5KMSA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 2.5 angstrom resolution.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
394
structure length
394
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
total genus 117
structure length 394
sequence length 394
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmsA00
3SZFA 3HYWA 3T2KA 4G6GA 4G6HA 3SY4A 3T2ZA 3T14A 3HYVA 3T0KA 3SZ0A 5KMPA 4G73A 3HYXA 3SX6A 3KPKA 4GAPA 5KMRA 4GAVA 4NWZA 5KMQA 3SYIA 4G74A 3SZCA 4G9KA 5KMSA 3SZWA 3SXIA 3T31A 3T2YA
chains in the Genus database with same CATH superfamily
3SZFA 1IUUA 4A6NB 2YR5A 3K7MX 1FOHA 1GRHA 1H6VA 5KNLA 4TM3A 3AE5A 2QA1A 4K5RA 2BS2A 3CGBA 3DK4A 4GDEA 4REKA 2WP9A 4ZCDA 3O0HA 4BJYA 3VR8A 3UTHA 2XYOA 4AOSA 3OZ2A 1O5WA 5CQFA 5KVHA 1YY5A 1QJDA 4NZHA 4EMJA 3Q9TA 2C3DA 2YM2A 4K7ZA 1KNRA 1H86A 1DJQA 3P4RA 4OPCA 3RHAA 1ZP0A 4G74A 4G9KA 3UOXA 4A5LA 4D03A 1YQ4A 3CNTA 1E6EA 5JCLA 3D8XA 1PBBA 3IF9A 5JCMA 3ATQA 4B63A 4Z2RA 3BI2A 1H7WA 1GESA 3ZDNA 5TR3A 5EBKA 1GNDA 2YVFA 2CDUA 2BA9A 4A9WA 3ATRA 2V6OA 3SGLA 3BHKA 1EL5A 4H4WA 2GAHB 3ALJA 2J3NA 1KDGA 1FECA 2BCPA 1NHSA 2BYBA 2XCGA 4CY8A 4K5SA 2ARDA 4U8OA 1ZMCA 2DKHA 1Q1WA 4Z2TA 3AD8B 1GT8A 1VQWA 4NTCA 2GR0A 4TM4A 1LQUA 4RG3A 1JNRA 1LQTA 1NDAA 2GQFA 2WPFA 2BCGG 3AD9B 3F8PA 4U8IA 3SZCA 1OJAA 1IUSA 3IHMA 4TLZA 3D1CA 5HHFA 2YG4A 3AECA 2BS3A 1S3EA 2JB2A 2VZ2A 3CNDA 1N1PA 4YSYA 1E1MA 2Q6UA 4YSXA 2JAEA 4OPLA 4DNAA 2F5ZA 1EL9A 5JCIA 2C3CA 3UTEA 2GB0A 3ICTA 2JK6A 3T0KA 4N9XA 4IA6A 4TLXA 2W0HA 4C5OA 3NYFA 2BABA 4A79A 1GETA 1PJ6A 2XVHA 4II2A 2OLOA 1H83A 3NN0X 3DA1A 2JB3A 3VRBA 2CVJA 3UCLA 1DJNA 2CFYA 3RP6A 1GEUA 1PBDA 4B64A 4JN9A 2YLWA 4EQSA 3NHOX 1EL8A 2FBWA 2Q0LA 3SM8A 1JRZA 3GRTA 5IQ1A 1VG0A 5KVIA 4Z26A 5J60A 5BRTA 2AQJA 2NVKX 1Q9IA 1RSGA 4HA6A 3GYXA 3V76A 1IUTA 3C4NA 1ZKQA 1PDHA 4A6NA 1GTHA 2C73A 2QCUA 2YVJA 4EIPA 2XLRA 2BK3A 4IVMB 2TPRA 2B9XA 3CPHG 4GF7A 1LJ1A 4ZCCA 2YR6A 4ECHA 2B7RA 3CTYA 3REDA 2H88A 5KMRA 1COYA 3GDNA 4WCTA 4O5UA 4EIQA 3AD7B 1CC6A 4EMIA 2RABA 3AEFA 2I0ZA 3CGCA 4X4JA 1VG9A 2EQ9A 2GR1A 4E0VA 4OPUA 1LV0A 3SQPA 4EM3A 4C3XA 4ADWA 1TDOA 3DK8A 4J31A 2OALA 3WE0A 2XVIA 3L8KA 3FG2P 4H4QA 2HQMA 2YQUA 1DODA 3AE9A 3QSSA 3KKJA 2B9WA 3NKSA 4ICYA 3AEAA 4ZN0A 3P4QA 3GDPA 3UOYA 1ZOYA 2IVEA 2NPXA 1D7LA 4J57A 2WEUA 3AEBA 4FDCB 4OPDA 2YG5A 1S2YA 2Z5YA 2RGJA 4K22A 2JBVA 4K8DA 3UP5A 3VRDB 1RYIA 3CPJG 4UDQA 4UDPA 4AP1A 4BK3A 3G5RA 2QAEA 4U2TA 1K0IA 1NENA 1NEKA 4Z44A 2YLRA 5C3JA 2X99A 1N4VA 3M0OA 3ICRA 4Y4NA 4Y4MA 4U8LA 1PBEA 3IC9A 2YG6A 1VDCA 1BGJA 2R0CA 3H8LA 5C2TA 4G6GA 4OPIA 4G6HA 3SY4A 2XDOA 3VR9A 1Y56B 1GTEA 2DKIA 4H4TA 3SZ0A 4C77A 3DH9A 4B69A 1KFYA 3SX6A 2XVEA 3M12A 1JOAA 1TDFA 3AXBA 3PO7A 1LVLA 1BKWA 1P2EA 1H81A 1TDNA 3NTAA 5LV9A 1TYTA 3F8DA 2YLXA 2VVLG 3ZYXA 1F8WA 3S5WA 2XFQA 1CBOA 1GRFA 1OJ9A 5U25A 1ELIA 3VQRA 3NK1X 1SEZA 4II3A 4P9SA 4A7AA 4B67A 4X9NA 2RGHA 4BK1A 4CNKA 1V59A 1H82A 1NHPA 2CULA 1GRTA 1P2HA 1DOCA 3RP8A 3AE6A 1H7XA 3ADAB 3I3LA 1E39A 4J36A 2V3BA 3UKKA 4A65A 1XANA 2ACZA 3UOZA 3FBSA 5M0ZA 3GMCA 3JSKA 3UKHA 4OCGA 5IQ4A 1ZOVA 3FIMB 4U8NA 1L9DA 1PXAA 4J33A 4Z25A 1OJTA 4YSHA 3K7QX 3L1RA 1IUVA 4UDRA 5M10A 4JY2A 5KMSA 2A8XA 1EL7A 4H4PA 1CJCA 2R46A 4BK2A 5KXJA 3K7TA 3GRSA 5EB5A 3BNMA 3NYCA 1K0JA 2AAQA 4TM0A 4XWZA 2X8GA 3C96A 3GMBA 2V3AA 4H4SA 1GALA 4LIIA 3B3RA 5EOWA 2A87A 4O5QA 4H4YA 3AE7A 2YM1A 4NTEA 4U8JA 2YAUA 2Z5XA 2ZZBA 2BS4A 1W4XA 4MJWA 2WS3A 3BNUA 1L0VA 5KMPA 5KRQA 1NAAA 2WPEA 3KPKA 3QJ4A 2WDRA 2EQ6A 5FS8A 1Y0PA 4GAPA 4AOXA 3C4AA 2X50A 4C3YA 2A89A 2C70A 4YKFA 4BV6A 1REOA 1PBCA 2XVFA 1Z6LA 3CNJA 5EB4A 5BULA 1DOEA 4YTNA 2WOVA 3AE8A 5FS9A 1JEHA 4PABA 2O9ZA 3NNEA 5FS6A 2GMHA 4H50A 2XLTA 1CJ4A 1JRYA 2R0GA 2GQWA 2VQ7A 4Y4LA 4BJZA 2C64A 3B6DA 3LZXA 4A99A 1IJHA 2XLSA 3AEGA 3KPFA 4D04A 5J7XA 1PJ5A 3EPTA 3BI5A 2H89A 1PBFA 2XFNA 2XVJA 3S61A 4CBQA 1L9EA 1IUWA 1Y56A 3G5SA 2XLPA 1F8SA 3AYJA 4GAVA 1D4DA 1GV4A 2ZZCA 4WX1A 3CNPA 3H4KA 2V61A 4AT2A 1XDIA 1UKVG 2BXSA 4XXGA 3SZWA 4YT0A 3ICSA 2IIDA 1GRAA 3R9UA 3EAOA 3QVPA 2RGOA 2OA1A 4FX9A 1PXBA 4GUVA 1QO8A 3CPIG 1CJ2A 2YR4A 1L9CA 1B5QA 3AE2A 4YWOA 4H4RA 4H7UA 2UZZA 1BZLA 4B1BA 3NLCA 4EMWA 1Q1RA 3AE3A 2XFUA 4GRTA 1K0LA 5HY5A 1TDEA 1ZY8A 4IV9A 5KOWA 2AR8A 1CJ3A 3CMMA 2Q7VA 3K30A 1ZK7A 3H8IA 1D4EA 1FL2A 4GCMA 5JCKA 1CF3A 2VRMA 4EQWA 3ABVA 5DBJA 1PN0A 1PJ7A 3LJPA 1CC4A 1GXFA 1H84A 2R45A 4Z2UA 3NT6A 1M64A 1D7YA 3P1WA 3QFBA 3SYIA 1B8SA 2GH5A 2XLUA 3ALLA 2V5ZA 4FK1A 4YXDA 1S2QA 2BK4A 3CN8A 2FJEA 3UKQA 5BVAA 1PHHA 3RP7A 3KD9A 4J2WA 3BHFA 3DJGX 1E1NA 1X31B 3LOVA 1FEAA 2WETA 4YTPA 3GYJA 3UTGA 3DK9A 2Y6QA 3AWIA 2PHHA 2WQYA 3F8RA 4J34A 4RG4A 3LZWA 3P9UA 1OJCA 2GMJA 3QSEA 1M6IA 3HYVA 3UKAA 5U63A 2C72A 1O94A 2WESA 4Z43A 3HYXA 2R4EA 5L46A 2YWLA 3SFEA 4RSLA 5HXIA 3URHA 1QLBA 1PXCA 2GEWA 4APNA 1VRQB 4OPGA 4NWZA 4IA5A 3P4PA 1DXLA 2BRYA 3SFDA 3PS9A 1GOSA 2GV8A 2YLTA 5GSNA 4GDPA 1NHRA 3NN6X 4LU6A 5BUKA 2XFPA 2B76A 2WHDA 3NTDA 4TM1A 3HYWA 1E1KA 3BI4A 4Z24A 4H4UA 1MOKA 2C65A 3G5QA 1N4WA 3T2ZA 2X8HA 1YQZA 4CY6A 1MXTA 4HB9A 1D5TA 4C74A 3P4SA 3LXDA 2PYXA 3QSMA 3GYIA 4NEWA 3GSIA 4UP3A 1GERA 2TMDA 2WOWA 1ONFA 5HYMA 3CGDA 2GRTA 2C7GA 4EQXA 1KSUA 1F3PA 5CKUA 4OPTA 3NH3X 3Q6JA 3NGCX 4PAAA 4EQRA 2C75A 4DSHA 2FJAA 2YVGA 1FEBA 2GAGB 2X3NA 3KA7A 1EBDA 2QA2A 3EANA 4NEVA 3UKLA 1E7PA 2X8CA 2OLNA 2BXRA 3UKPA 3AYLA 3NK2X 2YG7A 3M13A 2VOUA 4JY3A 4FK1C 2WOIA 2ZBWA 1NPXA 1YQ3A 1TRBA 3T37A 1FCDA 4DSGA 5JCNA 4U8KA 3DJJA 4USRA 1XHCA 2YLZA 2APGA 1MO9A 3AYIA 4KX6A 4USQA 1TDKA 4JQ9A 4U8PA 4I59A 3UTFA 1E1LA 1F8RA 4XWRA 2WP5A 3V3NA 4J56A 3II4A 4CNJA 1LPFA 3KLJA 3NYEA 2WU5A 3CGEA 3NIXA 4H2PA 2WPCA 4H4XA 4K2XA 4KPRA 1B4VA 1F6MA 5GRTA 5IPYA 4DGKA 3COXA 3ITJA 4I58A 2B7SA 1XPQA 2XFOA 4IVOB 2C76A 1GSNA 1CHUA 4LA1A 2C67A 2GF3A 3QFAA 2ZZ0A 4H4ZA 4B66A 3PVCA 4CCRA 1NHQA 2WDQA 2E1MA 3AEEA 2GR2A 2FJDA 2VVMA 5FMHA 1GREA 1S3BA 3E1TA 2VVLA 1OJDA 3AB1A 3NRNA 2R4JA 1PS9A 1BGNA 2R9ZA 3UP4A 2BK5A 4CCQA 4JDRA 3AE1A 2YG3A 2Y6RA 4GR1A 5KMQA 3UOVA 4AT0A 2BC1A 4EM4A 1RP0A 2GVCA 3GWFA 1TYPA 2E5VA 1N4UA 2JB1A 4YTMA 3T2YA 3T31A 2IVDA 4U8MA 4YSZA 4X9MA 3AE4A 1KF6A 3CIRA 4AP3A 3KVEA 4B68A 2FJBA 3IWAA 5FS7A 3I6DA 3UKFA 4U2SA 2BACA 3EF6A 3FPZA 4YKGA 3NG7X 1BF3A 4H2RA 3DJDA 1CL0A 3GD4A 1D4CA 3KU9A 2V60A 1ZDLA 1JU2A 1KSSA 2BC0A 2OAMA 3NK0X 4H4VA 2JKCA 4U2LA 1LTXR 2BRAA 3V3OA 3QVRA 1GRGA 3DGHA 4BURA 3CNSA 2WP6A 2GR3A 2WBAA 1NG3A 5KOXA 1CC2A 4NTDA 1K4QA 5KWFA 2B9YA 1ZMDA 1AOGA 2VRLA 1YKJA 3DMEA 3SXIA 3HZLA 1JNZA 3FMWA 3AEDA 4H2QA 4JNQA 4JNAA 3DGZA 3OC4A 2EQ8A 3LADA 3T2KA 1GPEA 2VQBA 3IHGA 4NNJA 2E4GA 2EQ7A 1JRXA 1IUXA 1HYUA 3T14A 2C66A 1ZX9A 2WU2A 3VRAA 4B65A 1NG4A 3RNMA 1KNPA 2R0PA 4G73A 4H2NA 2C4CA 5U1OA 2WDVA 1B37A 1O95A 1GRBA 1DOBA 2Q0KA 3ALMA 4OVIA 5ER0A 2YLSA 3GWDA 1BWCA 1DNCA 4M52A 4CRTA 3ISHA 3GD3A 3DJEA 3LB8A
chains in the Genus database with same CATH topology
3SZFA 1IUUA 4A6NB 2YR5A 3K7MX 1FOHA 1GRHA 1H6VA 5KNLA 4TM3A 3AE5A 2QA1A 4K5RA 2BS2A 3CGBA 3DK4A 4GDEA 4REKA 2WP9A 4ZCDA 3O0HA 4BJYA 3VR8A 3UTHA 2XYOA 4AOSA 3OZ2A 1O5WA 5CQFA 5KVHA 1YY5A 1QJDA 4NZHA 4EMJA 3Q9TA 2C3DA 2YM2A 4K7ZA 1KNRA 1H86A 1DJQA 3P4RA 4OPCA 3RHAA 1ZP0A 4G74A 4G9KA 3UOXA 4A5LA 4D03A 1YQ4A 3CNTA 1E6EA 5JCLA 3D8XA 1PBBA 3IF9A 5JCMA 3ATQA 4B63A 4Z2RA 3BI2A 1H7WA 1GESA 3ZDNA 5TR3A 5EBKA 1GNDA 2YVFA 2CDUA 2BA9A 4A9WA 3ATRA 2V6OA 3SGLA 3BHKA 1EL5A 4H4WA 2GAHB 3ALJA 2J3NA 1KDGA 1FECA 2BCPA 1NHSA 2BYBA 2XCGA 4CY8A 4K5SA 2ARDA 4U8OA 1ZMCA 2DKHA 1Q1WA 4Z2TA 3AD8B 1GT8A 1VQWA 4NTCA 2GR0A 4TM4A 1LQUA 4RG3A 1JNRA 1LQTA 1NDAA 2GQFA 2WPFA 2BCGG 3AD9B 3F8PA 4U8IA 3SZCA 1OJAA 1IUSA 3IHMA 4TLZA 3D1CA 5HHFA 2YG4A 3AECA 2BS3A 1S3EA 2JB2A 2VZ2A 3CNDA 1N1PA 4YSYA 1E1MA 2Q6UA 4YSXA 2JAEA 4OPLA 4DNAA 2F5ZA 1EL9A 5JCIA 2C3CA 3UTEA 2GB0A 3ICTA 2JK6A 3T0KA 4N9XA 4IA6A 4TLXA 2W0HA 4C5OA 3NYFA 2BABA 4A79A 1GETA 1PJ6A 2XVHA 4II2A 2OLOA 1H83A 3NN0X 3DA1A 2JB3A 3VRBA 2CVJA 3UCLA 1DJNA 2CFYA 3RP6A 1GEUA 1PBDA 4B64A 4JN9A 2YLWA 4EQSA 3NHOX 1EL8A 2FBWA 2Q0LA 3SM8A 1JRZA 3GRTA 5IQ1A 1VG0A 5KVIA 4Z26A 5J60A 5BRTA 2AQJA 2NVKX 1Q9IA 1RSGA 4HA6A 3GYXA 3V76A 1IUTA 3C4NA 1ZKQA 1PDHA 4A6NA 1GTHA 2C73A 2QCUA 2YVJA 4EIPA 2XLRA 2BK3A 4IVMB 2TPRA 2B9XA 3CPHG 4GF7A 1LJ1A 4ZCCA 2YR6A 4ECHA 2B7RA 3CTYA 3REDA 2H88A 5KMRA 1COYA 3GDNA 4WCTA 4O5UA 4EIQA 3AD7B 1CC6A 4EMIA 2RABA 3AEFA 2I0ZA 3CGCA 4X4JA 1VG9A 2EQ9A 2GR1A 4E0VA 4OPUA 1LV0A 3SQPA 4EM3A 4C3XA 4ADWA 1TDOA 3DK8A 4J31A 2OALA 3WE0A 2XVIA 3L8KA 3FG2P 4H4QA 2HQMA 2YQUA 1DODA 3AE9A 3QSSA 3KKJA 2B9WA 3NKSA 4ICYA 3AEAA 4ZN0A 3P4QA 3GDPA 3UOYA 1ZOYA 2IVEA 2NPXA 1D7LA 4J57A 2WEUA 3AEBA 4FDCB 4OPDA 2YG5A 1S2YA 2Z5YA 2RGJA 4K22A 2JBVA 4K8DA 3UP5A 3VRDB 1RYIA 3CPJG 4UDQA 4UDPA 4AP1A 4BK3A 3G5RA 2QAEA 4U2TA 1K0IA 1NENA 1NEKA 4Z44A 2YLRA 5C3JA 2X99A 1N4VA 3M0OA 3ICRA 4Y4NA 4Y4MA 4U8LA 1PBEA 3IC9A 2YG6A 1VDCA 1BGJA 2R0CA 3H8LA 5C2TA 4G6GA 4OPIA 4G6HA 3SY4A 2XDOA 3VR9A 1Y56B 1GTEA 2DKIA 4H4TA 3SZ0A 4C77A 3DH9A 4B69A 1KFYA 3SX6A 2XVEA 3M12A 1JOAA 1TDFA 3AXBA 3PO7A 1LVLA 1BKWA 1P2EA 1H81A 1TDNA 3NTAA 5LV9A 1TYTA 3F8DA 2YLXA 2VVLG 3ZYXA 1F8WA 3S5WA 2XFQA 1CBOA 1GRFA 1OJ9A 5U25A 1ELIA 3VQRA 3NK1X 1SEZA 4II3A 4P9SA 4A7AA 4B67A 4X9NA 2RGHA 4BK1A 4CNKA 1V59A 1H82A 1NHPA 2CULA 1GRTA 1P2HA 1DOCA 3RP8A 3AE6A 1H7XA 3ADAB 3I3LA 1E39A 4J36A 2V3BA 3UKKA 4A65A 1XANA 2ACZA 3UOZA 3FBSA 5M0ZA 3GMCA 3JSKA 3UKHA 4OCGA 5IQ4A 1ZOVA 3FIMB 4U8NA 1L9DA 1PXAA 4J33A 4Z25A 1OJTA 4YSHA 3K7QX 3L1RA 1IUVA 4UDRA 5M10A 4JY2A 5KMSA 2A8XA 1EL7A 4H4PA 1CJCA 2R46A 4BK2A 5KXJA 3K7TA 3GRSA 5EB5A 3BNMA 3NYCA 1K0JA 2AAQA 4TM0A 4XWZA 2X8GA 3C96A 3GMBA 2V3AA 4H4SA 1GALA 4LIIA 3B3RA 5EOWA 2A87A 4O5QA 4H4YA 3AE7A 2YM1A 4NTEA 4U8JA 2YAUA 2Z5XA 2ZZBA 2BS4A 1W4XA 4MJWA 2WS3A 3BNUA 1L0VA 5KMPA 5KRQA 1NAAA 2WPEA 3KPKA 3QJ4A 2WDRA 2EQ6A 5FS8A 1Y0PA 4GAPA 4AOXA 3C4AA 2X50A 4C3YA 2A89A 2C70A 4YKFA 4BV6A 1REOA 1PBCA 2XVFA 1Z6LA 3CNJA 5EB4A 5BULA 1DOEA 4YTNA 2WOVA 3AE8A 5FS9A 1JEHA 4PABA 2O9ZA 3NNEA 5FS6A 2GMHA 4H50A 2XLTA 1CJ4A 1JRYA 2R0GA 2GQWA 2VQ7A 4Y4LA 4BJZA 2C64A 3B6DA 3LZXA 4A99A 1IJHA 2XLSA 3AEGA 3KPFA 4D04A 5J7XA 1PJ5A 3EPTA 3BI5A 2H89A 1PBFA 2XFNA 2XVJA 3S61A 4CBQA 1L9EA 1IUWA 1Y56A 3G5SA 2XLPA 1F8SA 3AYJA 4GAVA 1D4DA 1GV4A 2ZZCA 4WX1A 3CNPA 3H4KA 2V61A 4AT2A 1XDIA 1UKVG 2BXSA 4XXGA 3SZWA 4YT0A 3ICSA 2IIDA 1GRAA 3R9UA 3EAOA 3QVPA 2RGOA 2OA1A 4FX9A 1PXBA 4GUVA 1QO8A 3CPIG 1CJ2A 2YR4A 1L9CA 1B5QA 3AE2A 4YWOA 4H4RA 4H7UA 2UZZA 1BZLA 4B1BA 3NLCA 4EMWA 1Q1RA 3AE3A 2XFUA 4GRTA 1K0LA 5HY5A 1TDEA 1ZY8A 4IV9A 5KOWA 2AR8A 1CJ3A 3CMMA 2Q7VA 3K30A 1ZK7A 3H8IA 1D4EA 1FL2A 4GCMA 5JCKA 1CF3A 2VRMA 4EQWA 3ABVA 5DBJA 1PN0A 1PJ7A 3LJPA 1CC4A 1GXFA 1H84A 2R45A 4Z2UA 3NT6A 1M64A 1D7YA 3P1WA 3QFBA 3SYIA 1B8SA 2GH5A 2XLUA 3ALLA 2V5ZA 4FK1A 4YXDA 1S2QA 2BK4A 3CN8A 2FJEA 3UKQA 5BVAA 1PHHA 3RP7A 3KD9A 4J2WA 3BHFA 3DJGX 1E1NA 1X31B 3LOVA 1FEAA 2WETA 4YTPA 3GYJA 3UTGA 3DK9A 2Y6QA 3AWIA 2PHHA 2WQYA 3F8RA 4J34A 4RG4A 3LZWA 3P9UA 1OJCA 2GMJA 3QSEA 1M6IA 3HYVA 3UKAA 5U63A 2C72A 1O94A 2WESA 4Z43A 3HYXA 2R4EA 5L46A 2YWLA 3SFEA 4RSLA 5HXIA 3URHA 1QLBA 1PXCA 2GEWA 4APNA 1VRQB 4OPGA 4NWZA 4IA5A 3P4PA 1DXLA 2BRYA 3SFDA 3PS9A 1GOSA 2GV8A 2YLTA 5GSNA 4GDPA 1NHRA 3NN6X 4LU6A 5BUKA 2XFPA 2B76A 2WHDA 3NTDA 4TM1A 3HYWA 1E1KA 3BI4A 4Z24A 4H4UA 1MOKA 2C65A 3G5QA 1N4WA 3T2ZA 2X8HA 1YQZA 4CY6A 1MXTA 4HB9A 1D5TA 4C74A 3P4SA 3LXDA 2PYXA 3QSMA 3GYIA 4NEWA 3GSIA 4UP3A 1GERA 2TMDA 2WOWA 1ONFA 5HYMA 3CGDA 2GRTA 2C7GA 4EQXA 1KSUA 1F3PA 5CKUA 4OPTA 3NH3X 3Q6JA 3NGCX 4PAAA 4EQRA 2C75A 4DSHA 2FJAA 2YVGA 1FEBA 2GAGB 2X3NA 3KA7A 1EBDA 2QA2A 3EANA 4NEVA 3UKLA 1E7PA 2X8CA 2OLNA 2BXRA 3UKPA 3AYLA 3NK2X 2YG7A 3M13A 2VOUA 4JY3A 4FK1C 2WOIA 2ZBWA 1NPXA 1YQ3A 1TRBA 3T37A 1FCDA 4DSGA 5JCNA 4U8KA 3DJJA 4USRA 1XHCA 2YLZA 2APGA 1MO9A 3AYIA 4KX6A 4USQA 1TDKA 4JQ9A 4U8PA 4I59A 3UTFA 1E1LA 1F8RA 4XWRA 2WP5A 3V3NA 4J56A 3II4A 4CNJA 1LPFA 3KLJA 3NYEA 2WU5A 3CGEA 3NIXA 4H2PA 2WPCA 4H4XA 4K2XA 4KPRA 1B4VA 1F6MA 5GRTA 5IPYA 4DGKA 3COXA 3ITJA 4I58A 2B7SA 1XPQA 2XFOA 4IVOB 2C76A 1GSNA 1CHUA 4LA1A 2C67A 2GF3A 3QFAA 2ZZ0A 4H4ZA 4B66A 3PVCA 4CCRA 1NHQA 2WDQA 2E1MA 3AEEA 2GR2A 2FJDA 2VVMA 5FMHA 1GREA 1S3BA 3E1TA 2VVLA 1OJDA 3AB1A 3NRNA 2R4JA 1PS9A 1BGNA 2R9ZA 3UP4A 2BK5A 4CCQA 4JDRA 3AE1A 2YG3A 2Y6RA 4GR1A 5KMQA 3UOVA 4AT0A 2BC1A 4EM4A 1RP0A 2GVCA 3GWFA 1TYPA 2E5VA 1N4UA 2JB1A 4YTMA 3T2YA 3T31A 2IVDA 4U8MA 4YSZA 4X9MA 3AE4A 1KF6A 3CIRA 4AP3A 3KVEA 4B68A 2FJBA 3IWAA 5FS7A 3I6DA 3UKFA 4U2SA 2BACA 3EF6A 3FPZA 4YKGA 3NG7X 1BF3A 4H2RA 3DJDA 1CL0A 3GD4A 1D4CA 3KU9A 2V60A 1ZDLA 1JU2A 1KSSA 2BC0A 2OAMA 3NK0X 4H4VA 2JKCA 4U2LA 1LTXR 2BRAA 3V3OA 3QVRA 1GRGA 3DGHA 4BURA 3CNSA 2WP6A 2GR3A 2WBAA 1NG3A 5KOXA 1CC2A 4NTDA 1K4QA 5KWFA 2B9YA 1ZMDA 1AOGA 2VRLA 1YKJA 3DMEA 3SXIA 3HZLA 1JNZA 3FMWA 3AEDA 4H2QA 4JNQA 4JNAA 3DGZA 3OC4A 2EQ8A 3LADA 3T2KA 1GPEA 2VQBA 3IHGA 4NNJA 2E4GA 2EQ7A 1JRXA 1IUXA 1HYUA 3T14A 2C66A 1ZX9A 2WU2A 3VRAA 4B65A 1NG4A 3RNMA 1KNPA 2R0PA 4G73A 4H2NA 2C4CA 5U1OA 2WDVA 1B37A 1O95A 1GRBA 1DOBA 2Q0KA 3ALMA 4OVIA 5ER0A 2YLSA 3GWDA 1BWCA 1DNCA 4M52A 4CRTA 3ISHA 3GD3A 3DJEA 3LB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZF A;  3HYW A;  3T2K A;  4G6G A;  4G6H A;  3SY4 A;  3T2Z A;  3T14 A;  3HYV A;  3T0K A;  3SZ0 A;  5KMP A;  4G73 A;  3HYX A;  3SX6 A;  3KPK A;  4GAP A;  5KMR A;  4GAV A;  4NWZ A;  5KMQ A;  3SYI A;  4G74 A;  3SZC A;  4G9K A;  5KMS A;  3SZW A;  3SXI A;  3T31 A;  3T2Y A; 
#chains in the Genus database with same CATH topology
 3SZF A;  1IUU A;  4A6N B;  2YR5 A;  3K7M X;  1FOH A;  1GRH A;  1H6V A;  5KNL A;  4TM3 A;  3AE5 A;  2QA1 A;  4K5R A;  2BS2 A;  3CGB A;  3DK4 A;  4GDE A;  4REK A;  2WP9 A;  4ZCD A;  3O0H A;  4BJY A;  3VR8 A;  3UTH A;  2XYO A;  4AOS A;  3OZ2 A;  1O5W A;  5CQF A;  5KVH A;  1YY5 A;  1QJD A;  4NZH A;  4EMJ A;  3Q9T A;  2C3D A;  2YM2 A;  4K7Z A;  1KNR A;  1H86 A;  1DJQ A;  3P4R A;  4OPC A;  3RHA A;  1ZP0 A;  4G74 A;  4G9K A;  3UOX A;  4A5L A;  4D03 A;  1YQ4 A;  3CNT A;  1E6E A;  5JCL A;  3D8X A;  1PBB A;  3IF9 A;  5JCM A;  3ATQ A;  4B63 A;  4Z2R A;  3BI2 A;  1H7W A;  1GES A;  3ZDN A;  5TR3 A;  5EBK A;  1GND A;  2YVF A;  2CDU A;  2BA9 A;  4A9W A;  3ATR A;  2V6O A;  3SGL A;  3BHK A;  1EL5 A;  4H4W A;  2GAH B;  3ALJ A;  2J3N A;  1KDG A;  1FEC A;  2BCP A;  1NHS A;  2BYB A;  2XCG A;  4CY8 A;  4K5S A;  2ARD A;  4U8O A;  1ZMC A;  2DKH A;  1Q1W A;  4Z2T A;  3AD8 B;  1GT8 A;  1VQW A;  4NTC A;  2GR0 A;  4TM4 A;  1LQU A;  4RG3 A;  1JNR A;  1LQT A;  1NDA A;  2GQF A;  2WPF A;  2BCG G;  3AD9 B;  3F8P A;  4U8I A;  3SZC A;  1OJA A;  1IUS A;  3IHM A;  4TLZ A;  3D1C A;  5HHF A;  2YG4 A;  3AEC A;  2BS3 A;  1S3E A;  2JB2 A;  2VZ2 A;  3CND A;  1N1P A;  4YSY A;  1E1M A;  2Q6U A;  4YSX A;  2JAE A;  4OPL A;  4DNA A;  2F5Z A;  1EL9 A;  5JCI A;  2C3C A;  3UTE A;  2GB0 A;  3ICT A;  2JK6 A;  3T0K A;  4N9X A;  4IA6 A;  4TLX A;  2W0H A;  4C5O A;  3NYF A;  2BAB A;  4A79 A;  1GET A;  1PJ6 A;  2XVH A;  4II2 A;  2OLO A;  1H83 A;  3NN0 X;  3DA1 A;  2JB3 A;  3VRB A;  2CVJ A;  3UCL A;  1DJN A;  2CFY A;  3RP6 A;  1GEU A;  1PBD A;  4B64 A;  4JN9 A;  2YLW A;  4EQS A;  3NHO X;  1EL8 A;  2FBW A;  2Q0L A;  3SM8 A;  1JRZ A;  3GRT A;  5IQ1 A;  1VG0 A;  5KVI A;  4Z26 A;  5J60 A;  5BRT A;  2AQJ A;  2NVK X;  1Q9I A;  1RSG A;  4HA6 A;  3GYX A;  3V76 A;  1IUT A;  3C4N A;  1ZKQ A;  1PDH A;  4A6N A;  1GTH A;  2C73 A;  2QCU A;  2YVJ A;  4EIP A;  2XLR A;  2BK3 A;  4IVM B;  2TPR A;  2B9X A;  3CPH G;  4GF7 A;  1LJ1 A;  4ZCC A;  2YR6 A;  4ECH A;  2B7R A;  3CTY A;  3RED A;  2H88 A;  5KMR A;  1COY A;  3GDN A;  4WCT A;  4O5U A;  4EIQ A;  3AD7 B;  1CC6 A;  4EMI A;  2RAB A;  3AEF A;  2I0Z A;  3CGC A;  4X4J A;  1VG9 A;  2EQ9 A;  2GR1 A;  4E0V A;  4OPU A;  1LV0 A;  3SQP A;  4EM3 A;  4C3X A;  4ADW A;  1TDO A;  3DK8 A;  4J31 A;  2OAL A;  3WE0 A;  2XVI A;  3L8K A;  3FG2 P;  4H4Q A;  2HQM A;  2YQU A;  1DOD A;  3AE9 A;  3QSS A;  3KKJ A;  2B9W A;  3NKS A;  4ICY A;  3AEA A;  4ZN0 A;  3P4Q A;  3GDP A;  3UOY A;  1ZOY A;  2IVE A;  2NPX A;  1D7L A;  4J57 A;  2WEU A;  3AEB A;  4FDC B;  4OPD A;  2YG5 A;  1S2Y A;  2Z5Y A;  2RGJ A;  4K22 A;  2JBV A;  4K8D A;  3UP5 A;  3VRD B;  1RYI A;  3CPJ G;  4UDQ A;  4UDP A;  4AP1 A;  4BK3 A;  3G5R A;  2QAE A;  4U2T A;  1K0I A;  1NEN A;  1NEK A;  4Z44 A;  2YLR A;  5C3J A;  2X99 A;  1N4V A;  3M0O A;  3ICR A;  4Y4N A;  4Y4M A;  4U8L A;  1PBE A;  3IC9 A;  2YG6 A;  1VDC A;  1BGJ A;  2R0C A;  3H8L A;  5C2T A;  4G6G A;  4OPI A;  4G6H A;  3SY4 A;  2XDO A;  3VR9 A;  1Y56 B;  1GTE A;  2DKI A;  4H4T A;  3SZ0 A;  4C77 A;  3DH9 A;  4B69 A;  1KFY A;  3SX6 A;  2XVE A;  3M12 A;  1JOA A;  1TDF A;  3AXB A;  3PO7 A;  1LVL A;  1BKW A;  1P2E A;  1H81 A;  1TDN A;  3NTA A;  5LV9 A;  1TYT A;  3F8D A;  2YLX A;  2VVL G;  3ZYX A;  1F8W A;  3S5W A;  2XFQ A;  1CBO A;  1GRF A;  1OJ9 A;  5U25 A;  1ELI A;  3VQR A;  3NK1 X;  1SEZ A;  4II3 A;  4P9S A;  4A7A A;  4B67 A;  4X9N A;  2RGH A;  4BK1 A;  4CNK A;  1V59 A;  1H82 A;  1NHP A;  2CUL A;  1GRT A;  1P2H A;  1DOC A;  3RP8 A;  3AE6 A;  1H7X A;  3ADA B;  3I3L A;  1E39 A;  4J36 A;  2V3B A;  3UKK A;  4A65 A;  1XAN A;  2ACZ A;  3UOZ A;  3FBS A;  5M0Z A;  3GMC A;  3JSK A;  3UKH A;  4OCG A;  5IQ4 A;  1ZOV A;  3FIM B;  4U8N A;  1L9D A;  1PXA A;  4J33 A;  4Z25 A;  1OJT A;  4YSH A;  3K7Q X;  3L1R A;  1IUV A;  4UDR A;  5M10 A;  4JY2 A;  5KMS A;  2A8X A;  1EL7 A;  4H4P A;  1CJC A;  2R46 A;  4BK2 A;  5KXJ A;  3K7T A;  3GRS A;  5EB5 A;  3BNM A;  3NYC A;  1K0J A;  2AAQ A;  4TM0 A;  4XWZ A;  2X8G A;  3C96 A;  3GMB A;  2V3A A;  4H4S A;  1GAL A;  4LII A;  3B3R A;  5EOW A;  2A87 A;  4O5Q A;  4H4Y A;  3AE7 A;  2YM1 A;  4NTE A;  4U8J A;  2YAU A;  2Z5X A;  2ZZB A;  2BS4 A;  1W4X A;  4MJW A;  2WS3 A;  3BNU A;  1L0V A;  5KMP A;  5KRQ A;  1NAA A;  2WPE A;  3KPK A;  3QJ4 A;  2WDR A;  2EQ6 A;  5FS8 A;  1Y0P A;  4GAP A;  4AOX A;  3C4A A;  2X50 A;  4C3Y A;  2A89 A;  2C70 A;  4YKF A;  4BV6 A;  1REO A;  1PBC A;  2XVF A;  1Z6L A;  3CNJ A;  5EB4 A;  5BUL A;  1DOE A;  4YTN A;  2WOV A;  3AE8 A;  5FS9 A;  1JEH A;  4PAB A;  2O9Z A;  3NNE A;  5FS6 A;  2GMH A;  4H50 A;  2XLT A;  1CJ4 A;  1JRY A;  2R0G A;  2GQW A;  2VQ7 A;  4Y4L A;  4BJZ A;  2C64 A;  3B6D A;  3LZX A;  4A99 A;  1IJH A;  2XLS A;  3AEG A;  3KPF A;  4D04 A;  5J7X A;  1PJ5 A;  3EPT A;  3BI5 A;  2H89 A;  1PBF A;  2XFN A;  2XVJ A;  3S61 A;  4CBQ A;  1L9E A;  1IUW A;  1Y56 A;  3G5S A;  2XLP A;  1F8S A;  3AYJ A;  4GAV A;  1D4D A;  1GV4 A;  2ZZC A;  4WX1 A;  3CNP A;  3H4K A;  2V61 A;  4AT2 A;  1XDI A;  1UKV G;  2BXS A;  4XXG A;  3SZW A;  4YT0 A;  3ICS A;  2IID A;  1GRA A;  3R9U A;  3EAO A;  3QVP A;  2RGO A;  2OA1 A;  4FX9 A;  1PXB A;  4GUV A;  1QO8 A;  3CPI G;  1CJ2 A;  2YR4 A;  1L9C A;  1B5Q A;  3AE2 A;  4YWO A;  4H4R A;  4H7U A;  2UZZ A;  1BZL A;  4B1B A;  3NLC A;  4EMW A;  1Q1R A;  3AE3 A;  2XFU A;  4GRT A;  1K0L A;  5HY5 A;  1TDE A;  1ZY8 A;  4IV9 A;  5KOW A;  2AR8 A;  1CJ3 A;  3CMM A;  2Q7V A;  3K30 A;  1ZK7 A;  3H8I A;  1D4E A;  1FL2 A;  4GCM A;  5JCK A;  1CF3 A;  2VRM A;  4EQW A;  3ABV A;  5DBJ A;  1PN0 A;  1PJ7 A;  3LJP A;  1CC4 A;  1GXF A;  1H84 A;  2R45 A;  4Z2U A;  3NT6 A;  1M64 A;  1D7Y A;  3P1W A;  3QFB A;  3SYI A;  1B8S A;  2GH5 A;  2XLU A;  3ALL A;  2V5Z A;  4FK1 A;  4YXD A;  1S2Q A;  2BK4 A;  3CN8 A;  2FJE A;  3UKQ A;  5BVA A;  1PHH A;  3RP7 A;  3KD9 A;  4J2W A;  3BHF A;  3DJG X;  1E1N A;  1X31 B;  3LOV A;  1FEA A;  2WET A;  4YTP A;  3GYJ A;  3UTG A;  3DK9 A;  2Y6Q A;  3AWI A;  2PHH A;  2WQY A;  3F8R A;  4J34 A;  4RG4 A;  3LZW A;  3P9U A;  1OJC A;  2GMJ A;  3QSE A;  1M6I A;  3HYV A;  3UKA A;  5U63 A;  2C72 A;  1O94 A;  2WES A;  4Z43 A;  3HYX A;  2R4E A;  5L46 A;  2YWL A;  3SFE A;  4RSL A;  5HXI A;  3URH A;  1QLB A;  1PXC A;  2GEW A;  4APN A;  1VRQ B;  4OPG A;  4NWZ A;  4IA5 A;  3P4P A;  1DXL A;  2BRY A;  3SFD A;  3PS9 A;  1GOS A;  2GV8 A;  2YLT A;  5GSN A;  4GDP A;  1NHR A;  3NN6 X;  4LU6 A;  5BUK A;  2XFP A;  2B76 A;  2WHD A;  3NTD A;  4TM1 A;  3HYW A;  1E1K A;  3BI4 A;  4Z24 A;  4H4U A;  1MOK A;  2C65 A;  3G5Q A;  1N4W A;  3T2Z A;  2X8H A;  1YQZ A;  4CY6 A;  1MXT A;  4HB9 A;  1D5T A;  4C74 A;  3P4S A;  3LXD A;  2PYX A;  3QSM A;  3GYI A;  4NEW A;  3GSI A;  4UP3 A;  1GER A;  2TMD A;  2WOW A;  1ONF A;  5HYM A;  3CGD A;  2GRT A;  2C7G A;  4EQX A;  1KSU A;  1F3P A;  5CKU A;  4OPT A;  3NH3 X;  3Q6J A;  3NGC X;  4PAA A;  4EQR A;  2C75 A;  4DSH A;  2FJA A;  2YVG A;  1FEB A;  2GAG B;  2X3N A;  3KA7 A;  1EBD A;  2QA2 A;  3EAN A;  4NEV A;  3UKL A;  1E7P A;  2X8C A;  2OLN A;  2BXR A;  3UKP A;  3AYL A;  3NK2 X;  2YG7 A;  3M13 A;  2VOU A;  4JY3 A;  4FK1 C;  2WOI A;  2ZBW A;  1NPX A;  1YQ3 A;  1TRB A;  3T37 A;  1FCD A;  4DSG A;  5JCN A;  4U8K A;  3DJJ A;  4USR A;  1XHC A;  2YLZ A;  2APG A;  1MO9 A;  3AYI A;  4KX6 A;  4USQ A;  1TDK A;  4JQ9 A;  4U8P A;  4I59 A;  3UTF A;  1E1L A;  1F8R A;  4XWR A;  2WP5 A;  3V3N A;  4J56 A;  3II4 A;  4CNJ A;  1LPF A;  3KLJ A;  3NYE A;  2WU5 A;  3CGE A;  3NIX A;  4H2P A;  2WPC A;  4H4X A;  4K2X A;  4KPR A;  1B4V A;  1F6M A;  5GRT A;  5IPY A;  4DGK A;  3COX A;  3ITJ A;  4I58 A;  2B7S A;  1XPQ A;  2XFO A;  4IVO B;  2C76 A;  1GSN A;  1CHU A;  4LA1 A;  2C67 A;  2GF3 A;  3QFA A;  2ZZ0 A;  4H4Z A;  4B66 A;  3PVC A;  4CCR A;  1NHQ A;  2WDQ A;  2E1M A;  3AEE A;  2GR2 A;  2FJD A;  2VVM A;  5FMH A;  1GRE A;  1S3B A;  3E1T A;  2VVL A;  1OJD A;  3AB1 A;  3NRN A;  2R4J A;  1PS9 A;  1BGN A;  2R9Z A;  3UP4 A;  2BK5 A;  4CCQ A;  4JDR A;  3AE1 A;  2YG3 A;  2Y6R A;  4GR1 A;  5KMQ A;  3UOV A;  4AT0 A;  2BC1 A;  4EM4 A;  1RP0 A;  2GVC A;  3GWF A;  1TYP A;  2E5V A;  1N4U A;  2JB1 A;  4YTM A;  3T2Y A;  3T31 A;  2IVD A;  4U8M A;  4YSZ A;  4X9M A;  3AE4 A;  1KF6 A;  3CIR A;  4AP3 A;  3KVE A;  4B68 A;  2FJB A;  3IWA A;  5FS7 A;  3I6D A;  3UKF A;  4U2S A;  2BAC A;  3EF6 A;  3FPZ A;  4YKG A;  3NG7 X;  1BF3 A;  4H2R A;  3DJD A;  1CL0 A;  3GD4 A;  1D4C A;  3KU9 A;  2V60 A;  1ZDL A;  1JU2 A;  1KSS A;  2BC0 A;  2OAM A;  3NK0 X;  4H4V A;  2JKC A;  4U2L A;  1LTX R;  2BRA A;  3V3O A;  3QVR A;  1GRG A;  3DGH A;  4BUR A;  3CNS A;  2WP6 A;  2GR3 A;  2WBA A;  1NG3 A;  5KOX A;  1CC2 A;  4NTD A;  1K4Q A;  5KWF A;  2B9Y A;  1ZMD A;  1AOG A;  2VRL A;  1YKJ A;  3DME A;  3SXI A;  3HZL A;  1JNZ A;  3FMW A;  3AED A;  4H2Q A;  4JNQ A;  4JNA A;  3DGZ A;  3OC4 A;  2EQ8 A;  3LAD A;  3T2K A;  1GPE A;  2VQB A;  3IHG A;  4NNJ A;  2E4G A;  2EQ7 A;  1JRX A;  1IUX A;  1HYU A;  3T14 A;  2C66 A;  1ZX9 A;  2WU2 A;  3VRA A;  4B65 A;  1NG4 A;  3RNM A;  1KNP A;  2R0P A;  4G73 A;  4H2N A;  2C4C A;  5U1O A;  2WDV A;  1B37 A;  1O95 A;  1GRB A;  1DOB A;  2Q0K A;  3ALM A;  4OVI A;  5ER0 A;  2YLS A;  3GWD A;  1BWC A;  1DNC A;  4M52 A;  4CRT A;  3ISH A;  3GD3 A;  3DJE A;  3LB8 A; 
#chains in the Genus database with same CATH homology
 3SZF A;  1IUU A;  4A6N B;  2YR5 A;  3K7M X;  1FOH A;  1GRH A;  1H6V A;  5KNL A;  4TM3 A;  3AE5 A;  2QA1 A;  4K5R A;  2BS2 A;  3CGB A;  3DK4 A;  4GDE A;  4REK A;  2WP9 A;  4ZCD A;  3O0H A;  4BJY A;  3VR8 A;  3UTH A;  2XYO A;  4AOS A;  3OZ2 A;  1O5W A;  5CQF A;  5KVH A;  1YY5 A;  1QJD A;  4NZH A;  4EMJ A;  3Q9T A;  2C3D A;  2YM2 A;  4K7Z A;  1KNR A;  1H86 A;  1DJQ A;  3P4R A;  4OPC A;  3RHA A;  1ZP0 A;  4G74 A;  4G9K A;  3UOX A;  4A5L A;  4D03 A;  1YQ4 A;  3CNT A;  1E6E A;  5JCL A;  3D8X A;  1PBB A;  3IF9 A;  5JCM A;  3ATQ A;  4B63 A;  4Z2R A;  3BI2 A;  1H7W A;  1GES A;  3ZDN A;  5TR3 A;  5EBK A;  1GND A;  2YVF A;  2CDU A;  2BA9 A;  4A9W A;  3ATR A;  2V6O A;  3SGL A;  3BHK A;  1EL5 A;  4H4W A;  2GAH B;  3ALJ A;  2J3N A;  1KDG A;  1FEC A;  2BCP A;  1NHS A;  2BYB A;  2XCG A;  4CY8 A;  4K5S A;  2ARD A;  4U8O A;  1ZMC A;  2DKH A;  1Q1W A;  4Z2T A;  3AD8 B;  1GT8 A;  1VQW A;  4NTC A;  2GR0 A;  4TM4 A;  1LQU A;  4RG3 A;  1JNR A;  1LQT A;  1NDA A;  2GQF A;  2WPF A;  2BCG G;  3AD9 B;  3F8P A;  4U8I A;  3SZC A;  1OJA A;  1IUS A;  3IHM A;  4TLZ A;  3D1C A;  5HHF A;  2YG4 A;  3AEC A;  2BS3 A;  1S3E A;  2JB2 A;  2VZ2 A;  3CND A;  1N1P A;  4YSY A;  1E1M A;  2Q6U A;  4YSX A;  2JAE A;  4OPL A;  4DNA A;  2F5Z A;  1EL9 A;  5JCI A;  2C3C A;  3UTE A;  2GB0 A;  3ICT A;  2JK6 A;  3T0K A;  4N9X A;  4IA6 A;  4TLX A;  2W0H A;  4C5O A;  3NYF A;  2BAB A;  4A79 A;  1GET A;  1PJ6 A;  2XVH A;  4II2 A;  2OLO A;  1H83 A;  3NN0 X;  3DA1 A;  2JB3 A;  3VRB A;  2CVJ A;  3UCL A;  1DJN A;  2CFY A;  3RP6 A;  1GEU A;  1PBD A;  4B64 A;  4JN9 A;  2YLW A;  4EQS A;  3NHO X;  1EL8 A;  2FBW A;  2Q0L A;  3SM8 A;  1JRZ A;  3GRT A;  5IQ1 A;  1VG0 A;  5KVI A;  4Z26 A;  5J60 A;  5BRT A;  2AQJ A;  2NVK X;  1Q9I A;  1RSG A;  4HA6 A;  3GYX A;  3V76 A;  1IUT A;  3C4N A;  1ZKQ A;  1PDH A;  4A6N A;  1GTH A;  2C73 A;  2QCU A;  2YVJ A;  4EIP A;  2XLR A;  2BK3 A;  4IVM B;  2TPR A;  2B9X A;  3CPH G;  4GF7 A;  1LJ1 A;  4ZCC A;  2YR6 A;  4ECH A;  2B7R A;  3CTY A;  3RED A;  2H88 A;  5KMR A;  1COY A;  3GDN A;  4WCT A;  4O5U A;  4EIQ A;  3AD7 B;  1CC6 A;  4EMI A;  2RAB A;  3AEF A;  2I0Z A;  3CGC A;  4X4J A;  1VG9 A;  2EQ9 A;  2GR1 A;  4E0V A;  4OPU A;  1LV0 A;  3SQP A;  4EM3 A;  4C3X A;  4ADW A;  1TDO A;  3DK8 A;  4J31 A;  2OAL A;  3WE0 A;  2XVI A;  3L8K A;  3FG2 P;  4H4Q A;  2HQM A;  2YQU A;  1DOD A;  3AE9 A;  3QSS A;  3KKJ A;  2B9W A;  3NKS A;  4ICY A;  3AEA A;  4ZN0 A;  3P4Q A;  3GDP A;  3UOY A;  1ZOY A;  2IVE A;  2NPX A;  1D7L A;  4J57 A;  2WEU A;  3AEB A;  4FDC B;  4OPD A;  2YG5 A;  1S2Y A;  2Z5Y A;  2RGJ A;  4K22 A;  2JBV A;  4K8D A;  3UP5 A;  3VRD B;  1RYI A;  3CPJ G;  4UDQ A;  4UDP A;  4AP1 A;  4BK3 A;  3G5R A;  2QAE A;  4U2T A;  1K0I A;  1NEN A;  1NEK A;  4Z44 A;  2YLR A;  5C3J A;  2X99 A;  1N4V A;  3M0O A;  3ICR A;  4Y4N A;  4Y4M A;  4U8L A;  1PBE A;  3IC9 A;  2YG6 A;  1VDC A;  1BGJ A;  2R0C A;  3H8L A;  5C2T A;  4G6G A;  4OPI A;  4G6H A;  3SY4 A;  2XDO A;  3VR9 A;  1Y56 B;  1GTE A;  2DKI A;  4H4T A;  3SZ0 A;  4C77 A;  3DH9 A;  4B69 A;  1KFY A;  3SX6 A;  2XVE A;  3M12 A;  1JOA A;  1TDF A;  3AXB A;  3PO7 A;  1LVL A;  1BKW A;  1P2E A;  1H81 A;  1TDN A;  3NTA A;  5LV9 A;  1TYT A;  3F8D A;  2YLX A;  2VVL G;  3ZYX A;  1F8W A;  3S5W A;  2XFQ A;  1CBO A;  1GRF A;  1OJ9 A;  5U25 A;  1ELI A;  3VQR A;  3NK1 X;  1SEZ A;  4II3 A;  4P9S A;  4A7A A;  4B67 A;  4X9N A;  2RGH A;  4BK1 A;  4CNK A;  1V59 A;  1H82 A;  1NHP A;  2CUL A;  1GRT A;  1P2H A;  1DOC A;  3RP8 A;  3AE6 A;  1H7X A;  3ADA B;  3I3L A;  1E39 A;  4J36 A;  2V3B A;  3UKK A;  4A65 A;  1XAN A;  2ACZ A;  3UOZ A;  3FBS A;  5M0Z A;  3GMC A;  3JSK A;  3UKH A;  4OCG A;  5IQ4 A;  1ZOV A;  3FIM B;  4U8N A;  1L9D A;  1PXA A;  4J33 A;  4Z25 A;  1OJT A;  4YSH A;  3K7Q X;  3L1R A;  1IUV A;  4UDR A;  5M10 A;  4JY2 A;  5KMS A;  2A8X A;  1EL7 A;  4H4P A;  1CJC A;  2R46 A;  4BK2 A;  5KXJ A;  3K7T A;  3GRS A;  5EB5 A;  3BNM A;  3NYC A;  1K0J A;  2AAQ A;  4TM0 A;  4XWZ A;  2X8G A;  3C96 A;  3GMB A;  2V3A A;  4H4S A;  1GAL A;  4LII A;  3B3R A;  5EOW A;  2A87 A;  4O5Q A;  4H4Y A;  3AE7 A;  2YM1 A;  4NTE A;  4U8J A;  2YAU A;  2Z5X A;  2ZZB A;  2BS4 A;  1W4X A;  4MJW A;  2WS3 A;  3BNU A;  1L0V A;  5KMP A;  5KRQ A;  1NAA A;  2WPE A;  3KPK A;  3QJ4 A;  2WDR A;  2EQ6 A;  5FS8 A;  1Y0P A;  4GAP A;  4AOX A;  3C4A A;  2X50 A;  4C3Y A;  2A89 A;  2C70 A;  4YKF A;  4BV6 A;  1REO A;  1PBC A;  2XVF A;  1Z6L A;  3CNJ A;  5EB4 A;  5BUL A;  1DOE A;  4YTN A;  2WOV A;  3AE8 A;  5FS9 A;  1JEH A;  4PAB A;  2O9Z A;  3NNE A;  5FS6 A;  2GMH A;  4H50 A;  2XLT A;  1CJ4 A;  1JRY A;  2R0G A;  2GQW A;  2VQ7 A;  4Y4L A;  4BJZ A;  2C64 A;  3B6D A;  3LZX A;  4A99 A;  1IJH A;  2XLS A;  3AEG A;  3KPF A;  4D04 A;  5J7X A;  1PJ5 A;  3EPT A;  3BI5 A;  2H89 A;  1PBF A;  2XFN A;  2XVJ A;  3S61 A;  4CBQ A;  1L9E A;  1IUW A;  1Y56 A;  3G5S A;  2XLP A;  1F8S A;  3AYJ A;  4GAV A;  1D4D A;  1GV4 A;  2ZZC A;  4WX1 A;  3CNP A;  3H4K A;  2V61 A;  4AT2 A;  1XDI A;  1UKV G;  2BXS A;  4XXG A;  3SZW A;  4YT0 A;  3ICS A;  2IID A;  1GRA A;  3R9U A;  3EAO A;  3QVP A;  2RGO A;  2OA1 A;  4FX9 A;  1PXB A;  4GUV A;  1QO8 A;  3CPI G;  1CJ2 A;  2YR4 A;  1L9C A;  1B5Q A;  3AE2 A;  4YWO A;  4H4R A;  4H7U A;  2UZZ A;  1BZL A;  4B1B A;  3NLC A;  4EMW A;  1Q1R A;  3AE3 A;  2XFU A;  4GRT A;  1K0L A;  5HY5 A;  1TDE A;  1ZY8 A;  4IV9 A;  5KOW A;  2AR8 A;  1CJ3 A;  3CMM A;  2Q7V A;  3K30 A;  1ZK7 A;  3H8I A;  1D4E A;  1FL2 A;  4GCM A;  5JCK A;  1CF3 A;  2VRM A;  4EQW A;  3ABV A;  5DBJ A;  1PN0 A;  1PJ7 A;  3LJP A;  1CC4 A;  1GXF A;  1H84 A;  2R45 A;  4Z2U A;  3NT6 A;  1M64 A;  1D7Y A;  3P1W A;  3QFB A;  3SYI A;  1B8S A;  2GH5 A;  2XLU A;  3ALL A;  2V5Z A;  4FK1 A;  4YXD A;  1S2Q A;  2BK4 A;  3CN8 A;  2FJE A;  3UKQ A;  5BVA A;  1PHH A;  3RP7 A;  3KD9 A;  4J2W A;  3BHF A;  3DJG X;  1E1N A;  1X31 B;  3LOV A;  1FEA A;  2WET A;  4YTP A;  3GYJ A;  3UTG A;  3DK9 A;  2Y6Q A;  3AWI A;  2PHH A;  2WQY A;  3F8R A;  4J34 A;  4RG4 A;  3LZW A;  3P9U A;  1OJC A;  2GMJ A;  3QSE A;  1M6I A;  3HYV A;  3UKA A;  5U63 A;  2C72 A;  1O94 A;  2WES A;  4Z43 A;  3HYX A;  2R4E A;  5L46 A;  2YWL A;  3SFE A;  4RSL A;  5HXI A;  3URH A;  1QLB A;  1PXC A;  2GEW A;  4APN A;  1VRQ B;  4OPG A;  4NWZ A;  4IA5 A;  3P4P A;  1DXL A;  2BRY A;  3SFD A;  3PS9 A;  1GOS A;  2GV8 A;  2YLT A;  5GSN A;  4GDP A;  1NHR A;  3NN6 X;  4LU6 A;  5BUK A;  2XFP A;  2B76 A;  2WHD A;  3NTD A;  4TM1 A;  3HYW A;  1E1K A;  3BI4 A;  4Z24 A;  4H4U A;  1MOK A;  2C65 A;  3G5Q A;  1N4W A;  3T2Z A;  2X8H A;  1YQZ A;  4CY6 A;  1MXT A;  4HB9 A;  1D5T A;  4C74 A;  3P4S A;  3LXD A;  2PYX A;  3QSM A;  3GYI A;  4NEW A;  3GSI A;  4UP3 A;  1GER A;  2TMD A;  2WOW A;  1ONF A;  5HYM A;  3CGD A;  2GRT A;  2C7G A;  4EQX A;  1KSU A;  1F3P A;  5CKU A;  4OPT A;  3NH3 X;  3Q6J A;  3NGC X;  4PAA A;  4EQR A;  2C75 A;  4DSH A;  2FJA A;  2YVG A;  1FEB A;  2GAG B;  2X3N A;  3KA7 A;  1EBD A;  2QA2 A;  3EAN A;  4NEV A;  3UKL A;  1E7P A;  2X8C A;  2OLN A;  2BXR A;  3UKP A;  3AYL A;  3NK2 X;  2YG7 A;  3M13 A;  2VOU A;  4JY3 A;  4FK1 C;  2WOI A;  2ZBW A;  1NPX A;  1YQ3 A;  1TRB A;  3T37 A;  1FCD A;  4DSG A;  5JCN A;  4U8K A;  3DJJ A;  4USR A;  1XHC A;  2YLZ A;  2APG A;  1MO9 A;  3AYI A;  4KX6 A;  4USQ A;  1TDK A;  4JQ9 A;  4U8P A;  4I59 A;  3UTF A;  1E1L A;  1F8R A;  4XWR A;  2WP5 A;  3V3N A;  4J56 A;  3II4 A;  4CNJ A;  1LPF A;  3KLJ A;  3NYE A;  2WU5 A;  3CGE A;  3NIX A;  4H2P A;  2WPC A;  4H4X A;  4K2X A;  4KPR A;  1B4V A;  1F6M A;  5GRT A;  5IPY A;  4DGK A;  3COX A;  3ITJ A;  4I58 A;  2B7S A;  1XPQ A;  2XFO A;  4IVO B;  2C76 A;  1GSN A;  1CHU A;  4LA1 A;  2C67 A;  2GF3 A;  3QFA A;  2ZZ0 A;  4H4Z A;  4B66 A;  3PVC A;  4CCR A;  1NHQ A;  2WDQ A;  2E1M A;  3AEE A;  2GR2 A;  2FJD A;  2VVM A;  5FMH A;  1GRE A;  1S3B A;  3E1T A;  2VVL A;  1OJD A;  3AB1 A;  3NRN A;  2R4J A;  1PS9 A;  1BGN A;  2R9Z A;  3UP4 A;  2BK5 A;  4CCQ A;  4JDR A;  3AE1 A;  2YG3 A;  2Y6R A;  4GR1 A;  5KMQ A;  3UOV A;  4AT0 A;  2BC1 A;  4EM4 A;  1RP0 A;  2GVC A;  3GWF A;  1TYP A;  2E5V A;  1N4U A;  2JB1 A;  4YTM A;  3T2Y A;  3T31 A;  2IVD A;  4U8M A;  4YSZ A;  4X9M A;  3AE4 A;  1KF6 A;  3CIR A;  4AP3 A;  3KVE A;  4B68 A;  2FJB A;  3IWA A;  5FS7 A;  3I6D A;  3UKF A;  4U2S A;  2BAC A;  3EF6 A;  3FPZ A;  4YKG A;  3NG7 X;  1BF3 A;  4H2R A;  3DJD A;  1CL0 A;  3GD4 A;  1D4C A;  3KU9 A;  2V60 A;  1ZDL A;  1JU2 A;  1KSS A;  2BC0 A;  2OAM A;  3NK0 X;  4H4V A;  2JKC A;  4U2L A;  1LTX R;  2BRA A;  3V3O A;  3QVR A;  1GRG A;  3DGH A;  4BUR A;  3CNS A;  2WP6 A;  2GR3 A;  2WBA A;  1NG3 A;  5KOX A;  1CC2 A;  4NTD A;  1K4Q A;  5KWF A;  2B9Y A;  1ZMD A;  1AOG A;  2VRL A;  1YKJ A;  3DME A;  3SXI A;  3HZL A;  1JNZ A;  3FMW A;  3AED A;  4H2Q A;  4JNQ A;  4JNA A;  3DGZ A;  3OC4 A;  2EQ8 A;  3LAD A;  3T2K A;  1GPE A;  2VQB A;  3IHG A;  4NNJ A;  2E4G A;  2EQ7 A;  1JRX A;  1IUX A;  1HYU A;  3T14 A;  2C66 A;  1ZX9 A;  2WU2 A;  3VRA A;  4B65 A;  1NG4 A;  3RNM A;  1KNP A;  2R0P A;  4G73 A;  4H2N A;  2C4C A;  5U1O A;  2WDV A;  1B37 A;  1O95 A;  1GRB A;  1DOB A;  2Q0K A;  3ALM A;  4OVI A;  5ER0 A;  2YLS A;  3GWD A;  1BWC A;  1DNC A;  4M52 A;  4CRT A;  3ISH A;  3GD3 A;  3DJE A;  3LB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...