3NYFA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-histidine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 122
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyfA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyfA01
4H2RA 2E4AA 3F8PA 1GNDA 4HB9A 3BHFA 4H4VA 5KRQA 1PXAA 1DJQA 4PAAA 1GSNA 4H7UA 2E4GA 4PABA 3KLJA 3SGLA 1C0KA 2C66A 3LB8A 3CUKA 1CF3A 3NN6X 1PBBA 2IVEA 3AE5A 1F8RA 2BK3A 2EQ8A 3AECA 4XWZA 3UP4A 1H7WA 2B76A 2IIDA 3LXDA 4U2LA 1B5QA 4OPTA 2BC1A 4XXGA 4BK3A 2E48A 4ICYA 4U8NA 3W4JA 3DK9A 1Y0PA 2AAQA 2C73A 3QFAA 2VZ2A 3P4SA 4TM3A 2XLTA 2GVCA 4JY2A 1LVLA 2Q0KA 3CGBA 3P9UA 4JY3A 1REOA 1E39A 4UDPA 1Q1WA 3CN8A 1GT8A 2BS4A 2E5VA 2YVJA 2NVKX 4X4JA 1PJ5A 2GEWA 2OA1A 1PXCA 2AQJA 3NH3X 5GSNA 4YJGB 1GALA 2UZZA 3C96A 3GMCA 1GRAA 2FJAA 2YQUA 1K4QA 3CNDA 4AOSA 1OJDA 2JB2A 5HXIA 4YWOA 1GRHA 1TDKA 4B69A 4DGKA 2TMDA 4H2PA 4I58A 3IWAA 4EIPA 2CDUA 1VQWA 3D8XA 3QSEA 3E1TA 3AEGA 3NNEA 4ADWA 4H4UA 2WEUA 1H86A 3C4AA 3CNTA 2YG6A 2V60A 4OPUA 4OPLA 4U8IA 3B3RA 3PO7A 4A6NB 2B9XA 4C5OA 1EVIA 4BK2A 2WPFA 1K0IA 1NG3A 2EQ6A 3UTFA 2E49A 4QFDA 1VG9A 2ZBWA 3ADAB 3FBSA 4CNKA 1JEHA 3LZWA 4CY8A 1YQ4A 3FG2P 3QSMA 4H4XA 4OPIA 4EMIA 1E1MA 3NYFA 1JRXA 2XDOA 3KVEA 1NHPA 4A9WA 1H82A 1GXFA 1DNCA 2FJBA 1QO8A 1IUXA 3NRNA 3GD4A 3LOVA 3ICTA 4E0VA 4UDRA 2YG4A 4FX9A 3DH9A 3CPJG 4TLZA 1LTXR 4U8MA 3ALLA 4OPCA 3UKLA 4EM4A 2DU8A 4YTPA 4C3YA 2A8XA 4RSLA 3VQRA 3EANA 4Y4MA 5IPYA 2XFOA 4YSYA 3NYEA 2BCPA 4TM4A 4Z2TA 3AE7A 4WCTA 1ZY8A 1ELIA 4NTDA 2XVEA 3CNJA 3H8IA 2WP9A 1PBDA 4YTMA 1O94A 4EQRA 4JNAA 1CJ4A 2BXRA 3NK2X 1JNRA 4B64A 1ZMDA 3M13A 4GDEA 1PDHA 4TLXA 2YR6A 4J36A 4Z24A 3IHGA 2YVGA 3DJDA 3GYJA 3NGCX 2W0HA 2BK5A 2RABA 3ALJA 1LQUA 4OPGA 3D1CA 1FOHA 1VRQB 3BNUA 4LA1A 4H2QA 2JB1A 3ATRA 5ER0A 5KWFA 4H4WA 2OALA 2YM2A 3NIXA 4Z44A 4YSXA 2B9WA 1LQTA 4TM0A 2WQYA 4YT0A 4U8KA 3O0HA 2Q6UA 1OJCA 1XDIA 3EPTA 4A7AA 4Z26A 2H89A 1E1KA 4UDQA 2XLSA 4U8PA 4J57A 4K22A 3R9UA 2J3NA 3DK4A 1KDGA 3SFDA 4A79A 3NTAA 3OZ2A 1B4VA 5FMHA 4DNAA 1F8SA 3UOXA 3ATQA 4AP1A 1H7XA 3DA1A 1UKVG 2WETA 3I3LA 4AP3A 5HY5A 1ZK7A 1OJAA 1EL9A 1JRZA 1Y56A 3M12A 3NN0X 5JCKA 3I6DA 3DMEA 4Z2RA 3GSIA 2NPXA 1CC6A 1ZOYA 3V3NA 3DJGX 3H8LA 5JCLA 1TDEA 2GRTA 3K30A 1S3BA 3NK0X 3WGTA 2APGA 3ICSA 4B65A 1GEUA 4D03A 4JQ9A 1OJTA 1V59A 1JNZA 1DOBA 5FS8A 5BRTA 1N1PA 1AOGA 3SQPA 1BZLA 2R4JA 1DXLA 3B6DA 4AT0A 3SM8A 4AOXA 1GPEA 3CPIG 3BI4A 2C65A 1E1LA 1K0JA 5C3JA 4J31A 4U8LA 3M0OA 1GREA 3K7QX 1ZMCA 2GR2A 1JU2A 3KA7A 1JOAA 1CC4A 3IHMA 1C0LA 1C0PA 3GRTA 1O5WA 3FMWA 4YSHA 1DAOA 3AD8B 4GCMA 2Y6QA 4WX1A 4ECHA 2B9YA 3RNMA 4JNQA 1H83A 2AR8A 4A99A 2FBWA 2YLSA 5KVHA 3KD9A 4NTCA 1BWCA 1PBFA 4GDPA 1F8WA 4EMJA 2RGOA 4X9NA 4CY6A 2BK4A 1F3PA 3GDNA 3QJ4A 1XANA 1BKWA 2R45A 2Q0LA 4RG3A 4XWRA 4C74A 4APNA 2GAHB 1B8SA 5C2TA 4CNJA 1PJ7A 2GQFA 4H4SA 2QAEA 2GR1A 2ZZ0A 4OVIA 1FEAA 2V5ZA 2XYOA 4CCQA 4GUVA 1NG4A 1YKJA 3UKKA 4YJFA 5FS6A 3LZXA 1L9DA 1IJHA 1GETA 2JAEA 1D4EA 5JCIA 3AYLA 5GRTA 1P2HA 2XFPA 2CULA 1F6MA 1Q1RA 2HQMA 3NHOX 4H4QA 2Y6RA 1GRBA 1TDOA 4U8JA 2XVIA 4GF7A 2DKIA 2C67A 3QVRA 2VVMA 1DOCA 1W4XA 1Y56B 4FK1A 2ARDA 3KU9A 1D4CA 1FL2A 2WOWA 3Q9TA 2IVDA 4NEVA 1FECA 2WP6A 5HYMA 1IUUA 1HYUA 1C0IA 5IQ4A 2WHDA 1D5TA 1NHSA 2YLRA 3L8KA 3UOYA 4MJWA 4P9SA 2WDVA 1NPXA 4CBQA 4YXDA 4IVOB 1Q9IA 4FDCB 1IUWA 2JK6A 4M52A 3BNMA 2RGHA 2GB0A 4YJHA 3FIMB 3VR9A 1D4DA 3T37A 1KF6A 1GERA 1RYIA 1NDAA 1CJ2A 2V61A 2YG5A 3CGCA 1N4WA 1NHRA 4U2SA 4ZCCA 4J34A 5IQ1A 3AD7B 2H88A 3ISHA 3COXA 1AN9A 2WDRA 3CGEA 3DGZA 3G5QA 1GRFA 1M6IA 2XLPA 2GR0A 2WPEA 3P4RA 2JB3A 4EQSA 5JCMA 1Z6LA 5JCNA 1EL5A 4OPDA 5EB5A 1LPFA 2XVFA 4O5QA 1YQ3A 4Z2UA 3GMBA 2B7RA 3H4KA 4H2NA 2R0CA 3CNPA 2CFYA 2X8HA 4KX6A 4BJZA 3EAOA 4ZN0A 4BJYA 5KVIA 3K7TA 2YLZA 3AE3A 4Y4NA 2TPRA 2BACA 4DSGA 1E1NA 2OLNA 3LADA 1TDFA 2GH5A 2WU5A 1VG0A 3K7MX 1LV0A 1ONFA 2BS3A 3VRBA 3IF9A 4N9XA 2VQ7A 3OC4A 3GRSA 3ZNNA 3F8DA 1GRGA 1FEBA 2C72A 2C3CA 2B7SA 5KOWA 1S3EA 2JKCA 1VE9A 1QLBA 1ZX9A 5U1OA 3UKQA 1XHCA 3HZLA 2FJDA 3P1WA 2BS2A 2V3BA 5EOWA 2GQWA 1DOEA 4U2TA 2A87A 3AEDA 2X8GA 3NYCA 4YJGA 5U25A 3UTHA 2R46A 1DDOA 3PVCA 1ZP0A 2Z5YA 3UKPA 2I0ZA 2YWLA 3UOVA 1D7LA 3ZNPA 3ALMA 2YR5A 3FPZA 4BV6A 3AE8A 1PBCA 1COYA 2F5ZA 1RP0A 3ICRA 1TYTA 5BUKA 5KOXA 4TM1A 4X9MA 2VOUA 4A65A 2O9ZA 3AEFA 5L46A 3EF6A 4IA6A 1K0LA 1IUVA 1EBDA 2QA2A 5EB4A 3AWIA 3C4NA 1KSSA 3AEEA 2EQ9A 2BXSA 3G5RA 5FS7A 4A5LA 2WP5A 3S61A 3AE9A 2BC0A 3AE6A 2OLOA 4LIIA 4A6NA 1L9EA 2YG7A 3GWDA 3RP8A 4B67A 4EQWA 1NAAA 1KFYA 3DJEA 3ZNOA 1H84A 1S2QA 3AYJA 1E6EA 1OJ9A 1MXTA 5CKUA 3AE2A 1NENA 3AD9B 2WU2A 3RP7A 1ZOVA 3QVPA 5J60A 5FS9A 2GMJA 2YM1A 4EQXA 1VDCA 4K5RA 2Z5XA 4H50A 1YQZA 2C64A 3P4PA 3NTDA 1L9CA 4NZHA 3DK8A 1MOKA 4IVMB 3S5WA 1PJ6A 3V3OA 4NEWA 4EM3A 1QJDA 2C70A 2YG3A 2R0PA 3GDPA 3G3EA 1NEKA 4YTNA 2PHHA 3VRAA 3W4KA 4GR1A 2YLXA 1O95A 3NT6A 4C77A 2C75A 4Z25A 1N4VA 3QSSA 4IV9A 2Q7VA 4H4PA 4KPRA 4K2XA 2X99A 3ABVA 3P4QA 1BGNA 3G5SA 3REDA 3ZYXA 1MO9A 1CJ3A 1E7PA 2WPCA 2YR4A 4OCGA 3SFEA 3GD3A 4LU6A 2V6OA 1M64A 4YKGA 4K8DA 1CL0A 2DKHA 1KIFA 3CIRA 4AT2A 3BI5A 2GV8A 3AXBA 1H6VA 3ZDNA 3CPHG 3W4IA 2X50A 1SEZA 1N4UA 3UKAA 2XFNA 2QA1A 3BHKA 4Z43A 4UP3A 2BYBA 2YLWA 3DJJA 3UKFA 1JRYA 3BI2A 1BGJA 1ZKQA 5KXJA 2R9ZA 3ITJA 1PN0A 3RP6A 4YKFA 2OAMA 4YJDA 2X8CA 4Y4LA 1S2YA 2EQ7A 2YVFA 1PXBA 1ZDLA 5J7XA 3RHAA 4FK1C 4D04A 1EL7A 3NLCA 5TR3A 1GESA 4RG4A 2XFUA 2XVJA 2BA9A 4J56A 4BK1A 1IUTA 2XLUA 4USRA 5LV9A 2R4EA 3GWFA 1PHHA 1GRTA 2PYXA 2VQBA 2ZZCA 3CNSA 3CTYA 4O5UA 1RSGA 2GR3A 4K5SA 3WE0A 3ZNQA 2GF3A 4JDRA 2CVJA 4QFCA 2XFQA 3UP5A 2WOIA 3PS9A 1XPQA 4B68A 4GRTA 4BURA 4JN9A 2C7GA 2GMHA 3KKJA 1CJCA 2WS3A 4EMWA 5BVAA 1D7YA 5HHFA 4H4TA 2FJEA 4J2WA 1GV4A 3KPFA 4J33A 4ZCDA 2JBVA 1H81A 2VVLG 2E82A 4REKA 3UTGA 4C3XA 1P2EA 3AEAA 4DSHA 1GOSA 1KSUA 2XLRA 3CGDA 4CCRA 5M10A 4YJFB 4H4YA 2WDQA 2GAGB 4USQA 3VR8A 2VVLA 2C76A 1PBEA 1X31B 2XCGA 1KNPA 1FCDA 2YLTA 1PS9A 3IC9A 1EL8A 3URHA 5BULA 2A89A 1GTEA 4CRTA 2BABA 1GTHA 2RGJA 4I59A 5CQFA 1CHUA 5DBJA 3F8RA 1DJNA 2V3AA 3II4A 1IUSA 1TRBA 1TYPA 3V76A 2WOVA 2X3NA 1L0VA 1CBOA 2VRMA 3GYIA 1NHQA 3NKSA 4B66A 2VRLA 4H4RA 4YSZA 3UCLA 1TDNA 1LJ1A 4K7ZA 4HA6A 3AYIA 2YAUA 3AB1A 2ZZBA 2E1MA 5EBKA 3UKHA 1BF3A 1KNRA 4EIQA 4NTEA 3AE4A 3AE1A 4YJHB 2ACZA 2WESA 2XVHA 3UTEA 5U63A 4B63A 3NK1X 1CC2A 1B37A 3Q6JA 2C3DA 4U8OA 3JSKA 3UOZA 3AEBA 4IA5A 5M0ZA 3L1RA 3VRDB 3QFBA 2R0GA 3DGHA 4B1BA 2QCUA 1DODA 2BCGG 4H4ZA 1YY5A 3NG7X 3LJPA 2WBAA
chains in the Genus database with same CATH superfamily
4H2RA 2E4AA 3F8PA 1GNDA 4HB9A 3SY4A 3BHFA 4H4VA 5KRQA 1PXAA 1DJQA 4PAAA 1GSNA 4H7UA 2E4GA 4PABA 3KLJA 3SGLA 1C0KA 2C4CA 2C66A 3LB8A 3CUKA 1CF3A 3NN6X 5KMQA 1PBBA 2IVEA 3AE5A 1F8RA 2BK3A 2EQ8A 3AECA 4XWZA 3GYXA 3UP4A 1H7WA 2B76A 2IIDA 3LXDA 4U2LA 1B5QA 4OPTA 2BC1A 4XXGA 4BK3A 2E48A 4ICYA 4U8NA 3W4JA 3DK9A 1Y0PA 2AAQA 2C73A 3QFAA 2VZ2A 3P4SA 4TM3A 2XLTA 2GVCA 4JY2A 1LVLA 2Q0KA 4JY3A 3CGBA 3P9UA 1REOA 1E39A 4UDPA 1Q1WA 3CN8A 1GT8A 2BS4A 2E5VA 2YVJA 2NVKX 4X4JA 1PJ5A 3T0KA 2GEWA 2OA1A 1PXCA 2AQJA 3NH3X 5GSNA 1GALA 4YJGB 3C96A 2UZZA 3GMCA 1GRAA 2FJAA 2YQUA 1K4QA 3CNDA 4AOSA 5HXIA 1OJDA 2JB2A 4YWOA 1GRHA 1TDKA 4B69A 4DGKA 2TMDA 4H2PA 4EIPA 3IWAA 4G6GA 2CDUA 1VQWA 3D8XA 4I58A 3QSEA 3E1TA 3AEGA 3NNEA 4ADWA 4GAPA 4H4UA 2WEUA 3C4AA 1H86A 3CNTA 2YG6A 2V60A 4OPUA 4OPLA 4U8IA 3B3RA 3PO7A 4A6NB 2B9XA 4C5OA 1EVIA 4BK2A 2WPFA 1K0IA 1NG3A 2EQ6A 3UTFA 2E49A 4QFDA 1VG9A 2ZBWA 3ADAB 3FBSA 4CNKA 1JEHA 3LZWA 4CY8A 1YQ4A 3FG2P 3QSMA 4H4XA 4OPIA 3SZ0A 3T2ZA 4EMIA 5KNLA 1JRXA 1E1MA 3NYFA 2XDOA 3KVEA 1NHPA 4A9WA 1H82A 1GXFA 1DNCA 2BRYA 2FJBA 1QO8A 1IUXA 3NRNA 3GD4A 3LOVA 3ICTA 4E0VA 4UDRA 2YG4A 4FX9A 3DH9A 3CPJG 4TLZA 1LTXR 4U8MA 3ALLA 4OPCA 3UKLA 4EM4A 2DU8A 4YTPA 4C3YA 2A8XA 4RSLA 3VQRA 3EANA 4Y4MA 5IPYA 2XFOA 4YSYA 3NYEA 2BCPA 4TM4A 4Z2TA 3AE7A 4WCTA 1ZY8A 1ELIA 4NTDA 2XVEA 3CNJA 3H8IA 2WP9A 1PBDA 4YTMA 1O94A 4EQRA 4JNAA 1CJ4A 2BXRA 3NK2X 1JNRA 4B64A 1ZMDA 3M13A 4GDEA 1PDHA 4TLXA 2YR6A 4J36A 4Z24A 3IHGA 2YVGA 3DJDA 3GYJA 3NGCX 2W0HA 2BK5A 2RABA 3ALJA 1LQUA 4OPGA 3D1CA 1FOHA 1VRQB 3BNUA 4LA1A 4H2QA 2JB1A 3ATRA 5ER0A 5KWFA 4H4WA 2OALA 3T2KA 2YM2A 3NIXA 4Z44A 4YSXA 2B9WA 4G73A 1LQTA 4TM0A 2WQYA 4YT0A 4U8KA 3O0HA 2Q6UA 1OJCA 1XDIA 3EPTA 4A7AA 4Z26A 2H89A 1E1KA 4UDQA 2XLSA 4U8PA 4K22A 4J57A 3R9UA 2J3NA 3DK4A 1KDGA 3SFDA 4A79A 3NTAA 3OZ2A 1B4VA 5FMHA 4DNAA 1F8SA 3UOXA 3ATQA 4AP1A 1H7XA 3DA1A 1UKVG 2WETA 3I3LA 4AP3A 5HY5A 1ZK7A 1OJAA 1EL9A 1JRZA 1Y56A 3M12A 3NN0X 5JCKA 3I6DA 3DMEA 4Z2RA 3GSIA 2NPXA 1CC6A 1ZOYA 3V3NA 3DJGX 3H8LA 5JCLA 1TDEA 2GRTA 3K30A 1S3BA 3NK0X 3WGTA 2APGA 3ICSA 4B65A 1GEUA 4D03A 4NNJA 4JQ9A 3SZCA 1OJTA 1V59A 1JNZA 1DOBA 5FS8A 5BRTA 1N1PA 1AOGA 3SQPA 1BZLA 2R4JA 1DXLA 3B6DA 4AT0A 3SM8A 4AOXA 1GPEA 3CPIG 3BI4A 2C65A 1E1LA 1K0JA 5C3JA 4J31A 4U8LA 3M0OA 1GREA 3K7QX 1ZMCA 2GR2A 1JU2A 3KA7A 3IHMA 1CC4A 1JOAA 1C0LA 1C0PA 3GRTA 1O5WA 3FMWA 4YSHA 1DAOA 3AD8B 4GCMA 2Y6QA 4WX1A 4ECHA 2B9YA 3RNMA 4JNQA 1H83A 2AR8A 4A99A 2FBWA 2YLSA 5KVHA 3KD9A 4NTCA 1BWCA 1PBFA 4GDPA 1F8WA 4EMJA 2RGOA 4X9NA 4CY6A 2BK4A 1F3PA 3GDNA 3QJ4A 1XANA 1BKWA 2R45A 2Q0LA 4RG3A 4XWRA 3SXIA 4APNA 4C74A 2GAHB 1B8SA 5C2TA 4CNJA 4G74A 1PJ7A 2GQFA 4H4SA 2QAEA 2GR1A 2ZZ0A 4OVIA 1FEAA 2V5ZA 2XYOA 4CCQA 4GUVA 1NG4A 1YKJA 3UKKA 4YJFA 5FS6A 3LZXA 1L9DA 1IJHA 1GETA 2JAEA 1D4EA 5JCIA 3AYLA 5GRTA 1P2HA 2XFPA 2CULA 1F6MA 1Q1RA 2HQMA 3NHOX 4H4QA 4II2A 2Y6RA 1GRBA 1TDOA 4U8JA 4GF7A 2XVIA 2DKIA 2C67A 3QVRA 2VVMA 1DOCA 1W4XA 1Y56B 4FK1A 2ARDA 3KU9A 1D4CA 1FL2A 2WOWA 3Q9TA 3KPKA 2IVDA 4NEVA 1FECA 2WP6A 5HYMA 1IUUA 1HYUA 1C0IA 5IQ4A 2WHDA 1D5TA 1NHSA 2YLRA 3L8KA 3UOYA 4MJWA 4NWZA 4P9SA 2WDVA 1NPXA 4CBQA 4YXDA 4IVOB 1Q9IA 4FDCB 1IUWA 2JK6A 4M52A 3BNMA 2RGHA 2GB0A 4YJHA 3FIMB 3VR9A 1D4DA 3T37A 1KF6A 1GERA 1RYIA 3SX6A 1NDAA 1CJ2A 2V61A 2YG5A 3CGCA 1N4WA 1NHRA 4GAVA 4U2SA 4J34A 4ZCCA 5IQ1A 3AD7B 2H88A 3ISHA 3COXA 1AN9A 4II3A 2WDRA 3CGEA 3DGZA 3G5QA 1GRFA 1M6IA 2XLPA 2GR0A 3CMMA 2WPEA 3P4RA 2JB3A 4EQSA 5JCMA 1Z6LA 5JCNA 1EL5A 4OPDA 5EB5A 1LPFA 2XVFA 4O5QA 1YQ3A 3SZFA 4Z2UA 3GMBA 4H2NA 2B7RA 3H4KA 2R0CA 3CNPA 2CFYA 2X8HA 4KX6A 4BJZA 3EAOA 4ZN0A 4BJYA 5KVIA 3K7TA 2YLZA 3AE3A 4Y4NA 2TPRA 2BACA 4DSGA 1E1NA 2OLNA 3LADA 1TDFA 2GH5A 2WU5A 1VG0A 3K7MX 1LV0A 1ONFA 2BS3A 3VRBA 3IF9A 4N9XA 2VQ7A 3OC4A 3SYIA 3GRSA 3ZNNA 3F8DA 1GRGA 1FEBA 2C72A 2C3CA 2B7SA 5KOWA 1S3EA 2JKCA 1VE9A 1QLBA 1ZX9A 5U1OA 3UKQA 1XHCA 3HZLA 2FJDA 3P1WA 2BS2A 2V3BA 5EOWA 2GQWA 1DOEA 4U2TA 2A87A 3AEDA 2X8GA 3NYCA 4YJGA 5U25A 3UTHA 2R46A 1DDOA 3PVCA 1ZP0A 2Z5YA 3UKPA 2I0ZA 2YWLA 3UOVA 1D7LA 3ALMA 3ZNPA 2YR5A 3FPZA 4BV6A 3AE8A 1PBCA 1COYA 2F5ZA 1RP0A 3ICRA 1TYTA 4G6HA 5BUKA 5KOXA 4TM1A 4X9MA 2VOUA 4A65A 2O9ZA 3AEFA 5L46A 3EF6A 2BRAA 4IA6A 1K0LA 1IUVA 1EBDA 2QA2A 5EB4A 3AWIA 3C4NA 1KSSA 3AEEA 2EQ9A 2BXSA 3G5RA 5FS7A 4A5LA 2WP5A 3S61A 3AE9A 2BC0A 3AE6A 2OLOA 4LIIA 4A6NA 1L9EA 2YG7A 3GWDA 3RP8A 4B67A 4EQWA 1NAAA 1KFYA 3DJEA 3ZNOA 1H84A 1S2QA 3AYJA 3HYVA 5KMRA 1E6EA 1OJ9A 1MXTA 5CKUA 3AE2A 1NENA 3AD9B 2WU2A 3RP7A 1ZOVA 3QVPA 5J60A 5FS9A 2GMJA 2YM1A 4EQXA 1VDCA 4K5RA 2Z5XA 4H50A 1YQZA 2C64A 3P4PA 3NTDA 1L9CA 4NZHA 3DK8A 1MOKA 4IVMB 3S5WA 1PJ6A 3V3OA 4NEWA 4EM3A 1QJDA 2C70A 2YG3A 2R0PA 3GDPA 3G3EA 1NEKA 4G9KA 4YTNA 2PHHA 3VRAA 3W4KA 4GR1A 2YLXA 1O95A 3NT6A 4C77A 2C75A 4Z25A 3T14A 1N4VA 3T2YA 3QSSA 4IV9A 2Q7VA 4H4PA 4KPRA 4K2XA 2X99A 3ABVA 3P4QA 1BGNA 3G5SA 3REDA 3ZYXA 1MO9A 1CJ3A 1E7PA 2WPCA 2YR4A 4OCGA 3SFEA 3GD3A 4LU6A 2V6OA 1M64A 4YKGA 4K8DA 3SZWA 1CL0A 3HYWA 2DKHA 1KIFA 3CIRA 4AT2A 3BI5A 2GV8A 3AXBA 1H6VA 3ZDNA 3CPHG 3W4IA 2X50A 1SEZA 5KMPA 1N4UA 3T31A 3UKAA 2XFNA 2QA1A 3BHKA 4Z43A 4UP3A 2BYBA 2YLWA 3DJJA 3UKFA 1JRYA 3BI2A 1BGJA 1ZKQA 5KXJA 2R9ZA 3ITJA 1PN0A 3RP6A 4YKFA 2OAMA 4YJDA 2X8CA 4Y4LA 1S2YA 2EQ7A 2YVFA 1PXBA 1ZDLA 5J7XA 3RHAA 4FK1C 4D04A 1EL7A 3NLCA 5TR3A 1GESA 4RG4A 2XFUA 2XVJA 2BA9A 4J56A 4BK1A 1IUTA 2XLUA 4USRA 5LV9A 2R4EA 3GWFA 1PHHA 1GRTA 2PYXA 2VQBA 2ZZCA 3CNSA 3CTYA 4O5UA 1RSGA 2GR3A 4K5SA 3WE0A 3ZNQA 2GF3A 4JDRA 2CVJA 4QFCA 2XFQA 3UP5A 2WOIA 3PS9A 1XPQA 4B68A 4GRTA 4BURA 4JN9A 2GMHA 2C7GA 3KKJA 5KMSA 1CJCA 2WS3A 4EMWA 5BVAA 3HYXA 1D7YA 5HHFA 4H4TA 2FJEA 4J2WA 1GV4A 3KPFA 4J33A 4ZCDA 2JBVA 1H81A 2VVLG 2E82A 4REKA 3UTGA 4C3XA 1P2EA 3AEAA 4DSHA 1KSUA 1GOSA 2XLRA 3CGDA 4CCRA 5M10A 4YJFB 4H4YA 2WDQA 2GAGB 4USQA 3VR8A 2VVLA 2C76A 1PBEA 1X31B 2XCGA 1KNPA 1FCDA 2YLTA 1PS9A 3IC9A 1EL8A 3URHA 5BULA 2A89A 1GTEA 4CRTA 2BABA 1GTHA 2RGJA 4I59A 5CQFA 1CHUA 5DBJA 3F8RA 1DJNA 2V3AA 3II4A 1IUSA 1TRBA 1TYPA 3V76A 2X3NA 2WOVA 1L0VA 1CBOA 2VRMA 3GYIA 1NHQA 3NKSA 4B66A 2VRLA 4H4RA 4YSZA 3UCLA 1TDNA 1LJ1A 4K7ZA 4HA6A 3AYIA 2YAUA 3AB1A 2ZZBA 2E1MA 5EBKA 3UKHA 1BF3A 4EIQA 1KNRA 4NTEA 3AE4A 3AE1A 4YJHB 2ACZA 2WESA 2XVHA 3UTEA 5U63A 4B63A 3NK1X 1CC2A 1B37A 3Q6JA 2C3DA 4U8OA 3JSKA 3UOZA 3AEBA 4IA5A 5M0ZA 3L1RA 3VRDB 3QFBA 2R0GA 3DGHA 4B1BA 2QCUA 1DODA 2BCGG 4H4ZA 1YY5A 3NG7X 3LJPA 2WBAA
chains in the Genus database with same CATH topology
4H2RA 2E4AA 3F8PA 1GNDA 4HB9A 3SY4A 3BHFA 4H4VA 5KRQA 1PXAA 1DJQA 4PAAA 1GSNA 4H7UA 2E4GA 4PABA 3KLJA 3SGLA 1C0KA 2C4CA 2C66A 3LB8A 3CUKA 1CF3A 3NN6X 5KMQA 1PBBA 2IVEA 3AE5A 1F8RA 2BK3A 2EQ8A 3AECA 4XWZA 3GYXA 3UP4A 1H7WA 2B76A 2IIDA 3LXDA 4U2LA 1B5QA 4OPTA 2BC1A 4XXGA 4BK3A 2E48A 4ICYA 4U8NA 3W4JA 3DK9A 1Y0PA 2AAQA 2C73A 3QFAA 2VZ2A 3P4SA 4TM3A 2XLTA 2GVCA 4JY2A 1LVLA 2Q0KA 3CGBA 3P9UA 4JY3A 1REOA 1E39A 4UDPA 1Q1WA 3CN8A 1GT8A 2BS4A 2E5VA 2YVJA 2NVKX 4X4JA 1PJ5A 3T0KA 2GEWA 2OA1A 1PXCA 2AQJA 3NH3X 5GSNA 4YJGB 1GALA 2UZZA 3C96A 3GMCA 1GRAA 2FJAA 2YQUA 1K4QA 3CNDA 4AOSA 1OJDA 2JB2A 5HXIA 4YWOA 1GRHA 1TDKA 4B69A 4DGKA 2TMDA 4G6GA 4H2PA 3IWAA 4I58A 2CDUA 1VQWA 3D8XA 4EIPA 3QSEA 3E1TA 3AEGA 3NNEA 4ADWA 4GAPA 4H4UA 2WEUA 1H86A 3C4AA 3CNTA 2YG6A 2V60A 4OPUA 4OPLA 4U8IA 3B3RA 3PO7A 4A6NB 2B9XA 4C5OA 1EVIA 4BK2A 2WPFA 1K0IA 1NG3A 2EQ6A 3UTFA 2E49A 4QFDA 1VG9A 2ZBWA 3ADAB 3FBSA 4CNKA 1JEHA 3LZWA 4CY8A 1YQ4A 3FG2P 3QSMA 4H4XA 4OPIA 3SZ0A 3T2ZA 4EMIA 5KNLA 1E1MA 3NYFA 1JRXA 2XDOA 3KVEA 1NHPA 4A9WA 1H82A 1GXFA 1DNCA 2BRYA 2FJBA 1QO8A 1IUXA 3NRNA 3GD4A 3LOVA 3ICTA 4E0VA 4UDRA 2YG4A 4FX9A 3DH9A 3CPJG 4TLZA 1LTXR 4U8MA 3ALLA 4OPCA 3UKLA 4EM4A 2DU8A 4YTPA 4C3YA 2A8XA 4RSLA 3VQRA 3EANA 4Y4MA 5IPYA 2XFOA 4YSYA 3NYEA 2BCPA 4TM4A 4Z2TA 3AE7A 4WCTA 1ZY8A 1ELIA 4NTDA 2XVEA 3CNJA 3H8IA 2WP9A 1PBDA 4YTMA 1O94A 4EQRA 4JNAA 1CJ4A 2BXRA 3NK2X 1JNRA 4B64A 1ZMDA 3M13A 4GDEA 1PDHA 4TLXA 2YR6A 4J36A 4Z24A 3IHGA 2YVGA 3DJDA 3GYJA 3NGCX 2W0HA 2BK5A 2RABA 3ALJA 1LQUA 4OPGA 3D1CA 1FOHA 1VRQB 3BNUA 4LA1A 4H2QA 2JB1A 3ATRA 5ER0A 5KWFA 4H4WA 2OALA 3T2KA 2YM2A 3NIXA 4Z44A 4YSXA 2B9WA 4G73A 1LQTA 4TM0A 2WQYA 4YT0A 4U8KA 3O0HA 2Q6UA 1OJCA 1XDIA 3EPTA 4A7AA 4Z26A 2H89A 1E1KA 4UDQA 2XLSA 4U8PA 4J57A 4K22A 3R9UA 2J3NA 3DK4A 1KDGA 3SFDA 4A79A 3NTAA 3OZ2A 1B4VA 5FMHA 4DNAA 1F8SA 3UOXA 3ATQA 4AP1A 1H7XA 3DA1A 1UKVG 2WETA 3I3LA 4AP3A 5HY5A 1ZK7A 1OJAA 1EL9A 1JRZA 1Y56A 3M12A 3NN0X 5JCKA 3I6DA 3DMEA 4Z2RA 3GSIA 2NPXA 1CC6A 1ZOYA 3V3NA 3DJGX 3H8LA 5JCLA 1TDEA 2GRTA 3K30A 1S3BA 3NK0X 3WGTA 2APGA 3ICSA 4B65A 1GEUA 4D03A 4NNJA 4JQ9A 3SZCA 1OJTA 1V59A 1JNZA 1DOBA 5FS8A 5BRTA 1N1PA 1AOGA 3SQPA 1BZLA 2R4JA 1DXLA 3B6DA 4AT0A 3SM8A 4AOXA 1GPEA 3CPIG 3BI4A 2C65A 1E1LA 1K0JA 5C3JA 4J31A 4U8LA 3M0OA 1GREA 3K7QX 1ZMCA 2GR2A 1JU2A 3KA7A 1JOAA 1CC4A 3IHMA 1C0LA 1C0PA 3GRTA 1O5WA 3FMWA 4YSHA 1DAOA 3AD8B 4GCMA 2Y6QA 4WX1A 4ECHA 2B9YA 3RNMA 4JNQA 1H83A 2AR8A 4A99A 2FBWA 2YLSA 5KVHA 3KD9A 4NTCA 1BWCA 1PBFA 4GDPA 1F8WA 4EMJA 2RGOA 4X9NA 4CY6A 2BK4A 1F3PA 3GDNA 3QJ4A 1XANA 1BKWA 2R45A 2Q0LA 4RG3A 4XWRA 3SXIA 4APNA 4C74A 2GAHB 1B8SA 5C2TA 4CNJA 4G74A 1PJ7A 2GQFA 4H4SA 2QAEA 2GR1A 2ZZ0A 4OVIA 1FEAA 2V5ZA 2XYOA 4CCQA 4GUVA 1NG4A 1YKJA 3UKKA 4YJFA 5FS6A 3LZXA 1L9DA 1IJHA 1GETA 2JAEA 1D4EA 5JCIA 3AYLA 5GRTA 1P2HA 2XFPA 2CULA 1F6MA 1Q1RA 2HQMA 3NHOX 4H4QA 4II2A 2Y6RA 1GRBA 1TDOA 4U8JA 2XVIA 4GF7A 2DKIA 2C67A 3QVRA 2VVMA 1DOCA 1W4XA 1Y56B 4FK1A 2ARDA 3KU9A 1D4CA 1FL2A 2WOWA 3Q9TA 3KPKA 2IVDA 4NEVA 1FECA 2WP6A 5HYMA 1IUUA 1HYUA 1C0IA 5IQ4A 2WHDA 1D5TA 1NHSA 2YLRA 3L8KA 3UOYA 4MJWA 4NWZA 4P9SA 2WDVA 1NPXA 4CBQA 4YXDA 4IVOB 1Q9IA 4FDCB 1IUWA 2JK6A 4M52A 3BNMA 2RGHA 2GB0A 4YJHA 3FIMB 3VR9A 1D4DA 3T37A 1KF6A 1GERA 1RYIA 3SX6A 1NDAA 1CJ2A 2V61A 2YG5A 3CGCA 1N4WA 1NHRA 4GAVA 4U2SA 4J34A 4ZCCA 5IQ1A 3AD7B 2H88A 3ISHA 3COXA 1AN9A 4II3A 2WDRA 3CGEA 3DGZA 3G5QA 1GRFA 1M6IA 2XLPA 2GR0A 3CMMA 2WPEA 3P4RA 2JB3A 4EQSA 5JCMA 1Z6LA 5JCNA 1EL5A 4OPDA 5EB5A 1LPFA 2XVFA 4O5QA 1YQ3A 3SZFA 4Z2UA 3GMBA 2B7RA 3H4KA 4H2NA 2R0CA 3CNPA 2CFYA 2X8HA 4KX6A 4BJZA 3EAOA 4ZN0A 4BJYA 5KVIA 3K7TA 2YLZA 3AE3A 4Y4NA 2TPRA 2BACA 4DSGA 1E1NA 2OLNA 3LADA 1TDFA 2GH5A 2WU5A 1VG0A 3K7MX 1LV0A 1ONFA 2BS3A 3VRBA 3IF9A 4N9XA 2VQ7A 3OC4A 3SYIA 3GRSA 3ZNNA 3F8DA 1GRGA 1FEBA 2C72A 2C3CA 2B7SA 5KOWA 1S3EA 2JKCA 1VE9A 1QLBA 1ZX9A 5U1OA 3UKQA 1XHCA 3HZLA 2FJDA 3P1WA 2BS2A 2V3BA 5EOWA 2GQWA 1DOEA 4U2TA 2A87A 3AEDA 2X8GA 3NYCA 4YJGA 5U25A 3UTHA 2R46A 1DDOA 3PVCA 1ZP0A 2Z5YA 3UKPA 2I0ZA 2YWLA 3UOVA 1D7LA 3ZNPA 3ALMA 2YR5A 3FPZA 4BV6A 3AE8A 1PBCA 1COYA 2F5ZA 1RP0A 3ICRA 1TYTA 4G6HA 5BUKA 5KOXA 4TM1A 4X9MA 2VOUA 4A65A 2O9ZA 3AEFA 5L46A 3EF6A 2BRAA 4IA6A 1K0LA 1IUVA 1EBDA 2QA2A 5EB4A 3AWIA 3C4NA 1KSSA 3AEEA 2EQ9A 2BXSA 3G5RA 5FS7A 4A5LA 2WP5A 3S61A 3AE9A 2BC0A 3AE6A 2OLOA 4LIIA 4A6NA 1L9EA 2YG7A 3GWDA 3RP8A 4B67A 4EQWA 1NAAA 1KFYA 3DJEA 3ZNOA 1H84A 1S2QA 3AYJA 3HYVA 5KMRA 1E6EA 1OJ9A 1MXTA 5CKUA 3AE2A 1NENA 3AD9B 2WU2A 3RP7A 1ZOVA 3QVPA 5J60A 5FS9A 2GMJA 2YM1A 4EQXA 1VDCA 4K5RA 2Z5XA 4H50A 1YQZA 2C64A 3P4PA 3NTDA 1L9CA 4NZHA 3DK8A 1MOKA 4IVMB 3S5WA 1PJ6A 3V3OA 4NEWA 4EM3A 1QJDA 2C70A 2YG3A 2R0PA 3GDPA 3G3EA 1NEKA 4G9KA 4YTNA 2PHHA 3VRAA 3W4KA 4GR1A 2YLXA 1O95A 3NT6A 4C77A 2C75A 4Z25A 3T14A 1N4VA 3T2YA 3QSSA 4IV9A 2Q7VA 4H4PA 4KPRA 4K2XA 2X99A 3ABVA 3P4QA 1BGNA 3G5SA 3REDA 3ZYXA 1MO9A 1CJ3A 1E7PA 2WPCA 2YR4A 4OCGA 3SFEA 3GD3A 4LU6A 2V6OA 1M64A 4YKGA 4K8DA 3SZWA 1CL0A 3HYWA 2DKHA 1KIFA 3CIRA 4AT2A 3BI5A 2GV8A 3AXBA 1H6VA 3ZDNA 3CPHG 3W4IA 2X50A 1SEZA 5KMPA 1N4UA 3T31A 3UKAA 2XFNA 2QA1A 3BHKA 4Z43A 4UP3A 2BYBA 2YLWA 3DJJA 3UKFA 1JRYA 3BI2A 1BGJA 1ZKQA 5KXJA 2R9ZA 3ITJA 1PN0A 3RP6A 4YKFA 2OAMA 4YJDA 2X8CA 4Y4LA 1S2YA 2EQ7A 2YVFA 1PXBA 1ZDLA 5J7XA 3RHAA 4FK1C 4D04A 1EL7A 3NLCA 5TR3A 1GESA 4RG4A 2XFUA 2XVJA 2BA9A 4J56A 4BK1A 1IUTA 2XLUA 4USRA 5LV9A 2R4EA 3GWFA 1PHHA 1GRTA 2PYXA 2VQBA 2ZZCA 3CNSA 3CTYA 4O5UA 1RSGA 2GR3A 4K5SA 3WE0A 3ZNQA 2GF3A 4JDRA 2CVJA 4QFCA 2XFQA 3UP5A 2WOIA 3PS9A 1XPQA 4B68A 4GRTA 4BURA 4JN9A 2C7GA 2GMHA 3KKJA 5KMSA 1CJCA 2WS3A 4EMWA 5BVAA 3HYXA 1D7YA 5HHFA 4H4TA 2FJEA 4J2WA 1GV4A 3KPFA 4J33A 4ZCDA 2JBVA 1H81A 2VVLG 2E82A 4REKA 3UTGA 4C3XA 1P2EA 3AEAA 4DSHA 1GOSA 1KSUA 2XLRA 3CGDA 4CCRA 5M10A 4YJFB 4H4YA 2WDQA 2GAGB 4USQA 3VR8A 2VVLA 2C76A 1PBEA 1X31B 2XCGA 1KNPA 1FCDA 2YLTA 1PS9A 3IC9A 1EL8A 3URHA 5BULA 2A89A 1GTEA 4CRTA 2BABA 1GTHA 2RGJA 4I59A 5CQFA 1CHUA 5DBJA 3F8RA 1DJNA 2V3AA 3II4A 1IUSA 1TRBA 1TYPA 3V76A 2WOVA 2X3NA 1L0VA 1CBOA 2VRMA 3GYIA 1NHQA 3NKSA 4B66A 2VRLA 4H4RA 4YSZA 3UCLA 1TDNA 1LJ1A 4K7ZA 4HA6A 3AYIA 2YAUA 3AB1A 2ZZBA 2E1MA 5EBKA 3UKHA 1BF3A 1KNRA 4EIQA 4NTEA 3AE4A 3AE1A 4YJHB 2ACZA 2WESA 2XVHA 3UTEA 5U63A 4B63A 3NK1X 1CC2A 1B37A 3Q6JA 2C3DA 4U8OA 3JSKA 3UOZA 3AEBA 4IA5A 5M0ZA 3L1RA 3VRDB 3QFBA 2R0GA 3DGHA 4B1BA 2QCUA 1DODA 2BCGG 4H4ZA 1YY5A 3NG7X 3LJPA 2WBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2R A;  2E4A A;  3F8P A;  1GND A;  4HB9 A;  3BHF A;  4H4V A;  5KRQ A;  1PXA A;  1DJQ A;  4PAA A;  1GSN A;  4H7U A;  2E4G A;  4PAB A;  3KLJ A;  3SGL A;  1C0K A;  2C66 A;  3LB8 A;  3CUK A;  1CF3 A;  3NN6 X;  1PBB A;  2IVE A;  3AE5 A;  1F8R A;  2BK3 A;  2EQ8 A;  3AEC A;  4XWZ A;  3UP4 A;  1H7W A;  2B76 A;  2IID A;  3LXD A;  4U2L A;  1B5Q A;  4OPT A;  2BC1 A;  4XXG A;  4BK3 A;  2E48 A;  4ICY A;  4U8N A;  3W4J A;  3DK9 A;  1Y0P A;  2AAQ A;  2C73 A;  3QFA A;  2VZ2 A;  3P4S A;  4TM3 A;  2XLT A;  2GVC A;  4JY2 A;  1LVL A;  2Q0K A;  3CGB A;  3P9U A;  4JY3 A;  1REO A;  1E39 A;  4UDP A;  1Q1W A;  3CN8 A;  1GT8 A;  2BS4 A;  2E5V A;  2YVJ A;  2NVK X;  4X4J A;  1PJ5 A;  2GEW A;  2OA1 A;  1PXC A;  2AQJ A;  3NH3 X;  5GSN A;  4YJG B;  1GAL A;  2UZZ A;  3C96 A;  3GMC A;  1GRA A;  2FJA A;  2YQU A;  1K4Q A;  3CND A;  4AOS A;  1OJD A;  2JB2 A;  5HXI A;  4YWO A;  1GRH A;  1TDK A;  4B69 A;  4DGK A;  2TMD A;  4H2P A;  4I58 A;  3IWA A;  4EIP A;  2CDU A;  1VQW A;  3D8X A;  3QSE A;  3E1T A;  3AEG A;  3NNE A;  4ADW A;  4H4U A;  2WEU A;  1H86 A;  3C4A A;  3CNT A;  2YG6 A;  2V60 A;  4OPU A;  4OPL A;  4U8I A;  3B3R A;  3PO7 A;  4A6N B;  2B9X A;  4C5O A;  1EVI A;  4BK2 A;  2WPF A;  1K0I A;  1NG3 A;  2EQ6 A;  3UTF A;  2E49 A;  4QFD A;  1VG9 A;  2ZBW A;  3ADA B;  3FBS A;  4CNK A;  1JEH A;  3LZW A;  4CY8 A;  1YQ4 A;  3FG2 P;  3QSM A;  4H4X A;  4OPI A;  4EMI A;  1E1M A;  3NYF A;  1JRX A;  2XDO A;  3KVE A;  1NHP A;  4A9W A;  1H82 A;  1GXF A;  1DNC A;  2FJB A;  1QO8 A;  1IUX A;  3NRN A;  3GD4 A;  3LOV A;  3ICT A;  4E0V A;  4UDR A;  2YG4 A;  4FX9 A;  3DH9 A;  3CPJ G;  4TLZ A;  1LTX R;  4U8M A;  3ALL A;  4OPC A;  3UKL A;  4EM4 A;  2DU8 A;  4YTP A;  4C3Y A;  2A8X A;  4RSL A;  3VQR A;  3EAN A;  4Y4M A;  5IPY A;  2XFO A;  4YSY A;  3NYE A;  2BCP A;  4TM4 A;  4Z2T A;  3AE7 A;  4WCT A;  1ZY8 A;  1ELI A;  4NTD A;  2XVE A;  3CNJ A;  3H8I A;  2WP9 A;  1PBD A;  4YTM A;  1O94 A;  4EQR A;  4JNA A;  1CJ4 A;  2BXR A;  3NK2 X;  1JNR A;  4B64 A;  1ZMD A;  3M13 A;  4GDE A;  1PDH A;  4TLX A;  2YR6 A;  4J36 A;  4Z24 A;  3IHG A;  2YVG A;  3DJD A;  3GYJ A;  3NGC X;  2W0H A;  2BK5 A;  2RAB A;  3ALJ A;  1LQU A;  4OPG A;  3D1C A;  1FOH A;  1VRQ B;  3BNU A;  4LA1 A;  4H2Q A;  2JB1 A;  3ATR A;  5ER0 A;  5KWF A;  4H4W A;  2OAL A;  2YM2 A;  3NIX A;  4Z44 A;  4YSX A;  2B9W A;  1LQT A;  4TM0 A;  2WQY A;  4YT0 A;  4U8K A;  3O0H A;  2Q6U A;  1OJC A;  1XDI A;  3EPT A;  4A7A A;  4Z26 A;  2H89 A;  1E1K A;  4UDQ A;  2XLS A;  4U8P A;  4J57 A;  4K22 A;  3R9U A;  2J3N A;  3DK4 A;  1KDG A;  3SFD A;  4A79 A;  3NTA A;  3OZ2 A;  1B4V A;  5FMH A;  4DNA A;  1F8S A;  3UOX A;  3ATQ A;  4AP1 A;  1H7X A;  3DA1 A;  1UKV G;  2WET A;  3I3L A;  4AP3 A;  5HY5 A;  1ZK7 A;  1OJA A;  1EL9 A;  1JRZ A;  1Y56 A;  3M12 A;  3NN0 X;  5JCK A;  3I6D A;  3DME A;  4Z2R A;  3GSI A;  2NPX A;  1CC6 A;  1ZOY A;  3V3N A;  3DJG X;  3H8L A;  5JCL A;  1TDE A;  2GRT A;  3K30 A;  1S3B A;  3NK0 X;  3WGT A;  2APG A;  3ICS A;  4B65 A;  1GEU A;  4D03 A;  4JQ9 A;  1OJT A;  1V59 A;  1JNZ A;  1DOB A;  5FS8 A;  5BRT A;  1N1P A;  1AOG A;  3SQP A;  1BZL A;  2R4J A;  1DXL A;  3B6D A;  4AT0 A;  3SM8 A;  4AOX A;  1GPE A;  3CPI G;  3BI4 A;  2C65 A;  1E1L A;  1K0J A;  5C3J A;  4J31 A;  4U8L A;  3M0O A;  1GRE A;  3K7Q X;  1ZMC A;  2GR2 A;  1JU2 A;  3KA7 A;  1JOA A;  1CC4 A;  3IHM A;  1C0L A;  1C0P A;  3GRT A;  1O5W A;  3FMW A;  4YSH A;  1DAO A;  3AD8 B;  4GCM A;  2Y6Q A;  4WX1 A;  4ECH A;  2B9Y A;  3RNM A;  4JNQ A;  1H83 A;  2AR8 A;  4A99 A;  2FBW A;  2YLS A;  5KVH A;  3KD9 A;  4NTC A;  1BWC A;  1PBF A;  4GDP A;  1F8W A;  4EMJ A;  2RGO A;  4X9N A;  4CY6 A;  2BK4 A;  1F3P A;  3GDN A;  3QJ4 A;  1XAN A;  1BKW A;  2R45 A;  2Q0L A;  4RG3 A;  4XWR A;  4C74 A;  4APN A;  2GAH B;  1B8S A;  5C2T A;  4CNJ A;  1PJ7 A;  2GQF A;  4H4S A;  2QAE A;  2GR1 A;  2ZZ0 A;  4OVI A;  1FEA A;  2V5Z A;  2XYO A;  4CCQ A;  4GUV A;  1NG4 A;  1YKJ A;  3UKK A;  4YJF A;  5FS6 A;  3LZX A;  1L9D A;  1IJH A;  1GET A;  2JAE A;  1D4E A;  5JCI A;  3AYL A;  5GRT A;  1P2H A;  2XFP A;  2CUL A;  1F6M A;  1Q1R A;  2HQM A;  3NHO X;  4H4Q A;  2Y6R A;  1GRB A;  1TDO A;  4U8J A;  2XVI A;  4GF7 A;  2DKI A;  2C67 A;  3QVR A;  2VVM A;  1DOC A;  1W4X A;  1Y56 B;  4FK1 A;  2ARD A;  3KU9 A;  1D4C A;  1FL2 A;  2WOW A;  3Q9T A;  2IVD A;  4NEV A;  1FEC A;  2WP6 A;  5HYM A;  1IUU A;  1HYU A;  1C0I A;  5IQ4 A;  2WHD A;  1D5T A;  1NHS A;  2YLR A;  3L8K A;  3UOY A;  4MJW A;  4P9S A;  2WDV A;  1NPX A;  4CBQ A;  4YXD A;  4IVO B;  1Q9I A;  4FDC B;  1IUW A;  2JK6 A;  4M52 A;  3BNM A;  2RGH A;  2GB0 A;  4YJH A;  3FIM B;  3VR9 A;  1D4D A;  3T37 A;  1KF6 A;  1GER A;  1RYI A;  1NDA A;  1CJ2 A;  2V61 A;  2YG5 A;  3CGC A;  1N4W A;  1NHR A;  4U2S A;  4ZCC A;  4J34 A;  5IQ1 A;  3AD7 B;  2H88 A;  3ISH A;  3COX A;  1AN9 A;  2WDR A;  3CGE A;  3DGZ A;  3G5Q A;  1GRF A;  1M6I A;  2XLP A;  2GR0 A;  2WPE A;  3P4R A;  2JB3 A;  4EQS A;  5JCM A;  1Z6L A;  5JCN A;  1EL5 A;  4OPD A;  5EB5 A;  1LPF A;  2XVF A;  4O5Q A;  1YQ3 A;  4Z2U A;  3GMB A;  2B7R A;  3H4K A;  4H2N A;  2R0C A;  3CNP A;  2CFY A;  2X8H A;  4KX6 A;  4BJZ A;  3EAO A;  4ZN0 A;  4BJY A;  5KVI A;  3K7T A;  2YLZ A;  3AE3 A;  4Y4N A;  2TPR A;  2BAC A;  4DSG A;  1E1N A;  2OLN A;  3LAD A;  1TDF A;  2GH5 A;  2WU5 A;  1VG0 A;  3K7M X;  1LV0 A;  1ONF A;  2BS3 A;  3VRB A;  3IF9 A;  4N9X A;  2VQ7 A;  3OC4 A;  3GRS A;  3ZNN A;  3F8D A;  1GRG A;  1FEB A;  2C72 A;  2C3C A;  2B7S A;  5KOW A;  1S3E A;  2JKC A;  1VE9 A;  1QLB A;  1ZX9 A;  5U1O A;  3UKQ A;  1XHC A;  3HZL A;  2FJD A;  3P1W A;  2BS2 A;  2V3B A;  5EOW A;  2GQW A;  1DOE A;  4U2T A;  2A87 A;  3AED A;  2X8G A;  3NYC A;  4YJG A;  5U25 A;  3UTH A;  2R46 A;  1DDO A;  3PVC A;  1ZP0 A;  2Z5Y A;  3UKP A;  2I0Z A;  2YWL A;  3UOV A;  1D7L A;  3ZNP A;  3ALM A;  2YR5 A;  3FPZ A;  4BV6 A;  3AE8 A;  1PBC A;  1COY A;  2F5Z A;  1RP0 A;  3ICR A;  1TYT A;  5BUK A;  5KOX A;  4TM1 A;  4X9M A;  2VOU A;  4A65 A;  2O9Z A;  3AEF A;  5L46 A;  3EF6 A;  4IA6 A;  1K0L A;  1IUV A;  1EBD A;  2QA2 A;  5EB4 A;  3AWI A;  3C4N A;  1KSS A;  3AEE A;  2EQ9 A;  2BXS A;  3G5R A;  5FS7 A;  4A5L A;  2WP5 A;  3S61 A;  3AE9 A;  2BC0 A;  3AE6 A;  2OLO A;  4LII A;  4A6N A;  1L9E A;  2YG7 A;  3GWD A;  3RP8 A;  4B67 A;  4EQW A;  1NAA A;  1KFY A;  3DJE A;  3ZNO A;  1H84 A;  1S2Q A;  3AYJ A;  1E6E A;  1OJ9 A;  1MXT A;  5CKU A;  3AE2 A;  1NEN A;  3AD9 B;  2WU2 A;  3RP7 A;  1ZOV A;  3QVP A;  5J60 A;  5FS9 A;  2GMJ A;  2YM1 A;  4EQX A;  1VDC A;  4K5R A;  2Z5X A;  4H50 A;  1YQZ A;  2C64 A;  3P4P A;  3NTD A;  1L9C A;  4NZH A;  3DK8 A;  1MOK A;  4IVM B;  3S5W A;  1PJ6 A;  3V3O A;  4NEW A;  4EM3 A;  1QJD A;  2C70 A;  2YG3 A;  2R0P A;  3GDP A;  3G3E A;  1NEK A;  4YTN A;  2PHH A;  3VRA A;  3W4K A;  4GR1 A;  2YLX A;  1O95 A;  3NT6 A;  4C77 A;  2C75 A;  4Z25 A;  1N4V A;  3QSS A;  4IV9 A;  2Q7V A;  4H4P A;  4KPR A;  4K2X A;  2X99 A;  3ABV A;  3P4Q A;  1BGN A;  3G5S A;  3RED A;  3ZYX A;  1MO9 A;  1CJ3 A;  1E7P A;  2WPC A;  2YR4 A;  4OCG A;  3SFE A;  3GD3 A;  4LU6 A;  2V6O A;  1M64 A;  4YKG A;  4K8D A;  1CL0 A;  2DKH A;  1KIF A;  3CIR A;  4AT2 A;  3BI5 A;  2GV8 A;  3AXB A;  1H6V A;  3ZDN A;  3CPH G;  3W4I A;  2X50 A;  1SEZ A;  1N4U A;  3UKA A;  2XFN A;  2QA1 A;  3BHK A;  4Z43 A;  4UP3 A;  2BYB A;  2YLW A;  3DJJ A;  3UKF A;  1JRY A;  3BI2 A;  1BGJ A;  1ZKQ A;  5KXJ A;  2R9Z A;  3ITJ A;  1PN0 A;  3RP6 A;  4YKF A;  2OAM A;  4YJD A;  2X8C A;  4Y4L A;  1S2Y A;  2EQ7 A;  2YVF A;  1PXB A;  1ZDL A;  5J7X A;  3RHA A;  4FK1 C;  4D04 A;  1EL7 A;  3NLC A;  5TR3 A;  1GES A;  4RG4 A;  2XFU A;  2XVJ A;  2BA9 A;  4J56 A;  4BK1 A;  1IUT A;  2XLU A;  4USR A;  5LV9 A;  2R4E A;  3GWF A;  1PHH A;  1GRT A;  2PYX A;  2VQB A;  2ZZC A;  3CNS A;  3CTY A;  4O5U A;  1RSG A;  2GR3 A;  4K5S A;  3WE0 A;  3ZNQ A;  2GF3 A;  4JDR A;  2CVJ A;  4QFC A;  2XFQ A;  3UP5 A;  2WOI A;  3PS9 A;  1XPQ A;  4B68 A;  4GRT A;  4BUR A;  4JN9 A;  2C7G A;  2GMH A;  3KKJ A;  1CJC A;  2WS3 A;  4EMW A;  5BVA A;  1D7Y A;  5HHF A;  4H4T A;  2FJE A;  4J2W A;  1GV4 A;  3KPF A;  4J33 A;  4ZCD A;  2JBV A;  1H81 A;  2VVL G;  2E82 A;  4REK A;  3UTG A;  4C3X A;  1P2E A;  3AEA A;  4DSH A;  1GOS A;  1KSU A;  2XLR A;  3CGD A;  4CCR A;  5M10 A;  4YJF B;  4H4Y A;  2WDQ A;  2GAG B;  4USQ A;  3VR8 A;  2VVL A;  2C76 A;  1PBE A;  1X31 B;  2XCG A;  1KNP A;  1FCD A;  2YLT A;  1PS9 A;  3IC9 A;  1EL8 A;  3URH A;  5BUL A;  2A89 A;  1GTE A;  4CRT A;  2BAB A;  1GTH A;  2RGJ A;  4I59 A;  5CQF A;  1CHU A;  5DBJ A;  3F8R A;  1DJN A;  2V3A A;  3II4 A;  1IUS A;  1TRB A;  1TYP A;  3V76 A;  2WOV A;  2X3N A;  1L0V A;  1CBO A;  2VRM A;  3GYI A;  1NHQ A;  3NKS A;  4B66 A;  2VRL A;  4H4R A;  4YSZ A;  3UCL A;  1TDN A;  1LJ1 A;  4K7Z A;  4HA6 A;  3AYI A;  2YAU A;  3AB1 A;  2ZZB A;  2E1M A;  5EBK A;  3UKH A;  1BF3 A;  1KNR A;  4EIQ A;  4NTE A;  3AE4 A;  3AE1 A;  4YJH B;  2ACZ A;  2WES A;  2XVH A;  3UTE A;  5U63 A;  4B63 A;  3NK1 X;  1CC2 A;  1B37 A;  3Q6J A;  2C3D A;  4U8O A;  3JSK A;  3UOZ A;  3AEB A;  4IA5 A;  5M0Z A;  3L1R A;  3VRD B;  3QFB A;  2R0G A;  3DGH A;  4B1B A;  2QCU A;  1DOD A;  2BCG G;  4H4Z A;  1YY5 A;  3NG7 X;  3LJP A;  2WBA A; 
#chains in the Genus database with same CATH topology
 4H2R A;  2E4A A;  3F8P A;  1GND A;  4HB9 A;  3SY4 A;  3BHF A;  4H4V A;  5KRQ A;  1PXA A;  1DJQ A;  4PAA A;  1GSN A;  4H7U A;  2E4G A;  4PAB A;  3KLJ A;  3SGL A;  1C0K A;  2C4C A;  2C66 A;  3LB8 A;  3CUK A;  1CF3 A;  3NN6 X;  5KMQ A;  1PBB A;  2IVE A;  3AE5 A;  1F8R A;  2BK3 A;  2EQ8 A;  3AEC A;  4XWZ A;  3GYX A;  3UP4 A;  1H7W A;  2B76 A;  2IID A;  3LXD A;  4U2L A;  1B5Q A;  4OPT A;  2BC1 A;  4XXG A;  4BK3 A;  2E48 A;  4ICY A;  4U8N A;  3W4J A;  3DK9 A;  1Y0P A;  2AAQ A;  2C73 A;  3QFA A;  2VZ2 A;  3P4S A;  4TM3 A;  2XLT A;  2GVC A;  4JY2 A;  1LVL A;  2Q0K A;  4JY3 A;  3CGB A;  3P9U A;  1REO A;  1E39 A;  4UDP A;  1Q1W A;  3CN8 A;  1GT8 A;  2BS4 A;  2E5V A;  2YVJ A;  2NVK X;  4X4J A;  1PJ5 A;  3T0K A;  2GEW A;  2OA1 A;  1PXC A;  2AQJ A;  3NH3 X;  5GSN A;  1GAL A;  4YJG B;  3C96 A;  2UZZ A;  3GMC A;  1GRA A;  2FJA A;  2YQU A;  1K4Q A;  3CND A;  4AOS A;  5HXI A;  1OJD A;  2JB2 A;  4YWO A;  1GRH A;  1TDK A;  4B69 A;  4DGK A;  2TMD A;  4H2P A;  4EIP A;  3IWA A;  4G6G A;  2CDU A;  1VQW A;  3D8X A;  4I58 A;  3QSE A;  3E1T A;  3AEG A;  3NNE A;  4ADW A;  4GAP A;  4H4U A;  2WEU A;  3C4A A;  1H86 A;  3CNT A;  2YG6 A;  2V60 A;  4OPU A;  4OPL A;  4U8I A;  3B3R A;  3PO7 A;  4A6N B;  2B9X A;  4C5O A;  1EVI A;  4BK2 A;  2WPF A;  1K0I A;  1NG3 A;  2EQ6 A;  3UTF A;  2E49 A;  4QFD A;  1VG9 A;  2ZBW A;  3ADA B;  3FBS A;  4CNK A;  1JEH A;  3LZW A;  4CY8 A;  1YQ4 A;  3FG2 P;  3QSM A;  4H4X A;  4OPI A;  3SZ0 A;  3T2Z A;  4EMI A;  5KNL A;  1JRX A;  1E1M A;  3NYF A;  2XDO A;  3KVE A;  1NHP A;  4A9W A;  1H82 A;  1GXF A;  1DNC A;  2BRY A;  2FJB A;  1QO8 A;  1IUX A;  3NRN A;  3GD4 A;  3LOV A;  3ICT A;  4E0V A;  4UDR A;  2YG4 A;  4FX9 A;  3DH9 A;  3CPJ G;  4TLZ A;  1LTX R;  4U8M A;  3ALL A;  4OPC A;  3UKL A;  4EM4 A;  2DU8 A;  4YTP A;  4C3Y A;  2A8X A;  4RSL A;  3VQR A;  3EAN A;  4Y4M A;  5IPY A;  2XFO A;  4YSY A;  3NYE A;  2BCP A;  4TM4 A;  4Z2T A;  3AE7 A;  4WCT A;  1ZY8 A;  1ELI A;  4NTD A;  2XVE A;  3CNJ A;  3H8I A;  2WP9 A;  1PBD A;  4YTM A;  1O94 A;  4EQR A;  4JNA A;  1CJ4 A;  2BXR A;  3NK2 X;  1JNR A;  4B64 A;  1ZMD A;  3M13 A;  4GDE A;  1PDH A;  4TLX A;  2YR6 A;  4J36 A;  4Z24 A;  3IHG A;  2YVG A;  3DJD A;  3GYJ A;  3NGC X;  2W0H A;  2BK5 A;  2RAB A;  3ALJ A;  1LQU A;  4OPG A;  3D1C A;  1FOH A;  1VRQ B;  3BNU A;  4LA1 A;  4H2Q A;  2JB1 A;  3ATR A;  5ER0 A;  5KWF A;  4H4W A;  2OAL A;  3T2K A;  2YM2 A;  3NIX A;  4Z44 A;  4YSX A;  2B9W A;  4G73 A;  1LQT A;  4TM0 A;  2WQY A;  4YT0 A;  4U8K A;  3O0H A;  2Q6U A;  1OJC A;  1XDI A;  3EPT A;  4A7A A;  4Z26 A;  2H89 A;  1E1K A;  4UDQ A;  2XLS A;  4U8P A;  4K22 A;  4J57 A;  3R9U A;  2J3N A;  3DK4 A;  1KDG A;  3SFD A;  4A79 A;  3NTA A;  3OZ2 A;  1B4V A;  5FMH A;  4DNA A;  1F8S A;  3UOX A;  3ATQ A;  4AP1 A;  1H7X A;  3DA1 A;  1UKV G;  2WET A;  3I3L A;  4AP3 A;  5HY5 A;  1ZK7 A;  1OJA A;  1EL9 A;  1JRZ A;  1Y56 A;  3M12 A;  3NN0 X;  5JCK A;  3I6D A;  3DME A;  4Z2R A;  3GSI A;  2NPX A;  1CC6 A;  1ZOY A;  3V3N A;  3DJG X;  3H8L A;  5JCL A;  1TDE A;  2GRT A;  3K30 A;  1S3B A;  3NK0 X;  3WGT A;  2APG A;  3ICS A;  4B65 A;  1GEU A;  4D03 A;  4NNJ A;  4JQ9 A;  3SZC A;  1OJT A;  1V59 A;  1JNZ A;  1DOB A;  5FS8 A;  5BRT A;  1N1P A;  1AOG A;  3SQP A;  1BZL A;  2R4J A;  1DXL A;  3B6D A;  4AT0 A;  3SM8 A;  4AOX A;  1GPE A;  3CPI G;  3BI4 A;  2C65 A;  1E1L A;  1K0J A;  5C3J A;  4J31 A;  4U8L A;  3M0O A;  1GRE A;  3K7Q X;  1ZMC A;  2GR2 A;  1JU2 A;  3KA7 A;  3IHM A;  1CC4 A;  1JOA A;  1C0L A;  1C0P A;  3GRT A;  1O5W A;  3FMW A;  4YSH A;  1DAO A;  3AD8 B;  4GCM A;  2Y6Q A;  4WX1 A;  4ECH A;  2B9Y A;  3RNM A;  4JNQ A;  1H83 A;  2AR8 A;  4A99 A;  2FBW A;  2YLS A;  5KVH A;  3KD9 A;  4NTC A;  1BWC A;  1PBF A;  4GDP A;  1F8W A;  4EMJ A;  2RGO A;  4X9N A;  4CY6 A;  2BK4 A;  1F3P A;  3GDN A;  3QJ4 A;  1XAN A;  1BKW A;  2R45 A;  2Q0L A;  4RG3 A;  4XWR A;  3SXI A;  4APN A;  4C74 A;  2GAH B;  1B8S A;  5C2T A;  4CNJ A;  4G74 A;  1PJ7 A;  2GQF A;  4H4S A;  2QAE A;  2GR1 A;  2ZZ0 A;  4OVI A;  1FEA A;  2V5Z A;  2XYO A;  4CCQ A;  4GUV A;  1NG4 A;  1YKJ A;  3UKK A;  4YJF A;  5FS6 A;  3LZX A;  1L9D A;  1IJH A;  1GET A;  2JAE A;  1D4E A;  5JCI A;  3AYL A;  5GRT A;  1P2H A;  2XFP A;  2CUL A;  1F6M A;  1Q1R A;  2HQM A;  3NHO X;  4H4Q A;  4II2 A;  2Y6R A;  1GRB A;  1TDO A;  4U8J A;  4GF7 A;  2XVI A;  2DKI A;  2C67 A;  3QVR A;  2VVM A;  1DOC A;  1W4X A;  1Y56 B;  4FK1 A;  2ARD A;  3KU9 A;  1D4C A;  1FL2 A;  2WOW A;  3Q9T A;  3KPK A;  2IVD A;  4NEV A;  1FEC A;  2WP6 A;  5HYM A;  1IUU A;  1HYU A;  1C0I A;  5IQ4 A;  2WHD A;  1D5T A;  1NHS A;  2YLR A;  3L8K A;  3UOY A;  4MJW A;  4NWZ A;  4P9S A;  2WDV A;  1NPX A;  4CBQ A;  4YXD A;  4IVO B;  1Q9I A;  4FDC B;  1IUW A;  2JK6 A;  4M52 A;  3BNM A;  2RGH A;  2GB0 A;  4YJH A;  3FIM B;  3VR9 A;  1D4D A;  3T37 A;  1KF6 A;  1GER A;  1RYI A;  3SX6 A;  1NDA A;  1CJ2 A;  2V61 A;  2YG5 A;  3CGC A;  1N4W A;  1NHR A;  4GAV A;  4U2S A;  4J34 A;  4ZCC A;  5IQ1 A;  3AD7 B;  2H88 A;  3ISH A;  3COX A;  1AN9 A;  4II3 A;  2WDR A;  3CGE A;  3DGZ A;  3G5Q A;  1GRF A;  1M6I A;  2XLP A;  2GR0 A;  3CMM A;  2WPE A;  3P4R A;  2JB3 A;  4EQS A;  5JCM A;  1Z6L A;  5JCN A;  1EL5 A;  4OPD A;  5EB5 A;  1LPF A;  2XVF A;  4O5Q A;  1YQ3 A;  3SZF A;  4Z2U A;  3GMB A;  4H2N A;  2B7R A;  3H4K A;  2R0C A;  3CNP A;  2CFY A;  2X8H A;  4KX6 A;  4BJZ A;  3EAO A;  4ZN0 A;  4BJY A;  5KVI A;  3K7T A;  2YLZ A;  3AE3 A;  4Y4N A;  2TPR A;  2BAC A;  4DSG A;  1E1N A;  2OLN A;  3LAD A;  1TDF A;  2GH5 A;  2WU5 A;  1VG0 A;  3K7M X;  1LV0 A;  1ONF A;  2BS3 A;  3VRB A;  3IF9 A;  4N9X A;  2VQ7 A;  3OC4 A;  3SYI A;  3GRS A;  3ZNN A;  3F8D A;  1GRG A;  1FEB A;  2C72 A;  2C3C A;  2B7S A;  5KOW A;  1S3E A;  2JKC A;  1VE9 A;  1QLB A;  1ZX9 A;  5U1O A;  3UKQ A;  1XHC A;  3HZL A;  2FJD A;  3P1W A;  2BS2 A;  2V3B A;  5EOW A;  2GQW A;  1DOE A;  4U2T A;  2A87 A;  3AED A;  2X8G A;  3NYC A;  4YJG A;  5U25 A;  3UTH A;  2R46 A;  1DDO A;  3PVC A;  1ZP0 A;  2Z5Y A;  3UKP A;  2I0Z A;  2YWL A;  3UOV A;  1D7L A;  3ALM A;  3ZNP A;  2YR5 A;  3FPZ A;  4BV6 A;  3AE8 A;  1PBC A;  1COY A;  2F5Z A;  1RP0 A;  3ICR A;  1TYT A;  4G6H A;  5BUK A;  5KOX A;  4TM1 A;  4X9M A;  2VOU A;  4A65 A;  2O9Z A;  3AEF A;  5L46 A;  3EF6 A;  2BRA A;  4IA6 A;  1K0L A;  1IUV A;  1EBD A;  2QA2 A;  5EB4 A;  3AWI A;  3C4N A;  1KSS A;  3AEE A;  2EQ9 A;  2BXS A;  3G5R A;  5FS7 A;  4A5L A;  2WP5 A;  3S61 A;  3AE9 A;  2BC0 A;  3AE6 A;  2OLO A;  4LII A;  4A6N A;  1L9E A;  2YG7 A;  3GWD A;  3RP8 A;  4B67 A;  4EQW A;  1NAA A;  1KFY A;  3DJE A;  3ZNO A;  1H84 A;  1S2Q A;  3AYJ A;  3HYV A;  5KMR A;  1E6E A;  1OJ9 A;  1MXT A;  5CKU A;  3AE2 A;  1NEN A;  3AD9 B;  2WU2 A;  3RP7 A;  1ZOV A;  3QVP A;  5J60 A;  5FS9 A;  2GMJ A;  2YM1 A;  4EQX A;  1VDC A;  4K5R A;  2Z5X A;  4H50 A;  1YQZ A;  2C64 A;  3P4P A;  3NTD A;  1L9C A;  4NZH A;  3DK8 A;  1MOK A;  4IVM B;  3S5W A;  1PJ6 A;  3V3O A;  4NEW A;  4EM3 A;  1QJD A;  2C70 A;  2YG3 A;  2R0P A;  3GDP A;  3G3E A;  1NEK A;  4G9K A;  4YTN A;  2PHH A;  3VRA A;  3W4K A;  4GR1 A;  2YLX A;  1O95 A;  3NT6 A;  4C77 A;  2C75 A;  4Z25 A;  3T14 A;  1N4V A;  3T2Y A;  3QSS A;  4IV9 A;  2Q7V A;  4H4P A;  4KPR A;  4K2X A;  2X99 A;  3ABV A;  3P4Q A;  1BGN A;  3G5S A;  3RED A;  3ZYX A;  1MO9 A;  1CJ3 A;  1E7P A;  2WPC A;  2YR4 A;  4OCG A;  3SFE A;  3GD3 A;  4LU6 A;  2V6O A;  1M64 A;  4YKG A;  4K8D A;  3SZW A;  1CL0 A;  3HYW A;  2DKH A;  1KIF A;  3CIR A;  4AT2 A;  3BI5 A;  2GV8 A;  3AXB A;  1H6V A;  3ZDN A;  3CPH G;  3W4I A;  2X50 A;  1SEZ A;  5KMP A;  1N4U A;  3T31 A;  3UKA A;  2XFN A;  2QA1 A;  3BHK A;  4Z43 A;  4UP3 A;  2BYB A;  2YLW A;  3DJJ A;  3UKF A;  1JRY A;  3BI2 A;  1BGJ A;  1ZKQ A;  5KXJ A;  2R9Z A;  3ITJ A;  1PN0 A;  3RP6 A;  4YKF A;  2OAM A;  4YJD A;  2X8C A;  4Y4L A;  1S2Y A;  2EQ7 A;  2YVF A;  1PXB A;  1ZDL A;  5J7X A;  3RHA A;  4FK1 C;  4D04 A;  1EL7 A;  3NLC A;  5TR3 A;  1GES A;  4RG4 A;  2XFU A;  2XVJ A;  2BA9 A;  4J56 A;  4BK1 A;  1IUT A;  2XLU A;  4USR A;  5LV9 A;  2R4E A;  3GWF A;  1PHH A;  1GRT A;  2PYX A;  2VQB A;  2ZZC A;  3CNS A;  3CTY A;  4O5U A;  1RSG A;  2GR3 A;  4K5S A;  3WE0 A;  3ZNQ A;  2GF3 A;  4JDR A;  2CVJ A;  4QFC A;  2XFQ A;  3UP5 A;  2WOI A;  3PS9 A;  1XPQ A;  4B68 A;  4GRT A;  4BUR A;  4JN9 A;  2GMH A;  2C7G A;  3KKJ A;  5KMS A;  1CJC A;  2WS3 A;  4EMW A;  5BVA A;  3HYX A;  1D7Y A;  5HHF A;  4H4T A;  2FJE A;  4J2W A;  1GV4 A;  3KPF A;  4J33 A;  4ZCD A;  2JBV A;  1H81 A;  2VVL G;  2E82 A;  4REK A;  3UTG A;  4C3X A;  1P2E A;  3AEA A;  4DSH A;  1KSU A;  1GOS A;  2XLR A;  3CGD A;  4CCR A;  5M10 A;  4YJF B;  4H4Y A;  2WDQ A;  2GAG B;  4USQ A;  3VR8 A;  2VVL A;  2C76 A;  1PBE A;  1X31 B;  2XCG A;  1KNP A;  1FCD A;  2YLT A;  1PS9 A;  3IC9 A;  1EL8 A;  3URH A;  5BUL A;  2A89 A;  1GTE A;  4CRT A;  2BAB A;  1GTH A;  2RGJ A;  4I59 A;  5CQF A;  1CHU A;  5DBJ A;  3F8R A;  1DJN A;  2V3A A;  3II4 A;  1IUS A;  1TRB A;  1TYP A;  3V76 A;  2X3N A;  2WOV A;  1L0V A;  1CBO A;  2VRM A;  3GYI A;  1NHQ A;  3NKS A;  4B66 A;  2VRL A;  4H4R A;  4YSZ A;  3UCL A;  1TDN A;  1LJ1 A;  4K7Z A;  4HA6 A;  3AYI A;  2YAU A;  3AB1 A;  2ZZB A;  2E1M A;  5EBK A;  3UKH A;  1BF3 A;  4EIQ A;  1KNR A;  4NTE A;  3AE4 A;  3AE1 A;  4YJH B;  2ACZ A;  2WES A;  2XVH A;  3UTE A;  5U63 A;  4B63 A;  3NK1 X;  1CC2 A;  1B37 A;  3Q6J A;  2C3D A;  4U8O A;  3JSK A;  3UOZ A;  3AEB A;  4IA5 A;  5M0Z A;  3L1R A;  3VRD B;  3QFB A;  2R0G A;  3DGH A;  4B1B A;  2QCU A;  1DOD A;  2BCG G;  4H4Z A;  1YY5 A;  3NG7 X;  3LJP A;  2WBA A; 
#chains in the Genus database with same CATH homology
 4H2R A;  2E4A A;  3F8P A;  1GND A;  4HB9 A;  3SY4 A;  3BHF A;  4H4V A;  5KRQ A;  1PXA A;  1DJQ A;  4PAA A;  1GSN A;  4H7U A;  2E4G A;  4PAB A;  3KLJ A;  3SGL A;  1C0K A;  2C4C A;  2C66 A;  3LB8 A;  3CUK A;  1CF3 A;  3NN6 X;  5KMQ A;  1PBB A;  2IVE A;  3AE5 A;  1F8R A;  2BK3 A;  2EQ8 A;  3AEC A;  4XWZ A;  3GYX A;  3UP4 A;  1H7W A;  2B76 A;  2IID A;  3LXD A;  4U2L A;  1B5Q A;  4OPT A;  2BC1 A;  4XXG A;  4BK3 A;  2E48 A;  4ICY A;  4U8N A;  3W4J A;  3DK9 A;  1Y0P A;  2AAQ A;  2C73 A;  3QFA A;  2VZ2 A;  3P4S A;  4TM3 A;  2XLT A;  2GVC A;  4JY2 A;  1LVL A;  2Q0K A;  3CGB A;  3P9U A;  4JY3 A;  1REO A;  1E39 A;  4UDP A;  1Q1W A;  3CN8 A;  1GT8 A;  2BS4 A;  2E5V A;  2YVJ A;  2NVK X;  4X4J A;  1PJ5 A;  3T0K A;  2GEW A;  2OA1 A;  1PXC A;  2AQJ A;  3NH3 X;  5GSN A;  4YJG B;  1GAL A;  2UZZ A;  3C96 A;  3GMC A;  1GRA A;  2FJA A;  2YQU A;  1K4Q A;  3CND A;  4AOS A;  1OJD A;  2JB2 A;  5HXI A;  4YWO A;  1GRH A;  1TDK A;  4B69 A;  4DGK A;  2TMD A;  4G6G A;  4H2P A;  3IWA A;  4I58 A;  2CDU A;  1VQW A;  3D8X A;  4EIP A;  3QSE A;  3E1T A;  3AEG A;  3NNE A;  4ADW A;  4GAP A;  4H4U A;  2WEU A;  1H86 A;  3C4A A;  3CNT A;  2YG6 A;  2V60 A;  4OPU A;  4OPL A;  4U8I A;  3B3R A;  3PO7 A;  4A6N B;  2B9X A;  4C5O A;  1EVI A;  4BK2 A;  2WPF A;  1K0I A;  1NG3 A;  2EQ6 A;  3UTF A;  2E49 A;  4QFD A;  1VG9 A;  2ZBW A;  3ADA B;  3FBS A;  4CNK A;  1JEH A;  3LZW A;  4CY8 A;  1YQ4 A;  3FG2 P;  3QSM A;  4H4X A;  4OPI A;  3SZ0 A;  3T2Z A;  4EMI A;  5KNL A;  1E1M A;  3NYF A;  1JRX A;  2XDO A;  3KVE A;  1NHP A;  4A9W A;  1H82 A;  1GXF A;  1DNC A;  2BRY A;  2FJB A;  1QO8 A;  1IUX A;  3NRN A;  3GD4 A;  3LOV A;  3ICT A;  4E0V A;  4UDR A;  2YG4 A;  4FX9 A;  3DH9 A;  3CPJ G;  4TLZ A;  1LTX R;  4U8M A;  3ALL A;  4OPC A;  3UKL A;  4EM4 A;  2DU8 A;  4YTP A;  4C3Y A;  2A8X A;  4RSL A;  3VQR A;  3EAN A;  4Y4M A;  5IPY A;  2XFO A;  4YSY A;  3NYE A;  2BCP A;  4TM4 A;  4Z2T A;  3AE7 A;  4WCT A;  1ZY8 A;  1ELI A;  4NTD A;  2XVE A;  3CNJ A;  3H8I A;  2WP9 A;  1PBD A;  4YTM A;  1O94 A;  4EQR A;  4JNA A;  1CJ4 A;  2BXR A;  3NK2 X;  1JNR A;  4B64 A;  1ZMD A;  3M13 A;  4GDE A;  1PDH A;  4TLX A;  2YR6 A;  4J36 A;  4Z24 A;  3IHG A;  2YVG A;  3DJD A;  3GYJ A;  3NGC X;  2W0H A;  2BK5 A;  2RAB A;  3ALJ A;  1LQU A;  4OPG A;  3D1C A;  1FOH A;  1VRQ B;  3BNU A;  4LA1 A;  4H2Q A;  2JB1 A;  3ATR A;  5ER0 A;  5KWF A;  4H4W A;  2OAL A;  3T2K A;  2YM2 A;  3NIX A;  4Z44 A;  4YSX A;  2B9W A;  4G73 A;  1LQT A;  4TM0 A;  2WQY A;  4YT0 A;  4U8K A;  3O0H A;  2Q6U A;  1OJC A;  1XDI A;  3EPT A;  4A7A A;  4Z26 A;  2H89 A;  1E1K A;  4UDQ A;  2XLS A;  4U8P A;  4J57 A;  4K22 A;  3R9U A;  2J3N A;  3DK4 A;  1KDG A;  3SFD A;  4A79 A;  3NTA A;  3OZ2 A;  1B4V A;  5FMH A;  4DNA A;  1F8S A;  3UOX A;  3ATQ A;  4AP1 A;  1H7X A;  3DA1 A;  1UKV G;  2WET A;  3I3L A;  4AP3 A;  5HY5 A;  1ZK7 A;  1OJA A;  1EL9 A;  1JRZ A;  1Y56 A;  3M12 A;  3NN0 X;  5JCK A;  3I6D A;  3DME A;  4Z2R A;  3GSI A;  2NPX A;  1CC6 A;  1ZOY A;  3V3N A;  3DJG X;  3H8L A;  5JCL A;  1TDE A;  2GRT A;  3K30 A;  1S3B A;  3NK0 X;  3WGT A;  2APG A;  3ICS A;  4B65 A;  1GEU A;  4D03 A;  4NNJ A;  4JQ9 A;  3SZC A;  1OJT A;  1V59 A;  1JNZ A;  1DOB A;  5FS8 A;  5BRT A;  1N1P A;  1AOG A;  3SQP A;  1BZL A;  2R4J A;  1DXL A;  3B6D A;  4AT0 A;  3SM8 A;  4AOX A;  1GPE A;  3CPI G;  3BI4 A;  2C65 A;  1E1L A;  1K0J A;  5C3J A;  4J31 A;  4U8L A;  3M0O A;  1GRE A;  3K7Q X;  1ZMC A;  2GR2 A;  1JU2 A;  3KA7 A;  1JOA A;  1CC4 A;  3IHM A;  1C0L A;  1C0P A;  3GRT A;  1O5W A;  3FMW A;  4YSH A;  1DAO A;  3AD8 B;  4GCM A;  2Y6Q A;  4WX1 A;  4ECH A;  2B9Y A;  3RNM A;  4JNQ A;  1H83 A;  2AR8 A;  4A99 A;  2FBW A;  2YLS A;  5KVH A;  3KD9 A;  4NTC A;  1BWC A;  1PBF A;  4GDP A;  1F8W A;  4EMJ A;  2RGO A;  4X9N A;  4CY6 A;  2BK4 A;  1F3P A;  3GDN A;  3QJ4 A;  1XAN A;  1BKW A;  2R45 A;  2Q0L A;  4RG3 A;  4XWR A;  3SXI A;  4APN A;  4C74 A;  2GAH B;  1B8S A;  5C2T A;  4CNJ A;  4G74 A;  1PJ7 A;  2GQF A;  4H4S A;  2QAE A;  2GR1 A;  2ZZ0 A;  4OVI A;  1FEA A;  2V5Z A;  2XYO A;  4CCQ A;  4GUV A;  1NG4 A;  1YKJ A;  3UKK A;  4YJF A;  5FS6 A;  3LZX A;  1L9D A;  1IJH A;  1GET A;  2JAE A;  1D4E A;  5JCI A;  3AYL A;  5GRT A;  1P2H A;  2XFP A;  2CUL A;  1F6M A;  1Q1R A;  2HQM A;  3NHO X;  4H4Q A;  4II2 A;  2Y6R A;  1GRB A;  1TDO A;  4U8J A;  2XVI A;  4GF7 A;  2DKI A;  2C67 A;  3QVR A;  2VVM A;  1DOC A;  1W4X A;  1Y56 B;  4FK1 A;  2ARD A;  3KU9 A;  1D4C A;  1FL2 A;  2WOW A;  3Q9T A;  3KPK A;  2IVD A;  4NEV A;  1FEC A;  2WP6 A;  5HYM A;  1IUU A;  1HYU A;  1C0I A;  5IQ4 A;  2WHD A;  1D5T A;  1NHS A;  2YLR A;  3L8K A;  3UOY A;  4MJW A;  4NWZ A;  4P9S A;  2WDV A;  1NPX A;  4CBQ A;  4YXD A;  4IVO B;  1Q9I A;  4FDC B;  1IUW A;  2JK6 A;  4M52 A;  3BNM A;  2RGH A;  2GB0 A;  4YJH A;  3FIM B;  3VR9 A;  1D4D A;  3T37 A;  1KF6 A;  1GER A;  1RYI A;  3SX6 A;  1NDA A;  1CJ2 A;  2V61 A;  2YG5 A;  3CGC A;  1N4W A;  1NHR A;  4GAV A;  4U2S A;  4J34 A;  4ZCC A;  5IQ1 A;  3AD7 B;  2H88 A;  3ISH A;  3COX A;  1AN9 A;  4II3 A;  2WDR A;  3CGE A;  3DGZ A;  3G5Q A;  1GRF A;  1M6I A;  2XLP A;  2GR0 A;  3CMM A;  2WPE A;  3P4R A;  2JB3 A;  4EQS A;  5JCM A;  1Z6L A;  5JCN A;  1EL5 A;  4OPD A;  5EB5 A;  1LPF A;  2XVF A;  4O5Q A;  1YQ3 A;  3SZF A;  4Z2U A;  3GMB A;  2B7R A;  3H4K A;  4H2N A;  2R0C A;  3CNP A;  2CFY A;  2X8H A;  4KX6 A;  4BJZ A;  3EAO A;  4ZN0 A;  4BJY A;  5KVI A;  3K7T A;  2YLZ A;  3AE3 A;  4Y4N A;  2TPR A;  2BAC A;  4DSG A;  1E1N A;  2OLN A;  3LAD A;  1TDF A;  2GH5 A;  2WU5 A;  1VG0 A;  3K7M X;  1LV0 A;  1ONF A;  2BS3 A;  3VRB A;  3IF9 A;  4N9X A;  2VQ7 A;  3OC4 A;  3SYI A;  3GRS A;  3ZNN A;  3F8D A;  1GRG A;  1FEB A;  2C72 A;  2C3C A;  2B7S A;  5KOW A;  1S3E A;  2JKC A;  1VE9 A;  1QLB A;  1ZX9 A;  5U1O A;  3UKQ A;  1XHC A;  3HZL A;  2FJD A;  3P1W A;  2BS2 A;  2V3B A;  5EOW A;  2GQW A;  1DOE A;  4U2T A;  2A87 A;  3AED A;  2X8G A;  3NYC A;  4YJG A;  5U25 A;  3UTH A;  2R46 A;  1DDO A;  3PVC A;  1ZP0 A;  2Z5Y A;  3UKP A;  2I0Z A;  2YWL A;  3UOV A;  1D7L A;  3ZNP A;  3ALM A;  2YR5 A;  3FPZ A;  4BV6 A;  3AE8 A;  1PBC A;  1COY A;  2F5Z A;  1RP0 A;  3ICR A;  1TYT A;  4G6H A;  5BUK A;  5KOX A;  4TM1 A;  4X9M A;  2VOU A;  4A65 A;  2O9Z A;  3AEF A;  5L46 A;  3EF6 A;  2BRA A;  4IA6 A;  1K0L A;  1IUV A;  1EBD A;  2QA2 A;  5EB4 A;  3AWI A;  3C4N A;  1KSS A;  3AEE A;  2EQ9 A;  2BXS A;  3G5R A;  5FS7 A;  4A5L A;  2WP5 A;  3S61 A;  3AE9 A;  2BC0 A;  3AE6 A;  2OLO A;  4LII A;  4A6N A;  1L9E A;  2YG7 A;  3GWD A;  3RP8 A;  4B67 A;  4EQW A;  1NAA A;  1KFY A;  3DJE A;  3ZNO A;  1H84 A;  1S2Q A;  3AYJ A;  3HYV A;  5KMR A;  1E6E A;  1OJ9 A;  1MXT A;  5CKU A;  3AE2 A;  1NEN A;  3AD9 B;  2WU2 A;  3RP7 A;  1ZOV A;  3QVP A;  5J60 A;  5FS9 A;  2GMJ A;  2YM1 A;  4EQX A;  1VDC A;  4K5R A;  2Z5X A;  4H50 A;  1YQZ A;  2C64 A;  3P4P A;  3NTD A;  1L9C A;  4NZH A;  3DK8 A;  1MOK A;  4IVM B;  3S5W A;  1PJ6 A;  3V3O A;  4NEW A;  4EM3 A;  1QJD A;  2C70 A;  2YG3 A;  2R0P A;  3GDP A;  3G3E A;  1NEK A;  4G9K A;  4YTN A;  2PHH A;  3VRA A;  3W4K A;  4GR1 A;  2YLX A;  1O95 A;  3NT6 A;  4C77 A;  2C75 A;  4Z25 A;  3T14 A;  1N4V A;  3T2Y A;  3QSS A;  4IV9 A;  2Q7V A;  4H4P A;  4KPR A;  4K2X A;  2X99 A;  3ABV A;  3P4Q A;  1BGN A;  3G5S A;  3RED A;  3ZYX A;  1MO9 A;  1CJ3 A;  1E7P A;  2WPC A;  2YR4 A;  4OCG A;  3SFE A;  3GD3 A;  4LU6 A;  2V6O A;  1M64 A;  4YKG A;  4K8D A;  3SZW A;  1CL0 A;  3HYW A;  2DKH A;  1KIF A;  3CIR A;  4AT2 A;  3BI5 A;  2GV8 A;  3AXB A;  1H6V A;  3ZDN A;  3CPH G;  3W4I A;  2X50 A;  1SEZ A;  5KMP A;  1N4U A;  3T31 A;  3UKA A;  2XFN A;  2QA1 A;  3BHK A;  4Z43 A;  4UP3 A;  2BYB A;  2YLW A;  3DJJ A;  3UKF A;  1JRY A;  3BI2 A;  1BGJ A;  1ZKQ A;  5KXJ A;  2R9Z A;  3ITJ A;  1PN0 A;  3RP6 A;  4YKF A;  2OAM A;  4YJD A;  2X8C A;  4Y4L A;  1S2Y A;  2EQ7 A;  2YVF A;  1PXB A;  1ZDL A;  5J7X A;  3RHA A;  4FK1 C;  4D04 A;  1EL7 A;  3NLC A;  5TR3 A;  1GES A;  4RG4 A;  2XFU A;  2XVJ A;  2BA9 A;  4J56 A;  4BK1 A;  1IUT A;  2XLU A;  4USR A;  5LV9 A;  2R4E A;  3GWF A;  1PHH A;  1GRT A;  2PYX A;  2VQB A;  2ZZC A;  3CNS A;  3CTY A;  4O5U A;  1RSG A;  2GR3 A;  4K5S A;  3WE0 A;  3ZNQ A;  2GF3 A;  4JDR A;  2CVJ A;  4QFC A;  2XFQ A;  3UP5 A;  2WOI A;  3PS9 A;  1XPQ A;  4B68 A;  4GRT A;  4BUR A;  4JN9 A;  2C7G A;  2GMH A;  3KKJ A;  5KMS A;  1CJC A;  2WS3 A;  4EMW A;  5BVA A;  3HYX A;  1D7Y A;  5HHF A;  4H4T A;  2FJE A;  4J2W A;  1GV4 A;  3KPF A;  4J33 A;  4ZCD A;  2JBV A;  1H81 A;  2VVL G;  2E82 A;  4REK A;  3UTG A;  4C3X A;  1P2E A;  3AEA A;  4DSH A;  1GOS A;  1KSU A;  2XLR A;  3CGD A;  4CCR A;  5M10 A;  4YJF B;  4H4Y A;  2WDQ A;  2GAG B;  4USQ A;  3VR8 A;  2VVL A;  2C76 A;  1PBE A;  1X31 B;  2XCG A;  1KNP A;  1FCD A;  2YLT A;  1PS9 A;  3IC9 A;  1EL8 A;  3URH A;  5BUL A;  2A89 A;  1GTE A;  4CRT A;  2BAB A;  1GTH A;  2RGJ A;  4I59 A;  5CQF A;  1CHU A;  5DBJ A;  3F8R A;  1DJN A;  2V3A A;  3II4 A;  1IUS A;  1TRB A;  1TYP A;  3V76 A;  2WOV A;  2X3N A;  1L0V A;  1CBO A;  2VRM A;  3GYI A;  1NHQ A;  3NKS A;  4B66 A;  2VRL A;  4H4R A;  4YSZ A;  3UCL A;  1TDN A;  1LJ1 A;  4K7Z A;  4HA6 A;  3AYI A;  2YAU A;  3AB1 A;  2ZZB A;  2E1M A;  5EBK A;  3UKH A;  1BF3 A;  1KNR A;  4EIQ A;  4NTE A;  3AE4 A;  3AE1 A;  4YJH B;  2ACZ A;  2WES A;  2XVH A;  3UTE A;  5U63 A;  4B63 A;  3NK1 X;  1CC2 A;  1B37 A;  3Q6J A;  2C3D A;  4U8O A;  3JSK A;  3UOZ A;  3AEB A;  4IA5 A;  5M0Z A;  3L1R A;  3VRD B;  3QFB A;  2R0G A;  3DGH A;  4B1B A;  2QCU A;  1DOD A;  2BCG G;  4H4Z A;  1YY5 A;  3NG7 X;  3LJP A;  2WBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...