4G9KA

Structure of the ndi1 protein from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
total genus 144
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g9kA00
4G9KA 3SZCA 5KMPA 3SZ0A 4NWZA 3HYVA 3SXIA 4GAVA 4GAPA 3T14A 3HYXA 5KMQA 3T0KA 3SZFA 3SY4A 3T2ZA 4G73A 3T2YA 3KPKA 4G6GA 4G74A 3SX6A 3T31A 5KMRA 3HYWA 5KMSA 3T2KA 3SYIA 4G6HA 3SZWA
chains in the Genus database with same CATH superfamily
2BRAA 1QO8A 1ZK7A 1Q1WA 2Y6QA 3IC9A 1YQZA 1N4VA 2JBVA 1MXTA 2CFYA 5JCNA 4DSGA 1ZMDA 3GYJA 2BK5A 4CCRA 1YY5A 2DKIA 1B5QA 5FS8A 2WU5A 2WDRA 2WOIA 1PXBA 2XLTA 3AE4A 3LJPA 3L1RA 4H4QA 2ZZCA 3NYFA 4UDQA 3T2YA 3V3OA 3UP5A 4G74A 4CY6A 4J36A 2XVEA 1EL8A 1S3BA 3ICRA 5GRTA 3S61A 4DNAA 2X8GA 3AEGA 2RGHA 4U2LA 2YR6A 5EBKA 1F8SA 5BRTA 3CN8A 3EAOA 2JK6A 4OPCA 2C66A 2OAMA 4U8LA 3CGBA 4H2PA 2BXSA 5J7XA 4B67A 4UDPA 1S2QA 2C65A 2RGJA 2E5VA 3QFBA 3UKHA 4J34A 1GRFA 1NPXA 3D1CA 4EIPA 1E1MA 2R45A 1LTXR 1BGJA 2YQUA 4NEVA 1HYUA 5HYMA 2C3DA 5JCLA 4Z43A 3UKFA 4JNAA 4FK1C 4J33A 3SX6A 3AD9B 5IPYA 4TM1A 1GESA 1Y56B 2VVLG 3DK8A 2W0HA 2R0GA 4C3XA 1NHSA 3FMWA 3BI4A 3B6DA 3WE0A 3AEBA 3GWDA 1BF3A 2RABA 1ZP0A 1IUVA 2YR5A 3L8KA 1DOCA 2NVKX 2XFNA 4U8NA 3UKLA 4Z2TA 3OC4A 4TM0A 1TYTA 2HQMA 1V59A 2FJBA 1ZDLA 3K7MX 3SZWA 5C3JA 2AR8A 2GR2A 3QSSA 4C74A 2WP5A 1S2YA 4Z25A 3BNUA 3NKSA 4YTPA 2WPCA 4NTDA 3CPHG 3Q9TA 4IVOB 4JNQA 3CPIG 5U25A 4YSXA 2RGOA 4II2A 3IHMA 3T37A 1OJ9A 2A87A 2Y6RA 4LIIA 4RG3A 5CQFA 3II4A 3ICSA 3SGLA 5FS7A 2C67A 1ELIA 1H84A 3AYIA 3GD4A 3KPFA 4G6GA 3SFEA 4OPGA 1FEAA 3GMCA 4UP3A 3IF9A 2E1MA 2H89A 2V3AA 2EQ6A 4C5OA 5JCMA 4BK1A 2Q7VA 3GRTA 2F5ZA 3AB1A 4YSZA 3PO7A 4G73A 4H4VA 1LQTA 3AD8B 4UDRA 2ZZ0A 1GNDA 3AYLA 1B8SA 2C76A 1OJCA 3LADA 3NYEA 2VZ2A 4D04A 3PVCA 1YQ3A 3I3LA 2BCGG 4Z2RA 1D7LA 2OALA 1E1KA 3BI5A 3HYXA 4N9XA 4YKFA 4GCMA 2C64A 3ICTA 4CCQA 1BGNA 4EQWA 1F3PA 5FS6A 3P9UA 3VR8A 4U8KA 4IV9A 1Q9IA 3F8RA 3ATRA 3RP8A 4DGKA 2V3BA 3ALMA 4YSHA 2V60A 4OPIA 3GSIA 3M13A 3B3RA 4A7AA 3BI2A 3NK2X 4C3YA 1GV4A 2Q6UA 4O5QA 1P2EA 2XDOA 4JDRA 2GMJA 3SXIA 2X8CA 2YAUA 3UKAA 3ATQA 5FMHA 1PS9A 4EQXA 3C4AA 5DBJA 1S3EA 2B9XA 2YLRA 4P9SA 1KF6A 1L9CA 1SEZA 4GRTA 4JY2A 1O95A 4GAVA 1GEUA 1VG9A 1KDGA 4KX6A 3AE5A 4H4UA 4ADWA 3NN6X 2OA1A 3S5WA 3ISHA 3LZXA 5KMRA 1PXAA 2QA1A 3COXA 4H4SA 3SQPA 1GRGA 4Z24A 3Q6JA 2BRYA 3CPJG 5JCIA 2XYOA 3EPTA 3P1WA 3NH3X 2XVJA 1E39A 4GDPA 3GDNA 1B4VA 4BJZA 1M6IA 3FIMB 2YVGA 2WESA 3AXBA 2V5ZA 3K30A 2WETA 4YXDA 5BULA 5KVHA 2GMHA 2QCUA 1PBDA 4EQRA 1DJQA 4A79A 1H6VA 4ICYA 1OJDA 2GVCA 2FJAA 2YWLA 4REKA 2ZZBA 4H4ZA 3GMBA 2APGA 3UTEA 1D5TA 2V6OA 5HY5A 5HXIA 4JN9A 1GTEA 3H8LA 3AE7A 3QSMA 2XVHA 1TDNA 3FPZA 1KFYA 3NNEA 3OZ2A 1XANA 3AEEA 4CY8A 3NN0X 4H7UA 2GQFA 1JEHA 4H2NA 4TLZA 2XFQA 3SM8A 2Q0LA 2BK3A 2R0PA 1GRAA 1E1LA 3NHOX 4JY3A 1CJCA 1CJ3A 1CBOA 2BC0A 2GF3A 3EANA 2ACZA 3CIRA 2ZBWA 1DJNA 4E0VA 3AE8A 2GR3A 2B76A 4RSLA 3VRBA 4Y4MA 3DGHA 1O5WA 1NG3A 3UOZA 2R46A 1JRZA 1GRBA 3GDPA 3CNSA 4Y4LA 4YTNA 4JQ9A 4A5LA 3QJ4A 3AYJA 1TDEA 2XLPA 3AE2A 1H82A 1JNZA 4HA6A 2BYBA 3AWIA 3H4KA 1FCDA 1GALA 1VG0A 4IA6A 5EB5A 4B65A 4U8MA 1IJHA 5LV9A 2GB0A 3I6DA 4A9WA 4B64A 2X50A 2FJEA 2V61A 3DK4A 4HB9A 4IVMB 4FK1A 4BK2A 4U8IA 1DOEA 1ONFA 2BC1A 2VQBA 1FECA 1QJDA 3D8XA 3AECA 1LVLA 1F8WA 2I0ZA 3F8DA 3DK9A 1XPQA 3ALJA 3VRDB 1JU2A 2WPEA 1MOKA 4WCTA 3AE9A 4I59A 3GD3A 4WX1A 3M12A 3UOXA 1RP0A 1CL0A 4U2SA 4Y4NA 1EL5A 2EQ9A 1COYA 4EQSA 5KNLA 1GETA 2X99A 1ZOVA 3URHA 5KWFA 2C7GA 4H50A 3E1TA 3R9UA 1Y0PA 2WOVA 3ZYXA 4YKGA 1KNPA 2VQ7A 1EL7A 3KLJA 3NGCX 1FL2A 4OPTA 3NG7X 4CBQA 1PBFA 4B68A 3BHKA 4FDCB 3DJDA 1NHPA 4BURA 3CGCA 2YG3A 3SZ0A 1ZKQA 2BA9A 4X9NA 3ABVA 4TLXA 1E1NA 2C75A 1CJ4A 2O9ZA 1L9DA 2XCGA 1IUUA 1CHUA 3LB8A 3UKKA 4Z26A 4CNJA 2R9ZA 3AE1A 4D03A 3UCLA 4U8OA 5EOWA 4H4XA 3BNMA 2AQJA 3NRNA 4YSYA 2GH5A 2GAGB 3QVRA 4KPRA 1ZMCA 1F8RA 1Q1RA 3NK0X 3KVEA 2GV8A 2BS3A 3VR9A 4AOXA 3KKJA 2WOWA 3KPKA 4GR1A 2VVLA 4A99A 4X9MA 2GAHB 1LJ1A 4CRTA 2YLXA 3AEAA 5M10A 3SFDA 2VRMA 3H8IA 3NTDA 2FBWA 4NTEA 3RNMA 5KMSA 1E6EA 1EL9A 1IUTA 1TRBA 3IWAA 2VRLA 1O94A 1VDCA 3ALLA 2WDQA 3G5QA 3O0HA 2BABA 1P2HA 1E7PA 1GOSA 3RP7A 4GUVA 4ZN0A 3FBSA 3NK1X 4J31A 3CNDA 2OLOA 2YG5A 2Z5YA 4GAPA 4DSHA 5KOWA 2XVFA 2H88A 4H4TA 4OPDA 2DKHA 4A65A 3NLCA 4B69A 2BXRA 4NTCA 4H4YA 3QFAA 1PBBA 4XXGA 2C73A 4H2RA 4LU6A 4A6NB 2YG7A 4H4RA 1KSSA 4O5UA 3K7QX 5GSNA 1GTHA 3EF6A 1DOBA 4OVIA 2XLRA 2CVJA 2UZZA 4MJWA 1K0LA 5FS9A 2GR1A 3UOYA 1VQWA 1L9EA 1GSNA 5KMPA 4A6NA 2GEWA 1LV0A 2B7SA 2JB2A 4NNJA 3NT6A 1N4UA 1IUXA 3REDA 4K5RA 4IA5A 3DJJA 4K5SA 5KMQA 2OLNA 3SY4A 3GYIA 4GDEA 4NEWA 1KSUA 4M52A 1W4XA 1CC4A 2WEUA 4B1BA 1JRXA 2PYXA 4RG4A 1GT8A 3KD9A 2WS3A 4APNA 4Z2UA 1OJTA 1DODA 1NENA 1CC6A 2WBAA 1PXCA 1TYPA 1GREA 2GQWA 4EMJA 3P4SA 3KU9A 4U8PA 1XDIA 4BV6A 2GRTA 3F8PA 4EM3A 1TDFA 2IVDA 2WP6A 4ECHA 1H7XA 1GRTA 4H4WA 3CNPA 5KVIA 1D7YA 3C4NA 4AP3A 1FEBA 1XHCA 4YT0A 5M0ZA 2BS2A 2R4EA 2YM2A 2IIDA 4U2TA 3T31A 2PHHA 1D4CA 4K7ZA 5ER0A 3UP4A 3HYWA 1NEKA 2B9WA 2C70A 3ADAB 4J57A 2WQYA 3DJGX 2R0CA 3CNJA 4CNKA 3NYCA 4B63A 4AP1A 3M0OA 2C72A 1N4WA 3SYIA 2VVMA 1YQ4A 4PAAA 4U8JA 2YR4A 3AD7B 1RYIA 4OCGA 1D4DA 2JAEA 3C96A 1H86A 3JSKA 3UTFA 2WPFA 2CULA 1IUWA 3DJEA 1K0IA 4GF7A 1LQUA 2XVIA 3V3NA 3FG2P 2XFOA 3HZLA 2XFPA 1GPEA 5U63A 1YKJA 3QSEA 3LZWA 5KXJA 4OPLA 1REOA 2AAQA 2JKCA 2A89A 3T0KA 3RHAA 3CNTA 2WP9A 4C77A 2QA2A 1ZY8A 1H7WA 5HHFA 2EQ8A 5BUKA 2YM1A 5JCKA 4TM3A 1D4EA 2TMDA 2YLWA 2CDUA 3CGEA 4ZCDA 5L46A 4J56A 2YLSA 1JRYA 1TDKA 5IQ1A 1AOGA 1BZLA 2JB3A 1PDHA 4NZHA 4OPUA 3SZCA 3NIXA 3QVPA 2Z5XA 2BS4A 2Q0KA 1RSGA 3GYXA 3NTAA 4TM4A 2C4CA 4AOSA 3HYVA 3AEFA 3K7TA 4B66A 2E4GA 5U1OA 1JNRA 2B7RA 4H4PA 3LOVA 3P4PA 3SZFA 2IVEA 3LXDA 1TDOA 3P4QA 3GRSA 1NG4A 4J2WA 4I58A 4PABA 3UKPA 1K4QA 1PBEA 4K22A 1H83A 2J3NA 3P4RA 2BCPA 4K2XA 1DNCA 3AE6A 1JOAA 2XLSA 1VRQB 4EMIA 4FX9A 5C2TA 3V76A 2JB1A 1LPFA 2YVJA 1F6MA 1BWCA 2EQ7A 2WU2A 3AE3A 4XWRA 1PHHA 1DXLA 2NPXA 1B37A 4K8DA 1QLBA 1X31B 2XFUA 2YVFA 3ITJA 3UOVA 1M64A 2R4JA 2B9YA 1GERA 2X8HA 3UTGA 2BACA 2YG4A 4AT0A 3AEDA 2QAEA 3T2ZA 5TR3A 2A8XA 3DMEA 1IUSA 4X4JA 1Z6LA 3DGZA 1N1PA 2YLTA 2XLUA 4EMWA 2BK4A 1ZX9A 1CF3A 4XWZA 4USRA 5CKUA 1NAAA 1OJAA 1PBCA 5J60A 3ZDNA 3VQRA 4G6HA 2X3NA 3DA1A 1NDAA 3T2KA 1CJ2A 4USQA 4YWOA 3G5RA 1Y56A 1NHQA 1BKWA 3BHFA 4G9KA 3UTHA 3CGDA 5KOXA 1PN0A 4YTMA 1FOHA 4Z44A 4BJYA 4NWZA 3PS9A 1EBDA 5BVAA 4H2QA 4II3A 1CC2A 5KRQA 4BK3A 3VRAA 2YG6A 1L0VA 3T14A 1GRHA 2ARDA 2C3CA 2WDVA 1GXFA 3DH9A 1NHRA 1UKVG 3G5SA 4LA1A 1H81A 3CMMA 3GWFA 4EIQA 1K0JA 2VOUA 1PJ6A 3RP6A 1ZOYA 2FJDA 3CTYA 4AT2A 3KA7A 2TPRA 2YLZA 5EB4A 1PJ5A 2WHDA 1MO9A 2GR0A 4EM4A 4ZCCA 5IQ4A 3IHGA 3UKQA 1KNRA 1PJ7A
chains in the Genus database with same CATH topology
2BRAA 1QO8A 1ZK7A 1Q1WA 2Y6QA 3IC9A 1YQZA 1N4VA 2JBVA 1MXTA 2CFYA 5JCNA 4DSGA 1ZMDA 3GYJA 2BK5A 4CCRA 1YY5A 2DKIA 1B5QA 5FS8A 2WU5A 2WDRA 2WOIA 1PXBA 2XLTA 3AE4A 3LJPA 3L1RA 4H4QA 2ZZCA 3NYFA 4UDQA 3T2YA 3V3OA 3UP5A 4G74A 4CY6A 4J36A 2XVEA 1EL8A 1S3BA 3ICRA 5GRTA 3S61A 4DNAA 2X8GA 3AEGA 2RGHA 4U2LA 2YR6A 5EBKA 1F8SA 5BRTA 3CN8A 3EAOA 2JK6A 4OPCA 2C66A 2OAMA 4U8LA 3CGBA 4H2PA 2BXSA 5J7XA 4B67A 4UDPA 1S2QA 2C65A 2RGJA 2E5VA 3QFBA 3UKHA 4J34A 1GRFA 1NPXA 3D1CA 4EIPA 1E1MA 2R45A 1LTXR 1BGJA 2YQUA 4NEVA 1HYUA 5HYMA 2C3DA 5JCLA 4Z43A 3UKFA 4JNAA 4FK1C 4J33A 3SX6A 3AD9B 5IPYA 4TM1A 1GESA 1Y56B 2VVLG 3DK8A 2W0HA 2R0GA 4C3XA 1NHSA 3FMWA 3BI4A 3B6DA 3WE0A 3AEBA 3GWDA 1BF3A 2RABA 1ZP0A 1IUVA 2YR5A 3L8KA 1DOCA 2NVKX 2XFNA 4U8NA 3UKLA 4Z2TA 3OC4A 4TM0A 1TYTA 2HQMA 1V59A 2FJBA 1ZDLA 3K7MX 3SZWA 5C3JA 2AR8A 2GR2A 3QSSA 4C74A 2WP5A 1S2YA 4Z25A 3BNUA 3NKSA 4YTPA 2WPCA 4NTDA 3CPHG 3Q9TA 4IVOB 4JNQA 3CPIG 5U25A 4YSXA 2RGOA 4II2A 3IHMA 3T37A 1OJ9A 2A87A 2Y6RA 4LIIA 4RG3A 5CQFA 3II4A 3ICSA 3SGLA 5FS7A 2C67A 1ELIA 1H84A 3AYIA 3GD4A 3KPFA 4G6GA 3SFEA 4OPGA 1FEAA 3GMCA 4UP3A 3IF9A 2E1MA 2H89A 2V3AA 2EQ6A 4C5OA 5JCMA 4BK1A 2Q7VA 3GRTA 2F5ZA 3AB1A 4YSZA 3PO7A 4G73A 4H4VA 1LQTA 3AD8B 4UDRA 2ZZ0A 1GNDA 3AYLA 1B8SA 2C76A 1OJCA 3LADA 3NYEA 2VZ2A 4D04A 3PVCA 1YQ3A 3I3LA 2BCGG 4Z2RA 1D7LA 2OALA 1E1KA 3BI5A 3HYXA 4N9XA 4YKFA 4GCMA 2C64A 3ICTA 4CCQA 1BGNA 4EQWA 1F3PA 5FS6A 3P9UA 3VR8A 4U8KA 4IV9A 1Q9IA 3F8RA 3ATRA 3RP8A 4DGKA 2V3BA 3ALMA 4YSHA 2V60A 4OPIA 3GSIA 3M13A 3B3RA 4A7AA 3BI2A 3NK2X 4C3YA 1GV4A 2Q6UA 4O5QA 1P2EA 2XDOA 4JDRA 2GMJA 3SXIA 2X8CA 2YAUA 3UKAA 3ATQA 5FMHA 1PS9A 4EQXA 3C4AA 5DBJA 1S3EA 2B9XA 2YLRA 4P9SA 1KF6A 1L9CA 1SEZA 4GRTA 4JY2A 1O95A 4GAVA 1GEUA 1VG9A 1KDGA 4KX6A 3AE5A 4H4UA 4ADWA 3NN6X 2OA1A 3S5WA 3ISHA 3LZXA 5KMRA 1PXAA 2QA1A 3COXA 4H4SA 3SQPA 1GRGA 4Z24A 3Q6JA 2BRYA 3CPJG 5JCIA 2XYOA 3EPTA 3P1WA 3NH3X 2XVJA 1E39A 4GDPA 3GDNA 1B4VA 4BJZA 1M6IA 3FIMB 2YVGA 2WESA 3AXBA 2V5ZA 3K30A 2WETA 4YXDA 5BULA 5KVHA 2GMHA 2QCUA 1PBDA 4EQRA 1DJQA 4A79A 1H6VA 4ICYA 1OJDA 2GVCA 2FJAA 2YWLA 4REKA 2ZZBA 4H4ZA 3GMBA 2APGA 3UTEA 1D5TA 2V6OA 5HY5A 5HXIA 4JN9A 1GTEA 3H8LA 3AE7A 3QSMA 2XVHA 1TDNA 3FPZA 1KFYA 3NNEA 3OZ2A 1XANA 3AEEA 4CY8A 3NN0X 4H7UA 2GQFA 1JEHA 4H2NA 4TLZA 2XFQA 3SM8A 2Q0LA 2BK3A 2R0PA 1GRAA 1E1LA 3NHOX 4JY3A 1CJCA 1CJ3A 1CBOA 2BC0A 2GF3A 3EANA 2ACZA 3CIRA 2ZBWA 1DJNA 4E0VA 3AE8A 2GR3A 2B76A 4RSLA 3VRBA 4Y4MA 3DGHA 1O5WA 1NG3A 3UOZA 2R46A 1JRZA 1GRBA 3GDPA 3CNSA 4Y4LA 4YTNA 4JQ9A 4A5LA 3QJ4A 3AYJA 1TDEA 2XLPA 3AE2A 1H82A 1JNZA 4HA6A 2BYBA 3AWIA 3H4KA 1FCDA 1GALA 1VG0A 4IA6A 5EB5A 4B65A 4U8MA 1IJHA 5LV9A 2GB0A 3I6DA 4A9WA 4B64A 2X50A 2FJEA 2V61A 3DK4A 4HB9A 4IVMB 4FK1A 4BK2A 4U8IA 1DOEA 1ONFA 2BC1A 2VQBA 1FECA 1QJDA 3D8XA 3AECA 1LVLA 1F8WA 2I0ZA 3F8DA 3DK9A 1XPQA 3ALJA 3VRDB 1JU2A 2WPEA 1MOKA 4WCTA 3AE9A 4I59A 3GD3A 4WX1A 3M12A 3UOXA 1RP0A 1CL0A 4U2SA 4Y4NA 1EL5A 2EQ9A 1COYA 4EQSA 5KNLA 1GETA 2X99A 1ZOVA 3URHA 5KWFA 2C7GA 4H50A 3E1TA 3R9UA 1Y0PA 2WOVA 3ZYXA 4YKGA 1KNPA 2VQ7A 1EL7A 3KLJA 3NGCX 1FL2A 4OPTA 3NG7X 4CBQA 1PBFA 4B68A 3BHKA 4FDCB 3DJDA 1NHPA 4BURA 3CGCA 2YG3A 3SZ0A 1ZKQA 2BA9A 4X9NA 3ABVA 4TLXA 1E1NA 2C75A 1CJ4A 2O9ZA 1L9DA 2XCGA 1IUUA 1CHUA 3LB8A 3UKKA 4Z26A 4CNJA 2R9ZA 3AE1A 4D03A 3UCLA 4U8OA 5EOWA 4H4XA 3BNMA 2AQJA 3NRNA 4YSYA 2GH5A 2GAGB 3QVRA 4KPRA 1ZMCA 1F8RA 1Q1RA 3NK0X 3KVEA 2GV8A 2BS3A 3VR9A 4AOXA 3KKJA 2WOWA 3KPKA 4GR1A 2VVLA 4A99A 4X9MA 2GAHB 1LJ1A 4CRTA 2YLXA 3AEAA 5M10A 3SFDA 2VRMA 3H8IA 3NTDA 2FBWA 4NTEA 3RNMA 5KMSA 1E6EA 1EL9A 1IUTA 1TRBA 3IWAA 2VRLA 1O94A 1VDCA 3ALLA 2WDQA 3G5QA 3O0HA 2BABA 1P2HA 1E7PA 1GOSA 3RP7A 4GUVA 4ZN0A 3FBSA 3NK1X 4J31A 3CNDA 2OLOA 2YG5A 2Z5YA 4GAPA 4DSHA 5KOWA 2XVFA 2H88A 4H4TA 4OPDA 2DKHA 4A65A 3NLCA 4B69A 2BXRA 4NTCA 4H4YA 3QFAA 1PBBA 4XXGA 2C73A 4H2RA 4LU6A 4A6NB 2YG7A 4H4RA 1KSSA 4O5UA 3K7QX 5GSNA 1GTHA 3EF6A 1DOBA 4OVIA 2XLRA 2CVJA 2UZZA 4MJWA 1K0LA 5FS9A 2GR1A 3UOYA 1VQWA 1L9EA 1GSNA 5KMPA 4A6NA 2GEWA 1LV0A 2B7SA 2JB2A 4NNJA 3NT6A 1N4UA 1IUXA 3REDA 4K5RA 4IA5A 3DJJA 4K5SA 5KMQA 2OLNA 3SY4A 3GYIA 4GDEA 4NEWA 1KSUA 4M52A 1W4XA 1CC4A 2WEUA 4B1BA 1JRXA 2PYXA 4RG4A 1GT8A 3KD9A 2WS3A 4APNA 4Z2UA 1OJTA 1DODA 1NENA 1CC6A 2WBAA 1PXCA 1TYPA 1GREA 2GQWA 4EMJA 3P4SA 3KU9A 4U8PA 1XDIA 4BV6A 2GRTA 3F8PA 4EM3A 1TDFA 2IVDA 2WP6A 4ECHA 1H7XA 1GRTA 4H4WA 3CNPA 5KVIA 1D7YA 3C4NA 4AP3A 1FEBA 1XHCA 4YT0A 5M0ZA 2BS2A 2R4EA 2YM2A 2IIDA 4U2TA 3T31A 2PHHA 1D4CA 4K7ZA 5ER0A 3UP4A 3HYWA 1NEKA 2B9WA 2C70A 3ADAB 4J57A 2WQYA 3DJGX 2R0CA 3CNJA 4CNKA 3NYCA 4B63A 4AP1A 3M0OA 2C72A 1N4WA 3SYIA 2VVMA 1YQ4A 4PAAA 4U8JA 2YR4A 3AD7B 1RYIA 4OCGA 1D4DA 2JAEA 3C96A 1H86A 3JSKA 3UTFA 2WPFA 2CULA 1IUWA 3DJEA 1K0IA 4GF7A 1LQUA 2XVIA 3V3NA 3FG2P 2XFOA 3HZLA 2XFPA 1GPEA 5U63A 1YKJA 3QSEA 3LZWA 5KXJA 4OPLA 1REOA 2AAQA 2JKCA 2A89A 3T0KA 3RHAA 3CNTA 2WP9A 4C77A 2QA2A 1ZY8A 1H7WA 5HHFA 2EQ8A 5BUKA 2YM1A 5JCKA 4TM3A 1D4EA 2TMDA 2YLWA 2CDUA 3CGEA 4ZCDA 5L46A 4J56A 2YLSA 1JRYA 1TDKA 5IQ1A 1AOGA 1BZLA 2JB3A 1PDHA 4NZHA 4OPUA 3SZCA 3NIXA 3QVPA 2Z5XA 2BS4A 2Q0KA 1RSGA 3GYXA 3NTAA 4TM4A 2C4CA 4AOSA 3HYVA 3AEFA 3K7TA 4B66A 2E4GA 5U1OA 1JNRA 2B7RA 4H4PA 3LOVA 3P4PA 3SZFA 2IVEA 3LXDA 1TDOA 3P4QA 3GRSA 1NG4A 4J2WA 4I58A 4PABA 3UKPA 1K4QA 1PBEA 4K22A 1H83A 2J3NA 3P4RA 2BCPA 4K2XA 1DNCA 3AE6A 1JOAA 2XLSA 1VRQB 4EMIA 4FX9A 5C2TA 3V76A 2JB1A 1LPFA 2YVJA 1F6MA 1BWCA 2EQ7A 2WU2A 3AE3A 4XWRA 1PHHA 1DXLA 2NPXA 1B37A 4K8DA 1QLBA 1X31B 2XFUA 2YVFA 3ITJA 3UOVA 1M64A 2R4JA 2B9YA 1GERA 2X8HA 3UTGA 2BACA 2YG4A 4AT0A 3AEDA 2QAEA 3T2ZA 5TR3A 2A8XA 3DMEA 1IUSA 4X4JA 1Z6LA 3DGZA 1N1PA 2YLTA 2XLUA 4EMWA 2BK4A 1ZX9A 1CF3A 4XWZA 4USRA 5CKUA 1NAAA 1OJAA 1PBCA 5J60A 3ZDNA 3VQRA 4G6HA 2X3NA 3DA1A 1NDAA 3T2KA 1CJ2A 4USQA 4YWOA 3G5RA 1Y56A 1NHQA 1BKWA 3BHFA 4G9KA 3UTHA 3CGDA 5KOXA 1PN0A 4YTMA 1FOHA 4Z44A 4BJYA 4NWZA 3PS9A 1EBDA 5BVAA 4H2QA 4II3A 1CC2A 5KRQA 4BK3A 3VRAA 2YG6A 1L0VA 3T14A 1GRHA 2ARDA 2C3CA 2WDVA 1GXFA 3DH9A 1NHRA 1UKVG 3G5SA 4LA1A 1H81A 3CMMA 3GWFA 4EIQA 1K0JA 2VOUA 1PJ6A 3RP6A 1ZOYA 2FJDA 3CTYA 4AT2A 3KA7A 2TPRA 2YLZA 5EB4A 1PJ5A 2WHDA 1MO9A 2GR0A 4EM4A 4ZCCA 5IQ4A 3IHGA 3UKQA 1KNRA 1PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9K A;  3SZC A;  5KMP A;  3SZ0 A;  4NWZ A;  3HYV A;  3SXI A;  4GAV A;  4GAP A;  3T14 A;  3HYX A;  5KMQ A;  3T0K A;  3SZF A;  3SY4 A;  3T2Z A;  4G73 A;  3T2Y A;  3KPK A;  4G6G A;  4G74 A;  3SX6 A;  3T31 A;  5KMR A;  3HYW A;  5KMS A;  3T2K A;  3SYI A;  4G6H A;  3SZW A; 
#chains in the Genus database with same CATH topology
 2BRA A;  1QO8 A;  1ZK7 A;  1Q1W A;  2Y6Q A;  3IC9 A;  1YQZ A;  1N4V A;  2JBV A;  1MXT A;  2CFY A;  5JCN A;  4DSG A;  1ZMD A;  3GYJ A;  2BK5 A;  4CCR A;  1YY5 A;  2DKI A;  1B5Q A;  5FS8 A;  2WU5 A;  2WDR A;  2WOI A;  1PXB A;  2XLT A;  3AE4 A;  3LJP A;  3L1R A;  4H4Q A;  2ZZC A;  3NYF A;  4UDQ A;  3T2Y A;  3V3O A;  3UP5 A;  4G74 A;  4CY6 A;  4J36 A;  2XVE A;  1EL8 A;  1S3B A;  3ICR A;  5GRT A;  3S61 A;  4DNA A;  2X8G A;  3AEG A;  2RGH A;  4U2L A;  2YR6 A;  5EBK A;  1F8S A;  5BRT A;  3CN8 A;  3EAO A;  2JK6 A;  4OPC A;  2C66 A;  2OAM A;  4U8L A;  3CGB A;  4H2P A;  2BXS A;  5J7X A;  4B67 A;  4UDP A;  1S2Q A;  2C65 A;  2RGJ A;  2E5V A;  3QFB A;  3UKH A;  4J34 A;  1GRF A;  1NPX A;  3D1C A;  4EIP A;  1E1M A;  2R45 A;  1LTX R;  1BGJ A;  2YQU A;  4NEV A;  1HYU A;  5HYM A;  2C3D A;  5JCL A;  4Z43 A;  3UKF A;  4JNA A;  4FK1 C;  4J33 A;  3SX6 A;  3AD9 B;  5IPY A;  4TM1 A;  1GES A;  1Y56 B;  2VVL G;  3DK8 A;  2W0H A;  2R0G A;  4C3X A;  1NHS A;  3FMW A;  3BI4 A;  3B6D A;  3WE0 A;  3AEB A;  3GWD A;  1BF3 A;  2RAB A;  1ZP0 A;  1IUV A;  2YR5 A;  3L8K A;  1DOC A;  2NVK X;  2XFN A;  4U8N A;  3UKL A;  4Z2T A;  3OC4 A;  4TM0 A;  1TYT A;  2HQM A;  1V59 A;  2FJB A;  1ZDL A;  3K7M X;  3SZW A;  5C3J A;  2AR8 A;  2GR2 A;  3QSS A;  4C74 A;  2WP5 A;  1S2Y A;  4Z25 A;  3BNU A;  3NKS A;  4YTP A;  2WPC A;  4NTD A;  3CPH G;  3Q9T A;  4IVO B;  4JNQ A;  3CPI G;  5U25 A;  4YSX A;  2RGO A;  4II2 A;  3IHM A;  3T37 A;  1OJ9 A;  2A87 A;  2Y6R A;  4LII A;  4RG3 A;  5CQF A;  3II4 A;  3ICS A;  3SGL A;  5FS7 A;  2C67 A;  1ELI A;  1H84 A;  3AYI A;  3GD4 A;  3KPF A;  4G6G A;  3SFE A;  4OPG A;  1FEA A;  3GMC A;  4UP3 A;  3IF9 A;  2E1M A;  2H89 A;  2V3A A;  2EQ6 A;  4C5O A;  5JCM A;  4BK1 A;  2Q7V A;  3GRT A;  2F5Z A;  3AB1 A;  4YSZ A;  3PO7 A;  4G73 A;  4H4V A;  1LQT A;  3AD8 B;  4UDR A;  2ZZ0 A;  1GND A;  3AYL A;  1B8S A;  2C76 A;  1OJC A;  3LAD A;  3NYE A;  2VZ2 A;  4D04 A;  3PVC A;  1YQ3 A;  3I3L A;  2BCG G;  4Z2R A;  1D7L A;  2OAL A;  1E1K A;  3BI5 A;  3HYX A;  4N9X A;  4YKF A;  4GCM A;  2C64 A;  3ICT A;  4CCQ A;  1BGN A;  4EQW A;  1F3P A;  5FS6 A;  3P9U A;  3VR8 A;  4U8K A;  4IV9 A;  1Q9I A;  3F8R A;  3ATR A;  3RP8 A;  4DGK A;  2V3B A;  3ALM A;  4YSH A;  2V60 A;  4OPI A;  3GSI A;  3M13 A;  3B3R A;  4A7A A;  3BI2 A;  3NK2 X;  4C3Y A;  1GV4 A;  2Q6U A;  4O5Q A;  1P2E A;  2XDO A;  4JDR A;  2GMJ A;  3SXI A;  2X8C A;  2YAU A;  3UKA A;  3ATQ A;  5FMH A;  1PS9 A;  4EQX A;  3C4A A;  5DBJ A;  1S3E A;  2B9X A;  2YLR A;  4P9S A;  1KF6 A;  1L9C A;  1SEZ A;  4GRT A;  4JY2 A;  1O95 A;  4GAV A;  1GEU A;  1VG9 A;  1KDG A;  4KX6 A;  3AE5 A;  4H4U A;  4ADW A;  3NN6 X;  2OA1 A;  3S5W A;  3ISH A;  3LZX A;  5KMR A;  1PXA A;  2QA1 A;  3COX A;  4H4S A;  3SQP A;  1GRG A;  4Z24 A;  3Q6J A;  2BRY A;  3CPJ G;  5JCI A;  2XYO A;  3EPT A;  3P1W A;  3NH3 X;  2XVJ A;  1E39 A;  4GDP A;  3GDN A;  1B4V A;  4BJZ A;  1M6I A;  3FIM B;  2YVG A;  2WES A;  3AXB A;  2V5Z A;  3K30 A;  2WET A;  4YXD A;  5BUL A;  5KVH A;  2GMH A;  2QCU A;  1PBD A;  4EQR A;  1DJQ A;  4A79 A;  1H6V A;  4ICY A;  1OJD A;  2GVC A;  2FJA A;  2YWL A;  4REK A;  2ZZB A;  4H4Z A;  3GMB A;  2APG A;  3UTE A;  1D5T A;  2V6O A;  5HY5 A;  5HXI A;  4JN9 A;  1GTE A;  3H8L A;  3AE7 A;  3QSM A;  2XVH A;  1TDN A;  3FPZ A;  1KFY A;  3NNE A;  3OZ2 A;  1XAN A;  3AEE A;  4CY8 A;  3NN0 X;  4H7U A;  2GQF A;  1JEH A;  4H2N A;  4TLZ A;  2XFQ A;  3SM8 A;  2Q0L A;  2BK3 A;  2R0P A;  1GRA A;  1E1L A;  3NHO X;  4JY3 A;  1CJC A;  1CJ3 A;  1CBO A;  2BC0 A;  2GF3 A;  3EAN A;  2ACZ A;  3CIR A;  2ZBW A;  1DJN A;  4E0V A;  3AE8 A;  2GR3 A;  2B76 A;  4RSL A;  3VRB A;  4Y4M A;  3DGH A;  1O5W A;  1NG3 A;  3UOZ A;  2R46 A;  1JRZ A;  1GRB A;  3GDP A;  3CNS A;  4Y4L A;  4YTN A;  4JQ9 A;  4A5L A;  3QJ4 A;  3AYJ A;  1TDE A;  2XLP A;  3AE2 A;  1H82 A;  1JNZ A;  4HA6 A;  2BYB A;  3AWI A;  3H4K A;  1FCD A;  1GAL A;  1VG0 A;  4IA6 A;  5EB5 A;  4B65 A;  4U8M A;  1IJH A;  5LV9 A;  2GB0 A;  3I6D A;  4A9W A;  4B64 A;  2X50 A;  2FJE A;  2V61 A;  3DK4 A;  4HB9 A;  4IVM B;  4FK1 A;  4BK2 A;  4U8I A;  1DOE A;  1ONF A;  2BC1 A;  2VQB A;  1FEC A;  1QJD A;  3D8X A;  3AEC A;  1LVL A;  1F8W A;  2I0Z A;  3F8D A;  3DK9 A;  1XPQ A;  3ALJ A;  3VRD B;  1JU2 A;  2WPE A;  1MOK A;  4WCT A;  3AE9 A;  4I59 A;  3GD3 A;  4WX1 A;  3M12 A;  3UOX A;  1RP0 A;  1CL0 A;  4U2S A;  4Y4N A;  1EL5 A;  2EQ9 A;  1COY A;  4EQS A;  5KNL A;  1GET A;  2X99 A;  1ZOV A;  3URH A;  5KWF A;  2C7G A;  4H50 A;  3E1T A;  3R9U A;  1Y0P A;  2WOV A;  3ZYX A;  4YKG A;  1KNP A;  2VQ7 A;  1EL7 A;  3KLJ A;  3NGC X;  1FL2 A;  4OPT A;  3NG7 X;  4CBQ A;  1PBF A;  4B68 A;  3BHK A;  4FDC B;  3DJD A;  1NHP A;  4BUR A;  3CGC A;  2YG3 A;  3SZ0 A;  1ZKQ A;  2BA9 A;  4X9N A;  3ABV A;  4TLX A;  1E1N A;  2C75 A;  1CJ4 A;  2O9Z A;  1L9D A;  2XCG A;  1IUU A;  1CHU A;  3LB8 A;  3UKK A;  4Z26 A;  4CNJ A;  2R9Z A;  3AE1 A;  4D03 A;  3UCL A;  4U8O A;  5EOW A;  4H4X A;  3BNM A;  2AQJ A;  3NRN A;  4YSY A;  2GH5 A;  2GAG B;  3QVR A;  4KPR A;  1ZMC A;  1F8R A;  1Q1R A;  3NK0 X;  3KVE A;  2GV8 A;  2BS3 A;  3VR9 A;  4AOX A;  3KKJ A;  2WOW A;  3KPK A;  4GR1 A;  2VVL A;  4A99 A;  4X9M A;  2GAH B;  1LJ1 A;  4CRT A;  2YLX A;  3AEA A;  5M10 A;  3SFD A;  2VRM A;  3H8I A;  3NTD A;  2FBW A;  4NTE A;  3RNM A;  5KMS A;  1E6E A;  1EL9 A;  1IUT A;  1TRB A;  3IWA A;  2VRL A;  1O94 A;  1VDC A;  3ALL A;  2WDQ A;  3G5Q A;  3O0H A;  2BAB A;  1P2H A;  1E7P A;  1GOS A;  3RP7 A;  4GUV A;  4ZN0 A;  3FBS A;  3NK1 X;  4J31 A;  3CND A;  2OLO A;  2YG5 A;  2Z5Y A;  4GAP A;  4DSH A;  5KOW A;  2XVF A;  2H88 A;  4H4T A;  4OPD A;  2DKH A;  4A65 A;  3NLC A;  4B69 A;  2BXR A;  4NTC A;  4H4Y A;  3QFA A;  1PBB A;  4XXG A;  2C73 A;  4H2R A;  4LU6 A;  4A6N B;  2YG7 A;  4H4R A;  1KSS A;  4O5U A;  3K7Q X;  5GSN A;  1GTH A;  3EF6 A;  1DOB A;  4OVI A;  2XLR A;  2CVJ A;  2UZZ A;  4MJW A;  1K0L A;  5FS9 A;  2GR1 A;  3UOY A;  1VQW A;  1L9E A;  1GSN A;  5KMP A;  4A6N A;  2GEW A;  1LV0 A;  2B7S A;  2JB2 A;  4NNJ A;  3NT6 A;  1N4U A;  1IUX A;  3RED A;  4K5R A;  4IA5 A;  3DJJ A;  4K5S A;  5KMQ A;  2OLN A;  3SY4 A;  3GYI A;  4GDE A;  4NEW A;  1KSU A;  4M52 A;  1W4X A;  1CC4 A;  2WEU A;  4B1B A;  1JRX A;  2PYX A;  4RG4 A;  1GT8 A;  3KD9 A;  2WS3 A;  4APN A;  4Z2U A;  1OJT A;  1DOD A;  1NEN A;  1CC6 A;  2WBA A;  1PXC A;  1TYP A;  1GRE A;  2GQW A;  4EMJ A;  3P4S A;  3KU9 A;  4U8P A;  1XDI A;  4BV6 A;  2GRT A;  3F8P A;  4EM3 A;  1TDF A;  2IVD A;  2WP6 A;  4ECH A;  1H7X A;  1GRT A;  4H4W A;  3CNP A;  5KVI A;  1D7Y A;  3C4N A;  4AP3 A;  1FEB A;  1XHC A;  4YT0 A;  5M0Z A;  2BS2 A;  2R4E A;  2YM2 A;  2IID A;  4U2T A;  3T31 A;  2PHH A;  1D4C A;  4K7Z A;  5ER0 A;  3UP4 A;  3HYW A;  1NEK A;  2B9W A;  2C70 A;  3ADA B;  4J57 A;  2WQY A;  3DJG X;  2R0C A;  3CNJ A;  4CNK A;  3NYC A;  4B63 A;  4AP1 A;  3M0O A;  2C72 A;  1N4W A;  3SYI A;  2VVM A;  1YQ4 A;  4PAA A;  4U8J A;  2YR4 A;  3AD7 B;  1RYI A;  4OCG A;  1D4D A;  2JAE A;  3C96 A;  1H86 A;  3JSK A;  3UTF A;  2WPF A;  2CUL A;  1IUW A;  3DJE A;  1K0I A;  4GF7 A;  1LQU A;  2XVI A;  3V3N A;  3FG2 P;  2XFO A;  3HZL A;  2XFP A;  1GPE A;  5U63 A;  1YKJ A;  3QSE A;  3LZW A;  5KXJ A;  4OPL A;  1REO A;  2AAQ A;  2JKC A;  2A89 A;  3T0K A;  3RHA A;  3CNT A;  2WP9 A;  4C77 A;  2QA2 A;  1ZY8 A;  1H7W A;  5HHF A;  2EQ8 A;  5BUK A;  2YM1 A;  5JCK A;  4TM3 A;  1D4E A;  2TMD A;  2YLW A;  2CDU A;  3CGE A;  4ZCD A;  5L46 A;  4J56 A;  2YLS A;  1JRY A;  1TDK A;  5IQ1 A;  1AOG A;  1BZL A;  2JB3 A;  1PDH A;  4NZH A;  4OPU A;  3SZC A;  3NIX A;  3QVP A;  2Z5X A;  2BS4 A;  2Q0K A;  1RSG A;  3GYX A;  3NTA A;  4TM4 A;  2C4C A;  4AOS A;  3HYV A;  3AEF A;  3K7T A;  4B66 A;  2E4G A;  5U1O A;  1JNR A;  2B7R A;  4H4P A;  3LOV A;  3P4P A;  3SZF A;  2IVE A;  3LXD A;  1TDO A;  3P4Q A;  3GRS A;  1NG4 A;  4J2W A;  4I58 A;  4PAB A;  3UKP A;  1K4Q A;  1PBE A;  4K22 A;  1H83 A;  2J3N A;  3P4R A;  2BCP A;  4K2X A;  1DNC A;  3AE6 A;  1JOA A;  2XLS A;  1VRQ B;  4EMI A;  4FX9 A;  5C2T A;  3V76 A;  2JB1 A;  1LPF A;  2YVJ A;  1F6M A;  1BWC A;  2EQ7 A;  2WU2 A;  3AE3 A;  4XWR A;  1PHH A;  1DXL A;  2NPX A;  1B37 A;  4K8D A;  1QLB A;  1X31 B;  2XFU A;  2YVF A;  3ITJ A;  3UOV A;  1M64 A;  2R4J A;  2B9Y A;  1GER A;  2X8H A;  3UTG A;  2BAC A;  2YG4 A;  4AT0 A;  3AED A;  2QAE A;  3T2Z A;  5TR3 A;  2A8X A;  3DME A;  1IUS A;  4X4J A;  1Z6L A;  3DGZ A;  1N1P A;  2YLT A;  2XLU A;  4EMW A;  2BK4 A;  1ZX9 A;  1CF3 A;  4XWZ A;  4USR A;  5CKU A;  1NAA A;  1OJA A;  1PBC A;  5J60 A;  3ZDN A;  3VQR A;  4G6H A;  2X3N A;  3DA1 A;  1NDA A;  3T2K A;  1CJ2 A;  4USQ A;  4YWO A;  3G5R A;  1Y56 A;  1NHQ A;  1BKW A;  3BHF A;  4G9K A;  3UTH A;  3CGD A;  5KOX A;  1PN0 A;  4YTM A;  1FOH A;  4Z44 A;  4BJY A;  4NWZ A;  3PS9 A;  1EBD A;  5BVA A;  4H2Q A;  4II3 A;  1CC2 A;  5KRQ A;  4BK3 A;  3VRA A;  2YG6 A;  1L0V A;  3T14 A;  1GRH A;  2ARD A;  2C3C A;  2WDV A;  1GXF A;  3DH9 A;  1NHR A;  1UKV G;  3G5S A;  4LA1 A;  1H81 A;  3CMM A;  3GWF A;  4EIQ A;  1K0J A;  2VOU A;  1PJ6 A;  3RP6 A;  1ZOY A;  2FJD A;  3CTY A;  4AT2 A;  3KA7 A;  2TPR A;  2YLZ A;  5EB4 A;  1PJ5 A;  2WHD A;  1MO9 A;  2GR0 A;  4EM4 A;  4ZCC A;  5IQ4 A;  3IHG A;  3UKQ A;  1KNR A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 2BRA A;  1QO8 A;  1ZK7 A;  1Q1W A;  2Y6Q A;  3IC9 A;  1YQZ A;  1N4V A;  2JBV A;  1MXT A;  2CFY A;  5JCN A;  4DSG A;  1ZMD A;  3GYJ A;  2BK5 A;  4CCR A;  1YY5 A;  2DKI A;  1B5Q A;  5FS8 A;  2WU5 A;  2WDR A;  2WOI A;  1PXB A;  2XLT A;  3AE4 A;  3LJP A;  3L1R A;  4H4Q A;  2ZZC A;  3NYF A;  4UDQ A;  3T2Y A;  3V3O A;  3UP5 A;  4G74 A;  4CY6 A;  4J36 A;  2XVE A;  1EL8 A;  1S3B A;  3ICR A;  5GRT A;  3S61 A;  4DNA A;  2X8G A;  3AEG A;  2RGH A;  4U2L A;  2YR6 A;  5EBK A;  1F8S A;  5BRT A;  3CN8 A;  3EAO A;  2JK6 A;  4OPC A;  2C66 A;  2OAM A;  4U8L A;  3CGB A;  4H2P A;  2BXS A;  5J7X A;  4B67 A;  4UDP A;  1S2Q A;  2C65 A;  2RGJ A;  2E5V A;  3QFB A;  3UKH A;  4J34 A;  1GRF A;  1NPX A;  3D1C A;  4EIP A;  1E1M A;  2R45 A;  1LTX R;  1BGJ A;  2YQU A;  4NEV A;  1HYU A;  5HYM A;  2C3D A;  5JCL A;  4Z43 A;  3UKF A;  4JNA A;  4FK1 C;  4J33 A;  3SX6 A;  3AD9 B;  5IPY A;  4TM1 A;  1GES A;  1Y56 B;  2VVL G;  3DK8 A;  2W0H A;  2R0G A;  4C3X A;  1NHS A;  3FMW A;  3BI4 A;  3B6D A;  3WE0 A;  3AEB A;  3GWD A;  1BF3 A;  2RAB A;  1ZP0 A;  1IUV A;  2YR5 A;  3L8K A;  1DOC A;  2NVK X;  2XFN A;  4U8N A;  3UKL A;  4Z2T A;  3OC4 A;  4TM0 A;  1TYT A;  2HQM A;  1V59 A;  2FJB A;  1ZDL A;  3K7M X;  3SZW A;  5C3J A;  2AR8 A;  2GR2 A;  3QSS A;  4C74 A;  2WP5 A;  1S2Y A;  4Z25 A;  3BNU A;  3NKS A;  4YTP A;  2WPC A;  4NTD A;  3CPH G;  3Q9T A;  4IVO B;  4JNQ A;  3CPI G;  5U25 A;  4YSX A;  2RGO A;  4II2 A;  3IHM A;  3T37 A;  1OJ9 A;  2A87 A;  2Y6R A;  4LII A;  4RG3 A;  5CQF A;  3II4 A;  3ICS A;  3SGL A;  5FS7 A;  2C67 A;  1ELI A;  1H84 A;  3AYI A;  3GD4 A;  3KPF A;  4G6G A;  3SFE A;  4OPG A;  1FEA A;  3GMC A;  4UP3 A;  3IF9 A;  2E1M A;  2H89 A;  2V3A A;  2EQ6 A;  4C5O A;  5JCM A;  4BK1 A;  2Q7V A;  3GRT A;  2F5Z A;  3AB1 A;  4YSZ A;  3PO7 A;  4G73 A;  4H4V A;  1LQT A;  3AD8 B;  4UDR A;  2ZZ0 A;  1GND A;  3AYL A;  1B8S A;  2C76 A;  1OJC A;  3LAD A;  3NYE A;  2VZ2 A;  4D04 A;  3PVC A;  1YQ3 A;  3I3L A;  2BCG G;  4Z2R A;  1D7L A;  2OAL A;  1E1K A;  3BI5 A;  3HYX A;  4N9X A;  4YKF A;  4GCM A;  2C64 A;  3ICT A;  4CCQ A;  1BGN A;  4EQW A;  1F3P A;  5FS6 A;  3P9U A;  3VR8 A;  4U8K A;  4IV9 A;  1Q9I A;  3F8R A;  3ATR A;  3RP8 A;  4DGK A;  2V3B A;  3ALM A;  4YSH A;  2V60 A;  4OPI A;  3GSI A;  3M13 A;  3B3R A;  4A7A A;  3BI2 A;  3NK2 X;  4C3Y A;  1GV4 A;  2Q6U A;  4O5Q A;  1P2E A;  2XDO A;  4JDR A;  2GMJ A;  3SXI A;  2X8C A;  2YAU A;  3UKA A;  3ATQ A;  5FMH A;  1PS9 A;  4EQX A;  3C4A A;  5DBJ A;  1S3E A;  2B9X A;  2YLR A;  4P9S A;  1KF6 A;  1L9C A;  1SEZ A;  4GRT A;  4JY2 A;  1O95 A;  4GAV A;  1GEU A;  1VG9 A;  1KDG A;  4KX6 A;  3AE5 A;  4H4U A;  4ADW A;  3NN6 X;  2OA1 A;  3S5W A;  3ISH A;  3LZX A;  5KMR A;  1PXA A;  2QA1 A;  3COX A;  4H4S A;  3SQP A;  1GRG A;  4Z24 A;  3Q6J A;  2BRY A;  3CPJ G;  5JCI A;  2XYO A;  3EPT A;  3P1W A;  3NH3 X;  2XVJ A;  1E39 A;  4GDP A;  3GDN A;  1B4V A;  4BJZ A;  1M6I A;  3FIM B;  2YVG A;  2WES A;  3AXB A;  2V5Z A;  3K30 A;  2WET A;  4YXD A;  5BUL A;  5KVH A;  2GMH A;  2QCU A;  1PBD A;  4EQR A;  1DJQ A;  4A79 A;  1H6V A;  4ICY A;  1OJD A;  2GVC A;  2FJA A;  2YWL A;  4REK A;  2ZZB A;  4H4Z A;  3GMB A;  2APG A;  3UTE A;  1D5T A;  2V6O A;  5HY5 A;  5HXI A;  4JN9 A;  1GTE A;  3H8L A;  3AE7 A;  3QSM A;  2XVH A;  1TDN A;  3FPZ A;  1KFY A;  3NNE A;  3OZ2 A;  1XAN A;  3AEE A;  4CY8 A;  3NN0 X;  4H7U A;  2GQF A;  1JEH A;  4H2N A;  4TLZ A;  2XFQ A;  3SM8 A;  2Q0L A;  2BK3 A;  2R0P A;  1GRA A;  1E1L A;  3NHO X;  4JY3 A;  1CJC A;  1CJ3 A;  1CBO A;  2BC0 A;  2GF3 A;  3EAN A;  2ACZ A;  3CIR A;  2ZBW A;  1DJN A;  4E0V A;  3AE8 A;  2GR3 A;  2B76 A;  4RSL A;  3VRB A;  4Y4M A;  3DGH A;  1O5W A;  1NG3 A;  3UOZ A;  2R46 A;  1JRZ A;  1GRB A;  3GDP A;  3CNS A;  4Y4L A;  4YTN A;  4JQ9 A;  4A5L A;  3QJ4 A;  3AYJ A;  1TDE A;  2XLP A;  3AE2 A;  1H82 A;  1JNZ A;  4HA6 A;  2BYB A;  3AWI A;  3H4K A;  1FCD A;  1GAL A;  1VG0 A;  4IA6 A;  5EB5 A;  4B65 A;  4U8M A;  1IJH A;  5LV9 A;  2GB0 A;  3I6D A;  4A9W A;  4B64 A;  2X50 A;  2FJE A;  2V61 A;  3DK4 A;  4HB9 A;  4IVM B;  4FK1 A;  4BK2 A;  4U8I A;  1DOE A;  1ONF A;  2BC1 A;  2VQB A;  1FEC A;  1QJD A;  3D8X A;  3AEC A;  1LVL A;  1F8W A;  2I0Z A;  3F8D A;  3DK9 A;  1XPQ A;  3ALJ A;  3VRD B;  1JU2 A;  2WPE A;  1MOK A;  4WCT A;  3AE9 A;  4I59 A;  3GD3 A;  4WX1 A;  3M12 A;  3UOX A;  1RP0 A;  1CL0 A;  4U2S A;  4Y4N A;  1EL5 A;  2EQ9 A;  1COY A;  4EQS A;  5KNL A;  1GET A;  2X99 A;  1ZOV A;  3URH A;  5KWF A;  2C7G A;  4H50 A;  3E1T A;  3R9U A;  1Y0P A;  2WOV A;  3ZYX A;  4YKG A;  1KNP A;  2VQ7 A;  1EL7 A;  3KLJ A;  3NGC X;  1FL2 A;  4OPT A;  3NG7 X;  4CBQ A;  1PBF A;  4B68 A;  3BHK A;  4FDC B;  3DJD A;  1NHP A;  4BUR A;  3CGC A;  2YG3 A;  3SZ0 A;  1ZKQ A;  2BA9 A;  4X9N A;  3ABV A;  4TLX A;  1E1N A;  2C75 A;  1CJ4 A;  2O9Z A;  1L9D A;  2XCG A;  1IUU A;  1CHU A;  3LB8 A;  3UKK A;  4Z26 A;  4CNJ A;  2R9Z A;  3AE1 A;  4D03 A;  3UCL A;  4U8O A;  5EOW A;  4H4X A;  3BNM A;  2AQJ A;  3NRN A;  4YSY A;  2GH5 A;  2GAG B;  3QVR A;  4KPR A;  1ZMC A;  1F8R A;  1Q1R A;  3NK0 X;  3KVE A;  2GV8 A;  2BS3 A;  3VR9 A;  4AOX A;  3KKJ A;  2WOW A;  3KPK A;  4GR1 A;  2VVL A;  4A99 A;  4X9M A;  2GAH B;  1LJ1 A;  4CRT A;  2YLX A;  3AEA A;  5M10 A;  3SFD A;  2VRM A;  3H8I A;  3NTD A;  2FBW A;  4NTE A;  3RNM A;  5KMS A;  1E6E A;  1EL9 A;  1IUT A;  1TRB A;  3IWA A;  2VRL A;  1O94 A;  1VDC A;  3ALL A;  2WDQ A;  3G5Q A;  3O0H A;  2BAB A;  1P2H A;  1E7P A;  1GOS A;  3RP7 A;  4GUV A;  4ZN0 A;  3FBS A;  3NK1 X;  4J31 A;  3CND A;  2OLO A;  2YG5 A;  2Z5Y A;  4GAP A;  4DSH A;  5KOW A;  2XVF A;  2H88 A;  4H4T A;  4OPD A;  2DKH A;  4A65 A;  3NLC A;  4B69 A;  2BXR A;  4NTC A;  4H4Y A;  3QFA A;  1PBB A;  4XXG A;  2C73 A;  4H2R A;  4LU6 A;  4A6N B;  2YG7 A;  4H4R A;  1KSS A;  4O5U A;  3K7Q X;  5GSN A;  1GTH A;  3EF6 A;  1DOB A;  4OVI A;  2XLR A;  2CVJ A;  2UZZ A;  4MJW A;  1K0L A;  5FS9 A;  2GR1 A;  3UOY A;  1VQW A;  1L9E A;  1GSN A;  5KMP A;  4A6N A;  2GEW A;  1LV0 A;  2B7S A;  2JB2 A;  4NNJ A;  3NT6 A;  1N4U A;  1IUX A;  3RED A;  4K5R A;  4IA5 A;  3DJJ A;  4K5S A;  5KMQ A;  2OLN A;  3SY4 A;  3GYI A;  4GDE A;  4NEW A;  1KSU A;  4M52 A;  1W4X A;  1CC4 A;  2WEU A;  4B1B A;  1JRX A;  2PYX A;  4RG4 A;  1GT8 A;  3KD9 A;  2WS3 A;  4APN A;  4Z2U A;  1OJT A;  1DOD A;  1NEN A;  1CC6 A;  2WBA A;  1PXC A;  1TYP A;  1GRE A;  2GQW A;  4EMJ A;  3P4S A;  3KU9 A;  4U8P A;  1XDI A;  4BV6 A;  2GRT A;  3F8P A;  4EM3 A;  1TDF A;  2IVD A;  2WP6 A;  4ECH A;  1H7X A;  1GRT A;  4H4W A;  3CNP A;  5KVI A;  1D7Y A;  3C4N A;  4AP3 A;  1FEB A;  1XHC A;  4YT0 A;  5M0Z A;  2BS2 A;  2R4E A;  2YM2 A;  2IID A;  4U2T A;  3T31 A;  2PHH A;  1D4C A;  4K7Z A;  5ER0 A;  3UP4 A;  3HYW A;  1NEK A;  2B9W A;  2C70 A;  3ADA B;  4J57 A;  2WQY A;  3DJG X;  2R0C A;  3CNJ A;  4CNK A;  3NYC A;  4B63 A;  4AP1 A;  3M0O A;  2C72 A;  1N4W A;  3SYI A;  2VVM A;  1YQ4 A;  4PAA A;  4U8J A;  2YR4 A;  3AD7 B;  1RYI A;  4OCG A;  1D4D A;  2JAE A;  3C96 A;  1H86 A;  3JSK A;  3UTF A;  2WPF A;  2CUL A;  1IUW A;  3DJE A;  1K0I A;  4GF7 A;  1LQU A;  2XVI A;  3V3N A;  3FG2 P;  2XFO A;  3HZL A;  2XFP A;  1GPE A;  5U63 A;  1YKJ A;  3QSE A;  3LZW A;  5KXJ A;  4OPL A;  1REO A;  2AAQ A;  2JKC A;  2A89 A;  3T0K A;  3RHA A;  3CNT A;  2WP9 A;  4C77 A;  2QA2 A;  1ZY8 A;  1H7W A;  5HHF A;  2EQ8 A;  5BUK A;  2YM1 A;  5JCK A;  4TM3 A;  1D4E A;  2TMD A;  2YLW A;  2CDU A;  3CGE A;  4ZCD A;  5L46 A;  4J56 A;  2YLS A;  1JRY A;  1TDK A;  5IQ1 A;  1AOG A;  1BZL A;  2JB3 A;  1PDH A;  4NZH A;  4OPU A;  3SZC A;  3NIX A;  3QVP A;  2Z5X A;  2BS4 A;  2Q0K A;  1RSG A;  3GYX A;  3NTA A;  4TM4 A;  2C4C A;  4AOS A;  3HYV A;  3AEF A;  3K7T A;  4B66 A;  2E4G A;  5U1O A;  1JNR A;  2B7R A;  4H4P A;  3LOV A;  3P4P A;  3SZF A;  2IVE A;  3LXD A;  1TDO A;  3P4Q A;  3GRS A;  1NG4 A;  4J2W A;  4I58 A;  4PAB A;  3UKP A;  1K4Q A;  1PBE A;  4K22 A;  1H83 A;  2J3N A;  3P4R A;  2BCP A;  4K2X A;  1DNC A;  3AE6 A;  1JOA A;  2XLS A;  1VRQ B;  4EMI A;  4FX9 A;  5C2T A;  3V76 A;  2JB1 A;  1LPF A;  2YVJ A;  1F6M A;  1BWC A;  2EQ7 A;  2WU2 A;  3AE3 A;  4XWR A;  1PHH A;  1DXL A;  2NPX A;  1B37 A;  4K8D A;  1QLB A;  1X31 B;  2XFU A;  2YVF A;  3ITJ A;  3UOV A;  1M64 A;  2R4J A;  2B9Y A;  1GER A;  2X8H A;  3UTG A;  2BAC A;  2YG4 A;  4AT0 A;  3AED A;  2QAE A;  3T2Z A;  5TR3 A;  2A8X A;  3DME A;  1IUS A;  4X4J A;  1Z6L A;  3DGZ A;  1N1P A;  2YLT A;  2XLU A;  4EMW A;  2BK4 A;  1ZX9 A;  1CF3 A;  4XWZ A;  4USR A;  5CKU A;  1NAA A;  1OJA A;  1PBC A;  5J60 A;  3ZDN A;  3VQR A;  4G6H A;  2X3N A;  3DA1 A;  1NDA A;  3T2K A;  1CJ2 A;  4USQ A;  4YWO A;  3G5R A;  1Y56 A;  1NHQ A;  1BKW A;  3BHF A;  4G9K A;  3UTH A;  3CGD A;  5KOX A;  1PN0 A;  4YTM A;  1FOH A;  4Z44 A;  4BJY A;  4NWZ A;  3PS9 A;  1EBD A;  5BVA A;  4H2Q A;  4II3 A;  1CC2 A;  5KRQ A;  4BK3 A;  3VRA A;  2YG6 A;  1L0V A;  3T14 A;  1GRH A;  2ARD A;  2C3C A;  2WDV A;  1GXF A;  3DH9 A;  1NHR A;  1UKV G;  3G5S A;  4LA1 A;  1H81 A;  3CMM A;  3GWF A;  4EIQ A;  1K0J A;  2VOU A;  1PJ6 A;  3RP6 A;  1ZOY A;  2FJD A;  3CTY A;  4AT2 A;  3KA7 A;  2TPR A;  2YLZ A;  5EB4 A;  1PJ5 A;  2WHD A;  1MO9 A;  2GR0 A;  4EM4 A;  4ZCC A;  5IQ4 A;  3IHG A;  3UKQ A;  1KNR A;  1PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...