5KMSA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 2.5 angstrom resolution.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
394
structure length
394
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
total genus 117
structure length 394
sequence length 394
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmsA00
3KPKA 3SZFA 4GAPA 3T31A 4GAVA 3HYWA 5KMSA 3SXIA 3SY4A 3T0KA 3HYVA 3T14A 3SZ0A 5KMPA 4G6HA 4G74A 3SX6A 4G73A 5KMRA 3HYXA 3SZWA 4G6GA 4G9KA 3T2ZA 5KMQA 3T2YA 3SZCA 3T2KA 3SYIA 4NWZA
chains in the Genus database with same CATH superfamily
5J7XA 4DSGA 4XWZA 4EMJA 3ABVA 2C66A 3AYIA 3AE9A 4JNAA 5KOXA 2JB3A 2RGOA 5EBKA 2H88A 1OJ9A 5KOWA 3AYLA 3CGBA 3FPZA 4FK1A 5EOWA 2VVMA 3H8LA 4GDEA 2WP9A 3AE6A 2WEUA 1IUUA 2GEWA 2XFPA 3SX6A 3UTGA 3LZXA 2VRMA 4B64A 2C75A 2OLNA 1PXBA 1E1NA 3NKSA 5HY5A 2B9XA 2TMDA 4YKFA 5U1OA 1D4DA 2EQ8A 3UKPA 4EMIA 5U25A 2BC1A 3DK8A 1PBBA 4A5LA 1GREA 2R0GA 5BULA 4UDQA 4EQWA 2C64A 4BURA 4TM0A 3DJDA 3AYJA 2WP5A 1TDFA 2GH5A 2WHDA 1KSUA 2C76A 3M13A 3QVRA 4U8OA 4CNJA 4CY6A 3GDNA 4ICYA 4H4ZA 4J34A 1D5TA 1H84A 1NPXA 1B37A 2YG4A 3V3NA 1B5QA 2FJBA 2FJEA 3B3RA 3C4AA 2RABA 2CULA 2YLSA 4AOSA 5KMRA 3GYIA 1DJNA 1K0JA 1CC2A 2EQ6A 3VQRA 3ICSA 1O5WA 3T2ZA 5BVAA 3AEDA 4U8NA 3SZCA 4OPDA 2YVFA 3T2KA 2GAHB 4H4TA 1FOHA 3UP5A 1F3PA 1D4CA 3SQPA 3KPKA 1L9EA 4OPGA 3CTYA 4H4WA 4CBQA 2WPCA 1JRXA 1NHQA 2B7SA 2ACZA 3HZLA 1REOA 2B76A 2XFQA 5KXJA 1K0LA 3SY4A 3RP8A 2BABA 5FS6A 4EIPA 2JB2A 2C65A 2CVJA 3AE3A 1MO9A 2V60A 4OPLA 2XVIA 3T14A 3E1TA 2Y6RA 1Q9IA 1ZOYA 4EQRA 4ADWA 1FL2A 2CFYA 3EF6A 3P4QA 1RSGA 2DKHA 3NIXA 4IA6A 3DJJA 3NH3X 3AD9B 1GERA 3DGZA 3CNTA 3H4KA 4B68A 3CPJG 2FJAA 3ALMA 1ZX9A 1JNRA 4AT2A 1OJDA 2GRTA 2XFUA 5CKUA 1OJAA 4WX1A 3T37A 3GD4A 4Z2UA 3ADAB 4O5UA 4EIQA 1XPQA 1DODA 4C3YA 3DK4A 4NWZA 2WDRA 4U8LA 4AP3A 3CPHG 2V5ZA 3H8IA 3QSMA 4Z43A 4KPRA 3L1RA 4BJZA 4H4QA 3LB8A 2Z5YA 1BGNA 4H2QA 2C72A 1GPEA 4H4XA 5ER0A 2IIDA 1DOCA 3O0HA 4YSHA 2C7GA 2YQUA 4II3A 1EL5A 2FBWA 2YG3A 3KPFA 1JOAA 1S3EA 2UZZA 2XLRA 4J33A 4RG3A 3URHA 4C74A 1LVLA 5FMHA 4J56A 1ZY8A 2A89A 5L46A 4RSLA 1IUSA 2X99A 3HYXA 4H4SA 1E1KA 3UOXA 4MJWA 3ZDNA 4O5QA 3VRDB 4LIIA 3ISHA 4OPCA 4Y4LA 3DMEA 3VR8A 2YLZA 2WBAA 4TM3A 1YY5A 1CC6A 2WQYA 3VRBA 2R45A 3RHAA 1O94A 3NTDA 2BRAA 3AEBA 3LZWA 4GAPA 3C96A 4U8JA 1ELIA 5KMSA 3CNSA 4BK2A 4U2SA 1CJ2A 5JCIA 2IVEA 3BI4A 2YG7A 1IUVA 2B9WA 1EBDA 1IJHA 4CNKA 3AEEA 3F8DA 4Z24A 4E0VA 5KVHA 3R9UA 4ZCDA 1EL8A 3CN8A 2YM2A 2YG6A 4DSHA 2W0HA 1L0VA 1VQWA 4X9MA 3UTFA 5JCNA 4J36A 2XVJA 3CGDA 3NN6X 1H6VA 2JB1A 2QAEA 3S61A 2B9YA 1QLBA 2A8XA 3P4PA 2WOVA 3SXIA 4A7AA 4YT0A 4PAAA 2VQBA 1PXAA 1UKVG 2VQ7A 4NTDA 2X8CA 4ECHA 3AD8B 1PBEA 1JU2A 2OAMA 3P9UA 3NG7X 4I59A 4BK1A 1LTXR 3CIRA 3M12A 5EB5A 4LU6A 2Q0KA 4B1BA 1YQ3A 3PS9A 1FEAA 2BXSA 2C70A 4OCGA 5IQ4A 5JCLA 5BUKA 4II2A 3I6DA 4U8PA 4YSYA 5TR3A 2BS3A 5FS7A 4HB9A 4A79A 2BS2A 4IA5A 3P4RA 4EM4A 1GSNA 2XLSA 2A87A 2BRYA 4JY3A 4GAVA 4GCMA 2RGHA 1E6EA 4NEWA 2QA1A 3T0KA 1LV0A 2YWLA 1DJQA 1F8WA 1ZMCA 3F8PA 3KU9A 3B6DA 4TM4A 4H4UA 2X8HA 3D1CA 2WU2A 2R9ZA 1TDNA 5M10A 2V61A 3PVCA 3AE8A 3K7MX 4UP3A 1N4WA 4U8MA 1GETA 1H7WA 3UOYA 4JDRA 3BNMA 3KVEA 1GRAA 2C67A 3AE5A 1CJCA 4H2RA 2XLTA 2PHHA 1NDAA 1H86A 1P2HA 5EB4A 1ZDLA 1B8SA 2BS4A 3QVPA 4UDRA 2WDQA 4EQSA 2WS3A 4B67A 2GQWA 2Q6UA 1NG3A 2Q7VA 1Z6LA 2R0CA 3UKKA 4GF7A 4X4JA 4P9SA 4DGKA 3HYWA 1S2YA 2WU5A 3GSIA 3P1WA 1PXCA 4JNQA 2ZZCA 3FBSA 2OALA 4ZCCA 3UTEA 1NHPA 2F5ZA 4A65A 4B66A 1D7LA 3GMCA 4B65A 4G6HA 3LXDA 4YTPA 1S3BA 3DH9A 1TDEA 3FG2P 2APGA 4NEVA 2OA1A 3GD3A 2XCGA 2JK6A 3AD7B 4K7ZA 4USRA 1JRZA 1GNDA 1M64A 2BCGG 3P4SA 3FMWA 1N4UA 2X50A 2H89A 4H2NA 5KMQA 2WPFA 1PHHA 3FIMB 2GVCA 2ZZBA 4A9WA 3LADA 2AR8A 3JSKA 5LV9A 4H7UA 3IF9A 3UKQA 3M0OA 4N9XA 3WE0A 3BI2A 3NYFA 4PABA 1GT8A 1YQ4A 2VVLG 4NTEA 3T31A 3CNJA 1LJ1A 3SM8A 1CJ4A 1W4XA 4XXGA 4H2PA 3Q9TA 5C3JA 3UKHA 2QA2A 1F8SA 1LPFA 4HA6A 1E7PA 4IVMB 4B63A 1TRBA 1X31B 3G5SA 4G73A 3LOVA 3REDA 4U8KA 3K30A 1GTHA 5JCKA 3QFBA 5GSNA 1GV4A 4A6NA 4APNA 1EL9A 3UTHA 4H4RA 2J3NA 1JNZA 3LJPA 1F6MA 3ICTA 2HQMA 4Z25A 2WOWA 2YVJA 3SYIA 1BKWA 3NYCA 1OJTA 1GRHA 3CGCA 4Y4NA 2C73A 1Y56A 4OPTA 3AB1A 3BI5A 2C3DA 1GRBA 1P2EA 3AECA 1NENA 1ZMDA 2PYXA 3DA1A 2C4CA 2E5VA 3BHKA 1ZK7A 3CGEA 3ALJA 1CF3A 3AXBA 3D8XA 3SZ0A 1GTEA 1NEKA 1TDKA 4D03A 1ONFA 5GRTA 1RP0A 2X8GA 3NK0X 4LA1A 3GRTA 5U63A 1O95A 4G6GA 1BF3A 5C2TA 1NHSA 4AP1A 4H50A 2BACA 2XVHA 4YXDA 4C5OA 2NPXA 4JQ9A 1PJ7A 4Z2RA 4NNJA 2R0PA 2AQJA 4YTNA 1PDHA 1CHUA 3KA7A 4EMWA 2BC0A 2NVKX 3GDPA 2VOUA 3IC9A 2B7RA 4YSXA 1CL0A 3KLJA 4FDCB 2GR1A 4B69A 3NK1X 3AE1A 1PBFA 5JCMA 3UCLA 3SFEA 1H83A 4WCTA 3UOZA 1S2QA 5IPYA 4AT0A 2GMHA 3AEFA 5KMPA 3CPIG 2TPRA 1Y56B 4CY8A 4YSZA 1GXFA 2QCUA 3SZWA 4EQXA 1AOGA 1BZLA 1DNCA 2GAGB 1YKJA 1F8RA 2JAEA 2BK3A 4K2XA 2V3AA 4GUVA 3VRAA 1VRQB 4GDPA 2I0ZA 2GV8A 4U8IA 3IHMA 3NN0X 4JY2A 2WDVA 1H81A 3ALLA 2R4EA 3GRSA 3VR9A 2EQ9A 4J31A 2YR4A 4AOXA 1E39A 3NYEA 2YLWA 3UOVA 1VDCA 3PO7A 5KRQA 2YLXA 2WOIA 3OZ2A 1QJDA 3SGLA 3V76A 3S5WA 3RP7A 4I58A 2GMJA 3UKFA 1Y0PA 3KD9A 1TDOA 3CNPA 3EAOA 3CMMA 4G74A 1DOEA 1JEHA 2YG5A 4XWRA 2WETA 4U2TA 1MOKA 2DKIA 2XFOA 1H7XA 1MXTA 2JKCA 3GYJA 1E1LA 5HXIA 2XLPA 1KF6A 4KX6A 3ATRA 3T2YA 3QFAA 1N1PA 3ATQA 3C4NA 3II4A 3DGHA 4U2LA 1E1MA 2X3NA 2R4JA 2GR2A 1HYUA 4OPUA 4K22A 4YWOA 1Q1WA 5FS9A 1XDIA 3SFDA 1YQZA 3RNMA 1PBCA 1GRTA 3AE7A 2BK5A 2YM1A 1K0IA 4NTCA 5HYMA 2AAQA 4RG4A 1PN0A 1ZP0A 3KKJA 4TLZA 4Y4MA 2YLRA 3Q6JA 4ZN0A 2GQFA 4GRTA 1CJ3A 5KNLA 1TYTA 1BGJA 1QO8A 4D04A 1PBDA 3GYXA 5FS8A 3DK9A 1VG0A 3NRNA 2XLUA 4JN9A 3K7QX 4REKA 1IUWA 4TM1A 5KVIA 3ZYXA 3QSSA 4CCRA 5DBJA 1VG9A 3GWDA 2ZZ0A 4BK3A 1PS9A 3NT6A 4CRTA 4DNAA 1CC4A 1DXLA 1IUXA 2BK4A 2BYBA 2C3CA 2XYOA 1V59A 5KWFA 4K8DA 3EANA 3CNDA 4YTMA 4BJYA 4A6NB 1NG4A 2E1MA 1FEBA 3ICRA 1H82A 2Q0LA 3V3OA 2ZBWA 2Z5XA 4M52A 1LQTA 3UKLA 4C77A 3AE4A 2ARDA 3QJ4A 4NZHA 2V3BA 2O9ZA 4K5RA 3G5RA 1COYA 1KDGA 1SEZA 2VVLA 3AEGA 2WP6A 2XFNA 3RP6A 3DJGX 2R46A 1K4QA 1D7YA 2YLTA 4FX9A 4H4YA 4Z44A 4X9NA 2RGJA 3IWAA 4IV9A 4UDPA 1PJ5A 5CQFA 1GEUA 3IHGA 3COXA 4EM3A 3NHOX 4A99A 2GR0A 1BWCA 3GWFA 2WPEA 3NK2X 2BA9A 4C3XA 3SZFA 4OPIA 3GMBA 3ITJA 2OLOA 2XDOA 1GRGA 4OVIA 1CBOA 1L9CA 3HYVA 5IQ1A 3K7TA 1Q1RA 1ZKQA 1XANA 3BHFA 3AEAA 2YR5A 3UP4A 1RYIA 4FK1C 3F8RA 1XHCA 1FCDA 5BRTA 1OJCA 3AE2A 4J2WA 4YKGA 4IVOB 3EPTA 2XVFA 2E4GA 1D4EA 1KNRA 2VRLA 3NLCA 4G9KA 4J57A 3UKAA 3NTAA 1IUTA 1GESA 3G5QA 4USQA 4Z2TA 2GR3A 4CCQA 1DOBA 2JBVA 4H4PA 1EL7A 1GALA 1B4VA 3QSEA 2YVGA 4Z26A 1KSSA 3DJEA 1JRYA 1L9DA 1N4VA 2Y6QA 1GOSA 1KFYA 3L8KA 4H4VA 2IVDA 1NHRA 2BXRA 3AWIA 2GF3A 1PJ6A 5HHFA 2FJDA 4BV6A 4TLXA 2EQ7A 1M6IA 2WESA 2XVEA 1KNPA 2YAUA 2YR6A 3OC4A 5J60A 4GR1A 1FECA 2V6OA 1ZOVA 2GB0A 3BNUA 1GRFA 3I3LA 1NAAA 2VZ2A 1LQUA 1TYPA 3NGCX 5M0ZA 3NNEA 2BCPA 2CDUA 4K5SA
chains in the Genus database with same CATH topology
5J7XA 4DSGA 4XWZA 4EMJA 3ABVA 2C66A 3AYIA 3AE9A 4JNAA 5KOXA 2JB3A 2RGOA 5EBKA 2H88A 1OJ9A 5KOWA 3AYLA 3CGBA 3FPZA 4FK1A 5EOWA 2VVMA 3H8LA 4GDEA 2WP9A 3AE6A 2WEUA 1IUUA 2GEWA 2XFPA 3SX6A 3UTGA 3LZXA 2VRMA 4B64A 2C75A 2OLNA 1PXBA 1E1NA 3NKSA 5HY5A 2B9XA 2TMDA 4YKFA 5U1OA 1D4DA 2EQ8A 3UKPA 4EMIA 5U25A 2BC1A 3DK8A 1PBBA 4A5LA 1GREA 2R0GA 5BULA 4UDQA 4EQWA 2C64A 4BURA 4TM0A 3DJDA 3AYJA 2WP5A 1TDFA 2GH5A 2WHDA 1KSUA 2C76A 3M13A 3QVRA 4U8OA 4CNJA 4CY6A 3GDNA 4ICYA 4H4ZA 4J34A 1D5TA 1H84A 1NPXA 1B37A 2YG4A 3V3NA 1B5QA 2FJBA 2FJEA 3B3RA 3C4AA 2RABA 2CULA 2YLSA 4AOSA 5KMRA 3GYIA 1DJNA 1K0JA 1CC2A 2EQ6A 3VQRA 3ICSA 1O5WA 3T2ZA 5BVAA 3AEDA 4U8NA 3SZCA 4OPDA 2YVFA 3T2KA 2GAHB 4H4TA 1FOHA 3UP5A 1F3PA 1D4CA 3SQPA 3KPKA 1L9EA 4OPGA 3CTYA 4H4WA 4CBQA 2WPCA 1JRXA 1NHQA 2B7SA 2ACZA 3HZLA 1REOA 2B76A 2XFQA 5KXJA 1K0LA 3SY4A 3RP8A 2BABA 5FS6A 4EIPA 2JB2A 2C65A 2CVJA 3AE3A 1MO9A 2V60A 4OPLA 2XVIA 3T14A 3E1TA 2Y6RA 1Q9IA 1ZOYA 4EQRA 4ADWA 1FL2A 2CFYA 3EF6A 3P4QA 1RSGA 2DKHA 3NIXA 4IA6A 3DJJA 3NH3X 3AD9B 1GERA 3DGZA 3CNTA 3H4KA 4B68A 3CPJG 2FJAA 3ALMA 1ZX9A 1JNRA 4AT2A 1OJDA 2GRTA 2XFUA 5CKUA 1OJAA 4WX1A 3T37A 3GD4A 4Z2UA 3ADAB 4O5UA 4EIQA 1XPQA 1DODA 4C3YA 3DK4A 4NWZA 2WDRA 4U8LA 4AP3A 3CPHG 2V5ZA 3H8IA 3QSMA 4Z43A 4KPRA 3L1RA 4BJZA 4H4QA 3LB8A 2Z5YA 1BGNA 4H2QA 2C72A 1GPEA 4H4XA 5ER0A 2IIDA 1DOCA 3O0HA 4YSHA 2C7GA 2YQUA 4II3A 1EL5A 2FBWA 2YG3A 3KPFA 1JOAA 1S3EA 2UZZA 2XLRA 4J33A 4RG3A 3URHA 4C74A 1LVLA 5FMHA 4J56A 1ZY8A 2A89A 5L46A 4RSLA 1IUSA 2X99A 3HYXA 4H4SA 1E1KA 3UOXA 4MJWA 3ZDNA 4O5QA 3VRDB 4LIIA 3ISHA 4OPCA 4Y4LA 3DMEA 3VR8A 2YLZA 2WBAA 4TM3A 1YY5A 1CC6A 2WQYA 3VRBA 2R45A 3RHAA 1O94A 3NTDA 2BRAA 3AEBA 3LZWA 4GAPA 3C96A 4U8JA 1ELIA 5KMSA 3CNSA 4BK2A 4U2SA 1CJ2A 5JCIA 2IVEA 3BI4A 2YG7A 1IUVA 2B9WA 1EBDA 1IJHA 4CNKA 3AEEA 3F8DA 4Z24A 4E0VA 5KVHA 3R9UA 4ZCDA 1EL8A 3CN8A 2YM2A 2YG6A 4DSHA 2W0HA 1L0VA 1VQWA 4X9MA 3UTFA 5JCNA 4J36A 2XVJA 3CGDA 3NN6X 1H6VA 2JB1A 2QAEA 3S61A 2B9YA 1QLBA 2A8XA 3P4PA 2WOVA 3SXIA 4A7AA 4YT0A 4PAAA 2VQBA 1PXAA 1UKVG 2VQ7A 4NTDA 2X8CA 4ECHA 3AD8B 1PBEA 1JU2A 2OAMA 3P9UA 3NG7X 4I59A 4BK1A 1LTXR 3CIRA 3M12A 5EB5A 4LU6A 2Q0KA 4B1BA 1YQ3A 3PS9A 1FEAA 2BXSA 2C70A 4OCGA 5IQ4A 5JCLA 5BUKA 4II2A 3I6DA 4U8PA 4YSYA 5TR3A 2BS3A 5FS7A 4HB9A 4A79A 2BS2A 4IA5A 3P4RA 4EM4A 1GSNA 2XLSA 2A87A 2BRYA 4JY3A 4GAVA 4GCMA 2RGHA 1E6EA 4NEWA 2QA1A 3T0KA 1LV0A 2YWLA 1DJQA 1F8WA 1ZMCA 3F8PA 3KU9A 3B6DA 4TM4A 4H4UA 2X8HA 3D1CA 2WU2A 2R9ZA 1TDNA 5M10A 2V61A 3PVCA 3AE8A 3K7MX 4UP3A 1N4WA 4U8MA 1GETA 1H7WA 3UOYA 4JDRA 3BNMA 3KVEA 1GRAA 2C67A 3AE5A 1CJCA 4H2RA 2XLTA 2PHHA 1NDAA 1H86A 1P2HA 5EB4A 1ZDLA 1B8SA 2BS4A 3QVPA 4UDRA 2WDQA 4EQSA 2WS3A 4B67A 2GQWA 2Q6UA 1NG3A 2Q7VA 1Z6LA 2R0CA 3UKKA 4GF7A 4X4JA 4P9SA 4DGKA 3HYWA 1S2YA 2WU5A 3GSIA 3P1WA 1PXCA 4JNQA 2ZZCA 3FBSA 2OALA 4ZCCA 3UTEA 1NHPA 2F5ZA 4A65A 4B66A 1D7LA 3GMCA 4B65A 4G6HA 3LXDA 4YTPA 1S3BA 3DH9A 1TDEA 3FG2P 2APGA 4NEVA 2OA1A 3GD3A 2XCGA 2JK6A 3AD7B 4K7ZA 4USRA 1JRZA 1GNDA 1M64A 2BCGG 3P4SA 3FMWA 1N4UA 2X50A 2H89A 4H2NA 5KMQA 2WPFA 1PHHA 3FIMB 2GVCA 2ZZBA 4A9WA 3LADA 2AR8A 3JSKA 5LV9A 4H7UA 3IF9A 3UKQA 3M0OA 4N9XA 3WE0A 3BI2A 3NYFA 4PABA 1GT8A 1YQ4A 2VVLG 4NTEA 3T31A 3CNJA 1LJ1A 3SM8A 1CJ4A 1W4XA 4XXGA 4H2PA 3Q9TA 5C3JA 3UKHA 2QA2A 1F8SA 1LPFA 4HA6A 1E7PA 4IVMB 4B63A 1TRBA 1X31B 3G5SA 4G73A 3LOVA 3REDA 4U8KA 3K30A 1GTHA 5JCKA 3QFBA 5GSNA 1GV4A 4A6NA 4APNA 1EL9A 3UTHA 4H4RA 2J3NA 1JNZA 3LJPA 1F6MA 3ICTA 2HQMA 4Z25A 2WOWA 2YVJA 3SYIA 1BKWA 3NYCA 1OJTA 1GRHA 3CGCA 4Y4NA 2C73A 1Y56A 4OPTA 3AB1A 3BI5A 2C3DA 1GRBA 1P2EA 3AECA 1NENA 1ZMDA 2PYXA 3DA1A 2C4CA 2E5VA 3BHKA 1ZK7A 3CGEA 3ALJA 1CF3A 3AXBA 3D8XA 3SZ0A 1GTEA 1NEKA 1TDKA 4D03A 1ONFA 5GRTA 1RP0A 2X8GA 3NK0X 4LA1A 3GRTA 5U63A 1O95A 4G6GA 1BF3A 5C2TA 1NHSA 4AP1A 4H50A 2BACA 2XVHA 4YXDA 4C5OA 2NPXA 4JQ9A 1PJ7A 4Z2RA 4NNJA 2R0PA 2AQJA 4YTNA 1PDHA 1CHUA 3KA7A 4EMWA 2BC0A 2NVKX 3GDPA 2VOUA 3IC9A 2B7RA 4YSXA 1CL0A 3KLJA 4FDCB 2GR1A 4B69A 3NK1X 3AE1A 1PBFA 5JCMA 3UCLA 3SFEA 1H83A 4WCTA 3UOZA 1S2QA 5IPYA 4AT0A 2GMHA 3AEFA 5KMPA 3CPIG 2TPRA 1Y56B 4CY8A 4YSZA 1GXFA 2QCUA 3SZWA 4EQXA 1AOGA 1BZLA 1DNCA 2GAGB 1YKJA 1F8RA 2JAEA 2BK3A 4K2XA 2V3AA 4GUVA 3VRAA 1VRQB 4GDPA 2I0ZA 2GV8A 4U8IA 3IHMA 3NN0X 4JY2A 2WDVA 1H81A 3ALLA 2R4EA 3GRSA 3VR9A 2EQ9A 4J31A 2YR4A 4AOXA 1E39A 3NYEA 2YLWA 3UOVA 1VDCA 3PO7A 5KRQA 2YLXA 2WOIA 3OZ2A 1QJDA 3SGLA 3V76A 3S5WA 3RP7A 4I58A 2GMJA 3UKFA 1Y0PA 3KD9A 1TDOA 3CNPA 3EAOA 3CMMA 4G74A 1DOEA 1JEHA 2YG5A 4XWRA 2WETA 4U2TA 1MOKA 2DKIA 2XFOA 1H7XA 1MXTA 2JKCA 3GYJA 1E1LA 5HXIA 2XLPA 1KF6A 4KX6A 3ATRA 3T2YA 3QFAA 1N1PA 3ATQA 3C4NA 3II4A 3DGHA 4U2LA 1E1MA 2X3NA 2R4JA 2GR2A 1HYUA 4OPUA 4K22A 4YWOA 1Q1WA 5FS9A 1XDIA 3SFDA 1YQZA 3RNMA 1PBCA 1GRTA 3AE7A 2BK5A 2YM1A 1K0IA 4NTCA 5HYMA 2AAQA 4RG4A 1PN0A 1ZP0A 3KKJA 4TLZA 4Y4MA 2YLRA 3Q6JA 4ZN0A 2GQFA 4GRTA 1CJ3A 5KNLA 1TYTA 1BGJA 1QO8A 4D04A 1PBDA 3GYXA 5FS8A 3DK9A 1VG0A 3NRNA 2XLUA 4JN9A 3K7QX 4REKA 1IUWA 4TM1A 5KVIA 3ZYXA 3QSSA 4CCRA 5DBJA 1VG9A 3GWDA 2ZZ0A 4BK3A 1PS9A 3NT6A 4CRTA 4DNAA 1CC4A 1DXLA 1IUXA 2BK4A 2BYBA 2C3CA 2XYOA 1V59A 5KWFA 4K8DA 3EANA 3CNDA 4YTMA 4BJYA 4A6NB 1NG4A 2E1MA 1FEBA 3ICRA 1H82A 2Q0LA 3V3OA 2ZBWA 2Z5XA 4M52A 1LQTA 3UKLA 4C77A 3AE4A 2ARDA 3QJ4A 4NZHA 2V3BA 2O9ZA 4K5RA 3G5RA 1COYA 1KDGA 1SEZA 2VVLA 3AEGA 2WP6A 2XFNA 3RP6A 3DJGX 2R46A 1K4QA 1D7YA 2YLTA 4FX9A 4H4YA 4Z44A 4X9NA 2RGJA 3IWAA 4IV9A 4UDPA 1PJ5A 5CQFA 1GEUA 3IHGA 3COXA 4EM3A 3NHOX 4A99A 2GR0A 1BWCA 3GWFA 2WPEA 3NK2X 2BA9A 4C3XA 3SZFA 4OPIA 3GMBA 3ITJA 2OLOA 2XDOA 1GRGA 4OVIA 1CBOA 1L9CA 3HYVA 5IQ1A 3K7TA 1Q1RA 1ZKQA 1XANA 3BHFA 3AEAA 2YR5A 3UP4A 1RYIA 4FK1C 3F8RA 1XHCA 1FCDA 5BRTA 1OJCA 3AE2A 4J2WA 4YKGA 4IVOB 3EPTA 2XVFA 2E4GA 1D4EA 1KNRA 2VRLA 3NLCA 4G9KA 4J57A 3UKAA 3NTAA 1IUTA 1GESA 3G5QA 4USQA 4Z2TA 2GR3A 4CCQA 1DOBA 2JBVA 4H4PA 1EL7A 1GALA 1B4VA 3QSEA 2YVGA 4Z26A 1KSSA 3DJEA 1JRYA 1L9DA 1N4VA 2Y6QA 1GOSA 1KFYA 3L8KA 4H4VA 2IVDA 1NHRA 2BXRA 3AWIA 2GF3A 1PJ6A 5HHFA 2FJDA 4BV6A 4TLXA 2EQ7A 1M6IA 2WESA 2XVEA 1KNPA 2YAUA 2YR6A 3OC4A 5J60A 4GR1A 1FECA 2V6OA 1ZOVA 2GB0A 3BNUA 1GRFA 3I3LA 1NAAA 2VZ2A 1LQUA 1TYPA 3NGCX 5M0ZA 3NNEA 2BCPA 2CDUA 4K5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPK A;  3SZF A;  4GAP A;  3T31 A;  4GAV A;  3HYW A;  5KMS A;  3SXI A;  3SY4 A;  3T0K A;  3HYV A;  3T14 A;  3SZ0 A;  5KMP A;  4G6H A;  4G74 A;  3SX6 A;  4G73 A;  5KMR A;  3HYX A;  3SZW A;  4G6G A;  4G9K A;  3T2Z A;  5KMQ A;  3T2Y A;  3SZC A;  3T2K A;  3SYI A;  4NWZ A; 
#chains in the Genus database with same CATH topology
 5J7X A;  4DSG A;  4XWZ A;  4EMJ A;  3ABV A;  2C66 A;  3AYI A;  3AE9 A;  4JNA A;  5KOX A;  2JB3 A;  2RGO A;  5EBK A;  2H88 A;  1OJ9 A;  5KOW A;  3AYL A;  3CGB A;  3FPZ A;  4FK1 A;  5EOW A;  2VVM A;  3H8L A;  4GDE A;  2WP9 A;  3AE6 A;  2WEU A;  1IUU A;  2GEW A;  2XFP A;  3SX6 A;  3UTG A;  3LZX A;  2VRM A;  4B64 A;  2C75 A;  2OLN A;  1PXB A;  1E1N A;  3NKS A;  5HY5 A;  2B9X A;  2TMD A;  4YKF A;  5U1O A;  1D4D A;  2EQ8 A;  3UKP A;  4EMI A;  5U25 A;  2BC1 A;  3DK8 A;  1PBB A;  4A5L A;  1GRE A;  2R0G A;  5BUL A;  4UDQ A;  4EQW A;  2C64 A;  4BUR A;  4TM0 A;  3DJD A;  3AYJ A;  2WP5 A;  1TDF A;  2GH5 A;  2WHD A;  1KSU A;  2C76 A;  3M13 A;  3QVR A;  4U8O A;  4CNJ A;  4CY6 A;  3GDN A;  4ICY A;  4H4Z A;  4J34 A;  1D5T A;  1H84 A;  1NPX A;  1B37 A;  2YG4 A;  3V3N A;  1B5Q A;  2FJB A;  2FJE A;  3B3R A;  3C4A A;  2RAB A;  2CUL A;  2YLS A;  4AOS A;  5KMR A;  3GYI A;  1DJN A;  1K0J A;  1CC2 A;  2EQ6 A;  3VQR A;  3ICS A;  1O5W A;  3T2Z A;  5BVA A;  3AED A;  4U8N A;  3SZC A;  4OPD A;  2YVF A;  3T2K A;  2GAH B;  4H4T A;  1FOH A;  3UP5 A;  1F3P A;  1D4C A;  3SQP A;  3KPK A;  1L9E A;  4OPG A;  3CTY A;  4H4W A;  4CBQ A;  2WPC A;  1JRX A;  1NHQ A;  2B7S A;  2ACZ A;  3HZL A;  1REO A;  2B76 A;  2XFQ A;  5KXJ A;  1K0L A;  3SY4 A;  3RP8 A;  2BAB A;  5FS6 A;  4EIP A;  2JB2 A;  2C65 A;  2CVJ A;  3AE3 A;  1MO9 A;  2V60 A;  4OPL A;  2XVI A;  3T14 A;  3E1T A;  2Y6R A;  1Q9I A;  1ZOY A;  4EQR A;  4ADW A;  1FL2 A;  2CFY A;  3EF6 A;  3P4Q A;  1RSG A;  2DKH A;  3NIX A;  4IA6 A;  3DJJ A;  3NH3 X;  3AD9 B;  1GER A;  3DGZ A;  3CNT A;  3H4K A;  4B68 A;  3CPJ G;  2FJA A;  3ALM A;  1ZX9 A;  1JNR A;  4AT2 A;  1OJD A;  2GRT A;  2XFU A;  5CKU A;  1OJA A;  4WX1 A;  3T37 A;  3GD4 A;  4Z2U A;  3ADA B;  4O5U A;  4EIQ A;  1XPQ A;  1DOD A;  4C3Y A;  3DK4 A;  4NWZ A;  2WDR A;  4U8L A;  4AP3 A;  3CPH G;  2V5Z A;  3H8I A;  3QSM A;  4Z43 A;  4KPR A;  3L1R A;  4BJZ A;  4H4Q A;  3LB8 A;  2Z5Y A;  1BGN A;  4H2Q A;  2C72 A;  1GPE A;  4H4X A;  5ER0 A;  2IID A;  1DOC A;  3O0H A;  4YSH A;  2C7G A;  2YQU A;  4II3 A;  1EL5 A;  2FBW A;  2YG3 A;  3KPF A;  1JOA A;  1S3E A;  2UZZ A;  2XLR A;  4J33 A;  4RG3 A;  3URH A;  4C74 A;  1LVL A;  5FMH A;  4J56 A;  1ZY8 A;  2A89 A;  5L46 A;  4RSL A;  1IUS A;  2X99 A;  3HYX A;  4H4S A;  1E1K A;  3UOX A;  4MJW A;  3ZDN A;  4O5Q A;  3VRD B;  4LII A;  3ISH A;  4OPC A;  4Y4L A;  3DME A;  3VR8 A;  2YLZ A;  2WBA A;  4TM3 A;  1YY5 A;  1CC6 A;  2WQY A;  3VRB A;  2R45 A;  3RHA A;  1O94 A;  3NTD A;  2BRA A;  3AEB A;  3LZW A;  4GAP A;  3C96 A;  4U8J A;  1ELI A;  5KMS A;  3CNS A;  4BK2 A;  4U2S A;  1CJ2 A;  5JCI A;  2IVE A;  3BI4 A;  2YG7 A;  1IUV A;  2B9W A;  1EBD A;  1IJH A;  4CNK A;  3AEE A;  3F8D A;  4Z24 A;  4E0V A;  5KVH A;  3R9U A;  4ZCD A;  1EL8 A;  3CN8 A;  2YM2 A;  2YG6 A;  4DSH A;  2W0H A;  1L0V A;  1VQW A;  4X9M A;  3UTF A;  5JCN A;  4J36 A;  2XVJ A;  3CGD A;  3NN6 X;  1H6V A;  2JB1 A;  2QAE A;  3S61 A;  2B9Y A;  1QLB A;  2A8X A;  3P4P A;  2WOV A;  3SXI A;  4A7A A;  4YT0 A;  4PAA A;  2VQB A;  1PXA A;  1UKV G;  2VQ7 A;  4NTD A;  2X8C A;  4ECH A;  3AD8 B;  1PBE A;  1JU2 A;  2OAM A;  3P9U A;  3NG7 X;  4I59 A;  4BK1 A;  1LTX R;  3CIR A;  3M12 A;  5EB5 A;  4LU6 A;  2Q0K A;  4B1B A;  1YQ3 A;  3PS9 A;  1FEA A;  2BXS A;  2C70 A;  4OCG A;  5IQ4 A;  5JCL A;  5BUK A;  4II2 A;  3I6D A;  4U8P A;  4YSY A;  5TR3 A;  2BS3 A;  5FS7 A;  4HB9 A;  4A79 A;  2BS2 A;  4IA5 A;  3P4R A;  4EM4 A;  1GSN A;  2XLS A;  2A87 A;  2BRY A;  4JY3 A;  4GAV A;  4GCM A;  2RGH A;  1E6E A;  4NEW A;  2QA1 A;  3T0K A;  1LV0 A;  2YWL A;  1DJQ A;  1F8W A;  1ZMC A;  3F8P A;  3KU9 A;  3B6D A;  4TM4 A;  4H4U A;  2X8H A;  3D1C A;  2WU2 A;  2R9Z A;  1TDN A;  5M10 A;  2V61 A;  3PVC A;  3AE8 A;  3K7M X;  4UP3 A;  1N4W A;  4U8M A;  1GET A;  1H7W A;  3UOY A;  4JDR A;  3BNM A;  3KVE A;  1GRA A;  2C67 A;  3AE5 A;  1CJC A;  4H2R A;  2XLT A;  2PHH A;  1NDA A;  1H86 A;  1P2H A;  5EB4 A;  1ZDL A;  1B8S A;  2BS4 A;  3QVP A;  4UDR A;  2WDQ A;  4EQS A;  2WS3 A;  4B67 A;  2GQW A;  2Q6U A;  1NG3 A;  2Q7V A;  1Z6L A;  2R0C A;  3UKK A;  4GF7 A;  4X4J A;  4P9S A;  4DGK A;  3HYW A;  1S2Y A;  2WU5 A;  3GSI A;  3P1W A;  1PXC A;  4JNQ A;  2ZZC A;  3FBS A;  2OAL A;  4ZCC A;  3UTE A;  1NHP A;  2F5Z A;  4A65 A;  4B66 A;  1D7L A;  3GMC A;  4B65 A;  4G6H A;  3LXD A;  4YTP A;  1S3B A;  3DH9 A;  1TDE A;  3FG2 P;  2APG A;  4NEV A;  2OA1 A;  3GD3 A;  2XCG A;  2JK6 A;  3AD7 B;  4K7Z A;  4USR A;  1JRZ A;  1GND A;  1M64 A;  2BCG G;  3P4S A;  3FMW A;  1N4U A;  2X50 A;  2H89 A;  4H2N A;  5KMQ A;  2WPF A;  1PHH A;  3FIM B;  2GVC A;  2ZZB A;  4A9W A;  3LAD A;  2AR8 A;  3JSK A;  5LV9 A;  4H7U A;  3IF9 A;  3UKQ A;  3M0O A;  4N9X A;  3WE0 A;  3BI2 A;  3NYF A;  4PAB A;  1GT8 A;  1YQ4 A;  2VVL G;  4NTE A;  3T31 A;  3CNJ A;  1LJ1 A;  3SM8 A;  1CJ4 A;  1W4X A;  4XXG A;  4H2P A;  3Q9T A;  5C3J A;  3UKH A;  2QA2 A;  1F8S A;  1LPF A;  4HA6 A;  1E7P A;  4IVM B;  4B63 A;  1TRB A;  1X31 B;  3G5S A;  4G73 A;  3LOV A;  3RED A;  4U8K A;  3K30 A;  1GTH A;  5JCK A;  3QFB A;  5GSN A;  1GV4 A;  4A6N A;  4APN A;  1EL9 A;  3UTH A;  4H4R A;  2J3N A;  1JNZ A;  3LJP A;  1F6M A;  3ICT A;  2HQM A;  4Z25 A;  2WOW A;  2YVJ A;  3SYI A;  1BKW A;  3NYC A;  1OJT A;  1GRH A;  3CGC A;  4Y4N A;  2C73 A;  1Y56 A;  4OPT A;  3AB1 A;  3BI5 A;  2C3D A;  1GRB A;  1P2E A;  3AEC A;  1NEN A;  1ZMD A;  2PYX A;  3DA1 A;  2C4C A;  2E5V A;  3BHK A;  1ZK7 A;  3CGE A;  3ALJ A;  1CF3 A;  3AXB A;  3D8X A;  3SZ0 A;  1GTE A;  1NEK A;  1TDK A;  4D03 A;  1ONF A;  5GRT A;  1RP0 A;  2X8G A;  3NK0 X;  4LA1 A;  3GRT A;  5U63 A;  1O95 A;  4G6G A;  1BF3 A;  5C2T A;  1NHS A;  4AP1 A;  4H50 A;  2BAC A;  2XVH A;  4YXD A;  4C5O A;  2NPX A;  4JQ9 A;  1PJ7 A;  4Z2R A;  4NNJ A;  2R0P A;  2AQJ A;  4YTN A;  1PDH A;  1CHU A;  3KA7 A;  4EMW A;  2BC0 A;  2NVK X;  3GDP A;  2VOU A;  3IC9 A;  2B7R A;  4YSX A;  1CL0 A;  3KLJ A;  4FDC B;  2GR1 A;  4B69 A;  3NK1 X;  3AE1 A;  1PBF A;  5JCM A;  3UCL A;  3SFE A;  1H83 A;  4WCT A;  3UOZ A;  1S2Q A;  5IPY A;  4AT0 A;  2GMH A;  3AEF A;  5KMP A;  3CPI G;  2TPR A;  1Y56 B;  4CY8 A;  4YSZ A;  1GXF A;  2QCU A;  3SZW A;  4EQX A;  1AOG A;  1BZL A;  1DNC A;  2GAG B;  1YKJ A;  1F8R A;  2JAE A;  2BK3 A;  4K2X A;  2V3A A;  4GUV A;  3VRA A;  1VRQ B;  4GDP A;  2I0Z A;  2GV8 A;  4U8I A;  3IHM A;  3NN0 X;  4JY2 A;  2WDV A;  1H81 A;  3ALL A;  2R4E A;  3GRS A;  3VR9 A;  2EQ9 A;  4J31 A;  2YR4 A;  4AOX A;  1E39 A;  3NYE A;  2YLW A;  3UOV A;  1VDC A;  3PO7 A;  5KRQ A;  2YLX A;  2WOI A;  3OZ2 A;  1QJD A;  3SGL A;  3V76 A;  3S5W A;  3RP7 A;  4I58 A;  2GMJ A;  3UKF A;  1Y0P A;  3KD9 A;  1TDO A;  3CNP A;  3EAO A;  3CMM A;  4G74 A;  1DOE A;  1JEH A;  2YG5 A;  4XWR A;  2WET A;  4U2T A;  1MOK A;  2DKI A;  2XFO A;  1H7X A;  1MXT A;  2JKC A;  3GYJ A;  1E1L A;  5HXI A;  2XLP A;  1KF6 A;  4KX6 A;  3ATR A;  3T2Y A;  3QFA A;  1N1P A;  3ATQ A;  3C4N A;  3II4 A;  3DGH A;  4U2L A;  1E1M A;  2X3N A;  2R4J A;  2GR2 A;  1HYU A;  4OPU A;  4K22 A;  4YWO A;  1Q1W A;  5FS9 A;  1XDI A;  3SFD A;  1YQZ A;  3RNM A;  1PBC A;  1GRT A;  3AE7 A;  2BK5 A;  2YM1 A;  1K0I A;  4NTC A;  5HYM A;  2AAQ A;  4RG4 A;  1PN0 A;  1ZP0 A;  3KKJ A;  4TLZ A;  4Y4M A;  2YLR A;  3Q6J A;  4ZN0 A;  2GQF A;  4GRT A;  1CJ3 A;  5KNL A;  1TYT A;  1BGJ A;  1QO8 A;  4D04 A;  1PBD A;  3GYX A;  5FS8 A;  3DK9 A;  1VG0 A;  3NRN A;  2XLU A;  4JN9 A;  3K7Q X;  4REK A;  1IUW A;  4TM1 A;  5KVI A;  3ZYX A;  3QSS A;  4CCR A;  5DBJ A;  1VG9 A;  3GWD A;  2ZZ0 A;  4BK3 A;  1PS9 A;  3NT6 A;  4CRT A;  4DNA A;  1CC4 A;  1DXL A;  1IUX A;  2BK4 A;  2BYB A;  2C3C A;  2XYO A;  1V59 A;  5KWF A;  4K8D A;  3EAN A;  3CND A;  4YTM A;  4BJY A;  4A6N B;  1NG4 A;  2E1M A;  1FEB A;  3ICR A;  1H82 A;  2Q0L A;  3V3O A;  2ZBW A;  2Z5X A;  4M52 A;  1LQT A;  3UKL A;  4C77 A;  3AE4 A;  2ARD A;  3QJ4 A;  4NZH A;  2V3B A;  2O9Z A;  4K5R A;  3G5R A;  1COY A;  1KDG A;  1SEZ A;  2VVL A;  3AEG A;  2WP6 A;  2XFN A;  3RP6 A;  3DJG X;  2R46 A;  1K4Q A;  1D7Y A;  2YLT A;  4FX9 A;  4H4Y A;  4Z44 A;  4X9N A;  2RGJ A;  3IWA A;  4IV9 A;  4UDP A;  1PJ5 A;  5CQF A;  1GEU A;  3IHG A;  3COX A;  4EM3 A;  3NHO X;  4A99 A;  2GR0 A;  1BWC A;  3GWF A;  2WPE A;  3NK2 X;  2BA9 A;  4C3X A;  3SZF A;  4OPI A;  3GMB A;  3ITJ A;  2OLO A;  2XDO A;  1GRG A;  4OVI A;  1CBO A;  1L9C A;  3HYV A;  5IQ1 A;  3K7T A;  1Q1R A;  1ZKQ A;  1XAN A;  3BHF A;  3AEA A;  2YR5 A;  3UP4 A;  1RYI A;  4FK1 C;  3F8R A;  1XHC A;  1FCD A;  5BRT A;  1OJC A;  3AE2 A;  4J2W A;  4YKG A;  4IVO B;  3EPT A;  2XVF A;  2E4G A;  1D4E A;  1KNR A;  2VRL A;  3NLC A;  4G9K A;  4J57 A;  3UKA A;  3NTA A;  1IUT A;  1GES A;  3G5Q A;  4USQ A;  4Z2T A;  2GR3 A;  4CCQ A;  1DOB A;  2JBV A;  4H4P A;  1EL7 A;  1GAL A;  1B4V A;  3QSE A;  2YVG A;  4Z26 A;  1KSS A;  3DJE A;  1JRY A;  1L9D A;  1N4V A;  2Y6Q A;  1GOS A;  1KFY A;  3L8K A;  4H4V A;  2IVD A;  1NHR A;  2BXR A;  3AWI A;  2GF3 A;  1PJ6 A;  5HHF A;  2FJD A;  4BV6 A;  4TLX A;  2EQ7 A;  1M6I A;  2WES A;  2XVE A;  1KNP A;  2YAU A;  2YR6 A;  3OC4 A;  5J60 A;  4GR1 A;  1FEC A;  2V6O A;  1ZOV A;  2GB0 A;  3BNU A;  1GRF A;  3I3L A;  1NAA A;  2VZ2 A;  1LQU A;  1TYP A;  3NGC X;  5M0Z A;  3NNE A;  2BCP A;  2CDU A;  4K5S A; 
#chains in the Genus database with same CATH homology
 5J7X A;  4DSG A;  4XWZ A;  4EMJ A;  3ABV A;  2C66 A;  3AYI A;  3AE9 A;  4JNA A;  5KOX A;  2JB3 A;  2RGO A;  5EBK A;  2H88 A;  1OJ9 A;  5KOW A;  3AYL A;  3CGB A;  3FPZ A;  4FK1 A;  5EOW A;  2VVM A;  3H8L A;  4GDE A;  2WP9 A;  3AE6 A;  2WEU A;  1IUU A;  2GEW A;  2XFP A;  3SX6 A;  3UTG A;  3LZX A;  2VRM A;  4B64 A;  2C75 A;  2OLN A;  1PXB A;  1E1N A;  3NKS A;  5HY5 A;  2B9X A;  2TMD A;  4YKF A;  5U1O A;  1D4D A;  2EQ8 A;  3UKP A;  4EMI A;  5U25 A;  2BC1 A;  3DK8 A;  1PBB A;  4A5L A;  1GRE A;  2R0G A;  5BUL A;  4UDQ A;  4EQW A;  2C64 A;  4BUR A;  4TM0 A;  3DJD A;  3AYJ A;  2WP5 A;  1TDF A;  2GH5 A;  2WHD A;  1KSU A;  2C76 A;  3M13 A;  3QVR A;  4U8O A;  4CNJ A;  4CY6 A;  3GDN A;  4ICY A;  4H4Z A;  4J34 A;  1D5T A;  1H84 A;  1NPX A;  1B37 A;  2YG4 A;  3V3N A;  1B5Q A;  2FJB A;  2FJE A;  3B3R A;  3C4A A;  2RAB A;  2CUL A;  2YLS A;  4AOS A;  5KMR A;  3GYI A;  1DJN A;  1K0J A;  1CC2 A;  2EQ6 A;  3VQR A;  3ICS A;  1O5W A;  3T2Z A;  5BVA A;  3AED A;  4U8N A;  3SZC A;  4OPD A;  2YVF A;  3T2K A;  2GAH B;  4H4T A;  1FOH A;  3UP5 A;  1F3P A;  1D4C A;  3SQP A;  3KPK A;  1L9E A;  4OPG A;  3CTY A;  4H4W A;  4CBQ A;  2WPC A;  1JRX A;  1NHQ A;  2B7S A;  2ACZ A;  3HZL A;  1REO A;  2B76 A;  2XFQ A;  5KXJ A;  1K0L A;  3SY4 A;  3RP8 A;  2BAB A;  5FS6 A;  4EIP A;  2JB2 A;  2C65 A;  2CVJ A;  3AE3 A;  1MO9 A;  2V60 A;  4OPL A;  2XVI A;  3T14 A;  3E1T A;  2Y6R A;  1Q9I A;  1ZOY A;  4EQR A;  4ADW A;  1FL2 A;  2CFY A;  3EF6 A;  3P4Q A;  1RSG A;  2DKH A;  3NIX A;  4IA6 A;  3DJJ A;  3NH3 X;  3AD9 B;  1GER A;  3DGZ A;  3CNT A;  3H4K A;  4B68 A;  3CPJ G;  2FJA A;  3ALM A;  1ZX9 A;  1JNR A;  4AT2 A;  1OJD A;  2GRT A;  2XFU A;  5CKU A;  1OJA A;  4WX1 A;  3T37 A;  3GD4 A;  4Z2U A;  3ADA B;  4O5U A;  4EIQ A;  1XPQ A;  1DOD A;  4C3Y A;  3DK4 A;  4NWZ A;  2WDR A;  4U8L A;  4AP3 A;  3CPH G;  2V5Z A;  3H8I A;  3QSM A;  4Z43 A;  4KPR A;  3L1R A;  4BJZ A;  4H4Q A;  3LB8 A;  2Z5Y A;  1BGN A;  4H2Q A;  2C72 A;  1GPE A;  4H4X A;  5ER0 A;  2IID A;  1DOC A;  3O0H A;  4YSH A;  2C7G A;  2YQU A;  4II3 A;  1EL5 A;  2FBW A;  2YG3 A;  3KPF A;  1JOA A;  1S3E A;  2UZZ A;  2XLR A;  4J33 A;  4RG3 A;  3URH A;  4C74 A;  1LVL A;  5FMH A;  4J56 A;  1ZY8 A;  2A89 A;  5L46 A;  4RSL A;  1IUS A;  2X99 A;  3HYX A;  4H4S A;  1E1K A;  3UOX A;  4MJW A;  3ZDN A;  4O5Q A;  3VRD B;  4LII A;  3ISH A;  4OPC A;  4Y4L A;  3DME A;  3VR8 A;  2YLZ A;  2WBA A;  4TM3 A;  1YY5 A;  1CC6 A;  2WQY A;  3VRB A;  2R45 A;  3RHA A;  1O94 A;  3NTD A;  2BRA A;  3AEB A;  3LZW A;  4GAP A;  3C96 A;  4U8J A;  1ELI A;  5KMS A;  3CNS A;  4BK2 A;  4U2S A;  1CJ2 A;  5JCI A;  2IVE A;  3BI4 A;  2YG7 A;  1IUV A;  2B9W A;  1EBD A;  1IJH A;  4CNK A;  3AEE A;  3F8D A;  4Z24 A;  4E0V A;  5KVH A;  3R9U A;  4ZCD A;  1EL8 A;  3CN8 A;  2YM2 A;  2YG6 A;  4DSH A;  2W0H A;  1L0V A;  1VQW A;  4X9M A;  3UTF A;  5JCN A;  4J36 A;  2XVJ A;  3CGD A;  3NN6 X;  1H6V A;  2JB1 A;  2QAE A;  3S61 A;  2B9Y A;  1QLB A;  2A8X A;  3P4P A;  2WOV A;  3SXI A;  4A7A A;  4YT0 A;  4PAA A;  2VQB A;  1PXA A;  1UKV G;  2VQ7 A;  4NTD A;  2X8C A;  4ECH A;  3AD8 B;  1PBE A;  1JU2 A;  2OAM A;  3P9U A;  3NG7 X;  4I59 A;  4BK1 A;  1LTX R;  3CIR A;  3M12 A;  5EB5 A;  4LU6 A;  2Q0K A;  4B1B A;  1YQ3 A;  3PS9 A;  1FEA A;  2BXS A;  2C70 A;  4OCG A;  5IQ4 A;  5JCL A;  5BUK A;  4II2 A;  3I6D A;  4U8P A;  4YSY A;  5TR3 A;  2BS3 A;  5FS7 A;  4HB9 A;  4A79 A;  2BS2 A;  4IA5 A;  3P4R A;  4EM4 A;  1GSN A;  2XLS A;  2A87 A;  2BRY A;  4JY3 A;  4GAV A;  4GCM A;  2RGH A;  1E6E A;  4NEW A;  2QA1 A;  3T0K A;  1LV0 A;  2YWL A;  1DJQ A;  1F8W A;  1ZMC A;  3F8P A;  3KU9 A;  3B6D A;  4TM4 A;  4H4U A;  2X8H A;  3D1C A;  2WU2 A;  2R9Z A;  1TDN A;  5M10 A;  2V61 A;  3PVC A;  3AE8 A;  3K7M X;  4UP3 A;  1N4W A;  4U8M A;  1GET A;  1H7W A;  3UOY A;  4JDR A;  3BNM A;  3KVE A;  1GRA A;  2C67 A;  3AE5 A;  1CJC A;  4H2R A;  2XLT A;  2PHH A;  1NDA A;  1H86 A;  1P2H A;  5EB4 A;  1ZDL A;  1B8S A;  2BS4 A;  3QVP A;  4UDR A;  2WDQ A;  4EQS A;  2WS3 A;  4B67 A;  2GQW A;  2Q6U A;  1NG3 A;  2Q7V A;  1Z6L A;  2R0C A;  3UKK A;  4GF7 A;  4X4J A;  4P9S A;  4DGK A;  3HYW A;  1S2Y A;  2WU5 A;  3GSI A;  3P1W A;  1PXC A;  4JNQ A;  2ZZC A;  3FBS A;  2OAL A;  4ZCC A;  3UTE A;  1NHP A;  2F5Z A;  4A65 A;  4B66 A;  1D7L A;  3GMC A;  4B65 A;  4G6H A;  3LXD A;  4YTP A;  1S3B A;  3DH9 A;  1TDE A;  3FG2 P;  2APG A;  4NEV A;  2OA1 A;  3GD3 A;  2XCG A;  2JK6 A;  3AD7 B;  4K7Z A;  4USR A;  1JRZ A;  1GND A;  1M64 A;  2BCG G;  3P4S A;  3FMW A;  1N4U A;  2X50 A;  2H89 A;  4H2N A;  5KMQ A;  2WPF A;  1PHH A;  3FIM B;  2GVC A;  2ZZB A;  4A9W A;  3LAD A;  2AR8 A;  3JSK A;  5LV9 A;  4H7U A;  3IF9 A;  3UKQ A;  3M0O A;  4N9X A;  3WE0 A;  3BI2 A;  3NYF A;  4PAB A;  1GT8 A;  1YQ4 A;  2VVL G;  4NTE A;  3T31 A;  3CNJ A;  1LJ1 A;  3SM8 A;  1CJ4 A;  1W4X A;  4XXG A;  4H2P A;  3Q9T A;  5C3J A;  3UKH A;  2QA2 A;  1F8S A;  1LPF A;  4HA6 A;  1E7P A;  4IVM B;  4B63 A;  1TRB A;  1X31 B;  3G5S A;  4G73 A;  3LOV A;  3RED A;  4U8K A;  3K30 A;  1GTH A;  5JCK A;  3QFB A;  5GSN A;  1GV4 A;  4A6N A;  4APN A;  1EL9 A;  3UTH A;  4H4R A;  2J3N A;  1JNZ A;  3LJP A;  1F6M A;  3ICT A;  2HQM A;  4Z25 A;  2WOW A;  2YVJ A;  3SYI A;  1BKW A;  3NYC A;  1OJT A;  1GRH A;  3CGC A;  4Y4N A;  2C73 A;  1Y56 A;  4OPT A;  3AB1 A;  3BI5 A;  2C3D A;  1GRB A;  1P2E A;  3AEC A;  1NEN A;  1ZMD A;  2PYX A;  3DA1 A;  2C4C A;  2E5V A;  3BHK A;  1ZK7 A;  3CGE A;  3ALJ A;  1CF3 A;  3AXB A;  3D8X A;  3SZ0 A;  1GTE A;  1NEK A;  1TDK A;  4D03 A;  1ONF A;  5GRT A;  1RP0 A;  2X8G A;  3NK0 X;  4LA1 A;  3GRT A;  5U63 A;  1O95 A;  4G6G A;  1BF3 A;  5C2T A;  1NHS A;  4AP1 A;  4H50 A;  2BAC A;  2XVH A;  4YXD A;  4C5O A;  2NPX A;  4JQ9 A;  1PJ7 A;  4Z2R A;  4NNJ A;  2R0P A;  2AQJ A;  4YTN A;  1PDH A;  1CHU A;  3KA7 A;  4EMW A;  2BC0 A;  2NVK X;  3GDP A;  2VOU A;  3IC9 A;  2B7R A;  4YSX A;  1CL0 A;  3KLJ A;  4FDC B;  2GR1 A;  4B69 A;  3NK1 X;  3AE1 A;  1PBF A;  5JCM A;  3UCL A;  3SFE A;  1H83 A;  4WCT A;  3UOZ A;  1S2Q A;  5IPY A;  4AT0 A;  2GMH A;  3AEF A;  5KMP A;  3CPI G;  2TPR A;  1Y56 B;  4CY8 A;  4YSZ A;  1GXF A;  2QCU A;  3SZW A;  4EQX A;  1AOG A;  1BZL A;  1DNC A;  2GAG B;  1YKJ A;  1F8R A;  2JAE A;  2BK3 A;  4K2X A;  2V3A A;  4GUV A;  3VRA A;  1VRQ B;  4GDP A;  2I0Z A;  2GV8 A;  4U8I A;  3IHM A;  3NN0 X;  4JY2 A;  2WDV A;  1H81 A;  3ALL A;  2R4E A;  3GRS A;  3VR9 A;  2EQ9 A;  4J31 A;  2YR4 A;  4AOX A;  1E39 A;  3NYE A;  2YLW A;  3UOV A;  1VDC A;  3PO7 A;  5KRQ A;  2YLX A;  2WOI A;  3OZ2 A;  1QJD A;  3SGL A;  3V76 A;  3S5W A;  3RP7 A;  4I58 A;  2GMJ A;  3UKF A;  1Y0P A;  3KD9 A;  1TDO A;  3CNP A;  3EAO A;  3CMM A;  4G74 A;  1DOE A;  1JEH A;  2YG5 A;  4XWR A;  2WET A;  4U2T A;  1MOK A;  2DKI A;  2XFO A;  1H7X A;  1MXT A;  2JKC A;  3GYJ A;  1E1L A;  5HXI A;  2XLP A;  1KF6 A;  4KX6 A;  3ATR A;  3T2Y A;  3QFA A;  1N1P A;  3ATQ A;  3C4N A;  3II4 A;  3DGH A;  4U2L A;  1E1M A;  2X3N A;  2R4J A;  2GR2 A;  1HYU A;  4OPU A;  4K22 A;  4YWO A;  1Q1W A;  5FS9 A;  1XDI A;  3SFD A;  1YQZ A;  3RNM A;  1PBC A;  1GRT A;  3AE7 A;  2BK5 A;  2YM1 A;  1K0I A;  4NTC A;  5HYM A;  2AAQ A;  4RG4 A;  1PN0 A;  1ZP0 A;  3KKJ A;  4TLZ A;  4Y4M A;  2YLR A;  3Q6J A;  4ZN0 A;  2GQF A;  4GRT A;  1CJ3 A;  5KNL A;  1TYT A;  1BGJ A;  1QO8 A;  4D04 A;  1PBD A;  3GYX A;  5FS8 A;  3DK9 A;  1VG0 A;  3NRN A;  2XLU A;  4JN9 A;  3K7Q X;  4REK A;  1IUW A;  4TM1 A;  5KVI A;  3ZYX A;  3QSS A;  4CCR A;  5DBJ A;  1VG9 A;  3GWD A;  2ZZ0 A;  4BK3 A;  1PS9 A;  3NT6 A;  4CRT A;  4DNA A;  1CC4 A;  1DXL A;  1IUX A;  2BK4 A;  2BYB A;  2C3C A;  2XYO A;  1V59 A;  5KWF A;  4K8D A;  3EAN A;  3CND A;  4YTM A;  4BJY A;  4A6N B;  1NG4 A;  2E1M A;  1FEB A;  3ICR A;  1H82 A;  2Q0L A;  3V3O A;  2ZBW A;  2Z5X A;  4M52 A;  1LQT A;  3UKL A;  4C77 A;  3AE4 A;  2ARD A;  3QJ4 A;  4NZH A;  2V3B A;  2O9Z A;  4K5R A;  3G5R A;  1COY A;  1KDG A;  1SEZ A;  2VVL A;  3AEG A;  2WP6 A;  2XFN A;  3RP6 A;  3DJG X;  2R46 A;  1K4Q A;  1D7Y A;  2YLT A;  4FX9 A;  4H4Y A;  4Z44 A;  4X9N A;  2RGJ A;  3IWA A;  4IV9 A;  4UDP A;  1PJ5 A;  5CQF A;  1GEU A;  3IHG A;  3COX A;  4EM3 A;  3NHO X;  4A99 A;  2GR0 A;  1BWC A;  3GWF A;  2WPE A;  3NK2 X;  2BA9 A;  4C3X A;  3SZF A;  4OPI A;  3GMB A;  3ITJ A;  2OLO A;  2XDO A;  1GRG A;  4OVI A;  1CBO A;  1L9C A;  3HYV A;  5IQ1 A;  3K7T A;  1Q1R A;  1ZKQ A;  1XAN A;  3BHF A;  3AEA A;  2YR5 A;  3UP4 A;  1RYI A;  4FK1 C;  3F8R A;  1XHC A;  1FCD A;  5BRT A;  1OJC A;  3AE2 A;  4J2W A;  4YKG A;  4IVO B;  3EPT A;  2XVF A;  2E4G A;  1D4E A;  1KNR A;  2VRL A;  3NLC A;  4G9K A;  4J57 A;  3UKA A;  3NTA A;  1IUT A;  1GES A;  3G5Q A;  4USQ A;  4Z2T A;  2GR3 A;  4CCQ A;  1DOB A;  2JBV A;  4H4P A;  1EL7 A;  1GAL A;  1B4V A;  3QSE A;  2YVG A;  4Z26 A;  1KSS A;  3DJE A;  1JRY A;  1L9D A;  1N4V A;  2Y6Q A;  1GOS A;  1KFY A;  3L8K A;  4H4V A;  2IVD A;  1NHR A;  2BXR A;  3AWI A;  2GF3 A;  1PJ6 A;  5HHF A;  2FJD A;  4BV6 A;  4TLX A;  2EQ7 A;  1M6I A;  2WES A;  2XVE A;  1KNP A;  2YAU A;  2YR6 A;  3OC4 A;  5J60 A;  4GR1 A;  1FEC A;  2V6O A;  1ZOV A;  2GB0 A;  3BNU A;  1GRF A;  3I3L A;  1NAA A;  2VZ2 A;  1LQU A;  1TYP A;  3NGC X;  5M0Z A;  3NNE A;  2BCP A;  2CDU A;  4K5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...