5KMSA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 2.5 angstrom resolution.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
394
structure length
394
Chain Sequence
b'KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 117
structure length 394
sequence length 394
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmsA00
4G73A 3SZCA 4G6GA 3HYXA 4GAVA 4NWZA 4G9KA 4G6HA 3HYVA 3SZFA 3SXIA 3T0KA 3SZ0A 3KPKA 3SZWA 3SX6A 3T2KA 3T2ZA 5KMRA 3SYIA 3HYWA 5KMSA 5KMPA 3T14A 4GAPA 4G74A 3T2YA 3T31A 3SY4A 5KMQA
chains in the Genus database with same CATH superfamily
1ZMCA 4CCRA 3C96A 1GT8A 2BC1A 4J2WA 2WP6A 3UKPA 2F5ZA 2FBWA 3AECA 3GWFA 3KU9A 4OVIA 1BGNA 3EAOA 3QJ4A 4CY8A 1FL2A 1K0IA 3HYVA 3T37A 3ICSA 2Q7VA 2R4EA 3NRNA 4A9WA 1TDOA 2GQFA 3M13A 1S2QA 4U8OA 2YAUA 1MOKA 4GCMA 4H4YA 1H6VA 2VRMA 3ZDNA 4CCQA 1EL5A 1E6EA 2GR1A 2YLXA 2YQUA 4TLXA 2VRLA 2YG5A 3H8LA 5HY5A 5JCLA 3CGBA 5J7XA 3QVRA 1JRXA 2J3NA 1QLBA 3UOZA 2C70A 2XVHA 4REKA 4H4VA 3UKHA 1GXFA 1BWCA 2OA1A 5EBKA 2YG7A 3AEGA 2WDQA 2GH5A 4RG3A 2BS2A 3RP8A 1L9CA 4HA6A 3WE0A 1XANA 2XVFA 3RHAA 1PJ5A 4YT0A 4GF7A 3LZXA 5KOWA 1KF6A 3CPHG 2XFUA 4TM3A 4AT0A 3UTFA 5IPYA 1OJ9A 3O0HA 3V76A 4H2NA 2B7RA 4K8DA 3VRBA 2R0GA 1JEHA 2V6OA 3GD3A 3GRTA 3ITJA 1B4VA 1ZY8A 1PXCA 3P4SA 3P4RA 2VVMA 2Y6RA 1PXBA 2Z5YA 2XFPA 3KKJA 1E1LA 2H88A 4O5QA 1NEKA 1LJ1A 3H8IA 3ALMA 3K7QX 2RGJA 1N4VA 2PYXA 3FBSA 3CIRA 3B3RA 3DGHA 1M6IA 3P4PA 3LZWA 1OJDA 3OZ2A 4H4QA 4OPDA 2OLNA 3AE6A 1L9EA 4JY3A 5EB5A 2BK5A 3SFEA 3SXIA 2YR6A 1YQ3A 2Z5XA 4EQXA 4LIIA 4Z24A 4YTNA 2XCGA 2ARDA 4XWZA 2VQBA 1JRZA 3G5RA 4UDQA 3K7TA 4UP3A 4M52A 1FCDA 2GMJA 1Y0PA 3CNDA 3DMEA 4NEVA 4OPLA 5JCKA 2V3AA 3NK2X 4EMIA 4OPGA 2JB1A 4J56A 5L46A 1NPXA 4RG4A 2V3BA 2WPEA 5DBJA 4CNKA 4NTEA 2BXRA 1F3PA 2AR8A 2TMDA 5ER0A 3GWDA 4CNJA 3G5QA 1QJDA 1EL7A 1JNRA 2BC0A 3ATQA 1H7XA 3AD7B 4OPTA 4H4TA 4OCGA 3SZ0A 3SZWA 1PXAA 1ZK7A 2EQ7A 2WOIA 1XPQA 4E0VA 1O5WA 1JRYA 3UKKA 2OLOA 2WU2A 3FMWA 3NYFA 4AP3A 4Y4NA 1CBOA 3VRDB 1M64A 1GEUA 2RGHA 2CFYA 3BHFA 3AEFA 2C3CA 1P2EA 1GRHA 2UZZA 3AEBA 2VVLG 2Q0KA 2YLSA 2JKCA 3CNTA 1K0JA 1D5TA 2WOWA 3VQRA 1AOGA 4H4SA 3CPJG 1LQTA 2BS4A 2OALA 2ZZBA 3ATRA 3IF9A 2YVGA 4XWRA 2FJEA 3V3NA 2BABA 4C3XA 2YR4A 2B9XA 2BRYA 2GR0A 3PVCA 1LV0A 2WU5A 5FS6A 3V3OA 1O94A 3VR8A 3B6DA 3ICTA 1Y56A 1JU2A 1ZOYA 4U8PA 3T2KA 1YY5A 3NN0X 3LADA 4A79A 4C3YA 1GRFA 2XFOA 1GREA 2FJBA 2XYOA 3FG2P 3NK1X 1PJ7A 1GRGA 3UTHA 4IA5A 3QFBA 2C7GA 1GPEA 3GSIA 2YLTA 4AT2A 5KRQA 4O5UA 4GDPA 4II2A 2YG6A 3P4QA 4A5LA 1DOEA 3SQPA 3H4KA 3UOXA 1DJQA 3AE8A 3NIXA 3RP6A 3DJDA 4ECHA 1ZP0A 1NG4A 4A99A 1PS9A 1PJ6A 1YQZA 3NN6X 3GYIA 2V61A 1D4DA 4B65A 3Q9TA 2YM2A 2C4CA 3SZFA 4G9KA 1K0LA 1L9DA 1TYPA 3CNJA 4YSHA 4B64A 1CJ4A 1PBEA 2WDRA 3UKQA 1VG0A 4K2XA 2R9ZA 3F8RA 4II3A 1B8SA 3COXA 2E1MA 5FS7A 1Q1WA 2C64A 1B5QA 1N4WA 1NENA 1Z6LA 3SYIA 1CJ3A 2EQ6A 2OAMA 3M0OA 3LXDA 1ZX9A 3HYWA 1DOBA 2A87A 3JSKA 3CGDA 4FK1C 4DSGA 1IJHA 4U8MA 4JQ9A 5TR3A 4K5SA 2YM1A 3S5WA 4YKGA 4LU6A 4YTPA 2R4JA 3AE5A 1EL8A 4D03A 3F8DA 3II4A 1NG3A 2YLRA 3ALLA 1NHQA 2WS3A 2WP9A 2BK4A 2WPFA 4A7AA 2WP5A 5M10A 4CY6A 5U63A 4H2QA 1D4EA 1KDGA 1RYIA 4TM0A 3SX6A 1GALA 2R0CA 5GSNA 3UKAA 5KMRA 4OPCA 3EF6A 1VRQB 2QAEA 5HYMA 3ALJA 4UDRA 2C72A 2BS3A 4AOSA 1PDHA 1KSSA 1HYUA 4H50A 2GR2A 3NTAA 3NYEA 2XVJA 4JNAA 4A6NA 3DK9A 2BK3A 4C77A 1RSGA 1N4UA 2YLZA 4U2TA 1ONFA 4YKFA 3DJJA 1N1PA 4PAAA 1EBDA 4FX9A 1CL0A 4GAVA 2Y6QA 5FS9A 1EL9A 1JNZA 3NGCX 2ACZA 3QVPA 1JOAA 4Z44A 3AYLA 2APGA 3QSMA 3UKLA 5C3JA 1Y56B 2C73A 1Q1RA 4JN9A 1GRBA 2XLPA 1PBCA 4NTCA 2B9WA 3UOVA 2WOVA 3EANA 5KNLA 1ZOVA 2CVJA 3URHA 4FDCB 1PHHA 4I59A 2RGOA 2WDVA 3CGEA 3SM8A 2VOUA 2ZZ0A 2XLTA 2GRTA 1LTXR 1GERA 3PO7A 1F6MA 4B66A 4A65A 5KOXA 2IVDA 2A8XA 3HYXA 2C67A 4H4XA 4USRA 4OPIA 3AXBA 1DOCA 1FEAA 2IVEA 2B7SA 4BK3A 1FEBA 2YWLA 1BGJA 1YQ4A 4Z43A 4ADWA 3LB8A 2E5VA 1IUWA 2VQ7A 2GEWA 3T2ZA 4H4UA 4APNA 1D7LA 2Q0LA 2QA1A 3QSSA 5HXIA 3Q6JA 3SFDA 2YR5A 3VRAA 1TYTA 2JK6A 1NDAA 2YG3A 4X9NA 3AE1A 1W4XA 2BXSA 5KMSA 1IUXA 3L1RA 3I6DA 3GMBA 3T14A 3CNPA 4C74A 3AYIA 4Y4MA 4DNAA 5J60A 1FECA 3T31A 3C4NA 4U8JA 5GRTA 1LQUA 1P2HA 4G6GA 4K7ZA 3NTDA 3GDPA 5U1OA 1D7YA 1Q9IA 1IUVA 4YSXA 4U8LA 1NHSA 5KVIA 1H83A 1MXTA 3BI5A 3GD4A 2RABA 3DH9A 3NHOX 5U25A 3AEEA 4BURA 3AE9A 3PS9A 2GVCA 4B1BA 2C65A 2R0PA 3BNMA 1H86A 4U8KA 5JCMA 3ISHA 4NTDA 2BCGG 3EPTA 4Z2TA 2W0HA 3NG7X 3IHMA 5HHFA 1GRAA 2Q6UA 4GAPA 5M0ZA 1SEZA 3RNMA 1E1MA 1CC4A 2AQJA 2CULA 3AD8B 1BF3A 3QFAA 2B76A 4H4ZA 4BV6A 3SZCA 2X8HA 1LPFA 4B67A 2E4GA 2GV8A 4ICYA 3CTYA 1KNRA 3CGCA 4USQA 4CRTA 5KXJA 1IUTA 2VVLA 3NKSA 4MJWA 2FJAA 2GAGB 3L8KA 4BJZA 3GYJA 4FK1A 4H4PA 3R9UA 4H2RA 4C5OA 4EMWA 2BCPA 1KNPA 3BI4A 1TDEA 5IQ4A 3UOYA 3NK0X 4EMJA 2BA9A 3K7MX 4ZN0A 2JAEA 1S3BA 3NT6A 3AWIA 4YWOA 4WX1A 2GF3A 4X4JA 4J34A 1OJAA 4K22A 3ZYXA 4EM4A 3QSEA 4BK2A 3FIMB 3I3LA 2PHHA 3NNEA 2WQYA 2VZ2A 1IUSA 3KLJA 3LJPA 4TLZA 3C4AA 5EOWA 4YXDA 3K30A 1GESA 2NVKX 1PBFA 3FPZA 4EIPA 5EB4A 1CC2A 3LOVA 3T0KA 1CJCA 1TRBA 2GAHB 4RSLA 3S61A 2A89A 1DJNA 1NHRA 2AAQA 4B69A 4YSYA 3DJEA 1VQWA 4IVOB 5IQ1A 1GTEA 2XVIA 3DK4A 1XHCA 5CQFA 4WCTA 5FMHA 3D8XA 5JCNA 4JDRA 4HB9A 3BI2A 2WPCA 3AD9B 4PABA 1ZMDA 1GTHA 3ADAB 1B37A 1D4CA 3AE7A 5KMPA 2B9YA 2GMHA 4Z2RA 3UTGA 1ELIA 2TPRA 2X8GA 3AEAA 1LVLA 1ZDLA 3BHKA 3KD9A 2V60A 3AB1A 4G74A 3HZLA 1L0VA 4ZCCA 4AP1A 1VG9A 2C75A 2C66A 5BVAA 3CN8A 3ICRA 2QA2A 2XLUA 4TM1A 4I58A 1UKVG 2JB2A 3F8PA 4UDPA 3KPFA 3P9UA 3IC9A 4G6HA 2YVFA 1H84A 1XDIA 4U8NA 1OJTA 2H89A 1PBDA 1TDFA 3CPIG 4EM3A 4Z25A 4IV9A 3VR9A 4B63A 3AE3A 2XVEA 4H2PA 5FS8A 4H4WA 4YTMA 4U2SA 1F8WA 2XLSA 4J36A 4EQSA 1F8RA 1BKWA 4KPRA 4J31A 1F8SA 2WEUA 3SGLA 1TDKA 1DXLA 4GRTA 3AE4A 4N9XA 2WHDA 2GR3A 4U8IA 5CKUA 4H4RA 3UP4A 2X50A 4IVMB 3NH3X 4BK1A 2R46A 5BRTA 5LV9A 2NPXA 1S3EA 4JNQA 2EQ9A 4K5RA 1CJ2A 1PN0A 1GNDA 5JCIA 2ZBWA 3IWAA 2HQMA 3OC4A 4KX6A 4DSHA 2JB3A 1YKJA 2XFNA 2O9ZA 1OJCA 4J57A 4BJYA 4EQRA 1REOA 1GV4A 2C76A 3UKFA 1KFYA 2V5ZA 2X8CA 4YSZA 3E1TA 3UP5A 1V59A 3P1WA 1MO9A 2YVJA 3ABVA 5BULA 4GUVA 4NEWA 4NZHA 1S2YA 4GDEA 3NYCA 1E39A 3T2YA 4P9SA 5BUKA 3AEDA 3SY4A 1KSUA 5KMQA 4G73A 2X99A 4AOXA 4Z2UA 1NAAA 1DODA 2YLWA 2GQWA 4OPUA 1E1NA 3DA1A 1GSNA 2CDUA 3GDNA 3DK8A 4GR1A 2R45A 4NNJA 1E1KA 2XLRA 4CBQA 2WBAA 4EIQA 2I0ZA 5KWFA 4B68A 3KA7A 4H7UA 2C3DA 1H82A 3DGZA 1IUUA 1X31B 2X3NA 2IIDA 3NLCA 1CHUA 1TDNA 1FOHA 2EQ8A 1GETA 1NHPA 2BRAA 4TM4A 2YG4A 1GOSA 2FJDA 1H7WA 1K4QA 3RP7A 4A6NB 3D1CA 4J33A 4JY2A 3AYJA 3GYXA 1CF3A 2XFQA 2DKHA 3GMCA 3UCLA 1CC6A 3GRSA 4ZCDA 1ZKQA 2BACA 4LA1A 3IHGA 4IA6A 4NWZA 3REDA 4EQWA 1H81A 5KVHA 1E7PA 2WESA 2ZZCA 2WETA 3KPKA 3M12A 2QCUA 2GB0A 4Y4LA 4DGKA 1BZLA 1QO8A 2JBVA 4XXGA 2DKIA 1O95A 1COYA 3CMMA 4U2LA 3KVEA 3AE2A 3CNSA 4X9MA 4D04A 4Z26A 2BYBA 5C2TA 1DNCA 3UTEA 3BNUA 2XDOA 1PBBA 1VDCA 1GRTA 3DJGX 1RP0A 3G5SA
chains in the Genus database with same CATH topology
1ZMCA 4CCRA 3C96A 1GT8A 2BC1A 4J2WA 2WP6A 3UKPA 2F5ZA 2FBWA 3AECA 3GWFA 3KU9A 4OVIA 1BGNA 3EAOA 3QJ4A 4CY8A 1FL2A 1K0IA 3HYVA 3T37A 3ICSA 2Q7VA 2R4EA 3NRNA 4A9WA 1TDOA 2GQFA 3M13A 1S2QA 4U8OA 2YAUA 1MOKA 4GCMA 4H4YA 1H6VA 2VRMA 3ZDNA 4CCQA 1EL5A 1E6EA 2GR1A 2YLXA 2YQUA 4TLXA 2VRLA 2YG5A 3H8LA 5HY5A 5JCLA 3CGBA 5J7XA 3QVRA 1JRXA 2J3NA 1QLBA 3UOZA 2C70A 2XVHA 4REKA 4H4VA 3UKHA 1GXFA 1BWCA 2OA1A 5EBKA 2YG7A 3AEGA 2WDQA 2GH5A 4RG3A 2BS2A 3RP8A 1L9CA 4HA6A 3WE0A 1XANA 2XVFA 3RHAA 1PJ5A 4YT0A 4GF7A 3LZXA 5KOWA 1KF6A 3CPHG 2XFUA 4TM3A 4AT0A 3UTFA 5IPYA 1OJ9A 3O0HA 3V76A 4H2NA 2B7RA 4K8DA 3VRBA 2R0GA 1JEHA 2V6OA 3GD3A 3GRTA 3ITJA 1B4VA 1ZY8A 1PXCA 3P4SA 3P4RA 2VVMA 2Y6RA 1PXBA 2Z5YA 2XFPA 3KKJA 1E1LA 2H88A 4O5QA 1NEKA 1LJ1A 3H8IA 3ALMA 3K7QX 2RGJA 1N4VA 2PYXA 3FBSA 3CIRA 3B3RA 3DGHA 1M6IA 3P4PA 3LZWA 1OJDA 3OZ2A 4H4QA 4OPDA 2OLNA 3AE6A 1L9EA 4JY3A 5EB5A 2BK5A 3SFEA 3SXIA 2YR6A 1YQ3A 2Z5XA 4EQXA 4LIIA 4Z24A 4YTNA 2XCGA 2ARDA 4XWZA 2VQBA 1JRZA 3G5RA 4UDQA 3K7TA 4UP3A 4M52A 1FCDA 2GMJA 1Y0PA 3CNDA 3DMEA 4NEVA 4OPLA 5JCKA 2V3AA 3NK2X 4EMIA 4OPGA 2JB1A 4J56A 5L46A 1NPXA 4RG4A 2V3BA 2WPEA 5DBJA 4CNKA 4NTEA 2BXRA 1F3PA 2AR8A 2TMDA 5ER0A 3GWDA 4CNJA 3G5QA 1QJDA 1EL7A 1JNRA 2BC0A 3ATQA 1H7XA 3AD7B 4OPTA 4H4TA 4OCGA 3SZ0A 3SZWA 1PXAA 1ZK7A 2EQ7A 2WOIA 1XPQA 4E0VA 1O5WA 1JRYA 3UKKA 2OLOA 2WU2A 3FMWA 3NYFA 4AP3A 4Y4NA 1CBOA 3VRDB 1M64A 1GEUA 2RGHA 2CFYA 3BHFA 3AEFA 2C3CA 1P2EA 1GRHA 2UZZA 3AEBA 2VVLG 2Q0KA 2YLSA 2JKCA 3CNTA 1K0JA 1D5TA 2WOWA 3VQRA 1AOGA 4H4SA 3CPJG 1LQTA 2BS4A 2OALA 2ZZBA 3ATRA 3IF9A 2YVGA 4XWRA 2FJEA 3V3NA 2BABA 4C3XA 2YR4A 2B9XA 2BRYA 2GR0A 3PVCA 1LV0A 2WU5A 5FS6A 3V3OA 1O94A 3VR8A 3B6DA 3ICTA 1Y56A 1JU2A 1ZOYA 4U8PA 3T2KA 1YY5A 3NN0X 3LADA 4A79A 4C3YA 1GRFA 2XFOA 1GREA 2FJBA 2XYOA 3FG2P 3NK1X 1PJ7A 1GRGA 3UTHA 4IA5A 3QFBA 2C7GA 1GPEA 3GSIA 2YLTA 4AT2A 5KRQA 4O5UA 4GDPA 4II2A 2YG6A 3P4QA 4A5LA 1DOEA 3SQPA 3H4KA 3UOXA 1DJQA 3AE8A 3NIXA 3RP6A 3DJDA 4ECHA 1ZP0A 1NG4A 4A99A 1PS9A 1PJ6A 1YQZA 3NN6X 3GYIA 2V61A 1D4DA 4B65A 3Q9TA 2YM2A 2C4CA 3SZFA 4G9KA 1K0LA 1L9DA 1TYPA 3CNJA 4YSHA 4B64A 1CJ4A 1PBEA 2WDRA 3UKQA 1VG0A 4K2XA 2R9ZA 3F8RA 4II3A 1B8SA 3COXA 2E1MA 5FS7A 1Q1WA 2C64A 1B5QA 1N4WA 1NENA 1Z6LA 3SYIA 1CJ3A 2EQ6A 2OAMA 3M0OA 3LXDA 1ZX9A 3HYWA 1DOBA 2A87A 3JSKA 3CGDA 4FK1C 4DSGA 1IJHA 4U8MA 4JQ9A 5TR3A 4K5SA 2YM1A 3S5WA 4YKGA 4LU6A 4YTPA 2R4JA 3AE5A 1EL8A 4D03A 3F8DA 3II4A 1NG3A 2YLRA 3ALLA 1NHQA 2WS3A 2WP9A 2BK4A 2WPFA 4A7AA 2WP5A 5M10A 4CY6A 5U63A 4H2QA 1D4EA 1KDGA 1RYIA 4TM0A 3SX6A 1GALA 2R0CA 5GSNA 3UKAA 5KMRA 4OPCA 3EF6A 1VRQB 2QAEA 5HYMA 3ALJA 4UDRA 2C72A 2BS3A 4AOSA 1PDHA 1KSSA 1HYUA 4H50A 2GR2A 3NTAA 3NYEA 2XVJA 4JNAA 4A6NA 3DK9A 2BK3A 4C77A 1RSGA 1N4UA 2YLZA 4U2TA 1ONFA 4YKFA 3DJJA 1N1PA 4PAAA 1EBDA 4FX9A 1CL0A 4GAVA 2Y6QA 5FS9A 1EL9A 1JNZA 3NGCX 2ACZA 3QVPA 1JOAA 4Z44A 3AYLA 2APGA 3QSMA 3UKLA 5C3JA 1Y56B 2C73A 1Q1RA 4JN9A 1GRBA 2XLPA 1PBCA 4NTCA 2B9WA 3UOVA 2WOVA 3EANA 5KNLA 1ZOVA 2CVJA 3URHA 4FDCB 1PHHA 4I59A 2RGOA 2WDVA 3CGEA 3SM8A 2VOUA 2ZZ0A 2XLTA 2GRTA 1LTXR 1GERA 3PO7A 1F6MA 4B66A 4A65A 5KOXA 2IVDA 2A8XA 3HYXA 2C67A 4H4XA 4USRA 4OPIA 3AXBA 1DOCA 1FEAA 2IVEA 2B7SA 4BK3A 1FEBA 2YWLA 1BGJA 1YQ4A 4Z43A 4ADWA 3LB8A 2E5VA 1IUWA 2VQ7A 2GEWA 3T2ZA 4H4UA 4APNA 1D7LA 2Q0LA 2QA1A 3QSSA 5HXIA 3Q6JA 3SFDA 2YR5A 3VRAA 1TYTA 2JK6A 1NDAA 2YG3A 4X9NA 3AE1A 1W4XA 2BXSA 5KMSA 1IUXA 3L1RA 3I6DA 3GMBA 3T14A 3CNPA 4C74A 3AYIA 4Y4MA 4DNAA 5J60A 1FECA 3T31A 3C4NA 4U8JA 5GRTA 1LQUA 1P2HA 4G6GA 4K7ZA 3NTDA 3GDPA 5U1OA 1D7YA 1Q9IA 1IUVA 4YSXA 4U8LA 1NHSA 5KVIA 1H83A 1MXTA 3BI5A 3GD4A 2RABA 3DH9A 3NHOX 5U25A 3AEEA 4BURA 3AE9A 3PS9A 2GVCA 4B1BA 2C65A 2R0PA 3BNMA 1H86A 4U8KA 5JCMA 3ISHA 4NTDA 2BCGG 3EPTA 4Z2TA 2W0HA 3NG7X 3IHMA 5HHFA 1GRAA 2Q6UA 4GAPA 5M0ZA 1SEZA 3RNMA 1E1MA 1CC4A 2AQJA 2CULA 3AD8B 1BF3A 3QFAA 2B76A 4H4ZA 4BV6A 3SZCA 2X8HA 1LPFA 4B67A 2E4GA 2GV8A 4ICYA 3CTYA 1KNRA 3CGCA 4USQA 4CRTA 5KXJA 1IUTA 2VVLA 3NKSA 4MJWA 2FJAA 2GAGB 3L8KA 4BJZA 3GYJA 4FK1A 4H4PA 3R9UA 4H2RA 4C5OA 4EMWA 2BCPA 1KNPA 3BI4A 1TDEA 5IQ4A 3UOYA 3NK0X 4EMJA 2BA9A 3K7MX 4ZN0A 2JAEA 1S3BA 3NT6A 3AWIA 4YWOA 4WX1A 2GF3A 4X4JA 4J34A 1OJAA 4K22A 3ZYXA 4EM4A 3QSEA 4BK2A 3FIMB 3I3LA 2PHHA 3NNEA 2WQYA 2VZ2A 1IUSA 3KLJA 3LJPA 4TLZA 3C4AA 5EOWA 4YXDA 3K30A 1GESA 2NVKX 1PBFA 3FPZA 4EIPA 5EB4A 1CC2A 3LOVA 3T0KA 1CJCA 1TRBA 2GAHB 4RSLA 3S61A 2A89A 1DJNA 1NHRA 2AAQA 4B69A 4YSYA 3DJEA 1VQWA 4IVOB 5IQ1A 1GTEA 2XVIA 3DK4A 1XHCA 5CQFA 4WCTA 5FMHA 3D8XA 5JCNA 4JDRA 4HB9A 3BI2A 2WPCA 3AD9B 4PABA 1ZMDA 1GTHA 3ADAB 1B37A 1D4CA 3AE7A 5KMPA 2B9YA 2GMHA 4Z2RA 3UTGA 1ELIA 2TPRA 2X8GA 3AEAA 1LVLA 1ZDLA 3BHKA 3KD9A 2V60A 3AB1A 4G74A 3HZLA 1L0VA 4ZCCA 4AP1A 1VG9A 2C75A 2C66A 5BVAA 3CN8A 3ICRA 2QA2A 2XLUA 4TM1A 4I58A 1UKVG 2JB2A 3F8PA 4UDPA 3KPFA 3P9UA 3IC9A 4G6HA 2YVFA 1H84A 1XDIA 4U8NA 1OJTA 2H89A 1PBDA 1TDFA 3CPIG 4EM3A 4Z25A 4IV9A 3VR9A 4B63A 3AE3A 2XVEA 4H2PA 5FS8A 4H4WA 4YTMA 4U2SA 1F8WA 2XLSA 4J36A 4EQSA 1F8RA 1BKWA 4KPRA 4J31A 1F8SA 2WEUA 3SGLA 1TDKA 1DXLA 4GRTA 3AE4A 4N9XA 2WHDA 2GR3A 4U8IA 5CKUA 4H4RA 3UP4A 2X50A 4IVMB 3NH3X 4BK1A 2R46A 5BRTA 5LV9A 2NPXA 1S3EA 4JNQA 2EQ9A 4K5RA 1CJ2A 1PN0A 1GNDA 5JCIA 2ZBWA 3IWAA 2HQMA 3OC4A 4KX6A 4DSHA 2JB3A 1YKJA 2XFNA 2O9ZA 1OJCA 4J57A 4BJYA 4EQRA 1REOA 1GV4A 2C76A 3UKFA 1KFYA 2V5ZA 2X8CA 4YSZA 3E1TA 3UP5A 1V59A 3P1WA 1MO9A 2YVJA 3ABVA 5BULA 4GUVA 4NEWA 4NZHA 1S2YA 4GDEA 3NYCA 1E39A 3T2YA 4P9SA 5BUKA 3AEDA 3SY4A 1KSUA 5KMQA 4G73A 2X99A 4AOXA 4Z2UA 1NAAA 1DODA 2YLWA 2GQWA 4OPUA 1E1NA 3DA1A 1GSNA 2CDUA 3GDNA 3DK8A 4GR1A 2R45A 4NNJA 1E1KA 2XLRA 4CBQA 2WBAA 4EIQA 2I0ZA 5KWFA 4B68A 3KA7A 4H7UA 2C3DA 1H82A 3DGZA 1IUUA 1X31B 2X3NA 2IIDA 3NLCA 1CHUA 1TDNA 1FOHA 2EQ8A 1GETA 1NHPA 2BRAA 4TM4A 2YG4A 1GOSA 2FJDA 1H7WA 1K4QA 3RP7A 4A6NB 3D1CA 4J33A 4JY2A 3AYJA 3GYXA 1CF3A 2XFQA 2DKHA 3GMCA 3UCLA 1CC6A 3GRSA 4ZCDA 1ZKQA 2BACA 4LA1A 3IHGA 4IA6A 4NWZA 3REDA 4EQWA 1H81A 5KVHA 1E7PA 2WESA 2ZZCA 2WETA 3KPKA 3M12A 2QCUA 2GB0A 4Y4LA 4DGKA 1BZLA 1QO8A 2JBVA 4XXGA 2DKIA 1O95A 1COYA 3CMMA 4U2LA 3KVEA 3AE2A 3CNSA 4X9MA 4D04A 4Z26A 2BYBA 5C2TA 1DNCA 3UTEA 3BNUA 2XDOA 1PBBA 1VDCA 1GRTA 3DJGX 1RP0A 3G5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G73 A;  3SZC A;  4G6G A;  3HYX A;  4GAV A;  4NWZ A;  4G9K A;  4G6H A;  3HYV A;  3SZF A;  3SXI A;  3T0K A;  3SZ0 A;  3KPK A;  3SZW A;  3SX6 A;  3T2K A;  3T2Z A;  5KMR A;  3SYI A;  3HYW A;  5KMS A;  5KMP A;  3T14 A;  4GAP A;  4G74 A;  3T2Y A;  3T31 A;  3SY4 A;  5KMQ A; 
#chains in the Genus database with same CATH topology
 1ZMC A;  4CCR A;  3C96 A;  1GT8 A;  2BC1 A;  4J2W A;  2WP6 A;  3UKP A;  2F5Z A;  2FBW A;  3AEC A;  3GWF A;  3KU9 A;  4OVI A;  1BGN A;  3EAO A;  3QJ4 A;  4CY8 A;  1FL2 A;  1K0I A;  3HYV A;  3T37 A;  3ICS A;  2Q7V A;  2R4E A;  3NRN A;  4A9W A;  1TDO A;  2GQF A;  3M13 A;  1S2Q A;  4U8O A;  2YAU A;  1MOK A;  4GCM A;  4H4Y A;  1H6V A;  2VRM A;  3ZDN A;  4CCQ A;  1EL5 A;  1E6E A;  2GR1 A;  2YLX A;  2YQU A;  4TLX A;  2VRL A;  2YG5 A;  3H8L A;  5HY5 A;  5JCL A;  3CGB A;  5J7X A;  3QVR A;  1JRX A;  2J3N A;  1QLB A;  3UOZ A;  2C70 A;  2XVH A;  4REK A;  4H4V A;  3UKH A;  1GXF A;  1BWC A;  2OA1 A;  5EBK A;  2YG7 A;  3AEG A;  2WDQ A;  2GH5 A;  4RG3 A;  2BS2 A;  3RP8 A;  1L9C A;  4HA6 A;  3WE0 A;  1XAN A;  2XVF A;  3RHA A;  1PJ5 A;  4YT0 A;  4GF7 A;  3LZX A;  5KOW A;  1KF6 A;  3CPH G;  2XFU A;  4TM3 A;  4AT0 A;  3UTF A;  5IPY A;  1OJ9 A;  3O0H A;  3V76 A;  4H2N A;  2B7R A;  4K8D A;  3VRB A;  2R0G A;  1JEH A;  2V6O A;  3GD3 A;  3GRT A;  3ITJ A;  1B4V A;  1ZY8 A;  1PXC A;  3P4S A;  3P4R A;  2VVM A;  2Y6R A;  1PXB A;  2Z5Y A;  2XFP A;  3KKJ A;  1E1L A;  2H88 A;  4O5Q A;  1NEK A;  1LJ1 A;  3H8I A;  3ALM A;  3K7Q X;  2RGJ A;  1N4V A;  2PYX A;  3FBS A;  3CIR A;  3B3R A;  3DGH A;  1M6I A;  3P4P A;  3LZW A;  1OJD A;  3OZ2 A;  4H4Q A;  4OPD A;  2OLN A;  3AE6 A;  1L9E A;  4JY3 A;  5EB5 A;  2BK5 A;  3SFE A;  3SXI A;  2YR6 A;  1YQ3 A;  2Z5X A;  4EQX A;  4LII A;  4Z24 A;  4YTN A;  2XCG A;  2ARD A;  4XWZ A;  2VQB A;  1JRZ A;  3G5R A;  4UDQ A;  3K7T A;  4UP3 A;  4M52 A;  1FCD A;  2GMJ A;  1Y0P A;  3CND A;  3DME A;  4NEV A;  4OPL A;  5JCK A;  2V3A A;  3NK2 X;  4EMI A;  4OPG A;  2JB1 A;  4J56 A;  5L46 A;  1NPX A;  4RG4 A;  2V3B A;  2WPE A;  5DBJ A;  4CNK A;  4NTE A;  2BXR A;  1F3P A;  2AR8 A;  2TMD A;  5ER0 A;  3GWD A;  4CNJ A;  3G5Q A;  1QJD A;  1EL7 A;  1JNR A;  2BC0 A;  3ATQ A;  1H7X A;  3AD7 B;  4OPT A;  4H4T A;  4OCG A;  3SZ0 A;  3SZW A;  1PXA A;  1ZK7 A;  2EQ7 A;  2WOI A;  1XPQ A;  4E0V A;  1O5W A;  1JRY A;  3UKK A;  2OLO A;  2WU2 A;  3FMW A;  3NYF A;  4AP3 A;  4Y4N A;  1CBO A;  3VRD B;  1M64 A;  1GEU A;  2RGH A;  2CFY A;  3BHF A;  3AEF A;  2C3C A;  1P2E A;  1GRH A;  2UZZ A;  3AEB A;  2VVL G;  2Q0K A;  2YLS A;  2JKC A;  3CNT A;  1K0J A;  1D5T A;  2WOW A;  3VQR A;  1AOG A;  4H4S A;  3CPJ G;  1LQT A;  2BS4 A;  2OAL A;  2ZZB A;  3ATR A;  3IF9 A;  2YVG A;  4XWR A;  2FJE A;  3V3N A;  2BAB A;  4C3X A;  2YR4 A;  2B9X A;  2BRY A;  2GR0 A;  3PVC A;  1LV0 A;  2WU5 A;  5FS6 A;  3V3O A;  1O94 A;  3VR8 A;  3B6D A;  3ICT A;  1Y56 A;  1JU2 A;  1ZOY A;  4U8P A;  3T2K A;  1YY5 A;  3NN0 X;  3LAD A;  4A79 A;  4C3Y A;  1GRF A;  2XFO A;  1GRE A;  2FJB A;  2XYO A;  3FG2 P;  3NK1 X;  1PJ7 A;  1GRG A;  3UTH A;  4IA5 A;  3QFB A;  2C7G A;  1GPE A;  3GSI A;  2YLT A;  4AT2 A;  5KRQ A;  4O5U A;  4GDP A;  4II2 A;  2YG6 A;  3P4Q A;  4A5L A;  1DOE A;  3SQP A;  3H4K A;  3UOX A;  1DJQ A;  3AE8 A;  3NIX A;  3RP6 A;  3DJD A;  4ECH A;  1ZP0 A;  1NG4 A;  4A99 A;  1PS9 A;  1PJ6 A;  1YQZ A;  3NN6 X;  3GYI A;  2V61 A;  1D4D A;  4B65 A;  3Q9T A;  2YM2 A;  2C4C A;  3SZF A;  4G9K A;  1K0L A;  1L9D A;  1TYP A;  3CNJ A;  4YSH A;  4B64 A;  1CJ4 A;  1PBE A;  2WDR A;  3UKQ A;  1VG0 A;  4K2X A;  2R9Z A;  3F8R A;  4II3 A;  1B8S A;  3COX A;  2E1M A;  5FS7 A;  1Q1W A;  2C64 A;  1B5Q A;  1N4W A;  1NEN A;  1Z6L A;  3SYI A;  1CJ3 A;  2EQ6 A;  2OAM A;  3M0O A;  3LXD A;  1ZX9 A;  3HYW A;  1DOB A;  2A87 A;  3JSK A;  3CGD A;  4FK1 C;  4DSG A;  1IJH A;  4U8M A;  4JQ9 A;  5TR3 A;  4K5S A;  2YM1 A;  3S5W A;  4YKG A;  4LU6 A;  4YTP A;  2R4J A;  3AE5 A;  1EL8 A;  4D03 A;  3F8D A;  3II4 A;  1NG3 A;  2YLR A;  3ALL A;  1NHQ A;  2WS3 A;  2WP9 A;  2BK4 A;  2WPF A;  4A7A A;  2WP5 A;  5M10 A;  4CY6 A;  5U63 A;  4H2Q A;  1D4E A;  1KDG A;  1RYI A;  4TM0 A;  3SX6 A;  1GAL A;  2R0C A;  5GSN A;  3UKA A;  5KMR A;  4OPC A;  3EF6 A;  1VRQ B;  2QAE A;  5HYM A;  3ALJ A;  4UDR A;  2C72 A;  2BS3 A;  4AOS A;  1PDH A;  1KSS A;  1HYU A;  4H50 A;  2GR2 A;  3NTA A;  3NYE A;  2XVJ A;  4JNA A;  4A6N A;  3DK9 A;  2BK3 A;  4C77 A;  1RSG A;  1N4U A;  2YLZ A;  4U2T A;  1ONF A;  4YKF A;  3DJJ A;  1N1P A;  4PAA A;  1EBD A;  4FX9 A;  1CL0 A;  4GAV A;  2Y6Q A;  5FS9 A;  1EL9 A;  1JNZ A;  3NGC X;  2ACZ A;  3QVP A;  1JOA A;  4Z44 A;  3AYL A;  2APG A;  3QSM A;  3UKL A;  5C3J A;  1Y56 B;  2C73 A;  1Q1R A;  4JN9 A;  1GRB A;  2XLP A;  1PBC A;  4NTC A;  2B9W A;  3UOV A;  2WOV A;  3EAN A;  5KNL A;  1ZOV A;  2CVJ A;  3URH A;  4FDC B;  1PHH A;  4I59 A;  2RGO A;  2WDV A;  3CGE A;  3SM8 A;  2VOU A;  2ZZ0 A;  2XLT A;  2GRT A;  1LTX R;  1GER A;  3PO7 A;  1F6M A;  4B66 A;  4A65 A;  5KOX A;  2IVD A;  2A8X A;  3HYX A;  2C67 A;  4H4X A;  4USR A;  4OPI A;  3AXB A;  1DOC A;  1FEA A;  2IVE A;  2B7S A;  4BK3 A;  1FEB A;  2YWL A;  1BGJ A;  1YQ4 A;  4Z43 A;  4ADW A;  3LB8 A;  2E5V A;  1IUW A;  2VQ7 A;  2GEW A;  3T2Z A;  4H4U A;  4APN A;  1D7L A;  2Q0L A;  2QA1 A;  3QSS A;  5HXI A;  3Q6J A;  3SFD A;  2YR5 A;  3VRA A;  1TYT A;  2JK6 A;  1NDA A;  2YG3 A;  4X9N A;  3AE1 A;  1W4X A;  2BXS A;  5KMS A;  1IUX A;  3L1R A;  3I6D A;  3GMB A;  3T14 A;  3CNP A;  4C74 A;  3AYI A;  4Y4M A;  4DNA A;  5J60 A;  1FEC A;  3T31 A;  3C4N A;  4U8J A;  5GRT A;  1LQU A;  1P2H A;  4G6G A;  4K7Z A;  3NTD A;  3GDP A;  5U1O A;  1D7Y A;  1Q9I A;  1IUV A;  4YSX A;  4U8L A;  1NHS A;  5KVI A;  1H83 A;  1MXT A;  3BI5 A;  3GD4 A;  2RAB A;  3DH9 A;  3NHO X;  5U25 A;  3AEE A;  4BUR A;  3AE9 A;  3PS9 A;  2GVC A;  4B1B A;  2C65 A;  2R0P A;  3BNM A;  1H86 A;  4U8K A;  5JCM A;  3ISH A;  4NTD A;  2BCG G;  3EPT A;  4Z2T A;  2W0H A;  3NG7 X;  3IHM A;  5HHF A;  1GRA A;  2Q6U A;  4GAP A;  5M0Z A;  1SEZ A;  3RNM A;  1E1M A;  1CC4 A;  2AQJ A;  2CUL A;  3AD8 B;  1BF3 A;  3QFA A;  2B76 A;  4H4Z A;  4BV6 A;  3SZC A;  2X8H A;  1LPF A;  4B67 A;  2E4G A;  2GV8 A;  4ICY A;  3CTY A;  1KNR A;  3CGC A;  4USQ A;  4CRT A;  5KXJ A;  1IUT A;  2VVL A;  3NKS A;  4MJW A;  2FJA A;  2GAG B;  3L8K A;  4BJZ A;  3GYJ A;  4FK1 A;  4H4P A;  3R9U A;  4H2R A;  4C5O A;  4EMW A;  2BCP A;  1KNP A;  3BI4 A;  1TDE A;  5IQ4 A;  3UOY A;  3NK0 X;  4EMJ A;  2BA9 A;  3K7M X;  4ZN0 A;  2JAE A;  1S3B A;  3NT6 A;  3AWI A;  4YWO A;  4WX1 A;  2GF3 A;  4X4J A;  4J34 A;  1OJA A;  4K22 A;  3ZYX A;  4EM4 A;  3QSE A;  4BK2 A;  3FIM B;  3I3L A;  2PHH A;  3NNE A;  2WQY A;  2VZ2 A;  1IUS A;  3KLJ A;  3LJP A;  4TLZ A;  3C4A A;  5EOW A;  4YXD A;  3K30 A;  1GES A;  2NVK X;  1PBF A;  3FPZ A;  4EIP A;  5EB4 A;  1CC2 A;  3LOV A;  3T0K A;  1CJC A;  1TRB A;  2GAH B;  4RSL A;  3S61 A;  2A89 A;  1DJN A;  1NHR A;  2AAQ A;  4B69 A;  4YSY A;  3DJE A;  1VQW A;  4IVO B;  5IQ1 A;  1GTE A;  2XVI A;  3DK4 A;  1XHC A;  5CQF A;  4WCT A;  5FMH A;  3D8X A;  5JCN A;  4JDR A;  4HB9 A;  3BI2 A;  2WPC A;  3AD9 B;  4PAB A;  1ZMD A;  1GTH A;  3ADA B;  1B37 A;  1D4C A;  3AE7 A;  5KMP A;  2B9Y A;  2GMH A;  4Z2R A;  3UTG A;  1ELI A;  2TPR A;  2X8G A;  3AEA A;  1LVL A;  1ZDL A;  3BHK A;  3KD9 A;  2V60 A;  3AB1 A;  4G74 A;  3HZL A;  1L0V A;  4ZCC A;  4AP1 A;  1VG9 A;  2C75 A;  2C66 A;  5BVA A;  3CN8 A;  3ICR A;  2QA2 A;  2XLU A;  4TM1 A;  4I58 A;  1UKV G;  2JB2 A;  3F8P A;  4UDP A;  3KPF A;  3P9U A;  3IC9 A;  4G6H A;  2YVF A;  1H84 A;  1XDI A;  4U8N A;  1OJT A;  2H89 A;  1PBD A;  1TDF A;  3CPI G;  4EM3 A;  4Z25 A;  4IV9 A;  3VR9 A;  4B63 A;  3AE3 A;  2XVE A;  4H2P A;  5FS8 A;  4H4W A;  4YTM A;  4U2S A;  1F8W A;  2XLS A;  4J36 A;  4EQS A;  1F8R A;  1BKW A;  4KPR A;  4J31 A;  1F8S A;  2WEU A;  3SGL A;  1TDK A;  1DXL A;  4GRT A;  3AE4 A;  4N9X A;  2WHD A;  2GR3 A;  4U8I A;  5CKU A;  4H4R A;  3UP4 A;  2X50 A;  4IVM B;  3NH3 X;  4BK1 A;  2R46 A;  5BRT A;  5LV9 A;  2NPX A;  1S3E A;  4JNQ A;  2EQ9 A;  4K5R A;  1CJ2 A;  1PN0 A;  1GND A;  5JCI A;  2ZBW A;  3IWA A;  2HQM A;  3OC4 A;  4KX6 A;  4DSH A;  2JB3 A;  1YKJ A;  2XFN A;  2O9Z A;  1OJC A;  4J57 A;  4BJY A;  4EQR A;  1REO A;  1GV4 A;  2C76 A;  3UKF A;  1KFY A;  2V5Z A;  2X8C A;  4YSZ A;  3E1T A;  3UP5 A;  1V59 A;  3P1W A;  1MO9 A;  2YVJ A;  3ABV A;  5BUL A;  4GUV A;  4NEW A;  4NZH A;  1S2Y A;  4GDE A;  3NYC A;  1E39 A;  3T2Y A;  4P9S A;  5BUK A;  3AED A;  3SY4 A;  1KSU A;  5KMQ A;  4G73 A;  2X99 A;  4AOX A;  4Z2U A;  1NAA A;  1DOD A;  2YLW A;  2GQW A;  4OPU A;  1E1N A;  3DA1 A;  1GSN A;  2CDU A;  3GDN A;  3DK8 A;  4GR1 A;  2R45 A;  4NNJ A;  1E1K A;  2XLR A;  4CBQ A;  2WBA A;  4EIQ A;  2I0Z A;  5KWF A;  4B68 A;  3KA7 A;  4H7U A;  2C3D A;  1H82 A;  3DGZ A;  1IUU A;  1X31 B;  2X3N A;  2IID A;  3NLC A;  1CHU A;  1TDN A;  1FOH A;  2EQ8 A;  1GET A;  1NHP A;  2BRA A;  4TM4 A;  2YG4 A;  1GOS A;  2FJD A;  1H7W A;  1K4Q A;  3RP7 A;  4A6N B;  3D1C A;  4J33 A;  4JY2 A;  3AYJ A;  3GYX A;  1CF3 A;  2XFQ A;  2DKH A;  3GMC A;  3UCL A;  1CC6 A;  3GRS A;  4ZCD A;  1ZKQ A;  2BAC A;  4LA1 A;  3IHG A;  4IA6 A;  4NWZ A;  3RED A;  4EQW A;  1H81 A;  5KVH A;  1E7P A;  2WES A;  2ZZC A;  2WET A;  3KPK A;  3M12 A;  2QCU A;  2GB0 A;  4Y4L A;  4DGK A;  1BZL A;  1QO8 A;  2JBV A;  4XXG A;  2DKI A;  1O95 A;  1COY A;  3CMM A;  4U2L A;  3KVE A;  3AE2 A;  3CNS A;  4X9M A;  4D04 A;  4Z26 A;  2BYB A;  5C2T A;  1DNC A;  3UTE A;  3BNU A;  2XDO A;  1PBB A;  1VDC A;  1GRT A;  3DJG X;  1RP0 A;  3G5S A; 
#chains in the Genus database with same CATH homology
 1ZMC A;  4CCR A;  3C96 A;  1GT8 A;  2BC1 A;  4J2W A;  2WP6 A;  3UKP A;  2F5Z A;  2FBW A;  3AEC A;  3GWF A;  3KU9 A;  4OVI A;  1BGN A;  3EAO A;  3QJ4 A;  4CY8 A;  1FL2 A;  1K0I A;  3HYV A;  3T37 A;  3ICS A;  2Q7V A;  2R4E A;  3NRN A;  4A9W A;  1TDO A;  2GQF A;  3M13 A;  1S2Q A;  4U8O A;  2YAU A;  1MOK A;  4GCM A;  4H4Y A;  1H6V A;  2VRM A;  3ZDN A;  4CCQ A;  1EL5 A;  1E6E A;  2GR1 A;  2YLX A;  2YQU A;  4TLX A;  2VRL A;  2YG5 A;  3H8L A;  5HY5 A;  5JCL A;  3CGB A;  5J7X A;  3QVR A;  1JRX A;  2J3N A;  1QLB A;  3UOZ A;  2C70 A;  2XVH A;  4REK A;  4H4V A;  3UKH A;  1GXF A;  1BWC A;  2OA1 A;  5EBK A;  2YG7 A;  3AEG A;  2WDQ A;  2GH5 A;  4RG3 A;  2BS2 A;  3RP8 A;  1L9C A;  4HA6 A;  3WE0 A;  1XAN A;  2XVF A;  3RHA A;  1PJ5 A;  4YT0 A;  4GF7 A;  3LZX A;  5KOW A;  1KF6 A;  3CPH G;  2XFU A;  4TM3 A;  4AT0 A;  3UTF A;  5IPY A;  1OJ9 A;  3O0H A;  3V76 A;  4H2N A;  2B7R A;  4K8D A;  3VRB A;  2R0G A;  1JEH A;  2V6O A;  3GD3 A;  3GRT A;  3ITJ A;  1B4V A;  1ZY8 A;  1PXC A;  3P4S A;  3P4R A;  2VVM A;  2Y6R A;  1PXB A;  2Z5Y A;  2XFP A;  3KKJ A;  1E1L A;  2H88 A;  4O5Q A;  1NEK A;  1LJ1 A;  3H8I A;  3ALM A;  3K7Q X;  2RGJ A;  1N4V A;  2PYX A;  3FBS A;  3CIR A;  3B3R A;  3DGH A;  1M6I A;  3P4P A;  3LZW A;  1OJD A;  3OZ2 A;  4H4Q A;  4OPD A;  2OLN A;  3AE6 A;  1L9E A;  4JY3 A;  5EB5 A;  2BK5 A;  3SFE A;  3SXI A;  2YR6 A;  1YQ3 A;  2Z5X A;  4EQX A;  4LII A;  4Z24 A;  4YTN A;  2XCG A;  2ARD A;  4XWZ A;  2VQB A;  1JRZ A;  3G5R A;  4UDQ A;  3K7T A;  4UP3 A;  4M52 A;  1FCD A;  2GMJ A;  1Y0P A;  3CND A;  3DME A;  4NEV A;  4OPL A;  5JCK A;  2V3A A;  3NK2 X;  4EMI A;  4OPG A;  2JB1 A;  4J56 A;  5L46 A;  1NPX A;  4RG4 A;  2V3B A;  2WPE A;  5DBJ A;  4CNK A;  4NTE A;  2BXR A;  1F3P A;  2AR8 A;  2TMD A;  5ER0 A;  3GWD A;  4CNJ A;  3G5Q A;  1QJD A;  1EL7 A;  1JNR A;  2BC0 A;  3ATQ A;  1H7X A;  3AD7 B;  4OPT A;  4H4T A;  4OCG A;  3SZ0 A;  3SZW A;  1PXA A;  1ZK7 A;  2EQ7 A;  2WOI A;  1XPQ A;  4E0V A;  1O5W A;  1JRY A;  3UKK A;  2OLO A;  2WU2 A;  3FMW A;  3NYF A;  4AP3 A;  4Y4N A;  1CBO A;  3VRD B;  1M64 A;  1GEU A;  2RGH A;  2CFY A;  3BHF A;  3AEF A;  2C3C A;  1P2E A;  1GRH A;  2UZZ A;  3AEB A;  2VVL G;  2Q0K A;  2YLS A;  2JKC A;  3CNT A;  1K0J A;  1D5T A;  2WOW A;  3VQR A;  1AOG A;  4H4S A;  3CPJ G;  1LQT A;  2BS4 A;  2OAL A;  2ZZB A;  3ATR A;  3IF9 A;  2YVG A;  4XWR A;  2FJE A;  3V3N A;  2BAB A;  4C3X A;  2YR4 A;  2B9X A;  2BRY A;  2GR0 A;  3PVC A;  1LV0 A;  2WU5 A;  5FS6 A;  3V3O A;  1O94 A;  3VR8 A;  3B6D A;  3ICT A;  1Y56 A;  1JU2 A;  1ZOY A;  4U8P A;  3T2K A;  1YY5 A;  3NN0 X;  3LAD A;  4A79 A;  4C3Y A;  1GRF A;  2XFO A;  1GRE A;  2FJB A;  2XYO A;  3FG2 P;  3NK1 X;  1PJ7 A;  1GRG A;  3UTH A;  4IA5 A;  3QFB A;  2C7G A;  1GPE A;  3GSI A;  2YLT A;  4AT2 A;  5KRQ A;  4O5U A;  4GDP A;  4II2 A;  2YG6 A;  3P4Q A;  4A5L A;  1DOE A;  3SQP A;  3H4K A;  3UOX A;  1DJQ A;  3AE8 A;  3NIX A;  3RP6 A;  3DJD A;  4ECH A;  1ZP0 A;  1NG4 A;  4A99 A;  1PS9 A;  1PJ6 A;  1YQZ A;  3NN6 X;  3GYI A;  2V61 A;  1D4D A;  4B65 A;  3Q9T A;  2YM2 A;  2C4C A;  3SZF A;  4G9K A;  1K0L A;  1L9D A;  1TYP A;  3CNJ A;  4YSH A;  4B64 A;  1CJ4 A;  1PBE A;  2WDR A;  3UKQ A;  1VG0 A;  4K2X A;  2R9Z A;  3F8R A;  4II3 A;  1B8S A;  3COX A;  2E1M A;  5FS7 A;  1Q1W A;  2C64 A;  1B5Q A;  1N4W A;  1NEN A;  1Z6L A;  3SYI A;  1CJ3 A;  2EQ6 A;  2OAM A;  3M0O A;  3LXD A;  1ZX9 A;  3HYW A;  1DOB A;  2A87 A;  3JSK A;  3CGD A;  4FK1 C;  4DSG A;  1IJH A;  4U8M A;  4JQ9 A;  5TR3 A;  4K5S A;  2YM1 A;  3S5W A;  4YKG A;  4LU6 A;  4YTP A;  2R4J A;  3AE5 A;  1EL8 A;  4D03 A;  3F8D A;  3II4 A;  1NG3 A;  2YLR A;  3ALL A;  1NHQ A;  2WS3 A;  2WP9 A;  2BK4 A;  2WPF A;  4A7A A;  2WP5 A;  5M10 A;  4CY6 A;  5U63 A;  4H2Q A;  1D4E A;  1KDG A;  1RYI A;  4TM0 A;  3SX6 A;  1GAL A;  2R0C A;  5GSN A;  3UKA A;  5KMR A;  4OPC A;  3EF6 A;  1VRQ B;  2QAE A;  5HYM A;  3ALJ A;  4UDR A;  2C72 A;  2BS3 A;  4AOS A;  1PDH A;  1KSS A;  1HYU A;  4H50 A;  2GR2 A;  3NTA A;  3NYE A;  2XVJ A;  4JNA A;  4A6N A;  3DK9 A;  2BK3 A;  4C77 A;  1RSG A;  1N4U A;  2YLZ A;  4U2T A;  1ONF A;  4YKF A;  3DJJ A;  1N1P A;  4PAA A;  1EBD A;  4FX9 A;  1CL0 A;  4GAV A;  2Y6Q A;  5FS9 A;  1EL9 A;  1JNZ A;  3NGC X;  2ACZ A;  3QVP A;  1JOA A;  4Z44 A;  3AYL A;  2APG A;  3QSM A;  3UKL A;  5C3J A;  1Y56 B;  2C73 A;  1Q1R A;  4JN9 A;  1GRB A;  2XLP A;  1PBC A;  4NTC A;  2B9W A;  3UOV A;  2WOV A;  3EAN A;  5KNL A;  1ZOV A;  2CVJ A;  3URH A;  4FDC B;  1PHH A;  4I59 A;  2RGO A;  2WDV A;  3CGE A;  3SM8 A;  2VOU A;  2ZZ0 A;  2XLT A;  2GRT A;  1LTX R;  1GER A;  3PO7 A;  1F6M A;  4B66 A;  4A65 A;  5KOX A;  2IVD A;  2A8X A;  3HYX A;  2C67 A;  4H4X A;  4USR A;  4OPI A;  3AXB A;  1DOC A;  1FEA A;  2IVE A;  2B7S A;  4BK3 A;  1FEB A;  2YWL A;  1BGJ A;  1YQ4 A;  4Z43 A;  4ADW A;  3LB8 A;  2E5V A;  1IUW A;  2VQ7 A;  2GEW A;  3T2Z A;  4H4U A;  4APN A;  1D7L A;  2Q0L A;  2QA1 A;  3QSS A;  5HXI A;  3Q6J A;  3SFD A;  2YR5 A;  3VRA A;  1TYT A;  2JK6 A;  1NDA A;  2YG3 A;  4X9N A;  3AE1 A;  1W4X A;  2BXS A;  5KMS A;  1IUX A;  3L1R A;  3I6D A;  3GMB A;  3T14 A;  3CNP A;  4C74 A;  3AYI A;  4Y4M A;  4DNA A;  5J60 A;  1FEC A;  3T31 A;  3C4N A;  4U8J A;  5GRT A;  1LQU A;  1P2H A;  4G6G A;  4K7Z A;  3NTD A;  3GDP A;  5U1O A;  1D7Y A;  1Q9I A;  1IUV A;  4YSX A;  4U8L A;  1NHS A;  5KVI A;  1H83 A;  1MXT A;  3BI5 A;  3GD4 A;  2RAB A;  3DH9 A;  3NHO X;  5U25 A;  3AEE A;  4BUR A;  3AE9 A;  3PS9 A;  2GVC A;  4B1B A;  2C65 A;  2R0P A;  3BNM A;  1H86 A;  4U8K A;  5JCM A;  3ISH A;  4NTD A;  2BCG G;  3EPT A;  4Z2T A;  2W0H A;  3NG7 X;  3IHM A;  5HHF A;  1GRA A;  2Q6U A;  4GAP A;  5M0Z A;  1SEZ A;  3RNM A;  1E1M A;  1CC4 A;  2AQJ A;  2CUL A;  3AD8 B;  1BF3 A;  3QFA A;  2B76 A;  4H4Z A;  4BV6 A;  3SZC A;  2X8H A;  1LPF A;  4B67 A;  2E4G A;  2GV8 A;  4ICY A;  3CTY A;  1KNR A;  3CGC A;  4USQ A;  4CRT A;  5KXJ A;  1IUT A;  2VVL A;  3NKS A;  4MJW A;  2FJA A;  2GAG B;  3L8K A;  4BJZ A;  3GYJ A;  4FK1 A;  4H4P A;  3R9U A;  4H2R A;  4C5O A;  4EMW A;  2BCP A;  1KNP A;  3BI4 A;  1TDE A;  5IQ4 A;  3UOY A;  3NK0 X;  4EMJ A;  2BA9 A;  3K7M X;  4ZN0 A;  2JAE A;  1S3B A;  3NT6 A;  3AWI A;  4YWO A;  4WX1 A;  2GF3 A;  4X4J A;  4J34 A;  1OJA A;  4K22 A;  3ZYX A;  4EM4 A;  3QSE A;  4BK2 A;  3FIM B;  3I3L A;  2PHH A;  3NNE A;  2WQY A;  2VZ2 A;  1IUS A;  3KLJ A;  3LJP A;  4TLZ A;  3C4A A;  5EOW A;  4YXD A;  3K30 A;  1GES A;  2NVK X;  1PBF A;  3FPZ A;  4EIP A;  5EB4 A;  1CC2 A;  3LOV A;  3T0K A;  1CJC A;  1TRB A;  2GAH B;  4RSL A;  3S61 A;  2A89 A;  1DJN A;  1NHR A;  2AAQ A;  4B69 A;  4YSY A;  3DJE A;  1VQW A;  4IVO B;  5IQ1 A;  1GTE A;  2XVI A;  3DK4 A;  1XHC A;  5CQF A;  4WCT A;  5FMH A;  3D8X A;  5JCN A;  4JDR A;  4HB9 A;  3BI2 A;  2WPC A;  3AD9 B;  4PAB A;  1ZMD A;  1GTH A;  3ADA B;  1B37 A;  1D4C A;  3AE7 A;  5KMP A;  2B9Y A;  2GMH A;  4Z2R A;  3UTG A;  1ELI A;  2TPR A;  2X8G A;  3AEA A;  1LVL A;  1ZDL A;  3BHK A;  3KD9 A;  2V60 A;  3AB1 A;  4G74 A;  3HZL A;  1L0V A;  4ZCC A;  4AP1 A;  1VG9 A;  2C75 A;  2C66 A;  5BVA A;  3CN8 A;  3ICR A;  2QA2 A;  2XLU A;  4TM1 A;  4I58 A;  1UKV G;  2JB2 A;  3F8P A;  4UDP A;  3KPF A;  3P9U A;  3IC9 A;  4G6H A;  2YVF A;  1H84 A;  1XDI A;  4U8N A;  1OJT A;  2H89 A;  1PBD A;  1TDF A;  3CPI G;  4EM3 A;  4Z25 A;  4IV9 A;  3VR9 A;  4B63 A;  3AE3 A;  2XVE A;  4H2P A;  5FS8 A;  4H4W A;  4YTM A;  4U2S A;  1F8W A;  2XLS A;  4J36 A;  4EQS A;  1F8R A;  1BKW A;  4KPR A;  4J31 A;  1F8S A;  2WEU A;  3SGL A;  1TDK A;  1DXL A;  4GRT A;  3AE4 A;  4N9X A;  2WHD A;  2GR3 A;  4U8I A;  5CKU A;  4H4R A;  3UP4 A;  2X50 A;  4IVM B;  3NH3 X;  4BK1 A;  2R46 A;  5BRT A;  5LV9 A;  2NPX A;  1S3E A;  4JNQ A;  2EQ9 A;  4K5R A;  1CJ2 A;  1PN0 A;  1GND A;  5JCI A;  2ZBW A;  3IWA A;  2HQM A;  3OC4 A;  4KX6 A;  4DSH A;  2JB3 A;  1YKJ A;  2XFN A;  2O9Z A;  1OJC A;  4J57 A;  4BJY A;  4EQR A;  1REO A;  1GV4 A;  2C76 A;  3UKF A;  1KFY A;  2V5Z A;  2X8C A;  4YSZ A;  3E1T A;  3UP5 A;  1V59 A;  3P1W A;  1MO9 A;  2YVJ A;  3ABV A;  5BUL A;  4GUV A;  4NEW A;  4NZH A;  1S2Y A;  4GDE A;  3NYC A;  1E39 A;  3T2Y A;  4P9S A;  5BUK A;  3AED A;  3SY4 A;  1KSU A;  5KMQ A;  4G73 A;  2X99 A;  4AOX A;  4Z2U A;  1NAA A;  1DOD A;  2YLW A;  2GQW A;  4OPU A;  1E1N A;  3DA1 A;  1GSN A;  2CDU A;  3GDN A;  3DK8 A;  4GR1 A;  2R45 A;  4NNJ A;  1E1K A;  2XLR A;  4CBQ A;  2WBA A;  4EIQ A;  2I0Z A;  5KWF A;  4B68 A;  3KA7 A;  4H7U A;  2C3D A;  1H82 A;  3DGZ A;  1IUU A;  1X31 B;  2X3N A;  2IID A;  3NLC A;  1CHU A;  1TDN A;  1FOH A;  2EQ8 A;  1GET A;  1NHP A;  2BRA A;  4TM4 A;  2YG4 A;  1GOS A;  2FJD A;  1H7W A;  1K4Q A;  3RP7 A;  4A6N B;  3D1C A;  4J33 A;  4JY2 A;  3AYJ A;  3GYX A;  1CF3 A;  2XFQ A;  2DKH A;  3GMC A;  3UCL A;  1CC6 A;  3GRS A;  4ZCD A;  1ZKQ A;  2BAC A;  4LA1 A;  3IHG A;  4IA6 A;  4NWZ A;  3RED A;  4EQW A;  1H81 A;  5KVH A;  1E7P A;  2WES A;  2ZZC A;  2WET A;  3KPK A;  3M12 A;  2QCU A;  2GB0 A;  4Y4L A;  4DGK A;  1BZL A;  1QO8 A;  2JBV A;  4XXG A;  2DKI A;  1O95 A;  1COY A;  3CMM A;  4U2L A;  3KVE A;  3AE2 A;  3CNS A;  4X9M A;  4D04 A;  4Z26 A;  2BYB A;  5C2T A;  1DNC A;  3UTE A;  3BNU A;  2XDO A;  1PBB A;  1VDC A;  1GRT A;  3DJG X;  1RP0 A;  3G5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...