3NYFA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-histidine
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 122
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyfA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyfA01
4B64A 2WQYA 2FBWA 2YLSA 5M0ZA 3ADAB 1O95A 2IVDA 4Z2TA 1PN0A 5JCIA 2XLUA 1PXCA 1FEAA 4K5RA 3ALJA 3LB8A 4AP1A 1GRHA 3C4NA 1Q1WA 2VOUA 3F8RA 2GMHA 1OJTA 2O9ZA 2WOVA 3C96A 4H4TA 4USRA 2X8HA 3REDA 4AT2A 1CJCA 4Y4LA 2V5ZA 2Y6QA 1KFYA 5KOXA 4U8KA 2B9WA 1REOA 4GF7A 4EM3A 3NGCX 4ZCDA 3QFAA 2X99A 2X8CA 1L9EA 3HZLA 2XYOA 1ZKQA 3NHOX 2I0ZA 4YJFA 3UKHA 2X50A 4REKA 4JNAA 5KXJA 2YR5A 3CUKA 4YSZA 2B7SA 2OALA 1FCDA 4DGKA 4EQWA 4H4SA 2WP5A 2XVIA 4H4WA 1TDFA 4YTPA 5HHFA 1JNZA 4JY2A 3QSSA 2V60A 3V3OA 1DNCA 4OVIA 2PYXA 4A65A 1LTXR 1RP0A 4USQA 1H7XA 2VVMA 3QSMA 3AEEA 2JK6A 2R45A 2E82A 2XVHA 3AXBA 1YQZA 1ZOYA 1KSUA 1E6EA 1M6IA 2BS4A 4RG3A 1D4EA 1VG0A 2A87A 2BK3A 4TLZA 1P2EA 4XXGA 4XWZA 3IF9A 1IUUA 1DAOA 1BZLA 3DGZA 2AR8A 1CL0A 2R46A 4E0VA 4H2NA 1NHSA 2WDQA 1KF6A 3ALLA 1LVLA 1AOGA 3IHGA 4YJHA 1S2QA 2BCPA 3P9UA 4IVMB 4YJGA 2BS3A 1UKVG 3M13A 3KPFA 2A8XA 2JKCA 2XFUA 3UKPA 2GV8A 1DOCA 4RG4A 2R0PA 4BK2A 3CPJG 1F6MA 3B6DA 1GPEA 2GRTA 3QVPA 4UDPA 2C65A 1PJ7A 4BK1A 4FK1C 3KVEA 2C3DA 1GALA 3NH3X 1GTHA 3G3EA 4UP3A 1Q9IA 4H4UA 3P4SA 3ZDNA 2W0HA 3FPZA 3URHA 4H2PA 2ZZBA 2BABA 4J56A 3S61A 3NT6A 1NHQA 4KX6A 4RSLA 1LQTA 2WP9A 1IUXA 2C3CA 3DGHA 4OPDA 2TPRA 3VR8A 1CC6A 3AE6A 4ADWA 2JB1A 2EQ6A 1E1NA 2QCUA 1D7LA 4OPIA 3UKAA 1IUSA 2J3NA 3NG7X 4H4PA 4K5SA 1KSSA 2XFQA 4EQSA 1JEHA 2Q6UA 3UTGA 4NTCA 3UKKA 1O94A 2YWLA 1GRTA 2F5ZA 1L9DA 3AD7B 1N1PA 5BRTA 1YY5A 1YQ4A 1GREA 3S5WA 4UDRA 4KPRA 4B66A 4YTNA 3KLJA 2VRLA 3NK1X 2GMJA 3F8PA 2Z5XA 2IVEA 3CGCA 3OC4A 3FIMB 2E4AA 2YLXA 1MO9A 3LZXA 3H4KA 1F3PA 5EOWA 4CY6A 4YXDA 2E49A 1PDHA 5EB5A 1MOKA 4A6NB 1F8SA 3AEAA 4OPCA 4H2RA 4TM3A 3K7TA 1PBDA 4BJZA 1IUVA 1DDOA 4H4VA 1N4WA 1H6VA 1EL9A 1L9CA 3R9UA 3L1RA 2JB3A 1V59A 4CNKA 1GERA 1TDEA 2BACA 1H86A 4C74A 3PVCA 2TMDA 4HA6A 2YQUA 4GCMA 4J2WA 4Z2RA 3ICSA 3G5SA 1H82A 1B4VA 3P4PA 2PHHA 4Z2UA 2H89A 1H84A 4BV6A 1XANA 3BI5A 4AOSA 1GT8A 2JB2A 3CNPA 1ZOVA 3QFBA 1GETA 4D03A 3L8KA 2RGJA 3NK0X 2QAEA 2DKHA 3K7MX 4CRTA 4H50A 2YLWA 2CULA 3P1WA 1KNRA 3NN6X 5BULA 3UTEA 1PBBA 2IIDA 4Z26A 4P9SA 4ICYA 4JNQA 1SEZA 2YM2A 3IHMA 2V61A 3CGEA 3D1CA 2E1MA 1PJ5A 2XLRA 1TDNA 1GXFA 3EPTA 3RP7A 1GEUA 1EL8A 1BF3A 3DJGX 1VRQB 3FBSA 4NTDA 3GYIA 2WPFA 3UP5A 3UOYA 2X8GA 3GMCA 1X31B 1GESA 2B9YA 3WE0A 3KA7A 1EL5A 1VQWA 4OPGA 1ZMCA 1BGNA 5CKUA 2RGHA 1F8RA 3B3RA 5FS7A 3SGLA 2H88A 4C3XA 4X9NA 1E1LA 4EM4A 4H4ZA 3AE9A 2RGOA 4BK3A 3GDNA 1LV0A 5GRTA 3SFDA 3M0OA 4OPUA 5HXIA 4JDRA 3Q9TA 3ATQA 5DBJA 3V76A 3AWIA 2BXSA 1GTEA 2C73A 3AECA 3GYJA 4WX1A 1IUWA 3C4AA 3PO7A 2WETA 1VDCA 4AOXA 3KD9A 2AAQA 1NG4A 2WU5A 1DXLA 2GR2A 4YWOA 2YG6A 5IQ4A 4C5OA 2FJAA 4CBQA 4A6NA 4J36A 4FDCB 3AYLA 2R4JA 1XHCA 1FOHA 2FJBA 1C0LA 2ZBWA 1DODA 1FEBA 3EANA 4H4RA 1K0LA 5BVAA 3LADA 1Z6LA 4BURA 5BUKA 4DSHA 2OLOA 3BHFA 3DA1A 2BCGG 4U2TA 4Z24A 3OZ2A 4A99A 2CFYA 2CVJA 3W4KA 1TYPA 2R0GA 5EB4A 3GWFA 3KKJA 3AYJA 3II4A 4CCQA 1ZP0A 5JCNA 4EQRA 4U8OA 4B65A 1B5QA 5KRQA 2Q0KA 5IQ1A 2WHDA 3O0HA 1AN9A 2E4GA 2ZZCA 3VRAA 1D4CA 2OLNA 2WDRA 4J34A 4EMWA 3NK2X 1ZY8A 4TM4A 3UKQA 4IA5A 1CC4A 2BYBA 2C72A 4Y4NA 3NYEA 1GV4A 5U25A 4HB9A 3QJ4A 3NN0X 1PJ6A 4H4QA 4JN9A 4YT0A 1CJ2A 4GDPA 1JU2A 1E7PA 3LZWA 1P2HA 3FG2P 3ZNOA 3ICTA 2WPEA 4U8IA 1IUTA 1VG9A 3COXA 1ZX9A 3WGTA 1CJ4A 3DJEA 2XCGA 2DU8A 1CJ3A 1F8WA 3RNMA 1Y56B 1QJDA 4DSGA 4YJFB 5KVHA 1PXAA 1Q1RA 3Q6JA 3BHKA 4CNJA 1K0IA 2GR0A 4TLXA 2VRMA 4EIQA 5JCLA 3UCLA 5GSNA 1BKWA 1FECA 2WOIA 1RSGA 1DJNA 3UTHA 4A9WA 2C76A 4A7AA 1CBOA 4I58A 2WBAA 2B76A 3LJPA 4U2LA 1GRFA 1EL7A 1IJHA 1NPXA 3BNUA 4D04A 3GWDA 1YKJA 3ICRA 4LU6A 1TDOA 2FJEA 1VE9A 1CHUA 3UOVA 1PHHA 3GSIA 4U8NA 3AE7A 4K7ZA 5HYMA 2EQ8A 2WOWA 3NKSA 3ZNQA 3VRDB 1EVIA 3NYFA 1ZMDA 2RABA 2XDOA 2YVJA 2EQ9A 1OJ9A 2GH5A 4PABA 4GR1A 5FS6A 4Z43A 5KOWA 3NRNA 2V3AA 4BJYA 3VR9A 1ZDLA 1MXTA 1E1KA 1NDAA 3GRSA 2XVEA 4ZN0A 1B37A 2BC1A 3GMBA 3BI2A 3RHAA 4A79A 1RYIA 1N4VA 3AEFA 1W4XA 1BGJA 3CPIG 4AP3A 1S3EA 2QA1A 2XVFA 3AEBA 3CTYA 4ZCCA 3W4JA 2ACZA 2Y6RA 3UP4A 4J31A 1JOAA 2C70A 4OPLA 4B69A 1KNPA 4TM0A 3DJDA 1DOBA 1PBFA 2WDVA 4LA1A 1EBDA 1BWCA 4U8MA 2BK4A 2NVKX 2JBVA 2V3BA 4JQ9A 3UOZA 3GD4A 3QVRA 3ZNPA 2BS2A 1XPQA 3W4IA 2YM1A 1C0KA 2C7GA 1QO8A 3CNSA 1M64A 3G5RA 4FK1A 3K7QX 1GRAA 3UKLA 3D8XA 2HQMA 5C3JA 2E5VA 3CNJA 4XWRA 1D4DA 4ECHA 1PBCA 2X3NA 4GRTA 4YSXA 3GDPA 4C77A 1H7WA 3NYCA 1CF3A 3LOVA 1QLBA 5IPYA 3ISHA 1Y0PA 3BI4A 1H81A 3NIXA 2XLSA 2GAGB 1NEKA 4YSHA 4U8JA 2WEUA 2GB0A 2GAHB 2Q0LA 2YR6A 4YJDA 1D5TA 4A5LA 2APGA 3AE1A 1LJ1A 1Y56A 3AE2A 3EAOA 5J60A 4CY8A 4U8LA 2R4EA 1HYUA 2VZ2A 1PS9A 2YG4A 3DK4A 4MJWA 2WPCA 4H2QA 5HY5A 3G5QA 1KDGA 1JNRA 1LQUA 2R0CA 2A89A 1GSNA 4YTMA 3H8IA 4U8PA 3AEDA 4UDQA 5FS9A 2QA2A 4YSYA 3P4QA 3JSKA 4NEWA 2WS3A 4IVOB 2AQJA 2WP6A 3SQPA 4K8DA 2DKIA 1K0JA 5J7XA 5JCKA 4H4XA 2C67A 1NHPA 2ARDA 3AE4A 1TYTA 4GUVA 2JAEA 2XLTA 3ITJA 3M12A 2ZZ0A 3DH9A 5KVIA 1JRZA 2WU2A 1ZK7A 2XLPA 4EMIA 4QFCA 1C0PA 3V3NA 2GQFA 2YLZA 1E1MA 1LPFA 4H7UA 2Q7VA 1JRXA 3GD3A 2YG3A 3CNTA 3K30A 3UKFA 4QFDA 1N4UA 5C2TA 1NG3A 1YQ3A 2BC0A 2XFPA 3RP8A 3I6DA 2YVFA 3NTAA 1E39A 3NTDA 2EQ7A 2YG7A 2E48A 5TR3A 1JRYA 2B7RA 3LXDA 3ABVA 5EBKA 5U63A 3DJJA 3DK9A 3EF6A 3UTFA 1K4QA 1S2YA 3T37A 4LIIA 3SFEA 3PS9A 3VRBA 2CDUA 4GDEA 3ZNNA 1GOSA 3AD8B 2VVLG 1FL2A 1GRGA 2XFNA 2XFOA 2YR4A 1S3BA 2YG5A 4Z44A 1XDIA 3UOXA 1PBEA 4Z25A 1DJQA 4AT0A 3AE3A 4PAAA 1C0IA 3AD9B 4CCRA 3ZYXA 2GVCA 4Y4MA 5FS8A 2GEWA 2GR1A 4O5QA 1ELIA 2VQ7A 1TRBA 3AE8A 1NAAA 2YLRA 2BK5A 3CPHG 4EMJA 2GF3A 3DMEA 2VQBA 1NENA 5ER0A 4H4YA 2YLTA 4IA6A 2C75A 2Z5YA 2WESA 4X9MA 2BA9A 2V6OA 5M10A 4OPTA 2UZZA 1D7YA 2GQWA 1OJAA 1B8SA 1GNDA 1DOEA 2OA1A 3SM8A 1NHRA 1OJDA 3QSEA 3KU9A 4IV9A 2XVJA 3GRTA 1GRBA 3E1TA 4NEVA 1PXBA 1TDKA 4YKGA 1CC2A 1KIFA 4B68A 3IWAA 4OCGA 5FMHA 4M52A 4TM1A 1ONFA 1OJCA 3FMWA 4EQXA 3P4RA 5CQFA 2C66A 3F8DA 4O5UA 3CIRA 3CGBA 3CN8A 4J33A 4FX9A 5L46A 1COYA 3VQRA 1O5WA 3CNDA 4JY3A 4DNAA 2C64A 4YJHB 3CGDA 4YKFA 4NZHA 3NNEA 4YJGB 4NTEA 2VVLA 3AEGA 3ATRA 3AYIA 4WCTA 3AE5A 2YVGA 2GR3A 4J57A 4K22A 5JCMA 4B67A 5U1OA 4B63A 3I3LA 1L0VA 3BNMA 2BXRA 5LV9A 3H8LA 3NLCA 2FJDA 3IC9A 4K2XA 3DK8A 4U2SA 4I59A 3RP6A 2NPXA 3ALMA 2R9ZA 4X4JA 4APNA 4EIPA 2B9XA 3AB1A 1H83A 2OAMA 2YAUA 5KWFA 4B1BA 4C3YA 4N9XA
chains in the Genus database with same CATH superfamily
4B64A 2WQYA 2FBWA 2YLSA 4G6HA 3ADAB 1O95A 5M0ZA 2IVDA 1PN0A 4Z2TA 2XLUA 1PXCA 1FEAA 4K5RA 3ALJA 3LB8A 4AP1A 1GRHA 3C4NA 2VOUA 1Q1WA 3F8RA 2GMHA 3C96A 1OJTA 2O9ZA 2WOVA 4H4TA 4USRA 2X8HA 3REDA 4AT2A 1CJCA 4Y4LA 2V5ZA 2Y6QA 1KFYA 5KOXA 4U8KA 3SX6A 2B9WA 1REOA 5JCIA 4GF7A 4EM3A 3NGCX 4ZCDA 3QFAA 2X99A 2X8CA 1L9EA 3HZLA 2XYOA 1ZKQA 3NHOX 2I0ZA 4YJFA 3UKHA 2X50A 4REKA 4JNAA 5KXJA 2YR5A 3T0KA 3CUKA 4YSZA 2B7SA 2OALA 1FCDA 4DGKA 4EQWA 4H4SA 2WP5A 2XVIA 4H4WA 1TDFA 4YTPA 5HHFA 4JY2A 1JNZA 3QSSA 2V60A 3V3OA 1DNCA 4OVIA 2PYXA 4A65A 1LTXR 1RP0A 4USQA 1H7XA 2VVMA 3QSMA 3AEEA 2JK6A 2R45A 2E82A 2XVHA 3AXBA 1YQZA 1ZOYA 1KSUA 1E6EA 1M6IA 2BS4A 4RG3A 1D4EA 1VG0A 2A87A 2BK3A 4TLZA 1P2EA 4XXGA 4XWZA 3IF9A 1IUUA 1DAOA 1BZLA 3DGZA 2AR8A 1CL0A 4GAVA 2R46A 4E0VA 4H2NA 1NHSA 2WDQA 1KF6A 4G9KA 3ALLA 1LVLA 1AOGA 3IHGA 4YJHA 1S2QA 2BCPA 3P9UA 4IVMB 4YJGA 2BS3A 1UKVG 3M13A 3KPFA 5KMSA 3T31A 2A8XA 2JKCA 2XFUA 3UKPA 3SZ0A 2GV8A 1DOCA 4RG4A 2R0PA 4BK2A 3CPJG 1F6MA 3B6DA 1GPEA 2GRTA 3QVPA 4UDPA 2BRAA 2C65A 1PJ7A 4BK1A 4FK1C 3KVEA 2C3DA 1GALA 3NH3X 1GTHA 3G3EA 4UP3A 1Q9IA 4H4UA 3P4SA 3ZDNA 2W0HA 3FPZA 3URHA 4H2PA 2ZZBA 2BABA 4J56A 3S61A 3NT6A 1NHQA 4KX6A 4RSLA 1LQTA 2WP9A 1IUXA 2C3CA 3DGHA 4OPDA 2TPRA 3VR8A 1CC6A 3AE6A 4ADWA 2JB1A 2BRYA 2EQ6A 1E1NA 2QCUA 1D7LA 4OPIA 3UKAA 1IUSA 2J3NA 3NG7X 4H4PA 4K5SA 1KSSA 2XFQA 4EQSA 1JEHA 2Q6UA 3T2KA 3UTGA 4NTCA 2C4CA 3UKKA 1O94A 2YWLA 1GRTA 2F5ZA 1L9DA 3AD7B 1N1PA 5BRTA 1YY5A 1YQ4A 1GREA 3S5WA 4UDRA 4KPRA 4B66A 4YTNA 3KLJA 2VRLA 3NK1X 2GMJA 3F8PA 2Z5XA 2IVEA 3CGCA 3OC4A 3FIMB 2E4AA 2YLXA 1MO9A 3LZXA 3H4KA 1F3PA 5EOWA 4CY6A 4YXDA 2E49A 1PDHA 3HYVA 5EB5A 1MOKA 4A6NB 1F8SA 3AEAA 4OPCA 4H2RA 4TM3A 3K7TA 1PBDA 5KNLA 4BJZA 1IUVA 1DDOA 4H4VA 1N4WA 1H6VA 1EL9A 1L9CA 3R9UA 3L1RA 2JB3A 1V59A 4CNKA 1GERA 1TDEA 2BACA 1H86A 4C74A 3PVCA 2TMDA 4HA6A 2YQUA 4GCMA 4J2WA 4Z2RA 3ICSA 3G5SA 1H82A 1B4VA 3P4PA 2PHHA 4Z2UA 2H89A 1H84A 4BV6A 1XANA 3BI5A 4AOSA 1GT8A 2JB2A 3CNPA 1ZOVA 3QFBA 1GETA 4D03A 3L8KA 2RGJA 3NK0X 2QAEA 2DKHA 3K7MX 4CRTA 4H50A 2YLWA 2CULA 3P1WA 1KNRA 3NN6X 5BULA 3UTEA 1PBBA 2IIDA 4Z26A 4P9SA 4ICYA 4JNQA 1SEZA 3SY4A 3HYWA 2YM2A 3IHMA 2V61A 3CGEA 3D1CA 2E1MA 1PJ5A 2XLRA 1TDNA 1GXFA 3EPTA 3RP7A 1GEUA 1EL8A 1BF3A 3DJGX 1VRQB 3FBSA 4NTDA 3GYIA 2WPFA 3UP5A 3UOYA 3GMCA 2X8GA 1X31B 1GESA 2B9YA 3WE0A 3KA7A 1EL5A 1VQWA 4OPGA 3SXIA 1ZMCA 1BGNA 5CKUA 2RGHA 1F8RA 3B3RA 5FS7A 3SGLA 2H88A 5KMQA 4X9NA 1E1LA 4C3XA 4H4ZA 4EM4A 3AE9A 2RGOA 4NWZA 4BK3A 5HXIA 1LV0A 3GDNA 5GRTA 3M0OA 4OPUA 3SFDA 4JDRA 3Q9TA 3ATQA 5DBJA 3V76A 3AWIA 2BXSA 1GTEA 2C73A 3AECA 3GYJA 4WX1A 1IUWA 3C4AA 3PO7A 2WETA 4G73A 1VDCA 4AOXA 3KD9A 4II3A 2AAQA 1NG4A 2WU5A 1DXLA 3T2YA 2GR2A 4YWOA 2YG6A 5IQ4A 4C5OA 2FJAA 4CBQA 3GYXA 4A6NA 4J36A 4FDCB 3AYLA 2R4JA 1XHCA 4G74A 1FOHA 2FJBA 1C0LA 2ZBWA 1DODA 3T14A 1FEBA 3EANA 4H4RA 5KMPA 1K0LA 5BVAA 3LADA 1Z6LA 4BURA 5BUKA 4DSHA 2OLOA 3BHFA 3DA1A 2BCGG 4U2TA 4Z24A 3OZ2A 4A99A 2CFYA 2CVJA 3W4KA 1TYPA 2R0GA 5EB4A 3GWFA 3KKJA 3AYJA 3II4A 4CCQA 1ZP0A 5JCNA 4EQRA 4U8OA 4B65A 1B5QA 5KRQA 2Q0KA 5IQ1A 2WHDA 3O0HA 1AN9A 2E4GA 2ZZCA 3VRAA 1D4CA 2OLNA 2WDRA 4J34A 4EMWA 3NK2X 1ZY8A 4TM4A 3UKQA 4IA5A 1CC4A 2BYBA 2C72A 4Y4NA 3NYEA 1GV4A 5U25A 4HB9A 3QJ4A 3NN0X 1PJ6A 4H4QA 4JN9A 4YT0A 1CJ2A 4GDPA 1JU2A 1E7PA 3LZWA 1P2HA 3FG2P 3ZNOA 3ICTA 2WPEA 4U8IA 1IUTA 1VG9A 3COXA 1ZX9A 3WGTA 1CJ4A 3DJEA 2XCGA 2DU8A 1CJ3A 1F8WA 3RNMA 1Y56B 1QJDA 4DSGA 4YJFB 5KVHA 1PXAA 1Q1RA 3Q6JA 3BHKA 4CNJA 1K0IA 4EIQA 2GR0A 2VRMA 4TLXA 5JCLA 3UCLA 5GSNA 1BKWA 1FECA 2WOIA 1RSGA 1DJNA 3UTHA 4A9WA 2C76A 4A7AA 1CBOA 4I58A 2WBAA 2B76A 3LJPA 4U2LA 1GRFA 1EL7A 1IJHA 1NPXA 3BNUA 4D04A 3GWDA 3HYXA 1YKJA 3ICRA 4LU6A 1TDOA 2FJEA 1VE9A 1CHUA 3UOVA 1PHHA 3GSIA 5HYMA 3AE7A 4K7ZA 4U8NA 2EQ8A 2WOWA 3NKSA 3ZNQA 3VRDB 5KMRA 1EVIA 3NYFA 1ZMDA 2RABA 2XDOA 2YVJA 2EQ9A 1OJ9A 2GH5A 4PABA 4GR1A 5FS6A 4Z43A 5KOWA 3NRNA 2V3AA 4BJYA 3VR9A 1ZDLA 1MXTA 1E1KA 1NDAA 3GRSA 2XVEA 4ZN0A 1B37A 3GMBA 2BC1A 3BI2A 3RHAA 3T2ZA 4A79A 1RYIA 1N4VA 3SZCA 4GAPA 3AEFA 1W4XA 1BGJA 3CPIG 4AP3A 1S3EA 2QA1A 2XVFA 3AEBA 3CTYA 4ZCCA 3W4JA 2ACZA 2Y6RA 3UP4A 4J31A 1JOAA 2C70A 4OPLA 4B69A 1KNPA 4TM0A 3DJDA 1DOBA 1PBFA 2WDVA 4LA1A 1EBDA 1BWCA 4U8MA 2BK4A 2NVKX 2JBVA 2V3BA 4JQ9A 3UOZA 3GD4A 3QVRA 3ZNPA 2BS2A 1XPQA 3W4IA 2YM1A 1C0KA 2C7GA 1QO8A 3CNSA 1M64A 3G5RA 4FK1A 3K7QX 1GRAA 3UKLA 3D8XA 2HQMA 3SZWA 5C3JA 2E5VA 3CNJA 4XWRA 1D4DA 4ECHA 1PBCA 2X3NA 4GRTA 4YSXA 3GDPA 4C77A 1H7WA 3NYCA 3CMMA 1CF3A 3LOVA 1QLBA 5IPYA 3ISHA 1Y0PA 3BI4A 1H81A 3NIXA 2XLSA 2GAGB 1NEKA 4YSHA 4U8JA 2WEUA 2GB0A 2GAHB 2Q0LA 2YR6A 4YJDA 1D5TA 3KPKA 4A5LA 2APGA 3AE1A 1LJ1A 1Y56A 3AE2A 3EAOA 5J60A 4CY8A 4U8LA 2R4EA 1HYUA 2VZ2A 1PS9A 2YG4A 3DK4A 4MJWA 4H2QA 2WPCA 5HY5A 3G5QA 1KDGA 1JNRA 2R0CA 1LQUA 2A89A 1GSNA 4YTMA 3H8IA 4U8PA 3AEDA 4UDQA 5FS9A 2QA2A 4YSYA 3P4QA 3JSKA 4NEWA 2WS3A 4IVOB 4II2A 2AQJA 2WP6A 3SQPA 4K8DA 2DKIA 1K0JA 5J7XA 5JCKA 4H4XA 2C67A 1NHPA 2ARDA 3AE4A 1TYTA 4GUVA 3SYIA 2JAEA 2XLTA 3ITJA 3M12A 2ZZ0A 3DH9A 5KVIA 1JRZA 2WU2A 1ZK7A 2XLPA 4NNJA 4EMIA 4QFCA 1C0PA 3V3NA 2GQFA 2YLZA 1E1MA 1LPFA 4H7UA 2Q7VA 1JRXA 3GD3A 2YG3A 3CNTA 3K30A 3UKFA 4QFDA 1N4UA 5C2TA 1NG3A 1YQ3A 2BC0A 3RP8A 2XFPA 3I6DA 2YVFA 3NTAA 1E39A 3NTDA 2EQ7A 2YG7A 2E48A 5TR3A 1JRYA 2B7RA 3LXDA 3ABVA 5EBKA 5U63A 3DJJA 3DK9A 3EF6A 3UTFA 1K4QA 1S2YA 3T37A 4LIIA 3SFEA 3PS9A 3VRBA 2CDUA 4G6GA 4GDEA 3ZNNA 1GOSA 3AD8B 2VVLG 1FL2A 1GRGA 2XFNA 2XFOA 2YR4A 1S3BA 2YG5A 4Z44A 1XDIA 3UOXA 1PBEA 4Z25A 1DJQA 4AT0A 3AE3A 4PAAA 1C0IA 3AD9B 4CCRA 3ZYXA 2GVCA 4Y4MA 5FS8A 2GEWA 2GR1A 4O5QA 1ELIA 2VQ7A 1TRBA 3AE8A 1NAAA 2YLRA 2BK5A 3CPHG 4EMJA 2GF3A 3DMEA 2VQBA 1NENA 5ER0A 4H4YA 2YLTA 4IA6A 2C75A 2Z5YA 2WESA 4X9MA 2BA9A 2V6OA 5M10A 4OPTA 2UZZA 1D7YA 2GQWA 1OJAA 1B8SA 1GNDA 1DOEA 2OA1A 3SM8A 1NHRA 1OJDA 3QSEA 3KU9A 4IV9A 2XVJA 3GRTA 1GRBA 3SZFA 3E1TA 4NEVA 1PXBA 1TDKA 4YKGA 1CC2A 1KIFA 4B68A 3IWAA 4OCGA 5FMHA 4M52A 4TM1A 1ONFA 1OJCA 3FMWA 4EQXA 3P4RA 5CQFA 2C66A 3F8DA 4O5UA 3CIRA 3CGBA 3CN8A 4J33A 4FX9A 5L46A 1COYA 3VQRA 1O5WA 4JY3A 3CNDA 4DNAA 2C64A 4YJHB 3CGDA 4YKFA 4NZHA 3NNEA 4YJGB 4NTEA 2VVLA 3AEGA 3ATRA 3AYIA 4WCTA 3AE5A 2YVGA 2GR3A 4J57A 4K22A 5JCMA 4B67A 5U1OA 4B63A 3I3LA 1L0VA 3BNMA 2BXRA 5LV9A 3H8LA 3NLCA 2FJDA 3IC9A 4K2XA 3DK8A 4U2SA 4I59A 3RP6A 3ALMA 4EIPA 2NPXA 2R9ZA 4X4JA 4APNA 2B9XA 3AB1A 1H83A 2OAMA 2YAUA 5KWFA 4B1BA 4C3YA 4N9XA
chains in the Genus database with same CATH topology
4B64A 2WQYA 2FBWA 2YLSA 4G6HA 3ADAB 1O95A 5M0ZA 2IVDA 1PN0A 4Z2TA 2XLUA 1PXCA 1FEAA 4K5RA 3ALJA 3LB8A 4AP1A 1GRHA 3C4NA 1Q1WA 2VOUA 3F8RA 2GMHA 1OJTA 2O9ZA 2WOVA 3C96A 4H4TA 4USRA 2X8HA 3REDA 4AT2A 1CJCA 4Y4LA 2V5ZA 2Y6QA 1KFYA 5KOXA 4U8KA 3SX6A 2B9WA 1REOA 5JCIA 4GF7A 4EM3A 3NGCX 4ZCDA 3QFAA 2X99A 2X8CA 1L9EA 3HZLA 2XYOA 1ZKQA 3NHOX 2I0ZA 4YJFA 3UKHA 2X50A 4REKA 4JNAA 5KXJA 2YR5A 3T0KA 3CUKA 4YSZA 2B7SA 2OALA 1FCDA 4DGKA 4EQWA 4H4SA 2WP5A 2XVIA 4H4WA 1TDFA 4YTPA 5HHFA 1JNZA 4JY2A 3QSSA 2V60A 3V3OA 1DNCA 4OVIA 2PYXA 4A65A 1LTXR 1RP0A 4USQA 1H7XA 2VVMA 3QSMA 3AEEA 2JK6A 2R45A 2E82A 2XVHA 3AXBA 1YQZA 1ZOYA 1KSUA 1E6EA 1M6IA 2BS4A 4RG3A 1D4EA 1VG0A 2A87A 2BK3A 4TLZA 1P2EA 4XXGA 4XWZA 3IF9A 1IUUA 1DAOA 1BZLA 3DGZA 2AR8A 1CL0A 4GAVA 2R46A 4E0VA 4H2NA 1NHSA 2WDQA 1KF6A 4G9KA 3ALLA 1LVLA 1AOGA 3IHGA 4YJHA 1S2QA 2BCPA 3P9UA 4IVMB 4YJGA 2BS3A 1UKVG 3M13A 3KPFA 5KMSA 3T31A 2A8XA 2JKCA 2XFUA 3UKPA 3SZ0A 2GV8A 1DOCA 4RG4A 2R0PA 4BK2A 3CPJG 1F6MA 3B6DA 1GPEA 2GRTA 3QVPA 4UDPA 2BRAA 2C65A 1PJ7A 4BK1A 4FK1C 3KVEA 2C3DA 1GALA 3NH3X 1GTHA 3G3EA 4UP3A 1Q9IA 4H4UA 3P4SA 3ZDNA 2W0HA 3FPZA 3URHA 4H2PA 2ZZBA 2BABA 4J56A 3S61A 3NT6A 1NHQA 4KX6A 4RSLA 1LQTA 2WP9A 1IUXA 2C3CA 3DGHA 4OPDA 2TPRA 3VR8A 1CC6A 3AE6A 4ADWA 2JB1A 2BRYA 2EQ6A 1E1NA 2QCUA 1D7LA 4OPIA 3UKAA 1IUSA 2J3NA 3NG7X 4H4PA 4K5SA 1KSSA 2XFQA 4EQSA 1JEHA 2Q6UA 3T2KA 3UTGA 4NTCA 2C4CA 3UKKA 1O94A 2YWLA 1GRTA 2F5ZA 1L9DA 3AD7B 1N1PA 5BRTA 1YY5A 1YQ4A 1GREA 3S5WA 4UDRA 4KPRA 4B66A 4YTNA 3KLJA 2VRLA 3NK1X 2GMJA 3F8PA 2Z5XA 2IVEA 3CGCA 3OC4A 3FIMB 2E4AA 2YLXA 1MO9A 3LZXA 3H4KA 1F3PA 5EOWA 4CY6A 4YXDA 2E49A 1PDHA 3HYVA 5EB5A 1MOKA 4A6NB 1F8SA 3AEAA 4OPCA 4H2RA 4TM3A 3K7TA 1PBDA 5KNLA 4BJZA 1IUVA 1DDOA 4H4VA 1N4WA 1H6VA 1EL9A 1L9CA 3R9UA 3L1RA 2JB3A 1V59A 4CNKA 1GERA 1TDEA 2BACA 1H86A 4C74A 3PVCA 2TMDA 4HA6A 2YQUA 4GCMA 4J2WA 4Z2RA 3ICSA 3G5SA 1H82A 1B4VA 3P4PA 2PHHA 4Z2UA 2H89A 1H84A 4BV6A 1XANA 3BI5A 4AOSA 1GT8A 2JB2A 3CNPA 1ZOVA 3QFBA 1GETA 4D03A 3L8KA 2RGJA 3NK0X 2QAEA 2DKHA 3K7MX 4CRTA 4H50A 2YLWA 2CULA 3P1WA 1KNRA 3NN6X 5BULA 3UTEA 1PBBA 2IIDA 4Z26A 4P9SA 4ICYA 4JNQA 1SEZA 3SY4A 3HYWA 2YM2A 3IHMA 2V61A 3CGEA 3D1CA 2E1MA 1PJ5A 2XLRA 1TDNA 1GXFA 3EPTA 3RP7A 1GEUA 1EL8A 1BF3A 3DJGX 1VRQB 3FBSA 4NTDA 3GYIA 2WPFA 3UP5A 3UOYA 2X8GA 3GMCA 1X31B 1GESA 2B9YA 3WE0A 3KA7A 1EL5A 1VQWA 4OPGA 3SXIA 1ZMCA 1BGNA 5CKUA 2RGHA 1F8RA 3B3RA 5FS7A 3SGLA 2H88A 5KMQA 4X9NA 1E1LA 4C3XA 4H4ZA 4EM4A 3AE9A 2RGOA 4NWZA 4BK3A 3GDNA 1LV0A 5GRTA 3SFDA 3M0OA 4OPUA 5HXIA 4JDRA 3Q9TA 3ATQA 5DBJA 3V76A 3AWIA 2BXSA 1GTEA 2C73A 3AECA 3GYJA 4WX1A 1IUWA 3C4AA 3PO7A 2WETA 4G73A 1VDCA 4AOXA 3KD9A 4II3A 2AAQA 1NG4A 2WU5A 1DXLA 3T2YA 2GR2A 4YWOA 2YG6A 5IQ4A 4C5OA 2FJAA 4CBQA 3GYXA 4A6NA 4J36A 4FDCB 3AYLA 2R4JA 1XHCA 4G74A 1FOHA 2FJBA 1C0LA 2ZBWA 1DODA 3T14A 1FEBA 3EANA 4H4RA 5KMPA 1K0LA 5BVAA 3LADA 1Z6LA 4BURA 5BUKA 4DSHA 2OLOA 3BHFA 3DA1A 2BCGG 4U2TA 4Z24A 3OZ2A 4A99A 2CFYA 2CVJA 3W4KA 1TYPA 2R0GA 5EB4A 3GWFA 3KKJA 3AYJA 3II4A 4CCQA 1ZP0A 5JCNA 4EQRA 4U8OA 4B65A 1B5QA 5KRQA 2Q0KA 5IQ1A 2WHDA 3O0HA 1AN9A 2E4GA 2ZZCA 3VRAA 1D4CA 2OLNA 2WDRA 4J34A 4EMWA 3NK2X 1ZY8A 4TM4A 3UKQA 4IA5A 1CC4A 2BYBA 2C72A 4Y4NA 3NYEA 1GV4A 5U25A 4HB9A 3QJ4A 3NN0X 1PJ6A 4H4QA 4JN9A 4YT0A 1CJ2A 4GDPA 1JU2A 1E7PA 3LZWA 1P2HA 3FG2P 3ZNOA 3ICTA 2WPEA 4U8IA 1IUTA 1VG9A 3COXA 1ZX9A 3WGTA 1CJ4A 3DJEA 2XCGA 2DU8A 1CJ3A 1F8WA 3RNMA 1Y56B 1QJDA 4DSGA 4YJFB 5KVHA 1PXAA 1Q1RA 3Q6JA 3BHKA 4CNJA 1K0IA 2GR0A 4TLXA 2VRMA 4EIQA 5JCLA 3UCLA 5GSNA 1BKWA 1FECA 2WOIA 1RSGA 1DJNA 3UTHA 4A9WA 2C76A 4A7AA 1CBOA 4I58A 2WBAA 2B76A 3LJPA 4U2LA 1GRFA 1EL7A 1IJHA 1NPXA 3BNUA 4D04A 3GWDA 3HYXA 1YKJA 3ICRA 4LU6A 1TDOA 2FJEA 1VE9A 1CHUA 3UOVA 1PHHA 3GSIA 4U8NA 3AE7A 4K7ZA 5HYMA 2EQ8A 2WOWA 3NKSA 3ZNQA 3VRDB 5KMRA 1EVIA 3NYFA 1ZMDA 2RABA 2XDOA 2YVJA 2EQ9A 1OJ9A 2GH5A 4PABA 4GR1A 5FS6A 4Z43A 5KOWA 3NRNA 2V3AA 4BJYA 3VR9A 1ZDLA 1MXTA 1E1KA 1NDAA 3GRSA 2XVEA 4ZN0A 1B37A 2BC1A 3GMBA 3BI2A 3RHAA 3T2ZA 4A79A 1RYIA 1N4VA 3SZCA 4GAPA 3AEFA 1W4XA 1BGJA 3CPIG 4AP3A 1S3EA 2QA1A 2XVFA 3AEBA 3CTYA 4ZCCA 3W4JA 2ACZA 2Y6RA 3UP4A 4J31A 1JOAA 2C70A 4OPLA 4B69A 1KNPA 4TM0A 3DJDA 1DOBA 1PBFA 2WDVA 4LA1A 1EBDA 1BWCA 4U8MA 2BK4A 2NVKX 2JBVA 2V3BA 4JQ9A 3UOZA 3GD4A 3QVRA 3ZNPA 2BS2A 1XPQA 3W4IA 2YM1A 1C0KA 2C7GA 1QO8A 3CNSA 1M64A 3G5RA 4FK1A 3K7QX 1GRAA 3UKLA 3D8XA 2HQMA 3SZWA 5C3JA 2E5VA 3CNJA 4XWRA 1D4DA 4ECHA 1PBCA 2X3NA 4GRTA 4YSXA 3GDPA 4C77A 1H7WA 3NYCA 3CMMA 1CF3A 3LOVA 1QLBA 5IPYA 3ISHA 1Y0PA 3BI4A 1H81A 3NIXA 2XLSA 2GAGB 1NEKA 4YSHA 4U8JA 2WEUA 2GB0A 2GAHB 2Q0LA 2YR6A 4YJDA 1D5TA 3KPKA 4A5LA 2APGA 3AE1A 1LJ1A 1Y56A 3AE2A 3EAOA 5J60A 4CY8A 4U8LA 2R4EA 1HYUA 2VZ2A 1PS9A 2YG4A 3DK4A 4MJWA 2WPCA 4H2QA 5HY5A 3G5QA 1KDGA 1JNRA 1LQUA 2R0CA 2A89A 1GSNA 4YTMA 3H8IA 4U8PA 3AEDA 4UDQA 5FS9A 2QA2A 4YSYA 3P4QA 3JSKA 4NEWA 2WS3A 4IVOB 4II2A 2AQJA 2WP6A 3SQPA 4K8DA 2DKIA 1K0JA 5J7XA 5JCKA 4H4XA 2C67A 1NHPA 2ARDA 3AE4A 1TYTA 4GUVA 3SYIA 2JAEA 2XLTA 3ITJA 3M12A 2ZZ0A 3DH9A 5KVIA 1JRZA 2WU2A 1ZK7A 2XLPA 4NNJA 4EMIA 4QFCA 1C0PA 3V3NA 2GQFA 2YLZA 1E1MA 1LPFA 4H7UA 2Q7VA 1JRXA 3GD3A 2YG3A 3CNTA 3K30A 3UKFA 4QFDA 1N4UA 5C2TA 1NG3A 1YQ3A 2BC0A 2XFPA 3RP8A 3I6DA 2YVFA 3NTAA 1E39A 3NTDA 2EQ7A 2YG7A 2E48A 5TR3A 1JRYA 2B7RA 3LXDA 3ABVA 5EBKA 5U63A 3DJJA 3DK9A 3EF6A 3UTFA 1K4QA 1S2YA 3T37A 4LIIA 3SFEA 3PS9A 3VRBA 2CDUA 4G6GA 4GDEA 3ZNNA 1GOSA 3AD8B 2VVLG 1FL2A 1GRGA 2XFNA 2XFOA 2YR4A 1S3BA 2YG5A 4Z44A 1XDIA 3UOXA 1PBEA 4Z25A 1DJQA 4AT0A 3AE3A 4PAAA 1C0IA 3AD9B 4CCRA 3ZYXA 2GVCA 4Y4MA 5FS8A 2GEWA 2GR1A 4O5QA 1ELIA 2VQ7A 1TRBA 3AE8A 1NAAA 2YLRA 2BK5A 3CPHG 4EMJA 2GF3A 3DMEA 2VQBA 1NENA 5ER0A 4H4YA 2YLTA 4IA6A 2C75A 2Z5YA 2WESA 4X9MA 2BA9A 2V6OA 5M10A 4OPTA 2UZZA 1D7YA 2GQWA 1OJAA 1B8SA 1GNDA 1DOEA 2OA1A 3SM8A 1NHRA 1OJDA 3QSEA 3KU9A 4IV9A 2XVJA 3GRTA 1GRBA 3SZFA 3E1TA 4NEVA 1PXBA 1TDKA 4YKGA 1CC2A 1KIFA 4B68A 3IWAA 4OCGA 5FMHA 4M52A 4TM1A 1ONFA 1OJCA 3FMWA 4EQXA 3P4RA 5CQFA 2C66A 3F8DA 4O5UA 3CIRA 3CGBA 3CN8A 4J33A 4FX9A 5L46A 1COYA 3VQRA 1O5WA 3CNDA 4JY3A 4DNAA 2C64A 4YJHB 3CGDA 4YKFA 4NZHA 3NNEA 4YJGB 4NTEA 2VVLA 3AEGA 3ATRA 3AYIA 4WCTA 3AE5A 2YVGA 2GR3A 4J57A 4K22A 5JCMA 4B67A 5U1OA 4B63A 3I3LA 1L0VA 3BNMA 2BXRA 5LV9A 3H8LA 3NLCA 2FJDA 3IC9A 4K2XA 3DK8A 4U2SA 4I59A 3RP6A 2NPXA 3ALMA 2R9ZA 4X4JA 4APNA 4EIPA 2B9XA 3AB1A 1H83A 2OAMA 2YAUA 5KWFA 4B1BA 4C3YA 4N9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B64 A;  2WQY A;  2FBW A;  2YLS A;  5M0Z A;  3ADA B;  1O95 A;  2IVD A;  4Z2T A;  1PN0 A;  5JCI A;  2XLU A;  1PXC A;  1FEA A;  4K5R A;  3ALJ A;  3LB8 A;  4AP1 A;  1GRH A;  3C4N A;  1Q1W A;  2VOU A;  3F8R A;  2GMH A;  1OJT A;  2O9Z A;  2WOV A;  3C96 A;  4H4T A;  4USR A;  2X8H A;  3RED A;  4AT2 A;  1CJC A;  4Y4L A;  2V5Z A;  2Y6Q A;  1KFY A;  5KOX A;  4U8K A;  2B9W A;  1REO A;  4GF7 A;  4EM3 A;  3NGC X;  4ZCD A;  3QFA A;  2X99 A;  2X8C A;  1L9E A;  3HZL A;  2XYO A;  1ZKQ A;  3NHO X;  2I0Z A;  4YJF A;  3UKH A;  2X50 A;  4REK A;  4JNA A;  5KXJ A;  2YR5 A;  3CUK A;  4YSZ A;  2B7S A;  2OAL A;  1FCD A;  4DGK A;  4EQW A;  4H4S A;  2WP5 A;  2XVI A;  4H4W A;  1TDF A;  4YTP A;  5HHF A;  1JNZ A;  4JY2 A;  3QSS A;  2V60 A;  3V3O A;  1DNC A;  4OVI A;  2PYX A;  4A65 A;  1LTX R;  1RP0 A;  4USQ A;  1H7X A;  2VVM A;  3QSM A;  3AEE A;  2JK6 A;  2R45 A;  2E82 A;  2XVH A;  3AXB A;  1YQZ A;  1ZOY A;  1KSU A;  1E6E A;  1M6I A;  2BS4 A;  4RG3 A;  1D4E A;  1VG0 A;  2A87 A;  2BK3 A;  4TLZ A;  1P2E A;  4XXG A;  4XWZ A;  3IF9 A;  1IUU A;  1DAO A;  1BZL A;  3DGZ A;  2AR8 A;  1CL0 A;  2R46 A;  4E0V A;  4H2N A;  1NHS A;  2WDQ A;  1KF6 A;  3ALL A;  1LVL A;  1AOG A;  3IHG A;  4YJH A;  1S2Q A;  2BCP A;  3P9U A;  4IVM B;  4YJG A;  2BS3 A;  1UKV G;  3M13 A;  3KPF A;  2A8X A;  2JKC A;  2XFU A;  3UKP A;  2GV8 A;  1DOC A;  4RG4 A;  2R0P A;  4BK2 A;  3CPJ G;  1F6M A;  3B6D A;  1GPE A;  2GRT A;  3QVP A;  4UDP A;  2C65 A;  1PJ7 A;  4BK1 A;  4FK1 C;  3KVE A;  2C3D A;  1GAL A;  3NH3 X;  1GTH A;  3G3E A;  4UP3 A;  1Q9I A;  4H4U A;  3P4S A;  3ZDN A;  2W0H A;  3FPZ A;  3URH A;  4H2P A;  2ZZB A;  2BAB A;  4J56 A;  3S61 A;  3NT6 A;  1NHQ A;  4KX6 A;  4RSL A;  1LQT A;  2WP9 A;  1IUX A;  2C3C A;  3DGH A;  4OPD A;  2TPR A;  3VR8 A;  1CC6 A;  3AE6 A;  4ADW A;  2JB1 A;  2EQ6 A;  1E1N A;  2QCU A;  1D7L A;  4OPI A;  3UKA A;  1IUS A;  2J3N A;  3NG7 X;  4H4P A;  4K5S A;  1KSS A;  2XFQ A;  4EQS A;  1JEH A;  2Q6U A;  3UTG A;  4NTC A;  3UKK A;  1O94 A;  2YWL A;  1GRT A;  2F5Z A;  1L9D A;  3AD7 B;  1N1P A;  5BRT A;  1YY5 A;  1YQ4 A;  1GRE A;  3S5W A;  4UDR A;  4KPR A;  4B66 A;  4YTN A;  3KLJ A;  2VRL A;  3NK1 X;  2GMJ A;  3F8P A;  2Z5X A;  2IVE A;  3CGC A;  3OC4 A;  3FIM B;  2E4A A;  2YLX A;  1MO9 A;  3LZX A;  3H4K A;  1F3P A;  5EOW A;  4CY6 A;  4YXD A;  2E49 A;  1PDH A;  5EB5 A;  1MOK A;  4A6N B;  1F8S A;  3AEA A;  4OPC A;  4H2R A;  4TM3 A;  3K7T A;  1PBD A;  4BJZ A;  1IUV A;  1DDO A;  4H4V A;  1N4W A;  1H6V A;  1EL9 A;  1L9C A;  3R9U A;  3L1R A;  2JB3 A;  1V59 A;  4CNK A;  1GER A;  1TDE A;  2BAC A;  1H86 A;  4C74 A;  3PVC A;  2TMD A;  4HA6 A;  2YQU A;  4GCM A;  4J2W A;  4Z2R A;  3ICS A;  3G5S A;  1H82 A;  1B4V A;  3P4P A;  2PHH A;  4Z2U A;  2H89 A;  1H84 A;  4BV6 A;  1XAN A;  3BI5 A;  4AOS A;  1GT8 A;  2JB2 A;  3CNP A;  1ZOV A;  3QFB A;  1GET A;  4D03 A;  3L8K A;  2RGJ A;  3NK0 X;  2QAE A;  2DKH A;  3K7M X;  4CRT A;  4H50 A;  2YLW A;  2CUL A;  3P1W A;  1KNR A;  3NN6 X;  5BUL A;  3UTE A;  1PBB A;  2IID A;  4Z26 A;  4P9S A;  4ICY A;  4JNQ A;  1SEZ A;  2YM2 A;  3IHM A;  2V61 A;  3CGE A;  3D1C A;  2E1M A;  1PJ5 A;  2XLR A;  1TDN A;  1GXF A;  3EPT A;  3RP7 A;  1GEU A;  1EL8 A;  1BF3 A;  3DJG X;  1VRQ B;  3FBS A;  4NTD A;  3GYI A;  2WPF A;  3UP5 A;  3UOY A;  2X8G A;  3GMC A;  1X31 B;  1GES A;  2B9Y A;  3WE0 A;  3KA7 A;  1EL5 A;  1VQW A;  4OPG A;  1ZMC A;  1BGN A;  5CKU A;  2RGH A;  1F8R A;  3B3R A;  5FS7 A;  3SGL A;  2H88 A;  4C3X A;  4X9N A;  1E1L A;  4EM4 A;  4H4Z A;  3AE9 A;  2RGO A;  4BK3 A;  3GDN A;  1LV0 A;  5GRT A;  3SFD A;  3M0O A;  4OPU A;  5HXI A;  4JDR A;  3Q9T A;  3ATQ A;  5DBJ A;  3V76 A;  3AWI A;  2BXS A;  1GTE A;  2C73 A;  3AEC A;  3GYJ A;  4WX1 A;  1IUW A;  3C4A A;  3PO7 A;  2WET A;  1VDC A;  4AOX A;  3KD9 A;  2AAQ A;  1NG4 A;  2WU5 A;  1DXL A;  2GR2 A;  4YWO A;  2YG6 A;  5IQ4 A;  4C5O A;  2FJA A;  4CBQ A;  4A6N A;  4J36 A;  4FDC B;  3AYL A;  2R4J A;  1XHC A;  1FOH A;  2FJB A;  1C0L A;  2ZBW A;  1DOD A;  1FEB A;  3EAN A;  4H4R A;  1K0L A;  5BVA A;  3LAD A;  1Z6L A;  4BUR A;  5BUK A;  4DSH A;  2OLO A;  3BHF A;  3DA1 A;  2BCG G;  4U2T A;  4Z24 A;  3OZ2 A;  4A99 A;  2CFY A;  2CVJ A;  3W4K A;  1TYP A;  2R0G A;  5EB4 A;  3GWF A;  3KKJ A;  3AYJ A;  3II4 A;  4CCQ A;  1ZP0 A;  5JCN A;  4EQR A;  4U8O A;  4B65 A;  1B5Q A;  5KRQ A;  2Q0K A;  5IQ1 A;  2WHD A;  3O0H A;  1AN9 A;  2E4G A;  2ZZC A;  3VRA A;  1D4C A;  2OLN A;  2WDR A;  4J34 A;  4EMW A;  3NK2 X;  1ZY8 A;  4TM4 A;  3UKQ A;  4IA5 A;  1CC4 A;  2BYB A;  2C72 A;  4Y4N A;  3NYE A;  1GV4 A;  5U25 A;  4HB9 A;  3QJ4 A;  3NN0 X;  1PJ6 A;  4H4Q A;  4JN9 A;  4YT0 A;  1CJ2 A;  4GDP A;  1JU2 A;  1E7P A;  3LZW A;  1P2H A;  3FG2 P;  3ZNO A;  3ICT A;  2WPE A;  4U8I A;  1IUT A;  1VG9 A;  3COX A;  1ZX9 A;  3WGT A;  1CJ4 A;  3DJE A;  2XCG A;  2DU8 A;  1CJ3 A;  1F8W A;  3RNM A;  1Y56 B;  1QJD A;  4DSG A;  4YJF B;  5KVH A;  1PXA A;  1Q1R A;  3Q6J A;  3BHK A;  4CNJ A;  1K0I A;  2GR0 A;  4TLX A;  2VRM A;  4EIQ A;  5JCL A;  3UCL A;  5GSN A;  1BKW A;  1FEC A;  2WOI A;  1RSG A;  1DJN A;  3UTH A;  4A9W A;  2C76 A;  4A7A A;  1CBO A;  4I58 A;  2WBA A;  2B76 A;  3LJP A;  4U2L A;  1GRF A;  1EL7 A;  1IJH A;  1NPX A;  3BNU A;  4D04 A;  3GWD A;  1YKJ A;  3ICR A;  4LU6 A;  1TDO A;  2FJE A;  1VE9 A;  1CHU A;  3UOV A;  1PHH A;  3GSI A;  4U8N A;  3AE7 A;  4K7Z A;  5HYM A;  2EQ8 A;  2WOW A;  3NKS A;  3ZNQ A;  3VRD B;  1EVI A;  3NYF A;  1ZMD A;  2RAB A;  2XDO A;  2YVJ A;  2EQ9 A;  1OJ9 A;  2GH5 A;  4PAB A;  4GR1 A;  5FS6 A;  4Z43 A;  5KOW A;  3NRN A;  2V3A A;  4BJY A;  3VR9 A;  1ZDL A;  1MXT A;  1E1K A;  1NDA A;  3GRS A;  2XVE A;  4ZN0 A;  1B37 A;  2BC1 A;  3GMB A;  3BI2 A;  3RHA A;  4A79 A;  1RYI A;  1N4V A;  3AEF A;  1W4X A;  1BGJ A;  3CPI G;  4AP3 A;  1S3E A;  2QA1 A;  2XVF A;  3AEB A;  3CTY A;  4ZCC A;  3W4J A;  2ACZ A;  2Y6R A;  3UP4 A;  4J31 A;  1JOA A;  2C70 A;  4OPL A;  4B69 A;  1KNP A;  4TM0 A;  3DJD A;  1DOB A;  1PBF A;  2WDV A;  4LA1 A;  1EBD A;  1BWC A;  4U8M A;  2BK4 A;  2NVK X;  2JBV A;  2V3B A;  4JQ9 A;  3UOZ A;  3GD4 A;  3QVR A;  3ZNP A;  2BS2 A;  1XPQ A;  3W4I A;  2YM1 A;  1C0K A;  2C7G A;  1QO8 A;  3CNS A;  1M64 A;  3G5R A;  4FK1 A;  3K7Q X;  1GRA A;  3UKL A;  3D8X A;  2HQM A;  5C3J A;  2E5V A;  3CNJ A;  4XWR A;  1D4D A;  4ECH A;  1PBC A;  2X3N A;  4GRT A;  4YSX A;  3GDP A;  4C77 A;  1H7W A;  3NYC A;  1CF3 A;  3LOV A;  1QLB A;  5IPY A;  3ISH A;  1Y0P A;  3BI4 A;  1H81 A;  3NIX A;  2XLS A;  2GAG B;  1NEK A;  4YSH A;  4U8J A;  2WEU A;  2GB0 A;  2GAH B;  2Q0L A;  2YR6 A;  4YJD A;  1D5T A;  4A5L A;  2APG A;  3AE1 A;  1LJ1 A;  1Y56 A;  3AE2 A;  3EAO A;  5J60 A;  4CY8 A;  4U8L A;  2R4E A;  1HYU A;  2VZ2 A;  1PS9 A;  2YG4 A;  3DK4 A;  4MJW A;  2WPC A;  4H2Q A;  5HY5 A;  3G5Q A;  1KDG A;  1JNR A;  1LQU A;  2R0C A;  2A89 A;  1GSN A;  4YTM A;  3H8I A;  4U8P A;  3AED A;  4UDQ A;  5FS9 A;  2QA2 A;  4YSY A;  3P4Q A;  3JSK A;  4NEW A;  2WS3 A;  4IVO B;  2AQJ A;  2WP6 A;  3SQP A;  4K8D A;  2DKI A;  1K0J A;  5J7X A;  5JCK A;  4H4X A;  2C67 A;  1NHP A;  2ARD A;  3AE4 A;  1TYT A;  4GUV A;  2JAE A;  2XLT A;  3ITJ A;  3M12 A;  2ZZ0 A;  3DH9 A;  5KVI A;  1JRZ A;  2WU2 A;  1ZK7 A;  2XLP A;  4EMI A;  4QFC A;  1C0P A;  3V3N A;  2GQF A;  2YLZ A;  1E1M A;  1LPF A;  4H7U A;  2Q7V A;  1JRX A;  3GD3 A;  2YG3 A;  3CNT A;  3K30 A;  3UKF A;  4QFD A;  1N4U A;  5C2T A;  1NG3 A;  1YQ3 A;  2BC0 A;  2XFP A;  3RP8 A;  3I6D A;  2YVF A;  3NTA A;  1E39 A;  3NTD A;  2EQ7 A;  2YG7 A;  2E48 A;  5TR3 A;  1JRY A;  2B7R A;  3LXD A;  3ABV A;  5EBK A;  5U63 A;  3DJJ A;  3DK9 A;  3EF6 A;  3UTF A;  1K4Q A;  1S2Y A;  3T37 A;  4LII A;  3SFE A;  3PS9 A;  3VRB A;  2CDU A;  4GDE A;  3ZNN A;  1GOS A;  3AD8 B;  2VVL G;  1FL2 A;  1GRG A;  2XFN A;  2XFO A;  2YR4 A;  1S3B A;  2YG5 A;  4Z44 A;  1XDI A;  3UOX A;  1PBE A;  4Z25 A;  1DJQ A;  4AT0 A;  3AE3 A;  4PAA A;  1C0I A;  3AD9 B;  4CCR A;  3ZYX A;  2GVC A;  4Y4M A;  5FS8 A;  2GEW A;  2GR1 A;  4O5Q A;  1ELI A;  2VQ7 A;  1TRB A;  3AE8 A;  1NAA A;  2YLR A;  2BK5 A;  3CPH G;  4EMJ A;  2GF3 A;  3DME A;  2VQB A;  1NEN A;  5ER0 A;  4H4Y A;  2YLT A;  4IA6 A;  2C75 A;  2Z5Y A;  2WES A;  4X9M A;  2BA9 A;  2V6O A;  5M10 A;  4OPT A;  2UZZ A;  1D7Y A;  2GQW A;  1OJA A;  1B8S A;  1GND A;  1DOE A;  2OA1 A;  3SM8 A;  1NHR A;  1OJD A;  3QSE A;  3KU9 A;  4IV9 A;  2XVJ A;  3GRT A;  1GRB A;  3E1T A;  4NEV A;  1PXB A;  1TDK A;  4YKG A;  1CC2 A;  1KIF A;  4B68 A;  3IWA A;  4OCG A;  5FMH A;  4M52 A;  4TM1 A;  1ONF A;  1OJC A;  3FMW A;  4EQX A;  3P4R A;  5CQF A;  2C66 A;  3F8D A;  4O5U A;  3CIR A;  3CGB A;  3CN8 A;  4J33 A;  4FX9 A;  5L46 A;  1COY A;  3VQR A;  1O5W A;  3CND A;  4JY3 A;  4DNA A;  2C64 A;  4YJH B;  3CGD A;  4YKF A;  4NZH A;  3NNE A;  4YJG B;  4NTE A;  2VVL A;  3AEG A;  3ATR A;  3AYI A;  4WCT A;  3AE5 A;  2YVG A;  2GR3 A;  4J57 A;  4K22 A;  5JCM A;  4B67 A;  5U1O A;  4B63 A;  3I3L A;  1L0V A;  3BNM A;  2BXR A;  5LV9 A;  3H8L A;  3NLC A;  2FJD A;  3IC9 A;  4K2X A;  3DK8 A;  4U2S A;  4I59 A;  3RP6 A;  2NPX A;  3ALM A;  2R9Z A;  4X4J A;  4APN A;  4EIP A;  2B9X A;  3AB1 A;  1H83 A;  2OAM A;  2YAU A;  5KWF A;  4B1B A;  4C3Y A;  4N9X A; 
#chains in the Genus database with same CATH topology
 4B64 A;  2WQY A;  2FBW A;  2YLS A;  4G6H A;  3ADA B;  1O95 A;  5M0Z A;  2IVD A;  1PN0 A;  4Z2T A;  2XLU A;  1PXC A;  1FEA A;  4K5R A;  3ALJ A;  3LB8 A;  4AP1 A;  1GRH A;  3C4N A;  2VOU A;  1Q1W A;  3F8R A;  2GMH A;  3C96 A;  1OJT A;  2O9Z A;  2WOV A;  4H4T A;  4USR A;  2X8H A;  3RED A;  4AT2 A;  1CJC A;  4Y4L A;  2V5Z A;  2Y6Q A;  1KFY A;  5KOX A;  4U8K A;  3SX6 A;  2B9W A;  1REO A;  5JCI A;  4GF7 A;  4EM3 A;  3NGC X;  4ZCD A;  3QFA A;  2X99 A;  2X8C A;  1L9E A;  3HZL A;  2XYO A;  1ZKQ A;  3NHO X;  2I0Z A;  4YJF A;  3UKH A;  2X50 A;  4REK A;  4JNA A;  5KXJ A;  2YR5 A;  3T0K A;  3CUK A;  4YSZ A;  2B7S A;  2OAL A;  1FCD A;  4DGK A;  4EQW A;  4H4S A;  2WP5 A;  2XVI A;  4H4W A;  1TDF A;  4YTP A;  5HHF A;  4JY2 A;  1JNZ A;  3QSS A;  2V60 A;  3V3O A;  1DNC A;  4OVI A;  2PYX A;  4A65 A;  1LTX R;  1RP0 A;  4USQ A;  1H7X A;  2VVM A;  3QSM A;  3AEE A;  2JK6 A;  2R45 A;  2E82 A;  2XVH A;  3AXB A;  1YQZ A;  1ZOY A;  1KSU A;  1E6E A;  1M6I A;  2BS4 A;  4RG3 A;  1D4E A;  1VG0 A;  2A87 A;  2BK3 A;  4TLZ A;  1P2E A;  4XXG A;  4XWZ A;  3IF9 A;  1IUU A;  1DAO A;  1BZL A;  3DGZ A;  2AR8 A;  1CL0 A;  4GAV A;  2R46 A;  4E0V A;  4H2N A;  1NHS A;  2WDQ A;  1KF6 A;  4G9K A;  3ALL A;  1LVL A;  1AOG A;  3IHG A;  4YJH A;  1S2Q A;  2BCP A;  3P9U A;  4IVM B;  4YJG A;  2BS3 A;  1UKV G;  3M13 A;  3KPF A;  5KMS A;  3T31 A;  2A8X A;  2JKC A;  2XFU A;  3UKP A;  3SZ0 A;  2GV8 A;  1DOC A;  4RG4 A;  2R0P A;  4BK2 A;  3CPJ G;  1F6M A;  3B6D A;  1GPE A;  2GRT A;  3QVP A;  4UDP A;  2BRA A;  2C65 A;  1PJ7 A;  4BK1 A;  4FK1 C;  3KVE A;  2C3D A;  1GAL A;  3NH3 X;  1GTH A;  3G3E A;  4UP3 A;  1Q9I A;  4H4U A;  3P4S A;  3ZDN A;  2W0H A;  3FPZ A;  3URH A;  4H2P A;  2ZZB A;  2BAB A;  4J56 A;  3S61 A;  3NT6 A;  1NHQ A;  4KX6 A;  4RSL A;  1LQT A;  2WP9 A;  1IUX A;  2C3C A;  3DGH A;  4OPD A;  2TPR A;  3VR8 A;  1CC6 A;  3AE6 A;  4ADW A;  2JB1 A;  2BRY A;  2EQ6 A;  1E1N A;  2QCU A;  1D7L A;  4OPI A;  3UKA A;  1IUS A;  2J3N A;  3NG7 X;  4H4P A;  4K5S A;  1KSS A;  2XFQ A;  4EQS A;  1JEH A;  2Q6U A;  3T2K A;  3UTG A;  4NTC A;  2C4C A;  3UKK A;  1O94 A;  2YWL A;  1GRT A;  2F5Z A;  1L9D A;  3AD7 B;  1N1P A;  5BRT A;  1YY5 A;  1YQ4 A;  1GRE A;  3S5W A;  4UDR A;  4KPR A;  4B66 A;  4YTN A;  3KLJ A;  2VRL A;  3NK1 X;  2GMJ A;  3F8P A;  2Z5X A;  2IVE A;  3CGC A;  3OC4 A;  3FIM B;  2E4A A;  2YLX A;  1MO9 A;  3LZX A;  3H4K A;  1F3P A;  5EOW A;  4CY6 A;  4YXD A;  2E49 A;  1PDH A;  3HYV A;  5EB5 A;  1MOK A;  4A6N B;  1F8S A;  3AEA A;  4OPC A;  4H2R A;  4TM3 A;  3K7T A;  1PBD A;  5KNL A;  4BJZ A;  1IUV A;  1DDO A;  4H4V A;  1N4W A;  1H6V A;  1EL9 A;  1L9C A;  3R9U A;  3L1R A;  2JB3 A;  1V59 A;  4CNK A;  1GER A;  1TDE A;  2BAC A;  1H86 A;  4C74 A;  3PVC A;  2TMD A;  4HA6 A;  2YQU A;  4GCM A;  4J2W A;  4Z2R A;  3ICS A;  3G5S A;  1H82 A;  1B4V A;  3P4P A;  2PHH A;  4Z2U A;  2H89 A;  1H84 A;  4BV6 A;  1XAN A;  3BI5 A;  4AOS A;  1GT8 A;  2JB2 A;  3CNP A;  1ZOV A;  3QFB A;  1GET A;  4D03 A;  3L8K A;  2RGJ A;  3NK0 X;  2QAE A;  2DKH A;  3K7M X;  4CRT A;  4H50 A;  2YLW A;  2CUL A;  3P1W A;  1KNR A;  3NN6 X;  5BUL A;  3UTE A;  1PBB A;  2IID A;  4Z26 A;  4P9S A;  4ICY A;  4JNQ A;  1SEZ A;  3SY4 A;  3HYW A;  2YM2 A;  3IHM A;  2V61 A;  3CGE A;  3D1C A;  2E1M A;  1PJ5 A;  2XLR A;  1TDN A;  1GXF A;  3EPT A;  3RP7 A;  1GEU A;  1EL8 A;  1BF3 A;  3DJG X;  1VRQ B;  3FBS A;  4NTD A;  3GYI A;  2WPF A;  3UP5 A;  3UOY A;  3GMC A;  2X8G A;  1X31 B;  1GES A;  2B9Y A;  3WE0 A;  3KA7 A;  1EL5 A;  1VQW A;  4OPG A;  3SXI A;  1ZMC A;  1BGN A;  5CKU A;  2RGH A;  1F8R A;  3B3R A;  5FS7 A;  3SGL A;  2H88 A;  5KMQ A;  4X9N A;  1E1L A;  4C3X A;  4H4Z A;  4EM4 A;  3AE9 A;  2RGO A;  4NWZ A;  4BK3 A;  5HXI A;  1LV0 A;  3GDN A;  5GRT A;  3M0O A;  4OPU A;  3SFD A;  4JDR A;  3Q9T A;  3ATQ A;  5DBJ A;  3V76 A;  3AWI A;  2BXS A;  1GTE A;  2C73 A;  3AEC A;  3GYJ A;  4WX1 A;  1IUW A;  3C4A A;  3PO7 A;  2WET A;  4G73 A;  1VDC A;  4AOX A;  3KD9 A;  4II3 A;  2AAQ A;  1NG4 A;  2WU5 A;  1DXL A;  3T2Y A;  2GR2 A;  4YWO A;  2YG6 A;  5IQ4 A;  4C5O A;  2FJA A;  4CBQ A;  3GYX A;  4A6N A;  4J36 A;  4FDC B;  3AYL A;  2R4J A;  1XHC A;  4G74 A;  1FOH A;  2FJB A;  1C0L A;  2ZBW A;  1DOD A;  3T14 A;  1FEB A;  3EAN A;  4H4R A;  5KMP A;  1K0L A;  5BVA A;  3LAD A;  1Z6L A;  4BUR A;  5BUK A;  4DSH A;  2OLO A;  3BHF A;  3DA1 A;  2BCG G;  4U2T A;  4Z24 A;  3OZ2 A;  4A99 A;  2CFY A;  2CVJ A;  3W4K A;  1TYP A;  2R0G A;  5EB4 A;  3GWF A;  3KKJ A;  3AYJ A;  3II4 A;  4CCQ A;  1ZP0 A;  5JCN A;  4EQR A;  4U8O A;  4B65 A;  1B5Q A;  5KRQ A;  2Q0K A;  5IQ1 A;  2WHD A;  3O0H A;  1AN9 A;  2E4G A;  2ZZC A;  3VRA A;  1D4C A;  2OLN A;  2WDR A;  4J34 A;  4EMW A;  3NK2 X;  1ZY8 A;  4TM4 A;  3UKQ A;  4IA5 A;  1CC4 A;  2BYB A;  2C72 A;  4Y4N A;  3NYE A;  1GV4 A;  5U25 A;  4HB9 A;  3QJ4 A;  3NN0 X;  1PJ6 A;  4H4Q A;  4JN9 A;  4YT0 A;  1CJ2 A;  4GDP A;  1JU2 A;  1E7P A;  3LZW A;  1P2H A;  3FG2 P;  3ZNO A;  3ICT A;  2WPE A;  4U8I A;  1IUT A;  1VG9 A;  3COX A;  1ZX9 A;  3WGT A;  1CJ4 A;  3DJE A;  2XCG A;  2DU8 A;  1CJ3 A;  1F8W A;  3RNM A;  1Y56 B;  1QJD A;  4DSG A;  4YJF B;  5KVH A;  1PXA A;  1Q1R A;  3Q6J A;  3BHK A;  4CNJ A;  1K0I A;  4EIQ A;  2GR0 A;  2VRM A;  4TLX A;  5JCL A;  3UCL A;  5GSN A;  1BKW A;  1FEC A;  2WOI A;  1RSG A;  1DJN A;  3UTH A;  4A9W A;  2C76 A;  4A7A A;  1CBO A;  4I58 A;  2WBA A;  2B76 A;  3LJP A;  4U2L A;  1GRF A;  1EL7 A;  1IJH A;  1NPX A;  3BNU A;  4D04 A;  3GWD A;  3HYX A;  1YKJ A;  3ICR A;  4LU6 A;  1TDO A;  2FJE A;  1VE9 A;  1CHU A;  3UOV A;  1PHH A;  3GSI A;  5HYM A;  3AE7 A;  4K7Z A;  4U8N A;  2EQ8 A;  2WOW A;  3NKS A;  3ZNQ A;  3VRD B;  5KMR A;  1EVI A;  3NYF A;  1ZMD A;  2RAB A;  2XDO A;  2YVJ A;  2EQ9 A;  1OJ9 A;  2GH5 A;  4PAB A;  4GR1 A;  5FS6 A;  4Z43 A;  5KOW A;  3NRN A;  2V3A A;  4BJY A;  3VR9 A;  1ZDL A;  1MXT A;  1E1K A;  1NDA A;  3GRS A;  2XVE A;  4ZN0 A;  1B37 A;  3GMB A;  2BC1 A;  3BI2 A;  3RHA A;  3T2Z A;  4A79 A;  1RYI A;  1N4V A;  3SZC A;  4GAP A;  3AEF A;  1W4X A;  1BGJ A;  3CPI G;  4AP3 A;  1S3E A;  2QA1 A;  2XVF A;  3AEB A;  3CTY A;  4ZCC A;  3W4J A;  2ACZ A;  2Y6R A;  3UP4 A;  4J31 A;  1JOA A;  2C70 A;  4OPL A;  4B69 A;  1KNP A;  4TM0 A;  3DJD A;  1DOB A;  1PBF A;  2WDV A;  4LA1 A;  1EBD A;  1BWC A;  4U8M A;  2BK4 A;  2NVK X;  2JBV A;  2V3B A;  4JQ9 A;  3UOZ A;  3GD4 A;  3QVR A;  3ZNP A;  2BS2 A;  1XPQ A;  3W4I A;  2YM1 A;  1C0K A;  2C7G A;  1QO8 A;  3CNS A;  1M64 A;  3G5R A;  4FK1 A;  3K7Q X;  1GRA A;  3UKL A;  3D8X A;  2HQM A;  3SZW A;  5C3J A;  2E5V A;  3CNJ A;  4XWR A;  1D4D A;  4ECH A;  1PBC A;  2X3N A;  4GRT A;  4YSX A;  3GDP A;  4C77 A;  1H7W A;  3NYC A;  3CMM A;  1CF3 A;  3LOV A;  1QLB A;  5IPY A;  3ISH A;  1Y0P A;  3BI4 A;  1H81 A;  3NIX A;  2XLS A;  2GAG B;  1NEK A;  4YSH A;  4U8J A;  2WEU A;  2GB0 A;  2GAH B;  2Q0L A;  2YR6 A;  4YJD A;  1D5T A;  3KPK A;  4A5L A;  2APG A;  3AE1 A;  1LJ1 A;  1Y56 A;  3AE2 A;  3EAO A;  5J60 A;  4CY8 A;  4U8L A;  2R4E A;  1HYU A;  2VZ2 A;  1PS9 A;  2YG4 A;  3DK4 A;  4MJW A;  4H2Q A;  2WPC A;  5HY5 A;  3G5Q A;  1KDG A;  1JNR A;  2R0C A;  1LQU A;  2A89 A;  1GSN A;  4YTM A;  3H8I A;  4U8P A;  3AED A;  4UDQ A;  5FS9 A;  2QA2 A;  4YSY A;  3P4Q A;  3JSK A;  4NEW A;  2WS3 A;  4IVO B;  4II2 A;  2AQJ A;  2WP6 A;  3SQP A;  4K8D A;  2DKI A;  1K0J A;  5J7X A;  5JCK A;  4H4X A;  2C67 A;  1NHP A;  2ARD A;  3AE4 A;  1TYT A;  4GUV A;  3SYI A;  2JAE A;  2XLT A;  3ITJ A;  3M12 A;  2ZZ0 A;  3DH9 A;  5KVI A;  1JRZ A;  2WU2 A;  1ZK7 A;  2XLP A;  4NNJ A;  4EMI A;  4QFC A;  1C0P A;  3V3N A;  2GQF A;  2YLZ A;  1E1M A;  1LPF A;  4H7U A;  2Q7V A;  1JRX A;  3GD3 A;  2YG3 A;  3CNT A;  3K30 A;  3UKF A;  4QFD A;  1N4U A;  5C2T A;  1NG3 A;  1YQ3 A;  2BC0 A;  3RP8 A;  2XFP A;  3I6D A;  2YVF A;  3NTA A;  1E39 A;  3NTD A;  2EQ7 A;  2YG7 A;  2E48 A;  5TR3 A;  1JRY A;  2B7R A;  3LXD A;  3ABV A;  5EBK A;  5U63 A;  3DJJ A;  3DK9 A;  3EF6 A;  3UTF A;  1K4Q A;  1S2Y A;  3T37 A;  4LII A;  3SFE A;  3PS9 A;  3VRB A;  2CDU A;  4G6G A;  4GDE A;  3ZNN A;  1GOS A;  3AD8 B;  2VVL G;  1FL2 A;  1GRG A;  2XFN A;  2XFO A;  2YR4 A;  1S3B A;  2YG5 A;  4Z44 A;  1XDI A;  3UOX A;  1PBE A;  4Z25 A;  1DJQ A;  4AT0 A;  3AE3 A;  4PAA A;  1C0I A;  3AD9 B;  4CCR A;  3ZYX A;  2GVC A;  4Y4M A;  5FS8 A;  2GEW A;  2GR1 A;  4O5Q A;  1ELI A;  2VQ7 A;  1TRB A;  3AE8 A;  1NAA A;  2YLR A;  2BK5 A;  3CPH G;  4EMJ A;  2GF3 A;  3DME A;  2VQB A;  1NEN A;  5ER0 A;  4H4Y A;  2YLT A;  4IA6 A;  2C75 A;  2Z5Y A;  2WES A;  4X9M A;  2BA9 A;  2V6O A;  5M10 A;  4OPT A;  2UZZ A;  1D7Y A;  2GQW A;  1OJA A;  1B8S A;  1GND A;  1DOE A;  2OA1 A;  3SM8 A;  1NHR A;  1OJD A;  3QSE A;  3KU9 A;  4IV9 A;  2XVJ A;  3GRT A;  1GRB A;  3SZF A;  3E1T A;  4NEV A;  1PXB A;  1TDK A;  4YKG A;  1CC2 A;  1KIF A;  4B68 A;  3IWA A;  4OCG A;  5FMH A;  4M52 A;  4TM1 A;  1ONF A;  1OJC A;  3FMW A;  4EQX A;  3P4R A;  5CQF A;  2C66 A;  3F8D A;  4O5U A;  3CIR A;  3CGB A;  3CN8 A;  4J33 A;  4FX9 A;  5L46 A;  1COY A;  3VQR A;  1O5W A;  4JY3 A;  3CND A;  4DNA A;  2C64 A;  4YJH B;  3CGD A;  4YKF A;  4NZH A;  3NNE A;  4YJG B;  4NTE A;  2VVL A;  3AEG A;  3ATR A;  3AYI A;  4WCT A;  3AE5 A;  2YVG A;  2GR3 A;  4J57 A;  4K22 A;  5JCM A;  4B67 A;  5U1O A;  4B63 A;  3I3L A;  1L0V A;  3BNM A;  2BXR A;  5LV9 A;  3H8L A;  3NLC A;  2FJD A;  3IC9 A;  4K2X A;  3DK8 A;  4U2S A;  4I59 A;  3RP6 A;  3ALM A;  4EIP A;  2NPX A;  2R9Z A;  4X4J A;  4APN A;  2B9X A;  3AB1 A;  1H83 A;  2OAM A;  2YAU A;  5KWF A;  4B1B A;  4C3Y A;  4N9X A; 
#chains in the Genus database with same CATH homology
 4B64 A;  2WQY A;  2FBW A;  2YLS A;  4G6H A;  3ADA B;  1O95 A;  5M0Z A;  2IVD A;  1PN0 A;  4Z2T A;  2XLU A;  1PXC A;  1FEA A;  4K5R A;  3ALJ A;  3LB8 A;  4AP1 A;  1GRH A;  3C4N A;  1Q1W A;  2VOU A;  3F8R A;  2GMH A;  1OJT A;  2O9Z A;  2WOV A;  3C96 A;  4H4T A;  4USR A;  2X8H A;  3RED A;  4AT2 A;  1CJC A;  4Y4L A;  2V5Z A;  2Y6Q A;  1KFY A;  5KOX A;  4U8K A;  3SX6 A;  2B9W A;  1REO A;  5JCI A;  4GF7 A;  4EM3 A;  3NGC X;  4ZCD A;  3QFA A;  2X99 A;  2X8C A;  1L9E A;  3HZL A;  2XYO A;  1ZKQ A;  3NHO X;  2I0Z A;  4YJF A;  3UKH A;  2X50 A;  4REK A;  4JNA A;  5KXJ A;  2YR5 A;  3T0K A;  3CUK A;  4YSZ A;  2B7S A;  2OAL A;  1FCD A;  4DGK A;  4EQW A;  4H4S A;  2WP5 A;  2XVI A;  4H4W A;  1TDF A;  4YTP A;  5HHF A;  1JNZ A;  4JY2 A;  3QSS A;  2V60 A;  3V3O A;  1DNC A;  4OVI A;  2PYX A;  4A65 A;  1LTX R;  1RP0 A;  4USQ A;  1H7X A;  2VVM A;  3QSM A;  3AEE A;  2JK6 A;  2R45 A;  2E82 A;  2XVH A;  3AXB A;  1YQZ A;  1ZOY A;  1KSU A;  1E6E A;  1M6I A;  2BS4 A;  4RG3 A;  1D4E A;  1VG0 A;  2A87 A;  2BK3 A;  4TLZ A;  1P2E A;  4XXG A;  4XWZ A;  3IF9 A;  1IUU A;  1DAO A;  1BZL A;  3DGZ A;  2AR8 A;  1CL0 A;  4GAV A;  2R46 A;  4E0V A;  4H2N A;  1NHS A;  2WDQ A;  1KF6 A;  4G9K A;  3ALL A;  1LVL A;  1AOG A;  3IHG A;  4YJH A;  1S2Q A;  2BCP A;  3P9U A;  4IVM B;  4YJG A;  2BS3 A;  1UKV G;  3M13 A;  3KPF A;  5KMS A;  3T31 A;  2A8X A;  2JKC A;  2XFU A;  3UKP A;  3SZ0 A;  2GV8 A;  1DOC A;  4RG4 A;  2R0P A;  4BK2 A;  3CPJ G;  1F6M A;  3B6D A;  1GPE A;  2GRT A;  3QVP A;  4UDP A;  2BRA A;  2C65 A;  1PJ7 A;  4BK1 A;  4FK1 C;  3KVE A;  2C3D A;  1GAL A;  3NH3 X;  1GTH A;  3G3E A;  4UP3 A;  1Q9I A;  4H4U A;  3P4S A;  3ZDN A;  2W0H A;  3FPZ A;  3URH A;  4H2P A;  2ZZB A;  2BAB A;  4J56 A;  3S61 A;  3NT6 A;  1NHQ A;  4KX6 A;  4RSL A;  1LQT A;  2WP9 A;  1IUX A;  2C3C A;  3DGH A;  4OPD A;  2TPR A;  3VR8 A;  1CC6 A;  3AE6 A;  4ADW A;  2JB1 A;  2BRY A;  2EQ6 A;  1E1N A;  2QCU A;  1D7L A;  4OPI A;  3UKA A;  1IUS A;  2J3N A;  3NG7 X;  4H4P A;  4K5S A;  1KSS A;  2XFQ A;  4EQS A;  1JEH A;  2Q6U A;  3T2K A;  3UTG A;  4NTC A;  2C4C A;  3UKK A;  1O94 A;  2YWL A;  1GRT A;  2F5Z A;  1L9D A;  3AD7 B;  1N1P A;  5BRT A;  1YY5 A;  1YQ4 A;  1GRE A;  3S5W A;  4UDR A;  4KPR A;  4B66 A;  4YTN A;  3KLJ A;  2VRL A;  3NK1 X;  2GMJ A;  3F8P A;  2Z5X A;  2IVE A;  3CGC A;  3OC4 A;  3FIM B;  2E4A A;  2YLX A;  1MO9 A;  3LZX A;  3H4K A;  1F3P A;  5EOW A;  4CY6 A;  4YXD A;  2E49 A;  1PDH A;  3HYV A;  5EB5 A;  1MOK A;  4A6N B;  1F8S A;  3AEA A;  4OPC A;  4H2R A;  4TM3 A;  3K7T A;  1PBD A;  5KNL A;  4BJZ A;  1IUV A;  1DDO A;  4H4V A;  1N4W A;  1H6V A;  1EL9 A;  1L9C A;  3R9U A;  3L1R A;  2JB3 A;  1V59 A;  4CNK A;  1GER A;  1TDE A;  2BAC A;  1H86 A;  4C74 A;  3PVC A;  2TMD A;  4HA6 A;  2YQU A;  4GCM A;  4J2W A;  4Z2R A;  3ICS A;  3G5S A;  1H82 A;  1B4V A;  3P4P A;  2PHH A;  4Z2U A;  2H89 A;  1H84 A;  4BV6 A;  1XAN A;  3BI5 A;  4AOS A;  1GT8 A;  2JB2 A;  3CNP A;  1ZOV A;  3QFB A;  1GET A;  4D03 A;  3L8K A;  2RGJ A;  3NK0 X;  2QAE A;  2DKH A;  3K7M X;  4CRT A;  4H50 A;  2YLW A;  2CUL A;  3P1W A;  1KNR A;  3NN6 X;  5BUL A;  3UTE A;  1PBB A;  2IID A;  4Z26 A;  4P9S A;  4ICY A;  4JNQ A;  1SEZ A;  3SY4 A;  3HYW A;  2YM2 A;  3IHM A;  2V61 A;  3CGE A;  3D1C A;  2E1M A;  1PJ5 A;  2XLR A;  1TDN A;  1GXF A;  3EPT A;  3RP7 A;  1GEU A;  1EL8 A;  1BF3 A;  3DJG X;  1VRQ B;  3FBS A;  4NTD A;  3GYI A;  2WPF A;  3UP5 A;  3UOY A;  2X8G A;  3GMC A;  1X31 B;  1GES A;  2B9Y A;  3WE0 A;  3KA7 A;  1EL5 A;  1VQW A;  4OPG A;  3SXI A;  1ZMC A;  1BGN A;  5CKU A;  2RGH A;  1F8R A;  3B3R A;  5FS7 A;  3SGL A;  2H88 A;  5KMQ A;  4X9N A;  1E1L A;  4C3X A;  4H4Z A;  4EM4 A;  3AE9 A;  2RGO A;  4NWZ A;  4BK3 A;  3GDN A;  1LV0 A;  5GRT A;  3SFD A;  3M0O A;  4OPU A;  5HXI A;  4JDR A;  3Q9T A;  3ATQ A;  5DBJ A;  3V76 A;  3AWI A;  2BXS A;  1GTE A;  2C73 A;  3AEC A;  3GYJ A;  4WX1 A;  1IUW A;  3C4A A;  3PO7 A;  2WET A;  4G73 A;  1VDC A;  4AOX A;  3KD9 A;  4II3 A;  2AAQ A;  1NG4 A;  2WU5 A;  1DXL A;  3T2Y A;  2GR2 A;  4YWO A;  2YG6 A;  5IQ4 A;  4C5O A;  2FJA A;  4CBQ A;  3GYX A;  4A6N A;  4J36 A;  4FDC B;  3AYL A;  2R4J A;  1XHC A;  4G74 A;  1FOH A;  2FJB A;  1C0L A;  2ZBW A;  1DOD A;  3T14 A;  1FEB A;  3EAN A;  4H4R A;  5KMP A;  1K0L A;  5BVA A;  3LAD A;  1Z6L A;  4BUR A;  5BUK A;  4DSH A;  2OLO A;  3BHF A;  3DA1 A;  2BCG G;  4U2T A;  4Z24 A;  3OZ2 A;  4A99 A;  2CFY A;  2CVJ A;  3W4K A;  1TYP A;  2R0G A;  5EB4 A;  3GWF A;  3KKJ A;  3AYJ A;  3II4 A;  4CCQ A;  1ZP0 A;  5JCN A;  4EQR A;  4U8O A;  4B65 A;  1B5Q A;  5KRQ A;  2Q0K A;  5IQ1 A;  2WHD A;  3O0H A;  1AN9 A;  2E4G A;  2ZZC A;  3VRA A;  1D4C A;  2OLN A;  2WDR A;  4J34 A;  4EMW A;  3NK2 X;  1ZY8 A;  4TM4 A;  3UKQ A;  4IA5 A;  1CC4 A;  2BYB A;  2C72 A;  4Y4N A;  3NYE A;  1GV4 A;  5U25 A;  4HB9 A;  3QJ4 A;  3NN0 X;  1PJ6 A;  4H4Q A;  4JN9 A;  4YT0 A;  1CJ2 A;  4GDP A;  1JU2 A;  1E7P A;  3LZW A;  1P2H A;  3FG2 P;  3ZNO A;  3ICT A;  2WPE A;  4U8I A;  1IUT A;  1VG9 A;  3COX A;  1ZX9 A;  3WGT A;  1CJ4 A;  3DJE A;  2XCG A;  2DU8 A;  1CJ3 A;  1F8W A;  3RNM A;  1Y56 B;  1QJD A;  4DSG A;  4YJF B;  5KVH A;  1PXA A;  1Q1R A;  3Q6J A;  3BHK A;  4CNJ A;  1K0I A;  2GR0 A;  4TLX A;  2VRM A;  4EIQ A;  5JCL A;  3UCL A;  5GSN A;  1BKW A;  1FEC A;  2WOI A;  1RSG A;  1DJN A;  3UTH A;  4A9W A;  2C76 A;  4A7A A;  1CBO A;  4I58 A;  2WBA A;  2B76 A;  3LJP A;  4U2L A;  1GRF A;  1EL7 A;  1IJH A;  1NPX A;  3BNU A;  4D04 A;  3GWD A;  3HYX A;  1YKJ A;  3ICR A;  4LU6 A;  1TDO A;  2FJE A;  1VE9 A;  1CHU A;  3UOV A;  1PHH A;  3GSI A;  4U8N A;  3AE7 A;  4K7Z A;  5HYM A;  2EQ8 A;  2WOW A;  3NKS A;  3ZNQ A;  3VRD B;  5KMR A;  1EVI A;  3NYF A;  1ZMD A;  2RAB A;  2XDO A;  2YVJ A;  2EQ9 A;  1OJ9 A;  2GH5 A;  4PAB A;  4GR1 A;  5FS6 A;  4Z43 A;  5KOW A;  3NRN A;  2V3A A;  4BJY A;  3VR9 A;  1ZDL A;  1MXT A;  1E1K A;  1NDA A;  3GRS A;  2XVE A;  4ZN0 A;  1B37 A;  2BC1 A;  3GMB A;  3BI2 A;  3RHA A;  3T2Z A;  4A79 A;  1RYI A;  1N4V A;  3SZC A;  4GAP A;  3AEF A;  1W4X A;  1BGJ A;  3CPI G;  4AP3 A;  1S3E A;  2QA1 A;  2XVF A;  3AEB A;  3CTY A;  4ZCC A;  3W4J A;  2ACZ A;  2Y6R A;  3UP4 A;  4J31 A;  1JOA A;  2C70 A;  4OPL A;  4B69 A;  1KNP A;  4TM0 A;  3DJD A;  1DOB A;  1PBF A;  2WDV A;  4LA1 A;  1EBD A;  1BWC A;  4U8M A;  2BK4 A;  2NVK X;  2JBV A;  2V3B A;  4JQ9 A;  3UOZ A;  3GD4 A;  3QVR A;  3ZNP A;  2BS2 A;  1XPQ A;  3W4I A;  2YM1 A;  1C0K A;  2C7G A;  1QO8 A;  3CNS A;  1M64 A;  3G5R A;  4FK1 A;  3K7Q X;  1GRA A;  3UKL A;  3D8X A;  2HQM A;  3SZW A;  5C3J A;  2E5V A;  3CNJ A;  4XWR A;  1D4D A;  4ECH A;  1PBC A;  2X3N A;  4GRT A;  4YSX A;  3GDP A;  4C77 A;  1H7W A;  3NYC A;  3CMM A;  1CF3 A;  3LOV A;  1QLB A;  5IPY A;  3ISH A;  1Y0P A;  3BI4 A;  1H81 A;  3NIX A;  2XLS A;  2GAG B;  1NEK A;  4YSH A;  4U8J A;  2WEU A;  2GB0 A;  2GAH B;  2Q0L A;  2YR6 A;  4YJD A;  1D5T A;  3KPK A;  4A5L A;  2APG A;  3AE1 A;  1LJ1 A;  1Y56 A;  3AE2 A;  3EAO A;  5J60 A;  4CY8 A;  4U8L A;  2R4E A;  1HYU A;  2VZ2 A;  1PS9 A;  2YG4 A;  3DK4 A;  4MJW A;  2WPC A;  4H2Q A;  5HY5 A;  3G5Q A;  1KDG A;  1JNR A;  1LQU A;  2R0C A;  2A89 A;  1GSN A;  4YTM A;  3H8I A;  4U8P A;  3AED A;  4UDQ A;  5FS9 A;  2QA2 A;  4YSY A;  3P4Q A;  3JSK A;  4NEW A;  2WS3 A;  4IVO B;  4II2 A;  2AQJ A;  2WP6 A;  3SQP A;  4K8D A;  2DKI A;  1K0J A;  5J7X A;  5JCK A;  4H4X A;  2C67 A;  1NHP A;  2ARD A;  3AE4 A;  1TYT A;  4GUV A;  3SYI A;  2JAE A;  2XLT A;  3ITJ A;  3M12 A;  2ZZ0 A;  3DH9 A;  5KVI A;  1JRZ A;  2WU2 A;  1ZK7 A;  2XLP A;  4NNJ A;  4EMI A;  4QFC A;  1C0P A;  3V3N A;  2GQF A;  2YLZ A;  1E1M A;  1LPF A;  4H7U A;  2Q7V A;  1JRX A;  3GD3 A;  2YG3 A;  3CNT A;  3K30 A;  3UKF A;  4QFD A;  1N4U A;  5C2T A;  1NG3 A;  1YQ3 A;  2BC0 A;  2XFP A;  3RP8 A;  3I6D A;  2YVF A;  3NTA A;  1E39 A;  3NTD A;  2EQ7 A;  2YG7 A;  2E48 A;  5TR3 A;  1JRY A;  2B7R A;  3LXD A;  3ABV A;  5EBK A;  5U63 A;  3DJJ A;  3DK9 A;  3EF6 A;  3UTF A;  1K4Q A;  1S2Y A;  3T37 A;  4LII A;  3SFE A;  3PS9 A;  3VRB A;  2CDU A;  4G6G A;  4GDE A;  3ZNN A;  1GOS A;  3AD8 B;  2VVL G;  1FL2 A;  1GRG A;  2XFN A;  2XFO A;  2YR4 A;  1S3B A;  2YG5 A;  4Z44 A;  1XDI A;  3UOX A;  1PBE A;  4Z25 A;  1DJQ A;  4AT0 A;  3AE3 A;  4PAA A;  1C0I A;  3AD9 B;  4CCR A;  3ZYX A;  2GVC A;  4Y4M A;  5FS8 A;  2GEW A;  2GR1 A;  4O5Q A;  1ELI A;  2VQ7 A;  1TRB A;  3AE8 A;  1NAA A;  2YLR A;  2BK5 A;  3CPH G;  4EMJ A;  2GF3 A;  3DME A;  2VQB A;  1NEN A;  5ER0 A;  4H4Y A;  2YLT A;  4IA6 A;  2C75 A;  2Z5Y A;  2WES A;  4X9M A;  2BA9 A;  2V6O A;  5M10 A;  4OPT A;  2UZZ A;  1D7Y A;  2GQW A;  1OJA A;  1B8S A;  1GND A;  1DOE A;  2OA1 A;  3SM8 A;  1NHR A;  1OJD A;  3QSE A;  3KU9 A;  4IV9 A;  2XVJ A;  3GRT A;  1GRB A;  3SZF A;  3E1T A;  4NEV A;  1PXB A;  1TDK A;  4YKG A;  1CC2 A;  1KIF A;  4B68 A;  3IWA A;  4OCG A;  5FMH A;  4M52 A;  4TM1 A;  1ONF A;  1OJC A;  3FMW A;  4EQX A;  3P4R A;  5CQF A;  2C66 A;  3F8D A;  4O5U A;  3CIR A;  3CGB A;  3CN8 A;  4J33 A;  4FX9 A;  5L46 A;  1COY A;  3VQR A;  1O5W A;  3CND A;  4JY3 A;  4DNA A;  2C64 A;  4YJH B;  3CGD A;  4YKF A;  4NZH A;  3NNE A;  4YJG B;  4NTE A;  2VVL A;  3AEG A;  3ATR A;  3AYI A;  4WCT A;  3AE5 A;  2YVG A;  2GR3 A;  4J57 A;  4K22 A;  5JCM A;  4B67 A;  5U1O A;  4B63 A;  3I3L A;  1L0V A;  3BNM A;  2BXR A;  5LV9 A;  3H8L A;  3NLC A;  2FJD A;  3IC9 A;  4K2X A;  3DK8 A;  4U2S A;  4I59 A;  3RP6 A;  2NPX A;  3ALM A;  2R9Z A;  4X4J A;  4APN A;  4EIP A;  2B9X A;  3AB1 A;  1H83 A;  2OAM A;  2YAU A;  5KWF A;  4B1B A;  4C3Y A;  4N9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...