3UOVA

Crystal structure of otemo (fad bound form 1)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
536
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords OTEMO
total genus 194
structure length 536
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uovA01
4B63A 3P4PA 1CJCA 1GNDA 3M13A 4YSXA 4UDQA 2R4EA 4ZCCA 3SFEA 3LB8A 2YQUA 4H4RA 2XVHA 4GUVA 2YLZA 2X8HA 4PAAA 2GR1A 1PJ6A 3BHFA 2TPRA 4YTNA 1KDGA 3DK9A 4EQXA 4IV9A 1FCDA 5M0ZA 2YAUA 5KVHA 3UOZA 4C3XA 3FG2P 1PJ5A 2R9ZA 1YQ4A 4YSYA 1GRAA 4JDRA 4U2SA 3NT6A 5GRTA 2ZZBA 3DGHA 4I58A 2OAMA 4RG4A 4TLXA 3CPHG 2R45A 3D1CA 1TYPA 4J36A 2EQ8A 1GSNA 2Y6QA 3RP6A 4AP3A 5BUKA 1EL8A 4IA5A 1KNRA 2DKHA 1LTXR 3GD4A 4EIPA 4EMWA 1PBFA 3KPFA 4J31A 4O5UA 3AD9B 1JNZA 3S5WA 4Z2TA 3CN8A 1NDAA 3P1WA 3L1RA 1LPFA 1D4CA 1VDCA 3UKLA 4Z24A 5EB5A 1B8SA 3REDA 3QVPA 2YM2A 3G5RA 1H7WA 3BNUA 1EBDA 1F6MA 1GPEA 3F8PA 3ZDNA 4H4XA 2YLWA 4B65A 2JB3A 4Z26A 1OJTA 3NGCX 2BC1A 2GQWA 3UKPA 2C3DA 4B69A 1E1KA 4YSZA 3AEGA 2AR8A 3DJJA 4LU6A 3AE3A 2R46A 2V61A 3UTFA 4J34A 1GEUA 4IVMB 1GXFA 4A9WA 3AEDA 1KF6A 2F5ZA 1RP0A 2H89A 3RNMA 5GSNA 4A6NB 3QJ4A 3LADA 5BVAA 4CNKA 4U8LA 1CJ4A 4YSHA 1MO9A 1PBEA 4J57A 1LV0A 4EQSA 1YKJA 1PJ7A 2JB2A 3UKAA 3CPIG 2BS4A 5FS8A 2APGA 2V60A 3OC4A 4MJWA 4ZN0A 1DNCA 5CKUA 1FEAA 3P9UA 4H4TA 4K5SA 1N4WA 2XYOA 3FMWA 4H4YA 1DJQA 3NN6X 4YKFA 2EQ6A 4OVIA 2C66A 4GRTA 5JCKA 4H2NA 1CC4A 1O94A 3V3OA 1S3EA 1IUSA 3VRBA 2YLRA 2WHDA 2WPCA 4B66A 2V3AA 2XDOA 4DSHA 3I3LA 5KWFA 3JSKA 4U8PA 2WPFA 5KOXA 1BGNA 1NG3A 4J2WA 3FPZA 4OPIA 3V3NA 2YVGA 1H84A 5JCLA 3DJGX 3SM8A 3ABVA 4CBQA 5L46A 3II4A 4U2LA 2GB0A 2A89A 1KNPA 3AE8A 1F8WA 4FK1A 3M0OA 3QSEA 1K0LA 3CNPA 2BK5A 2WS3A 5IQ1A 4I59A 2XVFA 4Z43A 3DH9A 1ZY8A 1LVLA 3C4AA 3URHA 3NYCA 2B7RA 2BACA 2XFPA 3AB1A 2NPXA 4K5RA 3VQRA 2W0HA 4FK1C 1NPXA 2C76A 3UKHA 4EM4A 4U8JA 1PN0A 2BK4A 3H8IA 3I6DA 4EM3A 3UOYA 1E1LA 4CCQA 4U8IA 3SGLA 5ER0A 3NTDA 2YVFA 1COYA 3CPJG 3LZWA 3ADAB 4OPGA 4REKA 3ICTA 1GT8A 1DOBA 2PYXA 5JCIA 3EANA 3RP8A 2FJEA 3KD9A 2BXSA 2R0PA 1IJHA 1EL5A 1Y56B 3SQPA 3Q6JA 3BHKA 3UKQA 1PBCA 2TMDA 2GQFA 2WU5A 4GDPA 1EL9A 2EQ7A 4M52A 4X9MA 3QFAA 4JNAA 4K22A 2WP6A 4BK1A 4EIQA 4EMIA 2V5ZA 1GESA 4C74A 5IPYA 5JCNA 4UP3A 1MOKA 2BC0A 4AP1A 1GOSA 2X8CA 3EAOA 2RGOA 1IUXA 3GYJA 1CJ3A 3AEAA 1PHHA 1E6EA 2Q7VA 2RGJA 2YR5A 4A79A 4YWOA 2VVMA 1GRGA 4Y4MA 1N4VA 4C77A 3V76A 4OPTA 2YG6A 1D7YA 1H6VA 3UP4A 3DK4A 4A99A 3DA1A 2WOWA 3NYEA 2IVDA 1ZOVA 2C67A 2YG3A 3AD7B 3KVEA 4U8NA 3IHGA 1DOCA 1NHQA 3UKKA 4EMJA 1P2EA 4EQRA 2VVLA 3LXDA 1B37A 1H82A 5J7XA 5EB4A 4BJYA 2R0GA 1ZMCA 2VRMA 3SFDA 3AE7A 3E1TA 3NLCA 3P4QA 1Q9IA 2R4JA 4WCTA 3UP5A 3K7QX 1NENA 1ZP0A 4Z2RA 2RABA 3UTHA 4U8KA 4FX9A 1JRXA 2XLRA 3O0HA 1SEZA 5C2TA 5KOWA 2I0ZA 3AYLA 4IA6A 2YLXA 3AXBA 5KRQA 1GRBA 1XDIA 4NTDA 4BV6A 1REOA 1RYIA 4TLZA 2BCPA 3K30A 4Z2UA 1PXAA 1VRQB 2BA9A 4A5LA 3GMBA 2WESA 3COXA 4H4UA 1CHUA 3AEEA 2WOIA 2XCGA 1OJAA 1S2YA 2AQJA 2OA1A 3NK1X 4O5QA 4GR1A 4PABA 4YT0A 2FJAA 2VRLA 1JRYA 5U1OA 4HB9A 1Q1WA 3UCLA 3CNDA 1IUVA 1ZOYA 3ICRA 2WEUA 4JQ9A 1CC2A 4U2TA 1N1PA 3KKJA 2WPEA 4E0VA 4ECHA 4OPLA 3WE0A 2E1MA 3GD3A 3NKSA 1GERA 1IUUA 2VQ7A 2OLOA 3B3RA 2XLPA 1ZDLA 4BK3A 1VG0A 2O9ZA 5HXIA 2YLTA 1K0IA 4N9XA 3B6DA 4AOSA 3ITJA 2QA2A 2FJDA 3AE6A 3CGDA 4XWRA 5M10A 2X8GA 1BF3A 4JN9A 1AOGA 1YQZA 4H50A 3VRAA 4GCMA 4AOXA 4X9NA 2EQ9A 3ICSA 1F8SA 1NHPA 3IHMA 3AECA 3EF6A 4IVOB 1TDNA 5EBKA 3NTAA 3LZXA 4B67A 3PVCA 1L0VA 4NEVA 3ISHA 1N4UA 4B68A 5U63A 3HZLA 5JCMA 1QO8A 1RSGA 3VRDB 2WDQA 1JRZA 3PO7A 2YR4A 3CGCA 2J3NA 1TDOA 4USRA 1PXBA 1W4XA 4ADWA 2GEWA 2CDUA 1E7PA 2QCUA 3KA7A 1DOEA 3KU9A 4JNQA 2JKCA 2YG5A 2FJBA 2GAHB 3NN0X 4K7ZA 3KLJA 3QVRA 1B5QA 2CULA 1F8RA 5FMHA 1GTHA 2C7GA 4CY6A 4YKGA 1D5TA 3AEBA 4OPCA 1D7LA 1CJ2A 1ELIA 4J56A 4BURA 1ONFA 3P4SA 2JB1A 3R9UA 4JY2A 3NRNA 4A6NA 1BGJA 1PXCA 3CNSA 3NYFA 3G5QA 1DXLA 3VR8A 1VQWA 2BYBA 1GV4A 4AT2A 3ATRA 3IC9A 2GMJA 4EQWA 5KVIA 2XVJA 4H2RA 4XXGA 1ZMDA 4Z25A 2X3NA 3AYIA 3NK2X 3QSMA 4WX1A 3IF9A 2ARDA 2B76A 3DMEA 1CL0A 3AE1A 1IUTA 1H83A 2C73A 3ALMA 2C75A 3LJPA 2GH5A 2XFOA 5DBJA 3QFBA 1PS9A 1Y56A 2Z5XA 4UDPA 4CY8A 1D4DA 4H4WA 4H7UA 4J33A 4OPDA 2BCGG 1K0JA 5CQFA 2GR2A 1IUWA 4NEWA 4KX6A 1NG4A 1PDHA 4BJZA 3NH3X 1H86A 2GF3A 1GRFA 2VQBA 1GREA 3AE4A 4C5OA 5C3JA 2JK6A 3C4NA 2ZBWA 3GRSA 2RGHA 3AE5A 3GRTA 4H4SA 3K7MX 1PBDA 2Q6UA 3CGBA 3NK0X 2R0CA 5HYMA 5FS9A 2XFQA 4RSLA 4H4VA 5IQ4A 1H81A 4DNAA 1MXTA 4OPUA 4YXDA 3AD8B 1NAAA 1XANA 2YWLA 1XPQA 3UOXA 3ZYXA 2YR6A 5KXJA 4U8OA 4YTPA 2GRTA 1NHRA 4D04A 3BI5A 3CIRA 2Q0LA 1BWCA 4TM0A 4UDRA 4CNJA 1FECA 1OJDA 3P4RA 4H4ZA 3RP7A 1E1MA 3Q9TA 2Q0KA 3S61A 2QA1A 1Z6LA 2H88A 2X50A 4U8MA 4Y4NA 3RHAA 1L9EA 4DSGA 1GALA 1JOAA 1GRHA 4H2PA 2WBAA 2AAQA 4TM1A 4APNA 3CTYA 2JBVA 1O95A 1XHCA 4H2QA 2XLSA 2XFNA 1YY5A 1V59A 3NG7X 1UKVG 2WP5A 4USQA 3NIXA 4JY3A 2GV8A 3UOVA 3PS9A 2YM1A 1K4QA 2GAGB 2PHHA 1LQUA 1Y0PA 3AE2A 1OJ9A 3H4KA 4H4PA 2WP9A 5TR3A 5FS7A 4K8DA 5HHFA 1GETA 4H4QA 2XLTA 3GMCA 2BS3A 3CGEA 1CC6A 2Z5YA 1GRTA 2GR3A 3DGZA 2C64A 3GWFA 2C70A 4TM4A 3OZ2A 3ATQA 3UTGA 5HY5A 1Q1RA 2OLNA 1QLBA 1DODA 1VG9A 1L9DA 3D8XA 2GVCA 1GTEA 3M12A 2XVEA 1PBBA 2X99A 4YTMA 2A8XA 1NEKA 2HQMA 2C72A 2B9WA 3AEFA 4RG3A 2QAEA 2C3CA 3C96A 1EL7A 5U25A 4NZHA 1TDEA 1ZK7A 4ZCDA 1CF3A 2B9YA 1FOHA 1NHSA 4Z44A 3H8LA 3ALLA 4TM3A 2UZZA 4BK2A 2E4GA 1JEHA 2XLUA 3DJEA 2GR0A 3GDNA 3F8DA 2ACZA 3T37A 1TYTA 2V6OA 2VVLG 4OCGA 2IIDA 2VZ2A 3BI2A 4Y4LA 2JAEA 4A7AA 2BS2A 3GWDA 3GSIA 2WDRA 2V3BA 4K2XA 1TDKA 1H7XA 4CRTA 3BNMA 4KPRA 1LQTA 2Y6RA 2YVJA 2A87A 3FIMB 3GYIA 3GDPA 4ICYA 2E5VA 2GMHA 2CVJA 1BZLA 2XFUA 3AWIA 3UTEA 2WU2A 3BI4A 1B4VA 3AE9A 2YG7A 3VR9A 1TDFA 4FDCB 2C65A 1ZX9A 1QJDA 1OJCA 1YQ3A 2BXRA 1S3BA 1LJ1A 2B9XA 4A65A 3G5SA 1M64A 4B64A 3K7TA 5LV9A 4C3YA 1CBOA 1FEBA 4D03A 4GDEA 2IVEA 1HYUA 3ALJA 2WETA 1JNRA 4NTEA 1FL2A 1KFYA 2B7SA 2NVKX 5J60A 3L8KA 4LIIA 2CFYA 3DJDA 3FBSA 3CNJA 4AT0A 1S2QA 4LA1A 1X31B 3LOVA 1E39A 4HA6A 1L9CA 4NTCA 3CNTA 5BRTA 2DKIA 2OALA 1KSSA 3UKFA 1TRBA 2WDVA 3NHOX 5BULA 4DGKA 2ZZCA 2ZZ0A 1JU2A 1BKWA 4X4JA 1KSUA 1ZKQA 2WQYA 5FS6A 1F3PA 1O5WA 3DK8A 3F8RA 2FBWA 3AYJA 3NNEA 4P9SA 5EOWA 3EPTA 2BK3A 2YG4A 1P2HA 4CCRA 4B1BA 4GF7A 2XVIA 1D4EA 1E1NA 4XWZA 1DJNA 2BABA 2WOVA 2VOUA 1M6IA 3QSSA 2YLSA 3IWAA
chains in the Genus database with same CATH superfamily
4B63A 3P4PA 1CJCA 1GNDA 3M13A 4YSXA 4UDQA 2R4EA 4ZCCA 3SFEA 3LB8A 2YQUA 4H4RA 2XVHA 4GUVA 2YLZA 2X8HA 4PAAA 2GR1A 1PJ6A 3BHFA 2TPRA 4YTNA 1KDGA 3DK9A 4EQXA 4IV9A 1FCDA 5M0ZA 2YAUA 5KVHA 4NWZA 3UOZA 4C3XA 3FG2P 1PJ5A 2R9ZA 1YQ4A 4YSYA 1GRAA 4JDRA 4U2SA 3NT6A 5GRTA 2ZZBA 3DGHA 4I58A 2OAMA 4RG4A 4TLXA 3CPHG 2R45A 3D1CA 1TYPA 3SZWA 4J36A 2EQ8A 1GSNA 2Y6QA 3RP6A 4AP3A 5BUKA 1EL8A 4IA5A 1KNRA 2DKHA 1LTXR 3GD4A 4EIPA 4EMWA 1PBFA 3KPFA 4J31A 4O5UA 3AD9B 1JNZA 4GAVA 3S5WA 3CN8A 1NDAA 3P1WA 3L1RA 1LPFA 1D4CA 1VDCA 3UKLA 4Z24A 5EB5A 1B8SA 3REDA 3QVPA 2YM2A 3G5RA 3KPKA 3SY4A 1H7WA 3BNUA 1EBDA 1F6MA 1GPEA 3F8PA 3ZDNA 4H4XA 2YLWA 4B65A 2JB3A 4Z26A 1OJTA 3NGCX 2BC1A 2GQWA 4G9KA 3UKPA 2C3DA 4B69A 1E1KA 4YSZA 3AEGA 2AR8A 3DJJA 4LU6A 3AE3A 2R46A 2V61A 3UTFA 4J34A 1GEUA 4IVMB 1GXFA 4A9WA 3AEDA 1KF6A 2F5ZA 1RP0A 2H89A 3RNMA 5GSNA 4A6NB 3QJ4A 3LADA 5BVAA 4CNKA 4U8LA 4NNJA 1CJ4A 4YSHA 1MO9A 4Z2TA 1PBEA 4J57A 1LV0A 4EQSA 1YKJA 1PJ7A 2JB2A 3UKAA 3CPIG 2BS4A 5FS8A 2APGA 2V60A 3OC4A 4MJWA 4ZN0A 1DNCA 5CKUA 1FEAA 3P9UA 4H4TA 3T31A 4K5SA 1N4WA 2XYOA 3FMWA 4H4YA 1DJQA 3NN6X 4YKFA 2EQ6A 4OVIA 2C66A 4GRTA 5JCKA 4H2NA 1CC4A 1O94A 3V3OA 1S3EA 1IUSA 3VRBA 2YLRA 2WHDA 2WPCA 4B66A 2V3AA 2XDOA 4DSHA 3I3LA 5KWFA 2BRYA 3JSKA 4U8PA 2WPFA 5KOXA 1BGNA 1NG3A 4J2WA 3FPZA 4OPIA 3V3NA 2YVGA 1H84A 5JCLA 3DJGX 3SM8A 3ABVA 4CBQA 5L46A 3II4A 4U2LA 2GB0A 2A89A 1KNPA 3AE8A 1F8WA 4FK1A 3M0OA 3QSEA 1K0LA 3CNPA 2BK5A 2WS3A 5IQ1A 4I59A 2XVFA 4Z43A 3DH9A 1ZY8A 1LVLA 3C4AA 3URHA 3NYCA 2B7RA 3SZFA 2BACA 2XFPA 3AB1A 2NPXA 4K5RA 3VQRA 2W0HA 4FK1C 1NPXA 2C76A 3T2YA 3UKHA 4EM4A 4U8JA 1PN0A 2BK4A 3H8IA 3I6DA 4EM3A 3UOYA 1E1LA 3SYIA 4CCQA 4U8IA 3SGLA 5ER0A 3NTDA 2YVFA 1COYA 3CPJG 3LZWA 3ADAB 4OPGA 4REKA 3ICTA 1GT8A 3CMMA 1DOBA 2PYXA 5JCIA 3EANA 3RP8A 2FJEA 3KD9A 2BXSA 2R0PA 1IJHA 1EL5A 1Y56B 3SQPA 3Q6JA 3BHKA 3UKQA 1PBCA 2TMDA 2GQFA 2WU5A 4GDPA 5KMSA 1EL9A 2EQ7A 4M52A 4X9MA 3QFAA 4JNAA 4K22A 2WP6A 4BK1A 4EIQA 4EMIA 2V5ZA 1GESA 4C74A 5IPYA 5JCNA 4UP3A 3T14A 1MOKA 2BC0A 4AP1A 1GOSA 2X8CA 3EAOA 2RGOA 1IUXA 3GYJA 1CJ3A 3AEAA 1PHHA 1E6EA 2Q7VA 2RGJA 2YR5A 4A79A 4YWOA 2VVMA 1GRGA 4Y4MA 1N4VA 4C77A 3V76A 4OPTA 2YG6A 1D7YA 1H6VA 3UP4A 3DK4A 4A99A 3DA1A 2WOWA 3NYEA 2IVDA 1ZOVA 2C67A 2YG3A 3AD7B 3KVEA 4U8NA 3IHGA 1DOCA 1NHQA 3UKKA 4EMJA 1P2EA 4EQRA 2VVLA 3LXDA 1B37A 1H82A 5J7XA 5EB4A 4BJYA 2R0GA 1ZMCA 2VRMA 3SFDA 3AE7A 3E1TA 3NLCA 3P4QA 1Q9IA 2R4JA 4WCTA 3UP5A 3K7QX 1NENA 1ZP0A 4Z2RA 2RABA 3UTHA 4U8KA 4FX9A 1JRXA 2XLRA 3O0HA 1SEZA 5C2TA 5KOWA 2I0ZA 3AYLA 4IA6A 3HYVA 2YLXA 3AXBA 5KRQA 1GRBA 1XDIA 4NTDA 4BV6A 1REOA 1RYIA 4TLZA 2BCPA 3K30A 4Z2UA 1PXAA 1VRQB 2BA9A 4A5LA 3SZ0A 3GMBA 2WESA 3COXA 4H4UA 1CHUA 3AEEA 2WOIA 2XCGA 1OJAA 1S2YA 2AQJA 2OA1A 3NK1X 4O5QA 4GR1A 4PABA 4YT0A 2FJAA 2VRLA 1JRYA 5U1OA 4HB9A 1Q1WA 3UCLA 3CNDA 1IUVA 1ZOYA 3ICRA 2WEUA 4JQ9A 1CC2A 4U2TA 1N1PA 3KKJA 2WPEA 4E0VA 4ECHA 4OPLA 4G74A 3WE0A 2E1MA 3GD3A 3NKSA 1GERA 2C4CA 1IUUA 2VQ7A 2OLOA 3B3RA 2XLPA 1ZDLA 4BK3A 1VG0A 2O9ZA 5HXIA 2YLTA 1K0IA 4N9XA 3B6DA 4AOSA 3ITJA 2QA2A 2FJDA 3AE6A 3CGDA 4XWRA 5M10A 2X8GA 1BF3A 4JN9A 1AOGA 1YQZA 4H50A 3VRAA 4GCMA 4AOXA 4X9NA 2EQ9A 3ICSA 1F8SA 1NHPA 3IHMA 3AECA 3EF6A 4IVOB 1TDNA 3SX6A 5EBKA 3NTAA 3LZXA 4B67A 3PVCA 1L0VA 4NEVA 3ISHA 1N4UA 4B68A 5U63A 3HZLA 5JCMA 1QO8A 1RSGA 3VRDB 2WDQA 1JRZA 3PO7A 2YR4A 3CGCA 2J3NA 1TDOA 4USRA 1PXBA 1W4XA 4ADWA 2GEWA 2CDUA 1E7PA 2QCUA 3KA7A 1DOEA 3KU9A 4JNQA 2JKCA 2YG5A 2FJBA 2GAHB 3NN0X 4K7ZA 3KLJA 3QVRA 1B5QA 2CULA 1F8RA 4II3A 1GTHA 2C7GA 5FMHA 4CY6A 4YKGA 1D5TA 3AEBA 4OPCA 1D7LA 2BRAA 1CJ2A 1ELIA 4J56A 4BURA 1ONFA 3P4SA 2JB1A 3R9UA 4JY2A 3NRNA 4A6NA 1BGJA 1PXCA 3CNSA 3NYFA 3G5QA 1DXLA 3VR8A 1VQWA 2BYBA 1GV4A 4AT2A 3ATRA 3IC9A 2GMJA 4EQWA 5KVIA 2XVJA 4H2RA 4XXGA 1ZMDA 4Z25A 2X3NA 3AYIA 3NK2X 3QSMA 4WX1A 3IF9A 2ARDA 2B76A 3DMEA 1CL0A 3AE1A 1IUTA 3SXIA 1H83A 2C73A 3ALMA 2C75A 3LJPA 2GH5A 2XFOA 5DBJA 3QFBA 1PS9A 1Y56A 2Z5XA 4UDPA 4CY8A 1D4DA 4H4WA 4H7UA 4J33A 4OPDA 2BCGG 1K0JA 5CQFA 2GR2A 1IUWA 4NEWA 4KX6A 1NG4A 1PDHA 4BJZA 3NH3X 1H86A 2GF3A 1GRFA 3HYWA 2VQBA 4G73A 1GREA 3AE4A 4C5OA 5C3JA 2JK6A 3C4NA 2ZBWA 3GRSA 2RGHA 3AE5A 3GRTA 4H4SA 3K7MX 1PBDA 2Q6UA 3CGBA 3NK0X 2R0CA 5HYMA 5FS9A 2XFQA 4RSLA 4H4VA 5KNLA 5IQ4A 1H81A 4DNAA 1MXTA 4OPUA 4YXDA 3AD8B 1NAAA 1XANA 2YWLA 1XPQA 3UOXA 3ZYXA 2YR6A 5KXJA 4U8OA 4YTPA 2GRTA 1NHRA 4D04A 3BI5A 3CIRA 2Q0LA 1BWCA 4TM0A 4UDRA 4CNJA 1FECA 1OJDA 3P4RA 4H4ZA 3RP7A 1E1MA 3Q9TA 2Q0KA 3S61A 2QA1A 1Z6LA 2H88A 3T2ZA 2X50A 4U8MA 4Y4NA 3RHAA 1L9EA 4DSGA 1GALA 1JOAA 1GRHA 4H2PA 2WBAA 2AAQA 4TM1A 4APNA 3CTYA 2JBVA 1O95A 1XHCA 4H2QA 2XLSA 2XFNA 1YY5A 1V59A 3NG7X 1UKVG 2WP5A 4USQA 3NIXA 4JY3A 2GV8A 3UOVA 3PS9A 2YM1A 1K4QA 2GAGB 2PHHA 1LQUA 1Y0PA 3AE2A 1OJ9A 3H4KA 4H4PA 2WP9A 5TR3A 5FS7A 4K8DA 5HHFA 1GETA 4H4QA 2XLTA 3GMCA 2BS3A 3CGEA 1CC6A 2Z5YA 1GRTA 2GR3A 3DGZA 2C64A 3GWFA 2C70A 4TM4A 3OZ2A 3ATQA 3UTGA 5HY5A 1Q1RA 2OLNA 1QLBA 1DODA 1VG9A 1L9DA 3D8XA 2GVCA 1GTEA 3M12A 2XVEA 1PBBA 2X99A 4YTMA 2A8XA 1NEKA 2HQMA 2C72A 2B9WA 3AEFA 3HYXA 4RG3A 5KMQA 2QAEA 2C3CA 3C96A 1EL7A 5U25A 4NZHA 1TDEA 1ZK7A 4ZCDA 3T0KA 1CF3A 2B9YA 1FOHA 1NHSA 4Z44A 3H8LA 3ALLA 4TM3A 2UZZA 4BK2A 3GYXA 2E4GA 1JEHA 2XLUA 3DJEA 2GR0A 3GDNA 3F8DA 2ACZA 3T37A 1TYTA 4II2A 2V6OA 2VVLG 4OCGA 2IIDA 2VZ2A 3BI2A 4Y4LA 2JAEA 4A7AA 2BS2A 3GWDA 3GSIA 2WDRA 4G6GA 2V3BA 4K2XA 1TDKA 1H7XA 4CRTA 3BNMA 4KPRA 1LQTA 2Y6RA 2YVJA 2A87A 3FIMB 3GYIA 3GDPA 4ICYA 2E5VA 2GMHA 2CVJA 1BZLA 2XFUA 3AWIA 3UTEA 2WU2A 3BI4A 1B4VA 3AE9A 2YG7A 3VR9A 1TDFA 4FDCB 2C65A 1ZX9A 4G6HA 1QJDA 1OJCA 1YQ3A 2BXRA 1S3BA 1LJ1A 2B9XA 4A65A 3G5SA 1M64A 4B64A 3K7TA 5LV9A 4C3YA 1CBOA 1FEBA 4D03A 5KMRA 4GDEA 2IVEA 1HYUA 3ALJA 2WETA 1JNRA 4GAPA 4NTEA 1FL2A 1KFYA 2B7SA 2NVKX 5J60A 3L8KA 4LIIA 2CFYA 3DJDA 3FBSA 3CNJA 4AT0A 3SZCA 3T2KA 1S2QA 4LA1A 1X31B 3LOVA 1E39A 5KMPA 4HA6A 1L9CA 4NTCA 3CNTA 5BRTA 2DKIA 2OALA 1KSSA 3UKFA 1TRBA 2WDVA 3NHOX 5BULA 4DGKA 2ZZCA 2ZZ0A 1JU2A 1BKWA 4X4JA 1KSUA 1ZKQA 2WQYA 5FS6A 1F3PA 1O5WA 3DK8A 3F8RA 2FBWA 3AYJA 3NNEA 4P9SA 5EOWA 3EPTA 2BK3A 2YG4A 1P2HA 4CCRA 4B1BA 4GF7A 2XVIA 1D4EA 1E1NA 4XWZA 1DJNA 2BABA 2WOVA 2VOUA 1M6IA 3QSSA 2YLSA 3IWAA
chains in the Genus database with same CATH topology
4B63A 3P4PA 1CJCA 1GNDA 3M13A 4YSXA 4UDQA 2R4EA 4ZCCA 3SFEA 3LB8A 2YQUA 4H4RA 2XVHA 4GUVA 2YLZA 2X8HA 4PAAA 2GR1A 1PJ6A 3BHFA 2TPRA 4YTNA 1KDGA 3DK9A 4EQXA 4IV9A 1FCDA 5M0ZA 2YAUA 5KVHA 4NWZA 3UOZA 4C3XA 3FG2P 1PJ5A 2R9ZA 1YQ4A 4YSYA 1GRAA 4JDRA 4U2SA 3NT6A 5GRTA 2ZZBA 3DGHA 4I58A 2OAMA 4RG4A 4TLXA 3CPHG 2R45A 3D1CA 1TYPA 3SZWA 4J36A 2EQ8A 1GSNA 2Y6QA 3RP6A 4AP3A 5BUKA 1EL8A 4IA5A 1KNRA 2DKHA 1LTXR 3GD4A 4EIPA 4EMWA 1PBFA 3KPFA 4J31A 4O5UA 3AD9B 1JNZA 4GAVA 3S5WA 3CN8A 1NDAA 3P1WA 3L1RA 1LPFA 1D4CA 1VDCA 3UKLA 4Z24A 5EB5A 1B8SA 3REDA 3QVPA 2YM2A 3G5RA 3KPKA 3SY4A 1H7WA 3BNUA 1EBDA 1F6MA 1GPEA 3F8PA 3ZDNA 4H4XA 2YLWA 4B65A 2JB3A 4Z26A 1OJTA 3NGCX 2BC1A 2GQWA 4G9KA 3UKPA 2C3DA 4B69A 1E1KA 4YSZA 3AEGA 2AR8A 3DJJA 4LU6A 3AE3A 2R46A 2V61A 3UTFA 4J34A 1GEUA 4IVMB 1GXFA 4A9WA 3AEDA 1KF6A 2F5ZA 1RP0A 2H89A 3RNMA 5GSNA 4A6NB 3QJ4A 3LADA 5BVAA 4CNKA 4U8LA 4NNJA 1CJ4A 4YSHA 1MO9A 4Z2TA 1PBEA 4J57A 1LV0A 4EQSA 1YKJA 1PJ7A 2JB2A 3UKAA 3CPIG 2BS4A 5FS8A 2APGA 2V60A 3OC4A 4MJWA 4ZN0A 1DNCA 5CKUA 1FEAA 3P9UA 4H4TA 3T31A 4K5SA 1N4WA 2XYOA 3FMWA 4H4YA 1DJQA 3NN6X 4YKFA 2EQ6A 4OVIA 2C66A 4GRTA 5JCKA 4H2NA 1CC4A 1O94A 3V3OA 1S3EA 1IUSA 3VRBA 2YLRA 2WHDA 2WPCA 4B66A 2V3AA 2XDOA 4DSHA 3I3LA 5KWFA 2BRYA 3JSKA 4U8PA 2WPFA 5KOXA 1BGNA 1NG3A 4J2WA 3FPZA 4OPIA 3V3NA 2YVGA 1H84A 5JCLA 3DJGX 3SM8A 3ABVA 4CBQA 5L46A 3II4A 4U2LA 2GB0A 2A89A 1KNPA 3AE8A 1F8WA 4FK1A 3M0OA 3QSEA 1K0LA 3CNPA 2BK5A 2WS3A 5IQ1A 4I59A 2XVFA 4Z43A 3DH9A 1ZY8A 1LVLA 3C4AA 3URHA 3NYCA 2B7RA 3SZFA 2BACA 2XFPA 3AB1A 2NPXA 4K5RA 3VQRA 2W0HA 4FK1C 1NPXA 2C76A 3T2YA 3UKHA 4EM4A 4U8JA 1PN0A 2BK4A 3H8IA 3I6DA 4EM3A 3UOYA 1E1LA 3SYIA 4CCQA 4U8IA 3SGLA 5ER0A 3NTDA 2YVFA 1COYA 3CPJG 3LZWA 3ADAB 4OPGA 4REKA 3ICTA 1GT8A 3CMMA 1DOBA 2PYXA 5JCIA 3EANA 3RP8A 2FJEA 3KD9A 2BXSA 2R0PA 1IJHA 1EL5A 1Y56B 3SQPA 3Q6JA 3BHKA 3UKQA 1PBCA 2TMDA 2GQFA 2WU5A 4GDPA 5KMSA 1EL9A 2EQ7A 4M52A 4X9MA 3QFAA 4JNAA 4K22A 2WP6A 4BK1A 4EIQA 4EMIA 2V5ZA 1GESA 4C74A 5IPYA 5JCNA 4UP3A 3T14A 1MOKA 2BC0A 4AP1A 1GOSA 2X8CA 3EAOA 2RGOA 1IUXA 3GYJA 1CJ3A 3AEAA 1PHHA 1E6EA 2Q7VA 2RGJA 2YR5A 4A79A 4YWOA 2VVMA 1GRGA 4Y4MA 1N4VA 4C77A 3V76A 4OPTA 2YG6A 1D7YA 1H6VA 3UP4A 3DK4A 4A99A 3DA1A 2WOWA 3NYEA 2IVDA 1ZOVA 2C67A 2YG3A 3AD7B 3KVEA 4U8NA 3IHGA 1DOCA 1NHQA 3UKKA 4EMJA 1P2EA 4EQRA 2VVLA 3LXDA 1B37A 1H82A 5J7XA 5EB4A 4BJYA 2R0GA 1ZMCA 2VRMA 3SFDA 3AE7A 3E1TA 3NLCA 3P4QA 1Q9IA 2R4JA 4WCTA 3UP5A 3K7QX 1NENA 1ZP0A 4Z2RA 2RABA 3UTHA 4U8KA 4FX9A 1JRXA 2XLRA 3O0HA 1SEZA 5C2TA 5KOWA 2I0ZA 3AYLA 4IA6A 3HYVA 2YLXA 3AXBA 5KRQA 1GRBA 1XDIA 4NTDA 4BV6A 1REOA 1RYIA 4TLZA 2BCPA 3K30A 4Z2UA 1PXAA 1VRQB 2BA9A 4A5LA 3SZ0A 3GMBA 2WESA 3COXA 4H4UA 1CHUA 3AEEA 2WOIA 2XCGA 1OJAA 1S2YA 2AQJA 2OA1A 3NK1X 4O5QA 4GR1A 4PABA 4YT0A 2FJAA 2VRLA 1JRYA 5U1OA 4HB9A 1Q1WA 3UCLA 3CNDA 1IUVA 1ZOYA 3ICRA 2WEUA 4JQ9A 1CC2A 4U2TA 1N1PA 3KKJA 2WPEA 4E0VA 4ECHA 4OPLA 4G74A 3WE0A 2E1MA 3GD3A 3NKSA 1GERA 2C4CA 1IUUA 2VQ7A 2OLOA 3B3RA 2XLPA 1ZDLA 4BK3A 1VG0A 2O9ZA 5HXIA 2YLTA 1K0IA 4N9XA 3B6DA 4AOSA 3ITJA 2QA2A 2FJDA 3AE6A 3CGDA 4XWRA 5M10A 2X8GA 1BF3A 4JN9A 1AOGA 1YQZA 4H50A 3VRAA 4GCMA 4AOXA 4X9NA 2EQ9A 3ICSA 1F8SA 1NHPA 3IHMA 3AECA 3EF6A 4IVOB 1TDNA 3SX6A 5EBKA 3NTAA 3LZXA 4B67A 3PVCA 1L0VA 4NEVA 3ISHA 1N4UA 4B68A 5U63A 3HZLA 5JCMA 1QO8A 1RSGA 3VRDB 2WDQA 1JRZA 3PO7A 2YR4A 3CGCA 2J3NA 1TDOA 4USRA 1PXBA 1W4XA 4ADWA 2GEWA 2CDUA 1E7PA 2QCUA 3KA7A 1DOEA 3KU9A 4JNQA 2JKCA 2YG5A 2FJBA 2GAHB 3NN0X 4K7ZA 3KLJA 3QVRA 1B5QA 2CULA 1F8RA 4II3A 1GTHA 2C7GA 5FMHA 4CY6A 4YKGA 1D5TA 3AEBA 4OPCA 1D7LA 2BRAA 1CJ2A 1ELIA 4J56A 4BURA 1ONFA 3P4SA 2JB1A 3R9UA 4JY2A 3NRNA 4A6NA 1BGJA 1PXCA 3CNSA 3NYFA 3G5QA 1DXLA 3VR8A 1VQWA 2BYBA 1GV4A 4AT2A 3ATRA 3IC9A 2GMJA 4EQWA 5KVIA 2XVJA 4H2RA 4XXGA 1ZMDA 4Z25A 2X3NA 3AYIA 3NK2X 3QSMA 4WX1A 3IF9A 2ARDA 2B76A 3DMEA 1CL0A 3AE1A 1IUTA 3SXIA 1H83A 2C73A 3ALMA 2C75A 3LJPA 2GH5A 2XFOA 5DBJA 3QFBA 1PS9A 1Y56A 2Z5XA 4UDPA 4CY8A 1D4DA 4H4WA 4H7UA 4J33A 4OPDA 2BCGG 1K0JA 5CQFA 2GR2A 1IUWA 4NEWA 4KX6A 1NG4A 1PDHA 4BJZA 3NH3X 1H86A 2GF3A 1GRFA 3HYWA 2VQBA 4G73A 1GREA 3AE4A 4C5OA 5C3JA 2JK6A 3C4NA 2ZBWA 3GRSA 2RGHA 3AE5A 3GRTA 4H4SA 3K7MX 1PBDA 2Q6UA 3CGBA 3NK0X 2R0CA 5HYMA 5FS9A 2XFQA 4RSLA 4H4VA 5KNLA 5IQ4A 1H81A 4DNAA 1MXTA 4OPUA 4YXDA 3AD8B 1NAAA 1XANA 2YWLA 1XPQA 3UOXA 3ZYXA 2YR6A 5KXJA 4U8OA 4YTPA 2GRTA 1NHRA 4D04A 3BI5A 3CIRA 2Q0LA 1BWCA 4TM0A 4UDRA 4CNJA 1FECA 1OJDA 3P4RA 4H4ZA 3RP7A 1E1MA 3Q9TA 2Q0KA 3S61A 2QA1A 1Z6LA 2H88A 3T2ZA 2X50A 4U8MA 4Y4NA 3RHAA 1L9EA 4DSGA 1GALA 1JOAA 1GRHA 4H2PA 2WBAA 2AAQA 4TM1A 4APNA 3CTYA 2JBVA 1O95A 1XHCA 4H2QA 2XLSA 2XFNA 1YY5A 1V59A 3NG7X 1UKVG 2WP5A 4USQA 3NIXA 4JY3A 2GV8A 3UOVA 3PS9A 2YM1A 1K4QA 2GAGB 2PHHA 1LQUA 1Y0PA 3AE2A 1OJ9A 3H4KA 4H4PA 2WP9A 5TR3A 5FS7A 4K8DA 5HHFA 1GETA 4H4QA 2XLTA 3GMCA 2BS3A 3CGEA 1CC6A 2Z5YA 1GRTA 2GR3A 3DGZA 2C64A 3GWFA 2C70A 4TM4A 3OZ2A 3ATQA 3UTGA 5HY5A 1Q1RA 2OLNA 1QLBA 1DODA 1VG9A 1L9DA 3D8XA 2GVCA 1GTEA 3M12A 2XVEA 1PBBA 2X99A 4YTMA 2A8XA 1NEKA 2HQMA 2C72A 2B9WA 3AEFA 3HYXA 4RG3A 5KMQA 2QAEA 2C3CA 3C96A 1EL7A 5U25A 4NZHA 1TDEA 1ZK7A 4ZCDA 3T0KA 1CF3A 2B9YA 1FOHA 1NHSA 4Z44A 3H8LA 3ALLA 4TM3A 2UZZA 4BK2A 3GYXA 2E4GA 1JEHA 2XLUA 3DJEA 2GR0A 3GDNA 3F8DA 2ACZA 3T37A 1TYTA 4II2A 2V6OA 2VVLG 4OCGA 2IIDA 2VZ2A 3BI2A 4Y4LA 2JAEA 4A7AA 2BS2A 3GWDA 3GSIA 2WDRA 4G6GA 2V3BA 4K2XA 1TDKA 1H7XA 4CRTA 3BNMA 4KPRA 1LQTA 2Y6RA 2YVJA 2A87A 3FIMB 3GYIA 3GDPA 4ICYA 2E5VA 2GMHA 2CVJA 1BZLA 2XFUA 3AWIA 3UTEA 2WU2A 3BI4A 1B4VA 3AE9A 2YG7A 3VR9A 1TDFA 4FDCB 2C65A 1ZX9A 4G6HA 1QJDA 1OJCA 1YQ3A 2BXRA 1S3BA 1LJ1A 2B9XA 4A65A 3G5SA 1M64A 4B64A 3K7TA 5LV9A 4C3YA 1CBOA 1FEBA 4D03A 5KMRA 4GDEA 2IVEA 1HYUA 3ALJA 2WETA 1JNRA 4GAPA 4NTEA 1FL2A 1KFYA 2B7SA 2NVKX 5J60A 3L8KA 4LIIA 2CFYA 3DJDA 3FBSA 3CNJA 4AT0A 3SZCA 3T2KA 1S2QA 4LA1A 1X31B 3LOVA 1E39A 5KMPA 4HA6A 1L9CA 4NTCA 3CNTA 5BRTA 2DKIA 2OALA 1KSSA 3UKFA 1TRBA 2WDVA 3NHOX 5BULA 4DGKA 2ZZCA 2ZZ0A 1JU2A 1BKWA 4X4JA 1KSUA 1ZKQA 2WQYA 5FS6A 1F3PA 1O5WA 3DK8A 3F8RA 2FBWA 3AYJA 3NNEA 4P9SA 5EOWA 3EPTA 2BK3A 2YG4A 1P2HA 4CCRA 4B1BA 4GF7A 2XVIA 1D4EA 1E1NA 4XWZA 1DJNA 2BABA 2WOVA 2VOUA 1M6IA 3QSSA 2YLSA 3IWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B63 A;  3P4P A;  1CJC A;  1GND A;  3M13 A;  4YSX A;  4UDQ A;  2R4E A;  4ZCC A;  3SFE A;  3LB8 A;  2YQU A;  4H4R A;  2XVH A;  4GUV A;  2YLZ A;  2X8H A;  4PAA A;  2GR1 A;  1PJ6 A;  3BHF A;  2TPR A;  4YTN A;  1KDG A;  3DK9 A;  4EQX A;  4IV9 A;  1FCD A;  5M0Z A;  2YAU A;  5KVH A;  3UOZ A;  4C3X A;  3FG2 P;  1PJ5 A;  2R9Z A;  1YQ4 A;  4YSY A;  1GRA A;  4JDR A;  4U2S A;  3NT6 A;  5GRT A;  2ZZB A;  3DGH A;  4I58 A;  2OAM A;  4RG4 A;  4TLX A;  3CPH G;  2R45 A;  3D1C A;  1TYP A;  4J36 A;  2EQ8 A;  1GSN A;  2Y6Q A;  3RP6 A;  4AP3 A;  5BUK A;  1EL8 A;  4IA5 A;  1KNR A;  2DKH A;  1LTX R;  3GD4 A;  4EIP A;  4EMW A;  1PBF A;  3KPF A;  4J31 A;  4O5U A;  3AD9 B;  1JNZ A;  3S5W A;  4Z2T A;  3CN8 A;  1NDA A;  3P1W A;  3L1R A;  1LPF A;  1D4C A;  1VDC A;  3UKL A;  4Z24 A;  5EB5 A;  1B8S A;  3RED A;  3QVP A;  2YM2 A;  3G5R A;  1H7W A;  3BNU A;  1EBD A;  1F6M A;  1GPE A;  3F8P A;  3ZDN A;  4H4X A;  2YLW A;  4B65 A;  2JB3 A;  4Z26 A;  1OJT A;  3NGC X;  2BC1 A;  2GQW A;  3UKP A;  2C3D A;  4B69 A;  1E1K A;  4YSZ A;  3AEG A;  2AR8 A;  3DJJ A;  4LU6 A;  3AE3 A;  2R46 A;  2V61 A;  3UTF A;  4J34 A;  1GEU A;  4IVM B;  1GXF A;  4A9W A;  3AED A;  1KF6 A;  2F5Z A;  1RP0 A;  2H89 A;  3RNM A;  5GSN A;  4A6N B;  3QJ4 A;  3LAD A;  5BVA A;  4CNK A;  4U8L A;  1CJ4 A;  4YSH A;  1MO9 A;  1PBE A;  4J57 A;  1LV0 A;  4EQS A;  1YKJ A;  1PJ7 A;  2JB2 A;  3UKA A;  3CPI G;  2BS4 A;  5FS8 A;  2APG A;  2V60 A;  3OC4 A;  4MJW A;  4ZN0 A;  1DNC A;  5CKU A;  1FEA A;  3P9U A;  4H4T A;  4K5S A;  1N4W A;  2XYO A;  3FMW A;  4H4Y A;  1DJQ A;  3NN6 X;  4YKF A;  2EQ6 A;  4OVI A;  2C66 A;  4GRT A;  5JCK A;  4H2N A;  1CC4 A;  1O94 A;  3V3O A;  1S3E A;  1IUS A;  3VRB A;  2YLR A;  2WHD A;  2WPC A;  4B66 A;  2V3A A;  2XDO A;  4DSH A;  3I3L A;  5KWF A;  3JSK A;  4U8P A;  2WPF A;  5KOX A;  1BGN A;  1NG3 A;  4J2W A;  3FPZ A;  4OPI A;  3V3N A;  2YVG A;  1H84 A;  5JCL A;  3DJG X;  3SM8 A;  3ABV A;  4CBQ A;  5L46 A;  3II4 A;  4U2L A;  2GB0 A;  2A89 A;  1KNP A;  3AE8 A;  1F8W A;  4FK1 A;  3M0O A;  3QSE A;  1K0L A;  3CNP A;  2BK5 A;  2WS3 A;  5IQ1 A;  4I59 A;  2XVF A;  4Z43 A;  3DH9 A;  1ZY8 A;  1LVL A;  3C4A A;  3URH A;  3NYC A;  2B7R A;  2BAC A;  2XFP A;  3AB1 A;  2NPX A;  4K5R A;  3VQR A;  2W0H A;  4FK1 C;  1NPX A;  2C76 A;  3UKH A;  4EM4 A;  4U8J A;  1PN0 A;  2BK4 A;  3H8I A;  3I6D A;  4EM3 A;  3UOY A;  1E1L A;  4CCQ A;  4U8I A;  3SGL A;  5ER0 A;  3NTD A;  2YVF A;  1COY A;  3CPJ G;  3LZW A;  3ADA B;  4OPG A;  4REK A;  3ICT A;  1GT8 A;  1DOB A;  2PYX A;  5JCI A;  3EAN A;  3RP8 A;  2FJE A;  3KD9 A;  2BXS A;  2R0P A;  1IJH A;  1EL5 A;  1Y56 B;  3SQP A;  3Q6J A;  3BHK A;  3UKQ A;  1PBC A;  2TMD A;  2GQF A;  2WU5 A;  4GDP A;  1EL9 A;  2EQ7 A;  4M52 A;  4X9M A;  3QFA A;  4JNA A;  4K22 A;  2WP6 A;  4BK1 A;  4EIQ A;  4EMI A;  2V5Z A;  1GES A;  4C74 A;  5IPY A;  5JCN A;  4UP3 A;  1MOK A;  2BC0 A;  4AP1 A;  1GOS A;  2X8C A;  3EAO A;  2RGO A;  1IUX A;  3GYJ A;  1CJ3 A;  3AEA A;  1PHH A;  1E6E A;  2Q7V A;  2RGJ A;  2YR5 A;  4A79 A;  4YWO A;  2VVM A;  1GRG A;  4Y4M A;  1N4V A;  4C77 A;  3V76 A;  4OPT A;  2YG6 A;  1D7Y A;  1H6V A;  3UP4 A;  3DK4 A;  4A99 A;  3DA1 A;  2WOW A;  3NYE A;  2IVD A;  1ZOV A;  2C67 A;  2YG3 A;  3AD7 B;  3KVE A;  4U8N A;  3IHG A;  1DOC A;  1NHQ A;  3UKK A;  4EMJ A;  1P2E A;  4EQR A;  2VVL A;  3LXD A;  1B37 A;  1H82 A;  5J7X A;  5EB4 A;  4BJY A;  2R0G A;  1ZMC A;  2VRM A;  3SFD A;  3AE7 A;  3E1T A;  3NLC A;  3P4Q A;  1Q9I A;  2R4J A;  4WCT A;  3UP5 A;  3K7Q X;  1NEN A;  1ZP0 A;  4Z2R A;  2RAB A;  3UTH A;  4U8K A;  4FX9 A;  1JRX A;  2XLR A;  3O0H A;  1SEZ A;  5C2T A;  5KOW A;  2I0Z A;  3AYL A;  4IA6 A;  2YLX A;  3AXB A;  5KRQ A;  1GRB A;  1XDI A;  4NTD A;  4BV6 A;  1REO A;  1RYI A;  4TLZ A;  2BCP A;  3K30 A;  4Z2U A;  1PXA A;  1VRQ B;  2BA9 A;  4A5L A;  3GMB A;  2WES A;  3COX A;  4H4U A;  1CHU A;  3AEE A;  2WOI A;  2XCG A;  1OJA A;  1S2Y A;  2AQJ A;  2OA1 A;  3NK1 X;  4O5Q A;  4GR1 A;  4PAB A;  4YT0 A;  2FJA A;  2VRL A;  1JRY A;  5U1O A;  4HB9 A;  1Q1W A;  3UCL A;  3CND A;  1IUV A;  1ZOY A;  3ICR A;  2WEU A;  4JQ9 A;  1CC2 A;  4U2T A;  1N1P A;  3KKJ A;  2WPE A;  4E0V A;  4ECH A;  4OPL A;  3WE0 A;  2E1M A;  3GD3 A;  3NKS A;  1GER A;  1IUU A;  2VQ7 A;  2OLO A;  3B3R A;  2XLP A;  1ZDL A;  4BK3 A;  1VG0 A;  2O9Z A;  5HXI A;  2YLT A;  1K0I A;  4N9X A;  3B6D A;  4AOS A;  3ITJ A;  2QA2 A;  2FJD A;  3AE6 A;  3CGD A;  4XWR A;  5M10 A;  2X8G A;  1BF3 A;  4JN9 A;  1AOG A;  1YQZ A;  4H50 A;  3VRA A;  4GCM A;  4AOX A;  4X9N A;  2EQ9 A;  3ICS A;  1F8S A;  1NHP A;  3IHM A;  3AEC A;  3EF6 A;  4IVO B;  1TDN A;  5EBK A;  3NTA A;  3LZX A;  4B67 A;  3PVC A;  1L0V A;  4NEV A;  3ISH A;  1N4U A;  4B68 A;  5U63 A;  3HZL A;  5JCM A;  1QO8 A;  1RSG A;  3VRD B;  2WDQ A;  1JRZ A;  3PO7 A;  2YR4 A;  3CGC A;  2J3N A;  1TDO A;  4USR A;  1PXB A;  1W4X A;  4ADW A;  2GEW A;  2CDU A;  1E7P A;  2QCU A;  3KA7 A;  1DOE A;  3KU9 A;  4JNQ A;  2JKC A;  2YG5 A;  2FJB A;  2GAH B;  3NN0 X;  4K7Z A;  3KLJ A;  3QVR A;  1B5Q A;  2CUL A;  1F8R A;  5FMH A;  1GTH A;  2C7G A;  4CY6 A;  4YKG A;  1D5T A;  3AEB A;  4OPC A;  1D7L A;  1CJ2 A;  1ELI A;  4J56 A;  4BUR A;  1ONF A;  3P4S A;  2JB1 A;  3R9U A;  4JY2 A;  3NRN A;  4A6N A;  1BGJ A;  1PXC A;  3CNS A;  3NYF A;  3G5Q A;  1DXL A;  3VR8 A;  1VQW A;  2BYB A;  1GV4 A;  4AT2 A;  3ATR A;  3IC9 A;  2GMJ A;  4EQW A;  5KVI A;  2XVJ A;  4H2R A;  4XXG A;  1ZMD A;  4Z25 A;  2X3N A;  3AYI A;  3NK2 X;  3QSM A;  4WX1 A;  3IF9 A;  2ARD A;  2B76 A;  3DME A;  1CL0 A;  3AE1 A;  1IUT A;  1H83 A;  2C73 A;  3ALM A;  2C75 A;  3LJP A;  2GH5 A;  2XFO A;  5DBJ A;  3QFB A;  1PS9 A;  1Y56 A;  2Z5X A;  4UDP A;  4CY8 A;  1D4D A;  4H4W A;  4H7U A;  4J33 A;  4OPD A;  2BCG G;  1K0J A;  5CQF A;  2GR2 A;  1IUW A;  4NEW A;  4KX6 A;  1NG4 A;  1PDH A;  4BJZ A;  3NH3 X;  1H86 A;  2GF3 A;  1GRF A;  2VQB A;  1GRE A;  3AE4 A;  4C5O A;  5C3J A;  2JK6 A;  3C4N A;  2ZBW A;  3GRS A;  2RGH A;  3AE5 A;  3GRT A;  4H4S A;  3K7M X;  1PBD A;  2Q6U A;  3CGB A;  3NK0 X;  2R0C A;  5HYM A;  5FS9 A;  2XFQ A;  4RSL A;  4H4V A;  5IQ4 A;  1H81 A;  4DNA A;  1MXT A;  4OPU A;  4YXD A;  3AD8 B;  1NAA A;  1XAN A;  2YWL A;  1XPQ A;  3UOX A;  3ZYX A;  2YR6 A;  5KXJ A;  4U8O A;  4YTP A;  2GRT A;  1NHR A;  4D04 A;  3BI5 A;  3CIR A;  2Q0L A;  1BWC A;  4TM0 A;  4UDR A;  4CNJ A;  1FEC A;  1OJD A;  3P4R A;  4H4Z A;  3RP7 A;  1E1M A;  3Q9T A;  2Q0K A;  3S61 A;  2QA1 A;  1Z6L A;  2H88 A;  2X50 A;  4U8M A;  4Y4N A;  3RHA A;  1L9E A;  4DSG A;  1GAL A;  1JOA A;  1GRH A;  4H2P A;  2WBA A;  2AAQ A;  4TM1 A;  4APN A;  3CTY A;  2JBV A;  1O95 A;  1XHC A;  4H2Q A;  2XLS A;  2XFN A;  1YY5 A;  1V59 A;  3NG7 X;  1UKV G;  2WP5 A;  4USQ A;  3NIX A;  4JY3 A;  2GV8 A;  3UOV A;  3PS9 A;  2YM1 A;  1K4Q A;  2GAG B;  2PHH A;  1LQU A;  1Y0P A;  3AE2 A;  1OJ9 A;  3H4K A;  4H4P A;  2WP9 A;  5TR3 A;  5FS7 A;  4K8D A;  5HHF A;  1GET A;  4H4Q A;  2XLT A;  3GMC A;  2BS3 A;  3CGE A;  1CC6 A;  2Z5Y A;  1GRT A;  2GR3 A;  3DGZ A;  2C64 A;  3GWF A;  2C70 A;  4TM4 A;  3OZ2 A;  3ATQ A;  3UTG A;  5HY5 A;  1Q1R A;  2OLN A;  1QLB A;  1DOD A;  1VG9 A;  1L9D A;  3D8X A;  2GVC A;  1GTE A;  3M12 A;  2XVE A;  1PBB A;  2X99 A;  4YTM A;  2A8X A;  1NEK A;  2HQM A;  2C72 A;  2B9W A;  3AEF A;  4RG3 A;  2QAE A;  2C3C A;  3C96 A;  1EL7 A;  5U25 A;  4NZH A;  1TDE A;  1ZK7 A;  4ZCD A;  1CF3 A;  2B9Y A;  1FOH A;  1NHS A;  4Z44 A;  3H8L A;  3ALL A;  4TM3 A;  2UZZ A;  4BK2 A;  2E4G A;  1JEH A;  2XLU A;  3DJE A;  2GR0 A;  3GDN A;  3F8D A;  2ACZ A;  3T37 A;  1TYT A;  2V6O A;  2VVL G;  4OCG A;  2IID A;  2VZ2 A;  3BI2 A;  4Y4L A;  2JAE A;  4A7A A;  2BS2 A;  3GWD A;  3GSI A;  2WDR A;  2V3B A;  4K2X A;  1TDK A;  1H7X A;  4CRT A;  3BNM A;  4KPR A;  1LQT A;  2Y6R A;  2YVJ A;  2A87 A;  3FIM B;  3GYI A;  3GDP A;  4ICY A;  2E5V A;  2GMH A;  2CVJ A;  1BZL A;  2XFU A;  3AWI A;  3UTE A;  2WU2 A;  3BI4 A;  1B4V A;  3AE9 A;  2YG7 A;  3VR9 A;  1TDF A;  4FDC B;  2C65 A;  1ZX9 A;  1QJD A;  1OJC A;  1YQ3 A;  2BXR A;  1S3B A;  1LJ1 A;  2B9X A;  4A65 A;  3G5S A;  1M64 A;  4B64 A;  3K7T A;  5LV9 A;  4C3Y A;  1CBO A;  1FEB A;  4D03 A;  4GDE A;  2IVE A;  1HYU A;  3ALJ A;  2WET A;  1JNR A;  4NTE A;  1FL2 A;  1KFY A;  2B7S A;  2NVK X;  5J60 A;  3L8K A;  4LII A;  2CFY A;  3DJD A;  3FBS A;  3CNJ A;  4AT0 A;  1S2Q A;  4LA1 A;  1X31 B;  3LOV A;  1E39 A;  4HA6 A;  1L9C A;  4NTC A;  3CNT A;  5BRT A;  2DKI A;  2OAL A;  1KSS A;  3UKF A;  1TRB A;  2WDV A;  3NHO X;  5BUL A;  4DGK A;  2ZZC A;  2ZZ0 A;  1JU2 A;  1BKW A;  4X4J A;  1KSU A;  1ZKQ A;  2WQY A;  5FS6 A;  1F3P A;  1O5W A;  3DK8 A;  3F8R A;  2FBW A;  3AYJ A;  3NNE A;  4P9S A;  5EOW A;  3EPT A;  2BK3 A;  2YG4 A;  1P2H A;  4CCR A;  4B1B A;  4GF7 A;  2XVI A;  1D4E A;  1E1N A;  4XWZ A;  1DJN A;  2BAB A;  2WOV A;  2VOU A;  1M6I A;  3QSS A;  2YLS A;  3IWA A; 
#chains in the Genus database with same CATH topology
 4B63 A;  3P4P A;  1CJC A;  1GND A;  3M13 A;  4YSX A;  4UDQ A;  2R4E A;  4ZCC A;  3SFE A;  3LB8 A;  2YQU A;  4H4R A;  2XVH A;  4GUV A;  2YLZ A;  2X8H A;  4PAA A;  2GR1 A;  1PJ6 A;  3BHF A;  2TPR A;  4YTN A;  1KDG A;  3DK9 A;  4EQX A;  4IV9 A;  1FCD A;  5M0Z A;  2YAU A;  5KVH A;  4NWZ A;  3UOZ A;  4C3X A;  3FG2 P;  1PJ5 A;  2R9Z A;  1YQ4 A;  4YSY A;  1GRA A;  4JDR A;  4U2S A;  3NT6 A;  5GRT A;  2ZZB A;  3DGH A;  4I58 A;  2OAM A;  4RG4 A;  4TLX A;  3CPH G;  2R45 A;  3D1C A;  1TYP A;  3SZW A;  4J36 A;  2EQ8 A;  1GSN A;  2Y6Q A;  3RP6 A;  4AP3 A;  5BUK A;  1EL8 A;  4IA5 A;  1KNR A;  2DKH A;  1LTX R;  3GD4 A;  4EIP A;  4EMW A;  1PBF A;  3KPF A;  4J31 A;  4O5U A;  3AD9 B;  1JNZ A;  4GAV A;  3S5W A;  3CN8 A;  1NDA A;  3P1W A;  3L1R A;  1LPF A;  1D4C A;  1VDC A;  3UKL A;  4Z24 A;  5EB5 A;  1B8S A;  3RED A;  3QVP A;  2YM2 A;  3G5R A;  3KPK A;  3SY4 A;  1H7W A;  3BNU A;  1EBD A;  1F6M A;  1GPE A;  3F8P A;  3ZDN A;  4H4X A;  2YLW A;  4B65 A;  2JB3 A;  4Z26 A;  1OJT A;  3NGC X;  2BC1 A;  2GQW A;  4G9K A;  3UKP A;  2C3D A;  4B69 A;  1E1K A;  4YSZ A;  3AEG A;  2AR8 A;  3DJJ A;  4LU6 A;  3AE3 A;  2R46 A;  2V61 A;  3UTF A;  4J34 A;  1GEU A;  4IVM B;  1GXF A;  4A9W A;  3AED A;  1KF6 A;  2F5Z A;  1RP0 A;  2H89 A;  3RNM A;  5GSN A;  4A6N B;  3QJ4 A;  3LAD A;  5BVA A;  4CNK A;  4U8L A;  4NNJ A;  1CJ4 A;  4YSH A;  1MO9 A;  4Z2T A;  1PBE A;  4J57 A;  1LV0 A;  4EQS A;  1YKJ A;  1PJ7 A;  2JB2 A;  3UKA A;  3CPI G;  2BS4 A;  5FS8 A;  2APG A;  2V60 A;  3OC4 A;  4MJW A;  4ZN0 A;  1DNC A;  5CKU A;  1FEA A;  3P9U A;  4H4T A;  3T31 A;  4K5S A;  1N4W A;  2XYO A;  3FMW A;  4H4Y A;  1DJQ A;  3NN6 X;  4YKF A;  2EQ6 A;  4OVI A;  2C66 A;  4GRT A;  5JCK A;  4H2N A;  1CC4 A;  1O94 A;  3V3O A;  1S3E A;  1IUS A;  3VRB A;  2YLR A;  2WHD A;  2WPC A;  4B66 A;  2V3A A;  2XDO A;  4DSH A;  3I3L A;  5KWF A;  2BRY A;  3JSK A;  4U8P A;  2WPF A;  5KOX A;  1BGN A;  1NG3 A;  4J2W A;  3FPZ A;  4OPI A;  3V3N A;  2YVG A;  1H84 A;  5JCL A;  3DJG X;  3SM8 A;  3ABV A;  4CBQ A;  5L46 A;  3II4 A;  4U2L A;  2GB0 A;  2A89 A;  1KNP A;  3AE8 A;  1F8W A;  4FK1 A;  3M0O A;  3QSE A;  1K0L A;  3CNP A;  2BK5 A;  2WS3 A;  5IQ1 A;  4I59 A;  2XVF A;  4Z43 A;  3DH9 A;  1ZY8 A;  1LVL A;  3C4A A;  3URH A;  3NYC A;  2B7R A;  3SZF A;  2BAC A;  2XFP A;  3AB1 A;  2NPX A;  4K5R A;  3VQR A;  2W0H A;  4FK1 C;  1NPX A;  2C76 A;  3T2Y A;  3UKH A;  4EM4 A;  4U8J A;  1PN0 A;  2BK4 A;  3H8I A;  3I6D A;  4EM3 A;  3UOY A;  1E1L A;  3SYI A;  4CCQ A;  4U8I A;  3SGL A;  5ER0 A;  3NTD A;  2YVF A;  1COY A;  3CPJ G;  3LZW A;  3ADA B;  4OPG A;  4REK A;  3ICT A;  1GT8 A;  3CMM A;  1DOB A;  2PYX A;  5JCI A;  3EAN A;  3RP8 A;  2FJE A;  3KD9 A;  2BXS A;  2R0P A;  1IJH A;  1EL5 A;  1Y56 B;  3SQP A;  3Q6J A;  3BHK A;  3UKQ A;  1PBC A;  2TMD A;  2GQF A;  2WU5 A;  4GDP A;  5KMS A;  1EL9 A;  2EQ7 A;  4M52 A;  4X9M A;  3QFA A;  4JNA A;  4K22 A;  2WP6 A;  4BK1 A;  4EIQ A;  4EMI A;  2V5Z A;  1GES A;  4C74 A;  5IPY A;  5JCN A;  4UP3 A;  3T14 A;  1MOK A;  2BC0 A;  4AP1 A;  1GOS A;  2X8C A;  3EAO A;  2RGO A;  1IUX A;  3GYJ A;  1CJ3 A;  3AEA A;  1PHH A;  1E6E A;  2Q7V A;  2RGJ A;  2YR5 A;  4A79 A;  4YWO A;  2VVM A;  1GRG A;  4Y4M A;  1N4V A;  4C77 A;  3V76 A;  4OPT A;  2YG6 A;  1D7Y A;  1H6V A;  3UP4 A;  3DK4 A;  4A99 A;  3DA1 A;  2WOW A;  3NYE A;  2IVD A;  1ZOV A;  2C67 A;  2YG3 A;  3AD7 B;  3KVE A;  4U8N A;  3IHG A;  1DOC A;  1NHQ A;  3UKK A;  4EMJ A;  1P2E A;  4EQR A;  2VVL A;  3LXD A;  1B37 A;  1H82 A;  5J7X A;  5EB4 A;  4BJY A;  2R0G A;  1ZMC A;  2VRM A;  3SFD A;  3AE7 A;  3E1T A;  3NLC A;  3P4Q A;  1Q9I A;  2R4J A;  4WCT A;  3UP5 A;  3K7Q X;  1NEN A;  1ZP0 A;  4Z2R A;  2RAB A;  3UTH A;  4U8K A;  4FX9 A;  1JRX A;  2XLR A;  3O0H A;  1SEZ A;  5C2T A;  5KOW A;  2I0Z A;  3AYL A;  4IA6 A;  3HYV A;  2YLX A;  3AXB A;  5KRQ A;  1GRB A;  1XDI A;  4NTD A;  4BV6 A;  1REO A;  1RYI A;  4TLZ A;  2BCP A;  3K30 A;  4Z2U A;  1PXA A;  1VRQ B;  2BA9 A;  4A5L A;  3SZ0 A;  3GMB A;  2WES A;  3COX A;  4H4U A;  1CHU A;  3AEE A;  2WOI A;  2XCG A;  1OJA A;  1S2Y A;  2AQJ A;  2OA1 A;  3NK1 X;  4O5Q A;  4GR1 A;  4PAB A;  4YT0 A;  2FJA A;  2VRL A;  1JRY A;  5U1O A;  4HB9 A;  1Q1W A;  3UCL A;  3CND A;  1IUV A;  1ZOY A;  3ICR A;  2WEU A;  4JQ9 A;  1CC2 A;  4U2T A;  1N1P A;  3KKJ A;  2WPE A;  4E0V A;  4ECH A;  4OPL A;  4G74 A;  3WE0 A;  2E1M A;  3GD3 A;  3NKS A;  1GER A;  2C4C A;  1IUU A;  2VQ7 A;  2OLO A;  3B3R A;  2XLP A;  1ZDL A;  4BK3 A;  1VG0 A;  2O9Z A;  5HXI A;  2YLT A;  1K0I A;  4N9X A;  3B6D A;  4AOS A;  3ITJ A;  2QA2 A;  2FJD A;  3AE6 A;  3CGD A;  4XWR A;  5M10 A;  2X8G A;  1BF3 A;  4JN9 A;  1AOG A;  1YQZ A;  4H50 A;  3VRA A;  4GCM A;  4AOX A;  4X9N A;  2EQ9 A;  3ICS A;  1F8S A;  1NHP A;  3IHM A;  3AEC A;  3EF6 A;  4IVO B;  1TDN A;  3SX6 A;  5EBK A;  3NTA A;  3LZX A;  4B67 A;  3PVC A;  1L0V A;  4NEV A;  3ISH A;  1N4U A;  4B68 A;  5U63 A;  3HZL A;  5JCM A;  1QO8 A;  1RSG A;  3VRD B;  2WDQ A;  1JRZ A;  3PO7 A;  2YR4 A;  3CGC A;  2J3N A;  1TDO A;  4USR A;  1PXB A;  1W4X A;  4ADW A;  2GEW A;  2CDU A;  1E7P A;  2QCU A;  3KA7 A;  1DOE A;  3KU9 A;  4JNQ A;  2JKC A;  2YG5 A;  2FJB A;  2GAH B;  3NN0 X;  4K7Z A;  3KLJ A;  3QVR A;  1B5Q A;  2CUL A;  1F8R A;  4II3 A;  1GTH A;  2C7G A;  5FMH A;  4CY6 A;  4YKG A;  1D5T A;  3AEB A;  4OPC A;  1D7L A;  2BRA A;  1CJ2 A;  1ELI A;  4J56 A;  4BUR A;  1ONF A;  3P4S A;  2JB1 A;  3R9U A;  4JY2 A;  3NRN A;  4A6N A;  1BGJ A;  1PXC A;  3CNS A;  3NYF A;  3G5Q A;  1DXL A;  3VR8 A;  1VQW A;  2BYB A;  1GV4 A;  4AT2 A;  3ATR A;  3IC9 A;  2GMJ A;  4EQW A;  5KVI A;  2XVJ A;  4H2R A;  4XXG A;  1ZMD A;  4Z25 A;  2X3N A;  3AYI A;  3NK2 X;  3QSM A;  4WX1 A;  3IF9 A;  2ARD A;  2B76 A;  3DME A;  1CL0 A;  3AE1 A;  1IUT A;  3SXI A;  1H83 A;  2C73 A;  3ALM A;  2C75 A;  3LJP A;  2GH5 A;  2XFO A;  5DBJ A;  3QFB A;  1PS9 A;  1Y56 A;  2Z5X A;  4UDP A;  4CY8 A;  1D4D A;  4H4W A;  4H7U A;  4J33 A;  4OPD A;  2BCG G;  1K0J A;  5CQF A;  2GR2 A;  1IUW A;  4NEW A;  4KX6 A;  1NG4 A;  1PDH A;  4BJZ A;  3NH3 X;  1H86 A;  2GF3 A;  1GRF A;  3HYW A;  2VQB A;  4G73 A;  1GRE A;  3AE4 A;  4C5O A;  5C3J A;  2JK6 A;  3C4N A;  2ZBW A;  3GRS A;  2RGH A;  3AE5 A;  3GRT A;  4H4S A;  3K7M X;  1PBD A;  2Q6U A;  3CGB A;  3NK0 X;  2R0C A;  5HYM A;  5FS9 A;  2XFQ A;  4RSL A;  4H4V A;  5KNL A;  5IQ4 A;  1H81 A;  4DNA A;  1MXT A;  4OPU A;  4YXD A;  3AD8 B;  1NAA A;  1XAN A;  2YWL A;  1XPQ A;  3UOX A;  3ZYX A;  2YR6 A;  5KXJ A;  4U8O A;  4YTP A;  2GRT A;  1NHR A;  4D04 A;  3BI5 A;  3CIR A;  2Q0L A;  1BWC A;  4TM0 A;  4UDR A;  4CNJ A;  1FEC A;  1OJD A;  3P4R A;  4H4Z A;  3RP7 A;  1E1M A;  3Q9T A;  2Q0K A;  3S61 A;  2QA1 A;  1Z6L A;  2H88 A;  3T2Z A;  2X50 A;  4U8M A;  4Y4N A;  3RHA A;  1L9E A;  4DSG A;  1GAL A;  1JOA A;  1GRH A;  4H2P A;  2WBA A;  2AAQ A;  4TM1 A;  4APN A;  3CTY A;  2JBV A;  1O95 A;  1XHC A;  4H2Q A;  2XLS A;  2XFN A;  1YY5 A;  1V59 A;  3NG7 X;  1UKV G;  2WP5 A;  4USQ A;  3NIX A;  4JY3 A;  2GV8 A;  3UOV A;  3PS9 A;  2YM1 A;  1K4Q A;  2GAG B;  2PHH A;  1LQU A;  1Y0P A;  3AE2 A;  1OJ9 A;  3H4K A;  4H4P A;  2WP9 A;  5TR3 A;  5FS7 A;  4K8D A;  5HHF A;  1GET A;  4H4Q A;  2XLT A;  3GMC A;  2BS3 A;  3CGE A;  1CC6 A;  2Z5Y A;  1GRT A;  2GR3 A;  3DGZ A;  2C64 A;  3GWF A;  2C70 A;  4TM4 A;  3OZ2 A;  3ATQ A;  3UTG A;  5HY5 A;  1Q1R A;  2OLN A;  1QLB A;  1DOD A;  1VG9 A;  1L9D A;  3D8X A;  2GVC A;  1GTE A;  3M12 A;  2XVE A;  1PBB A;  2X99 A;  4YTM A;  2A8X A;  1NEK A;  2HQM A;  2C72 A;  2B9W A;  3AEF A;  3HYX A;  4RG3 A;  5KMQ A;  2QAE A;  2C3C A;  3C96 A;  1EL7 A;  5U25 A;  4NZH A;  1TDE A;  1ZK7 A;  4ZCD A;  3T0K A;  1CF3 A;  2B9Y A;  1FOH A;  1NHS A;  4Z44 A;  3H8L A;  3ALL A;  4TM3 A;  2UZZ A;  4BK2 A;  3GYX A;  2E4G A;  1JEH A;  2XLU A;  3DJE A;  2GR0 A;  3GDN A;  3F8D A;  2ACZ A;  3T37 A;  1TYT A;  4II2 A;  2V6O A;  2VVL G;  4OCG A;  2IID A;  2VZ2 A;  3BI2 A;  4Y4L A;  2JAE A;  4A7A A;  2BS2 A;  3GWD A;  3GSI A;  2WDR A;  4G6G A;  2V3B A;  4K2X A;  1TDK A;  1H7X A;  4CRT A;  3BNM A;  4KPR A;  1LQT A;  2Y6R A;  2YVJ A;  2A87 A;  3FIM B;  3GYI A;  3GDP A;  4ICY A;  2E5V A;  2GMH A;  2CVJ A;  1BZL A;  2XFU A;  3AWI A;  3UTE A;  2WU2 A;  3BI4 A;  1B4V A;  3AE9 A;  2YG7 A;  3VR9 A;  1TDF A;  4FDC B;  2C65 A;  1ZX9 A;  4G6H A;  1QJD A;  1OJC A;  1YQ3 A;  2BXR A;  1S3B A;  1LJ1 A;  2B9X A;  4A65 A;  3G5S A;  1M64 A;  4B64 A;  3K7T A;  5LV9 A;  4C3Y A;  1CBO A;  1FEB A;  4D03 A;  5KMR A;  4GDE A;  2IVE A;  1HYU A;  3ALJ A;  2WET A;  1JNR A;  4GAP A;  4NTE A;  1FL2 A;  1KFY A;  2B7S A;  2NVK X;  5J60 A;  3L8K A;  4LII A;  2CFY A;  3DJD A;  3FBS A;  3CNJ A;  4AT0 A;  3SZC A;  3T2K A;  1S2Q A;  4LA1 A;  1X31 B;  3LOV A;  1E39 A;  5KMP A;  4HA6 A;  1L9C A;  4NTC A;  3CNT A;  5BRT A;  2DKI A;  2OAL A;  1KSS A;  3UKF A;  1TRB A;  2WDV A;  3NHO X;  5BUL A;  4DGK A;  2ZZC A;  2ZZ0 A;  1JU2 A;  1BKW A;  4X4J A;  1KSU A;  1ZKQ A;  2WQY A;  5FS6 A;  1F3P A;  1O5W A;  3DK8 A;  3F8R A;  2FBW A;  3AYJ A;  3NNE A;  4P9S A;  5EOW A;  3EPT A;  2BK3 A;  2YG4 A;  1P2H A;  4CCR A;  4B1B A;  4GF7 A;  2XVI A;  1D4E A;  1E1N A;  4XWZ A;  1DJN A;  2BAB A;  2WOV A;  2VOU A;  1M6I A;  3QSS A;  2YLS A;  3IWA A; 
#chains in the Genus database with same CATH homology
 4B63 A;  3P4P A;  1CJC A;  1GND A;  3M13 A;  4YSX A;  4UDQ A;  2R4E A;  4ZCC A;  3SFE A;  3LB8 A;  2YQU A;  4H4R A;  2XVH A;  4GUV A;  2YLZ A;  2X8H A;  4PAA A;  2GR1 A;  1PJ6 A;  3BHF A;  2TPR A;  4YTN A;  1KDG A;  3DK9 A;  4EQX A;  4IV9 A;  1FCD A;  5M0Z A;  2YAU A;  5KVH A;  4NWZ A;  3UOZ A;  4C3X A;  3FG2 P;  1PJ5 A;  2R9Z A;  1YQ4 A;  4YSY A;  1GRA A;  4JDR A;  4U2S A;  3NT6 A;  5GRT A;  2ZZB A;  3DGH A;  4I58 A;  2OAM A;  4RG4 A;  4TLX A;  3CPH G;  2R45 A;  3D1C A;  1TYP A;  3SZW A;  4J36 A;  2EQ8 A;  1GSN A;  2Y6Q A;  3RP6 A;  4AP3 A;  5BUK A;  1EL8 A;  4IA5 A;  1KNR A;  2DKH A;  1LTX R;  3GD4 A;  4EIP A;  4EMW A;  1PBF A;  3KPF A;  4J31 A;  4O5U A;  3AD9 B;  1JNZ A;  4GAV A;  3S5W A;  3CN8 A;  1NDA A;  3P1W A;  3L1R A;  1LPF A;  1D4C A;  1VDC A;  3UKL A;  4Z24 A;  5EB5 A;  1B8S A;  3RED A;  3QVP A;  2YM2 A;  3G5R A;  3KPK A;  3SY4 A;  1H7W A;  3BNU A;  1EBD A;  1F6M A;  1GPE A;  3F8P A;  3ZDN A;  4H4X A;  2YLW A;  4B65 A;  2JB3 A;  4Z26 A;  1OJT A;  3NGC X;  2BC1 A;  2GQW A;  4G9K A;  3UKP A;  2C3D A;  4B69 A;  1E1K A;  4YSZ A;  3AEG A;  2AR8 A;  3DJJ A;  4LU6 A;  3AE3 A;  2R46 A;  2V61 A;  3UTF A;  4J34 A;  1GEU A;  4IVM B;  1GXF A;  4A9W A;  3AED A;  1KF6 A;  2F5Z A;  1RP0 A;  2H89 A;  3RNM A;  5GSN A;  4A6N B;  3QJ4 A;  3LAD A;  5BVA A;  4CNK A;  4U8L A;  4NNJ A;  1CJ4 A;  4YSH A;  1MO9 A;  4Z2T A;  1PBE A;  4J57 A;  1LV0 A;  4EQS A;  1YKJ A;  1PJ7 A;  2JB2 A;  3UKA A;  3CPI G;  2BS4 A;  5FS8 A;  2APG A;  2V60 A;  3OC4 A;  4MJW A;  4ZN0 A;  1DNC A;  5CKU A;  1FEA A;  3P9U A;  4H4T A;  3T31 A;  4K5S A;  1N4W A;  2XYO A;  3FMW A;  4H4Y A;  1DJQ A;  3NN6 X;  4YKF A;  2EQ6 A;  4OVI A;  2C66 A;  4GRT A;  5JCK A;  4H2N A;  1CC4 A;  1O94 A;  3V3O A;  1S3E A;  1IUS A;  3VRB A;  2YLR A;  2WHD A;  2WPC A;  4B66 A;  2V3A A;  2XDO A;  4DSH A;  3I3L A;  5KWF A;  2BRY A;  3JSK A;  4U8P A;  2WPF A;  5KOX A;  1BGN A;  1NG3 A;  4J2W A;  3FPZ A;  4OPI A;  3V3N A;  2YVG A;  1H84 A;  5JCL A;  3DJG X;  3SM8 A;  3ABV A;  4CBQ A;  5L46 A;  3II4 A;  4U2L A;  2GB0 A;  2A89 A;  1KNP A;  3AE8 A;  1F8W A;  4FK1 A;  3M0O A;  3QSE A;  1K0L A;  3CNP A;  2BK5 A;  2WS3 A;  5IQ1 A;  4I59 A;  2XVF A;  4Z43 A;  3DH9 A;  1ZY8 A;  1LVL A;  3C4A A;  3URH A;  3NYC A;  2B7R A;  3SZF A;  2BAC A;  2XFP A;  3AB1 A;  2NPX A;  4K5R A;  3VQR A;  2W0H A;  4FK1 C;  1NPX A;  2C76 A;  3T2Y A;  3UKH A;  4EM4 A;  4U8J A;  1PN0 A;  2BK4 A;  3H8I A;  3I6D A;  4EM3 A;  3UOY A;  1E1L A;  3SYI A;  4CCQ A;  4U8I A;  3SGL A;  5ER0 A;  3NTD A;  2YVF A;  1COY A;  3CPJ G;  3LZW A;  3ADA B;  4OPG A;  4REK A;  3ICT A;  1GT8 A;  3CMM A;  1DOB A;  2PYX A;  5JCI A;  3EAN A;  3RP8 A;  2FJE A;  3KD9 A;  2BXS A;  2R0P A;  1IJH A;  1EL5 A;  1Y56 B;  3SQP A;  3Q6J A;  3BHK A;  3UKQ A;  1PBC A;  2TMD A;  2GQF A;  2WU5 A;  4GDP A;  5KMS A;  1EL9 A;  2EQ7 A;  4M52 A;  4X9M A;  3QFA A;  4JNA A;  4K22 A;  2WP6 A;  4BK1 A;  4EIQ A;  4EMI A;  2V5Z A;  1GES A;  4C74 A;  5IPY A;  5JCN A;  4UP3 A;  3T14 A;  1MOK A;  2BC0 A;  4AP1 A;  1GOS A;  2X8C A;  3EAO A;  2RGO A;  1IUX A;  3GYJ A;  1CJ3 A;  3AEA A;  1PHH A;  1E6E A;  2Q7V A;  2RGJ A;  2YR5 A;  4A79 A;  4YWO A;  2VVM A;  1GRG A;  4Y4M A;  1N4V A;  4C77 A;  3V76 A;  4OPT A;  2YG6 A;  1D7Y A;  1H6V A;  3UP4 A;  3DK4 A;  4A99 A;  3DA1 A;  2WOW A;  3NYE A;  2IVD A;  1ZOV A;  2C67 A;  2YG3 A;  3AD7 B;  3KVE A;  4U8N A;  3IHG A;  1DOC A;  1NHQ A;  3UKK A;  4EMJ A;  1P2E A;  4EQR A;  2VVL A;  3LXD A;  1B37 A;  1H82 A;  5J7X A;  5EB4 A;  4BJY A;  2R0G A;  1ZMC A;  2VRM A;  3SFD A;  3AE7 A;  3E1T A;  3NLC A;  3P4Q A;  1Q9I A;  2R4J A;  4WCT A;  3UP5 A;  3K7Q X;  1NEN A;  1ZP0 A;  4Z2R A;  2RAB A;  3UTH A;  4U8K A;  4FX9 A;  1JRX A;  2XLR A;  3O0H A;  1SEZ A;  5C2T A;  5KOW A;  2I0Z A;  3AYL A;  4IA6 A;  3HYV A;  2YLX A;  3AXB A;  5KRQ A;  1GRB A;  1XDI A;  4NTD A;  4BV6 A;  1REO A;  1RYI A;  4TLZ A;  2BCP A;  3K30 A;  4Z2U A;  1PXA A;  1VRQ B;  2BA9 A;  4A5L A;  3SZ0 A;  3GMB A;  2WES A;  3COX A;  4H4U A;  1CHU A;  3AEE A;  2WOI A;  2XCG A;  1OJA A;  1S2Y A;  2AQJ A;  2OA1 A;  3NK1 X;  4O5Q A;  4GR1 A;  4PAB A;  4YT0 A;  2FJA A;  2VRL A;  1JRY A;  5U1O A;  4HB9 A;  1Q1W A;  3UCL A;  3CND A;  1IUV A;  1ZOY A;  3ICR A;  2WEU A;  4JQ9 A;  1CC2 A;  4U2T A;  1N1P A;  3KKJ A;  2WPE A;  4E0V A;  4ECH A;  4OPL A;  4G74 A;  3WE0 A;  2E1M A;  3GD3 A;  3NKS A;  1GER A;  2C4C A;  1IUU A;  2VQ7 A;  2OLO A;  3B3R A;  2XLP A;  1ZDL A;  4BK3 A;  1VG0 A;  2O9Z A;  5HXI A;  2YLT A;  1K0I A;  4N9X A;  3B6D A;  4AOS A;  3ITJ A;  2QA2 A;  2FJD A;  3AE6 A;  3CGD A;  4XWR A;  5M10 A;  2X8G A;  1BF3 A;  4JN9 A;  1AOG A;  1YQZ A;  4H50 A;  3VRA A;  4GCM A;  4AOX A;  4X9N A;  2EQ9 A;  3ICS A;  1F8S A;  1NHP A;  3IHM A;  3AEC A;  3EF6 A;  4IVO B;  1TDN A;  3SX6 A;  5EBK A;  3NTA A;  3LZX A;  4B67 A;  3PVC A;  1L0V A;  4NEV A;  3ISH A;  1N4U A;  4B68 A;  5U63 A;  3HZL A;  5JCM A;  1QO8 A;  1RSG A;  3VRD B;  2WDQ A;  1JRZ A;  3PO7 A;  2YR4 A;  3CGC A;  2J3N A;  1TDO A;  4USR A;  1PXB A;  1W4X A;  4ADW A;  2GEW A;  2CDU A;  1E7P A;  2QCU A;  3KA7 A;  1DOE A;  3KU9 A;  4JNQ A;  2JKC A;  2YG5 A;  2FJB A;  2GAH B;  3NN0 X;  4K7Z A;  3KLJ A;  3QVR A;  1B5Q A;  2CUL A;  1F8R A;  4II3 A;  1GTH A;  2C7G A;  5FMH A;  4CY6 A;  4YKG A;  1D5T A;  3AEB A;  4OPC A;  1D7L A;  2BRA A;  1CJ2 A;  1ELI A;  4J56 A;  4BUR A;  1ONF A;  3P4S A;  2JB1 A;  3R9U A;  4JY2 A;  3NRN A;  4A6N A;  1BGJ A;  1PXC A;  3CNS A;  3NYF A;  3G5Q A;  1DXL A;  3VR8 A;  1VQW A;  2BYB A;  1GV4 A;  4AT2 A;  3ATR A;  3IC9 A;  2GMJ A;  4EQW A;  5KVI A;  2XVJ A;  4H2R A;  4XXG A;  1ZMD A;  4Z25 A;  2X3N A;  3AYI A;  3NK2 X;  3QSM A;  4WX1 A;  3IF9 A;  2ARD A;  2B76 A;  3DME A;  1CL0 A;  3AE1 A;  1IUT A;  3SXI A;  1H83 A;  2C73 A;  3ALM A;  2C75 A;  3LJP A;  2GH5 A;  2XFO A;  5DBJ A;  3QFB A;  1PS9 A;  1Y56 A;  2Z5X A;  4UDP A;  4CY8 A;  1D4D A;  4H4W A;  4H7U A;  4J33 A;  4OPD A;  2BCG G;  1K0J A;  5CQF A;  2GR2 A;  1IUW A;  4NEW A;  4KX6 A;  1NG4 A;  1PDH A;  4BJZ A;  3NH3 X;  1H86 A;  2GF3 A;  1GRF A;  3HYW A;  2VQB A;  4G73 A;  1GRE A;  3AE4 A;  4C5O A;  5C3J A;  2JK6 A;  3C4N A;  2ZBW A;  3GRS A;  2RGH A;  3AE5 A;  3GRT A;  4H4S A;  3K7M X;  1PBD A;  2Q6U A;  3CGB A;  3NK0 X;  2R0C A;  5HYM A;  5FS9 A;  2XFQ A;  4RSL A;  4H4V A;  5KNL A;  5IQ4 A;  1H81 A;  4DNA A;  1MXT A;  4OPU A;  4YXD A;  3AD8 B;  1NAA A;  1XAN A;  2YWL A;  1XPQ A;  3UOX A;  3ZYX A;  2YR6 A;  5KXJ A;  4U8O A;  4YTP A;  2GRT A;  1NHR A;  4D04 A;  3BI5 A;  3CIR A;  2Q0L A;  1BWC A;  4TM0 A;  4UDR A;  4CNJ A;  1FEC A;  1OJD A;  3P4R A;  4H4Z A;  3RP7 A;  1E1M A;  3Q9T A;  2Q0K A;  3S61 A;  2QA1 A;  1Z6L A;  2H88 A;  3T2Z A;  2X50 A;  4U8M A;  4Y4N A;  3RHA A;  1L9E A;  4DSG A;  1GAL A;  1JOA A;  1GRH A;  4H2P A;  2WBA A;  2AAQ A;  4TM1 A;  4APN A;  3CTY A;  2JBV A;  1O95 A;  1XHC A;  4H2Q A;  2XLS A;  2XFN A;  1YY5 A;  1V59 A;  3NG7 X;  1UKV G;  2WP5 A;  4USQ A;  3NIX A;  4JY3 A;  2GV8 A;  3UOV A;  3PS9 A;  2YM1 A;  1K4Q A;  2GAG B;  2PHH A;  1LQU A;  1Y0P A;  3AE2 A;  1OJ9 A;  3H4K A;  4H4P A;  2WP9 A;  5TR3 A;  5FS7 A;  4K8D A;  5HHF A;  1GET A;  4H4Q A;  2XLT A;  3GMC A;  2BS3 A;  3CGE A;  1CC6 A;  2Z5Y A;  1GRT A;  2GR3 A;  3DGZ A;  2C64 A;  3GWF A;  2C70 A;  4TM4 A;  3OZ2 A;  3ATQ A;  3UTG A;  5HY5 A;  1Q1R A;  2OLN A;  1QLB A;  1DOD A;  1VG9 A;  1L9D A;  3D8X A;  2GVC A;  1GTE A;  3M12 A;  2XVE A;  1PBB A;  2X99 A;  4YTM A;  2A8X A;  1NEK A;  2HQM A;  2C72 A;  2B9W A;  3AEF A;  3HYX A;  4RG3 A;  5KMQ A;  2QAE A;  2C3C A;  3C96 A;  1EL7 A;  5U25 A;  4NZH A;  1TDE A;  1ZK7 A;  4ZCD A;  3T0K A;  1CF3 A;  2B9Y A;  1FOH A;  1NHS A;  4Z44 A;  3H8L A;  3ALL A;  4TM3 A;  2UZZ A;  4BK2 A;  3GYX A;  2E4G A;  1JEH A;  2XLU A;  3DJE A;  2GR0 A;  3GDN A;  3F8D A;  2ACZ A;  3T37 A;  1TYT A;  4II2 A;  2V6O A;  2VVL G;  4OCG A;  2IID A;  2VZ2 A;  3BI2 A;  4Y4L A;  2JAE A;  4A7A A;  2BS2 A;  3GWD A;  3GSI A;  2WDR A;  4G6G A;  2V3B A;  4K2X A;  1TDK A;  1H7X A;  4CRT A;  3BNM A;  4KPR A;  1LQT A;  2Y6R A;  2YVJ A;  2A87 A;  3FIM B;  3GYI A;  3GDP A;  4ICY A;  2E5V A;  2GMH A;  2CVJ A;  1BZL A;  2XFU A;  3AWI A;  3UTE A;  2WU2 A;  3BI4 A;  1B4V A;  3AE9 A;  2YG7 A;  3VR9 A;  1TDF A;  4FDC B;  2C65 A;  1ZX9 A;  4G6H A;  1QJD A;  1OJC A;  1YQ3 A;  2BXR A;  1S3B A;  1LJ1 A;  2B9X A;  4A65 A;  3G5S A;  1M64 A;  4B64 A;  3K7T A;  5LV9 A;  4C3Y A;  1CBO A;  1FEB A;  4D03 A;  5KMR A;  4GDE A;  2IVE A;  1HYU A;  3ALJ A;  2WET A;  1JNR A;  4GAP A;  4NTE A;  1FL2 A;  1KFY A;  2B7S A;  2NVK X;  5J60 A;  3L8K A;  4LII A;  2CFY A;  3DJD A;  3FBS A;  3CNJ A;  4AT0 A;  3SZC A;  3T2K A;  1S2Q A;  4LA1 A;  1X31 B;  3LOV A;  1E39 A;  5KMP A;  4HA6 A;  1L9C A;  4NTC A;  3CNT A;  5BRT A;  2DKI A;  2OAL A;  1KSS A;  3UKF A;  1TRB A;  2WDV A;  3NHO X;  5BUL A;  4DGK A;  2ZZC A;  2ZZ0 A;  1JU2 A;  1BKW A;  4X4J A;  1KSU A;  1ZKQ A;  2WQY A;  5FS6 A;  1F3P A;  1O5W A;  3DK8 A;  3F8R A;  2FBW A;  3AYJ A;  3NNE A;  4P9S A;  5EOW A;  3EPT A;  2BK3 A;  2YG4 A;  1P2H A;  4CCR A;  4B1B A;  4GF7 A;  2XVI A;  1D4E A;  1E1N A;  4XWZ A;  1DJN A;  2BAB A;  2WOV A;  2VOU A;  1M6I A;  3QSS A;  2YLS A;  3IWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...