DXLA 2VVMA 1GRAA 1DOBA 3W4IA 2WQYA 4NTDA 3NT6A 4ZCCA 2AR8A 1M64A 1L9EA 3ABVA 4AT0A 4A6NA 3BHKA 2C4CA 1F8RA 2C3CA 2YQUA 3NNEA 4Z24A 4YSYA 5J60A 4GDPA 1FEAA 2GAHB 2B7SA 1E1NA 1Y56A 2CDUA 5JCLA 3DK4A 3E1TA 1X31B 5HY5A 2PYXA 1P2HA 1DAOA 2OAMA 2BA9A 2WP6A 2C3DA 3QSEA 4H4PA 3Q6JA 2WDRA 4IA5A 2R0PA 1O95A 1IJHA 2C73A 2GF3A 2UZZA 3QVPA 4EMWA 3NK1X 1OJCA 4ICYA 2W0HA 3HZLA 2WU2A 2E49A 5FMHA 3II4A 2Z5XA 2BK3A 4AT2A 2A89A 4Y4LA 3FG2P 2Q0KA 2GMJA 3GDPA 1VE9A 2F5ZA 2V3AA 3ZDNA 3AE3A 3HYVA 2BS2A 2XVFA 3FBSA 4B64A 1KSSA 2WETA 2YLWA 3K30A 2JB3A 1PBBA 5ER0A 4J34A 3CMMA 3VRDB 4K5RA 2R4JA 5KMSA 4H50A 4ZCDA 4ZN0A 1E1LA 1ZP0A 1RYIA 3UCLA 1KIFA 3CTYA 4TLZA 1OJ9A 1GRFA 2I0ZA 5EOWA 3K7TA 1FCDA 3M0OA 2OALA 2YLRA 4U8IA 3AXBA 2BCPA 1B4VA 1LQTA 2YR5A 3P4PA 5FS6A 5U63A 3REDA 2GH5A 1TYPA 3UTGA 2OA1A 1PXBA 1DJQA 1VG9A 3AE4A 3ISHA 4YSXA 4Z26A 4H2PA 2NPXA 1KNRA 3CIRA 3CGEA 3ALJA 1DDOA 4A6NB 1BZLA 4B67A 3UKPA 3UOXA 2DU8A 3ZNQA 4H4VA 2BK5A 1LPFA 4UDRA 4YJDA 1EL5A 1Y56B 1TDOA 2E4AA 1DOEA 2FJEA 5FS9A 1RSGA 3PS9A 1ZY8A 3ICSA 1FL2A 2BRAA 5C2TA 3ALLA 3NTAA 4H4TA 2YLTA 4PABA 2X99A 3IWAA 2WP5A 4RG3A 1GALA 5DBJA 3VR8A 5IQ4A 4UP3A 2ZZ0A 2BACA 3UTEA 4U8MA 4JY3A 1BWCA 3SGLA 3C4NA 1JRZA 1P2EA 2YVFA 3PO7A 4XWRA 2GR2A 3NN0X 2YR4A 4J2WA 1PHHA 4EQXA 1JU2A 1Z6LA 3GDNA 1VRQB 3LZXA 4CCQA 1JEHA 2XVEA 1IUXA 4FK1A 4REKA 5IPYA 3FIMB 2BS4A 2YAUA 3KPFA 3ZNOA 2JB1A 4CNJA 4OVIA 2GV8A 4H4YA 1GXFA 2O9ZA 1ZOVA 4C3YA 4UDPA 2YLSA 2Y6QA 3ALMA 3ICTA 4GDEA 4U2TA 4X4JA 1TRBA 3DJGX 4UDQA 3BHFA 4D04A 2C65A 1JOAA 3QFBA 2X8HA 3F8DA 4EMIA 3T2YA 2BS3A 4NTCA 4OPIA 3SX6A 1F8SA 2YLZA 4A79A 1GT8A 2VRLA 1GTEA 3QJ4A 2BYBA 4II2A 3NHOX 3T0KA 3F8PA 4YKFA 1E1MA 3UKHA 2AAQA 3EANA 1IUUA 3UP5A 1F8WA 4CY6A 1AN9A 3L8KA 1IUTA 1O5WA 3T2ZA 4EM3A 2B9XA 5HHFA 5JCIA 2R9ZA 2QAEA 2GAGB 2R46A 1K0IA 3DMEA 4B66A 2WU5A 1K0JA 5KMQA 2A8XA 3NTDA 3UTHA 3SZCA 4RG4A 3I3LA 4WX1A 4NNJA 1D7YA 3DA1A 4EIPA 2FBWA 1N4VA 2QA1A 3QSSA 4CCRA 1QLBA 5C3JA 3CPHG 2R0GA 2QA2A 3RNMA 4N9XA 1BGNA 4TLXA 2WS3A 4YJFB 2VQBA 2YG7A 1E7PA 3BNUA 3AEGA 4GCMA 3SXIA 3NLCA 3OC4A 1F3PA 1OJTA 1N1PA 1XDIA 1O94A 1C0IA 3CNJA 3AD9B 2YG5A 1YQ3A 2VOUA 1TYTA 1NENA 2E1MA 2XFPA 2XYOA 1C0LA 3AYLA 2WDQA 1QO8A 1GEUA 5KMPA 3AD7B 1NEKA 5CQFA 2ACZA 3P4RA 3NH3X 1IUVA 4U8NA 4J57A 3SYIA 1VG0A 3AECA 3DGHA 4HB9A 5BULA 2J3NA 1NHSA 4FK1C 1H82A 1ZK7A 1EVIA 4H4SA 1LQUA 2VVLA 3GRTA 3AEEA 1PJ6A 2Z5YA 4AP3A 4Z44A 2XLUA 2JKCA 2ZZBA 2YLXA 3AEAA 3GD3A 1JNRA 4B63A 5JCKA 2VVLG 3H8LA 3CGCA 2C64A 3T37A 3DGZA 3HYXA 4ECHA 1ZKQA 2B9WA 2BRYA 3UOVA 3CPIG 4M52A 4LA1A 3R9UA 5EB5A 4NEVA 1NHQA 2DKHA 4K22A 1YQZA 1H81A 2PHHA 2E4GA 2XFOA 4CBQA 1CC4A 2H89A 4BURA 1FEBA 3CNTA 3NG7X 4CRTA 4GAVA 3SZFA 4MJWA 3NGCX 1CJ3A 1DJNA 4X9NA 1JNZA 1KF6A 1DOCA 3GRSA 2GB0A 4KX6A 4NWZA 1PDHA 3COXA 4JNAA 4G6GA 2Q7VA 2WP9A 2XLPA 1H7WA 5EBKA 1ELIA 2BC1A 2TMDA 2WOVA 3DK9A 3L1RA 1CL0A 3RP6A 3RP8A 3D8XA 4J33A 1CBOA 1EL7A 2FJBA 1B37A 3O0HA 5KWFA 1KDGA 4DSGA 4YTNA 3G5RA 5U25A 2GMHA 2CVJA 1CJ2A 1CC2A 3GSIA 2XFUA 4Z2UA 1S3BA 4A9WA 3NK2X 3QFAA 4KPRA 1XHCA 2GR0A 2GRTA 3G3EA 2BK4A 4GF7A 3I6DA 4TM0A 3UKQA 1NDAA 1GPEA 4GR1A 3LXDA 2JAEA 4TM1A 3GYXA 4X9MA 1REOA 1JRXA 3DJEA 5KRQA 2Q6UA 2H88A 4DGKA 2Y6RA 3W4JA 3UKFA 2V6OA 5GRTA 3LB8A 5HYMA 4Z43A 4G6HA 4NZHA 5JCMA 3AE8A 3AYIA 4JY2A 2R4EA 3LOVA 3H4KA 4C5OA 2VZ2A 2GQWA 2XLTA 4IA6A 2XCGA 3B6DA 1MO9A 2FJDA 3T2KA 3ZNPA 2X3NA 3RP7A 2C76A 3ZNNA 2C67A 3BI5A 3CGDA 2ZZCA 3GD4A 3GMBA 1L9CA 2WBAA 4LIIA 4EMJA 4YJHA 2ZBWA 3LJPA 2BXSA 4G74A 3AE6A 2CFYA 2GR1A 4USRA 3S5WA 1PS9A 3IHMA 2C72A 2BC0A 2XFQA 4Y4NA 1NG3A 3PVCA 4H2QA 2AQJA 2WPEA 4H4XA 4NEWA 4OPLA 3VQRA 3CUKA 1V59A 4YSZA 4J31A 1N4UA 5U1OA 3FPZA 4C74A 2WPCA 2C66A 4O5QA 1YY5A 2B9YA 4P9SA 5BUKA 5M0ZA 1HYUA 4GUVA 3AB1A 4USQA 1YKJA 1JRYA 3WGTA 1GOSA 4LU6A 2GEWA 5LV9A 2GR3A 3DH9A 4YKGA 5KNLA 1XANA 3D1CA 1GETA 4CY8A 2APGA 4I58A 1LJ1A 4U8JA 2V61A 1NG4A 4YWOA 3AD8B 5TR3A 1GSNA 4K5SA 1NHRA 1H84A 3SQPA 1K4QA 5KVIA 2YG4A 4APNA 4TM3A 5KXJA 5EB4A 2XVIA 1C0PA 2A87A 1OJDA 2BXRA 1E39A 3KPKA 3NYFA 4CNKA 1F6MA 3SZWA 3GMCA 2BCGG 1UKVG 2FJAA 2VQ7A 3CN8A 4YTPA 2WEUA 4Z2TA 1CF3A 1GNDA 4DNAA 4PAAA 4U8KA 3GYIA 4OPCA 5BVAA 1LVLA 4H4RA 4JN9A 2C70A 1RP0A 1Q1RA 4U2SA 1AOGA 2EQ6A 1DNCA 2E5VA 3BI4A 4K7ZA 3VRBA 4YJHB 2YG6A 4JDRA 2WDVA 1PBDA 2NVKX 1XPQA 2X50A 3KU9A 2RGOA 3WE0A 2B7RA 3KVEA 1CJCA 2YM1A 4AOSA 4EM4A 2XDOA 3EAOA 3AEFA 4J36A 1H7XA 1D4CA 2XLRA 4FDCB 3CNSA 4JNQA 4EQSA 4IVMB 1VDCA 4WCTA 1YQ4A 2YG3A 2YM2A 3ITJA 3RHAA 1ZOYA 2Q0LA 3G5SA 3ATRA 1GRGA 4EQWA 3P4SA 2C7GA 4A5LA 1H86A 4I59A 3G5QA 3CNDA 2RGJA 4FX9A 1TDEA 3UKLA 4G9KA 1LTXR 3SZ0A 1GTHA 3GWDA 3IC9A 5KOXA 1Q9IA 4DSHA 2DKIA 1GRHA 2BABA 3AE2A 3IHGA 2C75A 2RABA 1IUSA 4B68A 2XVHA 2IIDA 1S2QA 4U8PA 3V76A 4QFDA 3NYEA 4RSLA 4YSHA 2XVJA 2R0CA 4AP1A 2OLNA 4GAPA 3Q9TA 3AE7A 1FECA 1W4XA 3NRNA 3UKAA 2EQ9A 3VR9A 3W4KA 1Q1WA 3K7MX 4U2LA 4BK1A 3CNPA 5KVHA 2IVEA 4H2NA 4H4QA 2RGHA 3P9UA 4H4ZA 3UTFA 3V3NA 3SFDA 1ZMDA 5J7XA 1EL8A 4B1BA 2X8CA 1GREA 1BKWA 1MOKA 1QJDA 2E48A 1PBFA 2CULA 1L0VA 1KSUA 4A7AA 4ADWA 4YXDA 5M10A 4H4WA 2WOWA 2V5ZA 1COYA 1LV0A 2YVJA 4Y4MA 3C96A 2EQ7A 3KD9A 2ARDA 2QCUA 4OPGA 5L46A 1PBEA 3EF6A 3JSKA 3BNMA 3GYJA 3UOZA 1S2YA 1TDNA 4B69A 4K8DA 4BJZA 4B65A 5KOWA 1EL9A 1PN0A 3M12A 4YJGA 2EQ8A 3BI2A 5CKUA 3SFEA 3SY4A 4XWZA 3URHA 2YR6A 4YT0A 1PBCA 1NAAA 4C3XA 1ZDLA 2V3BA 4BV6A 2TPRA 2GVCA 1IUWA 1CC6A 1NPXA 4OPTA 3T31A 4JQ9A 1N4WA 3DJJA 3DK8A 4H7UA 1E1KA 4XXGA 5BRTA 4OPUA 2V60A 4BK2A 4H4UA 5GSNA 4EIQA 3CGBA 2X8GA 4BJYA 1Y0PA 2B76A 3KKJA 2JBVA 4E0VA 3EPTA 1E6EA 3ATQA 5HXIA 1VQWA 3AE5A 3AEBA 3AE9A 1DODA 4YTMA 1MXTA 5FS8A 2WHDA 5FS7A 1M6IA 3F8RA 1TDKA
chains in the Genus database with same CATH topology
4YJFA 3IF9A 1PJ5A 1CHUA 2YVGA 3AE1A 3UKKA 1FOHA 2VRMA 3NK0X 3ZYXA 4IVOB 1B8SA 3T14A 1SEZA 1D4EA 4OCGA 4U8OA 1ZX9A 4II3A 2IVDA 4EQRA 3OZ2A 1GRTA 1ONFA 4QFCA 2JK6A 4NTEA 3VRAA 4AOXA 4BK3A 4D03A 1GERA 1H83A 4Z25A 1KNPA 4O5UA 4OPDA 3UOYA 3B3RA 4H2RA 1GV4A 3AWIA 2XLSA 1C0KA 3QSMA 1BF3A 3GWFA 3CPJG 3H8IA 4U8LA 3SM8A 1BGJA 4YJGB 2WESA 5IQ1A 3NKSA 2XFNA 3NN6X 1PJ7A 1B5QA 3P4QA 1D5TA 4C77A 1NHPA 3KA7A 2R45A 2WPFA 4Z2RA 1ZMCA 1PXCA 3AEDA 3NIXA 3FMWA 1EBDA 1OJAA 3LZWA 4IV9A 2E82A 2JB2A 2WOIA 4HA6A 3ADAB 1GESA 3DJDA 3M13A 4A99A 1K0LA 2GQFA 1CJ4A 1TDFA 2YWLA 3HYWA 1D7LA 3K7QX 3UP4A 5KMRA 2HQMA 1S3EA 3ICRA 3QVRA 4TM4A 4A65A 3LADA 1GRBA 4K2XA 3V3OA 3P1WA 1KFYA 1H6VA 3C4AA 1PXAA 4GRTA 1L9DA 2OLOA 3NYCA 3S61A 3AYJA 1D4DA 3KLJA 4G73A 4J56A 5JCNA 1DXLA 2VVMA 1GRAA 1DOBA 3W4IA 2WQYA 4NTDA 3NT6A 4ZCCA 2AR8A 1M64A 1L9EA 3ABVA 4AT0A 4A6NA 3BHKA 2C4CA 1F8RA 2C3CA 2YQUA 3NNEA 4Z24A 4YSYA 5J60A 4GDPA 2GAHB 1FEAA 2B7SA 1E1NA 1Y56A 2CDUA 5JCLA 3DK4A 3E1TA 1X31B 5HY5A 2PYXA 1P2HA 1DAOA 2OAMA 2BA9A 2WP6A 2C3DA 3QSEA 4H4PA 3Q6JA 2WDRA 4IA5A 2R0PA 1O95A 1IJHA 2C73A 2GF3A 2UZZA 3QVPA 4EMWA 3NK1X 1OJCA 4ICYA 2W0HA 3HZLA 2WU2A 2E49A 5FMHA 3II4A 2Z5XA 2BK3A 4AT2A 2A89A 4Y4LA 3FG2P 2Q0KA 2GMJA 3GDPA 1VE9A 2F5ZA 2V3AA 3ZDNA 3AE3A 3HYVA 2BS2A 2XVFA 3FBSA 4B64A 1KSSA 2WETA 2YLWA 3K30A 2JB3A 1PBBA 5ER0A 4J34A 3CMMA 3VRDB 4K5RA 2R4JA 5KMSA 4H50A 4ZCDA 4ZN0A 1E1LA 1ZP0A 1RYIA 3UCLA 1KIFA 3CTYA 4TLZA 1OJ9A 1GRFA 2I0ZA 5EOWA 3K7TA 1FCDA 3M0OA 2OALA 2YLRA 4U8IA 3AXBA 2BCPA 1B4VA 1LQTA 2YR5A 3P4PA 5FS6A 5U63A 3REDA 2GH5A 1TYPA 3UTGA 2OA1A 1PXBA 1DJQA 1VG9A 3AE4A 3ISHA 4YSXA 4Z26A 4H2PA 2NPXA 1KNRA 3CIRA 3CGEA 3ALJA 1DDOA 4A6NB 1BZLA 4B67A 3UKPA 3UOXA 2DU8A 3ZNQA 4H4VA 2BK5A 1LPFA 4UDRA 4YJDA 1EL5A 1Y56B 1TDOA 2E4AA 1DOEA 2FJEA 5FS9A 1RSGA 3PS9A 1ZY8A 3ICSA 1FL2A 2BRAA 5C2TA 3ALLA 3NTAA 4H4TA 2YLTA 4PABA 2X99A 3IWAA 2WP5A 4RG3A 1GALA 5DBJA 3VR8A 5IQ4A 4UP3A 2ZZ0A 2BACA 3UTEA 4U8MA 4JY3A 1BWCA 3SGLA 3C4NA 1P2EA 1JRZA 2YVFA 3PO7A 4XWRA 2GR2A 3NN0X 2YR4A 4J2WA 1PHHA 4EQXA 1JU2A 1Z6LA 3GDNA 1VRQB 3LZXA 4CCQA 1JEHA 2XVEA 1IUXA 4FK1A 4REKA 5IPYA 3FIMB 2BS4A 2YAUA 3KPFA 3ZNOA 2JB1A 4CNJA 4OVIA 2GV8A 4H4YA 1GXFA 2O9ZA 1ZOVA 4C3YA 4UDPA 2YLSA 2Y6QA 3ALMA 3ICTA 4GDEA 4U2TA 4X4JA 1TRBA 3DJGX 4UDQA 3BHFA 4D04A 2C65A 1JOAA 3QFBA 2X8HA 3F8DA 4EMIA 3T2YA 2BS3A 4NTCA 4OPIA 3SX6A 1F8SA 2YLZA 4A79A 1GT8A 2VRLA 1GTEA 3QJ4A 2BYBA 4II2A 3NHOX 3T0KA 3F8PA 4YKFA 1E1MA 3UKHA 2AAQA 3EANA 1IUUA 3UP5A 1F8WA 4CY6A 1AN9A 3L8KA 1IUTA 1O5WA 3T2ZA 4EM3A 2B9XA 5HHFA 5JCIA 2R9ZA 2QAEA 2GAGB 2R46A 1K0IA 3DMEA 4B66A 2WU5A 1K0JA 5KMQA 2A8XA 3NTDA 3UTHA 3SZCA 4RG4A 3I3LA 4WX1A 4NNJA 1D7YA 3DA1A 2FBWA 4EIPA 1N4VA 2QA1A 3QSSA 4CCRA 1QLBA 5C3JA 3CPHG 2R0GA 2QA2A 3RNMA 4N9XA 1BGNA 4TLXA 2WS3A 4YJFB 2VQBA 2YG7A 1E7PA 3BNUA 3AEGA 4GCMA 3SXIA 3NLCA 3OC4A 1F3PA 1OJTA 1N1PA 1XDIA 1O94A 1C0IA 3CNJA 3AD9B 2YG5A 1YQ3A 2E1MA 1TYTA 1NENA 2VOUA 2XFPA 2XYOA 1C0LA 3AYLA 2WDQA 1QO8A 1GEUA 5KMPA 3AD7B 1NEKA 5CQFA 2ACZA 3P4RA 3NH3X 1IUVA 4U8NA 4J57A 3SYIA 1VG0A 3AECA 3DGHA 4HB9A 5BULA 2J3NA 1NHSA 4FK1C 1H82A 1ZK7A 1EVIA 4H4SA 1LQUA 2VVLA 3GRTA 3AEEA 1PJ6A 2Z5YA 4AP3A 4Z44A 2XLUA 2JKCA 2ZZBA 2YLXA 3AEAA 3GD3A 1JNRA 4B63A 5JCKA 2VVLG 3H8LA 3CGCA 2C64A 3T37A 3DGZA 3HYXA 4ECHA 1ZKQA 2B9WA 2BRYA 3UOVA 3CPIG 4M52A 4LA1A 3R9UA 5EB5A 4NEVA 1NHQA 2DKHA 4K22A 1YQZA 1H81A 2PHHA 2E4GA 2XFOA 4CBQA 1CC4A 2H89A 4BURA 1FEBA 3CNTA 3NG7X 4CRTA 4GAVA 3SZFA 4MJWA 3NGCX 1CJ3A 1DJNA 4X9NA 1JNZA 1KF6A 1DOCA 3GRSA 2GB0A 4KX6A 4NWZA 1PDHA 3COXA 4JNAA 4G6GA 2Q7VA 2WP9A 2XLPA 1H7WA 5EBKA 1ELIA 2BC1A 2TMDA 2WOVA 3DK9A 3L1RA 1CL0A 3RP6A 3RP8A 3D8XA 4J33A 1CBOA 1EL7A 2FJBA 1B37A 3O0HA 5KWFA 1KDGA 4DSGA 4YTNA 3G5RA 5U25A 2GMHA 2CVJA 1CJ2A 1CC2A 3GSIA 2XFUA 4Z2UA 1S3BA 4A9WA 3NK2X 3QFAA 4KPRA 1XHCA 2GR0A 2GRTA 3G3EA 2BK4A 3I6DA 4GF7A 4TM0A 3UKQA 1NDAA 1GPEA 4GR1A 3LXDA 2JAEA 4TM1A 3GYXA 4X9MA 1REOA 1JRXA 3DJEA 5KRQA 2Q6UA 2H88A 4DGKA 2Y6RA 3W4JA 3UKFA 2V6OA 5GRTA 3LB8A 4Z43A 5HYMA 4G6HA 4NZHA 5JCMA 3AE8A 3AYIA 4JY2A 2R4EA 3LOVA 3H4KA 4C5OA 2VZ2A 2GQWA 2XLTA 2XCGA 3B6DA 4IA6A 1MO9A 2FJDA 3T2KA 3ZNPA 2X3NA 2C76A 2C67A 3ZNNA 3BI5A 3CGDA 3RP7A 2ZZCA 3GD4A 3GMBA 1L9CA 2WBAA 4LIIA 4EMJA 4YJHA 2ZBWA 3LJPA 2BXSA 4G74A 3AE6A 2CFYA 2GR1A 4USRA 3S5WA 1PS9A 3IHMA 2C72A 2BC0A 2XFQA 4Y4NA 1NG3A 3PVCA 2AQJA 2WPEA 4H2QA 4H4XA 4NEWA 4OPLA 3VQRA 3CUKA 1V59A 4YSZA 4J31A 1N4UA 5U1OA 3FPZA 4C74A 2WPCA 2C66A 4O5QA 1YY5A 2B9YA 4P9SA 5BUKA 5M0ZA 1HYUA 4GUVA 3AB1A 4USQA 1YKJA 1JRYA 3WGTA 1GOSA 4LU6A 2GEWA 5LV9A 2GR3A 3DH9A 4YKGA 5KNLA 1XANA 3D1CA 1GETA 4CY8A 2APGA 4I58A 1LJ1A 4U8JA 2V61A 1NG4A 4YWOA 3AD8B 5TR3A 1GSNA 4K5SA 1NHRA 1H84A 3SQPA 1K4QA 5KVIA 2YG4A 4APNA 4TM3A 5KXJA 5EB4A 2XVIA 1C0PA 2A87A 1OJDA 2BXRA 1E39A 3KPKA 3NYFA 4CNKA 1F6MA 3SZWA 2BCGG 2FJAA 1UKVG 2VQ7A 3CN8A 3GMCA 4YTPA 2WEUA 4Z2TA 1CF3A 1GNDA 4DNAA 4PAAA 4U8KA 3GYIA 4OPCA 5BVAA 1LVLA 4H4RA 4JN9A 2C70A 1RP0A 1Q1RA 4U2SA 1AOGA 2EQ6A 1DNCA 2E5VA 3BI4A 4K7ZA 3VRBA 4YJHB 2YG6A 4JDRA 2WDVA 1PBDA 2NVKX 1XPQA 2X50A 3KU9A 2RGOA 3WE0A 2B7RA 3KVEA 1CJCA 2YM1A 4AOSA 4EM4A 2XDOA 3EAOA 3AEFA 4J36A 1H7XA 1D4CA 2XLRA 4FDCB 3CNSA 4JNQA 4EQSA 4IVMB 1VDCA 4WCTA 1YQ4A 2YG3A 2YM2A 3ITJA 3RHAA 1ZOYA 2Q0LA 3G5SA 3ATRA 1GRGA 4EQWA 3P4SA 2C7GA 4A5LA 1H86A 4I59A 3G5QA 3CNDA 2RGJA 4FX9A 1TDEA 3UKLA 4G9KA 1LTXR 3SZ0A 1GTHA 3GWDA 3IC9A 5KOXA 1Q9IA 4DSHA 2DKIA 1GRHA 2BABA 3AE2A 2C75A 3IHGA 2RABA 1IUSA 4B68A 2XVHA 2IIDA 1S2QA 4U8PA 3V76A 4QFDA 3NYEA 4RSLA 4YSHA 2XVJA 2R0CA 4AP1A 2OLNA 4GAPA 3Q9TA 3AE7A 1FECA 1W4XA 3NRNA 3UKAA 2EQ9A 3VR9A 3W4KA 1Q1WA 3K7MX 4U2LA 4BK1A 3CNPA 5KVHA 2IVEA 4H2NA 4H4QA 2RGHA 3P9UA 4H4ZA 3UTFA 3V3NA 3SFDA 1ZMDA 5J7XA 1EL8A 4B1BA 2X8CA 1BKWA 1GREA 1MOKA 1QJDA 2E48A 1PBFA 2CULA 1L0VA 1KSUA 4A7AA 4ADWA 4YXDA 5M10A 4H4WA 2WOWA 2V5ZA 1COYA 1LV0A 2YVJA 4Y4MA 2EQ7A 3C96A 3KD9A 2ARDA 2QCUA 4OPGA 5L46A 1PBEA 3EF6A 3JSKA 3BNMA 3GYJA 3UOZA 1S2YA 1TDNA 4B69A 4K8DA 4BJZA 4B65A 5KOWA 1EL9A 1PN0A 3M12A 4YJGA 2EQ8A 3BI2A 5CKUA 3SFEA 3SY4A 4XWZA 3URHA 2YR6A 4YT0A 1PBCA 1NAAA 4C3XA 1ZDLA 2V3BA 4BV6A 2TPRA 2GVCA 1IUWA 1CC6A 1NPXA 4OPTA 3T31A 4JQ9A 1N4WA 3DJJA 3DK8A 4H7UA 1E1KA 4XXGA 5BRTA 4OPUA 2V60A 5GSNA 4H4UA 4BK2A 4EIQA 3CGBA 2X8GA 4BJYA 1Y0PA 2B76A 3KKJA 2JBVA 4E0VA 1E6EA 3EPTA 3ATQA 3AE5A 1VQWA 5HXIA 3AEBA 3AE9A 1DODA 4YTMA 1MXTA 5FS8A 2WHDA 5FS7A 1M6IA 3F8RA 1TDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YJF A;  3IF9 A;  1PJ5 A;  1CHU A;  2YVG A;  3AE1 A;  3UKK A;  1FOH A;  2VRM A;  3NK0 X;  3ZYX A;  4IVO B;  1B8S A;  1SEZ A;  1D4E A;  4OCG A;  4U8O A;  1ZX9 A;  2IVD A;  4EQR A;  3OZ2 A;  1GRT A;  1ONF A;  4QFC A;  2JK6 A;  4NTE A;  3VRA A;  4AOX A;  4BK3 A;  4D03 A;  1GER A;  1H83 A;  4Z25 A;  1KNP A;  4O5U A;  4OPD A;  3UOY A;  3B3R A;  4H2R A;  1GV4 A;  3AWI A;  2XLS A;  1C0K A;  3QSM A;  1BF3 A;  3GWF A;  3CPJ G;  3H8I A;  4U8L A;  3SM8 A;  1BGJ A;  4YJG B;  2WES A;  5IQ1 A;  3NKS A;  2XFN A;  3NN6 X;  1PJ7 A;  1B5Q A;  3P4Q A;  1D5T A;  4C77 A;  1NHP A;  3KA7 A;  2R45 A;  2WPF A;  4Z2R A;  1ZMC A;  1PXC A;  3AED A;  3NIX A;  3FMW A;  1EBD A;  1OJA A;  3LZW A;  4IV9 A;  2E82 A;  2JB2 A;  2WOI A;  4HA6 A;  3ADA B;  1GES A;  3DJD A;  3M13 A;  4A99 A;  1K0L A;  2GQF A;  1CJ4 A;  1TDF A;  2YWL A;  3K7Q X;  1D7L A;  3UP4 A;  2HQM A;  1S3E A;  3ICR A;  3QVR A;  4TM4 A;  4A65 A;  3LAD A;  1GRB A;  4K2X A;  3V3O A;  3P1W A;  1KFY A;  1H6V A;  3C4A A;  1PXA A;  4GRT A;  1L9D A;  2OLO A;  3NYC A;  3S61 A;  3AYJ A;  1D4D A;  3KLJ A;  4J56 A;  5JCN A;  1DXL A;  2VVM A;  1GRA A;  1DOB A;  3W4I A;  2WQY A;  4NTD A;  3NT6 A;  4ZCC A;  2AR8 A;  1M64 A;  1L9E A;  3ABV A;  4AT0 A;  4A6N A;  3BHK A;  2C3C A;  1F8R A;  2YQU A;  3NNE A;  4Z24 A;  4YSY A;  5J60 A;  4GDP A;  2GAH B;  1FEA A;  2B7S A;  1E1N A;  1Y56 A;  2CDU A;  5JCL A;  3DK4 A;  3E1T A;  1X31 B;  5HY5 A;  2PYX A;  1P2H A;  1DAO A;  2OAM A;  2BA9 A;  2WP6 A;  2C3D A;  3QSE A;  4H4P A;  3Q6J A;  2WDR A;  4IA5 A;  2R0P A;  1O95 A;  1IJH A;  2C73 A;  2GF3 A;  2UZZ A;  3QVP A;  4EMW A;  3NK1 X;  1OJC A;  4ICY A;  2W0H A;  3HZL A;  2WU2 A;  2E49 A;  5FMH A;  3II4 A;  2Z5X A;  2BK3 A;  4AT2 A;  2A89 A;  4Y4L A;  3FG2 P;  2Q0K A;  2GMJ A;  3GDP A;  1VE9 A;  2F5Z A;  2V3A A;  3ZDN A;  3AE3 A;  2BS2 A;  2XVF A;  3FBS A;  4B64 A;  1KSS A;  2WET A;  2YLW A;  3K30 A;  2JB3 A;  1PBB A;  5ER0 A;  4J34 A;  3VRD B;  4K5R A;  2R4J A;  4H50 A;  4ZCD A;  4ZN0 A;  1E1L A;  1ZP0 A;  1RYI A;  3UCL A;  1KIF A;  3CTY A;  4TLZ A;  1OJ9 A;  1GRF A;  2I0Z A;  5EOW A;  3K7T A;  1FCD A;  3M0O A;  2OAL A;  2YLR A;  4U8I A;  3AXB A;  2BCP A;  1B4V A;  1LQT A;  2YR5 A;  3P4P A;  5FS6 A;  5U63 A;  3RED A;  2GH5 A;  1TYP A;  3UTG A;  2OA1 A;  1PXB A;  1DJQ A;  1VG9 A;  3AE4 A;  3ISH A;  4YSX A;  4Z26 A;  4H2P A;  2NPX A;  1KNR A;  3CIR A;  3CGE A;  3ALJ A;  1DDO A;  4A6N B;  1BZL A;  4B67 A;  3UKP A;  3UOX A;  2DU8 A;  3ZNQ A;  4H4V A;  2BK5 A;  1LPF A;  4UDR A;  4YJD A;  1EL5 A;  1Y56 B;  1TDO A;  2E4A A;  1DOE A;  2FJE A;  5FS9 A;  1RSG A;  3PS9 A;  1ZY8 A;  3ICS A;  1FL2 A;  5C2T A;  3ALL A;  3NTA A;  4H4T A;  2YLT A;  4PAB A;  2X99 A;  3IWA A;  2WP5 A;  4RG3 A;  1GAL A;  5DBJ A;  3VR8 A;  5IQ4 A;  4UP3 A;  2ZZ0 A;  2BAC A;  3UTE A;  4U8M A;  4JY3 A;  1BWC A;  3SGL A;  3C4N A;  1P2E A;  1JRZ A;  2YVF A;  3PO7 A;  4XWR A;  2GR2 A;  3NN0 X;  2YR4 A;  4J2W A;  1PHH A;  4EQX A;  1JU2 A;  1Z6L A;  3GDN A;  1VRQ B;  3LZX A;  4CCQ A;  1JEH A;  2XVE A;  1IUX A;  4FK1 A;  4REK A;  5IPY A;  3FIM B;  2BS4 A;  2YAU A;  3KPF A;  3ZNO A;  2JB1 A;  4CNJ A;  4OVI A;  2GV8 A;  4H4Y A;  1GXF A;  2O9Z A;  1ZOV A;  4C3Y A;  4UDP A;  2YLS A;  2Y6Q A;  3ALM A;  3ICT A;  4GDE A;  4U2T A;  4X4J A;  1TRB A;  3DJG X;  4UDQ A;  3BHF A;  4D04 A;  2C65 A;  1JOA A;  3QFB A;  2X8H A;  3F8D A;  4EMI A;  2BS3 A;  4NTC A;  4OPI A;  1F8S A;  2YLZ A;  4A79 A;  1GT8 A;  2VRL A;  1GTE A;  3QJ4 A;  2BYB A;  3NHO X;  3F8P A;  4YKF A;  1E1M A;  3UKH A;  2AAQ A;  3EAN A;  1IUU A;  3UP5 A;  1F8W A;  4CY6 A;  1AN9 A;  3L8K A;  1IUT A;  1O5W A;  4EM3 A;  2B9X A;  5HHF A;  5JCI A;  2R9Z A;  2QAE A;  2GAG B;  2R46 A;  1K0I A;  3DME A;  4B66 A;  2WU5 A;  1K0J A;  2A8X A;  3NTD A;  3UTH A;  4RG4 A;  3I3L A;  4WX1 A;  1D7Y A;  3DA1 A;  2FBW A;  4EIP A;  1N4V A;  2QA1 A;  3QSS A;  4CCR A;  1QLB A;  5C3J A;  3CPH G;  2R0G A;  2QA2 A;  3RNM A;  4N9X A;  1BGN A;  4TLX A;  2WS3 A;  4YJF B;  2VQB A;  2YG7 A;  1E7P A;  3BNU A;  3AEG A;  4GCM A;  3NLC A;  3OC4 A;  1F3P A;  1OJT A;  1N1P A;  1XDI A;  1O94 A;  1C0I A;  3CNJ A;  3AD9 B;  2YG5 A;  1YQ3 A;  2E1M A;  1TYT A;  1NEN A;  2VOU A;  2XFP A;  2XYO A;  1C0L A;  3AYL A;  2WDQ A;  1QO8 A;  1GEU A;  3AD7 B;  1NEK A;  5CQF A;  2ACZ A;  3P4R A;  3NH3 X;  1IUV A;  4U8N A;  4J57 A;  1VG0 A;  3AEC A;  3DGH A;  4HB9 A;  5BUL A;  2J3N A;  1NHS A;  4FK1 C;  1H82 A;  1ZK7 A;  1EVI A;  4H4S A;  1LQU A;  2VVL A;  3GRT A;  3AEE A;  1PJ6 A;  2Z5Y A;  4AP3 A;  4Z44 A;  2XLU A;  2JKC A;  2ZZB A;  2YLX A;  3AEA A;  3GD3 A;  1JNR A;  4B63 A;  5JCK A;  2VVL G;  3H8L A;  3CGC A;  2C64 A;  3T37 A;  3DGZ A;  4ECH A;  1ZKQ A;  2B9W A;  3UOV A;  3CPI G;  4M52 A;  4LA1 A;  3R9U A;  5EB5 A;  4NEV A;  1NHQ A;  2DKH A;  4K22 A;  1YQZ A;  1H81 A;  2PHH A;  2E4G A;  2XFO A;  4CBQ A;  1CC4 A;  2H89 A;  4BUR A;  1FEB A;  3CNT A;  3NG7 X;  4CRT A;  4MJW A;  3NGC X;  1CJ3 A;  1DJN A;  4X9N A;  1JNZ A;  1KF6 A;  1DOC A;  3GRS A;  2GB0 A;  4KX6 A;  1PDH A;  3COX A;  4JNA A;  2Q7V A;  2WP9 A;  2XLP A;  1H7W A;  5EBK A;  1ELI A;  2BC1 A;  2TMD A;  2WOV A;  3DK9 A;  3L1R A;  1CL0 A;  3RP6 A;  3RP8 A;  3D8X A;  4J33 A;  1CBO A;  1EL7 A;  2FJB A;  1B37 A;  3O0H A;  5KWF A;  1KDG A;  4DSG A;  4YTN A;  3G5R A;  5U25 A;  2GMH A;  2CVJ A;  1CJ2 A;  1CC2 A;  3GSI A;  2XFU A;  4Z2U A;  1S3B A;  4A9W A;  3NK2 X;  3QFA A;  4KPR A;  1XHC A;  2GR0 A;  2GRT A;  3G3E A;  2BK4 A;  3I6D A;  4GF7 A;  4TM0 A;  3UKQ A;  1NDA A;  1GPE A;  4GR1 A;  3LXD A;  2JAE A;  4TM1 A;  4X9M A;  1REO A;  1JRX A;  3DJE A;  5KRQ A;  2Q6U A;  2H88 A;  4DGK A;  2Y6R A;  3W4J A;  3UKF A;  2V6O A;  5GRT A;  3LB8 A;  4Z43 A;  5HYM A;  4NZH A;  5JCM A;  3AE8 A;  3AYI A;  4JY2 A;  2R4E A;  3LOV A;  3H4K A;  4C5O A;  2VZ2 A;  2GQW A;  2XLT A;  2XCG A;  3B6D A;  4IA6 A;  1MO9 A;  2FJD A;  3ZNP A;  2X3N A;  2C76 A;  2C67 A;  3ZNN A;  3BI5 A;  3CGD A;  3RP7 A;  2ZZC A;  3GD4 A;  3GMB A;  1L9C A;  2WBA A;  4LII A;  4EMJ A;  4YJH A;  2ZBW A;  3LJP A;  2BXS A;  3AE6 A;  2CFY A;  2GR1 A;  4USR A;  3S5W A;  1PS9 A;  3IHM A;  2C72 A;  2BC0 A;  2XFQ A;  4Y4N A;  1NG3 A;  3PVC A;  2AQJ A;  2WPE A;  4H2Q A;  4H4X A;  4NEW A;  4OPL A;  3VQR A;  3CUK A;  1V59 A;  4YSZ A;  4J31 A;  1N4U A;  5U1O A;  3FPZ A;  4C74 A;  2WPC A;  2C66 A;  4O5Q A;  1YY5 A;  2B9Y A;  4P9S A;  5BUK A;  5M0Z A;  1HYU A;  4GUV A;  3AB1 A;  4USQ A;  1YKJ A;  1JRY A;  3WGT A;  1GOS A;  4LU6 A;  2GEW A;  5LV9 A;  2GR3 A;  3DH9 A;  4YKG A;  1XAN A;  3D1C A;  1GET A;  4CY8 A;  2APG A;  4I58 A;  1LJ1 A;  4U8J A;  2V61 A;  1NG4 A;  4YWO A;  3AD8 B;  5TR3 A;  1GSN A;  4K5S A;  1NHR A;  1H84 A;  3SQP A;  1K4Q A;  5KVI A;  2YG4 A;  4APN A;  4TM3 A;  5KXJ A;  5EB4 A;  2XVI A;  1C0P A;  2A87 A;  1OJD A;  2BXR A;  1E39 A;  3NYF A;  4CNK A;  1F6M A;  2BCG G;  2FJA A;  1UKV G;  2VQ7 A;  3CN8 A;  3GMC A;  4YTP A;  2WEU A;  4Z2T A;  1CF3 A;  1GND A;  4DNA A;  4PAA A;  4U8K A;  3GYI A;  4OPC A;  5BVA A;  1LVL A;  4H4R A;  4JN9 A;  2C70 A;  1RP0 A;  1Q1R A;  4U2S A;  1AOG A;  2EQ6 A;  1DNC A;  2E5V A;  3BI4 A;  4K7Z A;  3VRB A;  4YJH B;  2YG6 A;  4JDR A;  2WDV A;  1PBD A;  2NVK X;  1XPQ A;  2X50 A;  3KU9 A;  2RGO A;  3WE0 A;  2B7R A;  3KVE A;  1CJC A;  2YM1 A;  4AOS A;  4EM4 A;  2XDO A;  3EAO A;  3AEF A;  4J36 A;  1H7X A;  1D4C A;  2XLR A;  4FDC B;  3CNS A;  4JNQ A;  4EQS A;  4IVM B;  1VDC A;  4WCT A;  1YQ4 A;  2YG3 A;  2YM2 A;  3ITJ A;  3RHA A;  1ZOY A;  2Q0L A;  3G5S A;  3ATR A;  1GRG A;  4EQW A;  3P4S A;  2C7G A;  4A5L A;  1H86 A;  4I59 A;  3G5Q A;  3CND A;  2RGJ A;  4FX9 A;  1TDE A;  3UKL A;  1LTX R;  1GTH A;  3GWD A;  3IC9 A;  5KOX A;  1Q9I A;  4DSH A;  2DKI A;  1GRH A;  2BAB A;  3AE2 A;  2C75 A;  3IHG A;  2RAB A;  1IUS A;  4B68 A;  2XVH A;  2IID A;  1S2Q A;  4U8P A;  3V76 A;  4QFD A;  3NYE A;  4RSL A;  4YSH A;  2XVJ A;  2R0C A;  4AP1 A;  2OLN A;  3Q9T A;  3AE7 A;  1FEC A;  1W4X A;  3NRN A;  3UKA A;  2EQ9 A;  3VR9 A;  3W4K A;  1Q1W A;  3K7M X;  4U2L A;  4BK1 A;  3CNP A;  5KVH A;  2IVE A;  4H2N A;  4H4Q A;  2RGH A;  3P9U A;  4H4Z A;  3UTF A;  3V3N A;  3SFD A;  1ZMD A;  5J7X A;  1EL8 A;  4B1B A;  2X8C A;  1BKW A;  1GRE A;  1MOK A;  1QJD A;  2E48 A;  1PBF A;  2CUL A;  1L0V A;  1KSU A;  4A7A A;  4ADW A;  4YXD A;  5M10 A;  4H4W A;  2WOW A;  2V5Z A;  1COY A;  1LV0 A;  2YVJ A;  4Y4M A;  2EQ7 A;  3C96 A;  3KD9 A;  2ARD A;  2QCU A;  4OPG A;  5L46 A;  1PBE A;  3EF6 A;  3JSK A;  3BNM A;  3GYJ A;  3UOZ A;  1S2Y A;  1TDN A;  4B69 A;  4K8D A;  4BJZ A;  4B65 A;  5KOW A;  1EL9 A;  1PN0 A;  3M12 A;  4YJG A;  2EQ8 A;  3BI2 A;  5CKU A;  3SFE A;  3URH A;  4XWZ A;  2YR6 A;  4YT0 A;  1PBC A;  1NAA A;  4C3X A;  1ZDL A;  2V3B A;  4BV6 A;  2TPR A;  2GVC A;  1IUW A;  1CC6 A;  1NPX A;  4OPT A;  4JQ9 A;  1N4W A;  3DJJ A;  3DK8 A;  4H7U A;  1E1K A;  4XXG A;  5BRT A;  4OPU A;  2V60 A;  5GSN A;  4H4U A;  4BK2 A;  4EIQ A;  3CGB A;  2X8G A;  4BJY A;  1Y0P A;  2B76 A;  3KKJ A;  2JBV A;  4E0V A;  1E6E A;  3EPT A;  3ATQ A;  3AE5 A;  1VQW A;  5HXI A;  3AEB A;  3AE9 A;  1DOD A;  4YTM A;  1MXT A;  5FS8 A;  2WHD A;  5FS7 A;  1M6I A;  3F8R A;  1TDK A; 
#chains in the Genus database with same CATH topology
 4YJF A;  3IF9 A;  1PJ5 A;  1CHU A;  2YVG A;  3AE1 A;  3UKK A;  1FOH A;  2VRM A;  3NK0 X;  3ZYX A;  4IVO B;  1B8S A;  3T14 A;  1SEZ A;  1D4E A;  4OCG A;  4U8O A;  1ZX9 A;  4II3 A;  2IVD A;  4EQR A;  3OZ2 A;  1GRT A;  4BK3 A;  4QFC A;  1ONF A;  2JK6 A;  4NTE A;  3VRA A;  4AOX A;  4D03 A;  1GER A;  1H83 A;  4Z25 A;  1KNP A;  4O5U A;  4OPD A;  3UOY A;  3B3R A;  4H2R A;  1GV4 A;  3AWI A;  2XLS A;  1C0K A;  3QSM A;  1BF3 A;  3GWF A;  3CPJ G;  3H8I A;  4U8L A;  3SM8 A;  1BGJ A;  4YJG B;  2WES A;  5IQ1 A;  3NKS A;  2XFN A;  3NN6 X;  1PJ7 A;  1B5Q A;  3P4Q A;  1D5T A;  4C77 A;  1NHP A;  3KA7 A;  2R45 A;  2WPF A;  4Z2R A;  1ZMC A;  1PXC A;  3AED A;  3NIX A;  3FMW A;  1EBD A;  1OJA A;  3LZW A;  4IV9 A;  2E82 A;  2JB2 A;  2WOI A;  4HA6 A;  3ADA B;  1GES A;  3DJD A;  3M13 A;  4A99 A;  1K0L A;  2GQF A;  1CJ4 A;  1TDF A;  2YWL A;  3HYW A;  1D7L A;  3K7Q X;  3UP4 A;  5KMR A;  2HQM A;  1S3E A;  3ICR A;  3QVR A;  4TM4 A;  4A65 A;  3LAD A;  1GRB A;  4K2X A;  3V3O A;  3P1W A;  1KFY A;  1H6V A;  3C4A A;  1PXA A;  4GRT A;  1L9D A;  2OLO A;  3NYC A;  3S61 A;  3AYJ A;  1D4D A;  3KLJ A;  4G73 A;  4J56 A;  5JCN A;  1DXL A;  2VVM A;  1GRA A;  1DOB A;  3W4I A;  2WQY A;  4NTD A;  3NT6 A;  4ZCC A;  2AR8 A;  1M64 A;  1L9E A;  3ABV A;  4AT0 A;  4A6N A;  3BHK A;  2C4C A;  1F8R A;  2C3C A;  2YQU A;  3NNE A;  4Z24 A;  4YSY A;  5J60 A;  4GDP A;  1FEA A;  2GAH B;  2B7S A;  1E1N A;  1Y56 A;  2CDU A;  5JCL A;  3DK4 A;  3E1T A;  1X31 B;  5HY5 A;  2PYX A;  1P2H A;  1DAO A;  2OAM A;  2BA9 A;  2WP6 A;  2C3D A;  3QSE A;  4H4P A;  3Q6J A;  2WDR A;  4IA5 A;  2R0P A;  1O95 A;  1IJH A;  2C73 A;  2GF3 A;  2UZZ A;  3QVP A;  4EMW A;  3NK1 X;  1OJC A;  4ICY A;  2W0H A;  3HZL A;  2WU2 A;  2E49 A;  5FMH A;  3II4 A;  2Z5X A;  2BK3 A;  4AT2 A;  2A89 A;  4Y4L A;  3FG2 P;  2Q0K A;  2GMJ A;  3GDP A;  1VE9 A;  2F5Z A;  2V3A A;  3ZDN A;  3AE3 A;  3HYV A;  2BS2 A;  2XVF A;  3FBS A;  4B64 A;  1KSS A;  2WET A;  2YLW A;  3K30 A;  2JB3 A;  1PBB A;  5ER0 A;  4J34 A;  3CMM A;  3VRD B;  4K5R A;  2R4J A;  5KMS A;  4H50 A;  4ZCD A;  4ZN0 A;  1E1L A;  1ZP0 A;  1RYI A;  3UCL A;  1KIF A;  3CTY A;  4TLZ A;  1OJ9 A;  1GRF A;  2I0Z A;  5EOW A;  3K7T A;  1FCD A;  3M0O A;  2OAL A;  2YLR A;  4U8I A;  3AXB A;  2BCP A;  1B4V A;  1LQT A;  2YR5 A;  3P4P A;  5FS6 A;  5U63 A;  3RED A;  2GH5 A;  1TYP A;  3UTG A;  2OA1 A;  1PXB A;  1DJQ A;  1VG9 A;  3AE4 A;  3ISH A;  4YSX A;  4Z26 A;  4H2P A;  2NPX A;  1KNR A;  3CIR A;  3CGE A;  3ALJ A;  1DDO A;  4A6N B;  1BZL A;  4B67 A;  3UKP A;  3UOX A;  2DU8 A;  3ZNQ A;  4H4V A;  2BK5 A;  1LPF A;  4UDR A;  4YJD A;  1EL5 A;  1Y56 B;  1TDO A;  2E4A A;  1DOE A;  2FJE A;  5FS9 A;  1RSG A;  3PS9 A;  1ZY8 A;  3ICS A;  1FL2 A;  2BRA A;  5C2T A;  3ALL A;  3NTA A;  4H4T A;  2YLT A;  4PAB A;  2X99 A;  3IWA A;  2WP5 A;  4RG3 A;  1GAL A;  5DBJ A;  3VR8 A;  5IQ4 A;  4UP3 A;  2ZZ0 A;  2BAC A;  3UTE A;  4U8M A;  4JY3 A;  1BWC A;  3SGL A;  3C4N A;  1JRZ A;  1P2E A;  2YVF A;  3PO7 A;  4XWR A;  2GR2 A;  3NN0 X;  2YR4 A;  4J2W A;  1PHH A;  4EQX A;  1JU2 A;  1Z6L A;  3GDN A;  1VRQ B;  3LZX A;  4CCQ A;  1JEH A;  2XVE A;  1IUX A;  4FK1 A;  4REK A;  5IPY A;  3FIM B;  2BS4 A;  2YAU A;  3KPF A;  3ZNO A;  2JB1 A;  4CNJ A;  4OVI A;  2GV8 A;  4H4Y A;  1GXF A;  2O9Z A;  1ZOV A;  4C3Y A;  4UDP A;  2YLS A;  2Y6Q A;  3ALM A;  3ICT A;  4GDE A;  4U2T A;  4X4J A;  1TRB A;  3DJG X;  4UDQ A;  3BHF A;  4D04 A;  2C65 A;  1JOA A;  3QFB A;  2X8H A;  3F8D A;  4EMI A;  3T2Y A;  2BS3 A;  4NTC A;  4OPI A;  3SX6 A;  1F8S A;  2YLZ A;  4A79 A;  1GT8 A;  2VRL A;  1GTE A;  3QJ4 A;  2BYB A;  4II2 A;  3NHO X;  3T0K A;  3F8P A;  4YKF A;  1E1M A;  3UKH A;  2AAQ A;  3EAN A;  1IUU A;  3UP5 A;  1F8W A;  4CY6 A;  1AN9 A;  3L8K A;  1IUT A;  1O5W A;  3T2Z A;  4EM3 A;  2B9X A;  5HHF A;  5JCI A;  2R9Z A;  2QAE A;  2GAG B;  2R46 A;  1K0I A;  3DME A;  4B66 A;  2WU5 A;  1K0J A;  5KMQ A;  2A8X A;  3NTD A;  3UTH A;  3SZC A;  4RG4 A;  3I3L A;  4WX1 A;  4NNJ A;  1D7Y A;  3DA1 A;  4EIP A;  2FBW A;  1N4V A;  2QA1 A;  3QSS A;  4CCR A;  1QLB A;  5C3J A;  3CPH G;  2R0G A;  2QA2 A;  3RNM A;  4N9X A;  1BGN A;  4TLX A;  2WS3 A;  4YJF B;  2VQB A;  2YG7 A;  1E7P A;  3BNU A;  3AEG A;  4GCM A;  3SXI A;  3NLC A;  3OC4 A;  1F3P A;  1OJT A;  1N1P A;  1XDI A;  1O94 A;  1C0I A;  3CNJ A;  3AD9 B;  2YG5 A;  1YQ3 A;  2VOU A;  1TYT A;  1NEN A;  2E1M A;  2XFP A;  2XYO A;  1C0L A;  3AYL A;  2WDQ A;  1QO8 A;  1GEU A;  5KMP A;  3AD7 B;  1NEK A;  5CQF A;  2ACZ A;  3P4R A;  3NH3 X;  1IUV A;  4U8N A;  4J57 A;  3SYI A;  1VG0 A;  3AEC A;  3DGH A;  4HB9 A;  5BUL A;  2J3N A;  1NHS A;  4FK1 C;  1H82 A;  1ZK7 A;  1EVI A;  4H4S A;  1LQU A;  2VVL A;  3GRT A;  3AEE A;  1PJ6 A;  2Z5Y A;  4AP3 A;  4Z44 A;  2XLU A;  2JKC A;  2ZZB A;  2YLX A;  3AEA A;  3GD3 A;  1JNR A;  4B63 A;  5JCK A;  2VVL G;  3H8L A;  3CGC A;  2C64 A;  3T37 A;  3DGZ A;  3HYX A;  4ECH A;  1ZKQ A;  2B9W A;  2BRY A;  3UOV A;  3CPI G;  4M52 A;  4LA1 A;  3R9U A;  5EB5 A;  4NEV A;  1NHQ A;  2DKH A;  4K22 A;  1YQZ A;  1H81 A;  2PHH A;  2E4G A;  2XFO A;  4CBQ A;  1CC4 A;  2H89 A;  4BUR A;  1FEB A;  3CNT A;  3NG7 X;  4CRT A;  4GAV A;  3SZF A;  4MJW A;  3NGC X;  1CJ3 A;  1DJN A;  4X9N A;  1JNZ A;  1KF6 A;  1DOC A;  3GRS A;  2GB0 A;  4KX6 A;  4NWZ A;  1PDH A;  3COX A;  4JNA A;  4G6G A;  2Q7V A;  2WP9 A;  2XLP A;  1H7W A;  5EBK A;  1ELI A;  2BC1 A;  2TMD A;  2WOV A;  3DK9 A;  3L1R A;  1CL0 A;  3RP6 A;  3RP8 A;  3D8X A;  4J33 A;  1CBO A;  1EL7 A;  2FJB A;  1B37 A;  3O0H A;  5KWF A;  1KDG A;  4DSG A;  4YTN A;  3G5R A;  5U25 A;  2GMH A;  2CVJ A;  1CJ2 A;  1CC2 A;  3GSI A;  2XFU A;  4Z2U A;  1S3B A;  4A9W A;  3NK2 X;  3QFA A;  4KPR A;  1XHC A;  2GR0 A;  2GRT A;  3G3E A;  2BK4 A;  4GF7 A;  3I6D A;  4TM0 A;  3UKQ A;  1NDA A;  1GPE A;  4GR1 A;  3LXD A;  2JAE A;  4TM1 A;  3GYX A;  4X9M A;  1REO A;  1JRX A;  3DJE A;  5KRQ A;  2Q6U A;  2H88 A;  4DGK A;  2Y6R A;  3W4J A;  3UKF A;  2V6O A;  5GRT A;  3LB8 A;  5HYM A;  4Z43 A;  4G6H A;  4NZH A;  5JCM A;  3AE8 A;  3AYI A;  4JY2 A;  2R4E A;  3LOV A;  3H4K A;  4C5O A;  2VZ2 A;  2GQW A;  2XLT A;  4IA6 A;  2XCG A;  3B6D A;  1MO9 A;  2FJD A;  3T2K A;  3ZNP A;  2X3N A;  3RP7 A;  2C76 A;  3ZNN A;  2C67 A;  3BI5 A;  3CGD A;  2ZZC A;  3GD4 A;  3GMB A;  1L9C A;  2WBA A;  4LII A;  4EMJ A;  4YJH A;  2ZBW A;  3LJP A;  2BXS A;  4G74 A;  3AE6 A;  2CFY A;  2GR1 A;  4USR A;  3S5W A;  1PS9 A;  3IHM A;  2C72 A;  2BC0 A;  2XFQ A;  4Y4N A;  1NG3 A;  3PVC A;  4H2Q A;  2AQJ A;  2WPE A;  4H4X A;  4NEW A;  4OPL A;  3VQR A;  3CUK A;  1V59 A;  4YSZ A;  4J31 A;  1N4U A;  5U1O A;  3FPZ A;  4C74 A;  2WPC A;  2C66 A;  4O5Q A;  1YY5 A;  2B9Y A;  4P9S A;  5BUK A;  5M0Z A;  1HYU A;  4GUV A;  3AB1 A;  4USQ A;  1YKJ A;  1JRY A;  3WGT A;  1GOS A;  4LU6 A;  2GEW A;  5LV9 A;  2GR3 A;  3DH9 A;  4YKG A;  5KNL A;  1XAN A;  3D1C A;  1GET A;  4CY8 A;  2APG A;  4I58 A;  1LJ1 A;  4U8J A;  2V61 A;  1NG4 A;  4YWO A;  3AD8 B;  5TR3 A;  1GSN A;  4K5S A;  1NHR A;  1H84 A;  3SQP A;  1K4Q A;  5KVI A;  2YG4 A;  4APN A;  4TM3 A;  5KXJ A;  5EB4 A;  2XVI A;  1C0P A;  2A87 A;  1OJD A;  2BXR A;  1E39 A;  3KPK A;  3NYF A;  4CNK A;  1F6M A;  3SZW A;  3GMC A;  2BCG G;  1UKV G;  2FJA A;  2VQ7 A;  3CN8 A;  4YTP A;  2WEU A;  4Z2T A;  1CF3 A;  1GND A;  4DNA A;  4PAA A;  4U8K A;  3GYI A;  4OPC A;  5BVA A;  1LVL A;  4H4R A;  4JN9 A;  2C70 A;  1RP0 A;  1Q1R A;  4U2S A;  1AOG A;  2EQ6 A;  1DNC A;  2E5V A;  3BI4 A;  4K7Z A;  3VRB A;  4YJH B;  2YG6 A;  4JDR A;  2WDV A;  1PBD A;  2NVK X;  1XPQ A;  2X50 A;  3KU9 A;  2RGO A;  3WE0 A;  2B7R A;  3KVE A;  1CJC A;  2YM1 A;  4AOS A;  4EM4 A;  2XDO A;  3EAO A;  3AEF A;  4J36 A;  1H7X A;  1D4C A;  2XLR A;  4FDC B;  3CNS A;  4JNQ A;  4EQS A;  4IVM B;  1VDC A;  4WCT A;  1YQ4 A;  2YG3 A;  2YM2 A;  3ITJ A;  3RHA A;  1ZOY A;  2Q0L A;  3G5S A;  3ATR A;  1GRG A;  4EQW A;  3P4S A;  2C7G A;  4A5L A;  1H86 A;  4I59 A;  3G5Q A;  3CND A;  2RGJ A;  4FX9 A;  1TDE A;  3UKL A;  4G9K A;  1LTX R;  3SZ0 A;  1GTH A;  3GWD A;  3IC9 A;  5KOX A;  1Q9I A;  4DSH A;  2DKI A;  1GRH A;  2BAB A;  3AE2 A;  3IHG A;  2C75 A;  2RAB A;  1IUS A;  4B68 A;  2XVH A;  2IID A;  1S2Q A;  4U8P A;  3V76 A;  4QFD A;  3NYE A;  4RSL A;  4YSH A;  2XVJ A;  2R0C A;  4AP1 A;  2OLN A;  4GAP A;  3Q9T A;  3AE7 A;  1FEC A;  1W4X A;  3NRN A;  3UKA A;  2EQ9 A;  3VR9 A;  3W4K A;  1Q1W A;  3K7M X;  4U2L A;  4BK1 A;  3CNP A;  5KVH A;  2IVE A;  4H2N A;  4H4Q A;  2RGH A;  3P9U A;  4H4Z A;  3UTF A;  3V3N A;  3SFD A;  1ZMD A;  5J7X A;  1EL8 A;  4B1B A;  2X8C A;  1GRE A;  1BKW A;  1MOK A;  1QJD A;  2E48 A;  1PBF A;  2CUL A;  1L0V A;  1KSU A;  4A7A A;  4ADW A;  4YXD A;  5M10 A;  4H4W A;  2WOW A;  2V5Z A;  1COY A;  1LV0 A;  2YVJ A;  4Y4M A;  3C96 A;  2EQ7 A;  3KD9 A;  2ARD A;  2QCU A;  4OPG A;  5L46 A;  1PBE A;  3EF6 A;  3JSK A;  3BNM A;  3GYJ A;  3UOZ A;  1S2Y A;  1TDN A;  4B69 A;  4K8D A;  4BJZ A;  4B65 A;  5KOW A;  1EL9 A;  1PN0 A;  3M12 A;  4YJG A;  2EQ8 A;  3BI2 A;  5CKU A;  3SFE A;  3SY4 A;  4XWZ A;  3URH A;  2YR6 A;  4YT0 A;  1PBC A;  1NAA A;  4C3X A;  1ZDL A;  2V3B A;  4BV6 A;  2TPR A;  2GVC A;  1IUW A;  1CC6 A;  1NPX A;  4OPT A;  3T31 A;  4JQ9 A;  1N4W A;  3DJJ A;  3DK8 A;  4H7U A;  1E1K A;  4XXG A;  5BRT A;  4OPU A;  2V60 A;  4BK2 A;  4H4U A;  5GSN A;  4EIQ A;  3CGB A;  2X8G A;  4BJY A;  1Y0P A;  2B76 A;  3KKJ A;  2JBV A;  4E0V A;  3EPT A;  1E6E A;  3ATQ A;  5HXI A;  1VQW A;  3AE5 A;  3AEB A;  3AE9 A;  1DOD A;  4YTM A;  1MXT A;  5FS8 A;  2WHD A;  5FS7 A;  1M6I A;  3F8R A;  1TDK A; 
#chains in the Genus database with same CATH homology
 4YJF A;  3IF9 A;  1PJ5 A;  1CHU A;  2YVG A;  3AE1 A;  3UKK A;  1FOH A;  2VRM A;  3NK0 X;  3ZYX A;  4IVO B;  1B8S A;  3T14 A;  1SEZ A;  1D4E A;  4OCG A;  4U8O A;  1ZX9 A;  4II3 A;  2IVD A;  4EQR A;  3OZ2 A;  1GRT A;  1ONF A;  4QFC A;  2JK6 A;  4NTE A;  3VRA A;  4AOX A;  4BK3 A;  4D03 A;  1GER A;  1H83 A;  4Z25 A;  1KNP A;  4O5U A;  4OPD A;  3UOY A;  3B3R A;  4H2R A;  1GV4 A;  3AWI A;  2XLS A;  1C0K A;  3QSM A;  1BF3 A;  3GWF A;  3CPJ G;  3H8I A;  4U8L A;  3SM8 A;  1BGJ A;  4YJG B;  2WES A;  5IQ1 A;  3NKS A;  2XFN A;  3NN6 X;  1PJ7 A;  1B5Q A;  3P4Q A;  1D5T A;  4C77 A;  1NHP A;  3KA7 A;  2R45 A;  2WPF A;  4Z2R A;  1ZMC A;  1PXC A;  3AED A;  3NIX A;  3FMW A;  1EBD A;  1OJA A;  3LZW A;  4IV9 A;  2E82 A;  2JB2 A;  2WOI A;  4HA6 A;  3ADA B;  1GES A;  3DJD A;  3M13 A;  4A99 A;  1K0L A;  2GQF A;  1CJ4 A;  1TDF A;  2YWL A;  3HYW A;  1D7L A;  3K7Q X;  3UP4 A;  5KMR A;  2HQM A;  1S3E A;  3ICR A;  3QVR A;  4TM4 A;  4A65 A;  3LAD A;  1GRB A;  4K2X A;  3V3O A;  3P1W A;  1KFY A;  1H6V A;  3C4A A;  1PXA A;  4GRT A;  1L9D A;  2OLO A;  3NYC A;  3S61 A;  3AYJ A;  1D4D A;  3KLJ A;  4G73 A;  4J56 A;  5JCN A;  1DXL A;  2VVM A;  1GRA A;  1DOB A;  3W4I A;  2WQY A;  4NTD A;  3NT6 A;  4ZCC A;  2AR8 A;  1M64 A;  1L9E A;  3ABV A;  4AT0 A;  4A6N A;  3BHK A;  2C4C A;  1F8R A;  2C3C A;  2YQU A;  3NNE A;  4Z24 A;  4YSY A;  5J60 A;  4GDP A;  2GAH B;  1FEA A;  2B7S A;  1E1N A;  1Y56 A;  2CDU A;  5JCL A;  3DK4 A;  3E1T A;  1X31 B;  5HY5 A;  2PYX A;  1P2H A;  1DAO A;  2OAM A;  2BA9 A;  2WP6 A;  2C3D A;  3QSE A;  4H4P A;  3Q6J A;  2WDR A;  4IA5 A;  2R0P A;  1O95 A;  1IJH A;  2C73 A;  2GF3 A;  2UZZ A;  3QVP A;  4EMW A;  3NK1 X;  1OJC A;  4ICY A;  2W0H A;  3HZL A;  2WU2 A;  2E49 A;  5FMH A;  3II4 A;  2Z5X A;  2BK3 A;  4AT2 A;  2A89 A;  4Y4L A;  3FG2 P;  2Q0K A;  2GMJ A;  3GDP A;  1VE9 A;  2F5Z A;  2V3A A;  3ZDN A;  3AE3 A;  3HYV A;  2BS2 A;  2XVF A;  3FBS A;  4B64 A;  1KSS A;  2WET A;  2YLW A;  3K30 A;  2JB3 A;  1PBB A;  5ER0 A;  4J34 A;  3CMM A;  3VRD B;  4K5R A;  2R4J A;  5KMS A;  4H50 A;  4ZCD A;  4ZN0 A;  1E1L A;  1ZP0 A;  1RYI A;  3UCL A;  1KIF A;  3CTY A;  4TLZ A;  1OJ9 A;  1GRF A;  2I0Z A;  5EOW A;  3K7T A;  1FCD A;  3M0O A;  2OAL A;  2YLR A;  4U8I A;  3AXB A;  2BCP A;  1B4V A;  1LQT A;  2YR5 A;  3P4P A;  5FS6 A;  5U63 A;  3RED A;  2GH5 A;  1TYP A;  3UTG A;  2OA1 A;  1PXB A;  1DJQ A;  1VG9 A;  3AE4 A;  3ISH A;  4YSX A;  4Z26 A;  4H2P A;  2NPX A;  1KNR A;  3CIR A;  3CGE A;  3ALJ A;  1DDO A;  4A6N B;  1BZL A;  4B67 A;  3UKP A;  3UOX A;  2DU8 A;  3ZNQ A;  4H4V A;  2BK5 A;  1LPF A;  4UDR A;  4YJD A;  1EL5 A;  1Y56 B;  1TDO A;  2E4A A;  1DOE A;  2FJE A;  5FS9 A;  1RSG A;  3PS9 A;  1ZY8 A;  3ICS A;  1FL2 A;  2BRA A;  5C2T A;  3ALL A;  3NTA A;  4H4T A;  2YLT A;  4PAB A;  2X99 A;  3IWA A;  2WP5 A;  4RG3 A;  1GAL A;  5DBJ A;  3VR8 A;  5IQ4 A;  4UP3 A;  2ZZ0 A;  2BAC A;  3UTE A;  4U8M A;  4JY3 A;  1BWC A;  3SGL A;  3C4N A;  1P2E A;  1JRZ A;  2YVF A;  3PO7 A;  4XWR A;  2GR2 A;  3NN0 X;  2YR4 A;  4J2W A;  1PHH A;  4EQX A;  1JU2 A;  1Z6L A;  3GDN A;  1VRQ B;  3LZX A;  4CCQ A;  1JEH A;  2XVE A;  1IUX A;  4FK1 A;  4REK A;  5IPY A;  3FIM B;  2BS4 A;  2YAU A;  3KPF A;  3ZNO A;  2JB1 A;  4CNJ A;  4OVI A;  2GV8 A;  4H4Y A;  1GXF A;  2O9Z A;  1ZOV A;  4C3Y A;  4UDP A;  2YLS A;  2Y6Q A;  3ALM A;  3ICT A;  4GDE A;  4U2T A;  4X4J A;  1TRB A;  3DJG X;  4UDQ A;  3BHF A;  4D04 A;  2C65 A;  1JOA A;  3QFB A;  2X8H A;  3F8D A;  4EMI A;  3T2Y A;  2BS3 A;  4NTC A;  4OPI A;  3SX6 A;  1F8S A;  2YLZ A;  4A79 A;  1GT8 A;  2VRL A;  1GTE A;  3QJ4 A;  2BYB A;  4II2 A;  3NHO X;  3T0K A;  3F8P A;  4YKF A;  1E1M A;  3UKH A;  2AAQ A;  3EAN A;  1IUU A;  3UP5 A;  1F8W A;  4CY6 A;  1AN9 A;  3L8K A;  1IUT A;  1O5W A;  3T2Z A;  4EM3 A;  2B9X A;  5HHF A;  5JCI A;  2R9Z A;  2QAE A;  2GAG B;  2R46 A;  1K0I A;  3DME A;  4B66 A;  2WU5 A;  1K0J A;  5KMQ A;  2A8X A;  3NTD A;  3UTH A;  3SZC A;  4RG4 A;  3I3L A;  4WX1 A;  4NNJ A;  1D7Y A;  3DA1 A;  2FBW A;  4EIP A;  1N4V A;  2QA1 A;  3QSS A;  4CCR A;  1QLB A;  5C3J A;  3CPH G;  2R0G A;  2QA2 A;  3RNM A;  4N9X A;  1BGN A;  4TLX A;  2WS3 A;  4YJF B;  2VQB A;  2YG7 A;  1E7P A;  3BNU A;  3AEG A;  4GCM A;  3SXI A;  3NLC A;  3OC4 A;  1F3P A;  1OJT A;  1N1P A;  1XDI A;  1O94 A;  1C0I A;  3CNJ A;  3AD9 B;  2YG5 A;  1YQ3 A;  2E1M A;  1TYT A;  1NEN A;  2VOU A;  2XFP A;  2XYO A;  1C0L A;  3AYL A;  2WDQ A;  1QO8 A;  1GEU A;  5KMP A;  3AD7 B;  1NEK A;  5CQF A;  2ACZ A;  3P4R A;  3NH3 X;  1IUV A;  4U8N A;  4J57 A;  3SYI A;  1VG0 A;  3AEC A;  3DGH A;  4HB9 A;  5BUL A;  2J3N A;  1NHS A;  4FK1 C;  1H82 A;  1ZK7 A;  1EVI A;  4H4S A;  1LQU A;  2VVL A;  3GRT A;  3AEE A;  1PJ6 A;  2Z5Y A;  4AP3 A;  4Z44 A;  2XLU A;  2JKC A;  2ZZB A;  2YLX A;  3AEA A;  3GD3 A;  1JNR A;  4B63 A;  5JCK A;  2VVL G;  3H8L A;  3CGC A;  2C64 A;  3T37 A;  3DGZ A;  3HYX A;  4ECH A;  1ZKQ A;  2B9W A;  2BRY A;  3UOV A;  3CPI G;  4M52 A;  4LA1 A;  3R9U A;  5EB5 A;  4NEV A;  1NHQ A;  2DKH A;  4K22 A;  1YQZ A;  1H81 A;  2PHH A;  2E4G A;  2XFO A;  4CBQ A;  1CC4 A;  2H89 A;  4BUR A;  1FEB A;  3CNT A;  3NG7 X;  4CRT A;  4GAV A;  3SZF A;  4MJW A;  3NGC X;  1CJ3 A;  1DJN A;  4X9N A;  1JNZ A;  1KF6 A;  1DOC A;  3GRS A;  2GB0 A;  4KX6 A;  4NWZ A;  1PDH A;  3COX A;  4JNA A;  4G6G A;  2Q7V A;  2WP9 A;  2XLP A;  1H7W A;  5EBK A;  1ELI A;  2BC1 A;  2TMD A;  2WOV A;  3DK9 A;  3L1R A;  1CL0 A;  3RP6 A;  3RP8 A;  3D8X A;  4J33 A;  1CBO A;  1EL7 A;  2FJB A;  1B37 A;  3O0H A;  5KWF A;  1KDG A;  4DSG A;  4YTN A;  3G5R A;  5U25 A;  2GMH A;  2CVJ A;  1CJ2 A;  1CC2 A;  3GSI A;  2XFU A;  4Z2U A;  1S3B A;  4A9W A;  3NK2 X;  3QFA A;  4KPR A;  1XHC A;  2GR0 A;  2GRT A;  3G3E A;  2BK4 A;  3I6D A;  4GF7 A;  4TM0 A;  3UKQ A;  1NDA A;  1GPE A;  4GR1 A;  3LXD A;  2JAE A;  4TM1 A;  3GYX A;  4X9M A;  1REO A;  1JRX A;  3DJE A;  5KRQ A;  2Q6U A;  2H88 A;  4DGK A;  2Y6R A;  3W4J A;  3UKF A;  2V6O A;  5GRT A;  3LB8 A;  4Z43 A;  5HYM A;  4G6H A;  4NZH A;  5JCM A;  3AE8 A;  3AYI A;  4JY2 A;  2R4E A;  3LOV A;  3H4K A;  4C5O A;  2VZ2 A;  2GQW A;  2XLT A;  2XCG A;  3B6D A;  4IA6 A;  1MO9 A;  2FJD A;  3T2K A;  3ZNP A;  2X3N A;  2C76 A;  2C67 A;  3ZNN A;  3BI5 A;  3CGD A;  3RP7 A;  2ZZC A;  3GD4 A;  3GMB A;  1L9C A;  2WBA A;  4LII A;  4EMJ A;  4YJH A;  2ZBW A;  3LJP A;  2BXS A;  4G74 A;  3AE6 A;  2CFY A;  2GR1 A;  4USR A;  3S5W A;  1PS9 A;  3IHM A;  2C72 A;  2BC0 A;  2XFQ A;  4Y4N A;  1NG3 A;  3PVC A;  2AQJ A;  2WPE A;  4H2Q A;  4H4X A;  4NEW A;  4OPL A;  3VQR A;  3CUK A;  1V59 A;  4YSZ A;  4J31 A;  1N4U A;  5U1O A;  3FPZ A;  4C74 A;  2WPC A;  2C66 A;  4O5Q A;  1YY5 A;  2B9Y A;  4P9S A;  5BUK A;  5M0Z A;  1HYU A;  4GUV A;  3AB1 A;  4USQ A;  1YKJ A;  1JRY A;  3WGT A;  1GOS A;  4LU6 A;  2GEW A;  5LV9 A;  2GR3 A;  3DH9 A;  4YKG A;  5KNL A;  1XAN A;  3D1C A;  1GET A;  4CY8 A;  2APG A;  4I58 A;  1LJ1 A;  4U8J A;  2V61 A;  1NG4 A;  4YWO A;  3AD8 B;  5TR3 A;  1GSN A;  4K5S A;  1NHR A;  1H84 A;  3SQP A;  1K4Q A;  5KVI A;  2YG4 A;  4APN A;  4TM3 A;  5KXJ A;  5EB4 A;  2XVI A;  1C0P A;  2A87 A;  1OJD A;  2BXR A;  1E39 A;  3KPK A;  3NYF A;  4CNK A;  1F6M A;  3SZW A;  2BCG G;  2FJA A;  1UKV G;  2VQ7 A;  3CN8 A;  3GMC A;  4YTP A;  2WEU A;  4Z2T A;  1CF3 A;  1GND A;  4DNA A;  4PAA A;  4U8K A;  3GYI A;  4OPC A;  5BVA A;  1LVL A;  4H4R A;  4JN9 A;  2C70 A;  1RP0 A;  1Q1R A;  4U2S A;  1AOG A;  2EQ6 A;  1DNC A;  2E5V A;  3BI4 A;  4K7Z A;  3VRB A;  4YJH B;  2YG6 A;  4JDR A;  2WDV A;  1PBD A;  2NVK X;  1XPQ A;  2X50 A;  3KU9 A;  2RGO A;  3WE0 A;  2B7R A;  3KVE A;  1CJC A;  2YM1 A;  4AOS A;  4EM4 A;  2XDO A;  3EAO A;  3AEF A;  4J36 A;  1H7X A;  1D4C A;  2XLR A;  4FDC B;  3CNS A;  4JNQ A;  4EQS A;  4IVM B;  1VDC A;  4WCT A;  1YQ4 A;  2YG3 A;  2YM2 A;  3ITJ A;  3RHA A;  1ZOY A;  2Q0L A;  3G5S A;  3ATR A;  1GRG A;  4EQW A;  3P4S A;  2C7G A;  4A5L A;  1H86 A;  4I59 A;  3G5Q A;  3CND A;  2RGJ A;  4FX9 A;  1TDE A;  3UKL A;  4G9K A;  1LTX R;  3SZ0 A;  1GTH A;  3GWD A;  3IC9 A;  5KOX A;  1Q9I A;  4DSH A;  2DKI A;  1GRH A;  2BAB A;  3AE2 A;  2C75 A;  3IHG A;  2RAB A;  1IUS A;  4B68 A;  2XVH A;  2IID A;  1S2Q A;  4U8P A;  3V76 A;  4QFD A;  3NYE A;  4RSL A;  4YSH A;  2XVJ A;  2R0C A;  4AP1 A;  2OLN A;  4GAP A;  3Q9T A;  3AE7 A;  1FEC A;  1W4X A;  3NRN A;  3UKA A;  2EQ9 A;  3VR9 A;  3W4K A;  1Q1W A;  3K7M X;  4U2L A;  4BK1 A;  3CNP A;  5KVH A;  2IVE A;  4H2N A;  4H4Q A;  2RGH A;  3P9U A;  4H4Z A;  3UTF A;  3V3N A;  3SFD A;  1ZMD A;  5J7X A;  1EL8 A;  4B1B A;  2X8C A;  1BKW A;  1GRE A;  1MOK A;  1QJD A;  2E48 A;  1PBF A;  2CUL A;  1L0V A;  1KSU A;  4A7A A;  4ADW A;  4YXD A;  5M10 A;  4H4W A;  2WOW A;  2V5Z A;  1COY A;  1LV0 A;  2YVJ A;  4Y4M A;  2EQ7 A;  3C96 A;  3KD9 A;  2ARD A;  2QCU A;  4OPG A;  5L46 A;  1PBE A;  3EF6 A;  3JSK A;  3BNM A;  3GYJ A;  3UOZ A;  1S2Y A;  1TDN A;  4B69 A;  4K8D A;  4BJZ A;  4B65 A;  5KOW A;  1EL9 A;  1PN0 A;  3M12 A;  4YJG A;  2EQ8 A;  3BI2 A;  5CKU A;  3SFE A;  3SY4 A;  4XWZ A;  3URH A;  2YR6 A;  4YT0 A;  1PBC A;  1NAA A;  4C3X A;  1ZDL A;  2V3B A;  4BV6 A;  2TPR A;  2GVC A;  1IUW A;  1CC6 A;  1NPX A;  4OPT A;  3T31 A;  4JQ9 A;  1N4W A;  3DJJ A;  3DK8 A;  4H7U A;  1E1K A;  4XXG A;  5BRT A;  4OPU A;  2V60 A;  5GSN A;  4H4U A;  4BK2 A;  4EIQ A;  3CGB A;  2X8G A;  4BJY A;  1Y0P A;  2B76 A;  3KKJ A;  2JBV A;  4E0V A;  1E6E A;  3EPT A;  3ATQ A;  3AE5 A;  1VQW A;  5HXI A;  3AEB A;  3AE9 A;  1DOD A;  4YTM A;  1MXT A;  5FS8 A;  2WHD A;  5FS7 A;  1M6I A;  3F8R A;  1TDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...