3UOVA

Crystal structure of otemo (fad bound form 1)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
536
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 194
structure length 536
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uovA01
1KDGA 1E1LA 1H82A 5GRTA 3OC4A 2RGJA 4CBQA 1EL5A 4H2PA 3SGLA 4U8MA 3ATQA 4MJWA 4U8PA 5L46A 4E0VA 3AE5A 1ZOYA 3AB1A 4NZHA 2XVFA 2V3BA 2FJDA 1Q9IA 4Z24A 3NLCA 4A6NB 3NTAA 1JRYA 2GR1A 4Z2TA 1PDHA 1S2YA 3UOXA 4C3YA 1H86A 1O94A 3NN6X 3M0OA 4Y4MA 2C64A 4B68A 4H4QA 1N4VA 2IVDA 2AR8A 2BYBA 3CPIG 1ZMDA 5IQ1A 3AD7B 3P1WA 3FBSA 2BCGG 1NAAA 2WDRA 1GREA 4O5UA 4JDRA 2YLSA 1N1PA 1F6MA 3NN0X 4D03A 5JCLA 1ZY8A 3CPHG 2WU2A 3CN8A 3CNPA 3II4A 1N4WA 2VRMA 4C5OA 1JOAA 2OAMA 3JSKA 4DSGA 2OLNA 2GQWA 4U2TA 5FS9A 3ALMA 2GAHB 2YG3A 3GWFA 4U8IA 1GNDA 5U25A 3UTHA 1L9CA 3P4QA 2IVEA 1BZLA 1DOEA 4LA1A 2R0CA 3LOVA 4KPRA 2YG7A 2BXRA 3F8DA 2AAQA 4DSHA 4YXDA 1W4XA 5KOWA 1S3EA 1PXCA 2WQYA 4ZCCA 1GT8A 4GCMA 5JCNA 1ZP0A 3K7QX 3GMCA 1HYUA 5U63A 1IUUA 4A65A 2RGHA 4H4UA 2VVLA 2JB2A 3WE0A 2XYOA 2WDVA 2C72A 3ZYXA 1LV0A 2B9WA 2YR4A 4OVIA 2YLXA 4Z44A 3GD3A 3DMEA 4JQ9A 3BHKA 3SFDA 1F8SA 2XVJA 2WETA 3ABVA 3RNMA 3NYEA 4H4WA 4GDPA 5TR3A 3ALLA 2BABA 2WBAA 4H4VA 3RP8A 4CNJA 4DGKA 3QSMA 4IA5A 4EQWA 4YSYA 4TM4A 3RP6A 3VR8A 3NK1X 2R45A 4IA6A 1NHSA 3AE8A 5KRQA 3FIMB 4K22A 5KVHA 2GV8A 1E39A 3HZLA 4GDEA 2VVMA 2E1MA 2XCGA 2W0HA 3AEEA 2JB3A 1O5WA 5KVIA 1OJDA 2Q0KA 4OPGA 2JKCA 2WHDA 3UKHA 3UKAA 1BF3A 4EIQA 5J60A 1OJCA 1PBEA 1ZX9A 4K7ZA 2ACZA 1RYIA 1L9EA 1JNRA 1YQ3A 4HB9A 2CFYA 3GSIA 2R9ZA 3KLJA 4YWOA 3DJJA 2V60A 3ICTA 2NVKX 2A87A 2Z5YA 3UKQA 2WPEA 2YLWA 3AEAA 2YM1A 3BNMA 1LVLA 1K0LA 4Z25A 3K7MX 1LQUA 1MXTA 4LU6A 4Y4LA 3RP7A 3IHGA 4FK1C 4DNAA 2GAGB 3VQRA 2PHHA 1EL8A 2Z5XA 3AEFA 2JK6A 3QFAA 5JCIA 3CGDA 2CULA 5BVAA 1E1MA 4U8OA 5IQ4A 1PN0A 3BNUA 3NT6A 4JY2A 2XFUA 1M6IA 4UDPA 3GDNA 4FDCB 3M12A 1PJ6A 1VQWA 1DNCA 2GR3A 3KKJA 3E1TA 2TMDA 3KPFA 4ECHA 1XANA 2BK5A 1NEKA 4H2QA 1D4EA 2EQ7A 2BK4A 4YKGA 1GTHA 3KA7A 2VOUA 2WOWA 4X9MA 4J33A 2V6OA 4XWRA 3I6DA 1TYTA 1Y56B 2VQBA 3IF9A 2C65A 4X4JA 2C3CA 2Y6RA 1IUVA 3B6DA 1VG0A 3ICSA 3NRNA 4C3XA 2ZZCA 3CPJG 1PS9A 3NGCX 3QSEA 1Z6LA 4NTEA 1DOBA 5HHFA 1D4DA 5HY5A 1KFYA 2Y6QA 1E7PA 3D8XA 4LIIA 5HYMA 3R9UA 1PBCA 3DA1A 4K8DA 1P2HA 1S2QA 3GWDA 2NPXA 3G5RA 3K7TA 1B4VA 4UDQA 1GXFA 4RG4A 1TYPA 5CQFA 3GYIA 2YVJA 4YSHA 1ZK7A 2GH5A 1GOSA 1H81A 4B1BA 5EOWA 1K0IA 1PBFA 2J3NA 3AWIA 1ELIA 3ATRA 2WPCA 1GRGA 2B9XA 2Q6UA 5FS6A 3UKFA 3GRSA 3UTEA 1ONFA 2QCUA 1E1NA 1LTXR 4M52A 1N4UA 4AP3A 4USQA 2BXSA 3AYJA 2GMJA 3H8IA 4K5SA 4A6NA 5C3JA 3CNTA 3REDA 3UOYA 1CJ2A 1DXLA 2QAEA 3GDPA 3CNSA 4K2XA 3DK8A 1IJHA 3CTYA 3ITJA 3VRBA 2BA9A 1KNRA 1IUWA 2Q7VA 3GD4A 2C76A 4TM0A 2WS3A 2X3NA 1RP0A 4BJYA 2ZZBA 2XFOA 4P9SA 3NTDA 3IC9A 2BC0A 5GSNA 4CY8A 1CBOA 4JNAA 5IPYA 1MOKA 1NHRA 2A8XA 3DJDA 4FX9A 4XXGA 1OJAA 1ZKQA 4OCGA 5J7XA 2BS4A 2JBVA 3CNDA 5BULA 4Z43A 2GF3A 3NG7X 3V76A 4A79A 1PBBA 4IVMB 1NPXA 4GF7A 1YY5A 1DJQA 3V3NA 2YVFA 4B64A 3K30A 5KWFA 2TPRA 3UOZA 2E4GA 2C70A 1VG9A 2XLRA 1GERA 4H4XA 4EQXA 4XWZA 1DOCA 1CC6A 3AEDA 3LZWA 4J57A 1NENA 3AD9B 2C3DA 3KD9A 4WX1A 4D04A 1PXAA 2YLRA 4TM1A 1FOHA 2WP6A 4JY3A 1LPFA 4J2WA 1BGNA 5BRTA 1H84A 1M64A 3DGZA 2ZZ0A 5M0ZA 1JEHA 2E5VA 1CL0A 2B7SA 2X8HA 3NK2X 4B67A 3NYCA 1Q1RA 1E6EA 1GEUA 4GUVA 2EQ9A 4OPLA 2WEUA 1JNZA 1TDNA 3P9UA 1EL7A 1K0JA 3QJ4A 4BK2A 3NKSA 1H7XA 5HXIA 2R0PA 4B65A 1F3PA 3CGEA 2VVLG 4TM3A 2C7GA 1BWCA 2H88A 1GSNA 3QFBA 3AYLA 3H4KA 1BKWA 1E1KA 3PS9A 3DGHA 4B69A 1LQTA 2GB0A 3LB8A 4EM4A 1GRHA 5EB4A 2WPFA 1KSSA 1QLBA 1YQZA 2AQJA 1RSGA 2ZBWA 3AE4A 1GRTA 3SM8A 4OPIA 1CF3A 2XLSA 1NG4A 1UKVG 4REKA 4N9XA 3DJEA 4JN9A 4BV6A 2I0ZA 2YVGA 4U8JA 4TLZA 3G5SA 1NG3A 2FJAA 1K4QA 4U8NA 1H83A 4CY6A 4ZN0A 4FK1A 2H89A 2VQ7A 3AECA 2ARDA 1TDFA 2JB1A 4X9NA 1PBDA 1KF6A 3ICRA 2WDQA 4H4PA 2XFPA 3ALJA 5EBKA 2FJEA 1FECA 2DKIA 2XFNA 3LADA 4U8KA 3UP5A 3AE2A 1OJ9A 3BI5A 5U1OA 5FMHA 2C75A 3CIRA 4WCTA 4NEWA 1GV4A 2QA1A 2WESA 2XDOA 4J36A 4BK1A 2BACA 4IVOB 4J34A 3GYJA 3VRAA 4Z2RA 3LXDA 1TDKA 2FBWA 3AE7A 3BI2A 2CDUA 1Y56A 3PO7A 4AP1A 5BUKA 1COYA 4U2SA 3EPTA 3C96A 1PXBA 1S3BA 1L0VA 4AOSA 4BK3A 1D4CA 4O5QA 3CGCA 2GEWA 3C4AA 3UKLA 2R46A 4AOXA 4H4RA 2R4JA 4H2RA 4NTCA 4CCRA 1KNPA 1NDAA 4OPCA 4IV9A 3LJPA 4H4YA 3BHFA 3QSSA 1EBDA 1DJNA 5KOXA 2C67A 3EAOA 4USRA 2CVJA 1SEZA 2PYXA 2IIDA 2YAUA 3IHMA 4ZCDA 3EF6A 1JRZA 4RSLA 5EB5A 2EQ8A 4ADWA 2UZZA 1ZDLA 2X8GA 2YLZA 2JAEA 3P4SA 4UP3A 3Q9TA 4I58A 1B37A 3DK9A 4H4TA 4CNKA 2WOVA 1TDOA 2BCPA 2BK3A 3AEGA 4YKFA 3VRDB 2GR0A 3AE9A 3DK4A 2BC1A 3M13A 3NYFA 5JCMA 2O9ZA 4I59A 5KXJA 3P4PA 4NTDA 2FJBA 1VDCA 2VRLA 4PABA 3DH9A 2XLUA 3AYIA 3G5QA 3I3LA 2V5ZA 4K5RA 4NEVA 2YR5A 3AXBA 2F5ZA 2GVCA 3CGBA 1D7LA 3KVEA 2QA2A 4OPDA 1F8WA 2R4EA 4AT0A 1KSUA 2YR6A 3AD8B 4PAAA 1MO9A 1H6VA 2OLOA 2XVEA 4H7UA 4B63A 4A7AA 3GMBA 3NIXA 3UOVA 3BI4A 3F8PA 3GRTA 1XDIA 4EMJA 3KU9A 3PVCA 3ISHA 4ICYA 4C77A 4EM3A 3COXA 2YQUA 5FS7A 1XHCA 3OZ2A 1JU2A 5FS8A 1CC4A 4BURA 2B9YA 2OA1A 1PHHA 1Q1WA 1XPQA 1CJ4A 4CRTA 2YG4A 3NH3X 1CHUA 1DODA 4J56A 1NHQA 3SFEA 1B5QA 2X99A 3L8KA 2BS3A 4UDRA 2XFQA 3C4NA 1D5TA 2C66A 3EANA 3NHOX 1IUTA 3NNEA 3T37A 1B8SA 2WU5A 1GALA 1ZMCA 3QVPA 4OPTA 4Y4NA 3UP4A 4YTPA 2WP9A 4AT2A 5LV9A 3RHAA 4U2LA 4EIPA 4Z26A 1CC2A 3AEBA 2R0GA 3QVRA 2B7RA 1GPEA 1OJTA 1LJ1A 1H7WA 4EMWA 4KX6A 4EMIA 4H4ZA 3FMWA 4YT0A 1GESA 1GRAA 1IUXA 1BGJA 4BJZA 3L1RA 2V3AA 3S61A 2DKHA 2OALA 2WP5A 2XVIA 4APNA 2A89A 5DBJA 3D1CA 2GR2A 1GRBA 3CNJA 1VRQB 1F8RA 1EL9A 3LZXA 4GR1A 5JCKA 1FEBA 2V61A 4H4SA 3S5WA 1YQ4A 4U8LA 4Z2UA 3B3RA 3H8LA 3IWAA 2YLTA 4EQSA 2WOIA 1REOA 2YWLA 5M10A 1X31B 3FG2P 4CCQA 4C74A 4JNQA 4YTNA 1L9DA 2RGOA 2X50A 1JRXA 2Q0LA 2GMHA 2XLPA 3V3OA 4EQRA 1GETA 2YG5A 4H2NA 2B76A 3UKPA 1FL2A 3VR9A 3DJGX 5ER0A 3SQPA 2YM2A 4A99A 1ZOVA 4RG3A 1TRBA 2XVHA 3AE6A 1V59A 1CJ3A 3O0HA 1NHPA 3ADAB 1D7YA 4GRTA 1CJCA 4YSZA 3P4RA 4YSXA 1QO8A 4B66A 1AOGA 1PJ7A 3AE3A 1Y0PA 3F8RA 2RABA 1FEAA 1FCDA 3FPZA 1QJDA 1TDEA 2APGA 2C73A 3AE1A 3NK0X 4A9WA 1IUSA 4HA6A 4TLXA 3ZDNA 4YTMA 1P2EA 5CKUA 2X8CA 1YKJA 3URHA 2VZ2A 3UKKA 2BS2A 4J31A 4A5LA 3UCLA 3Q6JA 1PJ5A 5C2TA 2GRTA 2HQMA 4H50A 2YG6A 2GQFA 3UTFA 3UTGA 1GRFA 4OPUA 1O95A 1GTEA 2XLTA 2EQ6A
chains in the Genus database with same CATH superfamily
1KDGA 1E1LA 1H82A 5GRTA 3OC4A 2RGJA 4CBQA 1EL5A 4H2PA 3SGLA 4U8MA 3ATQA 4MJWA 4U8PA 5L46A 4E0VA 3AE5A 1ZOYA 3AB1A 4NZHA 2XVFA 2V3BA 3T31A 2FJDA 1Q9IA 4Z24A 3NLCA 4A6NB 3NTAA 1JRYA 2GR1A 4Z2TA 1PDHA 1S2YA 3UOXA 4C3YA 1H86A 1O94A 3NN6X 3M0OA 4Y4MA 2C64A 4B68A 4H4QA 1N4VA 3SYIA 2IVDA 2AR8A 2BYBA 3CPIG 1ZMDA 5IQ1A 3AD7B 3P1WA 3FBSA 2BCGG 1NAAA 2WDRA 4II2A 1GREA 4O5UA 4JDRA 2YLSA 1N1PA 1F6MA 3NN0X 4G73A 4D03A 1ZY8A 5JCLA 3CPHG 2WU2A 3CN8A 3CNPA 3II4A 1N4WA 2VRMA 4C5OA 1JOAA 2OAMA 3JSKA 4DSGA 2OLNA 2GQWA 4U2TA 5FS9A 3ALMA 2GAHB 2YG3A 3GWFA 4U8IA 1GNDA 5U25A 3UTHA 1L9CA 3P4QA 2IVEA 1BZLA 1DOEA 4LA1A 2R0CA 3HYXA 3LOVA 4KPRA 2YG7A 2BXRA 3F8DA 2AAQA 4DSHA 4YXDA 1W4XA 5KOWA 1S3EA 1PXCA 2WQYA 4ZCCA 1GT8A 4GCMA 5JCNA 1ZP0A 3K7QX 3GMCA 1HYUA 5U63A 1IUUA 4A65A 2RGHA 4H4UA 2VVLA 2JB2A 3WE0A 2XYOA 2WDVA 2C72A 3ZYXA 1LV0A 2B9WA 2YR4A 3CMMA 4OVIA 2YLXA 4Z44A 3GD3A 3DMEA 4JQ9A 3BHKA 3SFDA 1F8SA 2XVJA 2WETA 3ABVA 3RNMA 3NYEA 4H4WA 4GDPA 5TR3A 3ALLA 2BABA 2WBAA 4H4VA 3RP8A 4CNJA 4DGKA 3QSMA 4IA5A 4EQWA 4YSYA 4TM4A 3RP6A 3VR8A 3NK1X 2R45A 4IA6A 1NHSA 3AE8A 5KRQA 3FIMB 4K22A 5KVHA 2GV8A 1E39A 3HZLA 4GDEA 2VVMA 2E1MA 2XCGA 2W0HA 3AEEA 2JB3A 3T2YA 1O5WA 5KVIA 1OJDA 2Q0KA 4OPGA 2JKCA 2WHDA 3UKHA 3UKAA 1BF3A 4EIQA 5J60A 1OJCA 1PBEA 1ZX9A 4K7ZA 2ACZA 1RYIA 1L9EA 1JNRA 1YQ3A 4HB9A 2CFYA 3GSIA 2R9ZA 3KLJA 4YWOA 3DJJA 2V60A 3ICTA 2NVKX 2A87A 2Z5YA 3UKQA 2WPEA 2YLWA 3AEAA 2YM1A 3BNMA 1LVLA 1K0LA 4Z25A 3K7MX 1LQUA 1MXTA 4LU6A 4Y4LA 3RP7A 3IHGA 4FK1C 4DNAA 2GAGB 3VQRA 2PHHA 1EL8A 2Z5XA 4GAVA 3AEFA 2JK6A 3QFAA 5JCIA 3CGDA 2CULA 5BVAA 1E1MA 4U8OA 5IQ4A 1PN0A 3BNUA 3NT6A 4JY2A 2XFUA 1M6IA 4UDPA 3GDNA 4FDCB 3M12A 1PJ6A 1VQWA 1DNCA 2GR3A 3KKJA 2C4CA 3E1TA 2TMDA 3KPFA 4ECHA 1XANA 2BK5A 1NEKA 4H2QA 1D4EA 2EQ7A 2BK4A 4YKGA 1GTHA 3KA7A 2VOUA 2WOWA 4X9MA 4J33A 2V6OA 4XWRA 3T0KA 3I6DA 1TYTA 1Y56B 2VQBA 3IF9A 2C65A 4X4JA 2C3CA 2Y6RA 1IUVA 3B6DA 1VG0A 3ICSA 3NRNA 4C3XA 2ZZCA 3CPJG 1PS9A 3NGCX 3QSEA 1Z6LA 4NTEA 1DOBA 5HHFA 1D4DA 5HY5A 1KFYA 2Y6QA 1E7PA 3D8XA 4LIIA 5HYMA 5KMRA 3R9UA 1PBCA 3DA1A 4K8DA 1P2HA 1S2QA 3GWDA 2NPXA 3G5RA 3K7TA 1B4VA 4UDQA 1GXFA 4RG4A 1TYPA 5CQFA 3GYIA 2YVJA 4YSHA 1ZK7A 2GH5A 1GOSA 1H81A 4B1BA 5EOWA 1K0IA 1PBFA 2J3NA 3AWIA 1ELIA 3ATRA 2WPCA 1GRGA 2B9XA 2Q6UA 5FS6A 3UKFA 3GRSA 3UTEA 1ONFA 2QCUA 1E1NA 1LTXR 4M52A 3T14A 4GAPA 1N4UA 4AP3A 4II3A 4USQA 2BXSA 3AYJA 2GMJA 3H8IA 4K5SA 4A6NA 5C3JA 3CNTA 3REDA 3UOYA 1CJ2A 1DXLA 2QAEA 3GDPA 3CNSA 4K2XA 3DK8A 1IJHA 3CTYA 3ITJA 3VRBA 2BA9A 1KNRA 1IUWA 2Q7VA 3GD4A 2C76A 4TM0A 2WS3A 2X3NA 1RP0A 4BJYA 2ZZBA 2XFOA 4P9SA 3NTDA 3IC9A 2BC0A 5GSNA 4CY8A 1CBOA 4JNAA 5IPYA 1MOKA 1NHRA 2A8XA 3DJDA 4FX9A 4XXGA 1OJAA 1ZKQA 4OCGA 5J7XA 2BS4A 3SX6A 2JBVA 3CNDA 4NWZA 4Z43A 5BULA 2GF3A 3NG7X 3V76A 4A79A 1PBBA 5KNLA 4IVMB 1NPXA 4GF7A 1YY5A 1DJQA 3SY4A 3V3NA 2YVFA 4B64A 3K30A 5KWFA 2TPRA 3UOZA 2E4GA 2C70A 1VG9A 2XLRA 1GERA 4H4XA 4EQXA 4XWZA 1DOCA 1CC6A 3AEDA 3LZWA 4J57A 1NENA 3AD9B 2C3DA 3KD9A 4WX1A 4D04A 3GYXA 1PXAA 2YLRA 4TM1A 1FOHA 2WP6A 4JY3A 1LPFA 4J2WA 1BGNA 5BRTA 1H84A 1M64A 3DGZA 2ZZ0A 5M0ZA 1JEHA 2E5VA 1CL0A 2B7SA 2X8HA 3NK2X 3SZFA 4B67A 3NYCA 1Q1RA 1E6EA 1GEUA 4GUVA 2EQ9A 4OPLA 2WEUA 1JNZA 1TDNA 3P9UA 1EL7A 1K0JA 3QJ4A 4BK2A 3NKSA 1H7XA 5HXIA 2R0PA 4B65A 1F3PA 3CGEA 2VVLG 4TM3A 2C7GA 1BWCA 2H88A 1GSNA 3QFBA 3AYLA 3H4KA 1BKWA 1E1KA 3PS9A 3DGHA 4B69A 1LQTA 2GB0A 3LB8A 4EM4A 1GRHA 4G6HA 5EB4A 2WPFA 1KSSA 1QLBA 1YQZA 2AQJA 1RSGA 2ZBWA 3AE4A 1GRTA 3SM8A 4OPIA 1CF3A 2XLSA 1NG4A 1UKVG 4REKA 4N9XA 3SXIA 3DJEA 4JN9A 4BV6A 2I0ZA 2YVGA 4U8JA 4TLZA 3G5SA 1NG3A 2FJAA 1K4QA 4U8NA 1H83A 4CY6A 4ZN0A 4FK1A 2H89A 2BRYA 2VQ7A 3AECA 2ARDA 1TDFA 2JB1A 4X9NA 1PBDA 1KF6A 3ICRA 2WDQA 3SZCA 4H4PA 2XFPA 3ALJA 5EBKA 2FJEA 1FECA 2DKIA 2XFNA 3LADA 4U8KA 3UP5A 3AE2A 1OJ9A 3BI5A 5U1OA 5FMHA 2C75A 3CIRA 4WCTA 4NEWA 1GV4A 2QA1A 2WESA 2XDOA 4J36A 4BK1A 2BACA 4IVOB 4J34A 3GYJA 3VRAA 4Z2RA 3LXDA 1TDKA 2FBWA 3AE7A 3BI2A 2CDUA 1Y56A 3PO7A 4AP1A 5BUKA 1COYA 4U2SA 3EPTA 3C96A 1PXBA 1S3BA 1L0VA 4AOSA 4BK3A 1D4CA 4O5QA 3CGCA 2GEWA 3C4AA 3UKLA 2R46A 4AOXA 4H4RA 2R4JA 4H2RA 4NTCA 4CCRA 1KNPA 1NDAA 4OPCA 2BRAA 4IV9A 3LJPA 4H4YA 3BHFA 3QSSA 1EBDA 1DJNA 5KOXA 2C67A 3EAOA 4USRA 2CVJA 1SEZA 2PYXA 2IIDA 2YAUA 3IHMA 4ZCDA 3EF6A 1JRZA 4RSLA 5EB5A 2EQ8A 4ADWA 2UZZA 1ZDLA 2X8GA 2YLZA 2JAEA 3P4SA 4UP3A 3Q9TA 4I58A 1B37A 3DK9A 4H4TA 4CNKA 2WOVA 1TDOA 2BCPA 2BK3A 3AEGA 4YKFA 3VRDB 4NNJA 2GR0A 3AE9A 3DK4A 2BC1A 3M13A 3NYFA 5JCMA 2O9ZA 4I59A 5KXJA 3P4PA 4NTDA 2FJBA 1VDCA 2VRLA 4PABA 3DH9A 2XLUA 3AYIA 3G5QA 3I3LA 2V5ZA 4K5RA 4NEVA 2YR5A 3AXBA 2F5ZA 2GVCA 3CGBA 1D7LA 3KVEA 2QA2A 4OPDA 1F8WA 2R4EA 4AT0A 1KSUA 2YR6A 3AD8B 4PAAA 1MO9A 1H6VA 2OLOA 2XVEA 4H7UA 4B63A 4A7AA 3GMBA 3NIXA 3UOVA 3BI4A 3F8PA 3GRTA 3T2KA 1XDIA 4EMJA 3KU9A 3PVCA 3ISHA 4ICYA 4C77A 4EM3A 3COXA 2YQUA 5FS7A 1XHCA 3OZ2A 1JU2A 5FS8A 1CC4A 4BURA 2B9YA 2OA1A 1PHHA 1Q1WA 1XPQA 1CJ4A 4CRTA 2YG4A 3NH3X 3HYWA 1CHUA 1DODA 4J56A 1NHQA 3SFEA 1B5QA 2X99A 3L8KA 5KMPA 2BS3A 4UDRA 2XFQA 3C4NA 1D5TA 2C66A 3EANA 3NHOX 1IUTA 3NNEA 3T37A 1B8SA 2WU5A 1GALA 1ZMCA 3QVPA 4OPTA 4Y4NA 3UP4A 4YTPA 2WP9A 4AT2A 5LV9A 3RHAA 4U2LA 4EIPA 3T2ZA 4Z26A 1CC2A 3AEBA 2R0GA 3QVRA 2B7RA 1GPEA 1OJTA 1LJ1A 1H7WA 4EMWA 4KX6A 4EMIA 4H4ZA 3FMWA 4YT0A 1GESA 1GRAA 1IUXA 1BGJA 4BJZA 3L1RA 2V3AA 3S61A 2DKHA 2OALA 2WP5A 2XVIA 4APNA 2A89A 5DBJA 3D1CA 2GR2A 1GRBA 3CNJA 1VRQB 1F8RA 1EL9A 3LZXA 4GR1A 5JCKA 1FEBA 2V61A 4H4SA 3S5WA 1YQ4A 4U8LA 4Z2UA 3B3RA 3H8LA 3IWAA 2YLTA 4EQSA 2WOIA 1REOA 2YWLA 5M10A 1X31B 3FG2P 4G6GA 5KMQA 4JNQA 4CCQA 4C74A 4YTNA 1L9DA 2RGOA 2X50A 1JRXA 2Q0LA 3HYVA 2GMHA 2XLPA 3SZ0A 3V3OA 4EQRA 1GETA 2YG5A 4H2NA 2B76A 3UKPA 1FL2A 3VR9A 3DJGX 5ER0A 3SQPA 2YM2A 4A99A 1ZOVA 4RG3A 1TRBA 2XVHA 4G74A 3AE6A 1V59A 1CJ3A 3O0HA 1NHPA 3ADAB 1D7YA 4GRTA 1CJCA 4YSZA 3P4RA 3SZWA 4YSXA 5KMSA 1QO8A 4B66A 1AOGA 1PJ7A 3AE3A 1Y0PA 3F8RA 2RABA 1FEAA 1FCDA 3FPZA 1QJDA 1TDEA 2APGA 2C73A 3AE1A 3NK0X 4A9WA 1IUSA 4HA6A 4TLXA 3ZDNA 4YTMA 1P2EA 5CKUA 2X8CA 1YKJA 3URHA 2VZ2A 3UKKA 2BS2A 4J31A 4A5LA 3UCLA 3KPKA 3Q6JA 1PJ5A 5C2TA 2GRTA 2HQMA 4H50A 2YG6A 2GQFA 3UTFA 3UTGA 1GRFA 4OPUA 1O95A 1GTEA 2XLTA 2EQ6A 4G9KA
chains in the Genus database with same CATH topology
1KDGA 1E1LA 1H82A 5GRTA 3OC4A 2RGJA 4CBQA 1EL5A 4H2PA 3SGLA 4U8MA 3ATQA 4MJWA 4U8PA 5L46A 4E0VA 3AE5A 1ZOYA 3AB1A 4NZHA 2XVFA 2V3BA 3T31A 2FJDA 1Q9IA 4Z24A 3NLCA 4A6NB 3NTAA 1JRYA 2GR1A 4Z2TA 1PDHA 1S2YA 3UOXA 4C3YA 1H86A 1O94A 3NN6X 3M0OA 4Y4MA 2C64A 4B68A 4H4QA 1N4VA 3SYIA 2IVDA 2AR8A 2BYBA 3CPIG 1ZMDA 5IQ1A 3AD7B 3P1WA 3FBSA 2BCGG 1NAAA 2WDRA 4II2A 1GREA 4O5UA 4JDRA 2YLSA 1N1PA 1F6MA 3NN0X 4G73A 4D03A 1ZY8A 5JCLA 3CPHG 2WU2A 3CN8A 3CNPA 3II4A 1N4WA 2VRMA 4C5OA 1JOAA 2OAMA 3JSKA 4DSGA 2OLNA 2GQWA 4U2TA 5FS9A 3ALMA 2GAHB 2YG3A 3GWFA 4U8IA 1GNDA 5U25A 3UTHA 1L9CA 3P4QA 2IVEA 1BZLA 1DOEA 4LA1A 2R0CA 3HYXA 3LOVA 4KPRA 2YG7A 2BXRA 3F8DA 2AAQA 4DSHA 4YXDA 1W4XA 5KOWA 1S3EA 1PXCA 2WQYA 4ZCCA 1GT8A 4GCMA 5JCNA 1ZP0A 3K7QX 3GMCA 1HYUA 5U63A 1IUUA 4A65A 2RGHA 4H4UA 2VVLA 2JB2A 3WE0A 2XYOA 2WDVA 2C72A 3ZYXA 1LV0A 2B9WA 2YR4A 3CMMA 4OVIA 2YLXA 4Z44A 3GD3A 3DMEA 4JQ9A 3BHKA 3SFDA 1F8SA 2XVJA 2WETA 3ABVA 3RNMA 3NYEA 4H4WA 4GDPA 5TR3A 3ALLA 2BABA 2WBAA 4H4VA 3RP8A 4CNJA 4DGKA 3QSMA 4IA5A 4EQWA 4YSYA 4TM4A 3RP6A 3VR8A 3NK1X 2R45A 4IA6A 1NHSA 3AE8A 5KRQA 3FIMB 4K22A 5KVHA 2GV8A 1E39A 3HZLA 4GDEA 2VVMA 2E1MA 2XCGA 2W0HA 3AEEA 2JB3A 3T2YA 1O5WA 5KVIA 1OJDA 2Q0KA 4OPGA 2JKCA 2WHDA 3UKHA 3UKAA 1BF3A 4EIQA 5J60A 1OJCA 1PBEA 1ZX9A 4K7ZA 2ACZA 1RYIA 1L9EA 1JNRA 1YQ3A 4HB9A 2CFYA 3GSIA 2R9ZA 3KLJA 4YWOA 3DJJA 2V60A 3ICTA 2NVKX 2A87A 2Z5YA 3UKQA 2WPEA 2YLWA 3AEAA 2YM1A 3BNMA 1LVLA 1K0LA 4Z25A 3K7MX 1LQUA 1MXTA 4LU6A 4Y4LA 3RP7A 3IHGA 4FK1C 4DNAA 2GAGB 3VQRA 2PHHA 1EL8A 2Z5XA 4GAVA 3AEFA 2JK6A 3QFAA 5JCIA 3CGDA 2CULA 5BVAA 1E1MA 4U8OA 5IQ4A 1PN0A 3BNUA 3NT6A 4JY2A 2XFUA 1M6IA 4UDPA 3GDNA 4FDCB 3M12A 1PJ6A 1VQWA 1DNCA 2GR3A 3KKJA 2C4CA 3E1TA 2TMDA 3KPFA 4ECHA 1XANA 2BK5A 1NEKA 4H2QA 1D4EA 2EQ7A 2BK4A 4YKGA 1GTHA 3KA7A 2VOUA 2WOWA 4X9MA 4J33A 2V6OA 4XWRA 3T0KA 3I6DA 1TYTA 1Y56B 2VQBA 3IF9A 2C65A 4X4JA 2C3CA 2Y6RA 1IUVA 3B6DA 1VG0A 3ICSA 3NRNA 4C3XA 2ZZCA 3CPJG 1PS9A 3NGCX 3QSEA 1Z6LA 4NTEA 1DOBA 5HHFA 1D4DA 5HY5A 1KFYA 2Y6QA 1E7PA 3D8XA 4LIIA 5HYMA 5KMRA 3R9UA 1PBCA 3DA1A 4K8DA 1P2HA 1S2QA 3GWDA 2NPXA 3G5RA 3K7TA 1B4VA 4UDQA 1GXFA 4RG4A 1TYPA 5CQFA 3GYIA 2YVJA 4YSHA 1ZK7A 2GH5A 1GOSA 1H81A 4B1BA 5EOWA 1K0IA 1PBFA 2J3NA 3AWIA 1ELIA 3ATRA 2WPCA 1GRGA 2B9XA 2Q6UA 5FS6A 3UKFA 3GRSA 3UTEA 1ONFA 2QCUA 1E1NA 1LTXR 4M52A 3T14A 4GAPA 1N4UA 4AP3A 4II3A 4USQA 2BXSA 3AYJA 2GMJA 3H8IA 4K5SA 4A6NA 5C3JA 3CNTA 3REDA 3UOYA 1CJ2A 1DXLA 2QAEA 3GDPA 3CNSA 4K2XA 3DK8A 1IJHA 3CTYA 3ITJA 3VRBA 2BA9A 1KNRA 1IUWA 2Q7VA 3GD4A 2C76A 4TM0A 2WS3A 2X3NA 1RP0A 4BJYA 2ZZBA 2XFOA 4P9SA 3NTDA 3IC9A 2BC0A 5GSNA 4CY8A 1CBOA 4JNAA 5IPYA 1MOKA 1NHRA 2A8XA 3DJDA 4FX9A 4XXGA 1OJAA 1ZKQA 4OCGA 5J7XA 2BS4A 3SX6A 2JBVA 3CNDA 4NWZA 4Z43A 5BULA 2GF3A 3NG7X 3V76A 4A79A 1PBBA 5KNLA 4IVMB 1NPXA 4GF7A 1YY5A 1DJQA 3SY4A 3V3NA 2YVFA 4B64A 3K30A 5KWFA 2TPRA 3UOZA 2E4GA 2C70A 1VG9A 2XLRA 1GERA 4H4XA 4EQXA 4XWZA 1DOCA 1CC6A 3AEDA 3LZWA 4J57A 1NENA 3AD9B 2C3DA 3KD9A 4WX1A 4D04A 3GYXA 1PXAA 2YLRA 4TM1A 1FOHA 2WP6A 4JY3A 1LPFA 4J2WA 1BGNA 5BRTA 1H84A 1M64A 3DGZA 2ZZ0A 5M0ZA 1JEHA 2E5VA 1CL0A 2B7SA 2X8HA 3NK2X 3SZFA 4B67A 3NYCA 1Q1RA 1E6EA 1GEUA 4GUVA 2EQ9A 4OPLA 2WEUA 1JNZA 1TDNA 3P9UA 1EL7A 1K0JA 3QJ4A 4BK2A 3NKSA 1H7XA 5HXIA 2R0PA 4B65A 1F3PA 3CGEA 2VVLG 4TM3A 2C7GA 1BWCA 2H88A 1GSNA 3QFBA 3AYLA 3H4KA 1BKWA 1E1KA 3PS9A 3DGHA 4B69A 1LQTA 2GB0A 3LB8A 4EM4A 1GRHA 4G6HA 5EB4A 2WPFA 1KSSA 1QLBA 1YQZA 2AQJA 1RSGA 2ZBWA 3AE4A 1GRTA 3SM8A 4OPIA 1CF3A 2XLSA 1NG4A 1UKVG 4REKA 4N9XA 3SXIA 3DJEA 4JN9A 4BV6A 2I0ZA 2YVGA 4U8JA 4TLZA 3G5SA 1NG3A 2FJAA 1K4QA 4U8NA 1H83A 4CY6A 4ZN0A 4FK1A 2H89A 2BRYA 2VQ7A 3AECA 2ARDA 1TDFA 2JB1A 4X9NA 1PBDA 1KF6A 3ICRA 2WDQA 3SZCA 4H4PA 2XFPA 3ALJA 5EBKA 2FJEA 1FECA 2DKIA 2XFNA 3LADA 4U8KA 3UP5A 3AE2A 1OJ9A 3BI5A 5U1OA 5FMHA 2C75A 3CIRA 4WCTA 4NEWA 1GV4A 2QA1A 2WESA 2XDOA 4J36A 4BK1A 2BACA 4IVOB 4J34A 3GYJA 3VRAA 4Z2RA 3LXDA 1TDKA 2FBWA 3AE7A 3BI2A 2CDUA 1Y56A 3PO7A 4AP1A 5BUKA 1COYA 4U2SA 3EPTA 3C96A 1PXBA 1S3BA 1L0VA 4AOSA 4BK3A 1D4CA 4O5QA 3CGCA 2GEWA 3C4AA 3UKLA 2R46A 4AOXA 4H4RA 2R4JA 4H2RA 4NTCA 4CCRA 1KNPA 1NDAA 4OPCA 2BRAA 4IV9A 3LJPA 4H4YA 3BHFA 3QSSA 1EBDA 1DJNA 5KOXA 2C67A 3EAOA 4USRA 2CVJA 1SEZA 2PYXA 2IIDA 2YAUA 3IHMA 4ZCDA 3EF6A 1JRZA 4RSLA 5EB5A 2EQ8A 4ADWA 2UZZA 1ZDLA 2X8GA 2YLZA 2JAEA 3P4SA 4UP3A 3Q9TA 4I58A 1B37A 3DK9A 4H4TA 4CNKA 2WOVA 1TDOA 2BCPA 2BK3A 3AEGA 4YKFA 3VRDB 4NNJA 2GR0A 3AE9A 3DK4A 2BC1A 3M13A 3NYFA 5JCMA 2O9ZA 4I59A 5KXJA 3P4PA 4NTDA 2FJBA 1VDCA 2VRLA 4PABA 3DH9A 2XLUA 3AYIA 3G5QA 3I3LA 2V5ZA 4K5RA 4NEVA 2YR5A 3AXBA 2F5ZA 2GVCA 3CGBA 1D7LA 3KVEA 2QA2A 4OPDA 1F8WA 2R4EA 4AT0A 1KSUA 2YR6A 3AD8B 4PAAA 1MO9A 1H6VA 2OLOA 2XVEA 4H7UA 4B63A 4A7AA 3GMBA 3NIXA 3UOVA 3BI4A 3F8PA 3GRTA 3T2KA 1XDIA 4EMJA 3KU9A 3PVCA 3ISHA 4ICYA 4C77A 4EM3A 3COXA 2YQUA 5FS7A 1XHCA 3OZ2A 1JU2A 5FS8A 1CC4A 4BURA 2B9YA 2OA1A 1PHHA 1Q1WA 1XPQA 1CJ4A 4CRTA 2YG4A 3NH3X 3HYWA 1CHUA 1DODA 4J56A 1NHQA 3SFEA 1B5QA 2X99A 3L8KA 5KMPA 2BS3A 4UDRA 2XFQA 3C4NA 1D5TA 2C66A 3EANA 3NHOX 1IUTA 3NNEA 3T37A 1B8SA 2WU5A 1GALA 1ZMCA 3QVPA 4OPTA 4Y4NA 3UP4A 4YTPA 2WP9A 4AT2A 5LV9A 3RHAA 4U2LA 4EIPA 3T2ZA 4Z26A 1CC2A 3AEBA 2R0GA 3QVRA 2B7RA 1GPEA 1OJTA 1LJ1A 1H7WA 4EMWA 4KX6A 4EMIA 4H4ZA 3FMWA 4YT0A 1GESA 1GRAA 1IUXA 1BGJA 4BJZA 3L1RA 2V3AA 3S61A 2DKHA 2OALA 2WP5A 2XVIA 4APNA 2A89A 5DBJA 3D1CA 2GR2A 1GRBA 3CNJA 1VRQB 1F8RA 1EL9A 3LZXA 4GR1A 5JCKA 1FEBA 2V61A 4H4SA 3S5WA 1YQ4A 4U8LA 4Z2UA 3B3RA 3H8LA 3IWAA 2YLTA 4EQSA 2WOIA 1REOA 2YWLA 5M10A 1X31B 3FG2P 4G6GA 5KMQA 4JNQA 4CCQA 4C74A 4YTNA 1L9DA 2RGOA 2X50A 1JRXA 2Q0LA 3HYVA 2GMHA 2XLPA 3SZ0A 3V3OA 4EQRA 1GETA 2YG5A 4H2NA 2B76A 3UKPA 1FL2A 3VR9A 3DJGX 5ER0A 3SQPA 2YM2A 4A99A 1ZOVA 4RG3A 1TRBA 2XVHA 4G74A 3AE6A 1V59A 1CJ3A 3O0HA 1NHPA 3ADAB 1D7YA 4GRTA 1CJCA 4YSZA 3P4RA 3SZWA 4YSXA 5KMSA 1QO8A 4B66A 1AOGA 1PJ7A 3AE3A 1Y0PA 3F8RA 2RABA 1FEAA 1FCDA 3FPZA 1QJDA 1TDEA 2APGA 2C73A 3AE1A 3NK0X 4A9WA 1IUSA 4HA6A 4TLXA 3ZDNA 4YTMA 1P2EA 5CKUA 2X8CA 1YKJA 3URHA 2VZ2A 3UKKA 2BS2A 4J31A 4A5LA 3UCLA 3KPKA 3Q6JA 1PJ5A 5C2TA 2GRTA 2HQMA 4H50A 2YG6A 2GQFA 3UTFA 3UTGA 1GRFA 4OPUA 1O95A 1GTEA 2XLTA 2EQ6A 4G9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDG A;  1E1L A;  1H82 A;  5GRT A;  3OC4 A;  2RGJ A;  4CBQ A;  1EL5 A;  4H2P A;  3SGL A;  4U8M A;  3ATQ A;  4MJW A;  4U8P A;  5L46 A;  4E0V A;  3AE5 A;  1ZOY A;  3AB1 A;  4NZH A;  2XVF A;  2V3B A;  2FJD A;  1Q9I A;  4Z24 A;  3NLC A;  4A6N B;  3NTA A;  1JRY A;  2GR1 A;  4Z2T A;  1PDH A;  1S2Y A;  3UOX A;  4C3Y A;  1H86 A;  1O94 A;  3NN6 X;  3M0O A;  4Y4M A;  2C64 A;  4B68 A;  4H4Q A;  1N4V A;  2IVD A;  2AR8 A;  2BYB A;  3CPI G;  1ZMD A;  5IQ1 A;  3AD7 B;  3P1W A;  3FBS A;  2BCG G;  1NAA A;  2WDR A;  1GRE A;  4O5U A;  4JDR A;  2YLS A;  1N1P A;  1F6M A;  3NN0 X;  4D03 A;  5JCL A;  1ZY8 A;  3CPH G;  2WU2 A;  3CN8 A;  3CNP A;  3II4 A;  1N4W A;  2VRM A;  4C5O A;  1JOA A;  2OAM A;  3JSK A;  4DSG A;  2OLN A;  2GQW A;  4U2T A;  5FS9 A;  3ALM A;  2GAH B;  2YG3 A;  3GWF A;  4U8I A;  1GND A;  5U25 A;  3UTH A;  1L9C A;  3P4Q A;  2IVE A;  1BZL A;  1DOE A;  4LA1 A;  2R0C A;  3LOV A;  4KPR A;  2YG7 A;  2BXR A;  3F8D A;  2AAQ A;  4DSH A;  4YXD A;  1W4X A;  5KOW A;  1S3E A;  1PXC A;  2WQY A;  4ZCC A;  1GT8 A;  4GCM A;  5JCN A;  1ZP0 A;  3K7Q X;  3GMC A;  1HYU A;  5U63 A;  1IUU A;  4A65 A;  2RGH A;  4H4U A;  2VVL A;  2JB2 A;  3WE0 A;  2XYO A;  2WDV A;  2C72 A;  3ZYX A;  1LV0 A;  2B9W A;  2YR4 A;  4OVI A;  2YLX A;  4Z44 A;  3GD3 A;  3DME A;  4JQ9 A;  3BHK A;  3SFD A;  1F8S A;  2XVJ A;  2WET A;  3ABV A;  3RNM A;  3NYE A;  4H4W A;  4GDP A;  5TR3 A;  3ALL A;  2BAB A;  2WBA A;  4H4V A;  3RP8 A;  4CNJ A;  4DGK A;  3QSM A;  4IA5 A;  4EQW A;  4YSY A;  4TM4 A;  3RP6 A;  3VR8 A;  3NK1 X;  2R45 A;  4IA6 A;  1NHS A;  3AE8 A;  5KRQ A;  3FIM B;  4K22 A;  5KVH A;  2GV8 A;  1E39 A;  3HZL A;  4GDE A;  2VVM A;  2E1M A;  2XCG A;  2W0H A;  3AEE A;  2JB3 A;  1O5W A;  5KVI A;  1OJD A;  2Q0K A;  4OPG A;  2JKC A;  2WHD A;  3UKH A;  3UKA A;  1BF3 A;  4EIQ A;  5J60 A;  1OJC A;  1PBE A;  1ZX9 A;  4K7Z A;  2ACZ A;  1RYI A;  1L9E A;  1JNR A;  1YQ3 A;  4HB9 A;  2CFY A;  3GSI A;  2R9Z A;  3KLJ A;  4YWO A;  3DJJ A;  2V60 A;  3ICT A;  2NVK X;  2A87 A;  2Z5Y A;  3UKQ A;  2WPE A;  2YLW A;  3AEA A;  2YM1 A;  3BNM A;  1LVL A;  1K0L A;  4Z25 A;  3K7M X;  1LQU A;  1MXT A;  4LU6 A;  4Y4L A;  3RP7 A;  3IHG A;  4FK1 C;  4DNA A;  2GAG B;  3VQR A;  2PHH A;  1EL8 A;  2Z5X A;  3AEF A;  2JK6 A;  3QFA A;  5JCI A;  3CGD A;  2CUL A;  5BVA A;  1E1M A;  4U8O A;  5IQ4 A;  1PN0 A;  3BNU A;  3NT6 A;  4JY2 A;  2XFU A;  1M6I A;  4UDP A;  3GDN A;  4FDC B;  3M12 A;  1PJ6 A;  1VQW A;  1DNC A;  2GR3 A;  3KKJ A;  3E1T A;  2TMD A;  3KPF A;  4ECH A;  1XAN A;  2BK5 A;  1NEK A;  4H2Q A;  1D4E A;  2EQ7 A;  2BK4 A;  4YKG A;  1GTH A;  3KA7 A;  2VOU A;  2WOW A;  4X9M A;  4J33 A;  2V6O A;  4XWR A;  3I6D A;  1TYT A;  1Y56 B;  2VQB A;  3IF9 A;  2C65 A;  4X4J A;  2C3C A;  2Y6R A;  1IUV A;  3B6D A;  1VG0 A;  3ICS A;  3NRN A;  4C3X A;  2ZZC A;  3CPJ G;  1PS9 A;  3NGC X;  3QSE A;  1Z6L A;  4NTE A;  1DOB A;  5HHF A;  1D4D A;  5HY5 A;  1KFY A;  2Y6Q A;  1E7P A;  3D8X A;  4LII A;  5HYM A;  3R9U A;  1PBC A;  3DA1 A;  4K8D A;  1P2H A;  1S2Q A;  3GWD A;  2NPX A;  3G5R A;  3K7T A;  1B4V A;  4UDQ A;  1GXF A;  4RG4 A;  1TYP A;  5CQF A;  3GYI A;  2YVJ A;  4YSH A;  1ZK7 A;  2GH5 A;  1GOS A;  1H81 A;  4B1B A;  5EOW A;  1K0I A;  1PBF A;  2J3N A;  3AWI A;  1ELI A;  3ATR A;  2WPC A;  1GRG A;  2B9X A;  2Q6U A;  5FS6 A;  3UKF A;  3GRS A;  3UTE A;  1ONF A;  2QCU A;  1E1N A;  1LTX R;  4M52 A;  1N4U A;  4AP3 A;  4USQ A;  2BXS A;  3AYJ A;  2GMJ A;  3H8I A;  4K5S A;  4A6N A;  5C3J A;  3CNT A;  3RED A;  3UOY A;  1CJ2 A;  1DXL A;  2QAE A;  3GDP A;  3CNS A;  4K2X A;  3DK8 A;  1IJH A;  3CTY A;  3ITJ A;  3VRB A;  2BA9 A;  1KNR A;  1IUW A;  2Q7V A;  3GD4 A;  2C76 A;  4TM0 A;  2WS3 A;  2X3N A;  1RP0 A;  4BJY A;  2ZZB A;  2XFO A;  4P9S A;  3NTD A;  3IC9 A;  2BC0 A;  5GSN A;  4CY8 A;  1CBO A;  4JNA A;  5IPY A;  1MOK A;  1NHR A;  2A8X A;  3DJD A;  4FX9 A;  4XXG A;  1OJA A;  1ZKQ A;  4OCG A;  5J7X A;  2BS4 A;  2JBV A;  3CND A;  5BUL A;  4Z43 A;  2GF3 A;  3NG7 X;  3V76 A;  4A79 A;  1PBB A;  4IVM B;  1NPX A;  4GF7 A;  1YY5 A;  1DJQ A;  3V3N A;  2YVF A;  4B64 A;  3K30 A;  5KWF A;  2TPR A;  3UOZ A;  2E4G A;  2C70 A;  1VG9 A;  2XLR A;  1GER A;  4H4X A;  4EQX A;  4XWZ A;  1DOC A;  1CC6 A;  3AED A;  3LZW A;  4J57 A;  1NEN A;  3AD9 B;  2C3D A;  3KD9 A;  4WX1 A;  4D04 A;  1PXA A;  2YLR A;  4TM1 A;  1FOH A;  2WP6 A;  4JY3 A;  1LPF A;  4J2W A;  1BGN A;  5BRT A;  1H84 A;  1M64 A;  3DGZ A;  2ZZ0 A;  5M0Z A;  1JEH A;  2E5V A;  1CL0 A;  2B7S A;  2X8H A;  3NK2 X;  4B67 A;  3NYC A;  1Q1R A;  1E6E A;  1GEU A;  4GUV A;  2EQ9 A;  4OPL A;  2WEU A;  1JNZ A;  1TDN A;  3P9U A;  1EL7 A;  1K0J A;  3QJ4 A;  4BK2 A;  3NKS A;  1H7X A;  5HXI A;  2R0P A;  4B65 A;  1F3P A;  3CGE A;  2VVL G;  4TM3 A;  2C7G A;  1BWC A;  2H88 A;  1GSN A;  3QFB A;  3AYL A;  3H4K A;  1BKW A;  1E1K A;  3PS9 A;  3DGH A;  4B69 A;  1LQT A;  2GB0 A;  3LB8 A;  4EM4 A;  1GRH A;  5EB4 A;  2WPF A;  1KSS A;  1QLB A;  1YQZ A;  2AQJ A;  1RSG A;  2ZBW A;  3AE4 A;  1GRT A;  3SM8 A;  4OPI A;  1CF3 A;  2XLS A;  1NG4 A;  1UKV G;  4REK A;  4N9X A;  3DJE A;  4JN9 A;  4BV6 A;  2I0Z A;  2YVG A;  4U8J A;  4TLZ A;  3G5S A;  1NG3 A;  2FJA A;  1K4Q A;  4U8N A;  1H83 A;  4CY6 A;  4ZN0 A;  4FK1 A;  2H89 A;  2VQ7 A;  3AEC A;  2ARD A;  1TDF A;  2JB1 A;  4X9N A;  1PBD A;  1KF6 A;  3ICR A;  2WDQ A;  4H4P A;  2XFP A;  3ALJ A;  5EBK A;  2FJE A;  1FEC A;  2DKI A;  2XFN A;  3LAD A;  4U8K A;  3UP5 A;  3AE2 A;  1OJ9 A;  3BI5 A;  5U1O A;  5FMH A;  2C75 A;  3CIR A;  4WCT A;  4NEW A;  1GV4 A;  2QA1 A;  2WES A;  2XDO A;  4J36 A;  4BK1 A;  2BAC A;  4IVO B;  4J34 A;  3GYJ A;  3VRA A;  4Z2R A;  3LXD A;  1TDK A;  2FBW A;  3AE7 A;  3BI2 A;  2CDU A;  1Y56 A;  3PO7 A;  4AP1 A;  5BUK A;  1COY A;  4U2S A;  3EPT A;  3C96 A;  1PXB A;  1S3B A;  1L0V A;  4AOS A;  4BK3 A;  1D4C A;  4O5Q A;  3CGC A;  2GEW A;  3C4A A;  3UKL A;  2R46 A;  4AOX A;  4H4R A;  2R4J A;  4H2R A;  4NTC A;  4CCR A;  1KNP A;  1NDA A;  4OPC A;  4IV9 A;  3LJP A;  4H4Y A;  3BHF A;  3QSS A;  1EBD A;  1DJN A;  5KOX A;  2C67 A;  3EAO A;  4USR A;  2CVJ A;  1SEZ A;  2PYX A;  2IID A;  2YAU A;  3IHM A;  4ZCD A;  3EF6 A;  1JRZ A;  4RSL A;  5EB5 A;  2EQ8 A;  4ADW A;  2UZZ A;  1ZDL A;  2X8G A;  2YLZ A;  2JAE A;  3P4S A;  4UP3 A;  3Q9T A;  4I58 A;  1B37 A;  3DK9 A;  4H4T A;  4CNK A;  2WOV A;  1TDO A;  2BCP A;  2BK3 A;  3AEG A;  4YKF A;  3VRD B;  2GR0 A;  3AE9 A;  3DK4 A;  2BC1 A;  3M13 A;  3NYF A;  5JCM A;  2O9Z A;  4I59 A;  5KXJ A;  3P4P A;  4NTD A;  2FJB A;  1VDC A;  2VRL A;  4PAB A;  3DH9 A;  2XLU A;  3AYI A;  3G5Q A;  3I3L A;  2V5Z A;  4K5R A;  4NEV A;  2YR5 A;  3AXB A;  2F5Z A;  2GVC A;  3CGB A;  1D7L A;  3KVE A;  2QA2 A;  4OPD A;  1F8W A;  2R4E A;  4AT0 A;  1KSU A;  2YR6 A;  3AD8 B;  4PAA A;  1MO9 A;  1H6V A;  2OLO A;  2XVE A;  4H7U A;  4B63 A;  4A7A A;  3GMB A;  3NIX A;  3UOV A;  3BI4 A;  3F8P A;  3GRT A;  1XDI A;  4EMJ A;  3KU9 A;  3PVC A;  3ISH A;  4ICY A;  4C77 A;  4EM3 A;  3COX A;  2YQU A;  5FS7 A;  1XHC A;  3OZ2 A;  1JU2 A;  5FS8 A;  1CC4 A;  4BUR A;  2B9Y A;  2OA1 A;  1PHH A;  1Q1W A;  1XPQ A;  1CJ4 A;  4CRT A;  2YG4 A;  3NH3 X;  1CHU A;  1DOD A;  4J56 A;  1NHQ A;  3SFE A;  1B5Q A;  2X99 A;  3L8K A;  2BS3 A;  4UDR A;  2XFQ A;  3C4N A;  1D5T A;  2C66 A;  3EAN A;  3NHO X;  1IUT A;  3NNE A;  3T37 A;  1B8S A;  2WU5 A;  1GAL A;  1ZMC A;  3QVP A;  4OPT A;  4Y4N A;  3UP4 A;  4YTP A;  2WP9 A;  4AT2 A;  5LV9 A;  3RHA A;  4U2L A;  4EIP A;  4Z26 A;  1CC2 A;  3AEB A;  2R0G A;  3QVR A;  2B7R A;  1GPE A;  1OJT A;  1LJ1 A;  1H7W A;  4EMW A;  4KX6 A;  4EMI A;  4H4Z A;  3FMW A;  4YT0 A;  1GES A;  1GRA A;  1IUX A;  1BGJ A;  4BJZ A;  3L1R A;  2V3A A;  3S61 A;  2DKH A;  2OAL A;  2WP5 A;  2XVI A;  4APN A;  2A89 A;  5DBJ A;  3D1C A;  2GR2 A;  1GRB A;  3CNJ A;  1VRQ B;  1F8R A;  1EL9 A;  3LZX A;  4GR1 A;  5JCK A;  1FEB A;  2V61 A;  4H4S A;  3S5W A;  1YQ4 A;  4U8L A;  4Z2U A;  3B3R A;  3H8L A;  3IWA A;  2YLT A;  4EQS A;  2WOI A;  1REO A;  2YWL A;  5M10 A;  1X31 B;  3FG2 P;  4CCQ A;  4C74 A;  4JNQ A;  4YTN A;  1L9D A;  2RGO A;  2X50 A;  1JRX A;  2Q0L A;  2GMH A;  2XLP A;  3V3O A;  4EQR A;  1GET A;  2YG5 A;  4H2N A;  2B76 A;  3UKP A;  1FL2 A;  3VR9 A;  3DJG X;  5ER0 A;  3SQP A;  2YM2 A;  4A99 A;  1ZOV A;  4RG3 A;  1TRB A;  2XVH A;  3AE6 A;  1V59 A;  1CJ3 A;  3O0H A;  1NHP A;  3ADA B;  1D7Y A;  4GRT A;  1CJC A;  4YSZ A;  3P4R A;  4YSX A;  1QO8 A;  4B66 A;  1AOG A;  1PJ7 A;  3AE3 A;  1Y0P A;  3F8R A;  2RAB A;  1FEA A;  1FCD A;  3FPZ A;  1QJD A;  1TDE A;  2APG A;  2C73 A;  3AE1 A;  3NK0 X;  4A9W A;  1IUS A;  4HA6 A;  4TLX A;  3ZDN A;  4YTM A;  1P2E A;  5CKU A;  2X8C A;  1YKJ A;  3URH A;  2VZ2 A;  3UKK A;  2BS2 A;  4J31 A;  4A5L A;  3UCL A;  3Q6J A;  1PJ5 A;  5C2T A;  2GRT A;  2HQM A;  4H50 A;  2YG6 A;  2GQF A;  3UTF A;  3UTG A;  1GRF A;  4OPU A;  1O95 A;  1GTE A;  2XLT A;  2EQ6 A; 
#chains in the Genus database with same CATH topology
 1KDG A;  1E1L A;  1H82 A;  5GRT A;  3OC4 A;  2RGJ A;  4CBQ A;  1EL5 A;  4H2P A;  3SGL A;  4U8M A;  3ATQ A;  4MJW A;  4U8P A;  5L46 A;  4E0V A;  3AE5 A;  1ZOY A;  3AB1 A;  4NZH A;  2XVF A;  2V3B A;  3T31 A;  2FJD A;  1Q9I A;  4Z24 A;  3NLC A;  4A6N B;  3NTA A;  1JRY A;  2GR1 A;  4Z2T A;  1PDH A;  1S2Y A;  3UOX A;  4C3Y A;  1H86 A;  1O94 A;  3NN6 X;  3M0O A;  4Y4M A;  2C64 A;  4B68 A;  4H4Q A;  1N4V A;  3SYI A;  2IVD A;  2AR8 A;  2BYB A;  3CPI G;  1ZMD A;  5IQ1 A;  3AD7 B;  3P1W A;  3FBS A;  2BCG G;  1NAA A;  2WDR A;  4II2 A;  1GRE A;  4O5U A;  4JDR A;  2YLS A;  1N1P A;  1F6M A;  3NN0 X;  4G73 A;  4D03 A;  1ZY8 A;  5JCL A;  3CPH G;  2WU2 A;  3CN8 A;  3CNP A;  3II4 A;  1N4W A;  2VRM A;  4C5O A;  1JOA A;  2OAM A;  3JSK A;  4DSG A;  2OLN A;  2GQW A;  4U2T A;  5FS9 A;  3ALM A;  2GAH B;  2YG3 A;  3GWF A;  4U8I A;  1GND A;  5U25 A;  3UTH A;  1L9C A;  3P4Q A;  2IVE A;  1BZL A;  1DOE A;  4LA1 A;  2R0C A;  3HYX A;  3LOV A;  4KPR A;  2YG7 A;  2BXR A;  3F8D A;  2AAQ A;  4DSH A;  4YXD A;  1W4X A;  5KOW A;  1S3E A;  1PXC A;  2WQY A;  4ZCC A;  1GT8 A;  4GCM A;  5JCN A;  1ZP0 A;  3K7Q X;  3GMC A;  1HYU A;  5U63 A;  1IUU A;  4A65 A;  2RGH A;  4H4U A;  2VVL A;  2JB2 A;  3WE0 A;  2XYO A;  2WDV A;  2C72 A;  3ZYX A;  1LV0 A;  2B9W A;  2YR4 A;  3CMM A;  4OVI A;  2YLX A;  4Z44 A;  3GD3 A;  3DME A;  4JQ9 A;  3BHK A;  3SFD A;  1F8S A;  2XVJ A;  2WET A;  3ABV A;  3RNM A;  3NYE A;  4H4W A;  4GDP A;  5TR3 A;  3ALL A;  2BAB A;  2WBA A;  4H4V A;  3RP8 A;  4CNJ A;  4DGK A;  3QSM A;  4IA5 A;  4EQW A;  4YSY A;  4TM4 A;  3RP6 A;  3VR8 A;  3NK1 X;  2R45 A;  4IA6 A;  1NHS A;  3AE8 A;  5KRQ A;  3FIM B;  4K22 A;  5KVH A;  2GV8 A;  1E39 A;  3HZL A;  4GDE A;  2VVM A;  2E1M A;  2XCG A;  2W0H A;  3AEE A;  2JB3 A;  3T2Y A;  1O5W A;  5KVI A;  1OJD A;  2Q0K A;  4OPG A;  2JKC A;  2WHD A;  3UKH A;  3UKA A;  1BF3 A;  4EIQ A;  5J60 A;  1OJC A;  1PBE A;  1ZX9 A;  4K7Z A;  2ACZ A;  1RYI A;  1L9E A;  1JNR A;  1YQ3 A;  4HB9 A;  2CFY A;  3GSI A;  2R9Z A;  3KLJ A;  4YWO A;  3DJJ A;  2V60 A;  3ICT A;  2NVK X;  2A87 A;  2Z5Y A;  3UKQ A;  2WPE A;  2YLW A;  3AEA A;  2YM1 A;  3BNM A;  1LVL A;  1K0L A;  4Z25 A;  3K7M X;  1LQU A;  1MXT A;  4LU6 A;  4Y4L A;  3RP7 A;  3IHG A;  4FK1 C;  4DNA A;  2GAG B;  3VQR A;  2PHH A;  1EL8 A;  2Z5X A;  4GAV A;  3AEF A;  2JK6 A;  3QFA A;  5JCI A;  3CGD A;  2CUL A;  5BVA A;  1E1M A;  4U8O A;  5IQ4 A;  1PN0 A;  3BNU A;  3NT6 A;  4JY2 A;  2XFU A;  1M6I A;  4UDP A;  3GDN A;  4FDC B;  3M12 A;  1PJ6 A;  1VQW A;  1DNC A;  2GR3 A;  3KKJ A;  2C4C A;  3E1T A;  2TMD A;  3KPF A;  4ECH A;  1XAN A;  2BK5 A;  1NEK A;  4H2Q A;  1D4E A;  2EQ7 A;  2BK4 A;  4YKG A;  1GTH A;  3KA7 A;  2VOU A;  2WOW A;  4X9M A;  4J33 A;  2V6O A;  4XWR A;  3T0K A;  3I6D A;  1TYT A;  1Y56 B;  2VQB A;  3IF9 A;  2C65 A;  4X4J A;  2C3C A;  2Y6R A;  1IUV A;  3B6D A;  1VG0 A;  3ICS A;  3NRN A;  4C3X A;  2ZZC A;  3CPJ G;  1PS9 A;  3NGC X;  3QSE A;  1Z6L A;  4NTE A;  1DOB A;  5HHF A;  1D4D A;  5HY5 A;  1KFY A;  2Y6Q A;  1E7P A;  3D8X A;  4LII A;  5HYM A;  5KMR A;  3R9U A;  1PBC A;  3DA1 A;  4K8D A;  1P2H A;  1S2Q A;  3GWD A;  2NPX A;  3G5R A;  3K7T A;  1B4V A;  4UDQ A;  1GXF A;  4RG4 A;  1TYP A;  5CQF A;  3GYI A;  2YVJ A;  4YSH A;  1ZK7 A;  2GH5 A;  1GOS A;  1H81 A;  4B1B A;  5EOW A;  1K0I A;  1PBF A;  2J3N A;  3AWI A;  1ELI A;  3ATR A;  2WPC A;  1GRG A;  2B9X A;  2Q6U A;  5FS6 A;  3UKF A;  3GRS A;  3UTE A;  1ONF A;  2QCU A;  1E1N A;  1LTX R;  4M52 A;  3T14 A;  4GAP A;  1N4U A;  4AP3 A;  4II3 A;  4USQ A;  2BXS A;  3AYJ A;  2GMJ A;  3H8I A;  4K5S A;  4A6N A;  5C3J A;  3CNT A;  3RED A;  3UOY A;  1CJ2 A;  1DXL A;  2QAE A;  3GDP A;  3CNS A;  4K2X A;  3DK8 A;  1IJH A;  3CTY A;  3ITJ A;  3VRB A;  2BA9 A;  1KNR A;  1IUW A;  2Q7V A;  3GD4 A;  2C76 A;  4TM0 A;  2WS3 A;  2X3N A;  1RP0 A;  4BJY A;  2ZZB A;  2XFO A;  4P9S A;  3NTD A;  3IC9 A;  2BC0 A;  5GSN A;  4CY8 A;  1CBO A;  4JNA A;  5IPY A;  1MOK A;  1NHR A;  2A8X A;  3DJD A;  4FX9 A;  4XXG A;  1OJA A;  1ZKQ A;  4OCG A;  5J7X A;  2BS4 A;  3SX6 A;  2JBV A;  3CND A;  4NWZ A;  4Z43 A;  5BUL A;  2GF3 A;  3NG7 X;  3V76 A;  4A79 A;  1PBB A;  5KNL A;  4IVM B;  1NPX A;  4GF7 A;  1YY5 A;  1DJQ A;  3SY4 A;  3V3N A;  2YVF A;  4B64 A;  3K30 A;  5KWF A;  2TPR A;  3UOZ A;  2E4G A;  2C70 A;  1VG9 A;  2XLR A;  1GER A;  4H4X A;  4EQX A;  4XWZ A;  1DOC A;  1CC6 A;  3AED A;  3LZW A;  4J57 A;  1NEN A;  3AD9 B;  2C3D A;  3KD9 A;  4WX1 A;  4D04 A;  3GYX A;  1PXA A;  2YLR A;  4TM1 A;  1FOH A;  2WP6 A;  4JY3 A;  1LPF A;  4J2W A;  1BGN A;  5BRT A;  1H84 A;  1M64 A;  3DGZ A;  2ZZ0 A;  5M0Z A;  1JEH A;  2E5V A;  1CL0 A;  2B7S A;  2X8H A;  3NK2 X;  3SZF A;  4B67 A;  3NYC A;  1Q1R A;  1E6E A;  1GEU A;  4GUV A;  2EQ9 A;  4OPL A;  2WEU A;  1JNZ A;  1TDN A;  3P9U A;  1EL7 A;  1K0J A;  3QJ4 A;  4BK2 A;  3NKS A;  1H7X A;  5HXI A;  2R0P A;  4B65 A;  1F3P A;  3CGE A;  2VVL G;  4TM3 A;  2C7G A;  1BWC A;  2H88 A;  1GSN A;  3QFB A;  3AYL A;  3H4K A;  1BKW A;  1E1K A;  3PS9 A;  3DGH A;  4B69 A;  1LQT A;  2GB0 A;  3LB8 A;  4EM4 A;  1GRH A;  4G6H A;  5EB4 A;  2WPF A;  1KSS A;  1QLB A;  1YQZ A;  2AQJ A;  1RSG A;  2ZBW A;  3AE4 A;  1GRT A;  3SM8 A;  4OPI A;  1CF3 A;  2XLS A;  1NG4 A;  1UKV G;  4REK A;  4N9X A;  3SXI A;  3DJE A;  4JN9 A;  4BV6 A;  2I0Z A;  2YVG A;  4U8J A;  4TLZ A;  3G5S A;  1NG3 A;  2FJA A;  1K4Q A;  4U8N A;  1H83 A;  4CY6 A;  4ZN0 A;  4FK1 A;  2H89 A;  2BRY A;  2VQ7 A;  3AEC A;  2ARD A;  1TDF A;  2JB1 A;  4X9N A;  1PBD A;  1KF6 A;  3ICR A;  2WDQ A;  3SZC A;  4H4P A;  2XFP A;  3ALJ A;  5EBK A;  2FJE A;  1FEC A;  2DKI A;  2XFN A;  3LAD A;  4U8K A;  3UP5 A;  3AE2 A;  1OJ9 A;  3BI5 A;  5U1O A;  5FMH A;  2C75 A;  3CIR A;  4WCT A;  4NEW A;  1GV4 A;  2QA1 A;  2WES A;  2XDO A;  4J36 A;  4BK1 A;  2BAC A;  4IVO B;  4J34 A;  3GYJ A;  3VRA A;  4Z2R A;  3LXD A;  1TDK A;  2FBW A;  3AE7 A;  3BI2 A;  2CDU A;  1Y56 A;  3PO7 A;  4AP1 A;  5BUK A;  1COY A;  4U2S A;  3EPT A;  3C96 A;  1PXB A;  1S3B A;  1L0V A;  4AOS A;  4BK3 A;  1D4C A;  4O5Q A;  3CGC A;  2GEW A;  3C4A A;  3UKL A;  2R46 A;  4AOX A;  4H4R A;  2R4J A;  4H2R A;  4NTC A;  4CCR A;  1KNP A;  1NDA A;  4OPC A;  2BRA A;  4IV9 A;  3LJP A;  4H4Y A;  3BHF A;  3QSS A;  1EBD A;  1DJN A;  5KOX A;  2C67 A;  3EAO A;  4USR A;  2CVJ A;  1SEZ A;  2PYX A;  2IID A;  2YAU A;  3IHM A;  4ZCD A;  3EF6 A;  1JRZ A;  4RSL A;  5EB5 A;  2EQ8 A;  4ADW A;  2UZZ A;  1ZDL A;  2X8G A;  2YLZ A;  2JAE A;  3P4S A;  4UP3 A;  3Q9T A;  4I58 A;  1B37 A;  3DK9 A;  4H4T A;  4CNK A;  2WOV A;  1TDO A;  2BCP A;  2BK3 A;  3AEG A;  4YKF A;  3VRD B;  4NNJ A;  2GR0 A;  3AE9 A;  3DK4 A;  2BC1 A;  3M13 A;  3NYF A;  5JCM A;  2O9Z A;  4I59 A;  5KXJ A;  3P4P A;  4NTD A;  2FJB A;  1VDC A;  2VRL A;  4PAB A;  3DH9 A;  2XLU A;  3AYI A;  3G5Q A;  3I3L A;  2V5Z A;  4K5R A;  4NEV A;  2YR5 A;  3AXB A;  2F5Z A;  2GVC A;  3CGB A;  1D7L A;  3KVE A;  2QA2 A;  4OPD A;  1F8W A;  2R4E A;  4AT0 A;  1KSU A;  2YR6 A;  3AD8 B;  4PAA A;  1MO9 A;  1H6V A;  2OLO A;  2XVE A;  4H7U A;  4B63 A;  4A7A A;  3GMB A;  3NIX A;  3UOV A;  3BI4 A;  3F8P A;  3GRT A;  3T2K A;  1XDI A;  4EMJ A;  3KU9 A;  3PVC A;  3ISH A;  4ICY A;  4C77 A;  4EM3 A;  3COX A;  2YQU A;  5FS7 A;  1XHC A;  3OZ2 A;  1JU2 A;  5FS8 A;  1CC4 A;  4BUR A;  2B9Y A;  2OA1 A;  1PHH A;  1Q1W A;  1XPQ A;  1CJ4 A;  4CRT A;  2YG4 A;  3NH3 X;  3HYW A;  1CHU A;  1DOD A;  4J56 A;  1NHQ A;  3SFE A;  1B5Q A;  2X99 A;  3L8K A;  5KMP A;  2BS3 A;  4UDR A;  2XFQ A;  3C4N A;  1D5T A;  2C66 A;  3EAN A;  3NHO X;  1IUT A;  3NNE A;  3T37 A;  1B8S A;  2WU5 A;  1GAL A;  1ZMC A;  3QVP A;  4OPT A;  4Y4N A;  3UP4 A;  4YTP A;  2WP9 A;  4AT2 A;  5LV9 A;  3RHA A;  4U2L A;  4EIP A;  3T2Z A;  4Z26 A;  1CC2 A;  3AEB A;  2R0G A;  3QVR A;  2B7R A;  1GPE A;  1OJT A;  1LJ1 A;  1H7W A;  4EMW A;  4KX6 A;  4EMI A;  4H4Z A;  3FMW A;  4YT0 A;  1GES A;  1GRA A;  1IUX A;  1BGJ A;  4BJZ A;  3L1R A;  2V3A A;  3S61 A;  2DKH A;  2OAL A;  2WP5 A;  2XVI A;  4APN A;  2A89 A;  5DBJ A;  3D1C A;  2GR2 A;  1GRB A;  3CNJ A;  1VRQ B;  1F8R A;  1EL9 A;  3LZX A;  4GR1 A;  5JCK A;  1FEB A;  2V61 A;  4H4S A;  3S5W A;  1YQ4 A;  4U8L A;  4Z2U A;  3B3R A;  3H8L A;  3IWA A;  2YLT A;  4EQS A;  2WOI A;  1REO A;  2YWL A;  5M10 A;  1X31 B;  3FG2 P;  4G6G A;  5KMQ A;  4JNQ A;  4CCQ A;  4C74 A;  4YTN A;  1L9D A;  2RGO A;  2X50 A;  1JRX A;  2Q0L A;  3HYV A;  2GMH A;  2XLP A;  3SZ0 A;  3V3O A;  4EQR A;  1GET A;  2YG5 A;  4H2N A;  2B76 A;  3UKP A;  1FL2 A;  3VR9 A;  3DJG X;  5ER0 A;  3SQP A;  2YM2 A;  4A99 A;  1ZOV A;  4RG3 A;  1TRB A;  2XVH A;  4G74 A;  3AE6 A;  1V59 A;  1CJ3 A;  3O0H A;  1NHP A;  3ADA B;  1D7Y A;  4GRT A;  1CJC A;  4YSZ A;  3P4R A;  3SZW A;  4YSX A;  5KMS A;  1QO8 A;  4B66 A;  1AOG A;  1PJ7 A;  3AE3 A;  1Y0P A;  3F8R A;  2RAB A;  1FEA A;  1FCD A;  3FPZ A;  1QJD A;  1TDE A;  2APG A;  2C73 A;  3AE1 A;  3NK0 X;  4A9W A;  1IUS A;  4HA6 A;  4TLX A;  3ZDN A;  4YTM A;  1P2E A;  5CKU A;  2X8C A;  1YKJ A;  3URH A;  2VZ2 A;  3UKK A;  2BS2 A;  4J31 A;  4A5L A;  3UCL A;  3KPK A;  3Q6J A;  1PJ5 A;  5C2T A;  2GRT A;  2HQM A;  4H50 A;  2YG6 A;  2GQF A;  3UTF A;  3UTG A;  1GRF A;  4OPU A;  1O95 A;  1GTE A;  2XLT A;  2EQ6 A;  4G9K A; 
#chains in the Genus database with same CATH homology
 1KDG A;  1E1L A;  1H82 A;  5GRT A;  3OC4 A;  2RGJ A;  4CBQ A;  1EL5 A;  4H2P A;  3SGL A;  4U8M A;  3ATQ A;  4MJW A;  4U8P A;  5L46 A;  4E0V A;  3AE5 A;  1ZOY A;  3AB1 A;  4NZH A;  2XVF A;  2V3B A;  3T31 A;  2FJD A;  1Q9I A;  4Z24 A;  3NLC A;  4A6N B;  3NTA A;  1JRY A;  2GR1 A;  4Z2T A;  1PDH A;  1S2Y A;  3UOX A;  4C3Y A;  1H86 A;  1O94 A;  3NN6 X;  3M0O A;  4Y4M A;  2C64 A;  4B68 A;  4H4Q A;  1N4V A;  3SYI A;  2IVD A;  2AR8 A;  2BYB A;  3CPI G;  1ZMD A;  5IQ1 A;  3AD7 B;  3P1W A;  3FBS A;  2BCG G;  1NAA A;  2WDR A;  4II2 A;  1GRE A;  4O5U A;  4JDR A;  2YLS A;  1N1P A;  1F6M A;  3NN0 X;  4G73 A;  4D03 A;  1ZY8 A;  5JCL A;  3CPH G;  2WU2 A;  3CN8 A;  3CNP A;  3II4 A;  1N4W A;  2VRM A;  4C5O A;  1JOA A;  2OAM A;  3JSK A;  4DSG A;  2OLN A;  2GQW A;  4U2T A;  5FS9 A;  3ALM A;  2GAH B;  2YG3 A;  3GWF A;  4U8I A;  1GND A;  5U25 A;  3UTH A;  1L9C A;  3P4Q A;  2IVE A;  1BZL A;  1DOE A;  4LA1 A;  2R0C A;  3HYX A;  3LOV A;  4KPR A;  2YG7 A;  2BXR A;  3F8D A;  2AAQ A;  4DSH A;  4YXD A;  1W4X A;  5KOW A;  1S3E A;  1PXC A;  2WQY A;  4ZCC A;  1GT8 A;  4GCM A;  5JCN A;  1ZP0 A;  3K7Q X;  3GMC A;  1HYU A;  5U63 A;  1IUU A;  4A65 A;  2RGH A;  4H4U A;  2VVL A;  2JB2 A;  3WE0 A;  2XYO A;  2WDV A;  2C72 A;  3ZYX A;  1LV0 A;  2B9W A;  2YR4 A;  3CMM A;  4OVI A;  2YLX A;  4Z44 A;  3GD3 A;  3DME A;  4JQ9 A;  3BHK A;  3SFD A;  1F8S A;  2XVJ A;  2WET A;  3ABV A;  3RNM A;  3NYE A;  4H4W A;  4GDP A;  5TR3 A;  3ALL A;  2BAB A;  2WBA A;  4H4V A;  3RP8 A;  4CNJ A;  4DGK A;  3QSM A;  4IA5 A;  4EQW A;  4YSY A;  4TM4 A;  3RP6 A;  3VR8 A;  3NK1 X;  2R45 A;  4IA6 A;  1NHS A;  3AE8 A;  5KRQ A;  3FIM B;  4K22 A;  5KVH A;  2GV8 A;  1E39 A;  3HZL A;  4GDE A;  2VVM A;  2E1M A;  2XCG A;  2W0H A;  3AEE A;  2JB3 A;  3T2Y A;  1O5W A;  5KVI A;  1OJD A;  2Q0K A;  4OPG A;  2JKC A;  2WHD A;  3UKH A;  3UKA A;  1BF3 A;  4EIQ A;  5J60 A;  1OJC A;  1PBE A;  1ZX9 A;  4K7Z A;  2ACZ A;  1RYI A;  1L9E A;  1JNR A;  1YQ3 A;  4HB9 A;  2CFY A;  3GSI A;  2R9Z A;  3KLJ A;  4YWO A;  3DJJ A;  2V60 A;  3ICT A;  2NVK X;  2A87 A;  2Z5Y A;  3UKQ A;  2WPE A;  2YLW A;  3AEA A;  2YM1 A;  3BNM A;  1LVL A;  1K0L A;  4Z25 A;  3K7M X;  1LQU A;  1MXT A;  4LU6 A;  4Y4L A;  3RP7 A;  3IHG A;  4FK1 C;  4DNA A;  2GAG B;  3VQR A;  2PHH A;  1EL8 A;  2Z5X A;  4GAV A;  3AEF A;  2JK6 A;  3QFA A;  5JCI A;  3CGD A;  2CUL A;  5BVA A;  1E1M A;  4U8O A;  5IQ4 A;  1PN0 A;  3BNU A;  3NT6 A;  4JY2 A;  2XFU A;  1M6I A;  4UDP A;  3GDN A;  4FDC B;  3M12 A;  1PJ6 A;  1VQW A;  1DNC A;  2GR3 A;  3KKJ A;  2C4C A;  3E1T A;  2TMD A;  3KPF A;  4ECH A;  1XAN A;  2BK5 A;  1NEK A;  4H2Q A;  1D4E A;  2EQ7 A;  2BK4 A;  4YKG A;  1GTH A;  3KA7 A;  2VOU A;  2WOW A;  4X9M A;  4J33 A;  2V6O A;  4XWR A;  3T0K A;  3I6D A;  1TYT A;  1Y56 B;  2VQB A;  3IF9 A;  2C65 A;  4X4J A;  2C3C A;  2Y6R A;  1IUV A;  3B6D A;  1VG0 A;  3ICS A;  3NRN A;  4C3X A;  2ZZC A;  3CPJ G;  1PS9 A;  3NGC X;  3QSE A;  1Z6L A;  4NTE A;  1DOB A;  5HHF A;  1D4D A;  5HY5 A;  1KFY A;  2Y6Q A;  1E7P A;  3D8X A;  4LII A;  5HYM A;  5KMR A;  3R9U A;  1PBC A;  3DA1 A;  4K8D A;  1P2H A;  1S2Q A;  3GWD A;  2NPX A;  3G5R A;  3K7T A;  1B4V A;  4UDQ A;  1GXF A;  4RG4 A;  1TYP A;  5CQF A;  3GYI A;  2YVJ A;  4YSH A;  1ZK7 A;  2GH5 A;  1GOS A;  1H81 A;  4B1B A;  5EOW A;  1K0I A;  1PBF A;  2J3N A;  3AWI A;  1ELI A;  3ATR A;  2WPC A;  1GRG A;  2B9X A;  2Q6U A;  5FS6 A;  3UKF A;  3GRS A;  3UTE A;  1ONF A;  2QCU A;  1E1N A;  1LTX R;  4M52 A;  3T14 A;  4GAP A;  1N4U A;  4AP3 A;  4II3 A;  4USQ A;  2BXS A;  3AYJ A;  2GMJ A;  3H8I A;  4K5S A;  4A6N A;  5C3J A;  3CNT A;  3RED A;  3UOY A;  1CJ2 A;  1DXL A;  2QAE A;  3GDP A;  3CNS A;  4K2X A;  3DK8 A;  1IJH A;  3CTY A;  3ITJ A;  3VRB A;  2BA9 A;  1KNR A;  1IUW A;  2Q7V A;  3GD4 A;  2C76 A;  4TM0 A;  2WS3 A;  2X3N A;  1RP0 A;  4BJY A;  2ZZB A;  2XFO A;  4P9S A;  3NTD A;  3IC9 A;  2BC0 A;  5GSN A;  4CY8 A;  1CBO A;  4JNA A;  5IPY A;  1MOK A;  1NHR A;  2A8X A;  3DJD A;  4FX9 A;  4XXG A;  1OJA A;  1ZKQ A;  4OCG A;  5J7X A;  2BS4 A;  3SX6 A;  2JBV A;  3CND A;  4NWZ A;  4Z43 A;  5BUL A;  2GF3 A;  3NG7 X;  3V76 A;  4A79 A;  1PBB A;  5KNL A;  4IVM B;  1NPX A;  4GF7 A;  1YY5 A;  1DJQ A;  3SY4 A;  3V3N A;  2YVF A;  4B64 A;  3K30 A;  5KWF A;  2TPR A;  3UOZ A;  2E4G A;  2C70 A;  1VG9 A;  2XLR A;  1GER A;  4H4X A;  4EQX A;  4XWZ A;  1DOC A;  1CC6 A;  3AED A;  3LZW A;  4J57 A;  1NEN A;  3AD9 B;  2C3D A;  3KD9 A;  4WX1 A;  4D04 A;  3GYX A;  1PXA A;  2YLR A;  4TM1 A;  1FOH A;  2WP6 A;  4JY3 A;  1LPF A;  4J2W A;  1BGN A;  5BRT A;  1H84 A;  1M64 A;  3DGZ A;  2ZZ0 A;  5M0Z A;  1JEH A;  2E5V A;  1CL0 A;  2B7S A;  2X8H A;  3NK2 X;  3SZF A;  4B67 A;  3NYC A;  1Q1R A;  1E6E A;  1GEU A;  4GUV A;  2EQ9 A;  4OPL A;  2WEU A;  1JNZ A;  1TDN A;  3P9U A;  1EL7 A;  1K0J A;  3QJ4 A;  4BK2 A;  3NKS A;  1H7X A;  5HXI A;  2R0P A;  4B65 A;  1F3P A;  3CGE A;  2VVL G;  4TM3 A;  2C7G A;  1BWC A;  2H88 A;  1GSN A;  3QFB A;  3AYL A;  3H4K A;  1BKW A;  1E1K A;  3PS9 A;  3DGH A;  4B69 A;  1LQT A;  2GB0 A;  3LB8 A;  4EM4 A;  1GRH A;  4G6H A;  5EB4 A;  2WPF A;  1KSS A;  1QLB A;  1YQZ A;  2AQJ A;  1RSG A;  2ZBW A;  3AE4 A;  1GRT A;  3SM8 A;  4OPI A;  1CF3 A;  2XLS A;  1NG4 A;  1UKV G;  4REK A;  4N9X A;  3SXI A;  3DJE A;  4JN9 A;  4BV6 A;  2I0Z A;  2YVG A;  4U8J A;  4TLZ A;  3G5S A;  1NG3 A;  2FJA A;  1K4Q A;  4U8N A;  1H83 A;  4CY6 A;  4ZN0 A;  4FK1 A;  2H89 A;  2BRY A;  2VQ7 A;  3AEC A;  2ARD A;  1TDF A;  2JB1 A;  4X9N A;  1PBD A;  1KF6 A;  3ICR A;  2WDQ A;  3SZC A;  4H4P A;  2XFP A;  3ALJ A;  5EBK A;  2FJE A;  1FEC A;  2DKI A;  2XFN A;  3LAD A;  4U8K A;  3UP5 A;  3AE2 A;  1OJ9 A;  3BI5 A;  5U1O A;  5FMH A;  2C75 A;  3CIR A;  4WCT A;  4NEW A;  1GV4 A;  2QA1 A;  2WES A;  2XDO A;  4J36 A;  4BK1 A;  2BAC A;  4IVO B;  4J34 A;  3GYJ A;  3VRA A;  4Z2R A;  3LXD A;  1TDK A;  2FBW A;  3AE7 A;  3BI2 A;  2CDU A;  1Y56 A;  3PO7 A;  4AP1 A;  5BUK A;  1COY A;  4U2S A;  3EPT A;  3C96 A;  1PXB A;  1S3B A;  1L0V A;  4AOS A;  4BK3 A;  1D4C A;  4O5Q A;  3CGC A;  2GEW A;  3C4A A;  3UKL A;  2R46 A;  4AOX A;  4H4R A;  2R4J A;  4H2R A;  4NTC A;  4CCR A;  1KNP A;  1NDA A;  4OPC A;  2BRA A;  4IV9 A;  3LJP A;  4H4Y A;  3BHF A;  3QSS A;  1EBD A;  1DJN A;  5KOX A;  2C67 A;  3EAO A;  4USR A;  2CVJ A;  1SEZ A;  2PYX A;  2IID A;  2YAU A;  3IHM A;  4ZCD A;  3EF6 A;  1JRZ A;  4RSL A;  5EB5 A;  2EQ8 A;  4ADW A;  2UZZ A;  1ZDL A;  2X8G A;  2YLZ A;  2JAE A;  3P4S A;  4UP3 A;  3Q9T A;  4I58 A;  1B37 A;  3DK9 A;  4H4T A;  4CNK A;  2WOV A;  1TDO A;  2BCP A;  2BK3 A;  3AEG A;  4YKF A;  3VRD B;  4NNJ A;  2GR0 A;  3AE9 A;  3DK4 A;  2BC1 A;  3M13 A;  3NYF A;  5JCM A;  2O9Z A;  4I59 A;  5KXJ A;  3P4P A;  4NTD A;  2FJB A;  1VDC A;  2VRL A;  4PAB A;  3DH9 A;  2XLU A;  3AYI A;  3G5Q A;  3I3L A;  2V5Z A;  4K5R A;  4NEV A;  2YR5 A;  3AXB A;  2F5Z A;  2GVC A;  3CGB A;  1D7L A;  3KVE A;  2QA2 A;  4OPD A;  1F8W A;  2R4E A;  4AT0 A;  1KSU A;  2YR6 A;  3AD8 B;  4PAA A;  1MO9 A;  1H6V A;  2OLO A;  2XVE A;  4H7U A;  4B63 A;  4A7A A;  3GMB A;  3NIX A;  3UOV A;  3BI4 A;  3F8P A;  3GRT A;  3T2K A;  1XDI A;  4EMJ A;  3KU9 A;  3PVC A;  3ISH A;  4ICY A;  4C77 A;  4EM3 A;  3COX A;  2YQU A;  5FS7 A;  1XHC A;  3OZ2 A;  1JU2 A;  5FS8 A;  1CC4 A;  4BUR A;  2B9Y A;  2OA1 A;  1PHH A;  1Q1W A;  1XPQ A;  1CJ4 A;  4CRT A;  2YG4 A;  3NH3 X;  3HYW A;  1CHU A;  1DOD A;  4J56 A;  1NHQ A;  3SFE A;  1B5Q A;  2X99 A;  3L8K A;  5KMP A;  2BS3 A;  4UDR A;  2XFQ A;  3C4N A;  1D5T A;  2C66 A;  3EAN A;  3NHO X;  1IUT A;  3NNE A;  3T37 A;  1B8S A;  2WU5 A;  1GAL A;  1ZMC A;  3QVP A;  4OPT A;  4Y4N A;  3UP4 A;  4YTP A;  2WP9 A;  4AT2 A;  5LV9 A;  3RHA A;  4U2L A;  4EIP A;  3T2Z A;  4Z26 A;  1CC2 A;  3AEB A;  2R0G A;  3QVR A;  2B7R A;  1GPE A;  1OJT A;  1LJ1 A;  1H7W A;  4EMW A;  4KX6 A;  4EMI A;  4H4Z A;  3FMW A;  4YT0 A;  1GES A;  1GRA A;  1IUX A;  1BGJ A;  4BJZ A;  3L1R A;  2V3A A;  3S61 A;  2DKH A;  2OAL A;  2WP5 A;  2XVI A;  4APN A;  2A89 A;  5DBJ A;  3D1C A;  2GR2 A;  1GRB A;  3CNJ A;  1VRQ B;  1F8R A;  1EL9 A;  3LZX A;  4GR1 A;  5JCK A;  1FEB A;  2V61 A;  4H4S A;  3S5W A;  1YQ4 A;  4U8L A;  4Z2U A;  3B3R A;  3H8L A;  3IWA A;  2YLT A;  4EQS A;  2WOI A;  1REO A;  2YWL A;  5M10 A;  1X31 B;  3FG2 P;  4G6G A;  5KMQ A;  4JNQ A;  4CCQ A;  4C74 A;  4YTN A;  1L9D A;  2RGO A;  2X50 A;  1JRX A;  2Q0L A;  3HYV A;  2GMH A;  2XLP A;  3SZ0 A;  3V3O A;  4EQR A;  1GET A;  2YG5 A;  4H2N A;  2B76 A;  3UKP A;  1FL2 A;  3VR9 A;  3DJG X;  5ER0 A;  3SQP A;  2YM2 A;  4A99 A;  1ZOV A;  4RG3 A;  1TRB A;  2XVH A;  4G74 A;  3AE6 A;  1V59 A;  1CJ3 A;  3O0H A;  1NHP A;  3ADA B;  1D7Y A;  4GRT A;  1CJC A;  4YSZ A;  3P4R A;  3SZW A;  4YSX A;  5KMS A;  1QO8 A;  4B66 A;  1AOG A;  1PJ7 A;  3AE3 A;  1Y0P A;  3F8R A;  2RAB A;  1FEA A;  1FCD A;  3FPZ A;  1QJD A;  1TDE A;  2APG A;  2C73 A;  3AE1 A;  3NK0 X;  4A9W A;  1IUS A;  4HA6 A;  4TLX A;  3ZDN A;  4YTM A;  1P2E A;  5CKU A;  2X8C A;  1YKJ A;  3URH A;  2VZ2 A;  3UKK A;  2BS2 A;  4J31 A;  4A5L A;  3UCL A;  3KPK A;  3Q6J A;  1PJ5 A;  5C2T A;  2GRT A;  2HQM A;  4H50 A;  2YG6 A;  2GQF A;  3UTF A;  3UTG A;  1GRF A;  4OPU A;  1O95 A;  1GTE A;  2XLT A;  2EQ6 A;  4G9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...