5KMSA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 2.5 angstrom resolution.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
394
structure length
394
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 117
structure length 394
sequence length 394
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmsA00
3SYIA 5KMSA 5KMPA 4GAVA 3SZFA 3HYVA 4G73A 3HYWA 3SZCA 3T0KA 5KMQA 4G6HA 4NWZA 4G6GA 5KMRA 3T2ZA 3T14A 3KPKA 3SZ0A 4GAPA 3SZWA 3T31A 3SX6A 4G74A 3T2KA 3SXIA 3T2YA 3HYXA 4G9KA 3SY4A
chains in the Genus database with same CATH superfamily
1MOKA 3H8LA 4A6NB 1Z6LA 1JU2A 3O0HA 1FECA 1GTHA 1SEZA 1JNZA 2AAQA 1NAAA 2BABA 2Q7VA 3NYCA 4TM0A 2YLSA 3SZFA 4C77A 3NGCX 1GETA 2Q0KA 3BNMA 1E39A 3RP6A 4NWZA 2J3NA 4BJYA 1KNPA 2XCGA 4C3XA 4JY3A 1DJNA 2E4GA 3UKPA 2W0HA 2AQJA 2I0ZA 3DH9A 3C4NA 1E7PA 3UOZA 1N4VA 2E5VA 2GMJA 1BGJA 4H50A 2GR2A 1YY5A 3FG2P 4Y4MA 4GF7A 2DKHA 4G9KA 3QJ4A 4Z44A 4XXGA 1CC6A 2C65A 3NK2X 4OPUA 4H2PA 3AE7A 1FOHA 3AE5A 3GWFA 1Y56B 3NN6X 4D03A 3RNMA 1L9CA 1LPFA 1RSGA 1TDNA 2BC1A 2Q0LA 3CN8A 3NYEA 2TPRA 1EL8A 3P4QA 4WCTA 2C66A 3CMMA 2CDUA 3G5RA 1PDHA 4I58A 3BI5A 2XFNA 1V59A 1E1MA 1DNCA 2C67A 3SZ0A 1L9DA 4CY8A 5IPYA 4FX9A 4UP3A 3V76A 2XVJA 4GCMA 4FDCB 5BULA 1PBFA 1NENA 2WDVA 3LB8A 4YT0A 4UDPA 3T31A 1KSUA 3G5SA 2B76A 4B69A 4CNKA 3P9UA 5EB4A 3ZDNA 4U2SA 2XVFA 1RYIA 3VRBA 4H2QA 1IUVA 3CGEA 3AEFA 4EM3A 1DOBA 3ICRA 2R4EA 2IIDA 2UZZA 2ZZ0A 3CPIG 3Q9TA 2YG4A 2B7RA 3SZCA 2CVJA 3UOXA 2B9XA 2GR1A 5KVHA 2WEUA 1F3PA 4G6GA 3FIMB 2VZ2A 1P2EA 5KMRA 5C3JA 3BI2A 2JKCA 2BXRA 2QAEA 1E1LA 4TM4A 1TDFA 3KPKA 3R9UA 4AP3A 4YSZA 4YTNA 2C75A 1PXCA 3E1TA 4H2NA 4I59A 3IHGA 4GAPA 1KF6A 1NPXA 5FMHA 3D8XA 4ZN0A 2XVHA 4G74A 3RHAA 3PS9A 2OLOA 3ATRA 5J7XA 2R46A 3ICSA 2R0PA 3NTAA 1PBDA 1F8SA 1O95A 1HYUA 2GF3A 3IHMA 3NLCA 4H4PA 3GDPA 3SGLA 2X8CA 1UKVG 5CQFA 4CRTA 4B68A 4M52A 4EQSA 4JY2A 2BK5A 2WOWA 3DJDA 4A7AA 1OJCA 3NHOX 2EQ7A 1YQ4A 3AEDA 5BUKA 1BF3A 4G73A 2WS3A 3LJPA 4RG4A 4YTMA 5KMQA 4JQ9A 2BK3A 2FJEA 3AB1A 2WBAA 4PAAA 5KRQA 5ER0A 2YLZA 5L46A 3LOVA 2Z5XA 3UKFA 4FK1A 2VOUA 3AD8B 4IA6A 4Z25A 2C72A 2V3AA 4IVMB 4XWZA 4OPLA 5CKUA 3ATQA 1NHPA 3UKKA 2Q6UA 4ADWA 3UTGA 2BCGG 4OPDA 4K5SA 3AE2A 1IUXA 1GT8A 4GDPA 1OJ9A 2WESA 1GPEA 1ZDLA 1TDOA 4A6NA 1N4UA 1KSSA 1GRFA 2Y6RA 4AOXA 3LZXA 3UP4A 1ZMCA 1EL7A 1XANA 3F8DA 1OJAA 1N1PA 3NYFA 2BXSA 3CNTA 4B63A 1IUSA 2GV8A 2QCUA 2ZZBA 3RP8A 2C64A 2VQ7A 2TMDA 4USRA 1ZMDA 3D1CA 1FL2A 3CNJA 3SZWA 2A89A 2FBWA 1ZOYA 1NG3A 3UP5A 3LADA 2XLTA 2XVEA 2GMHA 2VQBA 2VRMA 3S61A 1S3BA 3UTFA 3II4A 3KKJA 1L9EA 2XLUA 3SQPA 5JCLA 2C3DA 3AE8A 2JK6A 3GYXA 1H7WA 2RGOA 5KOXA 2WPEA 1Y56A 1CHUA 1NG4A 2WOIA 2YR5A 1LQTA 1TDKA 2F5ZA 1PN0A 1F6MA 3T37A 1ONFA 1PHHA 2GQFA 1LVLA 2X50A 4B66A 4JDRA 4EQWA 5JCNA 1L0VA 3VRAA 4PABA 4AT2A 2YVJA 3DA1A 3SFDA 4H4VA 4H4YA 2V5ZA 1B5QA 4DSHA 4YWOA 5HYMA 2IVEA 1CC4A 4GDEA 1FEAA 4U2TA 1GNDA 2YG3A 4Z2UA 1COYA 4J57A 4LIIA 4BK2A 1O94A 4H4XA 4MJWA 5EBKA 4UDQA 4NEWA 5M10A 3NTDA 3K7MX 5KVIA 2GVCA 4U8JA 4XWRA 2JB1A 3BHKA 5FS6A 4YSHA 3IC9A 4OPTA 4TLXA 1H82A 3HYWA 2VRLA 2WOVA 2WP6A 3KLJA 3QFBA 1FEBA 2E1MA 4C74A 1D4EA 4H4QA 3CNDA 4UDRA 4ZCDA 3DK8A 3GYIA 2HQMA 3NK1X 1Q9IA 2WP5A 2A87A 2GEWA 3PVCA 1YKJA 2YVFA 3FBSA 4NTDA 3T2YA 3AXBA 3EAOA 3K7QX 4K8DA 4IVOB 3OC4A 4OPCA 3VRDB 2R45A 2PHHA 2R9ZA 2YR4A 4J31A 3M12A 2NVKX 1JOAA 2WU5A 5KMSA 4A79A 1X31B 2XFQA 2XLSA 1EL9A 3UKLA 2C3CA 4E0VA 1GRGA 2EQ8A 1NHSA 3UTHA 5JCIA 2APGA 1PJ7A 2GAHB 4P9SA 3H4KA 2YG7A 4B1BA 1TRBA 3IF9A 3NIXA 4K22A 3KD9A 1B37A 1K0JA 4N9XA 4REKA 2B7SA 5HXIA 5J60A 1Y0PA 4C5OA 2BYBA 3GRTA 4IA5A 4TM3A 1DOCA 1KDGA 1YQZA 1H86A 2JBVA 3GDNA 2R4JA 3ITJA 2ZBWA 2H89A 3GD3A 3GRSA 4DGKA 2VVLG 5BVAA 1GREA 2BS4A 3CGDA 3ICTA 4X9NA 1OJTA 2R0CA 3B6DA 4YSYA 2IVDA 3ISHA 5LV9A 3CTYA 3C4AA 1PS9A 1PBBA 4DNAA 5BRTA 3AD9B 2ZZCA 2YLXA 4A65A 1RP0A 2YG5A 1ZOVA 2YVGA 4K5RA 4TLZA 1GV4A 2YQUA 4YKGA 1XHCA 4H4SA 1M64A 3AEAA 3OZ2A 4YSXA 4LA1A 2C4CA 3Q6JA 4OCGA 2XDOA 1NHQA 4EQXA 3KA7A 4JNAA 2BS2A 1GTEA 1D4DA 4NNJA 1K4QA 2JB2A 4O5UA 3ABVA 3M13A 5U63A 3S5WA 3UKQA 4EMWA 5DBJA 1PXBA 2Y6QA 3DGZA 1NHRA 4U8OA 2BACA 4U8IA 4KPRA 2RABA 3DK4A 4ZCCA 2YM2A 2BCPA 3CPHG 1E6EA 4Y4LA 4D04A 4EQRA 3CPJG 1VG9A 3AE4A 4B65A 5JCMA 1GALA 2XVIA 5FS9A 1CJ3A 2YG6A 3FMWA 1N4WA 4JNQA 4DSGA 3SFEA 4IV9A 3SYIA 4BJZA 2X8GA 3CNPA 3GMBA 1JEHA 3ALLA 3P4RA 1H83A 3VQRA 4C3YA 4CBQA 3AEGA 2V61A 4Z43A 1S3EA 3AEEA 1CBOA 2PYXA 1GERA 3T2ZA 2RGJA 2V60A 1VRQB 3GD4A 3NKSA 1LQUA 4YXDA 3BI4A 3CGCA 1W4XA 2R0GA 3GWDA 3NK0X 3ADAB 4J2WA 2OALA 2WPCA 2WP9A 3GYJA 4RSLA 4J56A 1KFYA 3T2KA 3SXIA 2WDQA 3HYXA 1IUTA 1GRBA 1VG0A 2QA1A 3UOYA 4K7ZA 1P2HA 3CGBA 4EMIA 2FJDA 4X4JA 1O5WA 3UKHA 1TYPA 4LU6A 3FPZA 5KMPA 2V6OA 3QSEA 4B67A 3QVPA 5EB5A 3UCLA 1MO9A 1ZK7A 3QVRA 2C76A 4GRTA 1GEUA 1LTXR 2QA2A 2XFOA 4AP1A 2YLRA 4NZHA 3I3LA 3AE1A 4AT0A 3LXDA 4A5LA 1PJ5A 3BHFA 4II2A 1B4VA 3DMEA 4FK1C 5KNLA 3K30A 1IJHA 2GQWA 4CNJA 2GH5A 1NEKA 3SY4A 1OJDA 2XLRA 5KOWA 1D7LA 3P4SA 3EF6A 1DOEA 1E1NA 1PJ6A 3AWIA 3KVEA 5U25A 2YLTA 1CJCA 1Q1RA 4U8LA 3REDA 4Z24A 3ALMA 2YAUA 3KPFA 2GRTA 5HHFA 4Z2RA 1FCDA 4J36A 3DK9A 3WE0A 2JB3A 2XFPA 1GOSA 2GR0A 3AYJA 3B3RA 5C2TA 4CCRA 1GESA 2EQ6A 1K0LA 1BKWA 1ZY8A 2VVMA 3AEBA 3CNSA 4O5QA 5M0ZA 3T14A 1EL5A 3NRNA 1ZKQA 1IUUA 1PBCA 3L1RA 3PO7A 4J33A 1YQ3A 1REOA 3DJJA 1IUWA 4GR1A 1CL0A 2BS3A 2OAMA 3AE3A 2FJAA 2VVLA 3SX6A 2EQ9A 1F8RA 2RGHA 2YLWA 3DGHA 4U8KA 4Z2TA 2OA1A 4EMJA 3QSSA 1JRYA 4H4RA 1XPQA 1H81A 2OLNA 3UTEA 4H2RA 1DODA 3AE6A 5IQ1A 2NPXA 4BURA 1GRAA 4NTEA 4EIQA 4KX6A 2BC0A 1XDIA 2YWLA 5GRTA 1QJDA 3P4PA 2X99A 3T0KA 3LZWA 1EBDA 4G6HA 4USQA 1KNRA 2C70A 3HZLA 3QFAA 2BRYA 3VR9A 1QO8A 1F8WA 4J34A 3V3OA 4RG3A 2V3BA 3H8IA 3JSKA 3P1WA 4APNA 3M0OA 2BA9A 4GUVA 3I6DA 4H4ZA 2XYOA 3AE9A 3L8KA 1ZP0A 2WDRA 2B9YA 1S2QA 2A8XA 3C96A 4H4WA 1GSNA 1H84A 4BK3A 3HYVA 5JCKA 2YR6A 2BRAA 4BK1A 5KXJA 2C7GA 4NTCA 4B64A 3F8RA 3RP7A 3AYLA 4A99A 1CF3A 1TYTA 4H4UA 1CJ4A 1NDAA 4Z26A 1TDEA 4H4TA 3URHA 1M6IA 4JN9A 1VQWA 3NT6A 1BZLA 2WU2A 3IWAA 2XLPA 4X9MA 2ACZA 1D4CA 3CIRA 2CULA 4OVIA 2X8HA 1MXTA 4EIPA 2X3NA 2AR8A 4H7UA 4U8NA 1K0IA 4ICYA 3EANA 2H88A 2WPFA 1H7XA 2ARDA 1PBEA 4YTPA 3K7TA 1PXAA 4HA6A 2WHDA 5TR3A 3ZYXA 1JRZA 4EM4A 1QLBA 5GSNA 5FS7A 2XFUA 2GB0A 4II3A 1DJQA 1CJ2A 4A9WA 4OPGA 4WX1A 3F8PA 1ZX9A 4BV6A 4ECHA 1ELIA 3QSMA 5IQ4A 4U8PA 3NNEA 1BWCA 3COXA 3VR8A 3ALJA 4TM1A 4HB9A 3NH3X 2JAEA 3V3NA 3BNUA 1AOGA 1LJ1A 3NG7X 1BGNA 4AOSA 2DKIA 3EPTA 3AYIA 2YM1A 2B9WA 1CC2A 1B8SA 2C73A 5FS8A 3GSIA 3KU9A 4GAVA 4U8MA 3GMCA 4U2LA 5U1OA 3UOVA 2GR3A 3AECA 4K2XA 1JRXA 4CY6A 2Z5YA 2BK4A 1GRHA 1LV0A 1S2YA 1GRTA 1JNRA 2CFYA 2GAGB 4OPIA 4YKFA 4Y4NA 3NN0X 2FJBA 1DXLA 1H6VA 5EOWA 1D7YA 3G5QA 1D5TA 5KWFA 1Q1WA 3DJEA 3SM8A 2WETA 5HY5A 1VDCA 1GXFA 3DJGX 3AD7B 2O9ZA 2WQYA 3UKAA 4NEVA 1E1KA 4CCQA
chains in the Genus database with same CATH topology
1MOKA 3H8LA 4A6NB 1Z6LA 1JU2A 3O0HA 1FECA 1GTHA 1SEZA 1JNZA 2AAQA 1NAAA 2BABA 2Q7VA 3NYCA 4TM0A 2YLSA 3SZFA 4C77A 3NGCX 1GETA 2Q0KA 3BNMA 1E39A 3RP6A 4NWZA 2J3NA 4BJYA 1KNPA 2XCGA 4C3XA 4JY3A 1DJNA 2E4GA 3UKPA 2W0HA 2AQJA 2I0ZA 3DH9A 3C4NA 1E7PA 3UOZA 1N4VA 2E5VA 2GMJA 1BGJA 4H50A 2GR2A 1YY5A 3FG2P 4Y4MA 4GF7A 2DKHA 4G9KA 3QJ4A 4Z44A 4XXGA 1CC6A 2C65A 3NK2X 4OPUA 4H2PA 3AE7A 1FOHA 3AE5A 3GWFA 1Y56B 3NN6X 4D03A 3RNMA 1L9CA 1LPFA 1RSGA 1TDNA 2BC1A 2Q0LA 3CN8A 3NYEA 2TPRA 1EL8A 3P4QA 4WCTA 2C66A 3CMMA 2CDUA 3G5RA 1PDHA 4I58A 3BI5A 2XFNA 1V59A 1E1MA 1DNCA 2C67A 3SZ0A 1L9DA 4CY8A 5IPYA 4FX9A 4UP3A 3V76A 2XVJA 4GCMA 4FDCB 5BULA 1PBFA 1NENA 2WDVA 3LB8A 4YT0A 4UDPA 3T31A 1KSUA 3G5SA 2B76A 4B69A 4CNKA 3P9UA 5EB4A 3ZDNA 4U2SA 2XVFA 1RYIA 3VRBA 4H2QA 1IUVA 3CGEA 3AEFA 4EM3A 1DOBA 3ICRA 2R4EA 2IIDA 2UZZA 2ZZ0A 3CPIG 3Q9TA 2YG4A 2B7RA 3SZCA 2CVJA 3UOXA 2B9XA 2GR1A 5KVHA 2WEUA 1F3PA 4G6GA 3FIMB 2VZ2A 1P2EA 5KMRA 5C3JA 3BI2A 2JKCA 2BXRA 2QAEA 1E1LA 4TM4A 1TDFA 3KPKA 3R9UA 4AP3A 4YSZA 4YTNA 2C75A 1PXCA 3E1TA 4H2NA 4I59A 3IHGA 4GAPA 1KF6A 1NPXA 5FMHA 3D8XA 4ZN0A 2XVHA 4G74A 3RHAA 3PS9A 2OLOA 3ATRA 5J7XA 2R46A 3ICSA 2R0PA 3NTAA 1PBDA 1F8SA 1O95A 1HYUA 2GF3A 3IHMA 3NLCA 4H4PA 3GDPA 3SGLA 2X8CA 1UKVG 5CQFA 4CRTA 4B68A 4M52A 4EQSA 4JY2A 2BK5A 2WOWA 3DJDA 4A7AA 1OJCA 3NHOX 2EQ7A 1YQ4A 3AEDA 5BUKA 1BF3A 4G73A 2WS3A 3LJPA 4RG4A 4YTMA 5KMQA 4JQ9A 2BK3A 2FJEA 3AB1A 2WBAA 4PAAA 5KRQA 5ER0A 2YLZA 5L46A 3LOVA 2Z5XA 3UKFA 4FK1A 2VOUA 3AD8B 4IA6A 4Z25A 2C72A 2V3AA 4IVMB 4XWZA 4OPLA 5CKUA 3ATQA 1NHPA 3UKKA 2Q6UA 4ADWA 3UTGA 2BCGG 4OPDA 4K5SA 3AE2A 1IUXA 1GT8A 4GDPA 1OJ9A 2WESA 1GPEA 1ZDLA 1TDOA 4A6NA 1N4UA 1KSSA 1GRFA 2Y6RA 4AOXA 3LZXA 3UP4A 1ZMCA 1EL7A 1XANA 3F8DA 1OJAA 1N1PA 3NYFA 2BXSA 3CNTA 4B63A 1IUSA 2GV8A 2QCUA 2ZZBA 3RP8A 2C64A 2VQ7A 2TMDA 4USRA 1ZMDA 3D1CA 1FL2A 3CNJA 3SZWA 2A89A 2FBWA 1ZOYA 1NG3A 3UP5A 3LADA 2XLTA 2XVEA 2GMHA 2VQBA 2VRMA 3S61A 1S3BA 3UTFA 3II4A 3KKJA 1L9EA 2XLUA 3SQPA 5JCLA 2C3DA 3AE8A 2JK6A 3GYXA 1H7WA 2RGOA 5KOXA 2WPEA 1Y56A 1CHUA 1NG4A 2WOIA 2YR5A 1LQTA 1TDKA 2F5ZA 1PN0A 1F6MA 3T37A 1ONFA 1PHHA 2GQFA 1LVLA 2X50A 4B66A 4JDRA 4EQWA 5JCNA 1L0VA 3VRAA 4PABA 4AT2A 2YVJA 3DA1A 3SFDA 4H4VA 4H4YA 2V5ZA 1B5QA 4DSHA 4YWOA 5HYMA 2IVEA 1CC4A 4GDEA 1FEAA 4U2TA 1GNDA 2YG3A 4Z2UA 1COYA 4J57A 4LIIA 4BK2A 1O94A 4H4XA 4MJWA 5EBKA 4UDQA 4NEWA 5M10A 3NTDA 3K7MX 5KVIA 2GVCA 4U8JA 4XWRA 2JB1A 3BHKA 5FS6A 4YSHA 3IC9A 4OPTA 4TLXA 1H82A 3HYWA 2VRLA 2WOVA 2WP6A 3KLJA 3QFBA 1FEBA 2E1MA 4C74A 1D4EA 4H4QA 3CNDA 4UDRA 4ZCDA 3DK8A 3GYIA 2HQMA 3NK1X 1Q9IA 2WP5A 2A87A 2GEWA 3PVCA 1YKJA 2YVFA 3FBSA 4NTDA 3T2YA 3AXBA 3EAOA 3K7QX 4K8DA 4IVOB 3OC4A 4OPCA 3VRDB 2R45A 2PHHA 2R9ZA 2YR4A 4J31A 3M12A 2NVKX 1JOAA 2WU5A 5KMSA 4A79A 1X31B 2XFQA 2XLSA 1EL9A 3UKLA 2C3CA 4E0VA 1GRGA 2EQ8A 1NHSA 3UTHA 5JCIA 2APGA 1PJ7A 2GAHB 4P9SA 3H4KA 2YG7A 4B1BA 1TRBA 3IF9A 3NIXA 4K22A 3KD9A 1B37A 1K0JA 4N9XA 4REKA 2B7SA 5HXIA 5J60A 1Y0PA 4C5OA 2BYBA 3GRTA 4IA5A 4TM3A 1DOCA 1KDGA 1YQZA 1H86A 2JBVA 3GDNA 2R4JA 3ITJA 2ZBWA 2H89A 3GD3A 3GRSA 4DGKA 2VVLG 5BVAA 1GREA 2BS4A 3CGDA 3ICTA 4X9NA 1OJTA 2R0CA 3B6DA 4YSYA 2IVDA 3ISHA 5LV9A 3CTYA 3C4AA 1PS9A 1PBBA 4DNAA 5BRTA 3AD9B 2ZZCA 2YLXA 4A65A 1RP0A 2YG5A 1ZOVA 2YVGA 4K5RA 4TLZA 1GV4A 2YQUA 4YKGA 1XHCA 4H4SA 1M64A 3AEAA 3OZ2A 4YSXA 4LA1A 2C4CA 3Q6JA 4OCGA 2XDOA 1NHQA 4EQXA 3KA7A 4JNAA 2BS2A 1GTEA 1D4DA 4NNJA 1K4QA 2JB2A 4O5UA 3ABVA 3M13A 5U63A 3S5WA 3UKQA 4EMWA 5DBJA 1PXBA 2Y6QA 3DGZA 1NHRA 4U8OA 2BACA 4U8IA 4KPRA 2RABA 3DK4A 4ZCCA 2YM2A 2BCPA 3CPHG 1E6EA 4Y4LA 4D04A 4EQRA 3CPJG 1VG9A 3AE4A 4B65A 5JCMA 1GALA 2XVIA 5FS9A 1CJ3A 2YG6A 3FMWA 1N4WA 4JNQA 4DSGA 3SFEA 4IV9A 3SYIA 4BJZA 2X8GA 3CNPA 3GMBA 1JEHA 3ALLA 3P4RA 1H83A 3VQRA 4C3YA 4CBQA 3AEGA 2V61A 4Z43A 1S3EA 3AEEA 1CBOA 2PYXA 1GERA 3T2ZA 2RGJA 2V60A 1VRQB 3GD4A 3NKSA 1LQUA 4YXDA 3BI4A 3CGCA 1W4XA 2R0GA 3GWDA 3NK0X 3ADAB 4J2WA 2OALA 2WPCA 2WP9A 3GYJA 4RSLA 4J56A 1KFYA 3T2KA 3SXIA 2WDQA 3HYXA 1IUTA 1GRBA 1VG0A 2QA1A 3UOYA 4K7ZA 1P2HA 3CGBA 4EMIA 2FJDA 4X4JA 1O5WA 3UKHA 1TYPA 4LU6A 3FPZA 5KMPA 2V6OA 3QSEA 4B67A 3QVPA 5EB5A 3UCLA 1MO9A 1ZK7A 3QVRA 2C76A 4GRTA 1GEUA 1LTXR 2QA2A 2XFOA 4AP1A 2YLRA 4NZHA 3I3LA 3AE1A 4AT0A 3LXDA 4A5LA 1PJ5A 3BHFA 4II2A 1B4VA 3DMEA 4FK1C 5KNLA 3K30A 1IJHA 2GQWA 4CNJA 2GH5A 1NEKA 3SY4A 1OJDA 2XLRA 5KOWA 1D7LA 3P4SA 3EF6A 1DOEA 1E1NA 1PJ6A 3AWIA 3KVEA 5U25A 2YLTA 1CJCA 1Q1RA 4U8LA 3REDA 4Z24A 3ALMA 2YAUA 3KPFA 2GRTA 5HHFA 4Z2RA 1FCDA 4J36A 3DK9A 3WE0A 2JB3A 2XFPA 1GOSA 2GR0A 3AYJA 3B3RA 5C2TA 4CCRA 1GESA 2EQ6A 1K0LA 1BKWA 1ZY8A 2VVMA 3AEBA 3CNSA 4O5QA 5M0ZA 3T14A 1EL5A 3NRNA 1ZKQA 1IUUA 1PBCA 3L1RA 3PO7A 4J33A 1YQ3A 1REOA 3DJJA 1IUWA 4GR1A 1CL0A 2BS3A 2OAMA 3AE3A 2FJAA 2VVLA 3SX6A 2EQ9A 1F8RA 2RGHA 2YLWA 3DGHA 4U8KA 4Z2TA 2OA1A 4EMJA 3QSSA 1JRYA 4H4RA 1XPQA 1H81A 2OLNA 3UTEA 4H2RA 1DODA 3AE6A 5IQ1A 2NPXA 4BURA 1GRAA 4NTEA 4EIQA 4KX6A 2BC0A 1XDIA 2YWLA 5GRTA 1QJDA 3P4PA 2X99A 3T0KA 3LZWA 1EBDA 4G6HA 4USQA 1KNRA 2C70A 3HZLA 3QFAA 2BRYA 3VR9A 1QO8A 1F8WA 4J34A 3V3OA 4RG3A 2V3BA 3H8IA 3JSKA 3P1WA 4APNA 3M0OA 2BA9A 4GUVA 3I6DA 4H4ZA 2XYOA 3AE9A 3L8KA 1ZP0A 2WDRA 2B9YA 1S2QA 2A8XA 3C96A 4H4WA 1GSNA 1H84A 4BK3A 3HYVA 5JCKA 2YR6A 2BRAA 4BK1A 5KXJA 2C7GA 4NTCA 4B64A 3F8RA 3RP7A 3AYLA 4A99A 1CF3A 1TYTA 4H4UA 1CJ4A 1NDAA 4Z26A 1TDEA 4H4TA 3URHA 1M6IA 4JN9A 1VQWA 3NT6A 1BZLA 2WU2A 3IWAA 2XLPA 4X9MA 2ACZA 1D4CA 3CIRA 2CULA 4OVIA 2X8HA 1MXTA 4EIPA 2X3NA 2AR8A 4H7UA 4U8NA 1K0IA 4ICYA 3EANA 2H88A 2WPFA 1H7XA 2ARDA 1PBEA 4YTPA 3K7TA 1PXAA 4HA6A 2WHDA 5TR3A 3ZYXA 1JRZA 4EM4A 1QLBA 5GSNA 5FS7A 2XFUA 2GB0A 4II3A 1DJQA 1CJ2A 4A9WA 4OPGA 4WX1A 3F8PA 1ZX9A 4BV6A 4ECHA 1ELIA 3QSMA 5IQ4A 4U8PA 3NNEA 1BWCA 3COXA 3VR8A 3ALJA 4TM1A 4HB9A 3NH3X 2JAEA 3V3NA 3BNUA 1AOGA 1LJ1A 3NG7X 1BGNA 4AOSA 2DKIA 3EPTA 3AYIA 2YM1A 2B9WA 1CC2A 1B8SA 2C73A 5FS8A 3GSIA 3KU9A 4GAVA 4U8MA 3GMCA 4U2LA 5U1OA 3UOVA 2GR3A 3AECA 4K2XA 1JRXA 4CY6A 2Z5YA 2BK4A 1GRHA 1LV0A 1S2YA 1GRTA 1JNRA 2CFYA 2GAGB 4OPIA 4YKFA 4Y4NA 3NN0X 2FJBA 1DXLA 1H6VA 5EOWA 1D7YA 3G5QA 1D5TA 5KWFA 1Q1WA 3DJEA 3SM8A 2WETA 5HY5A 1VDCA 1GXFA 3DJGX 3AD7B 2O9ZA 2WQYA 3UKAA 4NEVA 1E1KA 4CCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYI A;  5KMS A;  5KMP A;  4GAV A;  3SZF A;  3HYV A;  4G73 A;  3HYW A;  3SZC A;  3T0K A;  5KMQ A;  4G6H A;  4NWZ A;  4G6G A;  5KMR A;  3T2Z A;  3T14 A;  3KPK A;  3SZ0 A;  4GAP A;  3SZW A;  3T31 A;  3SX6 A;  4G74 A;  3T2K A;  3SXI A;  3T2Y A;  3HYX A;  4G9K A;  3SY4 A; 
#chains in the Genus database with same CATH topology
 1MOK A;  3H8L A;  4A6N B;  1Z6L A;  1JU2 A;  3O0H A;  1FEC A;  1GTH A;  1SEZ A;  1JNZ A;  2AAQ A;  1NAA A;  2BAB A;  2Q7V A;  3NYC A;  4TM0 A;  2YLS A;  3SZF A;  4C77 A;  3NGC X;  1GET A;  2Q0K A;  3BNM A;  1E39 A;  3RP6 A;  4NWZ A;  2J3N A;  4BJY A;  1KNP A;  2XCG A;  4C3X A;  4JY3 A;  1DJN A;  2E4G A;  3UKP A;  2W0H A;  2AQJ A;  2I0Z A;  3DH9 A;  3C4N A;  1E7P A;  3UOZ A;  1N4V A;  2E5V A;  2GMJ A;  1BGJ A;  4H50 A;  2GR2 A;  1YY5 A;  3FG2 P;  4Y4M A;  4GF7 A;  2DKH A;  4G9K A;  3QJ4 A;  4Z44 A;  4XXG A;  1CC6 A;  2C65 A;  3NK2 X;  4OPU A;  4H2P A;  3AE7 A;  1FOH A;  3AE5 A;  3GWF A;  1Y56 B;  3NN6 X;  4D03 A;  3RNM A;  1L9C A;  1LPF A;  1RSG A;  1TDN A;  2BC1 A;  2Q0L A;  3CN8 A;  3NYE A;  2TPR A;  1EL8 A;  3P4Q A;  4WCT A;  2C66 A;  3CMM A;  2CDU A;  3G5R A;  1PDH A;  4I58 A;  3BI5 A;  2XFN A;  1V59 A;  1E1M A;  1DNC A;  2C67 A;  3SZ0 A;  1L9D A;  4CY8 A;  5IPY A;  4FX9 A;  4UP3 A;  3V76 A;  2XVJ A;  4GCM A;  4FDC B;  5BUL A;  1PBF A;  1NEN A;  2WDV A;  3LB8 A;  4YT0 A;  4UDP A;  3T31 A;  1KSU A;  3G5S A;  2B76 A;  4B69 A;  4CNK A;  3P9U A;  5EB4 A;  3ZDN A;  4U2S A;  2XVF A;  1RYI A;  3VRB A;  4H2Q A;  1IUV A;  3CGE A;  3AEF A;  4EM3 A;  1DOB A;  3ICR A;  2R4E A;  2IID A;  2UZZ A;  2ZZ0 A;  3CPI G;  3Q9T A;  2YG4 A;  2B7R A;  3SZC A;  2CVJ A;  3UOX A;  2B9X A;  2GR1 A;  5KVH A;  2WEU A;  1F3P A;  4G6G A;  3FIM B;  2VZ2 A;  1P2E A;  5KMR A;  5C3J A;  3BI2 A;  2JKC A;  2BXR A;  2QAE A;  1E1L A;  4TM4 A;  1TDF A;  3KPK A;  3R9U A;  4AP3 A;  4YSZ A;  4YTN A;  2C75 A;  1PXC A;  3E1T A;  4H2N A;  4I59 A;  3IHG A;  4GAP A;  1KF6 A;  1NPX A;  5FMH A;  3D8X A;  4ZN0 A;  2XVH A;  4G74 A;  3RHA A;  3PS9 A;  2OLO A;  3ATR A;  5J7X A;  2R46 A;  3ICS A;  2R0P A;  3NTA A;  1PBD A;  1F8S A;  1O95 A;  1HYU A;  2GF3 A;  3IHM A;  3NLC A;  4H4P A;  3GDP A;  3SGL A;  2X8C A;  1UKV G;  5CQF A;  4CRT A;  4B68 A;  4M52 A;  4EQS A;  4JY2 A;  2BK5 A;  2WOW A;  3DJD A;  4A7A A;  1OJC A;  3NHO X;  2EQ7 A;  1YQ4 A;  3AED A;  5BUK A;  1BF3 A;  4G73 A;  2WS3 A;  3LJP A;  4RG4 A;  4YTM A;  5KMQ A;  4JQ9 A;  2BK3 A;  2FJE A;  3AB1 A;  2WBA A;  4PAA A;  5KRQ A;  5ER0 A;  2YLZ A;  5L46 A;  3LOV A;  2Z5X A;  3UKF A;  4FK1 A;  2VOU A;  3AD8 B;  4IA6 A;  4Z25 A;  2C72 A;  2V3A A;  4IVM B;  4XWZ A;  4OPL A;  5CKU A;  3ATQ A;  1NHP A;  3UKK A;  2Q6U A;  4ADW A;  3UTG A;  2BCG G;  4OPD A;  4K5S A;  3AE2 A;  1IUX A;  1GT8 A;  4GDP A;  1OJ9 A;  2WES A;  1GPE A;  1ZDL A;  1TDO A;  4A6N A;  1N4U A;  1KSS A;  1GRF A;  2Y6R A;  4AOX A;  3LZX A;  3UP4 A;  1ZMC A;  1EL7 A;  1XAN A;  3F8D A;  1OJA A;  1N1P A;  3NYF A;  2BXS A;  3CNT A;  4B63 A;  1IUS A;  2GV8 A;  2QCU A;  2ZZB A;  3RP8 A;  2C64 A;  2VQ7 A;  2TMD A;  4USR A;  1ZMD A;  3D1C A;  1FL2 A;  3CNJ A;  3SZW A;  2A89 A;  2FBW A;  1ZOY A;  1NG3 A;  3UP5 A;  3LAD A;  2XLT A;  2XVE A;  2GMH A;  2VQB A;  2VRM A;  3S61 A;  1S3B A;  3UTF A;  3II4 A;  3KKJ A;  1L9E A;  2XLU A;  3SQP A;  5JCL A;  2C3D A;  3AE8 A;  2JK6 A;  3GYX A;  1H7W A;  2RGO A;  5KOX A;  2WPE A;  1Y56 A;  1CHU A;  1NG4 A;  2WOI A;  2YR5 A;  1LQT A;  1TDK A;  2F5Z A;  1PN0 A;  1F6M A;  3T37 A;  1ONF A;  1PHH A;  2GQF A;  1LVL A;  2X50 A;  4B66 A;  4JDR A;  4EQW A;  5JCN A;  1L0V A;  3VRA A;  4PAB A;  4AT2 A;  2YVJ A;  3DA1 A;  3SFD A;  4H4V A;  4H4Y A;  2V5Z A;  1B5Q A;  4DSH A;  4YWO A;  5HYM A;  2IVE A;  1CC4 A;  4GDE A;  1FEA A;  4U2T A;  1GND A;  2YG3 A;  4Z2U A;  1COY A;  4J57 A;  4LII A;  4BK2 A;  1O94 A;  4H4X A;  4MJW A;  5EBK A;  4UDQ A;  4NEW A;  5M10 A;  3NTD A;  3K7M X;  5KVI A;  2GVC A;  4U8J A;  4XWR A;  2JB1 A;  3BHK A;  5FS6 A;  4YSH A;  3IC9 A;  4OPT A;  4TLX A;  1H82 A;  3HYW A;  2VRL A;  2WOV A;  2WP6 A;  3KLJ A;  3QFB A;  1FEB A;  2E1M A;  4C74 A;  1D4E A;  4H4Q A;  3CND A;  4UDR A;  4ZCD A;  3DK8 A;  3GYI A;  2HQM A;  3NK1 X;  1Q9I A;  2WP5 A;  2A87 A;  2GEW A;  3PVC A;  1YKJ A;  2YVF A;  3FBS A;  4NTD A;  3T2Y A;  3AXB A;  3EAO A;  3K7Q X;  4K8D A;  4IVO B;  3OC4 A;  4OPC A;  3VRD B;  2R45 A;  2PHH A;  2R9Z A;  2YR4 A;  4J31 A;  3M12 A;  2NVK X;  1JOA A;  2WU5 A;  5KMS A;  4A79 A;  1X31 B;  2XFQ A;  2XLS A;  1EL9 A;  3UKL A;  2C3C A;  4E0V A;  1GRG A;  2EQ8 A;  1NHS A;  3UTH A;  5JCI A;  2APG A;  1PJ7 A;  2GAH B;  4P9S A;  3H4K A;  2YG7 A;  4B1B A;  1TRB A;  3IF9 A;  3NIX A;  4K22 A;  3KD9 A;  1B37 A;  1K0J A;  4N9X A;  4REK A;  2B7S A;  5HXI A;  5J60 A;  1Y0P A;  4C5O A;  2BYB A;  3GRT A;  4IA5 A;  4TM3 A;  1DOC A;  1KDG A;  1YQZ A;  1H86 A;  2JBV A;  3GDN A;  2R4J A;  3ITJ A;  2ZBW A;  2H89 A;  3GD3 A;  3GRS A;  4DGK A;  2VVL G;  5BVA A;  1GRE A;  2BS4 A;  3CGD A;  3ICT A;  4X9N A;  1OJT A;  2R0C A;  3B6D A;  4YSY A;  2IVD A;  3ISH A;  5LV9 A;  3CTY A;  3C4A A;  1PS9 A;  1PBB A;  4DNA A;  5BRT A;  3AD9 B;  2ZZC A;  2YLX A;  4A65 A;  1RP0 A;  2YG5 A;  1ZOV A;  2YVG A;  4K5R A;  4TLZ A;  1GV4 A;  2YQU A;  4YKG A;  1XHC A;  4H4S A;  1M64 A;  3AEA A;  3OZ2 A;  4YSX A;  4LA1 A;  2C4C A;  3Q6J A;  4OCG A;  2XDO A;  1NHQ A;  4EQX A;  3KA7 A;  4JNA A;  2BS2 A;  1GTE A;  1D4D A;  4NNJ A;  1K4Q A;  2JB2 A;  4O5U A;  3ABV A;  3M13 A;  5U63 A;  3S5W A;  3UKQ A;  4EMW A;  5DBJ A;  1PXB A;  2Y6Q A;  3DGZ A;  1NHR A;  4U8O A;  2BAC A;  4U8I A;  4KPR A;  2RAB A;  3DK4 A;  4ZCC A;  2YM2 A;  2BCP A;  3CPH G;  1E6E A;  4Y4L A;  4D04 A;  4EQR A;  3CPJ G;  1VG9 A;  3AE4 A;  4B65 A;  5JCM A;  1GAL A;  2XVI A;  5FS9 A;  1CJ3 A;  2YG6 A;  3FMW A;  1N4W A;  4JNQ A;  4DSG A;  3SFE A;  4IV9 A;  3SYI A;  4BJZ A;  2X8G A;  3CNP A;  3GMB A;  1JEH A;  3ALL A;  3P4R A;  1H83 A;  3VQR A;  4C3Y A;  4CBQ A;  3AEG A;  2V61 A;  4Z43 A;  1S3E A;  3AEE A;  1CBO A;  2PYX A;  1GER A;  3T2Z A;  2RGJ A;  2V60 A;  1VRQ B;  3GD4 A;  3NKS A;  1LQU A;  4YXD A;  3BI4 A;  3CGC A;  1W4X A;  2R0G A;  3GWD A;  3NK0 X;  3ADA B;  4J2W A;  2OAL A;  2WPC A;  2WP9 A;  3GYJ A;  4RSL A;  4J56 A;  1KFY A;  3T2K A;  3SXI A;  2WDQ A;  3HYX A;  1IUT A;  1GRB A;  1VG0 A;  2QA1 A;  3UOY A;  4K7Z A;  1P2H A;  3CGB A;  4EMI A;  2FJD A;  4X4J A;  1O5W A;  3UKH A;  1TYP A;  4LU6 A;  3FPZ A;  5KMP A;  2V6O A;  3QSE A;  4B67 A;  3QVP A;  5EB5 A;  3UCL A;  1MO9 A;  1ZK7 A;  3QVR A;  2C76 A;  4GRT A;  1GEU A;  1LTX R;  2QA2 A;  2XFO A;  4AP1 A;  2YLR A;  4NZH A;  3I3L A;  3AE1 A;  4AT0 A;  3LXD A;  4A5L A;  1PJ5 A;  3BHF A;  4II2 A;  1B4V A;  3DME A;  4FK1 C;  5KNL A;  3K30 A;  1IJH A;  2GQW A;  4CNJ A;  2GH5 A;  1NEK A;  3SY4 A;  1OJD A;  2XLR A;  5KOW A;  1D7L A;  3P4S A;  3EF6 A;  1DOE A;  1E1N A;  1PJ6 A;  3AWI A;  3KVE A;  5U25 A;  2YLT A;  1CJC A;  1Q1R A;  4U8L A;  3RED A;  4Z24 A;  3ALM A;  2YAU A;  3KPF A;  2GRT A;  5HHF A;  4Z2R A;  1FCD A;  4J36 A;  3DK9 A;  3WE0 A;  2JB3 A;  2XFP A;  1GOS A;  2GR0 A;  3AYJ A;  3B3R A;  5C2T A;  4CCR A;  1GES A;  2EQ6 A;  1K0L A;  1BKW A;  1ZY8 A;  2VVM A;  3AEB A;  3CNS A;  4O5Q A;  5M0Z A;  3T14 A;  1EL5 A;  3NRN A;  1ZKQ A;  1IUU A;  1PBC A;  3L1R A;  3PO7 A;  4J33 A;  1YQ3 A;  1REO A;  3DJJ A;  1IUW A;  4GR1 A;  1CL0 A;  2BS3 A;  2OAM A;  3AE3 A;  2FJA A;  2VVL A;  3SX6 A;  2EQ9 A;  1F8R A;  2RGH A;  2YLW A;  3DGH A;  4U8K A;  4Z2T A;  2OA1 A;  4EMJ A;  3QSS A;  1JRY A;  4H4R A;  1XPQ A;  1H81 A;  2OLN A;  3UTE A;  4H2R A;  1DOD A;  3AE6 A;  5IQ1 A;  2NPX A;  4BUR A;  1GRA A;  4NTE A;  4EIQ A;  4KX6 A;  2BC0 A;  1XDI A;  2YWL A;  5GRT A;  1QJD A;  3P4P A;  2X99 A;  3T0K A;  3LZW A;  1EBD A;  4G6H A;  4USQ A;  1KNR A;  2C70 A;  3HZL A;  3QFA A;  2BRY A;  3VR9 A;  1QO8 A;  1F8W A;  4J34 A;  3V3O A;  4RG3 A;  2V3B A;  3H8I A;  3JSK A;  3P1W A;  4APN A;  3M0O A;  2BA9 A;  4GUV A;  3I6D A;  4H4Z A;  2XYO A;  3AE9 A;  3L8K A;  1ZP0 A;  2WDR A;  2B9Y A;  1S2Q A;  2A8X A;  3C96 A;  4H4W A;  1GSN A;  1H84 A;  4BK3 A;  3HYV A;  5JCK A;  2YR6 A;  2BRA A;  4BK1 A;  5KXJ A;  2C7G A;  4NTC A;  4B64 A;  3F8R A;  3RP7 A;  3AYL A;  4A99 A;  1CF3 A;  1TYT A;  4H4U A;  1CJ4 A;  1NDA A;  4Z26 A;  1TDE A;  4H4T A;  3URH A;  1M6I A;  4JN9 A;  1VQW A;  3NT6 A;  1BZL A;  2WU2 A;  3IWA A;  2XLP A;  4X9M A;  2ACZ A;  1D4C A;  3CIR A;  2CUL A;  4OVI A;  2X8H A;  1MXT A;  4EIP A;  2X3N A;  2AR8 A;  4H7U A;  4U8N A;  1K0I A;  4ICY A;  3EAN A;  2H88 A;  2WPF A;  1H7X A;  2ARD A;  1PBE A;  4YTP A;  3K7T A;  1PXA A;  4HA6 A;  2WHD A;  5TR3 A;  3ZYX A;  1JRZ A;  4EM4 A;  1QLB A;  5GSN A;  5FS7 A;  2XFU A;  2GB0 A;  4II3 A;  1DJQ A;  1CJ2 A;  4A9W A;  4OPG A;  4WX1 A;  3F8P A;  1ZX9 A;  4BV6 A;  4ECH A;  1ELI A;  3QSM A;  5IQ4 A;  4U8P A;  3NNE A;  1BWC A;  3COX A;  3VR8 A;  3ALJ A;  4TM1 A;  4HB9 A;  3NH3 X;  2JAE A;  3V3N A;  3BNU A;  1AOG A;  1LJ1 A;  3NG7 X;  1BGN A;  4AOS A;  2DKI A;  3EPT A;  3AYI A;  2YM1 A;  2B9W A;  1CC2 A;  1B8S A;  2C73 A;  5FS8 A;  3GSI A;  3KU9 A;  4GAV A;  4U8M A;  3GMC A;  4U2L A;  5U1O A;  3UOV A;  2GR3 A;  3AEC A;  4K2X A;  1JRX A;  4CY6 A;  2Z5Y A;  2BK4 A;  1GRH A;  1LV0 A;  1S2Y A;  1GRT A;  1JNR A;  2CFY A;  2GAG B;  4OPI A;  4YKF A;  4Y4N A;  3NN0 X;  2FJB A;  1DXL A;  1H6V A;  5EOW A;  1D7Y A;  3G5Q A;  1D5T A;  5KWF A;  1Q1W A;  3DJE A;  3SM8 A;  2WET A;  5HY5 A;  1VDC A;  1GXF A;  3DJG X;  3AD7 B;  2O9Z A;  2WQY A;  3UKA A;  4NEV A;  1E1K A;  4CCQ A; 
#chains in the Genus database with same CATH homology
 1MOK A;  3H8L A;  4A6N B;  1Z6L A;  1JU2 A;  3O0H A;  1FEC A;  1GTH A;  1SEZ A;  1JNZ A;  2AAQ A;  1NAA A;  2BAB A;  2Q7V A;  3NYC A;  4TM0 A;  2YLS A;  3SZF A;  4C77 A;  3NGC X;  1GET A;  2Q0K A;  3BNM A;  1E39 A;  3RP6 A;  4NWZ A;  2J3N A;  4BJY A;  1KNP A;  2XCG A;  4C3X A;  4JY3 A;  1DJN A;  2E4G A;  3UKP A;  2W0H A;  2AQJ A;  2I0Z A;  3DH9 A;  3C4N A;  1E7P A;  3UOZ A;  1N4V A;  2E5V A;  2GMJ A;  1BGJ A;  4H50 A;  2GR2 A;  1YY5 A;  3FG2 P;  4Y4M A;  4GF7 A;  2DKH A;  4G9K A;  3QJ4 A;  4Z44 A;  4XXG A;  1CC6 A;  2C65 A;  3NK2 X;  4OPU A;  4H2P A;  3AE7 A;  1FOH A;  3AE5 A;  3GWF A;  1Y56 B;  3NN6 X;  4D03 A;  3RNM A;  1L9C A;  1LPF A;  1RSG A;  1TDN A;  2BC1 A;  2Q0L A;  3CN8 A;  3NYE A;  2TPR A;  1EL8 A;  3P4Q A;  4WCT A;  2C66 A;  3CMM A;  2CDU A;  3G5R A;  1PDH A;  4I58 A;  3BI5 A;  2XFN A;  1V59 A;  1E1M A;  1DNC A;  2C67 A;  3SZ0 A;  1L9D A;  4CY8 A;  5IPY A;  4FX9 A;  4UP3 A;  3V76 A;  2XVJ A;  4GCM A;  4FDC B;  5BUL A;  1PBF A;  1NEN A;  2WDV A;  3LB8 A;  4YT0 A;  4UDP A;  3T31 A;  1KSU A;  3G5S A;  2B76 A;  4B69 A;  4CNK A;  3P9U A;  5EB4 A;  3ZDN A;  4U2S A;  2XVF A;  1RYI A;  3VRB A;  4H2Q A;  1IUV A;  3CGE A;  3AEF A;  4EM3 A;  1DOB A;  3ICR A;  2R4E A;  2IID A;  2UZZ A;  2ZZ0 A;  3CPI G;  3Q9T A;  2YG4 A;  2B7R A;  3SZC A;  2CVJ A;  3UOX A;  2B9X A;  2GR1 A;  5KVH A;  2WEU A;  1F3P A;  4G6G A;  3FIM B;  2VZ2 A;  1P2E A;  5KMR A;  5C3J A;  3BI2 A;  2JKC A;  2BXR A;  2QAE A;  1E1L A;  4TM4 A;  1TDF A;  3KPK A;  3R9U A;  4AP3 A;  4YSZ A;  4YTN A;  2C75 A;  1PXC A;  3E1T A;  4H2N A;  4I59 A;  3IHG A;  4GAP A;  1KF6 A;  1NPX A;  5FMH A;  3D8X A;  4ZN0 A;  2XVH A;  4G74 A;  3RHA A;  3PS9 A;  2OLO A;  3ATR A;  5J7X A;  2R46 A;  3ICS A;  2R0P A;  3NTA A;  1PBD A;  1F8S A;  1O95 A;  1HYU A;  2GF3 A;  3IHM A;  3NLC A;  4H4P A;  3GDP A;  3SGL A;  2X8C A;  1UKV G;  5CQF A;  4CRT A;  4B68 A;  4M52 A;  4EQS A;  4JY2 A;  2BK5 A;  2WOW A;  3DJD A;  4A7A A;  1OJC A;  3NHO X;  2EQ7 A;  1YQ4 A;  3AED A;  5BUK A;  1BF3 A;  4G73 A;  2WS3 A;  3LJP A;  4RG4 A;  4YTM A;  5KMQ A;  4JQ9 A;  2BK3 A;  2FJE A;  3AB1 A;  2WBA A;  4PAA A;  5KRQ A;  5ER0 A;  2YLZ A;  5L46 A;  3LOV A;  2Z5X A;  3UKF A;  4FK1 A;  2VOU A;  3AD8 B;  4IA6 A;  4Z25 A;  2C72 A;  2V3A A;  4IVM B;  4XWZ A;  4OPL A;  5CKU A;  3ATQ A;  1NHP A;  3UKK A;  2Q6U A;  4ADW A;  3UTG A;  2BCG G;  4OPD A;  4K5S A;  3AE2 A;  1IUX A;  1GT8 A;  4GDP A;  1OJ9 A;  2WES A;  1GPE A;  1ZDL A;  1TDO A;  4A6N A;  1N4U A;  1KSS A;  1GRF A;  2Y6R A;  4AOX A;  3LZX A;  3UP4 A;  1ZMC A;  1EL7 A;  1XAN A;  3F8D A;  1OJA A;  1N1P A;  3NYF A;  2BXS A;  3CNT A;  4B63 A;  1IUS A;  2GV8 A;  2QCU A;  2ZZB A;  3RP8 A;  2C64 A;  2VQ7 A;  2TMD A;  4USR A;  1ZMD A;  3D1C A;  1FL2 A;  3CNJ A;  3SZW A;  2A89 A;  2FBW A;  1ZOY A;  1NG3 A;  3UP5 A;  3LAD A;  2XLT A;  2XVE A;  2GMH A;  2VQB A;  2VRM A;  3S61 A;  1S3B A;  3UTF A;  3II4 A;  3KKJ A;  1L9E A;  2XLU A;  3SQP A;  5JCL A;  2C3D A;  3AE8 A;  2JK6 A;  3GYX A;  1H7W A;  2RGO A;  5KOX A;  2WPE A;  1Y56 A;  1CHU A;  1NG4 A;  2WOI A;  2YR5 A;  1LQT A;  1TDK A;  2F5Z A;  1PN0 A;  1F6M A;  3T37 A;  1ONF A;  1PHH A;  2GQF A;  1LVL A;  2X50 A;  4B66 A;  4JDR A;  4EQW A;  5JCN A;  1L0V A;  3VRA A;  4PAB A;  4AT2 A;  2YVJ A;  3DA1 A;  3SFD A;  4H4V A;  4H4Y A;  2V5Z A;  1B5Q A;  4DSH A;  4YWO A;  5HYM A;  2IVE A;  1CC4 A;  4GDE A;  1FEA A;  4U2T A;  1GND A;  2YG3 A;  4Z2U A;  1COY A;  4J57 A;  4LII A;  4BK2 A;  1O94 A;  4H4X A;  4MJW A;  5EBK A;  4UDQ A;  4NEW A;  5M10 A;  3NTD A;  3K7M X;  5KVI A;  2GVC A;  4U8J A;  4XWR A;  2JB1 A;  3BHK A;  5FS6 A;  4YSH A;  3IC9 A;  4OPT A;  4TLX A;  1H82 A;  3HYW A;  2VRL A;  2WOV A;  2WP6 A;  3KLJ A;  3QFB A;  1FEB A;  2E1M A;  4C74 A;  1D4E A;  4H4Q A;  3CND A;  4UDR A;  4ZCD A;  3DK8 A;  3GYI A;  2HQM A;  3NK1 X;  1Q9I A;  2WP5 A;  2A87 A;  2GEW A;  3PVC A;  1YKJ A;  2YVF A;  3FBS A;  4NTD A;  3T2Y A;  3AXB A;  3EAO A;  3K7Q X;  4K8D A;  4IVO B;  3OC4 A;  4OPC A;  3VRD B;  2R45 A;  2PHH A;  2R9Z A;  2YR4 A;  4J31 A;  3M12 A;  2NVK X;  1JOA A;  2WU5 A;  5KMS A;  4A79 A;  1X31 B;  2XFQ A;  2XLS A;  1EL9 A;  3UKL A;  2C3C A;  4E0V A;  1GRG A;  2EQ8 A;  1NHS A;  3UTH A;  5JCI A;  2APG A;  1PJ7 A;  2GAH B;  4P9S A;  3H4K A;  2YG7 A;  4B1B A;  1TRB A;  3IF9 A;  3NIX A;  4K22 A;  3KD9 A;  1B37 A;  1K0J A;  4N9X A;  4REK A;  2B7S A;  5HXI A;  5J60 A;  1Y0P A;  4C5O A;  2BYB A;  3GRT A;  4IA5 A;  4TM3 A;  1DOC A;  1KDG A;  1YQZ A;  1H86 A;  2JBV A;  3GDN A;  2R4J A;  3ITJ A;  2ZBW A;  2H89 A;  3GD3 A;  3GRS A;  4DGK A;  2VVL G;  5BVA A;  1GRE A;  2BS4 A;  3CGD A;  3ICT A;  4X9N A;  1OJT A;  2R0C A;  3B6D A;  4YSY A;  2IVD A;  3ISH A;  5LV9 A;  3CTY A;  3C4A A;  1PS9 A;  1PBB A;  4DNA A;  5BRT A;  3AD9 B;  2ZZC A;  2YLX A;  4A65 A;  1RP0 A;  2YG5 A;  1ZOV A;  2YVG A;  4K5R A;  4TLZ A;  1GV4 A;  2YQU A;  4YKG A;  1XHC A;  4H4S A;  1M64 A;  3AEA A;  3OZ2 A;  4YSX A;  4LA1 A;  2C4C A;  3Q6J A;  4OCG A;  2XDO A;  1NHQ A;  4EQX A;  3KA7 A;  4JNA A;  2BS2 A;  1GTE A;  1D4D A;  4NNJ A;  1K4Q A;  2JB2 A;  4O5U A;  3ABV A;  3M13 A;  5U63 A;  3S5W A;  3UKQ A;  4EMW A;  5DBJ A;  1PXB A;  2Y6Q A;  3DGZ A;  1NHR A;  4U8O A;  2BAC A;  4U8I A;  4KPR A;  2RAB A;  3DK4 A;  4ZCC A;  2YM2 A;  2BCP A;  3CPH G;  1E6E A;  4Y4L A;  4D04 A;  4EQR A;  3CPJ G;  1VG9 A;  3AE4 A;  4B65 A;  5JCM A;  1GAL A;  2XVI A;  5FS9 A;  1CJ3 A;  2YG6 A;  3FMW A;  1N4W A;  4JNQ A;  4DSG A;  3SFE A;  4IV9 A;  3SYI A;  4BJZ A;  2X8G A;  3CNP A;  3GMB A;  1JEH A;  3ALL A;  3P4R A;  1H83 A;  3VQR A;  4C3Y A;  4CBQ A;  3AEG A;  2V61 A;  4Z43 A;  1S3E A;  3AEE A;  1CBO A;  2PYX A;  1GER A;  3T2Z A;  2RGJ A;  2V60 A;  1VRQ B;  3GD4 A;  3NKS A;  1LQU A;  4YXD A;  3BI4 A;  3CGC A;  1W4X A;  2R0G A;  3GWD A;  3NK0 X;  3ADA B;  4J2W A;  2OAL A;  2WPC A;  2WP9 A;  3GYJ A;  4RSL A;  4J56 A;  1KFY A;  3T2K A;  3SXI A;  2WDQ A;  3HYX A;  1IUT A;  1GRB A;  1VG0 A;  2QA1 A;  3UOY A;  4K7Z A;  1P2H A;  3CGB A;  4EMI A;  2FJD A;  4X4J A;  1O5W A;  3UKH A;  1TYP A;  4LU6 A;  3FPZ A;  5KMP A;  2V6O A;  3QSE A;  4B67 A;  3QVP A;  5EB5 A;  3UCL A;  1MO9 A;  1ZK7 A;  3QVR A;  2C76 A;  4GRT A;  1GEU A;  1LTX R;  2QA2 A;  2XFO A;  4AP1 A;  2YLR A;  4NZH A;  3I3L A;  3AE1 A;  4AT0 A;  3LXD A;  4A5L A;  1PJ5 A;  3BHF A;  4II2 A;  1B4V A;  3DME A;  4FK1 C;  5KNL A;  3K30 A;  1IJH A;  2GQW A;  4CNJ A;  2GH5 A;  1NEK A;  3SY4 A;  1OJD A;  2XLR A;  5KOW A;  1D7L A;  3P4S A;  3EF6 A;  1DOE A;  1E1N A;  1PJ6 A;  3AWI A;  3KVE A;  5U25 A;  2YLT A;  1CJC A;  1Q1R A;  4U8L A;  3RED A;  4Z24 A;  3ALM A;  2YAU A;  3KPF A;  2GRT A;  5HHF A;  4Z2R A;  1FCD A;  4J36 A;  3DK9 A;  3WE0 A;  2JB3 A;  2XFP A;  1GOS A;  2GR0 A;  3AYJ A;  3B3R A;  5C2T A;  4CCR A;  1GES A;  2EQ6 A;  1K0L A;  1BKW A;  1ZY8 A;  2VVM A;  3AEB A;  3CNS A;  4O5Q A;  5M0Z A;  3T14 A;  1EL5 A;  3NRN A;  1ZKQ A;  1IUU A;  1PBC A;  3L1R A;  3PO7 A;  4J33 A;  1YQ3 A;  1REO A;  3DJJ A;  1IUW A;  4GR1 A;  1CL0 A;  2BS3 A;  2OAM A;  3AE3 A;  2FJA A;  2VVL A;  3SX6 A;  2EQ9 A;  1F8R A;  2RGH A;  2YLW A;  3DGH A;  4U8K A;  4Z2T A;  2OA1 A;  4EMJ A;  3QSS A;  1JRY A;  4H4R A;  1XPQ A;  1H81 A;  2OLN A;  3UTE A;  4H2R A;  1DOD A;  3AE6 A;  5IQ1 A;  2NPX A;  4BUR A;  1GRA A;  4NTE A;  4EIQ A;  4KX6 A;  2BC0 A;  1XDI A;  2YWL A;  5GRT A;  1QJD A;  3P4P A;  2X99 A;  3T0K A;  3LZW A;  1EBD A;  4G6H A;  4USQ A;  1KNR A;  2C70 A;  3HZL A;  3QFA A;  2BRY A;  3VR9 A;  1QO8 A;  1F8W A;  4J34 A;  3V3O A;  4RG3 A;  2V3B A;  3H8I A;  3JSK A;  3P1W A;  4APN A;  3M0O A;  2BA9 A;  4GUV A;  3I6D A;  4H4Z A;  2XYO A;  3AE9 A;  3L8K A;  1ZP0 A;  2WDR A;  2B9Y A;  1S2Q A;  2A8X A;  3C96 A;  4H4W A;  1GSN A;  1H84 A;  4BK3 A;  3HYV A;  5JCK A;  2YR6 A;  2BRA A;  4BK1 A;  5KXJ A;  2C7G A;  4NTC A;  4B64 A;  3F8R A;  3RP7 A;  3AYL A;  4A99 A;  1CF3 A;  1TYT A;  4H4U A;  1CJ4 A;  1NDA A;  4Z26 A;  1TDE A;  4H4T A;  3URH A;  1M6I A;  4JN9 A;  1VQW A;  3NT6 A;  1BZL A;  2WU2 A;  3IWA A;  2XLP A;  4X9M A;  2ACZ A;  1D4C A;  3CIR A;  2CUL A;  4OVI A;  2X8H A;  1MXT A;  4EIP A;  2X3N A;  2AR8 A;  4H7U A;  4U8N A;  1K0I A;  4ICY A;  3EAN A;  2H88 A;  2WPF A;  1H7X A;  2ARD A;  1PBE A;  4YTP A;  3K7T A;  1PXA A;  4HA6 A;  2WHD A;  5TR3 A;  3ZYX A;  1JRZ A;  4EM4 A;  1QLB A;  5GSN A;  5FS7 A;  2XFU A;  2GB0 A;  4II3 A;  1DJQ A;  1CJ2 A;  4A9W A;  4OPG A;  4WX1 A;  3F8P A;  1ZX9 A;  4BV6 A;  4ECH A;  1ELI A;  3QSM A;  5IQ4 A;  4U8P A;  3NNE A;  1BWC A;  3COX A;  3VR8 A;  3ALJ A;  4TM1 A;  4HB9 A;  3NH3 X;  2JAE A;  3V3N A;  3BNU A;  1AOG A;  1LJ1 A;  3NG7 X;  1BGN A;  4AOS A;  2DKI A;  3EPT A;  3AYI A;  2YM1 A;  2B9W A;  1CC2 A;  1B8S A;  2C73 A;  5FS8 A;  3GSI A;  3KU9 A;  4GAV A;  4U8M A;  3GMC A;  4U2L A;  5U1O A;  3UOV A;  2GR3 A;  3AEC A;  4K2X A;  1JRX A;  4CY6 A;  2Z5Y A;  2BK4 A;  1GRH A;  1LV0 A;  1S2Y A;  1GRT A;  1JNR A;  2CFY A;  2GAG B;  4OPI A;  4YKF A;  4Y4N A;  3NN0 X;  2FJB A;  1DXL A;  1H6V A;  5EOW A;  1D7Y A;  3G5Q A;  1D5T A;  5KWF A;  1Q1W A;  3DJE A;  3SM8 A;  2WET A;  5HY5 A;  1VDC A;  1GXF A;  3DJG X;  3AD7 B;  2O9Z A;  2WQY A;  3UKA A;  4NEV A;  1E1K A;  4CCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...