3UOVA

Crystal structure of otemo (fad bound form 1)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
536
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 194
structure length 536
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uovA01
1ZK7A 4OPIA 1TDOA 1NHSA 2OA1A 4JY3A 2Q7VA 1K0LA 2GRTA 1JEHA 4B64A 3IWAA 4JQ9A 2YVJA 4Y4LA 1NPXA 3IC9A 2YQUA 1K0JA 2YR4A 4GDPA 1DOEA 2ZZBA 2GQWA 1TDNA 5FS9A 3I6DA 1BF3A 1TYPA 3URHA 3NYEA 4JY2A 4BK1A 1PJ7A 1S3EA 2GVCA 4IA5A 5KVIA 3DK9A 1BGNA 2X99A 1XPQA 1GEUA 4J36A 3KLJA 1ZKQA 2Y6RA 3BI2A 3NN0X 4CNJA 2C66A 3G5QA 1IUUA 1Q1WA 2BK5A 4D03A 3AWIA 1DXLA 4P9SA 3UKKA 2H89A 1GSNA 1MO9A 1L9CA 3V3NA 5U63A 1H81A 4H4SA 1NG4A 1XHCA 2YG6A 3AEFA 4LA1A 5U1OA 2VVMA 1KF6A 2XVEA 3AEGA 5KWFA 1OJTA 2YG4A 4IVOB 1Y56B 3AYJA 3NIXA 3BI4A 4LU6A 3AE3A 3AXBA 3CPIG 4FK1C 3K30A 3GYJA 1EL8A 2FJAA 1GNDA 3C4NA 3HZLA 2OLOA 2WOVA 4H4PA 3M0OA 4U8LA 3RHAA 1BZLA 1PJ5A 3LB8A 4H4WA 4ADWA 4CRTA 3GMCA 2CVJA 4KX6A 3FPZA 2F5ZA 2YLWA 5J60A 3BHFA 2FJEA 2GQFA 3AE1A 3I3LA 1Q1RA 3NHOX 1SEZA 2YLRA 3PVCA 1NEKA 3CNSA 2GAGB 3ADAB 1KNPA 1GRHA 4ZCDA 4AOXA 4U2TA 2E5VA 4M52A 5EB4A 4B63A 3KVEA 4X9NA 4H2QA 4WX1A 2C64A 3VRDB 1XANA 5KRQA 1VQWA 2R46A 3PO7A 4EIPA 4IA6A 1GETA 1L9DA 1PXAA 3OC4A 3GD4A 4B66A 1N1PA 5LV9A 3GRTA 2CDUA 4CCRA 1YQ4A 1BGJA 3F8RA 3ICTA 2WEUA 3AEEA 4H4TA 2XLSA 1IJHA 4A6NB 5EB5A 4U8KA 3KD9A 4H50A 2WOWA 2QCUA 2YLTA 4OPGA 3P4QA 3LJPA 2Z5XA 1MOKA 2JK6A 4BJYA 3RP7A 4Z2UA 3AYIA 2X50A 4EQWA 2GAHB 3AEBA 2JB1A 1GALA 4U8IA 5DBJA 3P4SA 3GSIA 4K8DA 1OJDA 4ZN0A 2RGHA 4H7UA 1DODA 2NVKX 4DSGA 2OAMA 2GF3A 1FECA 1NHPA 2J3NA 3CGCA 2YVGA 4J31A 2GR1A 2WDVA 2XFUA 1CHUA 1E1KA 3NK0X 4O5QA 3CN8A 4TM3A 3P9UA 1LPFA 3VQRA 2AAQA 1L9EA 3NK2X 3PS9A 1Z6LA 3UKAA 3NGCX 4D04A 1PHHA 2BABA 2BC1A 4U2LA 1CJCA 3DGZA 2BS3A 2C65A 2Q6UA 5HXIA 3RP8A 3AD7B 2OLNA 3AECA 2V3AA 4CBQA 2R4JA 3FBSA 2R0GA 3C4AA 1Q9IA 1ZMDA 3CNDA 3UKLA 5KOXA 5J7XA 2GR0A 3KPFA 2JB2A 4H2PA 2XDOA 1GESA 2UZZA 4J34A 1H7WA 2APGA 2BYBA 3COXA 2XYOA 2C70A 5IQ4A 1P2EA 1ZY8A 2GMJA 1BKWA 3M12A 2H88A 4J56A 4YTPA 3AE5A 1X31B 1GTEA 2YWLA 1KNRA 4XWZA 4B69A 2V5ZA 1PXBA 4HB9A 4BK3A 2DKHA 1JU2A 2GMHA 2Z5YA 3D1CA 3ICSA 2BACA 3BNUA 2WPFA 2C76A 4CY8A 3CNPA 3NTDA 4K7ZA 3QSMA 3CPJG 3RNMA 4EMWA 2VRLA 2BK4A 2VOUA 2WETA 4EIQA 2XFOA 1EL9A 2YLSA 1ONFA 5GRTA 1B8SA 1NHRA 2BS2A 2IVDA 3UCLA 1IUWA 4YSZA 1DOCA 1RP0A 4UP3A 3GRSA 1QJDA 3Q9TA 1CL0A 3DJEA 4EQXA 3FIMB 3KKJA 2WU2A 1D4DA 3LZXA 1OJ9A 3SM8A 2BC0A 1PDHA 4OVIA 1ZOYA 3CGDA 3JSKA 2WPCA 1JRXA 2YR6A 5HY5A 2XLPA 1CC2A 3H4KA 2V6OA 4A79A 4RSLA 1GXFA 2PHHA 3AD9B 3LADA 3SGLA 2V61A 2AR8A 2ZZCA 4BJZA 4Z2RA 2VZ2A 3F8DA 4GF7A 3WE0A 3DJGX 2E1MA 4YKGA 1JNRA 2BK3A 1GPEA 1ZP0A 5CKUA 4APNA 2YG5A 2WS3A 2VRMA 4NTDA 3VR8A 4Z2TA 2WHDA 3ICRA 3T37A 4CCQA 3EPTA 3ATRA 2B9XA 3AE7A 4CNKA 4OPDA 1JRZA 1YKJA 4NZHA 3P1WA 1HYUA 4USRA 1B4VA 3BI5A 2AQJA 2YM2A 3C96A 3QVPA 4JDRA 4AT2A 4EM4A 2YG7A 1F6MA 4K5SA 5BUKA 3B6DA 5EBKA 2RGOA 2X3NA 4OPUA 1MXTA 1DJQA 1XDIA 1N4WA 2BXRA 4TLZA 5FS7A 5C3JA 5FMHA 3NG7X 2WP5A 4X9MA 2A8XA 3NNEA 1LVLA 2C72A 4C3XA 2C73A 2BA9A 3DJJA 4Z43A 5BVAA 5JCNA 3DK4A 2B7RA 3FG2P 1GOSA 1IUTA 1TDEA 3AB1A 4U8JA 2I0ZA 4DGKA 3QVRA 3S5WA 1AOGA 4Z24A 1TDKA 1PN0A 2VVLA 2Y6QA 2XVHA 4H4XA 4UDRA 4TM0A 4Y4NA 3UTHA 3UTEA 1GT8A 2IIDA 1PBEA 2R45A 1NENA 2EQ6A 1D7LA 3QSEA 4USQA 3NTAA 3Q6JA 1BWCA 2VVLG 4EMJA 1ZMCA 2YVFA 3CTYA 4H4UA 2B76A 3NT6A 3NYFA 4XXGA 4ICYA 3V3OA 1H7XA 2VQBA 2C3DA 1FEAA 4IV9A 3UKHA 3D8XA 4MJWA 2GB0A 1D4EA 1DJNA 4C74A 5JCLA 1EL5A 1L0VA 1GRAA 1F8RA 4Z25A 5KVHA 3H8LA 2JBVA 2XFPA 1LV0A 1PBDA 4GCMA 4YSXA 2WP6A 4U8NA 4YKFA 2XLUA 3NLCA 1PJ6A 1VRQB 3NH3X 1TDFA 3AE6A 3P4RA 1QLBA 4H2RA 3ZDNA 4X4JA 4H4ZA 4JNQA 5KXJA 1VG0A 2X8GA 2IVEA 2OALA 4I58A 4YTNA 4H4VA 5ER0A 4Z44A 4J33A 4AP1A 5IPYA 4H4RA 1ELIA 2RABA 1B5QA 3IHGA 5M0ZA 5CQFA 1CJ2A 1CF3A 4K5RA 4H2NA 5HHFA 3UOZA 4YT0A 4B67A 3G5SA 4K22A 2XCGA 1LQUA 3UP5A 3GYIA 4FX9A 2EQ7A 4JN9A 1KSUA 3CGBA 2X8CA 3GD3A 4A9WA 1KDGA 3GDNA 4YXDA 4C77A 2WDRA 2C75A 1RSGA 3NK1X 3ATQA 1QO8A 2A89A 2FJBA 2GEWA 1N4UA 2XVFA 2YLZA 2EQ8A 3EF6A 5EOWA 4LIIA 3NKSA 2V3BA 5GSNA 1OJCA 3AEAA 1P2HA 3CIRA 2C3CA 4RG3A 3O0HA 4AP3A 2JKCA 3UOVA 3AEDA 3AE4A 3UKPA 2PYXA 1H82A 2XLTA 2WQYA 3H8IA 3VR9A 3ALLA 3B3RA 1RYIA 1F8WA 3QJ4A 4BURA 4AOSA 1E39A 1LQTA 4KPRA 3G5RA 1IUSA 1EL7A 1PBFA 3CPHG 1FOHA 1DNCA 3L8KA 1IUXA 5TR3A 3R9UA 5JCKA 3FMWA 4YWOA 3DK8A 2BCPA 1M6IA 5U25A 1PBBA 2FJDA 5BULA 2ARDA 2C7GA 3BHKA 3ISHA 1GV4A 1YY5A 2R4EA 1H83A 1GRFA 5HYMA 2R0PA 4PAAA 3GMBA 2YLXA 3NYCA 3EAOA 1H84A 2WP9A 2BS4A 2CFYA 4A99A 5FS6A 4A7AA 2TPRA 3AE2A 1NHQA 2QA2A 5IQ1A 1TYTA 1FL2A 4IVMB 2RGJA 3DMEA 2XLRA 2ZBWA 3AYLA 2B7SA 3UKQA 3VRAA 2O9ZA 2GH5A 3K7MX 4K2XA 3SFDA 1YQZA 4GUVA 4JNAA 4YSHA 3UTFA 2XVJA 1FCDA 4REKA 1DOBA 3SQPA 2W0HA 2WPEA 4A5LA 4GDEA 1D4CA 1Y0PA 3P4PA 1LTXR 2CULA 3AE9A 1NDAA 4OPTA 1PBCA 4XWRA 1JNZA 3DJDA 1K4QA 1F3PA 4A65A 1H86A 4UDPA 1M64A 3ABVA 4OCGA 3ALMA 3II4A 4BK2A 5JCMA 1CC4A 3ZYXA 4AT0A 3RP6A 2GV8A 2GR2A 4Z26A 1GRBA 1E1NA 1KSSA 3CNTA 1E6EA 2XFNA 1B37A 2Q0LA 5KOWA 4C3YA 3K7TA 1OJAA 2FBWA 3BNMA 2WU5A 1S2QA 5FS8A 5C2TA 4NEVA 4OPLA 4CY6A 2HQMA 3ALJA 4B1BA 5JCIA 4ZCCA 4ECHA 2VQ7A 3GWFA 1O95A 2WESA 4J57A 1VG9A 2JAEA 1COYA 1W4XA 1O5WA 3E1TA 4BV6A 3VRBA 1CC6A 4J2WA 3GDPA 2V60A 1D7YA 1Y56A 4FDCB 2WOIA 3AE8A 3IHMA 1PXCA 4B65A 3CGEA 3QSSA 3REDA 2DKIA 4YSYA 3K7QX 1E1LA 4UDQA 1UKVG 4TM4A 3V76A 2WBAA 4U8OA 2R9ZA 1E1MA 3NN6X 4GR1A 3S61A 4I59A 4H4YA 3DGHA 2YG3A 4FK1A 1REOA 1ZX9A 1K0IA 1O94A 5M10A 1D5TA 1E7PA 4WCTA 4HA6A 4DSHA 1GTHA 1LJ1A 2BXSA 4TM1A 4EMIA 2E4GA 2NPXA 2QA1A 1GREA 2XVIA 4C5OA 1H6VA 1CJ3A 2JB3A 3M13A 3UKFA 2XFQA 5L46A 4TLXA 2A87A 1VDCA 4NTCA 1F8SA 3DH9A 1CJ4A 2YAUA 4PABA 1JOAA 3EANA 1IUVA 1S3BA 2QAEA 3QFBA 4EQRA 3UTGA 1NAAA 2EQ9A 3OZ2A 4Y4MA 3LZWA 3NRNA 3CNJA 1NG3A 1YQ3A 2C67A 2ZZ0A 3IF9A 1GRGA 4OPCA 1N4VA 2TMDA 4A6NA 2YM1A 4B68A 2Q0KA 3DA1A 1S2YA 4U8MA 1JRYA 4EQSA 3KU9A 3LOVA 1CBOA 4N9XA 1PS9A 3UOXA 3LXDA 1ZDLA 3ITJA 4E0VA 3KA7A 3SFEA 1GRTA 2X8HA 2ACZA 2B9WA 4NTEA 1EBDA 4RG4A 4GRTA 3AD8B 3F8PA 1V59A 4NEWA 4O5UA 3L1RA 5BRTA 4U8PA 2GR3A 2WDQA 4EM3A 2B9YA 2YR5A 3QFAA 3UOYA 1KFYA 1TRBA 2BCGG 1GERA 3GWDA 3UP4A 1FEBA 1ZOVA 4U2SA 4YTMA 4H4QA 4DNAA 2R0CA
chains in the Genus database with same CATH superfamily
1ZK7A 4OPIA 1TDOA 1NHSA 2OA1A 4JY3A 2Q7VA 1K0LA 2GRTA 1JEHA 4B64A 3IWAA 4JQ9A 2YVJA 4Y4LA 1NPXA 3IC9A 2YQUA 1K0JA 2YR4A 4GDPA 1DOEA 2ZZBA 2GQWA 1TDNA 5FS9A 3I6DA 1BF3A 1TYPA 3URHA 3NYEA 4JY2A 4BK1A 1PJ7A 1S3EA 2GVCA 4IA5A 5KVIA 3DK9A 1BGNA 2X99A 1XPQA 1GEUA 4J36A 3KLJA 1ZKQA 2Y6RA 3BI2A 3NN0X 4CNJA 2C66A 3G5QA 3SZ0A 1IUUA 1Q1WA 2BK5A 4D03A 3AWIA 1DXLA 4P9SA 3UKKA 2H89A 1GSNA 1MO9A 1L9CA 3V3NA 5U63A 1H81A 4H4SA 1NG4A 1XHCA 2YG6A 3AEFA 4LA1A 5U1OA 2VVMA 1KF6A 2XVEA 3AEGA 5KWFA 1OJTA 2YG4A 4IVOB 1Y56B 3AYJA 3NIXA 3BI4A 4LU6A 3AE3A 3AXBA 3HYVA 3CPIG 4FK1C 3K30A 3GYJA 1EL8A 2FJAA 1GNDA 3C4NA 3HZLA 2OLOA 2WOVA 4H4PA 3M0OA 4U8LA 3RHAA 4G6HA 1BZLA 1PJ5A 3LB8A 4H4WA 3SYIA 4ADWA 4CRTA 3GMCA 2CVJA 4KX6A 3FPZA 2F5ZA 2YLWA 5J60A 3BHFA 2FJEA 5KMSA 2GQFA 3AE1A 3I3LA 1Q1RA 3NHOX 1SEZA 2YLRA 3PVCA 1NEKA 3CNSA 2GAGB 3ADAB 1KNPA 1GRHA 4ZCDA 4AOXA 4U2TA 2E5VA 4M52A 5EB4A 4B63A 3KVEA 4X9NA 4H2QA 4WX1A 2C64A 3VRDB 1XANA 5KRQA 1VQWA 2R46A 3PO7A 4EIPA 4IA6A 1GETA 1L9DA 1PXAA 3OC4A 3GD4A 4B66A 1N1PA 5LV9A 3GRTA 2CDUA 4CCRA 1YQ4A 1BGJA 3F8RA 3ICTA 2WEUA 3AEEA 4H4TA 2XLSA 1IJHA 4A6NB 5EB5A 4U8KA 3KD9A 4H50A 2WOWA 2QCUA 2YLTA 4OPGA 3P4QA 3LJPA 2Z5XA 1MOKA 2JK6A 4BJYA 3RP7A 4Z2UA 3AYIA 2X50A 4EQWA 5KNLA 2GAHB 3AEBA 2JB1A 1GALA 4U8IA 5DBJA 3P4SA 3GSIA 4K8DA 1OJDA 4ZN0A 2RGHA 4H7UA 1DODA 2NVKX 4DSGA 2OAMA 2GF3A 1FECA 1NHPA 2J3NA 3CGCA 2YVGA 4J31A 2GR1A 2WDVA 2XFUA 1CHUA 1E1KA 3NK0X 4O5QA 3CN8A 4TM3A 3P9UA 1LPFA 3VQRA 2AAQA 1L9EA 3NK2X 2C4CA 3PS9A 1Z6LA 3UKAA 3NGCX 4D04A 1PHHA 2BABA 2BC1A 3SZCA 4U2LA 1CJCA 3DGZA 2BS3A 2C65A 2Q6UA 5HXIA 3RP8A 3AD7B 2OLNA 3AECA 2V3AA 4CBQA 2R4JA 3FBSA 2R0GA 3C4AA 1Q9IA 1ZMDA 3CNDA 3UKLA 5KOXA 5J7XA 2GR0A 3KPFA 2JB2A 4H2PA 2XDOA 1GESA 2UZZA 4J34A 1H7WA 2APGA 2BYBA 3COXA 2XYOA 2C70A 5IQ4A 1P2EA 1ZY8A 2GMJA 1BKWA 3M12A 2H88A 4J56A 4YTPA 3AE5A 1X31B 1GTEA 2YWLA 1KNRA 4XWZA 4B69A 2V5ZA 1PXBA 4HB9A 4BK3A 2DKHA 1JU2A 2GMHA 2Z5YA 3D1CA 3ICSA 2BACA 3BNUA 2WPFA 2C76A 3T2KA 3CNPA 4CY8A 3NTDA 3SX6A 4K7ZA 3QSMA 3CPJG 3RNMA 4EMWA 2VRLA 3T31A 2BK4A 2VOUA 2WETA 4EIQA 2XFOA 1EL9A 2YLSA 1ONFA 5GRTA 1B8SA 1NHRA 2BS2A 4NWZA 2IVDA 3UCLA 1IUWA 4YSZA 1DOCA 1RP0A 4UP3A 3GRSA 1QJDA 3Q9TA 1CL0A 3DJEA 4EQXA 3FIMB 3KKJA 2WU2A 1D4DA 3LZXA 1OJ9A 3SM8A 2BC0A 1PDHA 4OVIA 3SZFA 1ZOYA 3CGDA 3JSKA 2WPCA 1JRXA 2YR6A 5HY5A 4G73A 2XLPA 1CC2A 3H4KA 2V6OA 4A79A 4RSLA 1GXFA 2PHHA 3AD9B 3LADA 3SGLA 2V61A 2AR8A 2ZZCA 4BJZA 4Z2RA 2VZ2A 3F8DA 4GF7A 3WE0A 3DJGX 2E1MA 4YKGA 1JNRA 2BK3A 1GPEA 1ZP0A 5CKUA 4APNA 2YG5A 2WS3A 2VRMA 4NTDA 3VR8A 4Z2TA 2WHDA 3ICRA 3T37A 4CCQA 3EPTA 3ATRA 2B9XA 3AE7A 4CNKA 4OPDA 1JRZA 1YKJA 4NZHA 3P1WA 1HYUA 4USRA 1B4VA 3BI5A 2AQJA 2YM2A 3C96A 3QVPA 4JDRA 5KMQA 4AT2A 4EM4A 2YG7A 1F6MA 4K5SA 5BUKA 3B6DA 5EBKA 2RGOA 2X3NA 4OPUA 1MXTA 1DJQA 1XDIA 1N4WA 2BXRA 4TLZA 5FS7A 5C3JA 5FMHA 3T2YA 3NG7X 2WP5A 4X9MA 2A8XA 3NNEA 1LVLA 2C72A 4G74A 4C3XA 2C73A 2BA9A 3DJJA 4Z43A 5BVAA 5JCNA 3DK4A 2B7RA 3FG2P 1GOSA 1IUTA 1TDEA 3AB1A 4U8JA 2I0ZA 4DGKA 3QVRA 3S5WA 1AOGA 4Z24A 1TDKA 1PN0A 2VVLA 2Y6QA 2XVHA 4H4XA 4UDRA 4TM0A 4Y4NA 3UTHA 3UTEA 1GT8A 2IIDA 1PBEA 2R45A 1NENA 2EQ6A 1D7LA 3QSEA 4USQA 3NTAA 3Q6JA 1BWCA 2VVLG 4EMJA 1ZMCA 2YVFA 3CTYA 4H4UA 2B76A 3NT6A 3NYFA 4XXGA 3SZWA 4ICYA 3V3OA 1H7XA 2VQBA 2C3DA 1FEAA 4IV9A 3UKHA 3D8XA 4MJWA 2GB0A 1D4EA 1DJNA 4C74A 5JCLA 1EL5A 3GYXA 1L0VA 1GRAA 1F8RA 4Z25A 5KVHA 3H8LA 2JBVA 2XFPA 1LV0A 1PBDA 4GCMA 4YSXA 2WP6A 4U8NA 4YKFA 2XLUA 3NLCA 1PJ6A 1VRQB 4NNJA 3NH3X 1TDFA 3AE6A 3P4RA 1QLBA 4H2RA 3ZDNA 4X4JA 4H4ZA 4JNQA 5KXJA 1VG0A 2X8GA 2IVEA 2OALA 4I58A 4YTNA 4H4VA 5ER0A 4Z44A 4J33A 4AP1A 5IPYA 4H4RA 1ELIA 2RABA 1B5QA 3IHGA 5M0ZA 5CQFA 1CJ2A 1CF3A 4K5RA 4H2NA 5HHFA 3UOZA 4YT0A 4B67A 3G5SA 4K22A 2XCGA 1LQUA 3UP5A 3GYIA 4FX9A 4G6GA 2EQ7A 4JN9A 1KSUA 3CGBA 2X8CA 3GD3A 4A9WA 1KDGA 3GDNA 4YXDA 4C77A 2WDRA 2C75A 1RSGA 3NK1X 3ATQA 1QO8A 2A89A 2FJBA 2GEWA 1N4UA 2XVFA 2YLZA 2EQ8A 3EF6A 5EOWA 4LIIA 3NKSA 2V3BA 3T14A 5GSNA 1OJCA 3AEAA 3T2ZA 1P2HA 3CIRA 2C3CA 4GAPA 4RG3A 2BRYA 3O0HA 4AP3A 2JKCA 3UOVA 3AEDA 3AE4A 3UKPA 2PYXA 1H82A 2XLTA 2WQYA 3H8IA 3VR9A 3ALLA 3B3RA 1RYIA 5KMRA 1F8WA 3QJ4A 4BURA 4AOSA 1E39A 1LQTA 4KPRA 3G5RA 1IUSA 1EL7A 1PBFA 3CPHG 1FOHA 1DNCA 3L8KA 1IUXA 5TR3A 3R9UA 5JCKA 3FMWA 4YWOA 3DK8A 2BCPA 1M6IA 5U25A 1PBBA 2FJDA 5BULA 2ARDA 2C7GA 3BHKA 3ISHA 1GV4A 1YY5A 2R4EA 1H83A 1GRFA 5HYMA 2R0PA 4PAAA 4G9KA 3GMBA 2YLXA 3NYCA 3EAOA 1H84A 2WP9A 2BS4A 2CFYA 4A99A 5FS6A 4A7AA 2TPRA 3AE2A 1NHQA 2BRAA 2QA2A 5IQ1A 1TYTA 1FL2A 4IVMB 3SY4A 2RGJA 3DMEA 2XLRA 2ZBWA 3AYLA 2B7SA 3UKQA 3VRAA 2O9ZA 2GH5A 3K7MX 4K2XA 3SFDA 1YQZA 4GUVA 4JNAA 4YSHA 3UTFA 2XVJA 1FCDA 4REKA 1DOBA 3SQPA 2W0HA 2WPEA 4A5LA 4GDEA 1D4CA 1Y0PA 3P4PA 1LTXR 2CULA 3AE9A 1NDAA 4OPTA 5KMPA 1PBCA 4XWRA 1JNZA 3DJDA 1K4QA 1F3PA 4A65A 1H86A 4UDPA 1M64A 3ABVA 4OCGA 3KPKA 3ALMA 3II4A 4BK2A 5JCMA 1CC4A 3ZYXA 4AT0A 3RP6A 2GV8A 2GR2A 4Z26A 1GRBA 1E1NA 1KSSA 3CNTA 1E6EA 2XFNA 1B37A 2Q0LA 5KOWA 4C3YA 3K7TA 1OJAA 2FBWA 3BNMA 2WU5A 1S2QA 3T0KA 5FS8A 5C2TA 4NEVA 4OPLA 4CY6A 2HQMA 3ALJA 4B1BA 5JCIA 4ZCCA 4ECHA 2VQ7A 3GWFA 1O95A 2WESA 4J57A 1VG9A 2JAEA 1COYA 1W4XA 1O5WA 3E1TA 4BV6A 3VRBA 1CC6A 4J2WA 3GDPA 2V60A 1D7YA 1Y56A 4FDCB 2WOIA 4II2A 3AE8A 3IHMA 1PXCA 4B65A 3CGEA 3QSSA 3REDA 2DKIA 4YSYA 3K7QX 1E1LA 4UDQA 1UKVG 4TM4A 3V76A 2WBAA 4U8OA 2R9ZA 1E1MA 3NN6X 4GR1A 3S61A 4I59A 4H4YA 3DGHA 2YG3A 4FK1A 1REOA 1ZX9A 1K0IA 1O94A 5M10A 3SXIA 1D5TA 1E7PA 4WCTA 4HA6A 4DSHA 1GTHA 1LJ1A 2BXSA 4TM1A 4EMIA 2E4GA 2NPXA 2QA1A 1GREA 2XVIA 4C5OA 1H6VA 1CJ3A 2JB3A 3M13A 3UKFA 2XFQA 5L46A 4TLXA 2A87A 1VDCA 4NTCA 1F8SA 3DH9A 1CJ4A 2YAUA 4PABA 1JOAA 3EANA 1IUVA 1S3BA 2QAEA 3QFBA 4EQRA 3UTGA 1NAAA 2EQ9A 3OZ2A 4Y4MA 3LZWA 3NRNA 3CNJA 1NG3A 1YQ3A 2C67A 2ZZ0A 3IF9A 1GRGA 3HYWA 4OPCA 1N4VA 2TMDA 4A6NA 2YM1A 4B68A 2Q0KA 3DA1A 1S2YA 4U8MA 1JRYA 4EQSA 3KU9A 3LOVA 1CBOA 4N9XA 1PS9A 3UOXA 3LXDA 1ZDLA 3ITJA 4E0VA 3KA7A 3SFEA 1GRTA 2X8HA 2ACZA 2B9WA 3HYXA 4NTEA 1EBDA 4RG4A 3CMMA 3AD8B 3F8PA 4GRTA 1V59A 4NEWA 4O5UA 3L1RA 5BRTA 4U8PA 4GAVA 2GR3A 2WDQA 4II3A 2B9YA 2YR5A 4EM3A 3QFAA 3UOYA 1KFYA 1TRBA 2BCGG 1GERA 3GWDA 3UP4A 1FEBA 1ZOVA 4U2SA 4YTMA 4H4QA 4DNAA 2R0CA
chains in the Genus database with same CATH topology
1ZK7A 4OPIA 1TDOA 1NHSA 2OA1A 4JY3A 2Q7VA 1K0LA 2GRTA 1JEHA 4B64A 3IWAA 4JQ9A 2YVJA 4Y4LA 1NPXA 3IC9A 2YQUA 1K0JA 2YR4A 4GDPA 1DOEA 2ZZBA 2GQWA 1TDNA 5FS9A 3I6DA 1BF3A 1TYPA 3URHA 3NYEA 4JY2A 4BK1A 1PJ7A 1S3EA 2GVCA 4IA5A 5KVIA 3DK9A 1BGNA 2X99A 1XPQA 1GEUA 4J36A 3KLJA 1ZKQA 2Y6RA 3BI2A 3NN0X 4CNJA 2C66A 3G5QA 3SZ0A 1IUUA 1Q1WA 2BK5A 4D03A 3AWIA 1DXLA 4P9SA 3UKKA 2H89A 1GSNA 1MO9A 1L9CA 3V3NA 5U63A 1H81A 4H4SA 1NG4A 1XHCA 2YG6A 3AEFA 4LA1A 5U1OA 2VVMA 1KF6A 2XVEA 3AEGA 5KWFA 1OJTA 2YG4A 4IVOB 1Y56B 3AYJA 3NIXA 3BI4A 4LU6A 3AE3A 3AXBA 3HYVA 3CPIG 4FK1C 3K30A 3GYJA 1EL8A 2FJAA 1GNDA 3C4NA 3HZLA 2OLOA 2WOVA 4H4PA 3M0OA 4U8LA 3RHAA 4G6HA 1BZLA 1PJ5A 3LB8A 4H4WA 3SYIA 4ADWA 4CRTA 3GMCA 2CVJA 4KX6A 3FPZA 2F5ZA 2YLWA 5J60A 3BHFA 2FJEA 5KMSA 2GQFA 3AE1A 3I3LA 1Q1RA 3NHOX 1SEZA 2YLRA 3PVCA 1NEKA 3CNSA 2GAGB 3ADAB 1KNPA 1GRHA 4ZCDA 4AOXA 4U2TA 2E5VA 4M52A 5EB4A 4B63A 3KVEA 4X9NA 4H2QA 4WX1A 2C64A 3VRDB 1XANA 5KRQA 1VQWA 2R46A 3PO7A 4EIPA 4IA6A 1GETA 1L9DA 1PXAA 3OC4A 3GD4A 4B66A 1N1PA 5LV9A 3GRTA 2CDUA 4CCRA 1YQ4A 1BGJA 3F8RA 3ICTA 2WEUA 3AEEA 4H4TA 2XLSA 1IJHA 4A6NB 5EB5A 4U8KA 3KD9A 4H50A 2WOWA 2QCUA 2YLTA 4OPGA 3P4QA 3LJPA 2Z5XA 1MOKA 2JK6A 4BJYA 3RP7A 4Z2UA 3AYIA 2X50A 4EQWA 5KNLA 2GAHB 3AEBA 2JB1A 1GALA 4U8IA 5DBJA 3P4SA 3GSIA 4K8DA 1OJDA 4ZN0A 2RGHA 4H7UA 1DODA 2NVKX 4DSGA 2OAMA 2GF3A 1FECA 1NHPA 2J3NA 3CGCA 2YVGA 4J31A 2GR1A 2WDVA 2XFUA 1CHUA 1E1KA 3NK0X 4O5QA 3CN8A 4TM3A 3P9UA 1LPFA 3VQRA 2AAQA 1L9EA 3NK2X 2C4CA 3PS9A 1Z6LA 3UKAA 3NGCX 4D04A 1PHHA 2BABA 2BC1A 3SZCA 4U2LA 1CJCA 3DGZA 2BS3A 2C65A 2Q6UA 5HXIA 3RP8A 3AD7B 2OLNA 3AECA 2V3AA 4CBQA 2R4JA 3FBSA 2R0GA 3C4AA 1Q9IA 1ZMDA 3CNDA 3UKLA 5KOXA 5J7XA 2GR0A 3KPFA 2JB2A 4H2PA 2XDOA 1GESA 2UZZA 4J34A 1H7WA 2APGA 2BYBA 3COXA 2XYOA 2C70A 5IQ4A 1P2EA 1ZY8A 2GMJA 1BKWA 3M12A 2H88A 4J56A 4YTPA 3AE5A 1X31B 1GTEA 2YWLA 1KNRA 4XWZA 4B69A 2V5ZA 1PXBA 4HB9A 4BK3A 2DKHA 1JU2A 2GMHA 2Z5YA 3D1CA 3ICSA 2BACA 3BNUA 2WPFA 2C76A 3T2KA 3CNPA 4CY8A 3NTDA 3SX6A 4K7ZA 3QSMA 3CPJG 3RNMA 4EMWA 2VRLA 3T31A 2BK4A 2VOUA 2WETA 4EIQA 2XFOA 1EL9A 2YLSA 1ONFA 5GRTA 1B8SA 1NHRA 2BS2A 4NWZA 2IVDA 3UCLA 1IUWA 4YSZA 1DOCA 1RP0A 4UP3A 3GRSA 1QJDA 3Q9TA 1CL0A 3DJEA 4EQXA 3FIMB 3KKJA 2WU2A 1D4DA 3LZXA 1OJ9A 3SM8A 2BC0A 1PDHA 4OVIA 3SZFA 1ZOYA 3CGDA 3JSKA 2WPCA 1JRXA 2YR6A 5HY5A 4G73A 2XLPA 1CC2A 3H4KA 2V6OA 4A79A 4RSLA 1GXFA 2PHHA 3AD9B 3LADA 3SGLA 2V61A 2AR8A 2ZZCA 4BJZA 4Z2RA 2VZ2A 3F8DA 4GF7A 3WE0A 3DJGX 2E1MA 4YKGA 1JNRA 2BK3A 1GPEA 1ZP0A 5CKUA 4APNA 2YG5A 2WS3A 2VRMA 4NTDA 3VR8A 4Z2TA 2WHDA 3ICRA 3T37A 4CCQA 3EPTA 3ATRA 2B9XA 3AE7A 4CNKA 4OPDA 1JRZA 1YKJA 4NZHA 3P1WA 1HYUA 4USRA 1B4VA 3BI5A 2AQJA 2YM2A 3C96A 3QVPA 4JDRA 5KMQA 4AT2A 4EM4A 2YG7A 1F6MA 4K5SA 5BUKA 3B6DA 5EBKA 2RGOA 2X3NA 4OPUA 1MXTA 1DJQA 1XDIA 1N4WA 2BXRA 4TLZA 5FS7A 5C3JA 5FMHA 3T2YA 3NG7X 2WP5A 4X9MA 2A8XA 3NNEA 1LVLA 2C72A 4G74A 4C3XA 2C73A 2BA9A 3DJJA 4Z43A 5BVAA 5JCNA 3DK4A 2B7RA 3FG2P 1GOSA 1IUTA 1TDEA 3AB1A 4U8JA 2I0ZA 4DGKA 3QVRA 3S5WA 1AOGA 4Z24A 1TDKA 1PN0A 2VVLA 2Y6QA 2XVHA 4H4XA 4UDRA 4TM0A 4Y4NA 3UTHA 3UTEA 1GT8A 2IIDA 1PBEA 2R45A 1NENA 2EQ6A 1D7LA 3QSEA 4USQA 3NTAA 3Q6JA 1BWCA 2VVLG 4EMJA 1ZMCA 2YVFA 3CTYA 4H4UA 2B76A 3NT6A 3NYFA 4XXGA 3SZWA 4ICYA 3V3OA 1H7XA 2VQBA 2C3DA 1FEAA 4IV9A 3UKHA 3D8XA 4MJWA 2GB0A 1D4EA 1DJNA 4C74A 5JCLA 1EL5A 3GYXA 1L0VA 1GRAA 1F8RA 4Z25A 5KVHA 3H8LA 2JBVA 2XFPA 1LV0A 1PBDA 4GCMA 4YSXA 2WP6A 4U8NA 4YKFA 2XLUA 3NLCA 1PJ6A 1VRQB 4NNJA 3NH3X 1TDFA 3AE6A 3P4RA 1QLBA 4H2RA 3ZDNA 4X4JA 4H4ZA 4JNQA 5KXJA 1VG0A 2X8GA 2IVEA 2OALA 4I58A 4YTNA 4H4VA 5ER0A 4Z44A 4J33A 4AP1A 5IPYA 4H4RA 1ELIA 2RABA 1B5QA 3IHGA 5M0ZA 5CQFA 1CJ2A 1CF3A 4K5RA 4H2NA 5HHFA 3UOZA 4YT0A 4B67A 3G5SA 4K22A 2XCGA 1LQUA 3UP5A 3GYIA 4FX9A 4G6GA 2EQ7A 4JN9A 1KSUA 3CGBA 2X8CA 3GD3A 4A9WA 1KDGA 3GDNA 4YXDA 4C77A 2WDRA 2C75A 1RSGA 3NK1X 3ATQA 1QO8A 2A89A 2FJBA 2GEWA 1N4UA 2XVFA 2YLZA 2EQ8A 3EF6A 5EOWA 4LIIA 3NKSA 2V3BA 3T14A 5GSNA 1OJCA 3AEAA 3T2ZA 1P2HA 3CIRA 2C3CA 4GAPA 4RG3A 2BRYA 3O0HA 4AP3A 2JKCA 3UOVA 3AEDA 3AE4A 3UKPA 2PYXA 1H82A 2XLTA 2WQYA 3H8IA 3VR9A 3ALLA 3B3RA 1RYIA 5KMRA 1F8WA 3QJ4A 4BURA 4AOSA 1E39A 1LQTA 4KPRA 3G5RA 1IUSA 1EL7A 1PBFA 3CPHG 1FOHA 1DNCA 3L8KA 1IUXA 5TR3A 3R9UA 5JCKA 3FMWA 4YWOA 3DK8A 2BCPA 1M6IA 5U25A 1PBBA 2FJDA 5BULA 2ARDA 2C7GA 3BHKA 3ISHA 1GV4A 1YY5A 2R4EA 1H83A 1GRFA 5HYMA 2R0PA 4PAAA 4G9KA 3GMBA 2YLXA 3NYCA 3EAOA 1H84A 2WP9A 2BS4A 2CFYA 4A99A 5FS6A 4A7AA 2TPRA 3AE2A 1NHQA 2BRAA 2QA2A 5IQ1A 1TYTA 1FL2A 4IVMB 3SY4A 2RGJA 3DMEA 2XLRA 2ZBWA 3AYLA 2B7SA 3UKQA 3VRAA 2O9ZA 2GH5A 3K7MX 4K2XA 3SFDA 1YQZA 4GUVA 4JNAA 4YSHA 3UTFA 2XVJA 1FCDA 4REKA 1DOBA 3SQPA 2W0HA 2WPEA 4A5LA 4GDEA 1D4CA 1Y0PA 3P4PA 1LTXR 2CULA 3AE9A 1NDAA 4OPTA 5KMPA 1PBCA 4XWRA 1JNZA 3DJDA 1K4QA 1F3PA 4A65A 1H86A 4UDPA 1M64A 3ABVA 4OCGA 3KPKA 3ALMA 3II4A 4BK2A 5JCMA 1CC4A 3ZYXA 4AT0A 3RP6A 2GV8A 2GR2A 4Z26A 1GRBA 1E1NA 1KSSA 3CNTA 1E6EA 2XFNA 1B37A 2Q0LA 5KOWA 4C3YA 3K7TA 1OJAA 2FBWA 3BNMA 2WU5A 1S2QA 3T0KA 5FS8A 5C2TA 4NEVA 4OPLA 4CY6A 2HQMA 3ALJA 4B1BA 5JCIA 4ZCCA 4ECHA 2VQ7A 3GWFA 1O95A 2WESA 4J57A 1VG9A 2JAEA 1COYA 1W4XA 1O5WA 3E1TA 4BV6A 3VRBA 1CC6A 4J2WA 3GDPA 2V60A 1D7YA 1Y56A 4FDCB 2WOIA 4II2A 3AE8A 3IHMA 1PXCA 4B65A 3CGEA 3QSSA 3REDA 2DKIA 4YSYA 3K7QX 1E1LA 4UDQA 1UKVG 4TM4A 3V76A 2WBAA 4U8OA 2R9ZA 1E1MA 3NN6X 4GR1A 3S61A 4I59A 4H4YA 3DGHA 2YG3A 4FK1A 1REOA 1ZX9A 1K0IA 1O94A 5M10A 3SXIA 1D5TA 1E7PA 4WCTA 4HA6A 4DSHA 1GTHA 1LJ1A 2BXSA 4TM1A 4EMIA 2E4GA 2NPXA 2QA1A 1GREA 2XVIA 4C5OA 1H6VA 1CJ3A 2JB3A 3M13A 3UKFA 2XFQA 5L46A 4TLXA 2A87A 1VDCA 4NTCA 1F8SA 3DH9A 1CJ4A 2YAUA 4PABA 1JOAA 3EANA 1IUVA 1S3BA 2QAEA 3QFBA 4EQRA 3UTGA 1NAAA 2EQ9A 3OZ2A 4Y4MA 3LZWA 3NRNA 3CNJA 1NG3A 1YQ3A 2C67A 2ZZ0A 3IF9A 1GRGA 3HYWA 4OPCA 1N4VA 2TMDA 4A6NA 2YM1A 4B68A 2Q0KA 3DA1A 1S2YA 4U8MA 1JRYA 4EQSA 3KU9A 3LOVA 1CBOA 4N9XA 1PS9A 3UOXA 3LXDA 1ZDLA 3ITJA 4E0VA 3KA7A 3SFEA 1GRTA 2X8HA 2ACZA 2B9WA 3HYXA 4NTEA 1EBDA 4RG4A 3CMMA 3AD8B 3F8PA 4GRTA 1V59A 4NEWA 4O5UA 3L1RA 5BRTA 4U8PA 4GAVA 2GR3A 2WDQA 4II3A 2B9YA 2YR5A 4EM3A 3QFAA 3UOYA 1KFYA 1TRBA 2BCGG 1GERA 3GWDA 3UP4A 1FEBA 1ZOVA 4U2SA 4YTMA 4H4QA 4DNAA 2R0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK7 A;  4OPI A;  1TDO A;  1NHS A;  2OA1 A;  4JY3 A;  2Q7V A;  1K0L A;  2GRT A;  1JEH A;  4B64 A;  3IWA A;  4JQ9 A;  2YVJ A;  4Y4L A;  1NPX A;  3IC9 A;  2YQU A;  1K0J A;  2YR4 A;  4GDP A;  1DOE A;  2ZZB A;  2GQW A;  1TDN A;  5FS9 A;  3I6D A;  1BF3 A;  1TYP A;  3URH A;  3NYE A;  4JY2 A;  4BK1 A;  1PJ7 A;  1S3E A;  2GVC A;  4IA5 A;  5KVI A;  3DK9 A;  1BGN A;  2X99 A;  1XPQ A;  1GEU A;  4J36 A;  3KLJ A;  1ZKQ A;  2Y6R A;  3BI2 A;  3NN0 X;  4CNJ A;  2C66 A;  3G5Q A;  1IUU A;  1Q1W A;  2BK5 A;  4D03 A;  3AWI A;  1DXL A;  4P9S A;  3UKK A;  2H89 A;  1GSN A;  1MO9 A;  1L9C A;  3V3N A;  5U63 A;  1H81 A;  4H4S A;  1NG4 A;  1XHC A;  2YG6 A;  3AEF A;  4LA1 A;  5U1O A;  2VVM A;  1KF6 A;  2XVE A;  3AEG A;  5KWF A;  1OJT A;  2YG4 A;  4IVO B;  1Y56 B;  3AYJ A;  3NIX A;  3BI4 A;  4LU6 A;  3AE3 A;  3AXB A;  3CPI G;  4FK1 C;  3K30 A;  3GYJ A;  1EL8 A;  2FJA A;  1GND A;  3C4N A;  3HZL A;  2OLO A;  2WOV A;  4H4P A;  3M0O A;  4U8L A;  3RHA A;  1BZL A;  1PJ5 A;  3LB8 A;  4H4W A;  4ADW A;  4CRT A;  3GMC A;  2CVJ A;  4KX6 A;  3FPZ A;  2F5Z A;  2YLW A;  5J60 A;  3BHF A;  2FJE A;  2GQF A;  3AE1 A;  3I3L A;  1Q1R A;  3NHO X;  1SEZ A;  2YLR A;  3PVC A;  1NEK A;  3CNS A;  2GAG B;  3ADA B;  1KNP A;  1GRH A;  4ZCD A;  4AOX A;  4U2T A;  2E5V A;  4M52 A;  5EB4 A;  4B63 A;  3KVE A;  4X9N A;  4H2Q A;  4WX1 A;  2C64 A;  3VRD B;  1XAN A;  5KRQ A;  1VQW A;  2R46 A;  3PO7 A;  4EIP A;  4IA6 A;  1GET A;  1L9D A;  1PXA A;  3OC4 A;  3GD4 A;  4B66 A;  1N1P A;  5LV9 A;  3GRT A;  2CDU A;  4CCR A;  1YQ4 A;  1BGJ A;  3F8R A;  3ICT A;  2WEU A;  3AEE A;  4H4T A;  2XLS A;  1IJH A;  4A6N B;  5EB5 A;  4U8K A;  3KD9 A;  4H50 A;  2WOW A;  2QCU A;  2YLT A;  4OPG A;  3P4Q A;  3LJP A;  2Z5X A;  1MOK A;  2JK6 A;  4BJY A;  3RP7 A;  4Z2U A;  3AYI A;  2X50 A;  4EQW A;  2GAH B;  3AEB A;  2JB1 A;  1GAL A;  4U8I A;  5DBJ A;  3P4S A;  3GSI A;  4K8D A;  1OJD A;  4ZN0 A;  2RGH A;  4H7U A;  1DOD A;  2NVK X;  4DSG A;  2OAM A;  2GF3 A;  1FEC A;  1NHP A;  2J3N A;  3CGC A;  2YVG A;  4J31 A;  2GR1 A;  2WDV A;  2XFU A;  1CHU A;  1E1K A;  3NK0 X;  4O5Q A;  3CN8 A;  4TM3 A;  3P9U A;  1LPF A;  3VQR A;  2AAQ A;  1L9E A;  3NK2 X;  3PS9 A;  1Z6L A;  3UKA A;  3NGC X;  4D04 A;  1PHH A;  2BAB A;  2BC1 A;  4U2L A;  1CJC A;  3DGZ A;  2BS3 A;  2C65 A;  2Q6U A;  5HXI A;  3RP8 A;  3AD7 B;  2OLN A;  3AEC A;  2V3A A;  4CBQ A;  2R4J A;  3FBS A;  2R0G A;  3C4A A;  1Q9I A;  1ZMD A;  3CND A;  3UKL A;  5KOX A;  5J7X A;  2GR0 A;  3KPF A;  2JB2 A;  4H2P A;  2XDO A;  1GES A;  2UZZ A;  4J34 A;  1H7W A;  2APG A;  2BYB A;  3COX A;  2XYO A;  2C70 A;  5IQ4 A;  1P2E A;  1ZY8 A;  2GMJ A;  1BKW A;  3M12 A;  2H88 A;  4J56 A;  4YTP A;  3AE5 A;  1X31 B;  1GTE A;  2YWL A;  1KNR A;  4XWZ A;  4B69 A;  2V5Z A;  1PXB A;  4HB9 A;  4BK3 A;  2DKH A;  1JU2 A;  2GMH A;  2Z5Y A;  3D1C A;  3ICS A;  2BAC A;  3BNU A;  2WPF A;  2C76 A;  4CY8 A;  3CNP A;  3NTD A;  4K7Z A;  3QSM A;  3CPJ G;  3RNM A;  4EMW A;  2VRL A;  2BK4 A;  2VOU A;  2WET A;  4EIQ A;  2XFO A;  1EL9 A;  2YLS A;  1ONF A;  5GRT A;  1B8S A;  1NHR A;  2BS2 A;  2IVD A;  3UCL A;  1IUW A;  4YSZ A;  1DOC A;  1RP0 A;  4UP3 A;  3GRS A;  1QJD A;  3Q9T A;  1CL0 A;  3DJE A;  4EQX A;  3FIM B;  3KKJ A;  2WU2 A;  1D4D A;  3LZX A;  1OJ9 A;  3SM8 A;  2BC0 A;  1PDH A;  4OVI A;  1ZOY A;  3CGD A;  3JSK A;  2WPC A;  1JRX A;  2YR6 A;  5HY5 A;  2XLP A;  1CC2 A;  3H4K A;  2V6O A;  4A79 A;  4RSL A;  1GXF A;  2PHH A;  3AD9 B;  3LAD A;  3SGL A;  2V61 A;  2AR8 A;  2ZZC A;  4BJZ A;  4Z2R A;  2VZ2 A;  3F8D A;  4GF7 A;  3WE0 A;  3DJG X;  2E1M A;  4YKG A;  1JNR A;  2BK3 A;  1GPE A;  1ZP0 A;  5CKU A;  4APN A;  2YG5 A;  2WS3 A;  2VRM A;  4NTD A;  3VR8 A;  4Z2T A;  2WHD A;  3ICR A;  3T37 A;  4CCQ A;  3EPT A;  3ATR A;  2B9X A;  3AE7 A;  4CNK A;  4OPD A;  1JRZ A;  1YKJ A;  4NZH A;  3P1W A;  1HYU A;  4USR A;  1B4V A;  3BI5 A;  2AQJ A;  2YM2 A;  3C96 A;  3QVP A;  4JDR A;  4AT2 A;  4EM4 A;  2YG7 A;  1F6M A;  4K5S A;  5BUK A;  3B6D A;  5EBK A;  2RGO A;  2X3N A;  4OPU A;  1MXT A;  1DJQ A;  1XDI A;  1N4W A;  2BXR A;  4TLZ A;  5FS7 A;  5C3J A;  5FMH A;  3NG7 X;  2WP5 A;  4X9M A;  2A8X A;  3NNE A;  1LVL A;  2C72 A;  4C3X A;  2C73 A;  2BA9 A;  3DJJ A;  4Z43 A;  5BVA A;  5JCN A;  3DK4 A;  2B7R A;  3FG2 P;  1GOS A;  1IUT A;  1TDE A;  3AB1 A;  4U8J A;  2I0Z A;  4DGK A;  3QVR A;  3S5W A;  1AOG A;  4Z24 A;  1TDK A;  1PN0 A;  2VVL A;  2Y6Q A;  2XVH A;  4H4X A;  4UDR A;  4TM0 A;  4Y4N A;  3UTH A;  3UTE A;  1GT8 A;  2IID A;  1PBE A;  2R45 A;  1NEN A;  2EQ6 A;  1D7L A;  3QSE A;  4USQ A;  3NTA A;  3Q6J A;  1BWC A;  2VVL G;  4EMJ A;  1ZMC A;  2YVF A;  3CTY A;  4H4U A;  2B76 A;  3NT6 A;  3NYF A;  4XXG A;  4ICY A;  3V3O A;  1H7X A;  2VQB A;  2C3D A;  1FEA A;  4IV9 A;  3UKH A;  3D8X A;  4MJW A;  2GB0 A;  1D4E A;  1DJN A;  4C74 A;  5JCL A;  1EL5 A;  1L0V A;  1GRA A;  1F8R A;  4Z25 A;  5KVH A;  3H8L A;  2JBV A;  2XFP A;  1LV0 A;  1PBD A;  4GCM A;  4YSX A;  2WP6 A;  4U8N A;  4YKF A;  2XLU A;  3NLC A;  1PJ6 A;  1VRQ B;  3NH3 X;  1TDF A;  3AE6 A;  3P4R A;  1QLB A;  4H2R A;  3ZDN A;  4X4J A;  4H4Z A;  4JNQ A;  5KXJ A;  1VG0 A;  2X8G A;  2IVE A;  2OAL A;  4I58 A;  4YTN A;  4H4V A;  5ER0 A;  4Z44 A;  4J33 A;  4AP1 A;  5IPY A;  4H4R A;  1ELI A;  2RAB A;  1B5Q A;  3IHG A;  5M0Z A;  5CQF A;  1CJ2 A;  1CF3 A;  4K5R A;  4H2N A;  5HHF A;  3UOZ A;  4YT0 A;  4B67 A;  3G5S A;  4K22 A;  2XCG A;  1LQU A;  3UP5 A;  3GYI A;  4FX9 A;  2EQ7 A;  4JN9 A;  1KSU A;  3CGB A;  2X8C A;  3GD3 A;  4A9W A;  1KDG A;  3GDN A;  4YXD A;  4C77 A;  2WDR A;  2C75 A;  1RSG A;  3NK1 X;  3ATQ A;  1QO8 A;  2A89 A;  2FJB A;  2GEW A;  1N4U A;  2XVF A;  2YLZ A;  2EQ8 A;  3EF6 A;  5EOW A;  4LII A;  3NKS A;  2V3B A;  5GSN A;  1OJC A;  3AEA A;  1P2H A;  3CIR A;  2C3C A;  4RG3 A;  3O0H A;  4AP3 A;  2JKC A;  3UOV A;  3AED A;  3AE4 A;  3UKP A;  2PYX A;  1H82 A;  2XLT A;  2WQY A;  3H8I A;  3VR9 A;  3ALL A;  3B3R A;  1RYI A;  1F8W A;  3QJ4 A;  4BUR A;  4AOS A;  1E39 A;  1LQT A;  4KPR A;  3G5R A;  1IUS A;  1EL7 A;  1PBF A;  3CPH G;  1FOH A;  1DNC A;  3L8K A;  1IUX A;  5TR3 A;  3R9U A;  5JCK A;  3FMW A;  4YWO A;  3DK8 A;  2BCP A;  1M6I A;  5U25 A;  1PBB A;  2FJD A;  5BUL A;  2ARD A;  2C7G A;  3BHK A;  3ISH A;  1GV4 A;  1YY5 A;  2R4E A;  1H83 A;  1GRF A;  5HYM A;  2R0P A;  4PAA A;  3GMB A;  2YLX A;  3NYC A;  3EAO A;  1H84 A;  2WP9 A;  2BS4 A;  2CFY A;  4A99 A;  5FS6 A;  4A7A A;  2TPR A;  3AE2 A;  1NHQ A;  2QA2 A;  5IQ1 A;  1TYT A;  1FL2 A;  4IVM B;  2RGJ A;  3DME A;  2XLR A;  2ZBW A;  3AYL A;  2B7S A;  3UKQ A;  3VRA A;  2O9Z A;  2GH5 A;  3K7M X;  4K2X A;  3SFD A;  1YQZ A;  4GUV A;  4JNA A;  4YSH A;  3UTF A;  2XVJ A;  1FCD A;  4REK A;  1DOB A;  3SQP A;  2W0H A;  2WPE A;  4A5L A;  4GDE A;  1D4C A;  1Y0P A;  3P4P A;  1LTX R;  2CUL A;  3AE9 A;  1NDA A;  4OPT A;  1PBC A;  4XWR A;  1JNZ A;  3DJD A;  1K4Q A;  1F3P A;  4A65 A;  1H86 A;  4UDP A;  1M64 A;  3ABV A;  4OCG A;  3ALM A;  3II4 A;  4BK2 A;  5JCM A;  1CC4 A;  3ZYX A;  4AT0 A;  3RP6 A;  2GV8 A;  2GR2 A;  4Z26 A;  1GRB A;  1E1N A;  1KSS A;  3CNT A;  1E6E A;  2XFN A;  1B37 A;  2Q0L A;  5KOW A;  4C3Y A;  3K7T A;  1OJA A;  2FBW A;  3BNM A;  2WU5 A;  1S2Q A;  5FS8 A;  5C2T A;  4NEV A;  4OPL A;  4CY6 A;  2HQM A;  3ALJ A;  4B1B A;  5JCI A;  4ZCC A;  4ECH A;  2VQ7 A;  3GWF A;  1O95 A;  2WES A;  4J57 A;  1VG9 A;  2JAE A;  1COY A;  1W4X A;  1O5W A;  3E1T A;  4BV6 A;  3VRB A;  1CC6 A;  4J2W A;  3GDP A;  2V60 A;  1D7Y A;  1Y56 A;  4FDC B;  2WOI A;  3AE8 A;  3IHM A;  1PXC A;  4B65 A;  3CGE A;  3QSS A;  3RED A;  2DKI A;  4YSY A;  3K7Q X;  1E1L A;  4UDQ A;  1UKV G;  4TM4 A;  3V76 A;  2WBA A;  4U8O A;  2R9Z A;  1E1M A;  3NN6 X;  4GR1 A;  3S61 A;  4I59 A;  4H4Y A;  3DGH A;  2YG3 A;  4FK1 A;  1REO A;  1ZX9 A;  1K0I A;  1O94 A;  5M10 A;  1D5T A;  1E7P A;  4WCT A;  4HA6 A;  4DSH A;  1GTH A;  1LJ1 A;  2BXS A;  4TM1 A;  4EMI A;  2E4G A;  2NPX A;  2QA1 A;  1GRE A;  2XVI A;  4C5O A;  1H6V A;  1CJ3 A;  2JB3 A;  3M13 A;  3UKF A;  2XFQ A;  5L46 A;  4TLX A;  2A87 A;  1VDC A;  4NTC A;  1F8S A;  3DH9 A;  1CJ4 A;  2YAU A;  4PAB A;  1JOA A;  3EAN A;  1IUV A;  1S3B A;  2QAE A;  3QFB A;  4EQR A;  3UTG A;  1NAA A;  2EQ9 A;  3OZ2 A;  4Y4M A;  3LZW A;  3NRN A;  3CNJ A;  1NG3 A;  1YQ3 A;  2C67 A;  2ZZ0 A;  3IF9 A;  1GRG A;  4OPC A;  1N4V A;  2TMD A;  4A6N A;  2YM1 A;  4B68 A;  2Q0K A;  3DA1 A;  1S2Y A;  4U8M A;  1JRY A;  4EQS A;  3KU9 A;  3LOV A;  1CBO A;  4N9X A;  1PS9 A;  3UOX A;  3LXD A;  1ZDL A;  3ITJ A;  4E0V A;  3KA7 A;  3SFE A;  1GRT A;  2X8H A;  2ACZ A;  2B9W A;  4NTE A;  1EBD A;  4RG4 A;  4GRT A;  3AD8 B;  3F8P A;  1V59 A;  4NEW A;  4O5U A;  3L1R A;  5BRT A;  4U8P A;  2GR3 A;  2WDQ A;  4EM3 A;  2B9Y A;  2YR5 A;  3QFA A;  3UOY A;  1KFY A;  1TRB A;  2BCG G;  1GER A;  3GWD A;  3UP4 A;  1FEB A;  1ZOV A;  4U2S A;  4YTM A;  4H4Q A;  4DNA A;  2R0C A; 
#chains in the Genus database with same CATH topology
 1ZK7 A;  4OPI A;  1TDO A;  1NHS A;  2OA1 A;  4JY3 A;  2Q7V A;  1K0L A;  2GRT A;  1JEH A;  4B64 A;  3IWA A;  4JQ9 A;  2YVJ A;  4Y4L A;  1NPX A;  3IC9 A;  2YQU A;  1K0J A;  2YR4 A;  4GDP A;  1DOE A;  2ZZB A;  2GQW A;  1TDN A;  5FS9 A;  3I6D A;  1BF3 A;  1TYP A;  3URH A;  3NYE A;  4JY2 A;  4BK1 A;  1PJ7 A;  1S3E A;  2GVC A;  4IA5 A;  5KVI A;  3DK9 A;  1BGN A;  2X99 A;  1XPQ A;  1GEU A;  4J36 A;  3KLJ A;  1ZKQ A;  2Y6R A;  3BI2 A;  3NN0 X;  4CNJ A;  2C66 A;  3G5Q A;  3SZ0 A;  1IUU A;  1Q1W A;  2BK5 A;  4D03 A;  3AWI A;  1DXL A;  4P9S A;  3UKK A;  2H89 A;  1GSN A;  1MO9 A;  1L9C A;  3V3N A;  5U63 A;  1H81 A;  4H4S A;  1NG4 A;  1XHC A;  2YG6 A;  3AEF A;  4LA1 A;  5U1O A;  2VVM A;  1KF6 A;  2XVE A;  3AEG A;  5KWF A;  1OJT A;  2YG4 A;  4IVO B;  1Y56 B;  3AYJ A;  3NIX A;  3BI4 A;  4LU6 A;  3AE3 A;  3AXB A;  3HYV A;  3CPI G;  4FK1 C;  3K30 A;  3GYJ A;  1EL8 A;  2FJA A;  1GND A;  3C4N A;  3HZL A;  2OLO A;  2WOV A;  4H4P A;  3M0O A;  4U8L A;  3RHA A;  4G6H A;  1BZL A;  1PJ5 A;  3LB8 A;  4H4W A;  3SYI A;  4ADW A;  4CRT A;  3GMC A;  2CVJ A;  4KX6 A;  3FPZ A;  2F5Z A;  2YLW A;  5J60 A;  3BHF A;  2FJE A;  5KMS A;  2GQF A;  3AE1 A;  3I3L A;  1Q1R A;  3NHO X;  1SEZ A;  2YLR A;  3PVC A;  1NEK A;  3CNS A;  2GAG B;  3ADA B;  1KNP A;  1GRH A;  4ZCD A;  4AOX A;  4U2T A;  2E5V A;  4M52 A;  5EB4 A;  4B63 A;  3KVE A;  4X9N A;  4H2Q A;  4WX1 A;  2C64 A;  3VRD B;  1XAN A;  5KRQ A;  1VQW A;  2R46 A;  3PO7 A;  4EIP A;  4IA6 A;  1GET A;  1L9D A;  1PXA A;  3OC4 A;  3GD4 A;  4B66 A;  1N1P A;  5LV9 A;  3GRT A;  2CDU A;  4CCR A;  1YQ4 A;  1BGJ A;  3F8R A;  3ICT A;  2WEU A;  3AEE A;  4H4T A;  2XLS A;  1IJH A;  4A6N B;  5EB5 A;  4U8K A;  3KD9 A;  4H50 A;  2WOW A;  2QCU A;  2YLT A;  4OPG A;  3P4Q A;  3LJP A;  2Z5X A;  1MOK A;  2JK6 A;  4BJY A;  3RP7 A;  4Z2U A;  3AYI A;  2X50 A;  4EQW A;  5KNL A;  2GAH B;  3AEB A;  2JB1 A;  1GAL A;  4U8I A;  5DBJ A;  3P4S A;  3GSI A;  4K8D A;  1OJD A;  4ZN0 A;  2RGH A;  4H7U A;  1DOD A;  2NVK X;  4DSG A;  2OAM A;  2GF3 A;  1FEC A;  1NHP A;  2J3N A;  3CGC A;  2YVG A;  4J31 A;  2GR1 A;  2WDV A;  2XFU A;  1CHU A;  1E1K A;  3NK0 X;  4O5Q A;  3CN8 A;  4TM3 A;  3P9U A;  1LPF A;  3VQR A;  2AAQ A;  1L9E A;  3NK2 X;  2C4C A;  3PS9 A;  1Z6L A;  3UKA A;  3NGC X;  4D04 A;  1PHH A;  2BAB A;  2BC1 A;  3SZC A;  4U2L A;  1CJC A;  3DGZ A;  2BS3 A;  2C65 A;  2Q6U A;  5HXI A;  3RP8 A;  3AD7 B;  2OLN A;  3AEC A;  2V3A A;  4CBQ A;  2R4J A;  3FBS A;  2R0G A;  3C4A A;  1Q9I A;  1ZMD A;  3CND A;  3UKL A;  5KOX A;  5J7X A;  2GR0 A;  3KPF A;  2JB2 A;  4H2P A;  2XDO A;  1GES A;  2UZZ A;  4J34 A;  1H7W A;  2APG A;  2BYB A;  3COX A;  2XYO A;  2C70 A;  5IQ4 A;  1P2E A;  1ZY8 A;  2GMJ A;  1BKW A;  3M12 A;  2H88 A;  4J56 A;  4YTP A;  3AE5 A;  1X31 B;  1GTE A;  2YWL A;  1KNR A;  4XWZ A;  4B69 A;  2V5Z A;  1PXB A;  4HB9 A;  4BK3 A;  2DKH A;  1JU2 A;  2GMH A;  2Z5Y A;  3D1C A;  3ICS A;  2BAC A;  3BNU A;  2WPF A;  2C76 A;  3T2K A;  3CNP A;  4CY8 A;  3NTD A;  3SX6 A;  4K7Z A;  3QSM A;  3CPJ G;  3RNM A;  4EMW A;  2VRL A;  3T31 A;  2BK4 A;  2VOU A;  2WET A;  4EIQ A;  2XFO A;  1EL9 A;  2YLS A;  1ONF A;  5GRT A;  1B8S A;  1NHR A;  2BS2 A;  4NWZ A;  2IVD A;  3UCL A;  1IUW A;  4YSZ A;  1DOC A;  1RP0 A;  4UP3 A;  3GRS A;  1QJD A;  3Q9T A;  1CL0 A;  3DJE A;  4EQX A;  3FIM B;  3KKJ A;  2WU2 A;  1D4D A;  3LZX A;  1OJ9 A;  3SM8 A;  2BC0 A;  1PDH A;  4OVI A;  3SZF A;  1ZOY A;  3CGD A;  3JSK A;  2WPC A;  1JRX A;  2YR6 A;  5HY5 A;  4G73 A;  2XLP A;  1CC2 A;  3H4K A;  2V6O A;  4A79 A;  4RSL A;  1GXF A;  2PHH A;  3AD9 B;  3LAD A;  3SGL A;  2V61 A;  2AR8 A;  2ZZC A;  4BJZ A;  4Z2R A;  2VZ2 A;  3F8D A;  4GF7 A;  3WE0 A;  3DJG X;  2E1M A;  4YKG A;  1JNR A;  2BK3 A;  1GPE A;  1ZP0 A;  5CKU A;  4APN A;  2YG5 A;  2WS3 A;  2VRM A;  4NTD A;  3VR8 A;  4Z2T A;  2WHD A;  3ICR A;  3T37 A;  4CCQ A;  3EPT A;  3ATR A;  2B9X A;  3AE7 A;  4CNK A;  4OPD A;  1JRZ A;  1YKJ A;  4NZH A;  3P1W A;  1HYU A;  4USR A;  1B4V A;  3BI5 A;  2AQJ A;  2YM2 A;  3C96 A;  3QVP A;  4JDR A;  5KMQ A;  4AT2 A;  4EM4 A;  2YG7 A;  1F6M A;  4K5S A;  5BUK A;  3B6D A;  5EBK A;  2RGO A;  2X3N A;  4OPU A;  1MXT A;  1DJQ A;  1XDI A;  1N4W A;  2BXR A;  4TLZ A;  5FS7 A;  5C3J A;  5FMH A;  3T2Y A;  3NG7 X;  2WP5 A;  4X9M A;  2A8X A;  3NNE A;  1LVL A;  2C72 A;  4G74 A;  4C3X A;  2C73 A;  2BA9 A;  3DJJ A;  4Z43 A;  5BVA A;  5JCN A;  3DK4 A;  2B7R A;  3FG2 P;  1GOS A;  1IUT A;  1TDE A;  3AB1 A;  4U8J A;  2I0Z A;  4DGK A;  3QVR A;  3S5W A;  1AOG A;  4Z24 A;  1TDK A;  1PN0 A;  2VVL A;  2Y6Q A;  2XVH A;  4H4X A;  4UDR A;  4TM0 A;  4Y4N A;  3UTH A;  3UTE A;  1GT8 A;  2IID A;  1PBE A;  2R45 A;  1NEN A;  2EQ6 A;  1D7L A;  3QSE A;  4USQ A;  3NTA A;  3Q6J A;  1BWC A;  2VVL G;  4EMJ A;  1ZMC A;  2YVF A;  3CTY A;  4H4U A;  2B76 A;  3NT6 A;  3NYF A;  4XXG A;  3SZW A;  4ICY A;  3V3O A;  1H7X A;  2VQB A;  2C3D A;  1FEA A;  4IV9 A;  3UKH A;  3D8X A;  4MJW A;  2GB0 A;  1D4E A;  1DJN A;  4C74 A;  5JCL A;  1EL5 A;  3GYX A;  1L0V A;  1GRA A;  1F8R A;  4Z25 A;  5KVH A;  3H8L A;  2JBV A;  2XFP A;  1LV0 A;  1PBD A;  4GCM A;  4YSX A;  2WP6 A;  4U8N A;  4YKF A;  2XLU A;  3NLC A;  1PJ6 A;  1VRQ B;  4NNJ A;  3NH3 X;  1TDF A;  3AE6 A;  3P4R A;  1QLB A;  4H2R A;  3ZDN A;  4X4J A;  4H4Z A;  4JNQ A;  5KXJ A;  1VG0 A;  2X8G A;  2IVE A;  2OAL A;  4I58 A;  4YTN A;  4H4V A;  5ER0 A;  4Z44 A;  4J33 A;  4AP1 A;  5IPY A;  4H4R A;  1ELI A;  2RAB A;  1B5Q A;  3IHG A;  5M0Z A;  5CQF A;  1CJ2 A;  1CF3 A;  4K5R A;  4H2N A;  5HHF A;  3UOZ A;  4YT0 A;  4B67 A;  3G5S A;  4K22 A;  2XCG A;  1LQU A;  3UP5 A;  3GYI A;  4FX9 A;  4G6G A;  2EQ7 A;  4JN9 A;  1KSU A;  3CGB A;  2X8C A;  3GD3 A;  4A9W A;  1KDG A;  3GDN A;  4YXD A;  4C77 A;  2WDR A;  2C75 A;  1RSG A;  3NK1 X;  3ATQ A;  1QO8 A;  2A89 A;  2FJB A;  2GEW A;  1N4U A;  2XVF A;  2YLZ A;  2EQ8 A;  3EF6 A;  5EOW A;  4LII A;  3NKS A;  2V3B A;  3T14 A;  5GSN A;  1OJC A;  3AEA A;  3T2Z A;  1P2H A;  3CIR A;  2C3C A;  4GAP A;  4RG3 A;  2BRY A;  3O0H A;  4AP3 A;  2JKC A;  3UOV A;  3AED A;  3AE4 A;  3UKP A;  2PYX A;  1H82 A;  2XLT A;  2WQY A;  3H8I A;  3VR9 A;  3ALL A;  3B3R A;  1RYI A;  5KMR A;  1F8W A;  3QJ4 A;  4BUR A;  4AOS A;  1E39 A;  1LQT A;  4KPR A;  3G5R A;  1IUS A;  1EL7 A;  1PBF A;  3CPH G;  1FOH A;  1DNC A;  3L8K A;  1IUX A;  5TR3 A;  3R9U A;  5JCK A;  3FMW A;  4YWO A;  3DK8 A;  2BCP A;  1M6I A;  5U25 A;  1PBB A;  2FJD A;  5BUL A;  2ARD A;  2C7G A;  3BHK A;  3ISH A;  1GV4 A;  1YY5 A;  2R4E A;  1H83 A;  1GRF A;  5HYM A;  2R0P A;  4PAA A;  4G9K A;  3GMB A;  2YLX A;  3NYC A;  3EAO A;  1H84 A;  2WP9 A;  2BS4 A;  2CFY A;  4A99 A;  5FS6 A;  4A7A A;  2TPR A;  3AE2 A;  1NHQ A;  2BRA A;  2QA2 A;  5IQ1 A;  1TYT A;  1FL2 A;  4IVM B;  3SY4 A;  2RGJ A;  3DME A;  2XLR A;  2ZBW A;  3AYL A;  2B7S A;  3UKQ A;  3VRA A;  2O9Z A;  2GH5 A;  3K7M X;  4K2X A;  3SFD A;  1YQZ A;  4GUV A;  4JNA A;  4YSH A;  3UTF A;  2XVJ A;  1FCD A;  4REK A;  1DOB A;  3SQP A;  2W0H A;  2WPE A;  4A5L A;  4GDE A;  1D4C A;  1Y0P A;  3P4P A;  1LTX R;  2CUL A;  3AE9 A;  1NDA A;  4OPT A;  5KMP A;  1PBC A;  4XWR A;  1JNZ A;  3DJD A;  1K4Q A;  1F3P A;  4A65 A;  1H86 A;  4UDP A;  1M64 A;  3ABV A;  4OCG A;  3KPK A;  3ALM A;  3II4 A;  4BK2 A;  5JCM A;  1CC4 A;  3ZYX A;  4AT0 A;  3RP6 A;  2GV8 A;  2GR2 A;  4Z26 A;  1GRB A;  1E1N A;  1KSS A;  3CNT A;  1E6E A;  2XFN A;  1B37 A;  2Q0L A;  5KOW A;  4C3Y A;  3K7T A;  1OJA A;  2FBW A;  3BNM A;  2WU5 A;  1S2Q A;  3T0K A;  5FS8 A;  5C2T A;  4NEV A;  4OPL A;  4CY6 A;  2HQM A;  3ALJ A;  4B1B A;  5JCI A;  4ZCC A;  4ECH A;  2VQ7 A;  3GWF A;  1O95 A;  2WES A;  4J57 A;  1VG9 A;  2JAE A;  1COY A;  1W4X A;  1O5W A;  3E1T A;  4BV6 A;  3VRB A;  1CC6 A;  4J2W A;  3GDP A;  2V60 A;  1D7Y A;  1Y56 A;  4FDC B;  2WOI A;  4II2 A;  3AE8 A;  3IHM A;  1PXC A;  4B65 A;  3CGE A;  3QSS A;  3RED A;  2DKI A;  4YSY A;  3K7Q X;  1E1L A;  4UDQ A;  1UKV G;  4TM4 A;  3V76 A;  2WBA A;  4U8O A;  2R9Z A;  1E1M A;  3NN6 X;  4GR1 A;  3S61 A;  4I59 A;  4H4Y A;  3DGH A;  2YG3 A;  4FK1 A;  1REO A;  1ZX9 A;  1K0I A;  1O94 A;  5M10 A;  3SXI A;  1D5T A;  1E7P A;  4WCT A;  4HA6 A;  4DSH A;  1GTH A;  1LJ1 A;  2BXS A;  4TM1 A;  4EMI A;  2E4G A;  2NPX A;  2QA1 A;  1GRE A;  2XVI A;  4C5O A;  1H6V A;  1CJ3 A;  2JB3 A;  3M13 A;  3UKF A;  2XFQ A;  5L46 A;  4TLX A;  2A87 A;  1VDC A;  4NTC A;  1F8S A;  3DH9 A;  1CJ4 A;  2YAU A;  4PAB A;  1JOA A;  3EAN A;  1IUV A;  1S3B A;  2QAE A;  3QFB A;  4EQR A;  3UTG A;  1NAA A;  2EQ9 A;  3OZ2 A;  4Y4M A;  3LZW A;  3NRN A;  3CNJ A;  1NG3 A;  1YQ3 A;  2C67 A;  2ZZ0 A;  3IF9 A;  1GRG A;  3HYW A;  4OPC A;  1N4V A;  2TMD A;  4A6N A;  2YM1 A;  4B68 A;  2Q0K A;  3DA1 A;  1S2Y A;  4U8M A;  1JRY A;  4EQS A;  3KU9 A;  3LOV A;  1CBO A;  4N9X A;  1PS9 A;  3UOX A;  3LXD A;  1ZDL A;  3ITJ A;  4E0V A;  3KA7 A;  3SFE A;  1GRT A;  2X8H A;  2ACZ A;  2B9W A;  3HYX A;  4NTE A;  1EBD A;  4RG4 A;  3CMM A;  3AD8 B;  3F8P A;  4GRT A;  1V59 A;  4NEW A;  4O5U A;  3L1R A;  5BRT A;  4U8P A;  4GAV A;  2GR3 A;  2WDQ A;  4II3 A;  2B9Y A;  2YR5 A;  4EM3 A;  3QFA A;  3UOY A;  1KFY A;  1TRB A;  2BCG G;  1GER A;  3GWD A;  3UP4 A;  1FEB A;  1ZOV A;  4U2S A;  4YTM A;  4H4Q A;  4DNA A;  2R0C A; 
#chains in the Genus database with same CATH homology
 1ZK7 A;  4OPI A;  1TDO A;  1NHS A;  2OA1 A;  4JY3 A;  2Q7V A;  1K0L A;  2GRT A;  1JEH A;  4B64 A;  3IWA A;  4JQ9 A;  2YVJ A;  4Y4L A;  1NPX A;  3IC9 A;  2YQU A;  1K0J A;  2YR4 A;  4GDP A;  1DOE A;  2ZZB A;  2GQW A;  1TDN A;  5FS9 A;  3I6D A;  1BF3 A;  1TYP A;  3URH A;  3NYE A;  4JY2 A;  4BK1 A;  1PJ7 A;  1S3E A;  2GVC A;  4IA5 A;  5KVI A;  3DK9 A;  1BGN A;  2X99 A;  1XPQ A;  1GEU A;  4J36 A;  3KLJ A;  1ZKQ A;  2Y6R A;  3BI2 A;  3NN0 X;  4CNJ A;  2C66 A;  3G5Q A;  3SZ0 A;  1IUU A;  1Q1W A;  2BK5 A;  4D03 A;  3AWI A;  1DXL A;  4P9S A;  3UKK A;  2H89 A;  1GSN A;  1MO9 A;  1L9C A;  3V3N A;  5U63 A;  1H81 A;  4H4S A;  1NG4 A;  1XHC A;  2YG6 A;  3AEF A;  4LA1 A;  5U1O A;  2VVM A;  1KF6 A;  2XVE A;  3AEG A;  5KWF A;  1OJT A;  2YG4 A;  4IVO B;  1Y56 B;  3AYJ A;  3NIX A;  3BI4 A;  4LU6 A;  3AE3 A;  3AXB A;  3HYV A;  3CPI G;  4FK1 C;  3K30 A;  3GYJ A;  1EL8 A;  2FJA A;  1GND A;  3C4N A;  3HZL A;  2OLO A;  2WOV A;  4H4P A;  3M0O A;  4U8L A;  3RHA A;  4G6H A;  1BZL A;  1PJ5 A;  3LB8 A;  4H4W A;  3SYI A;  4ADW A;  4CRT A;  3GMC A;  2CVJ A;  4KX6 A;  3FPZ A;  2F5Z A;  2YLW A;  5J60 A;  3BHF A;  2FJE A;  5KMS A;  2GQF A;  3AE1 A;  3I3L A;  1Q1R A;  3NHO X;  1SEZ A;  2YLR A;  3PVC A;  1NEK A;  3CNS A;  2GAG B;  3ADA B;  1KNP A;  1GRH A;  4ZCD A;  4AOX A;  4U2T A;  2E5V A;  4M52 A;  5EB4 A;  4B63 A;  3KVE A;  4X9N A;  4H2Q A;  4WX1 A;  2C64 A;  3VRD B;  1XAN A;  5KRQ A;  1VQW A;  2R46 A;  3PO7 A;  4EIP A;  4IA6 A;  1GET A;  1L9D A;  1PXA A;  3OC4 A;  3GD4 A;  4B66 A;  1N1P A;  5LV9 A;  3GRT A;  2CDU A;  4CCR A;  1YQ4 A;  1BGJ A;  3F8R A;  3ICT A;  2WEU A;  3AEE A;  4H4T A;  2XLS A;  1IJH A;  4A6N B;  5EB5 A;  4U8K A;  3KD9 A;  4H50 A;  2WOW A;  2QCU A;  2YLT A;  4OPG A;  3P4Q A;  3LJP A;  2Z5X A;  1MOK A;  2JK6 A;  4BJY A;  3RP7 A;  4Z2U A;  3AYI A;  2X50 A;  4EQW A;  5KNL A;  2GAH B;  3AEB A;  2JB1 A;  1GAL A;  4U8I A;  5DBJ A;  3P4S A;  3GSI A;  4K8D A;  1OJD A;  4ZN0 A;  2RGH A;  4H7U A;  1DOD A;  2NVK X;  4DSG A;  2OAM A;  2GF3 A;  1FEC A;  1NHP A;  2J3N A;  3CGC A;  2YVG A;  4J31 A;  2GR1 A;  2WDV A;  2XFU A;  1CHU A;  1E1K A;  3NK0 X;  4O5Q A;  3CN8 A;  4TM3 A;  3P9U A;  1LPF A;  3VQR A;  2AAQ A;  1L9E A;  3NK2 X;  2C4C A;  3PS9 A;  1Z6L A;  3UKA A;  3NGC X;  4D04 A;  1PHH A;  2BAB A;  2BC1 A;  3SZC A;  4U2L A;  1CJC A;  3DGZ A;  2BS3 A;  2C65 A;  2Q6U A;  5HXI A;  3RP8 A;  3AD7 B;  2OLN A;  3AEC A;  2V3A A;  4CBQ A;  2R4J A;  3FBS A;  2R0G A;  3C4A A;  1Q9I A;  1ZMD A;  3CND A;  3UKL A;  5KOX A;  5J7X A;  2GR0 A;  3KPF A;  2JB2 A;  4H2P A;  2XDO A;  1GES A;  2UZZ A;  4J34 A;  1H7W A;  2APG A;  2BYB A;  3COX A;  2XYO A;  2C70 A;  5IQ4 A;  1P2E A;  1ZY8 A;  2GMJ A;  1BKW A;  3M12 A;  2H88 A;  4J56 A;  4YTP A;  3AE5 A;  1X31 B;  1GTE A;  2YWL A;  1KNR A;  4XWZ A;  4B69 A;  2V5Z A;  1PXB A;  4HB9 A;  4BK3 A;  2DKH A;  1JU2 A;  2GMH A;  2Z5Y A;  3D1C A;  3ICS A;  2BAC A;  3BNU A;  2WPF A;  2C76 A;  3T2K A;  3CNP A;  4CY8 A;  3NTD A;  3SX6 A;  4K7Z A;  3QSM A;  3CPJ G;  3RNM A;  4EMW A;  2VRL A;  3T31 A;  2BK4 A;  2VOU A;  2WET A;  4EIQ A;  2XFO A;  1EL9 A;  2YLS A;  1ONF A;  5GRT A;  1B8S A;  1NHR A;  2BS2 A;  4NWZ A;  2IVD A;  3UCL A;  1IUW A;  4YSZ A;  1DOC A;  1RP0 A;  4UP3 A;  3GRS A;  1QJD A;  3Q9T A;  1CL0 A;  3DJE A;  4EQX A;  3FIM B;  3KKJ A;  2WU2 A;  1D4D A;  3LZX A;  1OJ9 A;  3SM8 A;  2BC0 A;  1PDH A;  4OVI A;  3SZF A;  1ZOY A;  3CGD A;  3JSK A;  2WPC A;  1JRX A;  2YR6 A;  5HY5 A;  4G73 A;  2XLP A;  1CC2 A;  3H4K A;  2V6O A;  4A79 A;  4RSL A;  1GXF A;  2PHH A;  3AD9 B;  3LAD A;  3SGL A;  2V61 A;  2AR8 A;  2ZZC A;  4BJZ A;  4Z2R A;  2VZ2 A;  3F8D A;  4GF7 A;  3WE0 A;  3DJG X;  2E1M A;  4YKG A;  1JNR A;  2BK3 A;  1GPE A;  1ZP0 A;  5CKU A;  4APN A;  2YG5 A;  2WS3 A;  2VRM A;  4NTD A;  3VR8 A;  4Z2T A;  2WHD A;  3ICR A;  3T37 A;  4CCQ A;  3EPT A;  3ATR A;  2B9X A;  3AE7 A;  4CNK A;  4OPD A;  1JRZ A;  1YKJ A;  4NZH A;  3P1W A;  1HYU A;  4USR A;  1B4V A;  3BI5 A;  2AQJ A;  2YM2 A;  3C96 A;  3QVP A;  4JDR A;  5KMQ A;  4AT2 A;  4EM4 A;  2YG7 A;  1F6M A;  4K5S A;  5BUK A;  3B6D A;  5EBK A;  2RGO A;  2X3N A;  4OPU A;  1MXT A;  1DJQ A;  1XDI A;  1N4W A;  2BXR A;  4TLZ A;  5FS7 A;  5C3J A;  5FMH A;  3T2Y A;  3NG7 X;  2WP5 A;  4X9M A;  2A8X A;  3NNE A;  1LVL A;  2C72 A;  4G74 A;  4C3X A;  2C73 A;  2BA9 A;  3DJJ A;  4Z43 A;  5BVA A;  5JCN A;  3DK4 A;  2B7R A;  3FG2 P;  1GOS A;  1IUT A;  1TDE A;  3AB1 A;  4U8J A;  2I0Z A;  4DGK A;  3QVR A;  3S5W A;  1AOG A;  4Z24 A;  1TDK A;  1PN0 A;  2VVL A;  2Y6Q A;  2XVH A;  4H4X A;  4UDR A;  4TM0 A;  4Y4N A;  3UTH A;  3UTE A;  1GT8 A;  2IID A;  1PBE A;  2R45 A;  1NEN A;  2EQ6 A;  1D7L A;  3QSE A;  4USQ A;  3NTA A;  3Q6J A;  1BWC A;  2VVL G;  4EMJ A;  1ZMC A;  2YVF A;  3CTY A;  4H4U A;  2B76 A;  3NT6 A;  3NYF A;  4XXG A;  3SZW A;  4ICY A;  3V3O A;  1H7X A;  2VQB A;  2C3D A;  1FEA A;  4IV9 A;  3UKH A;  3D8X A;  4MJW A;  2GB0 A;  1D4E A;  1DJN A;  4C74 A;  5JCL A;  1EL5 A;  3GYX A;  1L0V A;  1GRA A;  1F8R A;  4Z25 A;  5KVH A;  3H8L A;  2JBV A;  2XFP A;  1LV0 A;  1PBD A;  4GCM A;  4YSX A;  2WP6 A;  4U8N A;  4YKF A;  2XLU A;  3NLC A;  1PJ6 A;  1VRQ B;  4NNJ A;  3NH3 X;  1TDF A;  3AE6 A;  3P4R A;  1QLB A;  4H2R A;  3ZDN A;  4X4J A;  4H4Z A;  4JNQ A;  5KXJ A;  1VG0 A;  2X8G A;  2IVE A;  2OAL A;  4I58 A;  4YTN A;  4H4V A;  5ER0 A;  4Z44 A;  4J33 A;  4AP1 A;  5IPY A;  4H4R A;  1ELI A;  2RAB A;  1B5Q A;  3IHG A;  5M0Z A;  5CQF A;  1CJ2 A;  1CF3 A;  4K5R A;  4H2N A;  5HHF A;  3UOZ A;  4YT0 A;  4B67 A;  3G5S A;  4K22 A;  2XCG A;  1LQU A;  3UP5 A;  3GYI A;  4FX9 A;  4G6G A;  2EQ7 A;  4JN9 A;  1KSU A;  3CGB A;  2X8C A;  3GD3 A;  4A9W A;  1KDG A;  3GDN A;  4YXD A;  4C77 A;  2WDR A;  2C75 A;  1RSG A;  3NK1 X;  3ATQ A;  1QO8 A;  2A89 A;  2FJB A;  2GEW A;  1N4U A;  2XVF A;  2YLZ A;  2EQ8 A;  3EF6 A;  5EOW A;  4LII A;  3NKS A;  2V3B A;  3T14 A;  5GSN A;  1OJC A;  3AEA A;  3T2Z A;  1P2H A;  3CIR A;  2C3C A;  4GAP A;  4RG3 A;  2BRY A;  3O0H A;  4AP3 A;  2JKC A;  3UOV A;  3AED A;  3AE4 A;  3UKP A;  2PYX A;  1H82 A;  2XLT A;  2WQY A;  3H8I A;  3VR9 A;  3ALL A;  3B3R A;  1RYI A;  5KMR A;  1F8W A;  3QJ4 A;  4BUR A;  4AOS A;  1E39 A;  1LQT A;  4KPR A;  3G5R A;  1IUS A;  1EL7 A;  1PBF A;  3CPH G;  1FOH A;  1DNC A;  3L8K A;  1IUX A;  5TR3 A;  3R9U A;  5JCK A;  3FMW A;  4YWO A;  3DK8 A;  2BCP A;  1M6I A;  5U25 A;  1PBB A;  2FJD A;  5BUL A;  2ARD A;  2C7G A;  3BHK A;  3ISH A;  1GV4 A;  1YY5 A;  2R4E A;  1H83 A;  1GRF A;  5HYM A;  2R0P A;  4PAA A;  4G9K A;  3GMB A;  2YLX A;  3NYC A;  3EAO A;  1H84 A;  2WP9 A;  2BS4 A;  2CFY A;  4A99 A;  5FS6 A;  4A7A A;  2TPR A;  3AE2 A;  1NHQ A;  2BRA A;  2QA2 A;  5IQ1 A;  1TYT A;  1FL2 A;  4IVM B;  3SY4 A;  2RGJ A;  3DME A;  2XLR A;  2ZBW A;  3AYL A;  2B7S A;  3UKQ A;  3VRA A;  2O9Z A;  2GH5 A;  3K7M X;  4K2X A;  3SFD A;  1YQZ A;  4GUV A;  4JNA A;  4YSH A;  3UTF A;  2XVJ A;  1FCD A;  4REK A;  1DOB A;  3SQP A;  2W0H A;  2WPE A;  4A5L A;  4GDE A;  1D4C A;  1Y0P A;  3P4P A;  1LTX R;  2CUL A;  3AE9 A;  1NDA A;  4OPT A;  5KMP A;  1PBC A;  4XWR A;  1JNZ A;  3DJD A;  1K4Q A;  1F3P A;  4A65 A;  1H86 A;  4UDP A;  1M64 A;  3ABV A;  4OCG A;  3KPK A;  3ALM A;  3II4 A;  4BK2 A;  5JCM A;  1CC4 A;  3ZYX A;  4AT0 A;  3RP6 A;  2GV8 A;  2GR2 A;  4Z26 A;  1GRB A;  1E1N A;  1KSS A;  3CNT A;  1E6E A;  2XFN A;  1B37 A;  2Q0L A;  5KOW A;  4C3Y A;  3K7T A;  1OJA A;  2FBW A;  3BNM A;  2WU5 A;  1S2Q A;  3T0K A;  5FS8 A;  5C2T A;  4NEV A;  4OPL A;  4CY6 A;  2HQM A;  3ALJ A;  4B1B A;  5JCI A;  4ZCC A;  4ECH A;  2VQ7 A;  3GWF A;  1O95 A;  2WES A;  4J57 A;  1VG9 A;  2JAE A;  1COY A;  1W4X A;  1O5W A;  3E1T A;  4BV6 A;  3VRB A;  1CC6 A;  4J2W A;  3GDP A;  2V60 A;  1D7Y A;  1Y56 A;  4FDC B;  2WOI A;  4II2 A;  3AE8 A;  3IHM A;  1PXC A;  4B65 A;  3CGE A;  3QSS A;  3RED A;  2DKI A;  4YSY A;  3K7Q X;  1E1L A;  4UDQ A;  1UKV G;  4TM4 A;  3V76 A;  2WBA A;  4U8O A;  2R9Z A;  1E1M A;  3NN6 X;  4GR1 A;  3S61 A;  4I59 A;  4H4Y A;  3DGH A;  2YG3 A;  4FK1 A;  1REO A;  1ZX9 A;  1K0I A;  1O94 A;  5M10 A;  3SXI A;  1D5T A;  1E7P A;  4WCT A;  4HA6 A;  4DSH A;  1GTH A;  1LJ1 A;  2BXS A;  4TM1 A;  4EMI A;  2E4G A;  2NPX A;  2QA1 A;  1GRE A;  2XVI A;  4C5O A;  1H6V A;  1CJ3 A;  2JB3 A;  3M13 A;  3UKF A;  2XFQ A;  5L46 A;  4TLX A;  2A87 A;  1VDC A;  4NTC A;  1F8S A;  3DH9 A;  1CJ4 A;  2YAU A;  4PAB A;  1JOA A;  3EAN A;  1IUV A;  1S3B A;  2QAE A;  3QFB A;  4EQR A;  3UTG A;  1NAA A;  2EQ9 A;  3OZ2 A;  4Y4M A;  3LZW A;  3NRN A;  3CNJ A;  1NG3 A;  1YQ3 A;  2C67 A;  2ZZ0 A;  3IF9 A;  1GRG A;  3HYW A;  4OPC A;  1N4V A;  2TMD A;  4A6N A;  2YM1 A;  4B68 A;  2Q0K A;  3DA1 A;  1S2Y A;  4U8M A;  1JRY A;  4EQS A;  3KU9 A;  3LOV A;  1CBO A;  4N9X A;  1PS9 A;  3UOX A;  3LXD A;  1ZDL A;  3ITJ A;  4E0V A;  3KA7 A;  3SFE A;  1GRT A;  2X8H A;  2ACZ A;  2B9W A;  3HYX A;  4NTE A;  1EBD A;  4RG4 A;  3CMM A;  3AD8 B;  3F8P A;  4GRT A;  1V59 A;  4NEW A;  4O5U A;  3L1R A;  5BRT A;  4U8P A;  4GAV A;  2GR3 A;  2WDQ A;  4II3 A;  2B9Y A;  2YR5 A;  4EM3 A;  3QFA A;  3UOY A;  1KFY A;  1TRB A;  2BCG G;  1GER A;  3GWD A;  3UP4 A;  1FEB A;  1ZOV A;  4U2S A;  4YTM A;  4H4Q A;  4DNA A;  2R0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...