4G9KA

Structure of the ndi1 protein from saccharomyces cerevisiae
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
471
structure length
463
Chain Sequence
MKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase
publication title The structure of the yeast NADH dehydrogenase (Ndi1) reveals overlapping binding sites for water- and lipid-soluble substrates.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 144
structure length 463
sequence length 471
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g9kA00
4G9KA 3T14A 3SXIA 5KMSA 3SZWA 3SYIA 5KMRA 4G6HA 3HYWA 3T31A 3SZ0A 3T2ZA 3T2KA 4G6GA 3KPKA 5KMPA 3T0KA 3SX6A 5KMQA 3SZFA 4NWZA 4GAVA 3HYXA 3SY4A 4GAPA 4G74A 3T2YA 4G73A 3SZCA 3HYVA
chains in the Genus database with same CATH superfamily
5HYMA 4YTNA 2PYXA 3GD3A 3K7TA 3SXIA 3CNPA 4USRA 3SYIA 2EQ6A 1PJ7A 2X50A 4NTDA 1S2QA 3ITJA 3UOXA 2E1MA 1BF3A 4YSHA 1F8SA 2YM2A 2YR4A 3GYJA 3NH3X 1JRZA 1BZLA 3AXBA 3VRBA 1GXFA 4AT0A 2XFQA 3ICTA 1O95A 4H4UA 1COYA 4A65A 4U8NA 1BGNA 1NAAA 2Y6QA 3AE9A 1PXAA 1Y56A 2X99A 5IQ1A 4DSGA 3P4PA 2B7RA 2C76A 1CBOA 3NK0X 1ZMDA 1YQ4A 2FBWA 3DGHA 3FG2P 4I59A 4YSYA 3CNSA 3URHA 4OPTA 4A6NB 2BK4A 1VG9A 3NLCA 4D04A 2BXRA 3T37A 1LTXR 2AR8A 2QAEA 2QA1A 4KX6A 2BACA 3DK4A 3SZWA 2RGOA 3ALMA 2CULA 2I0ZA 3AYLA 1FL2A 4J36A 1GREA 2GEWA 1TRBA 3IC9A 2C7GA 4II2A 1H7WA 1L9CA 3SM8A 1P2HA 3QFBA 2WETA 4TM3A 1E1MA 4YKGA 4BJZA 1YKJA 4TM1A 3F8PA 1JRYA 3V3NA 3ISHA 2YWLA 1H84A 1B8SA 3BI4A 4JY3A 1TYTA 2JK6A 2VVLG 1MXTA 2XVEA 3G5QA 2C73A 1LPFA 3GDNA 2GR2A 3GDPA 1LVLA 4G74A 3E1TA 1MO9A 3AE7A 3AEDA 4DNAA 5EB5A 1GESA 1O94A 2GMHA 1TDNA 1Q1WA 3DA1A 3IWAA 1Y56B 1KSSA 1FEBA 2A87A 2GAGB 2UZZA 3G5RA 4GRTA 4H4SA 2B76A 1QO8A 1ZKQA 1ZMCA 4J57A 4B64A 1IUWA 3D1CA 3FPZA 5J60A 3LZXA 2CVJA 5JCNA 1REOA 4GR1A 4C3XA 2PHHA 3CPJG 2AQJA 2BXSA 2CDUA 3LJPA 3P4QA 3NYEA 4FDCB 4HA6A 3II4A 3CGDA 2GF3A 1CF3A 2GR0A 4B69A 2XLRA 1F6MA 2WDVA 2C3DA 1E1KA 2R0PA 4H4PA 3SZCA 3AEEA 3UOZA 4O5QA 2WDRA 1QLBA 3C4AA 4RG3A 5GRTA 4DSHA 5FS9A 1P2EA 4JDRA 3ICSA 3AE2A 4YSXA 2WDQA 1K0IA 3NHOX 4KPRA 4REKA 4X9NA 5HHFA 1PBBA 1GOSA 3SGLA 3SFDA 1JEHA 1IUTA 1NENA 2V6OA 2BC0A 2YAUA 4Z2RA 4C5OA 3NK2X 4A99A 1TDEA 2EQ7A 2JB1A 5KVHA 3M0OA 3AYJA 2RGHA 5KMPA 3IHMA 1ZX9A 2C75A 2GB0A 2BCGG 5JCLA 2BYBA 1YY5A 1UKVG 2BRAA 3OC4A 1CC4A 3EPTA 4B68A 1LJ1A 3R9UA 3KKJA 3ZYXA 4K5SA 1HYUA 1XDIA 4ADWA 4B65A 4TLXA 3UP4A 3GYIA 4B67A 1VDCA 1ELIA 1RYIA 2XLUA 1FEAA 2XDOA 2IVDA 3IHGA 4C77A 1GT8A 3K7MX 5KWFA 1EBDA 1OJTA 1AOGA 2XLPA 1IUUA 2A89A 5GSNA 1PXCA 4YSZA 4ZCCA 5KNLA 3IF9A 1JOAA 2JAEA 1BWCA 4NNJA 4EM3A 4EMJA 1XHCA 2R45A 4U2LA 1M6IA 1ZK7A 2JBVA 1Q9IA 1GTHA 3ICRA 2YLTA 2R0CA 5EB4A 3S5WA 3HZLA 3ADAB 3NG7X 4FK1A 4A5LA 1E1LA 2C66A 3ATRA 1CJ2A 2VQBA 3NTDA 2RGJA 1E39A 3HYVA 4H2RA 4G9KA 2JKCA 1N4UA 4EIQA 4Z24A 5KMSA 4Y4NA 5FS7A 3AYIA 3FIMB 1EL7A 3AD8B 4XWZA 4LIIA 5IPYA 1GRBA 1PBCA 1NHRA 3BNMA 4NEVA 3M12A 2V5ZA 4JN9A 2R4JA 5CKUA 2WP9A 3T2ZA 2GVCA 4A7AA 5JCKA 3CTYA 5KVIA 2Q6UA 2VVMA 2IVEA 1LQUA 3DJGX 4U8PA 4OVIA 2WOWA 4BV6A 2B9YA 5KOWA 3F8RA 2Z5XA 2GR3A 1GPEA 4BK3A 1JNZA 1FOHA 2BS4A 2XVIA 1B37A 1DOCA 5C3JA 4ZN0A 1Q1RA 2YG3A 2WESA 1DXLA 2AAQA 2WHDA 3OZ2A 1D5TA 2BK3A 2WS3A 2XFUA 4X4JA 3UOYA 2WU5A 3G5SA 4AP1A 5JCMA 1DNCA 1M64A 1NDAA 3GMCA 4C3YA 2WP5A 4D03A 1GETA 2BABA 2OALA 1TYPA 3HYWA 4UDRA 1EL8A 3NNEA 3T31A 2B9XA 3Q9TA 4U8JA 2FJDA 4X9MA 3KLJA 1DODA 1OJDA 1O5WA 1VG0A 2X8CA 2Q7VA 4K8DA 1DJQA 2BK5A 3K7QX 3NT6A 1S3EA 2BA9A 1H86A 3KVEA 4AT2A 1NHQA 5J7XA 2WPCA 4DGKA 4Z2TA 2EQ9A 2YVFA 3B6DA 3REDA 4H4YA 4M52A 1GRTA 4GDPA 4TLZA 1KF6A 3GRSA 4YWOA 1NPXA 2X3NA 4IA5A 5TR3A 1RSGA 4MJWA 1KNPA 4U8MA 1H82A 3DJJA 3QFAA 5L46A 3H8IA 4K22A 1D7YA 4RG4A 2YR6A 3I6DA 3PVCA 4H4XA 2ZZBA 4ZCDA 2DKHA 1GNDA 1E7PA 2WPEA 5FS6A 2W0HA 4EM4A 3I3LA 3CIRA 3AE4A 3UKPA 4H2PA 5ER0A 3NN0X 1QJDA 4II3A 3DK9A 4K5RA 1YQ3A 2R46A 4U8IA 3PO7A 2HQMA 2XLTA 4OCGA 3UKHA 1B5QA 2R4EA 2RABA 1DOEA 4U2SA 3AEBA 4H2NA 3RNMA 3UCLA 2R0GA 2XYOA 1D4DA 4AOXA 4UDPA 3BHKA 5EBKA 1DJNA 2F5ZA 4OPCA 4A79A 4EQSA 3EAOA 1H6VA 5BVAA 5KMRA 4Z2UA 2VZ2A 4NTCA 3T2YA 2YG6A 3AEGA 2XLSA 4CNKA 3QSMA 2YR5A 5EOWA 1PHHA 3SZ0A 2ACZA 3B3RA 3NYFA 2V60A 2WP6A 4BK2A 5KXJA 3P4SA 3PS9A 4GDEA 2GAHB 2GH5A 4USQA 1PBDA 4OPLA 2ZZ0A 2JB2A 1Y0PA 4BURA 3RP8A 4EMIA 1CHUA 1F8WA 2C3CA 3H4KA 3DJEA 1GV4A 4E0VA 1L9EA 3GYXA 3LADA 4JNQA 1VRQB 4IV9A 1IUSA 4NTEA 5M0ZA 2XFNA 4AP3A 3SQPA 3ALLA 3KA7A 1N4VA 3CGCA 1KFYA 4EQWA 3P9UA 2BS2A 1ZY8A 1PJ5A 4U8LA 1LQTA 2V3BA 4AOSA 5JCIA 3ATQA 3P4RA 5U25A 3UP5A 4EIPA 4FX9A 4G6GA 4UDQA 4U2TA 2XVHA 1BKWA 3O0HA 3F8DA 2GQFA 3BHFA 2V3AA 3T0KA 2YLWA 3M13A 4H4VA 4CCQA 4XXGA 4GAVA 1CJCA 5CQFA 2TPRA 3JSKA 4Z44A 3RHAA 4TM0A 4YXDA 2OLNA 3BI5A 2Q0LA 3GWFA 2VRMA 2QA2A 3UKFA 2WOVA 2H88A 4TM4A 3T14A 3ABVA 2BCPA 1GSNA 2Q0KA 3C4NA 5U63A 1L9DA 4Z43A 3H8LA 2YM1A 1KDGA 1PS9A 4IVOB 2Z5YA 2ZZCA 3KPFA 3DGZA 1YQZA 3GSIA 3RP7A 1DOBA 2FJAA 2A8XA 3Q6JA 3S61A 2GMJA 1GALA 3AECA 3AE1A 3EF6A 3L8KA 5KMQA 2E5VA 1GRGA 2FJEA 2NPXA 4P9SA 2DKIA 3UKLA 4APNA 1JNRA 4N9XA 2XVFA 4H4QA 1KSUA 2EQ8A 2BC1A 1CC6A 3D8XA 4CNJA 3QJ4A 4OPUA 2R9ZA 3AE3A 2Y6RA 2WOIA 5BULA 1XANA 2YG7A 2YQUA 2YLXA 4U8OA 4G73A 5FMHA 1GTEA 4H4WA 4H4RA 3GRTA 3KD9A 3UTHA 1PBEA 2QCUA 3UTEA 3BNUA 4GUVA 1CL0A 4H50A 2XCGA 4LA1A 3V3OA 4EQRA 4JY2A 1E6EA 4CBQA 3KPKA 4J31A 1F3PA 3UTFA 1BGJA 1X31B 1H83A 2NVKX 4Z25A 3SZFA 2OLOA 5LV9A 4NWZA 1SEZA 3EANA 5U1OA 4UP3A 4YT0A 2O9ZA 3CGBA 1GERA 2FJBA 3CNTA 2C70A 5M10A 1K0LA 1TDOA 2OAMA 1ZDLA 3NKSA 1N4WA 3HYXA 4K7ZA 3CNJA 5KOXA 4IVMB 1NEKA 4LU6A 2ZBWA 3LOVA 4NEWA 4WX1A 1FCDA 4B1BA 1V59A 4I58A 1PJ6A 2GR1A 3RP6A 1PDHA 1PBFA 2VVLA 1W4XA 3VR9A 1ZOVA 1GRHA 1TDFA 3KU9A 4H4TA 1JRXA 1OJCA 4NZHA 2ARDA 5BRTA 3VQRA 1E1NA 1OJAA 2YLZA 1ZP0A 4OPGA 1L0VA 3V76A 2C4CA 1CJ4A 4CCRA 2X8GA 3DMEA 4A9WA 3UKAA 1IUVA 1EL9A 2GV8A 2WU2A 3CGEA 4YTPA 5HY5A 3AEAA 3NIXA 3CPIG 1OJ9A 4PABA 4ECHA 2E4GA 4Z26A 3NTAA 1VQWA 3P1WA 1NG4A 3CMMA 4G6HA 3CN8A 1PXBA 4RSLA 4JQ9A 3GMBA 3QVPA 2CFYA 4OPIA 4B63A 4H4ZA 3L1RA 2BS3A 4OPDA 4J2WA 2B9WA 3LZWA 2V61A 4Y4LA 3UOVA 3ALJA 4EMWA 4FK1C 1H7XA 2WEUA 3WE0A 4Y4MA 1LV0A 1K4QA 5FS8A 2BRYA 3LXDA 2GQWA 1Z6LA 4K2XA 1RP0A 3UKQA 4C74A 2JB3A 4J34A 4BK1A 4CY6A 2WBAA 3AE5A 1NHPA 1KNRA 3NN6X 3AB1A 4XWRA 4BJYA 3VRAA 3AWIA 5BUKA 1FECA 2XVJA 5KRQA 3QVRA 3COXA 3AE6A 3LB8A 3FBSA 2YVJA 3GD4A 2GRTA 3NYCA 1PN0A 2VRLA 3VR8A 1MOKA 2YLSA 4H2QA 4U8KA 5HXIA 1XPQA 2VQ7A 4IA6A 1IUXA 2C67A 2WPFA 3C96A 2B7SA 4J56A 1CC2A 1D7LA 2OA1A 3K30A 4HB9A 1TDKA 2C72A 4GF7A 4WCTA 2YG4A 2H89A 2C64A 2J3NA 1NG3A 1S2YA 2X8HA 3AD7B 3BI2A 3DJDA 3NGCX 4PAAA 3NRNA 1NHSA 1ONFA 2XFOA 4CRTA 5IQ4A 3CPHG 2XFPA 2VOUA 3AD9B 1ZOYA 1H81A 3GWDA 2YVGA 1N1PA 4O5UA 4YTMA 3NK1X 1B4VA 3AE8A 2TMDA 4YKFA 1F8RA 4A6NA 1IJHA 4EQXA 1GRFA 3UTGA 1EL5A 2WQYA 5C2TA 1CJ3A 3ZDNA 1K0JA 1S3BA 3SX6A 1D4EA 3UKKA 1JU2A 4ICYA 1GRAA 2IIDA 2APGA 4H7UA 3DH9A 4CY8A 1D4CA 3DK8A 4B66A 3AEFA 4GCMA 3SFEA 3VRDB 4JNAA 1GEUA 3QSEA 4J33A 3QSSA 5DBJA 3SY4A 4GAPA 2YLRA 3FMWA 3CNDA 2C65A 2YG5A 3T2KA
chains in the Genus database with same CATH topology
5HYMA 4YTNA 2PYXA 3GD3A 3K7TA 3SXIA 3CNPA 4USRA 3SYIA 2EQ6A 1PJ7A 2X50A 4NTDA 1S2QA 3ITJA 3UOXA 2E1MA 1BF3A 4YSHA 1F8SA 2YM2A 2YR4A 3GYJA 3NH3X 1JRZA 1BZLA 3AXBA 3VRBA 1GXFA 4AT0A 2XFQA 3ICTA 1O95A 4H4UA 1COYA 4A65A 4U8NA 1BGNA 1NAAA 2Y6QA 3AE9A 1PXAA 1Y56A 2X99A 5IQ1A 4DSGA 3P4PA 2B7RA 2C76A 1CBOA 3NK0X 1ZMDA 1YQ4A 2FBWA 3DGHA 3FG2P 4I59A 4YSYA 3CNSA 3URHA 4OPTA 4A6NB 2BK4A 1VG9A 3NLCA 4D04A 2BXRA 3T37A 1LTXR 2AR8A 2QAEA 2QA1A 4KX6A 2BACA 3DK4A 3SZWA 2RGOA 3ALMA 2CULA 2I0ZA 3AYLA 1FL2A 4J36A 1GREA 2GEWA 1TRBA 3IC9A 2C7GA 4II2A 1H7WA 1L9CA 3SM8A 1P2HA 3QFBA 2WETA 4TM3A 1E1MA 4YKGA 4BJZA 1YKJA 4TM1A 3F8PA 1JRYA 3V3NA 3ISHA 2YWLA 1H84A 1B8SA 3BI4A 4JY3A 1TYTA 2JK6A 2VVLG 1MXTA 2XVEA 3G5QA 2C73A 1LPFA 3GDNA 2GR2A 3GDPA 1LVLA 4G74A 3E1TA 1MO9A 3AE7A 3AEDA 4DNAA 5EB5A 1GESA 1O94A 2GMHA 1TDNA 1Q1WA 3DA1A 3IWAA 1Y56B 1KSSA 1FEBA 2A87A 2GAGB 2UZZA 3G5RA 4GRTA 4H4SA 2B76A 1QO8A 1ZKQA 1ZMCA 4J57A 4B64A 1IUWA 3D1CA 3FPZA 5J60A 3LZXA 2CVJA 5JCNA 1REOA 4GR1A 4C3XA 2PHHA 3CPJG 2AQJA 2BXSA 2CDUA 3LJPA 3P4QA 3NYEA 4FDCB 4HA6A 3II4A 3CGDA 2GF3A 1CF3A 2GR0A 4B69A 2XLRA 1F6MA 2WDVA 2C3DA 1E1KA 2R0PA 4H4PA 3SZCA 3AEEA 3UOZA 4O5QA 2WDRA 1QLBA 3C4AA 4RG3A 5GRTA 4DSHA 5FS9A 1P2EA 4JDRA 3ICSA 3AE2A 4YSXA 2WDQA 1K0IA 3NHOX 4KPRA 4REKA 4X9NA 5HHFA 1PBBA 1GOSA 3SGLA 3SFDA 1JEHA 1IUTA 1NENA 2V6OA 2BC0A 2YAUA 4Z2RA 4C5OA 3NK2X 4A99A 1TDEA 2EQ7A 2JB1A 5KVHA 3M0OA 3AYJA 2RGHA 5KMPA 3IHMA 1ZX9A 2C75A 2GB0A 2BCGG 5JCLA 2BYBA 1YY5A 1UKVG 2BRAA 3OC4A 1CC4A 3EPTA 4B68A 1LJ1A 3R9UA 3KKJA 3ZYXA 4K5SA 1HYUA 1XDIA 4ADWA 4B65A 4TLXA 3UP4A 3GYIA 4B67A 1VDCA 1ELIA 1RYIA 2XLUA 1FEAA 2XDOA 2IVDA 3IHGA 4C77A 1GT8A 3K7MX 5KWFA 1EBDA 1OJTA 1AOGA 2XLPA 1IUUA 2A89A 5GSNA 1PXCA 4YSZA 4ZCCA 5KNLA 3IF9A 1JOAA 2JAEA 1BWCA 4NNJA 4EM3A 4EMJA 1XHCA 2R45A 4U2LA 1M6IA 1ZK7A 2JBVA 1Q9IA 1GTHA 3ICRA 2YLTA 2R0CA 5EB4A 3S5WA 3HZLA 3ADAB 3NG7X 4FK1A 4A5LA 1E1LA 2C66A 3ATRA 1CJ2A 2VQBA 3NTDA 2RGJA 1E39A 3HYVA 4H2RA 4G9KA 2JKCA 1N4UA 4EIQA 4Z24A 5KMSA 4Y4NA 5FS7A 3AYIA 3FIMB 1EL7A 3AD8B 4XWZA 4LIIA 5IPYA 1GRBA 1PBCA 1NHRA 3BNMA 4NEVA 3M12A 2V5ZA 4JN9A 2R4JA 5CKUA 2WP9A 3T2ZA 2GVCA 4A7AA 5JCKA 3CTYA 5KVIA 2Q6UA 2VVMA 2IVEA 1LQUA 3DJGX 4U8PA 4OVIA 2WOWA 4BV6A 2B9YA 5KOWA 3F8RA 2Z5XA 2GR3A 1GPEA 4BK3A 1JNZA 1FOHA 2BS4A 2XVIA 1B37A 1DOCA 5C3JA 4ZN0A 1Q1RA 2YG3A 2WESA 1DXLA 2AAQA 2WHDA 3OZ2A 1D5TA 2BK3A 2WS3A 2XFUA 4X4JA 3UOYA 2WU5A 3G5SA 4AP1A 5JCMA 1DNCA 1M64A 1NDAA 3GMCA 4C3YA 2WP5A 4D03A 1GETA 2BABA 2OALA 1TYPA 3HYWA 4UDRA 1EL8A 3NNEA 3T31A 2B9XA 3Q9TA 4U8JA 2FJDA 4X9MA 3KLJA 1DODA 1OJDA 1O5WA 1VG0A 2X8CA 2Q7VA 4K8DA 1DJQA 2BK5A 3K7QX 3NT6A 1S3EA 2BA9A 1H86A 3KVEA 4AT2A 1NHQA 5J7XA 2WPCA 4DGKA 4Z2TA 2EQ9A 2YVFA 3B6DA 3REDA 4H4YA 4M52A 1GRTA 4GDPA 4TLZA 1KF6A 3GRSA 4YWOA 1NPXA 2X3NA 4IA5A 5TR3A 1RSGA 4MJWA 1KNPA 4U8MA 1H82A 3DJJA 3QFAA 5L46A 3H8IA 4K22A 1D7YA 4RG4A 2YR6A 3I6DA 3PVCA 4H4XA 2ZZBA 4ZCDA 2DKHA 1GNDA 1E7PA 2WPEA 5FS6A 2W0HA 4EM4A 3I3LA 3CIRA 3AE4A 3UKPA 4H2PA 5ER0A 3NN0X 1QJDA 4II3A 3DK9A 4K5RA 1YQ3A 2R46A 4U8IA 3PO7A 2HQMA 2XLTA 4OCGA 3UKHA 1B5QA 2R4EA 2RABA 1DOEA 4U2SA 3AEBA 4H2NA 3RNMA 3UCLA 2R0GA 2XYOA 1D4DA 4AOXA 4UDPA 3BHKA 5EBKA 1DJNA 2F5ZA 4OPCA 4A79A 4EQSA 3EAOA 1H6VA 5BVAA 5KMRA 4Z2UA 2VZ2A 4NTCA 3T2YA 2YG6A 3AEGA 2XLSA 4CNKA 3QSMA 2YR5A 5EOWA 1PHHA 3SZ0A 2ACZA 3B3RA 3NYFA 2V60A 2WP6A 4BK2A 5KXJA 3P4SA 3PS9A 4GDEA 2GAHB 2GH5A 4USQA 1PBDA 4OPLA 2ZZ0A 2JB2A 1Y0PA 4BURA 3RP8A 4EMIA 1CHUA 1F8WA 2C3CA 3H4KA 3DJEA 1GV4A 4E0VA 1L9EA 3GYXA 3LADA 4JNQA 1VRQB 4IV9A 1IUSA 4NTEA 5M0ZA 2XFNA 4AP3A 3SQPA 3ALLA 3KA7A 1N4VA 3CGCA 1KFYA 4EQWA 3P9UA 2BS2A 1ZY8A 1PJ5A 4U8LA 1LQTA 2V3BA 4AOSA 5JCIA 3ATQA 3P4RA 5U25A 3UP5A 4EIPA 4FX9A 4G6GA 4UDQA 4U2TA 2XVHA 1BKWA 3O0HA 3F8DA 2GQFA 3BHFA 2V3AA 3T0KA 2YLWA 3M13A 4H4VA 4CCQA 4XXGA 4GAVA 1CJCA 5CQFA 2TPRA 3JSKA 4Z44A 3RHAA 4TM0A 4YXDA 2OLNA 3BI5A 2Q0LA 3GWFA 2VRMA 2QA2A 3UKFA 2WOVA 2H88A 4TM4A 3T14A 3ABVA 2BCPA 1GSNA 2Q0KA 3C4NA 5U63A 1L9DA 4Z43A 3H8LA 2YM1A 1KDGA 1PS9A 4IVOB 2Z5YA 2ZZCA 3KPFA 3DGZA 1YQZA 3GSIA 3RP7A 1DOBA 2FJAA 2A8XA 3Q6JA 3S61A 2GMJA 1GALA 3AECA 3AE1A 3EF6A 3L8KA 5KMQA 2E5VA 1GRGA 2FJEA 2NPXA 4P9SA 2DKIA 3UKLA 4APNA 1JNRA 4N9XA 2XVFA 4H4QA 1KSUA 2EQ8A 2BC1A 1CC6A 3D8XA 4CNJA 3QJ4A 4OPUA 2R9ZA 3AE3A 2Y6RA 2WOIA 5BULA 1XANA 2YG7A 2YQUA 2YLXA 4U8OA 4G73A 5FMHA 1GTEA 4H4WA 4H4RA 3GRTA 3KD9A 3UTHA 1PBEA 2QCUA 3UTEA 3BNUA 4GUVA 1CL0A 4H50A 2XCGA 4LA1A 3V3OA 4EQRA 4JY2A 1E6EA 4CBQA 3KPKA 4J31A 1F3PA 3UTFA 1BGJA 1X31B 1H83A 2NVKX 4Z25A 3SZFA 2OLOA 5LV9A 4NWZA 1SEZA 3EANA 5U1OA 4UP3A 4YT0A 2O9ZA 3CGBA 1GERA 2FJBA 3CNTA 2C70A 5M10A 1K0LA 1TDOA 2OAMA 1ZDLA 3NKSA 1N4WA 3HYXA 4K7ZA 3CNJA 5KOXA 4IVMB 1NEKA 4LU6A 2ZBWA 3LOVA 4NEWA 4WX1A 1FCDA 4B1BA 1V59A 4I58A 1PJ6A 2GR1A 3RP6A 1PDHA 1PBFA 2VVLA 1W4XA 3VR9A 1ZOVA 1GRHA 1TDFA 3KU9A 4H4TA 1JRXA 1OJCA 4NZHA 2ARDA 5BRTA 3VQRA 1E1NA 1OJAA 2YLZA 1ZP0A 4OPGA 1L0VA 3V76A 2C4CA 1CJ4A 4CCRA 2X8GA 3DMEA 4A9WA 3UKAA 1IUVA 1EL9A 2GV8A 2WU2A 3CGEA 4YTPA 5HY5A 3AEAA 3NIXA 3CPIG 1OJ9A 4PABA 4ECHA 2E4GA 4Z26A 3NTAA 1VQWA 3P1WA 1NG4A 3CMMA 4G6HA 3CN8A 1PXBA 4RSLA 4JQ9A 3GMBA 3QVPA 2CFYA 4OPIA 4B63A 4H4ZA 3L1RA 2BS3A 4OPDA 4J2WA 2B9WA 3LZWA 2V61A 4Y4LA 3UOVA 3ALJA 4EMWA 4FK1C 1H7XA 2WEUA 3WE0A 4Y4MA 1LV0A 1K4QA 5FS8A 2BRYA 3LXDA 2GQWA 1Z6LA 4K2XA 1RP0A 3UKQA 4C74A 2JB3A 4J34A 4BK1A 4CY6A 2WBAA 3AE5A 1NHPA 1KNRA 3NN6X 3AB1A 4XWRA 4BJYA 3VRAA 3AWIA 5BUKA 1FECA 2XVJA 5KRQA 3QVRA 3COXA 3AE6A 3LB8A 3FBSA 2YVJA 3GD4A 2GRTA 3NYCA 1PN0A 2VRLA 3VR8A 1MOKA 2YLSA 4H2QA 4U8KA 5HXIA 1XPQA 2VQ7A 4IA6A 1IUXA 2C67A 2WPFA 3C96A 2B7SA 4J56A 1CC2A 1D7LA 2OA1A 3K30A 4HB9A 1TDKA 2C72A 4GF7A 4WCTA 2YG4A 2H89A 2C64A 2J3NA 1NG3A 1S2YA 2X8HA 3AD7B 3BI2A 3DJDA 3NGCX 4PAAA 3NRNA 1NHSA 1ONFA 2XFOA 4CRTA 5IQ4A 3CPHG 2XFPA 2VOUA 3AD9B 1ZOYA 1H81A 3GWDA 2YVGA 1N1PA 4O5UA 4YTMA 3NK1X 1B4VA 3AE8A 2TMDA 4YKFA 1F8RA 4A6NA 1IJHA 4EQXA 1GRFA 3UTGA 1EL5A 2WQYA 5C2TA 1CJ3A 3ZDNA 1K0JA 1S3BA 3SX6A 1D4EA 3UKKA 1JU2A 4ICYA 1GRAA 2IIDA 2APGA 4H7UA 3DH9A 4CY8A 1D4CA 3DK8A 4B66A 3AEFA 4GCMA 3SFEA 3VRDB 4JNAA 1GEUA 3QSEA 4J33A 3QSSA 5DBJA 3SY4A 4GAPA 2YLRA 3FMWA 3CNDA 2C65A 2YG5A 3T2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9K A;  3T14 A;  3SXI A;  5KMS A;  3SZW A;  3SYI A;  5KMR A;  4G6H A;  3HYW A;  3T31 A;  3SZ0 A;  3T2Z A;  3T2K A;  4G6G A;  3KPK A;  5KMP A;  3T0K A;  3SX6 A;  5KMQ A;  3SZF A;  4NWZ A;  4GAV A;  3HYX A;  3SY4 A;  4GAP A;  4G74 A;  3T2Y A;  4G73 A;  3SZC A;  3HYV A; 
#chains in the Genus database with same CATH topology
 5HYM A;  4YTN A;  2PYX A;  3GD3 A;  3K7T A;  3SXI A;  3CNP A;  4USR A;  3SYI A;  2EQ6 A;  1PJ7 A;  2X50 A;  4NTD A;  1S2Q A;  3ITJ A;  3UOX A;  2E1M A;  1BF3 A;  4YSH A;  1F8S A;  2YM2 A;  2YR4 A;  3GYJ A;  3NH3 X;  1JRZ A;  1BZL A;  3AXB A;  3VRB A;  1GXF A;  4AT0 A;  2XFQ A;  3ICT A;  1O95 A;  4H4U A;  1COY A;  4A65 A;  4U8N A;  1BGN A;  1NAA A;  2Y6Q A;  3AE9 A;  1PXA A;  1Y56 A;  2X99 A;  5IQ1 A;  4DSG A;  3P4P A;  2B7R A;  2C76 A;  1CBO A;  3NK0 X;  1ZMD A;  1YQ4 A;  2FBW A;  3DGH A;  3FG2 P;  4I59 A;  4YSY A;  3CNS A;  3URH A;  4OPT A;  4A6N B;  2BK4 A;  1VG9 A;  3NLC A;  4D04 A;  2BXR A;  3T37 A;  1LTX R;  2AR8 A;  2QAE A;  2QA1 A;  4KX6 A;  2BAC A;  3DK4 A;  3SZW A;  2RGO A;  3ALM A;  2CUL A;  2I0Z A;  3AYL A;  1FL2 A;  4J36 A;  1GRE A;  2GEW A;  1TRB A;  3IC9 A;  2C7G A;  4II2 A;  1H7W A;  1L9C A;  3SM8 A;  1P2H A;  3QFB A;  2WET A;  4TM3 A;  1E1M A;  4YKG A;  4BJZ A;  1YKJ A;  4TM1 A;  3F8P A;  1JRY A;  3V3N A;  3ISH A;  2YWL A;  1H84 A;  1B8S A;  3BI4 A;  4JY3 A;  1TYT A;  2JK6 A;  2VVL G;  1MXT A;  2XVE A;  3G5Q A;  2C73 A;  1LPF A;  3GDN A;  2GR2 A;  3GDP A;  1LVL A;  4G74 A;  3E1T A;  1MO9 A;  3AE7 A;  3AED A;  4DNA A;  5EB5 A;  1GES A;  1O94 A;  2GMH A;  1TDN A;  1Q1W A;  3DA1 A;  3IWA A;  1Y56 B;  1KSS A;  1FEB A;  2A87 A;  2GAG B;  2UZZ A;  3G5R A;  4GRT A;  4H4S A;  2B76 A;  1QO8 A;  1ZKQ A;  1ZMC A;  4J57 A;  4B64 A;  1IUW A;  3D1C A;  3FPZ A;  5J60 A;  3LZX A;  2CVJ A;  5JCN A;  1REO A;  4GR1 A;  4C3X A;  2PHH A;  3CPJ G;  2AQJ A;  2BXS A;  2CDU A;  3LJP A;  3P4Q A;  3NYE A;  4FDC B;  4HA6 A;  3II4 A;  3CGD A;  2GF3 A;  1CF3 A;  2GR0 A;  4B69 A;  2XLR A;  1F6M A;  2WDV A;  2C3D A;  1E1K A;  2R0P A;  4H4P A;  3SZC A;  3AEE A;  3UOZ A;  4O5Q A;  2WDR A;  1QLB A;  3C4A A;  4RG3 A;  5GRT A;  4DSH A;  5FS9 A;  1P2E A;  4JDR A;  3ICS A;  3AE2 A;  4YSX A;  2WDQ A;  1K0I A;  3NHO X;  4KPR A;  4REK A;  4X9N A;  5HHF A;  1PBB A;  1GOS A;  3SGL A;  3SFD A;  1JEH A;  1IUT A;  1NEN A;  2V6O A;  2BC0 A;  2YAU A;  4Z2R A;  4C5O A;  3NK2 X;  4A99 A;  1TDE A;  2EQ7 A;  2JB1 A;  5KVH A;  3M0O A;  3AYJ A;  2RGH A;  5KMP A;  3IHM A;  1ZX9 A;  2C75 A;  2GB0 A;  2BCG G;  5JCL A;  2BYB A;  1YY5 A;  1UKV G;  2BRA A;  3OC4 A;  1CC4 A;  3EPT A;  4B68 A;  1LJ1 A;  3R9U A;  3KKJ A;  3ZYX A;  4K5S A;  1HYU A;  1XDI A;  4ADW A;  4B65 A;  4TLX A;  3UP4 A;  3GYI A;  4B67 A;  1VDC A;  1ELI A;  1RYI A;  2XLU A;  1FEA A;  2XDO A;  2IVD A;  3IHG A;  4C77 A;  1GT8 A;  3K7M X;  5KWF A;  1EBD A;  1OJT A;  1AOG A;  2XLP A;  1IUU A;  2A89 A;  5GSN A;  1PXC A;  4YSZ A;  4ZCC A;  5KNL A;  3IF9 A;  1JOA A;  2JAE A;  1BWC A;  4NNJ A;  4EM3 A;  4EMJ A;  1XHC A;  2R45 A;  4U2L A;  1M6I A;  1ZK7 A;  2JBV A;  1Q9I A;  1GTH A;  3ICR A;  2YLT A;  2R0C A;  5EB4 A;  3S5W A;  3HZL A;  3ADA B;  3NG7 X;  4FK1 A;  4A5L A;  1E1L A;  2C66 A;  3ATR A;  1CJ2 A;  2VQB A;  3NTD A;  2RGJ A;  1E39 A;  3HYV A;  4H2R A;  4G9K A;  2JKC A;  1N4U A;  4EIQ A;  4Z24 A;  5KMS A;  4Y4N A;  5FS7 A;  3AYI A;  3FIM B;  1EL7 A;  3AD8 B;  4XWZ A;  4LII A;  5IPY A;  1GRB A;  1PBC A;  1NHR A;  3BNM A;  4NEV A;  3M12 A;  2V5Z A;  4JN9 A;  2R4J A;  5CKU A;  2WP9 A;  3T2Z A;  2GVC A;  4A7A A;  5JCK A;  3CTY A;  5KVI A;  2Q6U A;  2VVM A;  2IVE A;  1LQU A;  3DJG X;  4U8P A;  4OVI A;  2WOW A;  4BV6 A;  2B9Y A;  5KOW A;  3F8R A;  2Z5X A;  2GR3 A;  1GPE A;  4BK3 A;  1JNZ A;  1FOH A;  2BS4 A;  2XVI A;  1B37 A;  1DOC A;  5C3J A;  4ZN0 A;  1Q1R A;  2YG3 A;  2WES A;  1DXL A;  2AAQ A;  2WHD A;  3OZ2 A;  1D5T A;  2BK3 A;  2WS3 A;  2XFU A;  4X4J A;  3UOY A;  2WU5 A;  3G5S A;  4AP1 A;  5JCM A;  1DNC A;  1M64 A;  1NDA A;  3GMC A;  4C3Y A;  2WP5 A;  4D03 A;  1GET A;  2BAB A;  2OAL A;  1TYP A;  3HYW A;  4UDR A;  1EL8 A;  3NNE A;  3T31 A;  2B9X A;  3Q9T A;  4U8J A;  2FJD A;  4X9M A;  3KLJ A;  1DOD A;  1OJD A;  1O5W A;  1VG0 A;  2X8C A;  2Q7V A;  4K8D A;  1DJQ A;  2BK5 A;  3K7Q X;  3NT6 A;  1S3E A;  2BA9 A;  1H86 A;  3KVE A;  4AT2 A;  1NHQ A;  5J7X A;  2WPC A;  4DGK A;  4Z2T A;  2EQ9 A;  2YVF A;  3B6D A;  3RED A;  4H4Y A;  4M52 A;  1GRT A;  4GDP A;  4TLZ A;  1KF6 A;  3GRS A;  4YWO A;  1NPX A;  2X3N A;  4IA5 A;  5TR3 A;  1RSG A;  4MJW A;  1KNP A;  4U8M A;  1H82 A;  3DJJ A;  3QFA A;  5L46 A;  3H8I A;  4K22 A;  1D7Y A;  4RG4 A;  2YR6 A;  3I6D A;  3PVC A;  4H4X A;  2ZZB A;  4ZCD A;  2DKH A;  1GND A;  1E7P A;  2WPE A;  5FS6 A;  2W0H A;  4EM4 A;  3I3L A;  3CIR A;  3AE4 A;  3UKP A;  4H2P A;  5ER0 A;  3NN0 X;  1QJD A;  4II3 A;  3DK9 A;  4K5R A;  1YQ3 A;  2R46 A;  4U8I A;  3PO7 A;  2HQM A;  2XLT A;  4OCG A;  3UKH A;  1B5Q A;  2R4E A;  2RAB A;  1DOE A;  4U2S A;  3AEB A;  4H2N A;  3RNM A;  3UCL A;  2R0G A;  2XYO A;  1D4D A;  4AOX A;  4UDP A;  3BHK A;  5EBK A;  1DJN A;  2F5Z A;  4OPC A;  4A79 A;  4EQS A;  3EAO A;  1H6V A;  5BVA A;  5KMR A;  4Z2U A;  2VZ2 A;  4NTC A;  3T2Y A;  2YG6 A;  3AEG A;  2XLS A;  4CNK A;  3QSM A;  2YR5 A;  5EOW A;  1PHH A;  3SZ0 A;  2ACZ A;  3B3R A;  3NYF A;  2V60 A;  2WP6 A;  4BK2 A;  5KXJ A;  3P4S A;  3PS9 A;  4GDE A;  2GAH B;  2GH5 A;  4USQ A;  1PBD A;  4OPL A;  2ZZ0 A;  2JB2 A;  1Y0P A;  4BUR A;  3RP8 A;  4EMI A;  1CHU A;  1F8W A;  2C3C A;  3H4K A;  3DJE A;  1GV4 A;  4E0V A;  1L9E A;  3GYX A;  3LAD A;  4JNQ A;  1VRQ B;  4IV9 A;  1IUS A;  4NTE A;  5M0Z A;  2XFN A;  4AP3 A;  3SQP A;  3ALL A;  3KA7 A;  1N4V A;  3CGC A;  1KFY A;  4EQW A;  3P9U A;  2BS2 A;  1ZY8 A;  1PJ5 A;  4U8L A;  1LQT A;  2V3B A;  4AOS A;  5JCI A;  3ATQ A;  3P4R A;  5U25 A;  3UP5 A;  4EIP A;  4FX9 A;  4G6G A;  4UDQ A;  4U2T A;  2XVH A;  1BKW A;  3O0H A;  3F8D A;  2GQF A;  3BHF A;  2V3A A;  3T0K A;  2YLW A;  3M13 A;  4H4V A;  4CCQ A;  4XXG A;  4GAV A;  1CJC A;  5CQF A;  2TPR A;  3JSK A;  4Z44 A;  3RHA A;  4TM0 A;  4YXD A;  2OLN A;  3BI5 A;  2Q0L A;  3GWF A;  2VRM A;  2QA2 A;  3UKF A;  2WOV A;  2H88 A;  4TM4 A;  3T14 A;  3ABV A;  2BCP A;  1GSN A;  2Q0K A;  3C4N A;  5U63 A;  1L9D A;  4Z43 A;  3H8L A;  2YM1 A;  1KDG A;  1PS9 A;  4IVO B;  2Z5Y A;  2ZZC A;  3KPF A;  3DGZ A;  1YQZ A;  3GSI A;  3RP7 A;  1DOB A;  2FJA A;  2A8X A;  3Q6J A;  3S61 A;  2GMJ A;  1GAL A;  3AEC A;  3AE1 A;  3EF6 A;  3L8K A;  5KMQ A;  2E5V A;  1GRG A;  2FJE A;  2NPX A;  4P9S A;  2DKI A;  3UKL A;  4APN A;  1JNR A;  4N9X A;  2XVF A;  4H4Q A;  1KSU A;  2EQ8 A;  2BC1 A;  1CC6 A;  3D8X A;  4CNJ A;  3QJ4 A;  4OPU A;  2R9Z A;  3AE3 A;  2Y6R A;  2WOI A;  5BUL A;  1XAN A;  2YG7 A;  2YQU A;  2YLX A;  4U8O A;  4G73 A;  5FMH A;  1GTE A;  4H4W A;  4H4R A;  3GRT A;  3KD9 A;  3UTH A;  1PBE A;  2QCU A;  3UTE A;  3BNU A;  4GUV A;  1CL0 A;  4H50 A;  2XCG A;  4LA1 A;  3V3O A;  4EQR A;  4JY2 A;  1E6E A;  4CBQ A;  3KPK A;  4J31 A;  1F3P A;  3UTF A;  1BGJ A;  1X31 B;  1H83 A;  2NVK X;  4Z25 A;  3SZF A;  2OLO A;  5LV9 A;  4NWZ A;  1SEZ A;  3EAN A;  5U1O A;  4UP3 A;  4YT0 A;  2O9Z A;  3CGB A;  1GER A;  2FJB A;  3CNT A;  2C70 A;  5M10 A;  1K0L A;  1TDO A;  2OAM A;  1ZDL A;  3NKS A;  1N4W A;  3HYX A;  4K7Z A;  3CNJ A;  5KOX A;  4IVM B;  1NEK A;  4LU6 A;  2ZBW A;  3LOV A;  4NEW A;  4WX1 A;  1FCD A;  4B1B A;  1V59 A;  4I58 A;  1PJ6 A;  2GR1 A;  3RP6 A;  1PDH A;  1PBF A;  2VVL A;  1W4X A;  3VR9 A;  1ZOV A;  1GRH A;  1TDF A;  3KU9 A;  4H4T A;  1JRX A;  1OJC A;  4NZH A;  2ARD A;  5BRT A;  3VQR A;  1E1N A;  1OJA A;  2YLZ A;  1ZP0 A;  4OPG A;  1L0V A;  3V76 A;  2C4C A;  1CJ4 A;  4CCR A;  2X8G A;  3DME A;  4A9W A;  3UKA A;  1IUV A;  1EL9 A;  2GV8 A;  2WU2 A;  3CGE A;  4YTP A;  5HY5 A;  3AEA A;  3NIX A;  3CPI G;  1OJ9 A;  4PAB A;  4ECH A;  2E4G A;  4Z26 A;  3NTA A;  1VQW A;  3P1W A;  1NG4 A;  3CMM A;  4G6H A;  3CN8 A;  1PXB A;  4RSL A;  4JQ9 A;  3GMB A;  3QVP A;  2CFY A;  4OPI A;  4B63 A;  4H4Z A;  3L1R A;  2BS3 A;  4OPD A;  4J2W A;  2B9W A;  3LZW A;  2V61 A;  4Y4L A;  3UOV A;  3ALJ A;  4EMW A;  4FK1 C;  1H7X A;  2WEU A;  3WE0 A;  4Y4M A;  1LV0 A;  1K4Q A;  5FS8 A;  2BRY A;  3LXD A;  2GQW A;  1Z6L A;  4K2X A;  1RP0 A;  3UKQ A;  4C74 A;  2JB3 A;  4J34 A;  4BK1 A;  4CY6 A;  2WBA A;  3AE5 A;  1NHP A;  1KNR A;  3NN6 X;  3AB1 A;  4XWR A;  4BJY A;  3VRA A;  3AWI A;  5BUK A;  1FEC A;  2XVJ A;  5KRQ A;  3QVR A;  3COX A;  3AE6 A;  3LB8 A;  3FBS A;  2YVJ A;  3GD4 A;  2GRT A;  3NYC A;  1PN0 A;  2VRL A;  3VR8 A;  1MOK A;  2YLS A;  4H2Q A;  4U8K A;  5HXI A;  1XPQ A;  2VQ7 A;  4IA6 A;  1IUX A;  2C67 A;  2WPF A;  3C96 A;  2B7S A;  4J56 A;  1CC2 A;  1D7L A;  2OA1 A;  3K30 A;  4HB9 A;  1TDK A;  2C72 A;  4GF7 A;  4WCT A;  2YG4 A;  2H89 A;  2C64 A;  2J3N A;  1NG3 A;  1S2Y A;  2X8H A;  3AD7 B;  3BI2 A;  3DJD A;  3NGC X;  4PAA A;  3NRN A;  1NHS A;  1ONF A;  2XFO A;  4CRT A;  5IQ4 A;  3CPH G;  2XFP A;  2VOU A;  3AD9 B;  1ZOY A;  1H81 A;  3GWD A;  2YVG A;  1N1P A;  4O5U A;  4YTM A;  3NK1 X;  1B4V A;  3AE8 A;  2TMD A;  4YKF A;  1F8R A;  4A6N A;  1IJH A;  4EQX A;  1GRF A;  3UTG A;  1EL5 A;  2WQY A;  5C2T A;  1CJ3 A;  3ZDN A;  1K0J A;  1S3B A;  3SX6 A;  1D4E A;  3UKK A;  1JU2 A;  4ICY A;  1GRA A;  2IID A;  2APG A;  4H7U A;  3DH9 A;  4CY8 A;  1D4C A;  3DK8 A;  4B66 A;  3AEF A;  4GCM A;  3SFE A;  3VRD B;  4JNA A;  1GEU A;  3QSE A;  4J33 A;  3QSS A;  5DBJ A;  3SY4 A;  4GAP A;  2YLR A;  3FMW A;  3CND A;  2C65 A;  2YG5 A;  3T2K A; 
#chains in the Genus database with same CATH homology
 5HYM A;  4YTN A;  2PYX A;  3GD3 A;  3K7T A;  3SXI A;  3CNP A;  4USR A;  3SYI A;  2EQ6 A;  1PJ7 A;  2X50 A;  4NTD A;  1S2Q A;  3ITJ A;  3UOX A;  2E1M A;  1BF3 A;  4YSH A;  1F8S A;  2YM2 A;  2YR4 A;  3GYJ A;  3NH3 X;  1JRZ A;  1BZL A;  3AXB A;  3VRB A;  1GXF A;  4AT0 A;  2XFQ A;  3ICT A;  1O95 A;  4H4U A;  1COY A;  4A65 A;  4U8N A;  1BGN A;  1NAA A;  2Y6Q A;  3AE9 A;  1PXA A;  1Y56 A;  2X99 A;  5IQ1 A;  4DSG A;  3P4P A;  2B7R A;  2C76 A;  1CBO A;  3NK0 X;  1ZMD A;  1YQ4 A;  2FBW A;  3DGH A;  3FG2 P;  4I59 A;  4YSY A;  3CNS A;  3URH A;  4OPT A;  4A6N B;  2BK4 A;  1VG9 A;  3NLC A;  4D04 A;  2BXR A;  3T37 A;  1LTX R;  2AR8 A;  2QAE A;  2QA1 A;  4KX6 A;  2BAC A;  3DK4 A;  3SZW A;  2RGO A;  3ALM A;  2CUL A;  2I0Z A;  3AYL A;  1FL2 A;  4J36 A;  1GRE A;  2GEW A;  1TRB A;  3IC9 A;  2C7G A;  4II2 A;  1H7W A;  1L9C A;  3SM8 A;  1P2H A;  3QFB A;  2WET A;  4TM3 A;  1E1M A;  4YKG A;  4BJZ A;  1YKJ A;  4TM1 A;  3F8P A;  1JRY A;  3V3N A;  3ISH A;  2YWL A;  1H84 A;  1B8S A;  3BI4 A;  4JY3 A;  1TYT A;  2JK6 A;  2VVL G;  1MXT A;  2XVE A;  3G5Q A;  2C73 A;  1LPF A;  3GDN A;  2GR2 A;  3GDP A;  1LVL A;  4G74 A;  3E1T A;  1MO9 A;  3AE7 A;  3AED A;  4DNA A;  5EB5 A;  1GES A;  1O94 A;  2GMH A;  1TDN A;  1Q1W A;  3DA1 A;  3IWA A;  1Y56 B;  1KSS A;  1FEB A;  2A87 A;  2GAG B;  2UZZ A;  3G5R A;  4GRT A;  4H4S A;  2B76 A;  1QO8 A;  1ZKQ A;  1ZMC A;  4J57 A;  4B64 A;  1IUW A;  3D1C A;  3FPZ A;  5J60 A;  3LZX A;  2CVJ A;  5JCN A;  1REO A;  4GR1 A;  4C3X A;  2PHH A;  3CPJ G;  2AQJ A;  2BXS A;  2CDU A;  3LJP A;  3P4Q A;  3NYE A;  4FDC B;  4HA6 A;  3II4 A;  3CGD A;  2GF3 A;  1CF3 A;  2GR0 A;  4B69 A;  2XLR A;  1F6M A;  2WDV A;  2C3D A;  1E1K A;  2R0P A;  4H4P A;  3SZC A;  3AEE A;  3UOZ A;  4O5Q A;  2WDR A;  1QLB A;  3C4A A;  4RG3 A;  5GRT A;  4DSH A;  5FS9 A;  1P2E A;  4JDR A;  3ICS A;  3AE2 A;  4YSX A;  2WDQ A;  1K0I A;  3NHO X;  4KPR A;  4REK A;  4X9N A;  5HHF A;  1PBB A;  1GOS A;  3SGL A;  3SFD A;  1JEH A;  1IUT A;  1NEN A;  2V6O A;  2BC0 A;  2YAU A;  4Z2R A;  4C5O A;  3NK2 X;  4A99 A;  1TDE A;  2EQ7 A;  2JB1 A;  5KVH A;  3M0O A;  3AYJ A;  2RGH A;  5KMP A;  3IHM A;  1ZX9 A;  2C75 A;  2GB0 A;  2BCG G;  5JCL A;  2BYB A;  1YY5 A;  1UKV G;  2BRA A;  3OC4 A;  1CC4 A;  3EPT A;  4B68 A;  1LJ1 A;  3R9U A;  3KKJ A;  3ZYX A;  4K5S A;  1HYU A;  1XDI A;  4ADW A;  4B65 A;  4TLX A;  3UP4 A;  3GYI A;  4B67 A;  1VDC A;  1ELI A;  1RYI A;  2XLU A;  1FEA A;  2XDO A;  2IVD A;  3IHG A;  4C77 A;  1GT8 A;  3K7M X;  5KWF A;  1EBD A;  1OJT A;  1AOG A;  2XLP A;  1IUU A;  2A89 A;  5GSN A;  1PXC A;  4YSZ A;  4ZCC A;  5KNL A;  3IF9 A;  1JOA A;  2JAE A;  1BWC A;  4NNJ A;  4EM3 A;  4EMJ A;  1XHC A;  2R45 A;  4U2L A;  1M6I A;  1ZK7 A;  2JBV A;  1Q9I A;  1GTH A;  3ICR A;  2YLT A;  2R0C A;  5EB4 A;  3S5W A;  3HZL A;  3ADA B;  3NG7 X;  4FK1 A;  4A5L A;  1E1L A;  2C66 A;  3ATR A;  1CJ2 A;  2VQB A;  3NTD A;  2RGJ A;  1E39 A;  3HYV A;  4H2R A;  4G9K A;  2JKC A;  1N4U A;  4EIQ A;  4Z24 A;  5KMS A;  4Y4N A;  5FS7 A;  3AYI A;  3FIM B;  1EL7 A;  3AD8 B;  4XWZ A;  4LII A;  5IPY A;  1GRB A;  1PBC A;  1NHR A;  3BNM A;  4NEV A;  3M12 A;  2V5Z A;  4JN9 A;  2R4J A;  5CKU A;  2WP9 A;  3T2Z A;  2GVC A;  4A7A A;  5JCK A;  3CTY A;  5KVI A;  2Q6U A;  2VVM A;  2IVE A;  1LQU A;  3DJG X;  4U8P A;  4OVI A;  2WOW A;  4BV6 A;  2B9Y A;  5KOW A;  3F8R A;  2Z5X A;  2GR3 A;  1GPE A;  4BK3 A;  1JNZ A;  1FOH A;  2BS4 A;  2XVI A;  1B37 A;  1DOC A;  5C3J A;  4ZN0 A;  1Q1R A;  2YG3 A;  2WES A;  1DXL A;  2AAQ A;  2WHD A;  3OZ2 A;  1D5T A;  2BK3 A;  2WS3 A;  2XFU A;  4X4J A;  3UOY A;  2WU5 A;  3G5S A;  4AP1 A;  5JCM A;  1DNC A;  1M64 A;  1NDA A;  3GMC A;  4C3Y A;  2WP5 A;  4D03 A;  1GET A;  2BAB A;  2OAL A;  1TYP A;  3HYW A;  4UDR A;  1EL8 A;  3NNE A;  3T31 A;  2B9X A;  3Q9T A;  4U8J A;  2FJD A;  4X9M A;  3KLJ A;  1DOD A;  1OJD A;  1O5W A;  1VG0 A;  2X8C A;  2Q7V A;  4K8D A;  1DJQ A;  2BK5 A;  3K7Q X;  3NT6 A;  1S3E A;  2BA9 A;  1H86 A;  3KVE A;  4AT2 A;  1NHQ A;  5J7X A;  2WPC A;  4DGK A;  4Z2T A;  2EQ9 A;  2YVF A;  3B6D A;  3RED A;  4H4Y A;  4M52 A;  1GRT A;  4GDP A;  4TLZ A;  1KF6 A;  3GRS A;  4YWO A;  1NPX A;  2X3N A;  4IA5 A;  5TR3 A;  1RSG A;  4MJW A;  1KNP A;  4U8M A;  1H82 A;  3DJJ A;  3QFA A;  5L46 A;  3H8I A;  4K22 A;  1D7Y A;  4RG4 A;  2YR6 A;  3I6D A;  3PVC A;  4H4X A;  2ZZB A;  4ZCD A;  2DKH A;  1GND A;  1E7P A;  2WPE A;  5FS6 A;  2W0H A;  4EM4 A;  3I3L A;  3CIR A;  3AE4 A;  3UKP A;  4H2P A;  5ER0 A;  3NN0 X;  1QJD A;  4II3 A;  3DK9 A;  4K5R A;  1YQ3 A;  2R46 A;  4U8I A;  3PO7 A;  2HQM A;  2XLT A;  4OCG A;  3UKH A;  1B5Q A;  2R4E A;  2RAB A;  1DOE A;  4U2S A;  3AEB A;  4H2N A;  3RNM A;  3UCL A;  2R0G A;  2XYO A;  1D4D A;  4AOX A;  4UDP A;  3BHK A;  5EBK A;  1DJN A;  2F5Z A;  4OPC A;  4A79 A;  4EQS A;  3EAO A;  1H6V A;  5BVA A;  5KMR A;  4Z2U A;  2VZ2 A;  4NTC A;  3T2Y A;  2YG6 A;  3AEG A;  2XLS A;  4CNK A;  3QSM A;  2YR5 A;  5EOW A;  1PHH A;  3SZ0 A;  2ACZ A;  3B3R A;  3NYF A;  2V60 A;  2WP6 A;  4BK2 A;  5KXJ A;  3P4S A;  3PS9 A;  4GDE A;  2GAH B;  2GH5 A;  4USQ A;  1PBD A;  4OPL A;  2ZZ0 A;  2JB2 A;  1Y0P A;  4BUR A;  3RP8 A;  4EMI A;  1CHU A;  1F8W A;  2C3C A;  3H4K A;  3DJE A;  1GV4 A;  4E0V A;  1L9E A;  3GYX A;  3LAD A;  4JNQ A;  1VRQ B;  4IV9 A;  1IUS A;  4NTE A;  5M0Z A;  2XFN A;  4AP3 A;  3SQP A;  3ALL A;  3KA7 A;  1N4V A;  3CGC A;  1KFY A;  4EQW A;  3P9U A;  2BS2 A;  1ZY8 A;  1PJ5 A;  4U8L A;  1LQT A;  2V3B A;  4AOS A;  5JCI A;  3ATQ A;  3P4R A;  5U25 A;  3UP5 A;  4EIP A;  4FX9 A;  4G6G A;  4UDQ A;  4U2T A;  2XVH A;  1BKW A;  3O0H A;  3F8D A;  2GQF A;  3BHF A;  2V3A A;  3T0K A;  2YLW A;  3M13 A;  4H4V A;  4CCQ A;  4XXG A;  4GAV A;  1CJC A;  5CQF A;  2TPR A;  3JSK A;  4Z44 A;  3RHA A;  4TM0 A;  4YXD A;  2OLN A;  3BI5 A;  2Q0L A;  3GWF A;  2VRM A;  2QA2 A;  3UKF A;  2WOV A;  2H88 A;  4TM4 A;  3T14 A;  3ABV A;  2BCP A;  1GSN A;  2Q0K A;  3C4N A;  5U63 A;  1L9D A;  4Z43 A;  3H8L A;  2YM1 A;  1KDG A;  1PS9 A;  4IVO B;  2Z5Y A;  2ZZC A;  3KPF A;  3DGZ A;  1YQZ A;  3GSI A;  3RP7 A;  1DOB A;  2FJA A;  2A8X A;  3Q6J A;  3S61 A;  2GMJ A;  1GAL A;  3AEC A;  3AE1 A;  3EF6 A;  3L8K A;  5KMQ A;  2E5V A;  1GRG A;  2FJE A;  2NPX A;  4P9S A;  2DKI A;  3UKL A;  4APN A;  1JNR A;  4N9X A;  2XVF A;  4H4Q A;  1KSU A;  2EQ8 A;  2BC1 A;  1CC6 A;  3D8X A;  4CNJ A;  3QJ4 A;  4OPU A;  2R9Z A;  3AE3 A;  2Y6R A;  2WOI A;  5BUL A;  1XAN A;  2YG7 A;  2YQU A;  2YLX A;  4U8O A;  4G73 A;  5FMH A;  1GTE A;  4H4W A;  4H4R A;  3GRT A;  3KD9 A;  3UTH A;  1PBE A;  2QCU A;  3UTE A;  3BNU A;  4GUV A;  1CL0 A;  4H50 A;  2XCG A;  4LA1 A;  3V3O A;  4EQR A;  4JY2 A;  1E6E A;  4CBQ A;  3KPK A;  4J31 A;  1F3P A;  3UTF A;  1BGJ A;  1X31 B;  1H83 A;  2NVK X;  4Z25 A;  3SZF A;  2OLO A;  5LV9 A;  4NWZ A;  1SEZ A;  3EAN A;  5U1O A;  4UP3 A;  4YT0 A;  2O9Z A;  3CGB A;  1GER A;  2FJB A;  3CNT A;  2C70 A;  5M10 A;  1K0L A;  1TDO A;  2OAM A;  1ZDL A;  3NKS A;  1N4W A;  3HYX A;  4K7Z A;  3CNJ A;  5KOX A;  4IVM B;  1NEK A;  4LU6 A;  2ZBW A;  3LOV A;  4NEW A;  4WX1 A;  1FCD A;  4B1B A;  1V59 A;  4I58 A;  1PJ6 A;  2GR1 A;  3RP6 A;  1PDH A;  1PBF A;  2VVL A;  1W4X A;  3VR9 A;  1ZOV A;  1GRH A;  1TDF A;  3KU9 A;  4H4T A;  1JRX A;  1OJC A;  4NZH A;  2ARD A;  5BRT A;  3VQR A;  1E1N A;  1OJA A;  2YLZ A;  1ZP0 A;  4OPG A;  1L0V A;  3V76 A;  2C4C A;  1CJ4 A;  4CCR A;  2X8G A;  3DME A;  4A9W A;  3UKA A;  1IUV A;  1EL9 A;  2GV8 A;  2WU2 A;  3CGE A;  4YTP A;  5HY5 A;  3AEA A;  3NIX A;  3CPI G;  1OJ9 A;  4PAB A;  4ECH A;  2E4G A;  4Z26 A;  3NTA A;  1VQW A;  3P1W A;  1NG4 A;  3CMM A;  4G6H A;  3CN8 A;  1PXB A;  4RSL A;  4JQ9 A;  3GMB A;  3QVP A;  2CFY A;  4OPI A;  4B63 A;  4H4Z A;  3L1R A;  2BS3 A;  4OPD A;  4J2W A;  2B9W A;  3LZW A;  2V61 A;  4Y4L A;  3UOV A;  3ALJ A;  4EMW A;  4FK1 C;  1H7X A;  2WEU A;  3WE0 A;  4Y4M A;  1LV0 A;  1K4Q A;  5FS8 A;  2BRY A;  3LXD A;  2GQW A;  1Z6L A;  4K2X A;  1RP0 A;  3UKQ A;  4C74 A;  2JB3 A;  4J34 A;  4BK1 A;  4CY6 A;  2WBA A;  3AE5 A;  1NHP A;  1KNR A;  3NN6 X;  3AB1 A;  4XWR A;  4BJY A;  3VRA A;  3AWI A;  5BUK A;  1FEC A;  2XVJ A;  5KRQ A;  3QVR A;  3COX A;  3AE6 A;  3LB8 A;  3FBS A;  2YVJ A;  3GD4 A;  2GRT A;  3NYC A;  1PN0 A;  2VRL A;  3VR8 A;  1MOK A;  2YLS A;  4H2Q A;  4U8K A;  5HXI A;  1XPQ A;  2VQ7 A;  4IA6 A;  1IUX A;  2C67 A;  2WPF A;  3C96 A;  2B7S A;  4J56 A;  1CC2 A;  1D7L A;  2OA1 A;  3K30 A;  4HB9 A;  1TDK A;  2C72 A;  4GF7 A;  4WCT A;  2YG4 A;  2H89 A;  2C64 A;  2J3N A;  1NG3 A;  1S2Y A;  2X8H A;  3AD7 B;  3BI2 A;  3DJD A;  3NGC X;  4PAA A;  3NRN A;  1NHS A;  1ONF A;  2XFO A;  4CRT A;  5IQ4 A;  3CPH G;  2XFP A;  2VOU A;  3AD9 B;  1ZOY A;  1H81 A;  3GWD A;  2YVG A;  1N1P A;  4O5U A;  4YTM A;  3NK1 X;  1B4V A;  3AE8 A;  2TMD A;  4YKF A;  1F8R A;  4A6N A;  1IJH A;  4EQX A;  1GRF A;  3UTG A;  1EL5 A;  2WQY A;  5C2T A;  1CJ3 A;  3ZDN A;  1K0J A;  1S3B A;  3SX6 A;  1D4E A;  3UKK A;  1JU2 A;  4ICY A;  1GRA A;  2IID A;  2APG A;  4H7U A;  3DH9 A;  4CY8 A;  1D4C A;  3DK8 A;  4B66 A;  3AEF A;  4GCM A;  3SFE A;  3VRD B;  4JNA A;  1GEU A;  3QSE A;  4J33 A;  3QSS A;  5DBJ A;  3SY4 A;  4GAP A;  2YLR A;  3FMW A;  3CND A;  2C65 A;  2YG5 A;  3T2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...