4G9KA

Structure of the ndi1 protein from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 144
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g9kA00
4G9KA 3HYXA 3HYVA 4G74A 3T2ZA 5KMRA 5KMQA 3SXIA 4GAVA 3KPKA 3SX6A 3T2YA 3T0KA 3HYWA 4GAPA 3T2KA 3SYIA 3SZFA 3SZCA 3T14A 5KMPA 5KMSA 4G6GA 4G73A 3SZWA 3SY4A 4NWZA 3SZ0A 3T31A 4G6HA
chains in the Genus database with same CATH superfamily
1XPQA 3HYXA 3HYVA 3AEAA 2YVJA 3NYCA 4G9KA 3T37A 1CC6A 2V6OA 3LZXA 4M52A 4YT0A 4Z25A 4ZN0A 4O5UA 3LOVA 2VZ2A 4H4VA 1GOSA 5BUKA 4OPUA 1PXBA 2FJAA 3AE2A 4JNAA 4JY3A 1L9CA 4IA6A 5EB5A 1ZMCA 3II4A 2H88A 2GEWA 2RGOA 1ELIA 3CNJA 3CNPA 2BK5A 4H7UA 3T14A 4A6NA 3OZ2A 2C3DA 5KVIA 3GDNA 2XVFA 4YSHA 2VVLA 2X8HA 1BKWA 1GRTA 3DK8A 3NHOX 2BABA 4TM4A 4BK3A 3UTEA 4TM1A 2BK3A 3NYFA 1ZOVA 4OCGA 4GCMA 1EL8A 3GMBA 4E0VA 4H4RA 1LQUA 2CDUA 3KPFA 4Z2TA 1GRHA 1PBCA 4RG4A 2Y6RA 2YG6A 1VDCA 4EQRA 4YSZA 3T2KA 2GR1A 2C66A 3P9UA 1GXFA 1OJDA 1ZP0A 2BS3A 1GNDA 2GVCA 2YG7A 5JCLA 4H2QA 2XDOA 3AE3A 4B67A 4H4XA 3ICTA 1PHHA 4EQWA 1H6VA 3OC4A 2B7RA 2GV8A 1H7WA 4NWZA 1JRXA 3AXBA 1GREA 4BK1A 4Z2UA 2YQUA 1E1NA 1JOAA 3GRTA 3R9UA 2X8GA 4H2PA 1CBOA 4JDRA 1PXAA 2Q0KA 4G6HA 2C4CA 3IHMA 3DJEA 3H8LA 2TMDA 1KDGA 2EQ6A 4BK2A 2JB3A 2X50A 3KKJA 4C74A 3L8KA 4BV6A 2YLXA 3QJ4A 1E7PA 4YSYA 1FL2A 2WP5A 2NPXA 2VQ7A 3NK1X 4DSHA 4AOXA 4CRTA 4YSXA 2Q6UA 3C4NA 4H4PA 5KXJA 4H50A 2E4GA 4U8LA 3F8RA 1L9DA 2R4EA 2GR3A 1Y0PA 1HYUA 1V59A 1IUSA 1GESA 2GB0A 3GYXA 4U8KA 2YG3A 2PHHA 3NN6X 1K0IA 4AT0A 2YR5A 1BF3A 1E1MA 2APGA 2FJDA 2PYXA 1ZX9A 1RP0A 5M10A 3ISHA 1TYTA 3LADA 5HHFA 4CNJA 4C3XA 1QLBA 3LJPA 5BVAA 4JQ9A 2HQMA 4B63A 2CVJA 5HY5A 1L0VA 4BJZA 2OLNA 1VRQB 2R0GA 5U25A 2EQ7A 1Y56A 2OAMA 2X3NA 3AEEA 4DNAA 3UOVA 1EL5A 3G5RA 4OVIA 3NK2X 1RYIA 4Z44A 5KNLA 4B1BA 3ATQA 1KSSA 2VQBA 4XWRA 2A8XA 3G5QA 4K7ZA 1D4DA 2Y6QA 4NZHA 2X8CA 4U2SA 3F8DA 3EF6A 5ER0A 1NENA 1ZK7A 3AE6A 2WDVA 3UP4A 3CPHG 1ZMDA 4U2LA 1B8SA 2WDRA 2WPFA 1P2EA 1OJTA 1LVLA 1M64A 4K8DA 2Q7VA 1GRBA 3QVPA 4EQXA 1NHPA 3UP5A 1CJ4A 2XFOA 3HZLA 4FDCB 4DSGA 3DK4A 4EMJA 1OJ9A 3UKFA 3DMEA 3NN0X 3AYLA 1GRAA 3M12A 2VOUA 4GAVA 2C64A 3GSIA 1BGNA 3AYJA 3CNSA 4AP1A 4NTDA 3S5WA 3EAOA 3I3LA 3UKPA 3PVCA 3CN8A 4Y4MA 1Z6LA 2R9ZA 2WDQA 2WESA 1E39A 2B9XA 4TLXA 2F5ZA 3UOYA 4RSLA 1Q1RA 4H4WA 2XFUA 3IHGA 2IVEA 5C2TA 3F8PA 1K0LA 3GD3A 2ZBWA 1FEAA 1D4CA 4OPTA 4J31A 5U63A 1KFYA 2B9YA 3AWIA 5KOWA 2YLRA 2B9WA 3BHKA 1QJDA 1O94A 3QFAA 1GALA 1L9EA 4OPGA 3P1WA 2WOIA 1TDFA 1F8WA 2RGJA 1DOCA 4ICYA 3ALMA 3SXIA 3AD9B 4H4SA 4KX6A 3ALLA 2YR4A 3NKSA 5JCNA 3PS9A 3B3RA 3H8IA 1S2QA 3REDA 2OLOA 1EL9A 2C72A 4LIIA 2QA2A 4OPIA 4EM3A 5KOXA 4YXDA 3JSKA 1JNRA 3CPJG 1UKVG 2R45A 3M13A 1N1PA 1B37A 1YY5A 5BULA 4OPDA 2C3CA 1COYA 3AEDA 3LXDA 4YWOA 5CKUA 3B6DA 2WOWA 3RP8A 4CCQA 2WETA 1Q9IA 1VG9A 2XFPA 1XHCA 2C73A 2R0PA 3Q9TA 3KLJA 3CIRA 1GSNA 4J2WA 4ZCCA 3QVRA 4I58A 3KVEA 2JK6A 2NVKX 2GAHB 1DJNA 4EMIA 1YQZA 1N4WA 2WQYA 4GUVA 2GRTA 2JB2A 1YKJA 3D1CA 3V76A 3VRDB 4NEWA 2B76A 2BK4A 1CC2A 3GMCA 1PDHA 3CGEA 1NEKA 1K4QA 1JNZA 3ALJA 3FPZA 4LU6A 5M0ZA 3S61A 3DGZA 3VRBA 4NTEA 2ARDA 4B64A 2WOVA 1MOKA 3NH3X 3P4SA 5JCIA 4CBQA 3VRAA 3UTHA 3UCLA 3AECA 2V5ZA 2GH5A 4K5RA 4ADWA 2BRAA 2BYBA 2XVIA 2YG4A 3LZWA 2FJEA 3K7QX 2XVHA 4A79A 2BXRA 4B65A 1H82A 2C65A 4H2RA 1KF6A 2RGHA 1NAAA 2FBWA 1TDEA 2BCGG 4O5QA 4A6NB 4TLZA 1N4UA 5FMHA 2V3AA 2YLWA 2WU5A 5DBJA 4B66A 4KPRA 3GD4A 2YVFA 3V3NA 5GRTA 1EBDA 1LPFA 4X9NA 2E1MA 3P4QA 4G73A 5EBKA 4UDQA 3SQPA 1ZDLA 3LB8A 3FBSA 3GYIA 3K30A 1JU2A 4GDPA 4FX9A 1GPEA 3CGCA 1SEZA 3SZ0A 1S3BA 3GWDA 1TDNA 4NEVA 1ZY8A 3NT6A 2JBVA 4IVMB 3NRNA 4EIPA 5HYMA 2GQFA 3AD7B 3UTFA 2QAEA 1RSGA 1PBDA 2CULA 1BZLA 2GQWA 2BACA 4EM4A 3CGBA 3HYWA 4A99A 3AEFA 1E6EA 2QA1A 3DJGX 3C96A 1F8RA 5FS9A 4H2NA 2GMHA 1D7LA 3AE4A 2WBAA 4EMWA 3ADAB 2YVGA 2YG5A 3CNTA 4USRA 3DA1A 2XLUA 2XLTA 3SZWA 2EQ9A 2YWLA 1GT8A 2WHDA 4FK1C 4U8PA 4B68A 2WPEA 4K22A 1TYPA 2YM2A 3NYEA 2GF3A 2R46A 2BC1A 3NGCX 1AOGA 4EIQA 3IWAA 3D8XA 2YLSA 5BRTA 1FOHA 3G5SA 3GWFA 1O95A 2Z5XA 1LQTA 4G74A 2XVJA 5IPYA 2R4JA 2DKIA 1DOEA 5IQ1A 1CJCA 4YKGA 1TDKA 3CMMA 5L46A 4C5OA 1D5TA 3H4KA 4GF7A 4K2XA 5KVHA 3SZFA 1NHSA 2V61A 4OPLA 2ZZBA 4NTCA 2YLZA 3EANA 3NTAA 1PJ5A 2VRMA 4TM0A 1S3EA 2H89A 4JN9A 1KSUA 4EQSA 3AD8B 4YTNA 3BI4A 4HB9A 3T31A 4IA5A 2CFYA 4Z24A 2W0HA 1E1KA 1JEHA 2XLRA 3V3OA 4A65A 3SGLA 1Q1WA 1LJ1A 1KNRA 1YQ3A 3NTDA 1Y56B 4Z26A 3BNMA 1LTXR 4REKA 1GV4A 2RABA 4WX1A 4GAPA 4YKFA 4CY8A 2BA9A 2BS4A 3ICRA 2WPCA 3SZCA 3AEGA 2AQJA 4RG3A 5FS6A 4ECHA 1S2YA 5KMPA 5LV9A 3K7MX 2O9ZA 4IV9A 2C7GA 2B7SA 4G6GA 5C3JA 1NDAA 1IUWA 1REOA 2FJBA 5FS7A 4H4UA 2C75A 4XXGA 3UTGA 2WS3A 1IUUA 3DK9A 3ABVA 4II3A 3NG7X 2X99A 4CNKA 2J3NA 2VRLA 3UOXA 2GR0A 3ICSA 2BXSA 3AE5A 4I59A 5KMQA 2BC0A 4UDPA 3CNDA 3ATRA 4U8NA 1B5QA 4CCRA 2WP9A 4PABA 3WE0A 1MXTA 1VQWA 3KPKA 1IUXA 4AOSA 1D4EA 3NLCA 4D04A 3UKAA 2TPRA 1EL7A 1GTHA 1GRGA 1H86A 1P2HA 4PAAA 1M6IA 1DNCA 4USQA 2BS2A 1DODA 5U1OA 1CF3A 2Q0LA 4H4ZA 2Z5YA 4A5LA 3BI5A 4J57A 4LA1A 3AE9A 1PBFA 1H7XA 3AYIA 3IC9A 3AEBA 1GERA 2JKCA 4ZCDA 1B4VA 3O0HA 1F8SA 1JRZA 3QSMA 3IF9A 4BJYA 1XANA 2EQ8A 1FECA 3RP7A 2AAQA 1LV0A 2R0CA 2GAGB 1DXLA 3SFDA 1FEBA 2IIDA 1W4XA 4HA6A 5GSNA 5JCKA 3COXA 3L1RA 1XDIA 4C77A 4GRTA 4AP3A 4H4YA 4II2A 4U8JA 4N9XA 1PS9A 3E1TA 3K7TA 1NHRA 3C4AA 1KNPA 1N4VA 3UKHA 1FCDA 1PJ6A 2JB1A 3Q6JA 2ZZCA 2XVEA 4Z43A 2AR8A 4X4JA 2WU2A 1CJ3A 1PBEA 1CL0A 4XWZA 1BWCA 2QCUA 4IVOB 1H83A 3NK0X 2V3BA 4UP3A 3M0OA 4YTPA 4Y4NA 3NIXA 4K5SA 4U8MA 4J33A 2XLSA 3KA7A 3CGDA 2XCGA 5KMRA 5JCMA 5CQFA 5TR3A 1JRYA 3FG2P 3T0KA 3BI2A 1DOBA 3AE8A 3SYIA 5J60A 5EOWA 4BURA 3GDPA 4UDRA 2OALA 1NG4A 3SFEA 1CC4A 2XFQA 4JNQA 3DJJA 4OPCA 1D7YA 4U8OA 3RHAA 1NG3A 2YR6A 3DGHA 3ZYXA 1QO8A 4YTMA 3QFBA 2BCPA 2I0ZA 2OA1A 2E5VA 2WP6A 4MJWA 4FK1A 3UOZA 3EPTA 4Y4LA 4A9WA 2YAUA 3KD9A 1NHQA 1ZOYA 2GR2A 2VVLG 3T2ZA 4CY6A 4APNA 1GEUA 1TRBA 4A7AA 1TDOA 3P4RA 4H4TA 3SM8A 3DJDA 1CHUA 5HXIA 3I6DA 5KRQA 4GDEA 2YM1A 3VR9A 1PJ7A 1OJCA 1IUTA 3GYJA 2IVDA 2YLTA 4C3YA 3RP6A 2C76A 4J56A 4JY2A 1CJ2A 3BNUA 5IQ4A 1K0JA 1NPXA 2XFNA 1DJQA 3FMWA 3UKKA 1VG0A 3DH9A 3ITJA 1IJHA 3QSSA 4B69A 4Z2RA 3GRSA 1IUVA 1X31B 2JAEA 3CTYA 3QSEA 3KU9A 3UKQA 3BHFA 5KWFA 4U8IA 1F3PA 1H81A 1PXCA 4J34A 4P9SA 3UKLA 2ZZ0A 2BRYA 1GTEA 4TM3A 1PN0A 2ACZA 3NNEA 1GETA 4X9MA 3SX6A 2A87A 3T2YA 3ZDNA 1E1LA 2V60A 4GR1A 3AE7A 4DGKA 5J7XA 2GMJA 3VR8A 3PO7A 2XYOA 1MO9A 5KMSA 2DKHA 5FS8A 4NNJA 1F6MA 4AT2A 1YQ4A 1H84A 3URHA 4D03A 2A89A 3AE1A 3SY4A 1ZKQA 3AB1A 3P4PA 2C67A 2UZZA 1BGJA 1GRFA 2C70A 2VVMA 3FIMB 4H4QA 1ONFA 4U2TA 1PBBA 5EB4A 1OJAA 3VQRA 3RNMA 2XLPA 4WCTA 4J36A 1O5WA 2WEUA 3CPIG
chains in the Genus database with same CATH topology
1XPQA 3HYXA 3HYVA 3AEAA 2YVJA 3NYCA 4G9KA 3T37A 1CC6A 2V6OA 3LZXA 4M52A 4YT0A 4Z25A 4ZN0A 4O5UA 3LOVA 2VZ2A 4H4VA 1GOSA 5BUKA 4OPUA 1PXBA 2FJAA 3AE2A 4JNAA 4JY3A 1L9CA 4IA6A 5EB5A 1ZMCA 3II4A 2H88A 2GEWA 2RGOA 1ELIA 3CNJA 3CNPA 2BK5A 4H7UA 3T14A 4A6NA 3OZ2A 2C3DA 5KVIA 3GDNA 2XVFA 4YSHA 2VVLA 2X8HA 1BKWA 1GRTA 3DK8A 3NHOX 2BABA 4TM4A 4BK3A 3UTEA 4TM1A 2BK3A 3NYFA 1ZOVA 4OCGA 4GCMA 1EL8A 3GMBA 4E0VA 4H4RA 1LQUA 2CDUA 3KPFA 4Z2TA 1GRHA 1PBCA 4RG4A 2Y6RA 2YG6A 1VDCA 4EQRA 4YSZA 3T2KA 2GR1A 2C66A 3P9UA 1GXFA 1OJDA 1ZP0A 2BS3A 1GNDA 2GVCA 2YG7A 5JCLA 4H2QA 2XDOA 3AE3A 4B67A 4H4XA 3ICTA 1PHHA 4EQWA 1H6VA 3OC4A 2B7RA 2GV8A 1H7WA 4NWZA 1JRXA 3AXBA 1GREA 4BK1A 4Z2UA 2YQUA 1E1NA 1JOAA 3GRTA 3R9UA 2X8GA 4H2PA 1CBOA 4JDRA 1PXAA 2Q0KA 4G6HA 2C4CA 3IHMA 3DJEA 3H8LA 2TMDA 1KDGA 2EQ6A 4BK2A 2JB3A 2X50A 3KKJA 4C74A 3L8KA 4BV6A 2YLXA 3QJ4A 1E7PA 4YSYA 1FL2A 2WP5A 2NPXA 2VQ7A 3NK1X 4DSHA 4AOXA 4CRTA 4YSXA 2Q6UA 3C4NA 4H4PA 5KXJA 4H50A 2E4GA 4U8LA 3F8RA 1L9DA 2R4EA 2GR3A 1Y0PA 1HYUA 1V59A 1IUSA 1GESA 2GB0A 3GYXA 4U8KA 2YG3A 2PHHA 3NN6X 1K0IA 4AT0A 2YR5A 1BF3A 1E1MA 2APGA 2FJDA 2PYXA 1ZX9A 1RP0A 5M10A 3ISHA 1TYTA 3LADA 5HHFA 4CNJA 4C3XA 1QLBA 3LJPA 5BVAA 4JQ9A 2HQMA 4B63A 2CVJA 5HY5A 1L0VA 4BJZA 2OLNA 1VRQB 2R0GA 5U25A 2EQ7A 1Y56A 2OAMA 2X3NA 3AEEA 4DNAA 3UOVA 1EL5A 3G5RA 4OVIA 3NK2X 1RYIA 4Z44A 5KNLA 4B1BA 3ATQA 1KSSA 2VQBA 4XWRA 2A8XA 3G5QA 4K7ZA 1D4DA 2Y6QA 4NZHA 2X8CA 4U2SA 3F8DA 3EF6A 5ER0A 1NENA 1ZK7A 3AE6A 2WDVA 3UP4A 3CPHG 1ZMDA 4U2LA 1B8SA 2WDRA 2WPFA 1P2EA 1OJTA 1LVLA 1M64A 4K8DA 2Q7VA 1GRBA 3QVPA 4EQXA 1NHPA 3UP5A 1CJ4A 2XFOA 3HZLA 4FDCB 4DSGA 3DK4A 4EMJA 1OJ9A 3UKFA 3DMEA 3NN0X 3AYLA 1GRAA 3M12A 2VOUA 4GAVA 2C64A 3GSIA 1BGNA 3AYJA 3CNSA 4AP1A 4NTDA 3S5WA 3EAOA 3I3LA 3UKPA 3PVCA 3CN8A 4Y4MA 1Z6LA 2R9ZA 2WDQA 2WESA 1E39A 2B9XA 4TLXA 2F5ZA 3UOYA 4RSLA 1Q1RA 4H4WA 2XFUA 3IHGA 2IVEA 5C2TA 3F8PA 1K0LA 3GD3A 2ZBWA 1FEAA 1D4CA 4OPTA 4J31A 5U63A 1KFYA 2B9YA 3AWIA 5KOWA 2YLRA 2B9WA 3BHKA 1QJDA 1O94A 3QFAA 1GALA 1L9EA 4OPGA 3P1WA 2WOIA 1TDFA 1F8WA 2RGJA 1DOCA 4ICYA 3ALMA 3SXIA 3AD9B 4H4SA 4KX6A 3ALLA 2YR4A 3NKSA 5JCNA 3PS9A 3B3RA 3H8IA 1S2QA 3REDA 2OLOA 1EL9A 2C72A 4LIIA 2QA2A 4OPIA 4EM3A 5KOXA 4YXDA 3JSKA 1JNRA 3CPJG 1UKVG 2R45A 3M13A 1N1PA 1B37A 1YY5A 5BULA 4OPDA 2C3CA 1COYA 3AEDA 3LXDA 4YWOA 5CKUA 3B6DA 2WOWA 3RP8A 4CCQA 2WETA 1Q9IA 1VG9A 2XFPA 1XHCA 2C73A 2R0PA 3Q9TA 3KLJA 3CIRA 1GSNA 4J2WA 4ZCCA 3QVRA 4I58A 3KVEA 2JK6A 2NVKX 2GAHB 1DJNA 4EMIA 1YQZA 1N4WA 2WQYA 4GUVA 2GRTA 2JB2A 1YKJA 3D1CA 3V76A 3VRDB 4NEWA 2B76A 2BK4A 1CC2A 3GMCA 1PDHA 3CGEA 1NEKA 1K4QA 1JNZA 3ALJA 3FPZA 4LU6A 5M0ZA 3S61A 3DGZA 3VRBA 4NTEA 2ARDA 4B64A 2WOVA 1MOKA 3NH3X 3P4SA 5JCIA 4CBQA 3VRAA 3UTHA 3UCLA 3AECA 2V5ZA 2GH5A 4K5RA 4ADWA 2BRAA 2BYBA 2XVIA 2YG4A 3LZWA 2FJEA 3K7QX 2XVHA 4A79A 2BXRA 4B65A 1H82A 2C65A 4H2RA 1KF6A 2RGHA 1NAAA 2FBWA 1TDEA 2BCGG 4O5QA 4A6NB 4TLZA 1N4UA 5FMHA 2V3AA 2YLWA 2WU5A 5DBJA 4B66A 4KPRA 3GD4A 2YVFA 3V3NA 5GRTA 1EBDA 1LPFA 4X9NA 2E1MA 3P4QA 4G73A 5EBKA 4UDQA 3SQPA 1ZDLA 3LB8A 3FBSA 3GYIA 3K30A 1JU2A 4GDPA 4FX9A 1GPEA 3CGCA 1SEZA 3SZ0A 1S3BA 3GWDA 1TDNA 4NEVA 1ZY8A 3NT6A 2JBVA 4IVMB 3NRNA 4EIPA 5HYMA 2GQFA 3AD7B 3UTFA 2QAEA 1RSGA 1PBDA 2CULA 1BZLA 2GQWA 2BACA 4EM4A 3CGBA 3HYWA 4A99A 3AEFA 1E6EA 2QA1A 3DJGX 3C96A 1F8RA 5FS9A 4H2NA 2GMHA 1D7LA 3AE4A 2WBAA 4EMWA 3ADAB 2YVGA 2YG5A 3CNTA 4USRA 3DA1A 2XLUA 2XLTA 3SZWA 2EQ9A 2YWLA 1GT8A 2WHDA 4FK1C 4U8PA 4B68A 2WPEA 4K22A 1TYPA 2YM2A 3NYEA 2GF3A 2R46A 2BC1A 3NGCX 1AOGA 4EIQA 3IWAA 3D8XA 2YLSA 5BRTA 1FOHA 3G5SA 3GWFA 1O95A 2Z5XA 1LQTA 4G74A 2XVJA 5IPYA 2R4JA 2DKIA 1DOEA 5IQ1A 1CJCA 4YKGA 1TDKA 3CMMA 5L46A 4C5OA 1D5TA 3H4KA 4GF7A 4K2XA 5KVHA 3SZFA 1NHSA 2V61A 4OPLA 2ZZBA 4NTCA 2YLZA 3EANA 3NTAA 1PJ5A 2VRMA 4TM0A 1S3EA 2H89A 4JN9A 1KSUA 4EQSA 3AD8B 4YTNA 3BI4A 4HB9A 3T31A 4IA5A 2CFYA 4Z24A 2W0HA 1E1KA 1JEHA 2XLRA 3V3OA 4A65A 3SGLA 1Q1WA 1LJ1A 1KNRA 1YQ3A 3NTDA 1Y56B 4Z26A 3BNMA 1LTXR 4REKA 1GV4A 2RABA 4WX1A 4GAPA 4YKFA 4CY8A 2BA9A 2BS4A 3ICRA 2WPCA 3SZCA 3AEGA 2AQJA 4RG3A 5FS6A 4ECHA 1S2YA 5KMPA 5LV9A 3K7MX 2O9ZA 4IV9A 2C7GA 2B7SA 4G6GA 5C3JA 1NDAA 1IUWA 1REOA 2FJBA 5FS7A 4H4UA 2C75A 4XXGA 3UTGA 2WS3A 1IUUA 3DK9A 3ABVA 4II3A 3NG7X 2X99A 4CNKA 2J3NA 2VRLA 3UOXA 2GR0A 3ICSA 2BXSA 3AE5A 4I59A 5KMQA 2BC0A 4UDPA 3CNDA 3ATRA 4U8NA 1B5QA 4CCRA 2WP9A 4PABA 3WE0A 1MXTA 1VQWA 3KPKA 1IUXA 4AOSA 1D4EA 3NLCA 4D04A 3UKAA 2TPRA 1EL7A 1GTHA 1GRGA 1H86A 1P2HA 4PAAA 1M6IA 1DNCA 4USQA 2BS2A 1DODA 5U1OA 1CF3A 2Q0LA 4H4ZA 2Z5YA 4A5LA 3BI5A 4J57A 4LA1A 3AE9A 1PBFA 1H7XA 3AYIA 3IC9A 3AEBA 1GERA 2JKCA 4ZCDA 1B4VA 3O0HA 1F8SA 1JRZA 3QSMA 3IF9A 4BJYA 1XANA 2EQ8A 1FECA 3RP7A 2AAQA 1LV0A 2R0CA 2GAGB 1DXLA 3SFDA 1FEBA 2IIDA 1W4XA 4HA6A 5GSNA 5JCKA 3COXA 3L1RA 1XDIA 4C77A 4GRTA 4AP3A 4H4YA 4II2A 4U8JA 4N9XA 1PS9A 3E1TA 3K7TA 1NHRA 3C4AA 1KNPA 1N4VA 3UKHA 1FCDA 1PJ6A 2JB1A 3Q6JA 2ZZCA 2XVEA 4Z43A 2AR8A 4X4JA 2WU2A 1CJ3A 1PBEA 1CL0A 4XWZA 1BWCA 2QCUA 4IVOB 1H83A 3NK0X 2V3BA 4UP3A 3M0OA 4YTPA 4Y4NA 3NIXA 4K5SA 4U8MA 4J33A 2XLSA 3KA7A 3CGDA 2XCGA 5KMRA 5JCMA 5CQFA 5TR3A 1JRYA 3FG2P 3T0KA 3BI2A 1DOBA 3AE8A 3SYIA 5J60A 5EOWA 4BURA 3GDPA 4UDRA 2OALA 1NG4A 3SFEA 1CC4A 2XFQA 4JNQA 3DJJA 4OPCA 1D7YA 4U8OA 3RHAA 1NG3A 2YR6A 3DGHA 3ZYXA 1QO8A 4YTMA 3QFBA 2BCPA 2I0ZA 2OA1A 2E5VA 2WP6A 4MJWA 4FK1A 3UOZA 3EPTA 4Y4LA 4A9WA 2YAUA 3KD9A 1NHQA 1ZOYA 2GR2A 2VVLG 3T2ZA 4CY6A 4APNA 1GEUA 1TRBA 4A7AA 1TDOA 3P4RA 4H4TA 3SM8A 3DJDA 1CHUA 5HXIA 3I6DA 5KRQA 4GDEA 2YM1A 3VR9A 1PJ7A 1OJCA 1IUTA 3GYJA 2IVDA 2YLTA 4C3YA 3RP6A 2C76A 4J56A 4JY2A 1CJ2A 3BNUA 5IQ4A 1K0JA 1NPXA 2XFNA 1DJQA 3FMWA 3UKKA 1VG0A 3DH9A 3ITJA 1IJHA 3QSSA 4B69A 4Z2RA 3GRSA 1IUVA 1X31B 2JAEA 3CTYA 3QSEA 3KU9A 3UKQA 3BHFA 5KWFA 4U8IA 1F3PA 1H81A 1PXCA 4J34A 4P9SA 3UKLA 2ZZ0A 2BRYA 1GTEA 4TM3A 1PN0A 2ACZA 3NNEA 1GETA 4X9MA 3SX6A 2A87A 3T2YA 3ZDNA 1E1LA 2V60A 4GR1A 3AE7A 4DGKA 5J7XA 2GMJA 3VR8A 3PO7A 2XYOA 1MO9A 5KMSA 2DKHA 5FS8A 4NNJA 1F6MA 4AT2A 1YQ4A 1H84A 3URHA 4D03A 2A89A 3AE1A 3SY4A 1ZKQA 3AB1A 3P4PA 2C67A 2UZZA 1BGJA 1GRFA 2C70A 2VVMA 3FIMB 4H4QA 1ONFA 4U2TA 1PBBA 5EB4A 1OJAA 3VQRA 3RNMA 2XLPA 4WCTA 4J36A 1O5WA 2WEUA 3CPIG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9K A;  3HYX A;  3HYV A;  4G74 A;  3T2Z A;  5KMR A;  5KMQ A;  3SXI A;  4GAV A;  3KPK A;  3SX6 A;  3T2Y A;  3T0K A;  3HYW A;  4GAP A;  3T2K A;  3SYI A;  3SZF A;  3SZC A;  3T14 A;  5KMP A;  5KMS A;  4G6G A;  4G73 A;  3SZW A;  3SY4 A;  4NWZ A;  3SZ0 A;  3T31 A;  4G6H A; 
#chains in the Genus database with same CATH topology
 1XPQ A;  3HYX A;  3HYV A;  3AEA A;  2YVJ A;  3NYC A;  4G9K A;  3T37 A;  1CC6 A;  2V6O A;  3LZX A;  4M52 A;  4YT0 A;  4Z25 A;  4ZN0 A;  4O5U A;  3LOV A;  2VZ2 A;  4H4V A;  1GOS A;  5BUK A;  4OPU A;  1PXB A;  2FJA A;  3AE2 A;  4JNA A;  4JY3 A;  1L9C A;  4IA6 A;  5EB5 A;  1ZMC A;  3II4 A;  2H88 A;  2GEW A;  2RGO A;  1ELI A;  3CNJ A;  3CNP A;  2BK5 A;  4H7U A;  3T14 A;  4A6N A;  3OZ2 A;  2C3D A;  5KVI A;  3GDN A;  2XVF A;  4YSH A;  2VVL A;  2X8H A;  1BKW A;  1GRT A;  3DK8 A;  3NHO X;  2BAB A;  4TM4 A;  4BK3 A;  3UTE A;  4TM1 A;  2BK3 A;  3NYF A;  1ZOV A;  4OCG A;  4GCM A;  1EL8 A;  3GMB A;  4E0V A;  4H4R A;  1LQU A;  2CDU A;  3KPF A;  4Z2T A;  1GRH A;  1PBC A;  4RG4 A;  2Y6R A;  2YG6 A;  1VDC A;  4EQR A;  4YSZ A;  3T2K A;  2GR1 A;  2C66 A;  3P9U A;  1GXF A;  1OJD A;  1ZP0 A;  2BS3 A;  1GND A;  2GVC A;  2YG7 A;  5JCL A;  4H2Q A;  2XDO A;  3AE3 A;  4B67 A;  4H4X A;  3ICT A;  1PHH A;  4EQW A;  1H6V A;  3OC4 A;  2B7R A;  2GV8 A;  1H7W A;  4NWZ A;  1JRX A;  3AXB A;  1GRE A;  4BK1 A;  4Z2U A;  2YQU A;  1E1N A;  1JOA A;  3GRT A;  3R9U A;  2X8G A;  4H2P A;  1CBO A;  4JDR A;  1PXA A;  2Q0K A;  4G6H A;  2C4C A;  3IHM A;  3DJE A;  3H8L A;  2TMD A;  1KDG A;  2EQ6 A;  4BK2 A;  2JB3 A;  2X50 A;  3KKJ A;  4C74 A;  3L8K A;  4BV6 A;  2YLX A;  3QJ4 A;  1E7P A;  4YSY A;  1FL2 A;  2WP5 A;  2NPX A;  2VQ7 A;  3NK1 X;  4DSH A;  4AOX A;  4CRT A;  4YSX A;  2Q6U A;  3C4N A;  4H4P A;  5KXJ A;  4H50 A;  2E4G A;  4U8L A;  3F8R A;  1L9D A;  2R4E A;  2GR3 A;  1Y0P A;  1HYU A;  1V59 A;  1IUS A;  1GES A;  2GB0 A;  3GYX A;  4U8K A;  2YG3 A;  2PHH A;  3NN6 X;  1K0I A;  4AT0 A;  2YR5 A;  1BF3 A;  1E1M A;  2APG A;  2FJD A;  2PYX A;  1ZX9 A;  1RP0 A;  5M10 A;  3ISH A;  1TYT A;  3LAD A;  5HHF A;  4CNJ A;  4C3X A;  1QLB A;  3LJP A;  5BVA A;  4JQ9 A;  2HQM A;  4B63 A;  2CVJ A;  5HY5 A;  1L0V A;  4BJZ A;  2OLN A;  1VRQ B;  2R0G A;  5U25 A;  2EQ7 A;  1Y56 A;  2OAM A;  2X3N A;  3AEE A;  4DNA A;  3UOV A;  1EL5 A;  3G5R A;  4OVI A;  3NK2 X;  1RYI A;  4Z44 A;  5KNL A;  4B1B A;  3ATQ A;  1KSS A;  2VQB A;  4XWR A;  2A8X A;  3G5Q A;  4K7Z A;  1D4D A;  2Y6Q A;  4NZH A;  2X8C A;  4U2S A;  3F8D A;  3EF6 A;  5ER0 A;  1NEN A;  1ZK7 A;  3AE6 A;  2WDV A;  3UP4 A;  3CPH G;  1ZMD A;  4U2L A;  1B8S A;  2WDR A;  2WPF A;  1P2E A;  1OJT A;  1LVL A;  1M64 A;  4K8D A;  2Q7V A;  1GRB A;  3QVP A;  4EQX A;  1NHP A;  3UP5 A;  1CJ4 A;  2XFO A;  3HZL A;  4FDC B;  4DSG A;  3DK4 A;  4EMJ A;  1OJ9 A;  3UKF A;  3DME A;  3NN0 X;  3AYL A;  1GRA A;  3M12 A;  2VOU A;  4GAV A;  2C64 A;  3GSI A;  1BGN A;  3AYJ A;  3CNS A;  4AP1 A;  4NTD A;  3S5W A;  3EAO A;  3I3L A;  3UKP A;  3PVC A;  3CN8 A;  4Y4M A;  1Z6L A;  2R9Z A;  2WDQ A;  2WES A;  1E39 A;  2B9X A;  4TLX A;  2F5Z A;  3UOY A;  4RSL A;  1Q1R A;  4H4W A;  2XFU A;  3IHG A;  2IVE A;  5C2T A;  3F8P A;  1K0L A;  3GD3 A;  2ZBW A;  1FEA A;  1D4C A;  4OPT A;  4J31 A;  5U63 A;  1KFY A;  2B9Y A;  3AWI A;  5KOW A;  2YLR A;  2B9W A;  3BHK A;  1QJD A;  1O94 A;  3QFA A;  1GAL A;  1L9E A;  4OPG A;  3P1W A;  2WOI A;  1TDF A;  1F8W A;  2RGJ A;  1DOC A;  4ICY A;  3ALM A;  3SXI A;  3AD9 B;  4H4S A;  4KX6 A;  3ALL A;  2YR4 A;  3NKS A;  5JCN A;  3PS9 A;  3B3R A;  3H8I A;  1S2Q A;  3RED A;  2OLO A;  1EL9 A;  2C72 A;  4LII A;  2QA2 A;  4OPI A;  4EM3 A;  5KOX A;  4YXD A;  3JSK A;  1JNR A;  3CPJ G;  1UKV G;  2R45 A;  3M13 A;  1N1P A;  1B37 A;  1YY5 A;  5BUL A;  4OPD A;  2C3C A;  1COY A;  3AED A;  3LXD A;  4YWO A;  5CKU A;  3B6D A;  2WOW A;  3RP8 A;  4CCQ A;  2WET A;  1Q9I A;  1VG9 A;  2XFP A;  1XHC A;  2C73 A;  2R0P A;  3Q9T A;  3KLJ A;  3CIR A;  1GSN A;  4J2W A;  4ZCC A;  3QVR A;  4I58 A;  3KVE A;  2JK6 A;  2NVK X;  2GAH B;  1DJN A;  4EMI A;  1YQZ A;  1N4W A;  2WQY A;  4GUV A;  2GRT A;  2JB2 A;  1YKJ A;  3D1C A;  3V76 A;  3VRD B;  4NEW A;  2B76 A;  2BK4 A;  1CC2 A;  3GMC A;  1PDH A;  3CGE A;  1NEK A;  1K4Q A;  1JNZ A;  3ALJ A;  3FPZ A;  4LU6 A;  5M0Z A;  3S61 A;  3DGZ A;  3VRB A;  4NTE A;  2ARD A;  4B64 A;  2WOV A;  1MOK A;  3NH3 X;  3P4S A;  5JCI A;  4CBQ A;  3VRA A;  3UTH A;  3UCL A;  3AEC A;  2V5Z A;  2GH5 A;  4K5R A;  4ADW A;  2BRA A;  2BYB A;  2XVI A;  2YG4 A;  3LZW A;  2FJE A;  3K7Q X;  2XVH A;  4A79 A;  2BXR A;  4B65 A;  1H82 A;  2C65 A;  4H2R A;  1KF6 A;  2RGH A;  1NAA A;  2FBW A;  1TDE A;  2BCG G;  4O5Q A;  4A6N B;  4TLZ A;  1N4U A;  5FMH A;  2V3A A;  2YLW A;  2WU5 A;  5DBJ A;  4B66 A;  4KPR A;  3GD4 A;  2YVF A;  3V3N A;  5GRT A;  1EBD A;  1LPF A;  4X9N A;  2E1M A;  3P4Q A;  4G73 A;  5EBK A;  4UDQ A;  3SQP A;  1ZDL A;  3LB8 A;  3FBS A;  3GYI A;  3K30 A;  1JU2 A;  4GDP A;  4FX9 A;  1GPE A;  3CGC A;  1SEZ A;  3SZ0 A;  1S3B A;  3GWD A;  1TDN A;  4NEV A;  1ZY8 A;  3NT6 A;  2JBV A;  4IVM B;  3NRN A;  4EIP A;  5HYM A;  2GQF A;  3AD7 B;  3UTF A;  2QAE A;  1RSG A;  1PBD A;  2CUL A;  1BZL A;  2GQW A;  2BAC A;  4EM4 A;  3CGB A;  3HYW A;  4A99 A;  3AEF A;  1E6E A;  2QA1 A;  3DJG X;  3C96 A;  1F8R A;  5FS9 A;  4H2N A;  2GMH A;  1D7L A;  3AE4 A;  2WBA A;  4EMW A;  3ADA B;  2YVG A;  2YG5 A;  3CNT A;  4USR A;  3DA1 A;  2XLU A;  2XLT A;  3SZW A;  2EQ9 A;  2YWL A;  1GT8 A;  2WHD A;  4FK1 C;  4U8P A;  4B68 A;  2WPE A;  4K22 A;  1TYP A;  2YM2 A;  3NYE A;  2GF3 A;  2R46 A;  2BC1 A;  3NGC X;  1AOG A;  4EIQ A;  3IWA A;  3D8X A;  2YLS A;  5BRT A;  1FOH A;  3G5S A;  3GWF A;  1O95 A;  2Z5X A;  1LQT A;  4G74 A;  2XVJ A;  5IPY A;  2R4J A;  2DKI A;  1DOE A;  5IQ1 A;  1CJC A;  4YKG A;  1TDK A;  3CMM A;  5L46 A;  4C5O A;  1D5T A;  3H4K A;  4GF7 A;  4K2X A;  5KVH A;  3SZF A;  1NHS A;  2V61 A;  4OPL A;  2ZZB A;  4NTC A;  2YLZ A;  3EAN A;  3NTA A;  1PJ5 A;  2VRM A;  4TM0 A;  1S3E A;  2H89 A;  4JN9 A;  1KSU A;  4EQS A;  3AD8 B;  4YTN A;  3BI4 A;  4HB9 A;  3T31 A;  4IA5 A;  2CFY A;  4Z24 A;  2W0H A;  1E1K A;  1JEH A;  2XLR A;  3V3O A;  4A65 A;  3SGL A;  1Q1W A;  1LJ1 A;  1KNR A;  1YQ3 A;  3NTD A;  1Y56 B;  4Z26 A;  3BNM A;  1LTX R;  4REK A;  1GV4 A;  2RAB A;  4WX1 A;  4GAP A;  4YKF A;  4CY8 A;  2BA9 A;  2BS4 A;  3ICR A;  2WPC A;  3SZC A;  3AEG A;  2AQJ A;  4RG3 A;  5FS6 A;  4ECH A;  1S2Y A;  5KMP A;  5LV9 A;  3K7M X;  2O9Z A;  4IV9 A;  2C7G A;  2B7S A;  4G6G A;  5C3J A;  1NDA A;  1IUW A;  1REO A;  2FJB A;  5FS7 A;  4H4U A;  2C75 A;  4XXG A;  3UTG A;  2WS3 A;  1IUU A;  3DK9 A;  3ABV A;  4II3 A;  3NG7 X;  2X99 A;  4CNK A;  2J3N A;  2VRL A;  3UOX A;  2GR0 A;  3ICS A;  2BXS A;  3AE5 A;  4I59 A;  5KMQ A;  2BC0 A;  4UDP A;  3CND A;  3ATR A;  4U8N A;  1B5Q A;  4CCR A;  2WP9 A;  4PAB A;  3WE0 A;  1MXT A;  1VQW A;  3KPK A;  1IUX A;  4AOS A;  1D4E A;  3NLC A;  4D04 A;  3UKA A;  2TPR A;  1EL7 A;  1GTH A;  1GRG A;  1H86 A;  1P2H A;  4PAA A;  1M6I A;  1DNC A;  4USQ A;  2BS2 A;  1DOD A;  5U1O A;  1CF3 A;  2Q0L A;  4H4Z A;  2Z5Y A;  4A5L A;  3BI5 A;  4J57 A;  4LA1 A;  3AE9 A;  1PBF A;  1H7X A;  3AYI A;  3IC9 A;  3AEB A;  1GER A;  2JKC A;  4ZCD A;  1B4V A;  3O0H A;  1F8S A;  1JRZ A;  3QSM A;  3IF9 A;  4BJY A;  1XAN A;  2EQ8 A;  1FEC A;  3RP7 A;  2AAQ A;  1LV0 A;  2R0C A;  2GAG B;  1DXL A;  3SFD A;  1FEB A;  2IID A;  1W4X A;  4HA6 A;  5GSN A;  5JCK A;  3COX A;  3L1R A;  1XDI A;  4C77 A;  4GRT A;  4AP3 A;  4H4Y A;  4II2 A;  4U8J A;  4N9X A;  1PS9 A;  3E1T A;  3K7T A;  1NHR A;  3C4A A;  1KNP A;  1N4V A;  3UKH A;  1FCD A;  1PJ6 A;  2JB1 A;  3Q6J A;  2ZZC A;  2XVE A;  4Z43 A;  2AR8 A;  4X4J A;  2WU2 A;  1CJ3 A;  1PBE A;  1CL0 A;  4XWZ A;  1BWC A;  2QCU A;  4IVO B;  1H83 A;  3NK0 X;  2V3B A;  4UP3 A;  3M0O A;  4YTP A;  4Y4N A;  3NIX A;  4K5S A;  4U8M A;  4J33 A;  2XLS A;  3KA7 A;  3CGD A;  2XCG A;  5KMR A;  5JCM A;  5CQF A;  5TR3 A;  1JRY A;  3FG2 P;  3T0K A;  3BI2 A;  1DOB A;  3AE8 A;  3SYI A;  5J60 A;  5EOW A;  4BUR A;  3GDP A;  4UDR A;  2OAL A;  1NG4 A;  3SFE A;  1CC4 A;  2XFQ A;  4JNQ A;  3DJJ A;  4OPC A;  1D7Y A;  4U8O A;  3RHA A;  1NG3 A;  2YR6 A;  3DGH A;  3ZYX A;  1QO8 A;  4YTM A;  3QFB A;  2BCP A;  2I0Z A;  2OA1 A;  2E5V A;  2WP6 A;  4MJW A;  4FK1 A;  3UOZ A;  3EPT A;  4Y4L A;  4A9W A;  2YAU A;  3KD9 A;  1NHQ A;  1ZOY A;  2GR2 A;  2VVL G;  3T2Z A;  4CY6 A;  4APN A;  1GEU A;  1TRB A;  4A7A A;  1TDO A;  3P4R A;  4H4T A;  3SM8 A;  3DJD A;  1CHU A;  5HXI A;  3I6D A;  5KRQ A;  4GDE A;  2YM1 A;  3VR9 A;  1PJ7 A;  1OJC A;  1IUT A;  3GYJ A;  2IVD A;  2YLT A;  4C3Y A;  3RP6 A;  2C76 A;  4J56 A;  4JY2 A;  1CJ2 A;  3BNU A;  5IQ4 A;  1K0J A;  1NPX A;  2XFN A;  1DJQ A;  3FMW A;  3UKK A;  1VG0 A;  3DH9 A;  3ITJ A;  1IJH A;  3QSS A;  4B69 A;  4Z2R A;  3GRS A;  1IUV A;  1X31 B;  2JAE A;  3CTY A;  3QSE A;  3KU9 A;  3UKQ A;  3BHF A;  5KWF A;  4U8I A;  1F3P A;  1H81 A;  1PXC A;  4J34 A;  4P9S A;  3UKL A;  2ZZ0 A;  2BRY A;  1GTE A;  4TM3 A;  1PN0 A;  2ACZ A;  3NNE A;  1GET A;  4X9M A;  3SX6 A;  2A87 A;  3T2Y A;  3ZDN A;  1E1L A;  2V60 A;  4GR1 A;  3AE7 A;  4DGK A;  5J7X A;  2GMJ A;  3VR8 A;  3PO7 A;  2XYO A;  1MO9 A;  5KMS A;  2DKH A;  5FS8 A;  4NNJ A;  1F6M A;  4AT2 A;  1YQ4 A;  1H84 A;  3URH A;  4D03 A;  2A89 A;  3AE1 A;  3SY4 A;  1ZKQ A;  3AB1 A;  3P4P A;  2C67 A;  2UZZ A;  1BGJ A;  1GRF A;  2C70 A;  2VVM A;  3FIM B;  4H4Q A;  1ONF A;  4U2T A;  1PBB A;  5EB4 A;  1OJA A;  3VQR A;  3RNM A;  2XLP A;  4WCT A;  4J36 A;  1O5W A;  2WEU A;  3CPI G; 
#chains in the Genus database with same CATH homology
 1XPQ A;  3HYX A;  3HYV A;  3AEA A;  2YVJ A;  3NYC A;  4G9K A;  3T37 A;  1CC6 A;  2V6O A;  3LZX A;  4M52 A;  4YT0 A;  4Z25 A;  4ZN0 A;  4O5U A;  3LOV A;  2VZ2 A;  4H4V A;  1GOS A;  5BUK A;  4OPU A;  1PXB A;  2FJA A;  3AE2 A;  4JNA A;  4JY3 A;  1L9C A;  4IA6 A;  5EB5 A;  1ZMC A;  3II4 A;  2H88 A;  2GEW A;  2RGO A;  1ELI A;  3CNJ A;  3CNP A;  2BK5 A;  4H7U A;  3T14 A;  4A6N A;  3OZ2 A;  2C3D A;  5KVI A;  3GDN A;  2XVF A;  4YSH A;  2VVL A;  2X8H A;  1BKW A;  1GRT A;  3DK8 A;  3NHO X;  2BAB A;  4TM4 A;  4BK3 A;  3UTE A;  4TM1 A;  2BK3 A;  3NYF A;  1ZOV A;  4OCG A;  4GCM A;  1EL8 A;  3GMB A;  4E0V A;  4H4R A;  1LQU A;  2CDU A;  3KPF A;  4Z2T A;  1GRH A;  1PBC A;  4RG4 A;  2Y6R A;  2YG6 A;  1VDC A;  4EQR A;  4YSZ A;  3T2K A;  2GR1 A;  2C66 A;  3P9U A;  1GXF A;  1OJD A;  1ZP0 A;  2BS3 A;  1GND A;  2GVC A;  2YG7 A;  5JCL A;  4H2Q A;  2XDO A;  3AE3 A;  4B67 A;  4H4X A;  3ICT A;  1PHH A;  4EQW A;  1H6V A;  3OC4 A;  2B7R A;  2GV8 A;  1H7W A;  4NWZ A;  1JRX A;  3AXB A;  1GRE A;  4BK1 A;  4Z2U A;  2YQU A;  1E1N A;  1JOA A;  3GRT A;  3R9U A;  2X8G A;  4H2P A;  1CBO A;  4JDR A;  1PXA A;  2Q0K A;  4G6H A;  2C4C A;  3IHM A;  3DJE A;  3H8L A;  2TMD A;  1KDG A;  2EQ6 A;  4BK2 A;  2JB3 A;  2X50 A;  3KKJ A;  4C74 A;  3L8K A;  4BV6 A;  2YLX A;  3QJ4 A;  1E7P A;  4YSY A;  1FL2 A;  2WP5 A;  2NPX A;  2VQ7 A;  3NK1 X;  4DSH A;  4AOX A;  4CRT A;  4YSX A;  2Q6U A;  3C4N A;  4H4P A;  5KXJ A;  4H50 A;  2E4G A;  4U8L A;  3F8R A;  1L9D A;  2R4E A;  2GR3 A;  1Y0P A;  1HYU A;  1V59 A;  1IUS A;  1GES A;  2GB0 A;  3GYX A;  4U8K A;  2YG3 A;  2PHH A;  3NN6 X;  1K0I A;  4AT0 A;  2YR5 A;  1BF3 A;  1E1M A;  2APG A;  2FJD A;  2PYX A;  1ZX9 A;  1RP0 A;  5M10 A;  3ISH A;  1TYT A;  3LAD A;  5HHF A;  4CNJ A;  4C3X A;  1QLB A;  3LJP A;  5BVA A;  4JQ9 A;  2HQM A;  4B63 A;  2CVJ A;  5HY5 A;  1L0V A;  4BJZ A;  2OLN A;  1VRQ B;  2R0G A;  5U25 A;  2EQ7 A;  1Y56 A;  2OAM A;  2X3N A;  3AEE A;  4DNA A;  3UOV A;  1EL5 A;  3G5R A;  4OVI A;  3NK2 X;  1RYI A;  4Z44 A;  5KNL A;  4B1B A;  3ATQ A;  1KSS A;  2VQB A;  4XWR A;  2A8X A;  3G5Q A;  4K7Z A;  1D4D A;  2Y6Q A;  4NZH A;  2X8C A;  4U2S A;  3F8D A;  3EF6 A;  5ER0 A;  1NEN A;  1ZK7 A;  3AE6 A;  2WDV A;  3UP4 A;  3CPH G;  1ZMD A;  4U2L A;  1B8S A;  2WDR A;  2WPF A;  1P2E A;  1OJT A;  1LVL A;  1M64 A;  4K8D A;  2Q7V A;  1GRB A;  3QVP A;  4EQX A;  1NHP A;  3UP5 A;  1CJ4 A;  2XFO A;  3HZL A;  4FDC B;  4DSG A;  3DK4 A;  4EMJ A;  1OJ9 A;  3UKF A;  3DME A;  3NN0 X;  3AYL A;  1GRA A;  3M12 A;  2VOU A;  4GAV A;  2C64 A;  3GSI A;  1BGN A;  3AYJ A;  3CNS A;  4AP1 A;  4NTD A;  3S5W A;  3EAO A;  3I3L A;  3UKP A;  3PVC A;  3CN8 A;  4Y4M A;  1Z6L A;  2R9Z A;  2WDQ A;  2WES A;  1E39 A;  2B9X A;  4TLX A;  2F5Z A;  3UOY A;  4RSL A;  1Q1R A;  4H4W A;  2XFU A;  3IHG A;  2IVE A;  5C2T A;  3F8P A;  1K0L A;  3GD3 A;  2ZBW A;  1FEA A;  1D4C A;  4OPT A;  4J31 A;  5U63 A;  1KFY A;  2B9Y A;  3AWI A;  5KOW A;  2YLR A;  2B9W A;  3BHK A;  1QJD A;  1O94 A;  3QFA A;  1GAL A;  1L9E A;  4OPG A;  3P1W A;  2WOI A;  1TDF A;  1F8W A;  2RGJ A;  1DOC A;  4ICY A;  3ALM A;  3SXI A;  3AD9 B;  4H4S A;  4KX6 A;  3ALL A;  2YR4 A;  3NKS A;  5JCN A;  3PS9 A;  3B3R A;  3H8I A;  1S2Q A;  3RED A;  2OLO A;  1EL9 A;  2C72 A;  4LII A;  2QA2 A;  4OPI A;  4EM3 A;  5KOX A;  4YXD A;  3JSK A;  1JNR A;  3CPJ G;  1UKV G;  2R45 A;  3M13 A;  1N1P A;  1B37 A;  1YY5 A;  5BUL A;  4OPD A;  2C3C A;  1COY A;  3AED A;  3LXD A;  4YWO A;  5CKU A;  3B6D A;  2WOW A;  3RP8 A;  4CCQ A;  2WET A;  1Q9I A;  1VG9 A;  2XFP A;  1XHC A;  2C73 A;  2R0P A;  3Q9T A;  3KLJ A;  3CIR A;  1GSN A;  4J2W A;  4ZCC A;  3QVR A;  4I58 A;  3KVE A;  2JK6 A;  2NVK X;  2GAH B;  1DJN A;  4EMI A;  1YQZ A;  1N4W A;  2WQY A;  4GUV A;  2GRT A;  2JB2 A;  1YKJ A;  3D1C A;  3V76 A;  3VRD B;  4NEW A;  2B76 A;  2BK4 A;  1CC2 A;  3GMC A;  1PDH A;  3CGE A;  1NEK A;  1K4Q A;  1JNZ A;  3ALJ A;  3FPZ A;  4LU6 A;  5M0Z A;  3S61 A;  3DGZ A;  3VRB A;  4NTE A;  2ARD A;  4B64 A;  2WOV A;  1MOK A;  3NH3 X;  3P4S A;  5JCI A;  4CBQ A;  3VRA A;  3UTH A;  3UCL A;  3AEC A;  2V5Z A;  2GH5 A;  4K5R A;  4ADW A;  2BRA A;  2BYB A;  2XVI A;  2YG4 A;  3LZW A;  2FJE A;  3K7Q X;  2XVH A;  4A79 A;  2BXR A;  4B65 A;  1H82 A;  2C65 A;  4H2R A;  1KF6 A;  2RGH A;  1NAA A;  2FBW A;  1TDE A;  2BCG G;  4O5Q A;  4A6N B;  4TLZ A;  1N4U A;  5FMH A;  2V3A A;  2YLW A;  2WU5 A;  5DBJ A;  4B66 A;  4KPR A;  3GD4 A;  2YVF A;  3V3N A;  5GRT A;  1EBD A;  1LPF A;  4X9N A;  2E1M A;  3P4Q A;  4G73 A;  5EBK A;  4UDQ A;  3SQP A;  1ZDL A;  3LB8 A;  3FBS A;  3GYI A;  3K30 A;  1JU2 A;  4GDP A;  4FX9 A;  1GPE A;  3CGC A;  1SEZ A;  3SZ0 A;  1S3B A;  3GWD A;  1TDN A;  4NEV A;  1ZY8 A;  3NT6 A;  2JBV A;  4IVM B;  3NRN A;  4EIP A;  5HYM A;  2GQF A;  3AD7 B;  3UTF A;  2QAE A;  1RSG A;  1PBD A;  2CUL A;  1BZL A;  2GQW A;  2BAC A;  4EM4 A;  3CGB A;  3HYW A;  4A99 A;  3AEF A;  1E6E A;  2QA1 A;  3DJG X;  3C96 A;  1F8R A;  5FS9 A;  4H2N A;  2GMH A;  1D7L A;  3AE4 A;  2WBA A;  4EMW A;  3ADA B;  2YVG A;  2YG5 A;  3CNT A;  4USR A;  3DA1 A;  2XLU A;  2XLT A;  3SZW A;  2EQ9 A;  2YWL A;  1GT8 A;  2WHD A;  4FK1 C;  4U8P A;  4B68 A;  2WPE A;  4K22 A;  1TYP A;  2YM2 A;  3NYE A;  2GF3 A;  2R46 A;  2BC1 A;  3NGC X;  1AOG A;  4EIQ A;  3IWA A;  3D8X A;  2YLS A;  5BRT A;  1FOH A;  3G5S A;  3GWF A;  1O95 A;  2Z5X A;  1LQT A;  4G74 A;  2XVJ A;  5IPY A;  2R4J A;  2DKI A;  1DOE A;  5IQ1 A;  1CJC A;  4YKG A;  1TDK A;  3CMM A;  5L46 A;  4C5O A;  1D5T A;  3H4K A;  4GF7 A;  4K2X A;  5KVH A;  3SZF A;  1NHS A;  2V61 A;  4OPL A;  2ZZB A;  4NTC A;  2YLZ A;  3EAN A;  3NTA A;  1PJ5 A;  2VRM A;  4TM0 A;  1S3E A;  2H89 A;  4JN9 A;  1KSU A;  4EQS A;  3AD8 B;  4YTN A;  3BI4 A;  4HB9 A;  3T31 A;  4IA5 A;  2CFY A;  4Z24 A;  2W0H A;  1E1K A;  1JEH A;  2XLR A;  3V3O A;  4A65 A;  3SGL A;  1Q1W A;  1LJ1 A;  1KNR A;  1YQ3 A;  3NTD A;  1Y56 B;  4Z26 A;  3BNM A;  1LTX R;  4REK A;  1GV4 A;  2RAB A;  4WX1 A;  4GAP A;  4YKF A;  4CY8 A;  2BA9 A;  2BS4 A;  3ICR A;  2WPC A;  3SZC A;  3AEG A;  2AQJ A;  4RG3 A;  5FS6 A;  4ECH A;  1S2Y A;  5KMP A;  5LV9 A;  3K7M X;  2O9Z A;  4IV9 A;  2C7G A;  2B7S A;  4G6G A;  5C3J A;  1NDA A;  1IUW A;  1REO A;  2FJB A;  5FS7 A;  4H4U A;  2C75 A;  4XXG A;  3UTG A;  2WS3 A;  1IUU A;  3DK9 A;  3ABV A;  4II3 A;  3NG7 X;  2X99 A;  4CNK A;  2J3N A;  2VRL A;  3UOX A;  2GR0 A;  3ICS A;  2BXS A;  3AE5 A;  4I59 A;  5KMQ A;  2BC0 A;  4UDP A;  3CND A;  3ATR A;  4U8N A;  1B5Q A;  4CCR A;  2WP9 A;  4PAB A;  3WE0 A;  1MXT A;  1VQW A;  3KPK A;  1IUX A;  4AOS A;  1D4E A;  3NLC A;  4D04 A;  3UKA A;  2TPR A;  1EL7 A;  1GTH A;  1GRG A;  1H86 A;  1P2H A;  4PAA A;  1M6I A;  1DNC A;  4USQ A;  2BS2 A;  1DOD A;  5U1O A;  1CF3 A;  2Q0L A;  4H4Z A;  2Z5Y A;  4A5L A;  3BI5 A;  4J57 A;  4LA1 A;  3AE9 A;  1PBF A;  1H7X A;  3AYI A;  3IC9 A;  3AEB A;  1GER A;  2JKC A;  4ZCD A;  1B4V A;  3O0H A;  1F8S A;  1JRZ A;  3QSM A;  3IF9 A;  4BJY A;  1XAN A;  2EQ8 A;  1FEC A;  3RP7 A;  2AAQ A;  1LV0 A;  2R0C A;  2GAG B;  1DXL A;  3SFD A;  1FEB A;  2IID A;  1W4X A;  4HA6 A;  5GSN A;  5JCK A;  3COX A;  3L1R A;  1XDI A;  4C77 A;  4GRT A;  4AP3 A;  4H4Y A;  4II2 A;  4U8J A;  4N9X A;  1PS9 A;  3E1T A;  3K7T A;  1NHR A;  3C4A A;  1KNP A;  1N4V A;  3UKH A;  1FCD A;  1PJ6 A;  2JB1 A;  3Q6J A;  2ZZC A;  2XVE A;  4Z43 A;  2AR8 A;  4X4J A;  2WU2 A;  1CJ3 A;  1PBE A;  1CL0 A;  4XWZ A;  1BWC A;  2QCU A;  4IVO B;  1H83 A;  3NK0 X;  2V3B A;  4UP3 A;  3M0O A;  4YTP A;  4Y4N A;  3NIX A;  4K5S A;  4U8M A;  4J33 A;  2XLS A;  3KA7 A;  3CGD A;  2XCG A;  5KMR A;  5JCM A;  5CQF A;  5TR3 A;  1JRY A;  3FG2 P;  3T0K A;  3BI2 A;  1DOB A;  3AE8 A;  3SYI A;  5J60 A;  5EOW A;  4BUR A;  3GDP A;  4UDR A;  2OAL A;  1NG4 A;  3SFE A;  1CC4 A;  2XFQ A;  4JNQ A;  3DJJ A;  4OPC A;  1D7Y A;  4U8O A;  3RHA A;  1NG3 A;  2YR6 A;  3DGH A;  3ZYX A;  1QO8 A;  4YTM A;  3QFB A;  2BCP A;  2I0Z A;  2OA1 A;  2E5V A;  2WP6 A;  4MJW A;  4FK1 A;  3UOZ A;  3EPT A;  4Y4L A;  4A9W A;  2YAU A;  3KD9 A;  1NHQ A;  1ZOY A;  2GR2 A;  2VVL G;  3T2Z A;  4CY6 A;  4APN A;  1GEU A;  1TRB A;  4A7A A;  1TDO A;  3P4R A;  4H4T A;  3SM8 A;  3DJD A;  1CHU A;  5HXI A;  3I6D A;  5KRQ A;  4GDE A;  2YM1 A;  3VR9 A;  1PJ7 A;  1OJC A;  1IUT A;  3GYJ A;  2IVD A;  2YLT A;  4C3Y A;  3RP6 A;  2C76 A;  4J56 A;  4JY2 A;  1CJ2 A;  3BNU A;  5IQ4 A;  1K0J A;  1NPX A;  2XFN A;  1DJQ A;  3FMW A;  3UKK A;  1VG0 A;  3DH9 A;  3ITJ A;  1IJH A;  3QSS A;  4B69 A;  4Z2R A;  3GRS A;  1IUV A;  1X31 B;  2JAE A;  3CTY A;  3QSE A;  3KU9 A;  3UKQ A;  3BHF A;  5KWF A;  4U8I A;  1F3P A;  1H81 A;  1PXC A;  4J34 A;  4P9S A;  3UKL A;  2ZZ0 A;  2BRY A;  1GTE A;  4TM3 A;  1PN0 A;  2ACZ A;  3NNE A;  1GET A;  4X9M A;  3SX6 A;  2A87 A;  3T2Y A;  3ZDN A;  1E1L A;  2V60 A;  4GR1 A;  3AE7 A;  4DGK A;  5J7X A;  2GMJ A;  3VR8 A;  3PO7 A;  2XYO A;  1MO9 A;  5KMS A;  2DKH A;  5FS8 A;  4NNJ A;  1F6M A;  4AT2 A;  1YQ4 A;  1H84 A;  3URH A;  4D03 A;  2A89 A;  3AE1 A;  3SY4 A;  1ZKQ A;  3AB1 A;  3P4P A;  2C67 A;  2UZZ A;  1BGJ A;  1GRF A;  2C70 A;  2VVM A;  3FIM B;  4H4Q A;  1ONF A;  4U2T A;  1PBB A;  5EB4 A;  1OJA A;  3VQR A;  3RNM A;  2XLP A;  4WCT A;  4J36 A;  1O5W A;  2WEU A;  3CPI G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...