3UOVA

Crystal structure of otemo (fad bound form 1)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
536
Chain Sequence
b'KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 194
structure length 536
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uovA01
1JNRA 2BABA 2R45A 1FL2A 3CNPA 3II4A 2GEWA 2BA9A 5BRTA 4USQA 4P9SA 4BURA 1PHHA 5KVHA 2A87A 2RGHA 3S5WA 3CPJG 1NPXA 1ELIA 1CC2A 2WOIA 2EQ7A 4JY2A 1MXTA 1GALA 4AP1A 1E1NA 2R0GA 1CJ4A 1YQ3A 2BCPA 4FK1A 5KWFA 3AE3A 4YSYA 1K0IA 2GAGB 4NTDA 5KOWA 2JB1A 3QSEA 2C7GA 2YLTA 2Z5XA 3COXA 3AD8B 2BS2A 2I0ZA 1PXCA 4U2SA 1KNRA 3CGEA 3CPIG 1BF3A 2X99A 3GYJA 3NGCX 4BK3A 1GREA 4EQWA 4OPCA 3S61A 4YTPA 4XWRA 3FIMB 1AOGA 1JRYA 2ARDA 2BK4A 5M0ZA 2BC1A 3ICRA 4YTNA 3KVEA 2XLTA 3L8KA 4IA6A 1PXBA 3K7QX 2WPFA 1PBFA 5EB5A 2C66A 3F8PA 1GEUA 3LOVA 4EMJA 3NK2X 1GPEA 2JAEA 3IWAA 1NG4A 2BCGG 3UP5A 2C64A 5IQ4A 4J31A 4CNJA 1GRGA 2FJDA 1CL0A 1H84A 3AE4A 3GMBA 3UKKA 1ZOVA 3PO7A 1KFYA 1S2QA 3IC9A 3NNEA 1GXFA 3QJ4A 3DMEA 3K7MX 4A6NA 4C3YA 2XFQA 3UKFA 3R9UA 4RSLA 2C3CA 4U8KA 4EQSA 3URHA 3ATQA 1LVLA 3FBSA 3QVPA 3AXBA 4J56A 2B7RA 3NT6A 4H4WA 2V61A 3LJPA 3C96A 3NYCA 4OCGA 1NEKA 4APNA 3DK4A 2C75A 1O95A 2AQJA 5JCLA 3AD7B 4DSHA 1PBEA 2YLSA 3V3NA 3M12A 1F8RA 4OVIA 2BXSA 2OAMA 4GUVA 3GWDA 2H88A 1H7XA 4I58A 4B65A 2OALA 2VRLA 4B69A 1O94A 3H8IA 2WBAA 3NN0X 1IJHA 2B9WA 1SEZA 3BI2A 3SGLA 1CJ3A 3KA7A 4YSZA 4D04A 3BNMA 3UOVA 2VRMA 2YR5A 3BNUA 4J57A 4PABA 2JB3A 1DOCA 3VR8A 1ZKQA 4IVOB 4XXGA 1GRTA 1HYUA 1B5QA 3B3RA 2XLRA 3ZYXA 3P4RA 4NTCA 3CIRA 5EB4A 3DH9A 1PXAA 3NH3X 2C67A 1Z6LA 1JOAA 4K5RA 2PYXA 1EL8A 4DGKA 2DKIA 2WP5A 3UCLA 2VOUA 1XPQA 2C72A 4ZCCA 2X8HA 2WP9A 4GCMA 4UDQA 2J3NA 3EPTA 4MJWA 3ATRA 3UP4A 5DBJA 3H4KA 3UTEA 4ECHA 2YG4A 1H83A 3AEFA 5CQFA 1NHSA 2XLUA 2TPRA 3RP7A 2XVJA 3DJDA 3UOZA 4A99A 1D4DA 4DNAA 3AE1A 1JU2A 4H4XA 1ZX9A 2BYBA 1GESA 2YM2A 4GRTA 1H6VA 1E1LA 3VRAA 1Q9IA 3DK9A 3LXDA 3NRNA 1CF3A 1ZP0A 3VRDB 3UKHA 2NPXA 1TDFA 5IQ1A 1ZK7A 4BJZA 4AT0A 4ZCDA 2JK6A 3H8LA 4NTEA 2CDUA 4H4VA 3RP8A 5J60A 4GF7A 1LQUA 4A79A 1KDGA 4WCTA 3NIXA 3AWIA 5IPYA 1CJCA 1RSGA 2EQ8A 2YWLA 1QJDA 3AEEA 3I3LA 4Z24A 3SM8A 1N4VA 2XDOA 1D4EA 1UKVG 3M13A 1VG9A 2JB2A 2VQBA 1H7WA 2BS4A 2XVFA 2DKHA 2ZZCA 2RGOA 1S3BA 4CBQA 3Q6JA 4O5QA 1TDEA 1NHQA 4HA6A 2WQYA 1Y56A 2O9ZA 1ZMDA 4ICYA 4EM3A 1PBBA 1EL5A 2C3DA 5CKUA 2GR2A 3SFEA 5KRQA 3AECA 2GR1A 4M52A 1GERA 4NEWA 2ZZ0A 1PDHA 3REDA 5KOXA 4CCQA 3L1RA 4A65A 1OJDA 3ALMA 4H4ZA 1VDCA 3K7TA 3ALLA 4YT0A 1GRHA 2QA1A 4YSXA 3V3OA 3AEDA 2YVGA 4YSHA 2C65A 1W4XA 2FJEA 3AE5A 4OPLA 4EMWA 3CPHG 1N4WA 3QSSA 2V6OA 2BXRA 4EM4A 2R4JA 2XFUA 1DODA 2QA2A 2YAUA 4J36A 3GRTA 4H4TA 2WP6A 5U25A 1PJ5A 1N4UA 3I6DA 3NKSA 2Q7VA 1ZY8A 2BK5A 3P4QA 4JNQA 4K8DA 4C74A 4Z25A 4YWOA 5C3JA 2YG7A 1FEAA 3D1CA 4PAAA 2V60A 3DA1A 1O5WA 4FX9A 1BZLA 4OPIA 5FMHA 1E1KA 4K5SA 2Y6RA 3EAOA 4A5LA 4H4PA 1XANA 5HHFA 1E39A 1FCDA 2H89A 1IUVA 1PS9A 2X8CA 4LIIA 1DJNA 3ZDNA 1ZOYA 5EBKA 2GVCA 1GOSA 2XCGA 5HY5A 4ZN0A 4JDRA 1JRXA 2B9XA 3RP6A 4Z44A 5U63A 2XYOA 2FJAA 3IF9A 1E7PA 2RGJA 1K0LA 4J33A 3DJGX 4IVMB 1DJQA 1OJAA 3M0OA 2WU2A 2C70A 3CGCA 1PN0A 4K7ZA 4H2NA 1CC4A 5ER0A 3UKAA 3NHOX 2E1MA 2X50A 4U2LA 2X8GA 2XLSA 1MO9A 3QFBA 4BV6A 1DOBA 4Z2UA 3NK0X 4JNAA 3VRBA 3FPZA 1OJTA 4BK2A 1FECA 3DGHA 1D4CA 2BC0A 3G5QA 4CY6A 4C77A 3QFAA 4EMIA 1FEBA 3AE9A 2WOVA 3RHAA 1GRAA 3KKJA 1IUSA 4X4JA 3VQRA 2XFOA 2XVHA 4Z2RA 5HXIA 4HB9A 4JQ9A 4Y4LA 4Z26A 2Q0LA 3AE8A 3ABVA 5KVIA 1GTEA 1YKJA 4A7AA 1B4VA 1VQWA 4UP3A 3RNMA 2BS3A 1EL9A 2GF3A 2GB0A 1EBDA 4LA1A 1E1MA 4H2PA 4IV9A 3ISHA 5EOWA 1B37A 1Y56B 4LU6A 3UTFA 3EANA 2IVDA 1GTHA 4TLZA 3WE0A 1TDKA 1PJ6A 4TM4A 4YTMA 2OLOA 1GV4A 2Q0KA 4Z43A 3BHKA 4FK1C 4YKGA 4AT2A 4CY8A 4O5UA 4CNKA 3GD4A 1D5TA 4OPTA 1D7YA 4U8OA 3NN6X 1KSSA 4A9WA 3ALJA 1TDOA 1CC6A 1ZDLA 3EF6A 1XDIA 4H4SA 2WETA 1VG0A 2IVEA 2XLPA 2VZ2A 4ADWA 3CGBA 4X9NA 2WU5A 3UOYA 3GSIA 4E0VA 1QO8A 5BUKA 1OJCA 1GETA 1PJ7A 3AB1A 1NDAA 3NLCA 1M6IA 4DSGA 3BHFA 3Q9TA 5HYMA 1JNZA 2AR8A 2CFYA 3AYLA 4B66A 3KU9A 5FS8A 3NYEA 3P4PA 4N9XA 4EQRA 2GV8A 3CNTA 4OPGA 4H7UA 5FS9A 2B7SA 2R0CA 1GSNA 2V3AA 4H4RA 2R9ZA 5M10A 2GAHB 1KNPA 4NZHA 1H81A 3UKQA 3AE7A 1ZMCA 4EQXA 1DNCA 4OPDA 2WHDA 1EL7A 3O0HA 1L0VA 2YG3A 2R46A 3B6DA 3ITJA 4H4YA 4A6NB 2APGA 2HQMA 1CJ2A 2W0HA 4RG4A 3KD9A 1Y0PA 1XHCA 4U8PA 4Y4MA 3DGZA 5TR3A 2QAEA 2WDVA 1LTXR 5J7XA 3OC4A 4U8IA 2OA1A 3HZLA 1LJ1A 5JCIA 1IUUA 2OLNA 4U2TA 2WESA 2E5VA 4Y4NA 2C73A 3GDPA 4H4QA 2YLXA 1B8SA 2RABA 3GD3A 3ICTA 3NG7X 1LPFA 1REOA 2GQFA 1IUWA 3DJEA 2GR3A 1RYIA 3ADAB 3C4AA 3GRSA 3JSKA 2YLWA 2YLRA 1BWCA 1GRFA 2R4EA 4Z2TA 2CULA 5GRTA 4C5OA 2GMJA 1YY5A 4FDCB 3NK1X 4U8NA 2YR6A 1NAAA 2XVEA 4EIQA 3LZWA 1BGJA 2JBVA 2A89A 3PVCA 2PHHA 3UKLA 1TRBA 2YVFA 2YLZA 2FBWA 4B67A 3CNJA 3G5SA 4RG3A 5BULA 1N1PA 1S3EA 5LV9A 1DXLA 1PBDA 1L9EA 4YXDA 2WDRA 1TYPA 1NHRA 3BI5A 3F8RA 1Q1RA 4JY3A 3V76A 2BK3A 5GSNA 3GMCA 3QVRA 4K22A 5L46A 4GDPA 1H82A 4UDRA 3P9UA 4NEVA 1FOHA 4TLXA 3SQPA 1OJ9A 3AD9B 4J2WA 1F8SA 3CNDA 4C3XA 3FMWA 3C4NA 4KX6A 3NYFA 3LB8A 1F6MA 3NTAA 2B9YA 2IIDA 4AOSA 1VRQB 2Q6UA 2Z5YA 4BJYA 1P2HA 3CTYA 4CCRA 3GDNA 1QLBA 4UDPA 5JCNA 3FG2P 2BACA 2GQWA 2ZBWA 1H86A 5U1OA 2R0PA 5BVAA 2YR4A 4U8MA 1IUTA 1P2EA 3AE2A 4REKA 3LZXA 1TDNA 2C76A 4U8JA 1KSUA 4XWZA 1D7LA 2YG6A 5FS7A 4B68A 4GDEA 3T37A 1L9CA 2GRTA 1M64A 2E4GA 2WEUA 3NTDA 2XVIA 2VQ7A 1COYA 3ICSA 3KLJA 4AP3A 1S2YA 2GH5A 3F8DA 2VVLG 4H4UA 3VR9A 3UOXA 2B76A 2UZZA 2WDQA 2ACZA 1K0JA 1YQ4A 2Y6QA 1NG3A 3GYIA 3CGDA 4BK1A 2TMDA 5FS6A 1NENA 1YQZA 4GR1A 3DJJA 2XFPA 4H2QA 4X9MA 1JEHA 3P1WA 5JCMA 2VVMA 4K2XA 1KF6A 2EQ6A 3IHMA 1BGNA 3G5RA 4OPUA 2WS3A 1IUXA 1V59A 2YQUA 3AYIA 4YKFA 1Q1WA 3UTHA 2YM1A 1X31B 3CNSA 1DOEA 2EQ9A 1F8WA 4AOXA 2A8XA 1CHUA 2YG5A 2ZZBA 1MOKA 3QSMA 4WX1A 4CRTA 1GNDA 3E1TA 3AEBA 2YVJA 3LADA 3GWFA 5C2TA 2XFNA 1NHPA 4USRA 1RP0A 2GMHA 1ONFA 3CN8A 4EIPA 2GR0A 2V3BA 4H50A 4D03A 2WPEA 3IHGA 4IA5A 2WPCA 3K30A 4TM3A 4TM1A 1F3PA 2QCUA 4B63A 3SFDA 5KXJA 3D8XA 4KPRA 3AYJA 3PS9A 2JKCA 4I59A 3KPFA 1CBOA 1E6EA 4H2RA 1GRBA 1JRZA 4JN9A 2AAQA 3DK8A 3AE6A 2NVKX 3BI4A 1BKWA 4U8LA 3AEGA 1GT8A 4TM0A 2FJBA 2V5ZA 1PBCA 3UTGA 3AEAA 2VVLA 2F5ZA 5JCKA 1LV0A 3OZ2A 4J34A 3P4SA 1LQTA 1TYTA 2WOWA 3UKPA 1L9DA 2CVJA 4B1BA 4B64A 1K4QA 2X3NA
chains in the Genus database with same CATH superfamily
1JNRA 2BABA 2R45A 1FL2A 3CNPA 3II4A 2GEWA 2BA9A 5BRTA 4USQA 4P9SA 4BURA 1PHHA 5KVHA 5KMQA 2A87A 2RGHA 3S5WA 3CPJG 1NPXA 1ELIA 1CC2A 2WOIA 2EQ7A 4JY2A 1MXTA 1GALA 4AP1A 3SX6A 1E1NA 2R0GA 1CJ4A 1YQ3A 2BCPA 4FK1A 5KWFA 3AE3A 4YSYA 1K0IA 2GAGB 4NTDA 5KOWA 2JB1A 3QSEA 2C7GA 2YLTA 2Z5XA 3COXA 3AD8B 2BS2A 2I0ZA 1PXCA 4U2SA 1KNRA 3CGEA 3CPIG 1BF3A 2X99A 3GYJA 3NGCX 4G6HA 1GREA 4BK3A 4OPCA 3S61A 4EQWA 4XWRA 3FIMB 4YTPA 1JRYA 2ARDA 2BK4A 4G74A 1AOGA 5M0ZA 2BC1A 3ICRA 4YTNA 3KVEA 2XLTA 3L8KA 4IA6A 1PXBA 3K7QX 2WPFA 1PBFA 5EB5A 2C66A 3F8PA 1GEUA 3LOVA 4EMJA 3NK2X 1GPEA 2JAEA 3IWAA 1NG4A 2BCGG 3UP5A 2C64A 5IQ4A 4J31A 4CNJA 1GRGA 2FJDA 1CL0A 1H84A 3AE4A 3GMBA 3UKKA 1ZOVA 3PO7A 1KFYA 1S2QA 3IC9A 3NNEA 1GXFA 3QJ4A 3DMEA 3K7MX 4A6NA 4G6GA 2XFQA 3UKFA 3R9UA 4RSLA 2C3CA 4U8KA 4EQSA 3URHA 3ATQA 1LVLA 3FBSA 3QVPA 3AXBA 4J56A 2B7RA 3NT6A 4H4WA 2V61A 3LJPA 3C96A 3NYCA 4OCGA 1NEKA 4APNA 3DK4A 2C75A 1O95A 2AQJA 5JCLA 3AD7B 4DSHA 1PBEA 2YLSA 3V3NA 3M12A 1F8RA 4OVIA 2BXSA 2OAMA 4GUVA 3GWDA 2H88A 1H7XA 4I58A 4B65A 2OALA 2VRLA 4B69A 1O94A 3H8IA 2WBAA 3NN0X 1IJHA 2B9WA 1SEZA 3BI2A 3SGLA 1CJ3A 3KA7A 4YSZA 4D04A 3BNMA 3UOVA 2VRMA 2YR5A 3BNUA 4J57A 4PABA 2JB3A 1DOCA 3VR8A 1ZKQA 4IVOB 4XXGA 1GRTA 1HYUA 1B5QA 3B3RA 2XLRA 3ZYXA 3P4RA 3T0KA 4NTCA 3CIRA 5EB4A 3DH9A 1PXAA 3NH3X 2C67A 1Z6LA 4G9KA 1JOAA 4K5RA 2PYXA 1EL8A 4DGKA 2DKIA 2WP5A 3UCLA 2VOUA 1XPQA 2C72A 4ZCCA 2X8HA 2WP9A 4GCMA 4UDQA 2J3NA 3EPTA 4MJWA 3ATRA 3UP4A 5DBJA 3H4KA 3UTEA 4ECHA 2YG4A 1H83A 3AEFA 5CQFA 1NHSA 2XLUA 2TPRA 3RP7A 2XVJA 3DJDA 3UOZA 4A99A 1D4DA 4DNAA 3AE1A 1JU2A 4H4XA 1ZX9A 2BYBA 1GESA 2YM2A 4GRTA 1H6VA 1E1LA 3VRAA 1Q9IA 3DK9A 3LXDA 3NRNA 1CF3A 1ZP0A 3VRDB 3UKHA 2NPXA 1TDFA 5IQ1A 1ZK7A 4BJZA 4AT0A 4ZCDA 2JK6A 3H8LA 4NTEA 2CDUA 4H4VA 3RP8A 5J60A 4GF7A 1LQUA 4A79A 1KDGA 4WCTA 3NIXA 3AWIA 5IPYA 1CJCA 1RSGA 2EQ8A 2YWLA 1QJDA 3AEEA 3I3LA 4Z24A 3SM8A 1N4VA 2XDOA 1D4EA 1UKVG 3M13A 1VG9A 2JB2A 2VQBA 1H7WA 2BS4A 2XVFA 2DKHA 2ZZCA 2RGOA 1S3BA 4CBQA 3Q6JA 4O5QA 1TDEA 1NHQA 4HA6A 2WQYA 1Y56A 2O9ZA 1ZMDA 4ICYA 4EM3A 1PBBA 1EL5A 2C3DA 5CKUA 2GR2A 3SFEA 5KRQA 3AECA 2GR1A 4M52A 1GERA 4NEWA 2ZZ0A 1PDHA 3REDA 5KOXA 4CCQA 3L1RA 4A65A 1OJDA 3ALMA 4H4ZA 1VDCA 3K7TA 3ALLA 4YT0A 1GRHA 2QA1A 2C4CA 4NNJA 4YSXA 3V3OA 3AEDA 2YVGA 4YSHA 2C65A 1W4XA 2FJEA 3AE5A 4OPLA 4EMWA 3CPHG 1N4WA 3QSSA 2V6OA 2BXRA 4EM4A 2R4JA 2XFUA 1DODA 2QA2A 2YAUA 4J36A 3GRTA 4H4TA 2WP6A 5U25A 1PJ5A 1N4UA 3I6DA 3NKSA 2Q7VA 1ZY8A 2BK5A 3P4QA 4JNQA 4K8DA 4C74A 4Z25A 4YWOA 5C3JA 2YG7A 1FEAA 3D1CA 4PAAA 3SZFA 2V60A 3DA1A 1O5WA 4FX9A 1BZLA 4OPIA 5FMHA 1E1KA 4K5SA 2Y6RA 3EAOA 4A5LA 4H4PA 1XANA 5HHFA 1E39A 1FCDA 2H89A 1IUVA 1PS9A 2X8CA 4LIIA 1DJNA 3ZDNA 1ZOYA 5EBKA 2GVCA 1GOSA 2XCGA 5HY5A 4ZN0A 4JDRA 1JRXA 2B9XA 3RP6A 4Z44A 5U63A 2XYOA 2FJAA 3IF9A 1E7PA 2RGJA 3SZ0A 3SYIA 1K0LA 4J33A 3DJGX 4IVMB 1DJQA 1OJAA 3M0OA 2WU2A 2C70A 3CGCA 1PN0A 4K7ZA 4H2NA 1CC4A 3SZCA 5ER0A 3UKAA 3NHOX 2E1MA 2X50A 4U2LA 2X8GA 2XLSA 1MO9A 3QFBA 4BV6A 1DOBA 4Z2UA 3NK0X 4JNAA 3VRBA 3FPZA 1OJTA 4BK2A 1FECA 3DGHA 1D4CA 2BC0A 3G5QA 4CY6A 4C77A 3QFAA 4EMIA 1FEBA 3AE9A 2WOVA 3RHAA 1GRAA 3KKJA 1IUSA 4X4JA 3VQRA 2XFOA 2XVHA 4Z2RA 5HXIA 4HB9A 4JQ9A 4Y4LA 4Z26A 2Q0LA 3AE8A 3ABVA 5KVIA 1GTEA 1YKJA 4A7AA 1B4VA 1VQWA 4UP3A 3RNMA 2BS3A 1EL9A 2GF3A 2GB0A 1EBDA 4LA1A 4II2A 1E1MA 4H2PA 3CMMA 3ISHA 4IV9A 5EOWA 1B37A 4G73A 1Y56B 4LU6A 3UTFA 3EANA 2IVDA 1GTHA 4TLZA 5KNLA 3WE0A 1TDKA 1PJ6A 4TM4A 4YTMA 2OLOA 1GV4A 2Q0KA 4Z43A 3BHKA 4FK1C 4YKGA 4AT2A 4CY8A 4O5UA 4CNKA 3GD4A 1D5TA 4OPTA 1D7YA 4U8OA 3NN6X 1KSSA 4A9WA 3ALJA 1TDOA 1CC6A 1ZDLA 3EF6A 1XDIA 4H4SA 2WETA 1VG0A 2IVEA 2XLPA 2VZ2A 4ADWA 3CGBA 4X9NA 2WU5A 3UOYA 3GSIA 4E0VA 1QO8A 5BUKA 1OJCA 1GETA 1PJ7A 3AB1A 1NDAA 3NLCA 1M6IA 4DSGA 3BHFA 3Q9TA 5HYMA 1JNZA 2AR8A 2CFYA 3AYLA 3T2YA 4B66A 3KU9A 5FS8A 2BRAA 3NYEA 3P4PA 4N9XA 4EQRA 2GV8A 3CNTA 4OPGA 4H7UA 5FS9A 2B7SA 2R0CA 3HYWA 1GSNA 2V3AA 4H4RA 2R9ZA 5M10A 2GAHB 1KNPA 4NZHA 1H81A 3UKQA 3AE7A 1ZMCA 4EQXA 1DNCA 4OPDA 2WHDA 1EL7A 3O0HA 1L0VA 2YG3A 2R46A 3B6DA 3ITJA 4H4YA 4A6NB 2APGA 2HQMA 1CJ2A 2W0HA 4RG4A 3KD9A 1Y0PA 1XHCA 4U8PA 4Y4MA 3DGZA 5TR3A 2QAEA 2WDVA 1LTXR 5J7XA 3OC4A 4U8IA 2OA1A 3HZLA 4NWZA 1LJ1A 5JCIA 1IUUA 2OLNA 4U2TA 2WESA 2E5VA 4Y4NA 2C73A 3GDPA 4H4QA 2BRYA 2YLXA 1B8SA 2RABA 3GD3A 3T2KA 3ICTA 3NG7X 1LPFA 1REOA 2GQFA 1IUWA 3DJEA 2GR3A 1RYIA 3ADAB 3C4AA 3GRSA 3JSKA 2YLWA 2YLRA 1BWCA 1GRFA 2R4EA 4Z2TA 2CULA 5GRTA 4C5OA 2GMJA 1YY5A 4FDCB 3NK1X 4U8NA 2YR6A 1NAAA 2XVEA 3SZWA 4EIQA 3LZWA 1BGJA 2JBVA 2A89A 3PVCA 2PHHA 3UKLA 1TRBA 2YVFA 2YLZA 2FBWA 4B67A 3CNJA 3G5SA 4RG3A 5BULA 1N1PA 1S3EA 3SY4A 5LV9A 1DXLA 4GAVA 1PBDA 1L9EA 4YXDA 2WDRA 1TYPA 1NHRA 3BI5A 3F8RA 1Q1RA 4JY3A 3V76A 2BK3A 5GSNA 3GMCA 3QVRA 4K22A 5L46A 4GDPA 1H82A 4UDRA 3HYXA 3P9UA 4NEVA 1FOHA 4TLXA 3SQPA 1OJ9A 3AD9B 4J2WA 1F8SA 3CNDA 4C3XA 3FMWA 3T14A 3C4NA 4KX6A 3NYFA 3LB8A 5KMRA 1F6MA 3NTAA 2B9YA 2IIDA 4AOSA 1VRQB 2Q6UA 2Z5YA 4BJYA 1P2HA 3CTYA 4CCRA 5KMPA 3GDNA 1QLBA 4UDPA 5JCNA 3FG2P 4II3A 2BACA 2GQWA 2ZBWA 1H86A 5U1OA 2R0PA 5BVAA 2YR4A 4U8MA 1IUTA 1P2EA 3AE2A 4REKA 3LZXA 1TDNA 2C76A 4U8JA 1KSUA 4XWZA 1D7LA 2YG6A 5KMSA 5FS7A 4B68A 4GDEA 3T37A 1L9CA 2GRTA 1M64A 2E4GA 2WEUA 3NTDA 2XVIA 2VQ7A 1COYA 3ICSA 3KLJA 4AP3A 1S2YA 2GH5A 3F8DA 2VVLG 4H4UA 3VR9A 3UOXA 2B76A 2UZZA 2WDQA 2ACZA 1K0JA 1YQ4A 2Y6QA 1NG3A 3GYIA 3CGDA 4BK1A 2TMDA 5FS6A 1NENA 1YQZA 4GR1A 3DJJA 2XFPA 4H2QA 4X9MA 1JEHA 3GYXA 3P1WA 5JCMA 3T2ZA 2VVMA 4K2XA 1KF6A 2EQ6A 3IHMA 1BGNA 3G5RA 4OPUA 2WS3A 1IUXA 1V59A 2YQUA 3AYIA 4YKFA 1Q1WA 3SXIA 2YM1A 1X31B 3CNSA 3UTHA 1DOEA 2EQ9A 1F8WA 4AOXA 2A8XA 1CHUA 2YG5A 2ZZBA 3KPKA 1MOKA 3QSMA 4WX1A 4CRTA 1GNDA 3E1TA 3AEBA 2YVJA 3LADA 4GAPA 3GWFA 5C2TA 2XFNA 1NHPA 4USRA 1RP0A 2GMHA 1ONFA 3CN8A 4EIPA 2GR0A 2V3BA 4H50A 4D03A 2WPEA 3IHGA 4IA5A 2WPCA 3K30A 4TM3A 4TM1A 1F3PA 2QCUA 4B63A 3SFDA 5KXJA 3D8XA 4KPRA 3AYJA 3PS9A 2JKCA 4I59A 3T31A 4C3YA 3KPFA 1CBOA 1E6EA 4H2RA 1GRBA 1JRZA 4JN9A 2AAQA 3DK8A 3AE6A 2NVKX 3BI4A 1BKWA 4U8LA 3AEGA 1GT8A 3HYVA 4TM0A 2FJBA 2V5ZA 1PBCA 3UTGA 3AEAA 2VVLA 2F5ZA 5JCKA 1LV0A 3OZ2A 4J34A 3P4SA 1LQTA 1TYTA 2WOWA 3UKPA 1L9DA 2CVJA 4B1BA 4B64A 1K4QA 2X3NA
chains in the Genus database with same CATH topology
1JNRA 2BABA 2R45A 1FL2A 3CNPA 3II4A 2GEWA 2BA9A 5BRTA 4USQA 4P9SA 4BURA 1PHHA 5KVHA 5KMQA 2A87A 2RGHA 3S5WA 3CPJG 1NPXA 1ELIA 1CC2A 2WOIA 2EQ7A 4JY2A 1MXTA 1GALA 4AP1A 3SX6A 1E1NA 2R0GA 1CJ4A 1YQ3A 2BCPA 4FK1A 5KWFA 3AE3A 4YSYA 1K0IA 2GAGB 4NTDA 5KOWA 2JB1A 3QSEA 2C7GA 2YLTA 2Z5XA 3COXA 3AD8B 2BS2A 2I0ZA 1PXCA 4U2SA 1KNRA 3CGEA 3CPIG 1BF3A 2X99A 3GYJA 3NGCX 4G6HA 1GREA 4BK3A 4OPCA 3S61A 4EQWA 4XWRA 3FIMB 4YTPA 1JRYA 2ARDA 2BK4A 4G74A 1AOGA 5M0ZA 2BC1A 3ICRA 4YTNA 3KVEA 2XLTA 3L8KA 4IA6A 1PXBA 3K7QX 2WPFA 1PBFA 5EB5A 2C66A 3F8PA 1GEUA 3LOVA 4EMJA 3NK2X 1GPEA 2JAEA 3IWAA 1NG4A 2BCGG 3UP5A 2C64A 5IQ4A 4J31A 4CNJA 1GRGA 2FJDA 1CL0A 1H84A 3AE4A 3GMBA 3UKKA 1ZOVA 3PO7A 1KFYA 1S2QA 3IC9A 3NNEA 1GXFA 3QJ4A 3DMEA 3K7MX 4A6NA 4G6GA 2XFQA 3UKFA 3R9UA 4RSLA 2C3CA 4U8KA 4EQSA 3URHA 3ATQA 1LVLA 3FBSA 3QVPA 3AXBA 4J56A 2B7RA 3NT6A 4H4WA 2V61A 3LJPA 3C96A 3NYCA 4OCGA 1NEKA 4APNA 3DK4A 2C75A 1O95A 2AQJA 5JCLA 3AD7B 4DSHA 1PBEA 2YLSA 3V3NA 3M12A 1F8RA 4OVIA 2BXSA 2OAMA 4GUVA 3GWDA 2H88A 1H7XA 4I58A 4B65A 2OALA 2VRLA 4B69A 1O94A 3H8IA 2WBAA 3NN0X 1IJHA 2B9WA 1SEZA 3BI2A 3SGLA 1CJ3A 3KA7A 4YSZA 4D04A 3BNMA 3UOVA 2VRMA 2YR5A 3BNUA 4J57A 4PABA 2JB3A 1DOCA 3VR8A 1ZKQA 4IVOB 4XXGA 1GRTA 1HYUA 1B5QA 3B3RA 2XLRA 3ZYXA 3P4RA 3T0KA 4NTCA 3CIRA 5EB4A 3DH9A 1PXAA 3NH3X 2C67A 1Z6LA 4G9KA 1JOAA 4K5RA 2PYXA 1EL8A 4DGKA 2DKIA 2WP5A 3UCLA 2VOUA 1XPQA 2C72A 4ZCCA 2X8HA 2WP9A 4GCMA 4UDQA 2J3NA 3EPTA 4MJWA 3ATRA 3UP4A 5DBJA 3H4KA 3UTEA 4ECHA 2YG4A 1H83A 3AEFA 5CQFA 1NHSA 2XLUA 2TPRA 3RP7A 2XVJA 3DJDA 3UOZA 4A99A 1D4DA 4DNAA 3AE1A 1JU2A 4H4XA 1ZX9A 2BYBA 1GESA 2YM2A 4GRTA 1H6VA 1E1LA 3VRAA 1Q9IA 3DK9A 3LXDA 3NRNA 1CF3A 1ZP0A 3VRDB 3UKHA 2NPXA 1TDFA 5IQ1A 1ZK7A 4BJZA 4AT0A 4ZCDA 2JK6A 3H8LA 4NTEA 2CDUA 4H4VA 3RP8A 5J60A 4GF7A 1LQUA 4A79A 1KDGA 4WCTA 3NIXA 3AWIA 5IPYA 1CJCA 1RSGA 2EQ8A 2YWLA 1QJDA 3AEEA 3I3LA 4Z24A 3SM8A 1N4VA 2XDOA 1D4EA 1UKVG 3M13A 1VG9A 2JB2A 2VQBA 1H7WA 2BS4A 2XVFA 2DKHA 2ZZCA 2RGOA 1S3BA 4CBQA 3Q6JA 4O5QA 1TDEA 1NHQA 4HA6A 2WQYA 1Y56A 2O9ZA 1ZMDA 4ICYA 4EM3A 1PBBA 1EL5A 2C3DA 5CKUA 2GR2A 3SFEA 5KRQA 3AECA 2GR1A 4M52A 1GERA 4NEWA 2ZZ0A 1PDHA 3REDA 5KOXA 4CCQA 3L1RA 4A65A 1OJDA 3ALMA 4H4ZA 1VDCA 3K7TA 3ALLA 4YT0A 1GRHA 2QA1A 2C4CA 4NNJA 4YSXA 3V3OA 3AEDA 2YVGA 4YSHA 2C65A 1W4XA 2FJEA 3AE5A 4OPLA 4EMWA 3CPHG 1N4WA 3QSSA 2V6OA 2BXRA 4EM4A 2R4JA 2XFUA 1DODA 2QA2A 2YAUA 4J36A 3GRTA 4H4TA 2WP6A 5U25A 1PJ5A 1N4UA 3I6DA 3NKSA 2Q7VA 1ZY8A 2BK5A 3P4QA 4JNQA 4K8DA 4C74A 4Z25A 4YWOA 5C3JA 2YG7A 1FEAA 3D1CA 4PAAA 3SZFA 2V60A 3DA1A 1O5WA 4FX9A 1BZLA 4OPIA 5FMHA 1E1KA 4K5SA 2Y6RA 3EAOA 4A5LA 4H4PA 1XANA 5HHFA 1E39A 1FCDA 2H89A 1IUVA 1PS9A 2X8CA 4LIIA 1DJNA 3ZDNA 1ZOYA 5EBKA 2GVCA 1GOSA 2XCGA 5HY5A 4ZN0A 4JDRA 1JRXA 2B9XA 3RP6A 4Z44A 5U63A 2XYOA 2FJAA 3IF9A 1E7PA 2RGJA 3SZ0A 3SYIA 1K0LA 4J33A 3DJGX 4IVMB 1DJQA 1OJAA 3M0OA 2WU2A 2C70A 3CGCA 1PN0A 4K7ZA 4H2NA 1CC4A 3SZCA 5ER0A 3UKAA 3NHOX 2E1MA 2X50A 4U2LA 2X8GA 2XLSA 1MO9A 3QFBA 4BV6A 1DOBA 4Z2UA 3NK0X 4JNAA 3VRBA 3FPZA 1OJTA 4BK2A 1FECA 3DGHA 1D4CA 2BC0A 3G5QA 4CY6A 4C77A 3QFAA 4EMIA 1FEBA 3AE9A 2WOVA 3RHAA 1GRAA 3KKJA 1IUSA 4X4JA 3VQRA 2XFOA 2XVHA 4Z2RA 5HXIA 4HB9A 4JQ9A 4Y4LA 4Z26A 2Q0LA 3AE8A 3ABVA 5KVIA 1GTEA 1YKJA 4A7AA 1B4VA 1VQWA 4UP3A 3RNMA 2BS3A 1EL9A 2GF3A 2GB0A 1EBDA 4LA1A 4II2A 1E1MA 4H2PA 3CMMA 3ISHA 4IV9A 5EOWA 1B37A 4G73A 1Y56B 4LU6A 3UTFA 3EANA 2IVDA 1GTHA 4TLZA 5KNLA 3WE0A 1TDKA 1PJ6A 4TM4A 4YTMA 2OLOA 1GV4A 2Q0KA 4Z43A 3BHKA 4FK1C 4YKGA 4AT2A 4CY8A 4O5UA 4CNKA 3GD4A 1D5TA 4OPTA 1D7YA 4U8OA 3NN6X 1KSSA 4A9WA 3ALJA 1TDOA 1CC6A 1ZDLA 3EF6A 1XDIA 4H4SA 2WETA 1VG0A 2IVEA 2XLPA 2VZ2A 4ADWA 3CGBA 4X9NA 2WU5A 3UOYA 3GSIA 4E0VA 1QO8A 5BUKA 1OJCA 1GETA 1PJ7A 3AB1A 1NDAA 3NLCA 1M6IA 4DSGA 3BHFA 3Q9TA 5HYMA 1JNZA 2AR8A 2CFYA 3AYLA 3T2YA 4B66A 3KU9A 5FS8A 2BRAA 3NYEA 3P4PA 4N9XA 4EQRA 2GV8A 3CNTA 4OPGA 4H7UA 5FS9A 2B7SA 2R0CA 3HYWA 1GSNA 2V3AA 4H4RA 2R9ZA 5M10A 2GAHB 1KNPA 4NZHA 1H81A 3UKQA 3AE7A 1ZMCA 4EQXA 1DNCA 4OPDA 2WHDA 1EL7A 3O0HA 1L0VA 2YG3A 2R46A 3B6DA 3ITJA 4H4YA 4A6NB 2APGA 2HQMA 1CJ2A 2W0HA 4RG4A 3KD9A 1Y0PA 1XHCA 4U8PA 4Y4MA 3DGZA 5TR3A 2QAEA 2WDVA 1LTXR 5J7XA 3OC4A 4U8IA 2OA1A 3HZLA 4NWZA 1LJ1A 5JCIA 1IUUA 2OLNA 4U2TA 2WESA 2E5VA 4Y4NA 2C73A 3GDPA 4H4QA 2BRYA 2YLXA 1B8SA 2RABA 3GD3A 3T2KA 3ICTA 3NG7X 1LPFA 1REOA 2GQFA 1IUWA 3DJEA 2GR3A 1RYIA 3ADAB 3C4AA 3GRSA 3JSKA 2YLWA 2YLRA 1BWCA 1GRFA 2R4EA 4Z2TA 2CULA 5GRTA 4C5OA 2GMJA 1YY5A 4FDCB 3NK1X 4U8NA 2YR6A 1NAAA 2XVEA 3SZWA 4EIQA 3LZWA 1BGJA 2JBVA 2A89A 3PVCA 2PHHA 3UKLA 1TRBA 2YVFA 2YLZA 2FBWA 4B67A 3CNJA 3G5SA 4RG3A 5BULA 1N1PA 1S3EA 3SY4A 5LV9A 1DXLA 4GAVA 1PBDA 1L9EA 4YXDA 2WDRA 1TYPA 1NHRA 3BI5A 3F8RA 1Q1RA 4JY3A 3V76A 2BK3A 5GSNA 3GMCA 3QVRA 4K22A 5L46A 4GDPA 1H82A 4UDRA 3HYXA 3P9UA 4NEVA 1FOHA 4TLXA 3SQPA 1OJ9A 3AD9B 4J2WA 1F8SA 3CNDA 4C3XA 3FMWA 3T14A 3C4NA 4KX6A 3NYFA 3LB8A 5KMRA 1F6MA 3NTAA 2B9YA 2IIDA 4AOSA 1VRQB 2Q6UA 2Z5YA 4BJYA 1P2HA 3CTYA 4CCRA 5KMPA 3GDNA 1QLBA 4UDPA 5JCNA 3FG2P 4II3A 2BACA 2GQWA 2ZBWA 1H86A 5U1OA 2R0PA 5BVAA 2YR4A 4U8MA 1IUTA 1P2EA 3AE2A 4REKA 3LZXA 1TDNA 2C76A 4U8JA 1KSUA 4XWZA 1D7LA 2YG6A 5KMSA 5FS7A 4B68A 4GDEA 3T37A 1L9CA 2GRTA 1M64A 2E4GA 2WEUA 3NTDA 2XVIA 2VQ7A 1COYA 3ICSA 3KLJA 4AP3A 1S2YA 2GH5A 3F8DA 2VVLG 4H4UA 3VR9A 3UOXA 2B76A 2UZZA 2WDQA 2ACZA 1K0JA 1YQ4A 2Y6QA 1NG3A 3GYIA 3CGDA 4BK1A 2TMDA 5FS6A 1NENA 1YQZA 4GR1A 3DJJA 2XFPA 4H2QA 4X9MA 1JEHA 3GYXA 3P1WA 5JCMA 3T2ZA 2VVMA 4K2XA 1KF6A 2EQ6A 3IHMA 1BGNA 3G5RA 4OPUA 2WS3A 1IUXA 1V59A 2YQUA 3AYIA 4YKFA 1Q1WA 3SXIA 2YM1A 1X31B 3CNSA 3UTHA 1DOEA 2EQ9A 1F8WA 4AOXA 2A8XA 1CHUA 2YG5A 2ZZBA 3KPKA 1MOKA 3QSMA 4WX1A 4CRTA 1GNDA 3E1TA 3AEBA 2YVJA 3LADA 4GAPA 3GWFA 5C2TA 2XFNA 1NHPA 4USRA 1RP0A 2GMHA 1ONFA 3CN8A 4EIPA 2GR0A 2V3BA 4H50A 4D03A 2WPEA 3IHGA 4IA5A 2WPCA 3K30A 4TM3A 4TM1A 1F3PA 2QCUA 4B63A 3SFDA 5KXJA 3D8XA 4KPRA 3AYJA 3PS9A 2JKCA 4I59A 3T31A 4C3YA 3KPFA 1CBOA 1E6EA 4H2RA 1GRBA 1JRZA 4JN9A 2AAQA 3DK8A 3AE6A 2NVKX 3BI4A 1BKWA 4U8LA 3AEGA 1GT8A 3HYVA 4TM0A 2FJBA 2V5ZA 1PBCA 3UTGA 3AEAA 2VVLA 2F5ZA 5JCKA 1LV0A 3OZ2A 4J34A 3P4SA 1LQTA 1TYTA 2WOWA 3UKPA 1L9DA 2CVJA 4B1BA 4B64A 1K4QA 2X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNR A;  2BAB A;  2R45 A;  1FL2 A;  3CNP A;  3II4 A;  2GEW A;  2BA9 A;  5BRT A;  4USQ A;  4P9S A;  4BUR A;  1PHH A;  5KVH A;  2A87 A;  2RGH A;  3S5W A;  3CPJ G;  1NPX A;  1ELI A;  1CC2 A;  2WOI A;  2EQ7 A;  4JY2 A;  1MXT A;  1GAL A;  4AP1 A;  1E1N A;  2R0G A;  1CJ4 A;  1YQ3 A;  2BCP A;  4FK1 A;  5KWF A;  3AE3 A;  4YSY A;  1K0I A;  2GAG B;  4NTD A;  5KOW A;  2JB1 A;  3QSE A;  2C7G A;  2YLT A;  2Z5X A;  3COX A;  3AD8 B;  2BS2 A;  2I0Z A;  1PXC A;  4U2S A;  1KNR A;  3CGE A;  3CPI G;  1BF3 A;  2X99 A;  3GYJ A;  3NGC X;  4BK3 A;  1GRE A;  4EQW A;  4OPC A;  3S61 A;  4YTP A;  4XWR A;  3FIM B;  1AOG A;  1JRY A;  2ARD A;  2BK4 A;  5M0Z A;  2BC1 A;  3ICR A;  4YTN A;  3KVE A;  2XLT A;  3L8K A;  4IA6 A;  1PXB A;  3K7Q X;  2WPF A;  1PBF A;  5EB5 A;  2C66 A;  3F8P A;  1GEU A;  3LOV A;  4EMJ A;  3NK2 X;  1GPE A;  2JAE A;  3IWA A;  1NG4 A;  2BCG G;  3UP5 A;  2C64 A;  5IQ4 A;  4J31 A;  4CNJ A;  1GRG A;  2FJD A;  1CL0 A;  1H84 A;  3AE4 A;  3GMB A;  3UKK A;  1ZOV A;  3PO7 A;  1KFY A;  1S2Q A;  3IC9 A;  3NNE A;  1GXF A;  3QJ4 A;  3DME A;  3K7M X;  4A6N A;  4C3Y A;  2XFQ A;  3UKF A;  3R9U A;  4RSL A;  2C3C A;  4U8K A;  4EQS A;  3URH A;  3ATQ A;  1LVL A;  3FBS A;  3QVP A;  3AXB A;  4J56 A;  2B7R A;  3NT6 A;  4H4W A;  2V61 A;  3LJP A;  3C96 A;  3NYC A;  4OCG A;  1NEK A;  4APN A;  3DK4 A;  2C75 A;  1O95 A;  2AQJ A;  5JCL A;  3AD7 B;  4DSH A;  1PBE A;  2YLS A;  3V3N A;  3M12 A;  1F8R A;  4OVI A;  2BXS A;  2OAM A;  4GUV A;  3GWD A;  2H88 A;  1H7X A;  4I58 A;  4B65 A;  2OAL A;  2VRL A;  4B69 A;  1O94 A;  3H8I A;  2WBA A;  3NN0 X;  1IJH A;  2B9W A;  1SEZ A;  3BI2 A;  3SGL A;  1CJ3 A;  3KA7 A;  4YSZ A;  4D04 A;  3BNM A;  3UOV A;  2VRM A;  2YR5 A;  3BNU A;  4J57 A;  4PAB A;  2JB3 A;  1DOC A;  3VR8 A;  1ZKQ A;  4IVO B;  4XXG A;  1GRT A;  1HYU A;  1B5Q A;  3B3R A;  2XLR A;  3ZYX A;  3P4R A;  4NTC A;  3CIR A;  5EB4 A;  3DH9 A;  1PXA A;  3NH3 X;  2C67 A;  1Z6L A;  1JOA A;  4K5R A;  2PYX A;  1EL8 A;  4DGK A;  2DKI A;  2WP5 A;  3UCL A;  2VOU A;  1XPQ A;  2C72 A;  4ZCC A;  2X8H A;  2WP9 A;  4GCM A;  4UDQ A;  2J3N A;  3EPT A;  4MJW A;  3ATR A;  3UP4 A;  5DBJ A;  3H4K A;  3UTE A;  4ECH A;  2YG4 A;  1H83 A;  3AEF A;  5CQF A;  1NHS A;  2XLU A;  2TPR A;  3RP7 A;  2XVJ A;  3DJD A;  3UOZ A;  4A99 A;  1D4D A;  4DNA A;  3AE1 A;  1JU2 A;  4H4X A;  1ZX9 A;  2BYB A;  1GES A;  2YM2 A;  4GRT A;  1H6V A;  1E1L A;  3VRA A;  1Q9I A;  3DK9 A;  3LXD A;  3NRN A;  1CF3 A;  1ZP0 A;  3VRD B;  3UKH A;  2NPX A;  1TDF A;  5IQ1 A;  1ZK7 A;  4BJZ A;  4AT0 A;  4ZCD A;  2JK6 A;  3H8L A;  4NTE A;  2CDU A;  4H4V A;  3RP8 A;  5J60 A;  4GF7 A;  1LQU A;  4A79 A;  1KDG A;  4WCT A;  3NIX A;  3AWI A;  5IPY A;  1CJC A;  1RSG A;  2EQ8 A;  2YWL A;  1QJD A;  3AEE A;  3I3L A;  4Z24 A;  3SM8 A;  1N4V A;  2XDO A;  1D4E A;  1UKV G;  3M13 A;  1VG9 A;  2JB2 A;  2VQB A;  1H7W A;  2BS4 A;  2XVF A;  2DKH A;  2ZZC A;  2RGO A;  1S3B A;  4CBQ A;  3Q6J A;  4O5Q A;  1TDE A;  1NHQ A;  4HA6 A;  2WQY A;  1Y56 A;  2O9Z A;  1ZMD A;  4ICY A;  4EM3 A;  1PBB A;  1EL5 A;  2C3D A;  5CKU A;  2GR2 A;  3SFE A;  5KRQ A;  3AEC A;  2GR1 A;  4M52 A;  1GER A;  4NEW A;  2ZZ0 A;  1PDH A;  3RED A;  5KOX A;  4CCQ A;  3L1R A;  4A65 A;  1OJD A;  3ALM A;  4H4Z A;  1VDC A;  3K7T A;  3ALL A;  4YT0 A;  1GRH A;  2QA1 A;  4YSX A;  3V3O A;  3AED A;  2YVG A;  4YSH A;  2C65 A;  1W4X A;  2FJE A;  3AE5 A;  4OPL A;  4EMW A;  3CPH G;  1N4W A;  3QSS A;  2V6O A;  2BXR A;  4EM4 A;  2R4J A;  2XFU A;  1DOD A;  2QA2 A;  2YAU A;  4J36 A;  3GRT A;  4H4T A;  2WP6 A;  5U25 A;  1PJ5 A;  1N4U A;  3I6D A;  3NKS A;  2Q7V A;  1ZY8 A;  2BK5 A;  3P4Q A;  4JNQ A;  4K8D A;  4C74 A;  4Z25 A;  4YWO A;  5C3J A;  2YG7 A;  1FEA A;  3D1C A;  4PAA A;  2V60 A;  3DA1 A;  1O5W A;  4FX9 A;  1BZL A;  4OPI A;  5FMH A;  1E1K A;  4K5S A;  2Y6R A;  3EAO A;  4A5L A;  4H4P A;  1XAN A;  5HHF A;  1E39 A;  1FCD A;  2H89 A;  1IUV A;  1PS9 A;  2X8C A;  4LII A;  1DJN A;  3ZDN A;  1ZOY A;  5EBK A;  2GVC A;  1GOS A;  2XCG A;  5HY5 A;  4ZN0 A;  4JDR A;  1JRX A;  2B9X A;  3RP6 A;  4Z44 A;  5U63 A;  2XYO A;  2FJA A;  3IF9 A;  1E7P A;  2RGJ A;  1K0L A;  4J33 A;  3DJG X;  4IVM B;  1DJQ A;  1OJA A;  3M0O A;  2WU2 A;  2C70 A;  3CGC A;  1PN0 A;  4K7Z A;  4H2N A;  1CC4 A;  5ER0 A;  3UKA A;  3NHO X;  2E1M A;  2X50 A;  4U2L A;  2X8G A;  2XLS A;  1MO9 A;  3QFB A;  4BV6 A;  1DOB A;  4Z2U A;  3NK0 X;  4JNA A;  3VRB A;  3FPZ A;  1OJT A;  4BK2 A;  1FEC A;  3DGH A;  1D4C A;  2BC0 A;  3G5Q A;  4CY6 A;  4C77 A;  3QFA A;  4EMI A;  1FEB A;  3AE9 A;  2WOV A;  3RHA A;  1GRA A;  3KKJ A;  1IUS A;  4X4J A;  3VQR A;  2XFO A;  2XVH A;  4Z2R A;  5HXI A;  4HB9 A;  4JQ9 A;  4Y4L A;  4Z26 A;  2Q0L A;  3AE8 A;  3ABV A;  5KVI A;  1GTE A;  1YKJ A;  4A7A A;  1B4V A;  1VQW A;  4UP3 A;  3RNM A;  2BS3 A;  1EL9 A;  2GF3 A;  2GB0 A;  1EBD A;  4LA1 A;  1E1M A;  4H2P A;  4IV9 A;  3ISH A;  5EOW A;  1B37 A;  1Y56 B;  4LU6 A;  3UTF A;  3EAN A;  2IVD A;  1GTH A;  4TLZ A;  3WE0 A;  1TDK A;  1PJ6 A;  4TM4 A;  4YTM A;  2OLO A;  1GV4 A;  2Q0K A;  4Z43 A;  3BHK A;  4FK1 C;  4YKG A;  4AT2 A;  4CY8 A;  4O5U A;  4CNK A;  3GD4 A;  1D5T A;  4OPT A;  1D7Y A;  4U8O A;  3NN6 X;  1KSS A;  4A9W A;  3ALJ A;  1TDO A;  1CC6 A;  1ZDL A;  3EF6 A;  1XDI A;  4H4S A;  2WET A;  1VG0 A;  2IVE A;  2XLP A;  2VZ2 A;  4ADW A;  3CGB A;  4X9N A;  2WU5 A;  3UOY A;  3GSI A;  4E0V A;  1QO8 A;  5BUK A;  1OJC A;  1GET A;  1PJ7 A;  3AB1 A;  1NDA A;  3NLC A;  1M6I A;  4DSG A;  3BHF A;  3Q9T A;  5HYM A;  1JNZ A;  2AR8 A;  2CFY A;  3AYL A;  4B66 A;  3KU9 A;  5FS8 A;  3NYE A;  3P4P A;  4N9X A;  4EQR A;  2GV8 A;  3CNT A;  4OPG A;  4H7U A;  5FS9 A;  2B7S A;  2R0C A;  1GSN A;  2V3A A;  4H4R A;  2R9Z A;  5M10 A;  2GAH B;  1KNP A;  4NZH A;  1H81 A;  3UKQ A;  3AE7 A;  1ZMC A;  4EQX A;  1DNC A;  4OPD A;  2WHD A;  1EL7 A;  3O0H A;  1L0V A;  2YG3 A;  2R46 A;  3B6D A;  3ITJ A;  4H4Y A;  4A6N B;  2APG A;  2HQM A;  1CJ2 A;  2W0H A;  4RG4 A;  3KD9 A;  1Y0P A;  1XHC A;  4U8P A;  4Y4M A;  3DGZ A;  5TR3 A;  2QAE A;  2WDV A;  1LTX R;  5J7X A;  3OC4 A;  4U8I A;  2OA1 A;  3HZL A;  1LJ1 A;  5JCI A;  1IUU A;  2OLN A;  4U2T A;  2WES A;  2E5V A;  4Y4N A;  2C73 A;  3GDP A;  4H4Q A;  2YLX A;  1B8S A;  2RAB A;  3GD3 A;  3ICT A;  3NG7 X;  1LPF A;  1REO A;  2GQF A;  1IUW A;  3DJE A;  2GR3 A;  1RYI A;  3ADA B;  3C4A A;  3GRS A;  3JSK A;  2YLW A;  2YLR A;  1BWC A;  1GRF A;  2R4E A;  4Z2T A;  2CUL A;  5GRT A;  4C5O A;  2GMJ A;  1YY5 A;  4FDC B;  3NK1 X;  4U8N A;  2YR6 A;  1NAA A;  2XVE A;  4EIQ A;  3LZW A;  1BGJ A;  2JBV A;  2A89 A;  3PVC A;  2PHH A;  3UKL A;  1TRB A;  2YVF A;  2YLZ A;  2FBW A;  4B67 A;  3CNJ A;  3G5S A;  4RG3 A;  5BUL A;  1N1P A;  1S3E A;  5LV9 A;  1DXL A;  1PBD A;  1L9E A;  4YXD A;  2WDR A;  1TYP A;  1NHR A;  3BI5 A;  3F8R A;  1Q1R A;  4JY3 A;  3V76 A;  2BK3 A;  5GSN A;  3GMC A;  3QVR A;  4K22 A;  5L46 A;  4GDP A;  1H82 A;  4UDR A;  3P9U A;  4NEV A;  1FOH A;  4TLX A;  3SQP A;  1OJ9 A;  3AD9 B;  4J2W A;  1F8S A;  3CND A;  4C3X A;  3FMW A;  3C4N A;  4KX6 A;  3NYF A;  3LB8 A;  1F6M A;  3NTA A;  2B9Y A;  2IID A;  4AOS A;  1VRQ B;  2Q6U A;  2Z5Y A;  4BJY A;  1P2H A;  3CTY A;  4CCR A;  3GDN A;  1QLB A;  4UDP A;  5JCN A;  3FG2 P;  2BAC A;  2GQW A;  2ZBW A;  1H86 A;  5U1O A;  2R0P A;  5BVA A;  2YR4 A;  4U8M A;  1IUT A;  1P2E A;  3AE2 A;  4REK A;  3LZX A;  1TDN A;  2C76 A;  4U8J A;  1KSU A;  4XWZ A;  1D7L A;  2YG6 A;  5FS7 A;  4B68 A;  4GDE A;  3T37 A;  1L9C A;  2GRT A;  1M64 A;  2E4G A;  2WEU A;  3NTD A;  2XVI A;  2VQ7 A;  1COY A;  3ICS A;  3KLJ A;  4AP3 A;  1S2Y A;  2GH5 A;  3F8D A;  2VVL G;  4H4U A;  3VR9 A;  3UOX A;  2B76 A;  2UZZ A;  2WDQ A;  2ACZ A;  1K0J A;  1YQ4 A;  2Y6Q A;  1NG3 A;  3GYI A;  3CGD A;  4BK1 A;  2TMD A;  5FS6 A;  1NEN A;  1YQZ A;  4GR1 A;  3DJJ A;  2XFP A;  4H2Q A;  4X9M A;  1JEH A;  3P1W A;  5JCM A;  2VVM A;  4K2X A;  1KF6 A;  2EQ6 A;  3IHM A;  1BGN A;  3G5R A;  4OPU A;  2WS3 A;  1IUX A;  1V59 A;  2YQU A;  3AYI A;  4YKF A;  1Q1W A;  3UTH A;  2YM1 A;  1X31 B;  3CNS A;  1DOE A;  2EQ9 A;  1F8W A;  4AOX A;  2A8X A;  1CHU A;  2YG5 A;  2ZZB A;  1MOK A;  3QSM A;  4WX1 A;  4CRT A;  1GND A;  3E1T A;  3AEB A;  2YVJ A;  3LAD A;  3GWF A;  5C2T A;  2XFN A;  1NHP A;  4USR A;  1RP0 A;  2GMH A;  1ONF A;  3CN8 A;  4EIP A;  2GR0 A;  2V3B A;  4H50 A;  4D03 A;  2WPE A;  3IHG A;  4IA5 A;  2WPC A;  3K30 A;  4TM3 A;  4TM1 A;  1F3P A;  2QCU A;  4B63 A;  3SFD A;  5KXJ A;  3D8X A;  4KPR A;  3AYJ A;  3PS9 A;  2JKC A;  4I59 A;  3KPF A;  1CBO A;  1E6E A;  4H2R A;  1GRB A;  1JRZ A;  4JN9 A;  2AAQ A;  3DK8 A;  3AE6 A;  2NVK X;  3BI4 A;  1BKW A;  4U8L A;  3AEG A;  1GT8 A;  4TM0 A;  2FJB A;  2V5Z A;  1PBC A;  3UTG A;  3AEA A;  2VVL A;  2F5Z A;  5JCK A;  1LV0 A;  3OZ2 A;  4J34 A;  3P4S A;  1LQT A;  1TYT A;  2WOW A;  3UKP A;  1L9D A;  2CVJ A;  4B1B A;  4B64 A;  1K4Q A;  2X3N A; 
#chains in the Genus database with same CATH topology
 1JNR A;  2BAB A;  2R45 A;  1FL2 A;  3CNP A;  3II4 A;  2GEW A;  2BA9 A;  5BRT A;  4USQ A;  4P9S A;  4BUR A;  1PHH A;  5KVH A;  5KMQ A;  2A87 A;  2RGH A;  3S5W A;  3CPJ G;  1NPX A;  1ELI A;  1CC2 A;  2WOI A;  2EQ7 A;  4JY2 A;  1MXT A;  1GAL A;  4AP1 A;  3SX6 A;  1E1N A;  2R0G A;  1CJ4 A;  1YQ3 A;  2BCP A;  4FK1 A;  5KWF A;  3AE3 A;  4YSY A;  1K0I A;  2GAG B;  4NTD A;  5KOW A;  2JB1 A;  3QSE A;  2C7G A;  2YLT A;  2Z5X A;  3COX A;  3AD8 B;  2BS2 A;  2I0Z A;  1PXC A;  4U2S A;  1KNR A;  3CGE A;  3CPI G;  1BF3 A;  2X99 A;  3GYJ A;  3NGC X;  4G6H A;  1GRE A;  4BK3 A;  4OPC A;  3S61 A;  4EQW A;  4XWR A;  3FIM B;  4YTP A;  1JRY A;  2ARD A;  2BK4 A;  4G74 A;  1AOG A;  5M0Z A;  2BC1 A;  3ICR A;  4YTN A;  3KVE A;  2XLT A;  3L8K A;  4IA6 A;  1PXB A;  3K7Q X;  2WPF A;  1PBF A;  5EB5 A;  2C66 A;  3F8P A;  1GEU A;  3LOV A;  4EMJ A;  3NK2 X;  1GPE A;  2JAE A;  3IWA A;  1NG4 A;  2BCG G;  3UP5 A;  2C64 A;  5IQ4 A;  4J31 A;  4CNJ A;  1GRG A;  2FJD A;  1CL0 A;  1H84 A;  3AE4 A;  3GMB A;  3UKK A;  1ZOV A;  3PO7 A;  1KFY A;  1S2Q A;  3IC9 A;  3NNE A;  1GXF A;  3QJ4 A;  3DME A;  3K7M X;  4A6N A;  4G6G A;  2XFQ A;  3UKF A;  3R9U A;  4RSL A;  2C3C A;  4U8K A;  4EQS A;  3URH A;  3ATQ A;  1LVL A;  3FBS A;  3QVP A;  3AXB A;  4J56 A;  2B7R A;  3NT6 A;  4H4W A;  2V61 A;  3LJP A;  3C96 A;  3NYC A;  4OCG A;  1NEK A;  4APN A;  3DK4 A;  2C75 A;  1O95 A;  2AQJ A;  5JCL A;  3AD7 B;  4DSH A;  1PBE A;  2YLS A;  3V3N A;  3M12 A;  1F8R A;  4OVI A;  2BXS A;  2OAM A;  4GUV A;  3GWD A;  2H88 A;  1H7X A;  4I58 A;  4B65 A;  2OAL A;  2VRL A;  4B69 A;  1O94 A;  3H8I A;  2WBA A;  3NN0 X;  1IJH A;  2B9W A;  1SEZ A;  3BI2 A;  3SGL A;  1CJ3 A;  3KA7 A;  4YSZ A;  4D04 A;  3BNM A;  3UOV A;  2VRM A;  2YR5 A;  3BNU A;  4J57 A;  4PAB A;  2JB3 A;  1DOC A;  3VR8 A;  1ZKQ A;  4IVO B;  4XXG A;  1GRT A;  1HYU A;  1B5Q A;  3B3R A;  2XLR A;  3ZYX A;  3P4R A;  3T0K A;  4NTC A;  3CIR A;  5EB4 A;  3DH9 A;  1PXA A;  3NH3 X;  2C67 A;  1Z6L A;  4G9K A;  1JOA A;  4K5R A;  2PYX A;  1EL8 A;  4DGK A;  2DKI A;  2WP5 A;  3UCL A;  2VOU A;  1XPQ A;  2C72 A;  4ZCC A;  2X8H A;  2WP9 A;  4GCM A;  4UDQ A;  2J3N A;  3EPT A;  4MJW A;  3ATR A;  3UP4 A;  5DBJ A;  3H4K A;  3UTE A;  4ECH A;  2YG4 A;  1H83 A;  3AEF A;  5CQF A;  1NHS A;  2XLU A;  2TPR A;  3RP7 A;  2XVJ A;  3DJD A;  3UOZ A;  4A99 A;  1D4D A;  4DNA A;  3AE1 A;  1JU2 A;  4H4X A;  1ZX9 A;  2BYB A;  1GES A;  2YM2 A;  4GRT A;  1H6V A;  1E1L A;  3VRA A;  1Q9I A;  3DK9 A;  3LXD A;  3NRN A;  1CF3 A;  1ZP0 A;  3VRD B;  3UKH A;  2NPX A;  1TDF A;  5IQ1 A;  1ZK7 A;  4BJZ A;  4AT0 A;  4ZCD A;  2JK6 A;  3H8L A;  4NTE A;  2CDU A;  4H4V A;  3RP8 A;  5J60 A;  4GF7 A;  1LQU A;  4A79 A;  1KDG A;  4WCT A;  3NIX A;  3AWI A;  5IPY A;  1CJC A;  1RSG A;  2EQ8 A;  2YWL A;  1QJD A;  3AEE A;  3I3L A;  4Z24 A;  3SM8 A;  1N4V A;  2XDO A;  1D4E A;  1UKV G;  3M13 A;  1VG9 A;  2JB2 A;  2VQB A;  1H7W A;  2BS4 A;  2XVF A;  2DKH A;  2ZZC A;  2RGO A;  1S3B A;  4CBQ A;  3Q6J A;  4O5Q A;  1TDE A;  1NHQ A;  4HA6 A;  2WQY A;  1Y56 A;  2O9Z A;  1ZMD A;  4ICY A;  4EM3 A;  1PBB A;  1EL5 A;  2C3D A;  5CKU A;  2GR2 A;  3SFE A;  5KRQ A;  3AEC A;  2GR1 A;  4M52 A;  1GER A;  4NEW A;  2ZZ0 A;  1PDH A;  3RED A;  5KOX A;  4CCQ A;  3L1R A;  4A65 A;  1OJD A;  3ALM A;  4H4Z A;  1VDC A;  3K7T A;  3ALL A;  4YT0 A;  1GRH A;  2QA1 A;  2C4C A;  4NNJ A;  4YSX A;  3V3O A;  3AED A;  2YVG A;  4YSH A;  2C65 A;  1W4X A;  2FJE A;  3AE5 A;  4OPL A;  4EMW A;  3CPH G;  1N4W A;  3QSS A;  2V6O A;  2BXR A;  4EM4 A;  2R4J A;  2XFU A;  1DOD A;  2QA2 A;  2YAU A;  4J36 A;  3GRT A;  4H4T A;  2WP6 A;  5U25 A;  1PJ5 A;  1N4U A;  3I6D A;  3NKS A;  2Q7V A;  1ZY8 A;  2BK5 A;  3P4Q A;  4JNQ A;  4K8D A;  4C74 A;  4Z25 A;  4YWO A;  5C3J A;  2YG7 A;  1FEA A;  3D1C A;  4PAA A;  3SZF A;  2V60 A;  3DA1 A;  1O5W A;  4FX9 A;  1BZL A;  4OPI A;  5FMH A;  1E1K A;  4K5S A;  2Y6R A;  3EAO A;  4A5L A;  4H4P A;  1XAN A;  5HHF A;  1E39 A;  1FCD A;  2H89 A;  1IUV A;  1PS9 A;  2X8C A;  4LII A;  1DJN A;  3ZDN A;  1ZOY A;  5EBK A;  2GVC A;  1GOS A;  2XCG A;  5HY5 A;  4ZN0 A;  4JDR A;  1JRX A;  2B9X A;  3RP6 A;  4Z44 A;  5U63 A;  2XYO A;  2FJA A;  3IF9 A;  1E7P A;  2RGJ A;  3SZ0 A;  3SYI A;  1K0L A;  4J33 A;  3DJG X;  4IVM B;  1DJQ A;  1OJA A;  3M0O A;  2WU2 A;  2C70 A;  3CGC A;  1PN0 A;  4K7Z A;  4H2N A;  1CC4 A;  3SZC A;  5ER0 A;  3UKA A;  3NHO X;  2E1M A;  2X50 A;  4U2L A;  2X8G A;  2XLS A;  1MO9 A;  3QFB A;  4BV6 A;  1DOB A;  4Z2U A;  3NK0 X;  4JNA A;  3VRB A;  3FPZ A;  1OJT A;  4BK2 A;  1FEC A;  3DGH A;  1D4C A;  2BC0 A;  3G5Q A;  4CY6 A;  4C77 A;  3QFA A;  4EMI A;  1FEB A;  3AE9 A;  2WOV A;  3RHA A;  1GRA A;  3KKJ A;  1IUS A;  4X4J A;  3VQR A;  2XFO A;  2XVH A;  4Z2R A;  5HXI A;  4HB9 A;  4JQ9 A;  4Y4L A;  4Z26 A;  2Q0L A;  3AE8 A;  3ABV A;  5KVI A;  1GTE A;  1YKJ A;  4A7A A;  1B4V A;  1VQW A;  4UP3 A;  3RNM A;  2BS3 A;  1EL9 A;  2GF3 A;  2GB0 A;  1EBD A;  4LA1 A;  4II2 A;  1E1M A;  4H2P A;  3CMM A;  3ISH A;  4IV9 A;  5EOW A;  1B37 A;  4G73 A;  1Y56 B;  4LU6 A;  3UTF A;  3EAN A;  2IVD A;  1GTH A;  4TLZ A;  5KNL A;  3WE0 A;  1TDK A;  1PJ6 A;  4TM4 A;  4YTM A;  2OLO A;  1GV4 A;  2Q0K A;  4Z43 A;  3BHK A;  4FK1 C;  4YKG A;  4AT2 A;  4CY8 A;  4O5U A;  4CNK A;  3GD4 A;  1D5T A;  4OPT A;  1D7Y A;  4U8O A;  3NN6 X;  1KSS A;  4A9W A;  3ALJ A;  1TDO A;  1CC6 A;  1ZDL A;  3EF6 A;  1XDI A;  4H4S A;  2WET A;  1VG0 A;  2IVE A;  2XLP A;  2VZ2 A;  4ADW A;  3CGB A;  4X9N A;  2WU5 A;  3UOY A;  3GSI A;  4E0V A;  1QO8 A;  5BUK A;  1OJC A;  1GET A;  1PJ7 A;  3AB1 A;  1NDA A;  3NLC A;  1M6I A;  4DSG A;  3BHF A;  3Q9T A;  5HYM A;  1JNZ A;  2AR8 A;  2CFY A;  3AYL A;  3T2Y A;  4B66 A;  3KU9 A;  5FS8 A;  2BRA A;  3NYE A;  3P4P A;  4N9X A;  4EQR A;  2GV8 A;  3CNT A;  4OPG A;  4H7U A;  5FS9 A;  2B7S A;  2R0C A;  3HYW A;  1GSN A;  2V3A A;  4H4R A;  2R9Z A;  5M10 A;  2GAH B;  1KNP A;  4NZH A;  1H81 A;  3UKQ A;  3AE7 A;  1ZMC A;  4EQX A;  1DNC A;  4OPD A;  2WHD A;  1EL7 A;  3O0H A;  1L0V A;  2YG3 A;  2R46 A;  3B6D A;  3ITJ A;  4H4Y A;  4A6N B;  2APG A;  2HQM A;  1CJ2 A;  2W0H A;  4RG4 A;  3KD9 A;  1Y0P A;  1XHC A;  4U8P A;  4Y4M A;  3DGZ A;  5TR3 A;  2QAE A;  2WDV A;  1LTX R;  5J7X A;  3OC4 A;  4U8I A;  2OA1 A;  3HZL A;  4NWZ A;  1LJ1 A;  5JCI A;  1IUU A;  2OLN A;  4U2T A;  2WES A;  2E5V A;  4Y4N A;  2C73 A;  3GDP A;  4H4Q A;  2BRY A;  2YLX A;  1B8S A;  2RAB A;  3GD3 A;  3T2K A;  3ICT A;  3NG7 X;  1LPF A;  1REO A;  2GQF A;  1IUW A;  3DJE A;  2GR3 A;  1RYI A;  3ADA B;  3C4A A;  3GRS A;  3JSK A;  2YLW A;  2YLR A;  1BWC A;  1GRF A;  2R4E A;  4Z2T A;  2CUL A;  5GRT A;  4C5O A;  2GMJ A;  1YY5 A;  4FDC B;  3NK1 X;  4U8N A;  2YR6 A;  1NAA A;  2XVE A;  3SZW A;  4EIQ A;  3LZW A;  1BGJ A;  2JBV A;  2A89 A;  3PVC A;  2PHH A;  3UKL A;  1TRB A;  2YVF A;  2YLZ A;  2FBW A;  4B67 A;  3CNJ A;  3G5S A;  4RG3 A;  5BUL A;  1N1P A;  1S3E A;  3SY4 A;  5LV9 A;  1DXL A;  4GAV A;  1PBD A;  1L9E A;  4YXD A;  2WDR A;  1TYP A;  1NHR A;  3BI5 A;  3F8R A;  1Q1R A;  4JY3 A;  3V76 A;  2BK3 A;  5GSN A;  3GMC A;  3QVR A;  4K22 A;  5L46 A;  4GDP A;  1H82 A;  4UDR A;  3HYX A;  3P9U A;  4NEV A;  1FOH A;  4TLX A;  3SQP A;  1OJ9 A;  3AD9 B;  4J2W A;  1F8S A;  3CND A;  4C3X A;  3FMW A;  3T14 A;  3C4N A;  4KX6 A;  3NYF A;  3LB8 A;  5KMR A;  1F6M A;  3NTA A;  2B9Y A;  2IID A;  4AOS A;  1VRQ B;  2Q6U A;  2Z5Y A;  4BJY A;  1P2H A;  3CTY A;  4CCR A;  5KMP A;  3GDN A;  1QLB A;  4UDP A;  5JCN A;  3FG2 P;  4II3 A;  2BAC A;  2GQW A;  2ZBW A;  1H86 A;  5U1O A;  2R0P A;  5BVA A;  2YR4 A;  4U8M A;  1IUT A;  1P2E A;  3AE2 A;  4REK A;  3LZX A;  1TDN A;  2C76 A;  4U8J A;  1KSU A;  4XWZ A;  1D7L A;  2YG6 A;  5KMS A;  5FS7 A;  4B68 A;  4GDE A;  3T37 A;  1L9C A;  2GRT A;  1M64 A;  2E4G A;  2WEU A;  3NTD A;  2XVI A;  2VQ7 A;  1COY A;  3ICS A;  3KLJ A;  4AP3 A;  1S2Y A;  2GH5 A;  3F8D A;  2VVL G;  4H4U A;  3VR9 A;  3UOX A;  2B76 A;  2UZZ A;  2WDQ A;  2ACZ A;  1K0J A;  1YQ4 A;  2Y6Q A;  1NG3 A;  3GYI A;  3CGD A;  4BK1 A;  2TMD A;  5FS6 A;  1NEN A;  1YQZ A;  4GR1 A;  3DJJ A;  2XFP A;  4H2Q A;  4X9M A;  1JEH A;  3GYX A;  3P1W A;  5JCM A;  3T2Z A;  2VVM A;  4K2X A;  1KF6 A;  2EQ6 A;  3IHM A;  1BGN A;  3G5R A;  4OPU A;  2WS3 A;  1IUX A;  1V59 A;  2YQU A;  3AYI A;  4YKF A;  1Q1W A;  3SXI A;  2YM1 A;  1X31 B;  3CNS A;  3UTH A;  1DOE A;  2EQ9 A;  1F8W A;  4AOX A;  2A8X A;  1CHU A;  2YG5 A;  2ZZB A;  3KPK A;  1MOK A;  3QSM A;  4WX1 A;  4CRT A;  1GND A;  3E1T A;  3AEB A;  2YVJ A;  3LAD A;  4GAP A;  3GWF A;  5C2T A;  2XFN A;  1NHP A;  4USR A;  1RP0 A;  2GMH A;  1ONF A;  3CN8 A;  4EIP A;  2GR0 A;  2V3B A;  4H50 A;  4D03 A;  2WPE A;  3IHG A;  4IA5 A;  2WPC A;  3K30 A;  4TM3 A;  4TM1 A;  1F3P A;  2QCU A;  4B63 A;  3SFD A;  5KXJ A;  3D8X A;  4KPR A;  3AYJ A;  3PS9 A;  2JKC A;  4I59 A;  3T31 A;  4C3Y A;  3KPF A;  1CBO A;  1E6E A;  4H2R A;  1GRB A;  1JRZ A;  4JN9 A;  2AAQ A;  3DK8 A;  3AE6 A;  2NVK X;  3BI4 A;  1BKW A;  4U8L A;  3AEG A;  1GT8 A;  3HYV A;  4TM0 A;  2FJB A;  2V5Z A;  1PBC A;  3UTG A;  3AEA A;  2VVL A;  2F5Z A;  5JCK A;  1LV0 A;  3OZ2 A;  4J34 A;  3P4S A;  1LQT A;  1TYT A;  2WOW A;  3UKP A;  1L9D A;  2CVJ A;  4B1B A;  4B64 A;  1K4Q A;  2X3N A; 
#chains in the Genus database with same CATH homology
 1JNR A;  2BAB A;  2R45 A;  1FL2 A;  3CNP A;  3II4 A;  2GEW A;  2BA9 A;  5BRT A;  4USQ A;  4P9S A;  4BUR A;  1PHH A;  5KVH A;  5KMQ A;  2A87 A;  2RGH A;  3S5W A;  3CPJ G;  1NPX A;  1ELI A;  1CC2 A;  2WOI A;  2EQ7 A;  4JY2 A;  1MXT A;  1GAL A;  4AP1 A;  3SX6 A;  1E1N A;  2R0G A;  1CJ4 A;  1YQ3 A;  2BCP A;  4FK1 A;  5KWF A;  3AE3 A;  4YSY A;  1K0I A;  2GAG B;  4NTD A;  5KOW A;  2JB1 A;  3QSE A;  2C7G A;  2YLT A;  2Z5X A;  3COX A;  3AD8 B;  2BS2 A;  2I0Z A;  1PXC A;  4U2S A;  1KNR A;  3CGE A;  3CPI G;  1BF3 A;  2X99 A;  3GYJ A;  3NGC X;  4G6H A;  1GRE A;  4BK3 A;  4OPC A;  3S61 A;  4EQW A;  4XWR A;  3FIM B;  4YTP A;  1JRY A;  2ARD A;  2BK4 A;  4G74 A;  1AOG A;  5M0Z A;  2BC1 A;  3ICR A;  4YTN A;  3KVE A;  2XLT A;  3L8K A;  4IA6 A;  1PXB A;  3K7Q X;  2WPF A;  1PBF A;  5EB5 A;  2C66 A;  3F8P A;  1GEU A;  3LOV A;  4EMJ A;  3NK2 X;  1GPE A;  2JAE A;  3IWA A;  1NG4 A;  2BCG G;  3UP5 A;  2C64 A;  5IQ4 A;  4J31 A;  4CNJ A;  1GRG A;  2FJD A;  1CL0 A;  1H84 A;  3AE4 A;  3GMB A;  3UKK A;  1ZOV A;  3PO7 A;  1KFY A;  1S2Q A;  3IC9 A;  3NNE A;  1GXF A;  3QJ4 A;  3DME A;  3K7M X;  4A6N A;  4G6G A;  2XFQ A;  3UKF A;  3R9U A;  4RSL A;  2C3C A;  4U8K A;  4EQS A;  3URH A;  3ATQ A;  1LVL A;  3FBS A;  3QVP A;  3AXB A;  4J56 A;  2B7R A;  3NT6 A;  4H4W A;  2V61 A;  3LJP A;  3C96 A;  3NYC A;  4OCG A;  1NEK A;  4APN A;  3DK4 A;  2C75 A;  1O95 A;  2AQJ A;  5JCL A;  3AD7 B;  4DSH A;  1PBE A;  2YLS A;  3V3N A;  3M12 A;  1F8R A;  4OVI A;  2BXS A;  2OAM A;  4GUV A;  3GWD A;  2H88 A;  1H7X A;  4I58 A;  4B65 A;  2OAL A;  2VRL A;  4B69 A;  1O94 A;  3H8I A;  2WBA A;  3NN0 X;  1IJH A;  2B9W A;  1SEZ A;  3BI2 A;  3SGL A;  1CJ3 A;  3KA7 A;  4YSZ A;  4D04 A;  3BNM A;  3UOV A;  2VRM A;  2YR5 A;  3BNU A;  4J57 A;  4PAB A;  2JB3 A;  1DOC A;  3VR8 A;  1ZKQ A;  4IVO B;  4XXG A;  1GRT A;  1HYU A;  1B5Q A;  3B3R A;  2XLR A;  3ZYX A;  3P4R A;  3T0K A;  4NTC A;  3CIR A;  5EB4 A;  3DH9 A;  1PXA A;  3NH3 X;  2C67 A;  1Z6L A;  4G9K A;  1JOA A;  4K5R A;  2PYX A;  1EL8 A;  4DGK A;  2DKI A;  2WP5 A;  3UCL A;  2VOU A;  1XPQ A;  2C72 A;  4ZCC A;  2X8H A;  2WP9 A;  4GCM A;  4UDQ A;  2J3N A;  3EPT A;  4MJW A;  3ATR A;  3UP4 A;  5DBJ A;  3H4K A;  3UTE A;  4ECH A;  2YG4 A;  1H83 A;  3AEF A;  5CQF A;  1NHS A;  2XLU A;  2TPR A;  3RP7 A;  2XVJ A;  3DJD A;  3UOZ A;  4A99 A;  1D4D A;  4DNA A;  3AE1 A;  1JU2 A;  4H4X A;  1ZX9 A;  2BYB A;  1GES A;  2YM2 A;  4GRT A;  1H6V A;  1E1L A;  3VRA A;  1Q9I A;  3DK9 A;  3LXD A;  3NRN A;  1CF3 A;  1ZP0 A;  3VRD B;  3UKH A;  2NPX A;  1TDF A;  5IQ1 A;  1ZK7 A;  4BJZ A;  4AT0 A;  4ZCD A;  2JK6 A;  3H8L A;  4NTE A;  2CDU A;  4H4V A;  3RP8 A;  5J60 A;  4GF7 A;  1LQU A;  4A79 A;  1KDG A;  4WCT A;  3NIX A;  3AWI A;  5IPY A;  1CJC A;  1RSG A;  2EQ8 A;  2YWL A;  1QJD A;  3AEE A;  3I3L A;  4Z24 A;  3SM8 A;  1N4V A;  2XDO A;  1D4E A;  1UKV G;  3M13 A;  1VG9 A;  2JB2 A;  2VQB A;  1H7W A;  2BS4 A;  2XVF A;  2DKH A;  2ZZC A;  2RGO A;  1S3B A;  4CBQ A;  3Q6J A;  4O5Q A;  1TDE A;  1NHQ A;  4HA6 A;  2WQY A;  1Y56 A;  2O9Z A;  1ZMD A;  4ICY A;  4EM3 A;  1PBB A;  1EL5 A;  2C3D A;  5CKU A;  2GR2 A;  3SFE A;  5KRQ A;  3AEC A;  2GR1 A;  4M52 A;  1GER A;  4NEW A;  2ZZ0 A;  1PDH A;  3RED A;  5KOX A;  4CCQ A;  3L1R A;  4A65 A;  1OJD A;  3ALM A;  4H4Z A;  1VDC A;  3K7T A;  3ALL A;  4YT0 A;  1GRH A;  2QA1 A;  2C4C A;  4NNJ A;  4YSX A;  3V3O A;  3AED A;  2YVG A;  4YSH A;  2C65 A;  1W4X A;  2FJE A;  3AE5 A;  4OPL A;  4EMW A;  3CPH G;  1N4W A;  3QSS A;  2V6O A;  2BXR A;  4EM4 A;  2R4J A;  2XFU A;  1DOD A;  2QA2 A;  2YAU A;  4J36 A;  3GRT A;  4H4T A;  2WP6 A;  5U25 A;  1PJ5 A;  1N4U A;  3I6D A;  3NKS A;  2Q7V A;  1ZY8 A;  2BK5 A;  3P4Q A;  4JNQ A;  4K8D A;  4C74 A;  4Z25 A;  4YWO A;  5C3J A;  2YG7 A;  1FEA A;  3D1C A;  4PAA A;  3SZF A;  2V60 A;  3DA1 A;  1O5W A;  4FX9 A;  1BZL A;  4OPI A;  5FMH A;  1E1K A;  4K5S A;  2Y6R A;  3EAO A;  4A5L A;  4H4P A;  1XAN A;  5HHF A;  1E39 A;  1FCD A;  2H89 A;  1IUV A;  1PS9 A;  2X8C A;  4LII A;  1DJN A;  3ZDN A;  1ZOY A;  5EBK A;  2GVC A;  1GOS A;  2XCG A;  5HY5 A;  4ZN0 A;  4JDR A;  1JRX A;  2B9X A;  3RP6 A;  4Z44 A;  5U63 A;  2XYO A;  2FJA A;  3IF9 A;  1E7P A;  2RGJ A;  3SZ0 A;  3SYI A;  1K0L A;  4J33 A;  3DJG X;  4IVM B;  1DJQ A;  1OJA A;  3M0O A;  2WU2 A;  2C70 A;  3CGC A;  1PN0 A;  4K7Z A;  4H2N A;  1CC4 A;  3SZC A;  5ER0 A;  3UKA A;  3NHO X;  2E1M A;  2X50 A;  4U2L A;  2X8G A;  2XLS A;  1MO9 A;  3QFB A;  4BV6 A;  1DOB A;  4Z2U A;  3NK0 X;  4JNA A;  3VRB A;  3FPZ A;  1OJT A;  4BK2 A;  1FEC A;  3DGH A;  1D4C A;  2BC0 A;  3G5Q A;  4CY6 A;  4C77 A;  3QFA A;  4EMI A;  1FEB A;  3AE9 A;  2WOV A;  3RHA A;  1GRA A;  3KKJ A;  1IUS A;  4X4J A;  3VQR A;  2XFO A;  2XVH A;  4Z2R A;  5HXI A;  4HB9 A;  4JQ9 A;  4Y4L A;  4Z26 A;  2Q0L A;  3AE8 A;  3ABV A;  5KVI A;  1GTE A;  1YKJ A;  4A7A A;  1B4V A;  1VQW A;  4UP3 A;  3RNM A;  2BS3 A;  1EL9 A;  2GF3 A;  2GB0 A;  1EBD A;  4LA1 A;  4II2 A;  1E1M A;  4H2P A;  3CMM A;  3ISH A;  4IV9 A;  5EOW A;  1B37 A;  4G73 A;  1Y56 B;  4LU6 A;  3UTF A;  3EAN A;  2IVD A;  1GTH A;  4TLZ A;  5KNL A;  3WE0 A;  1TDK A;  1PJ6 A;  4TM4 A;  4YTM A;  2OLO A;  1GV4 A;  2Q0K A;  4Z43 A;  3BHK A;  4FK1 C;  4YKG A;  4AT2 A;  4CY8 A;  4O5U A;  4CNK A;  3GD4 A;  1D5T A;  4OPT A;  1D7Y A;  4U8O A;  3NN6 X;  1KSS A;  4A9W A;  3ALJ A;  1TDO A;  1CC6 A;  1ZDL A;  3EF6 A;  1XDI A;  4H4S A;  2WET A;  1VG0 A;  2IVE A;  2XLP A;  2VZ2 A;  4ADW A;  3CGB A;  4X9N A;  2WU5 A;  3UOY A;  3GSI A;  4E0V A;  1QO8 A;  5BUK A;  1OJC A;  1GET A;  1PJ7 A;  3AB1 A;  1NDA A;  3NLC A;  1M6I A;  4DSG A;  3BHF A;  3Q9T A;  5HYM A;  1JNZ A;  2AR8 A;  2CFY A;  3AYL A;  3T2Y A;  4B66 A;  3KU9 A;  5FS8 A;  2BRA A;  3NYE A;  3P4P A;  4N9X A;  4EQR A;  2GV8 A;  3CNT A;  4OPG A;  4H7U A;  5FS9 A;  2B7S A;  2R0C A;  3HYW A;  1GSN A;  2V3A A;  4H4R A;  2R9Z A;  5M10 A;  2GAH B;  1KNP A;  4NZH A;  1H81 A;  3UKQ A;  3AE7 A;  1ZMC A;  4EQX A;  1DNC A;  4OPD A;  2WHD A;  1EL7 A;  3O0H A;  1L0V A;  2YG3 A;  2R46 A;  3B6D A;  3ITJ A;  4H4Y A;  4A6N B;  2APG A;  2HQM A;  1CJ2 A;  2W0H A;  4RG4 A;  3KD9 A;  1Y0P A;  1XHC A;  4U8P A;  4Y4M A;  3DGZ A;  5TR3 A;  2QAE A;  2WDV A;  1LTX R;  5J7X A;  3OC4 A;  4U8I A;  2OA1 A;  3HZL A;  4NWZ A;  1LJ1 A;  5JCI A;  1IUU A;  2OLN A;  4U2T A;  2WES A;  2E5V A;  4Y4N A;  2C73 A;  3GDP A;  4H4Q A;  2BRY A;  2YLX A;  1B8S A;  2RAB A;  3GD3 A;  3T2K A;  3ICT A;  3NG7 X;  1LPF A;  1REO A;  2GQF A;  1IUW A;  3DJE A;  2GR3 A;  1RYI A;  3ADA B;  3C4A A;  3GRS A;  3JSK A;  2YLW A;  2YLR A;  1BWC A;  1GRF A;  2R4E A;  4Z2T A;  2CUL A;  5GRT A;  4C5O A;  2GMJ A;  1YY5 A;  4FDC B;  3NK1 X;  4U8N A;  2YR6 A;  1NAA A;  2XVE A;  3SZW A;  4EIQ A;  3LZW A;  1BGJ A;  2JBV A;  2A89 A;  3PVC A;  2PHH A;  3UKL A;  1TRB A;  2YVF A;  2YLZ A;  2FBW A;  4B67 A;  3CNJ A;  3G5S A;  4RG3 A;  5BUL A;  1N1P A;  1S3E A;  3SY4 A;  5LV9 A;  1DXL A;  4GAV A;  1PBD A;  1L9E A;  4YXD A;  2WDR A;  1TYP A;  1NHR A;  3BI5 A;  3F8R A;  1Q1R A;  4JY3 A;  3V76 A;  2BK3 A;  5GSN A;  3GMC A;  3QVR A;  4K22 A;  5L46 A;  4GDP A;  1H82 A;  4UDR A;  3HYX A;  3P9U A;  4NEV A;  1FOH A;  4TLX A;  3SQP A;  1OJ9 A;  3AD9 B;  4J2W A;  1F8S A;  3CND A;  4C3X A;  3FMW A;  3T14 A;  3C4N A;  4KX6 A;  3NYF A;  3LB8 A;  5KMR A;  1F6M A;  3NTA A;  2B9Y A;  2IID A;  4AOS A;  1VRQ B;  2Q6U A;  2Z5Y A;  4BJY A;  1P2H A;  3CTY A;  4CCR A;  5KMP A;  3GDN A;  1QLB A;  4UDP A;  5JCN A;  3FG2 P;  4II3 A;  2BAC A;  2GQW A;  2ZBW A;  1H86 A;  5U1O A;  2R0P A;  5BVA A;  2YR4 A;  4U8M A;  1IUT A;  1P2E A;  3AE2 A;  4REK A;  3LZX A;  1TDN A;  2C76 A;  4U8J A;  1KSU A;  4XWZ A;  1D7L A;  2YG6 A;  5KMS A;  5FS7 A;  4B68 A;  4GDE A;  3T37 A;  1L9C A;  2GRT A;  1M64 A;  2E4G A;  2WEU A;  3NTD A;  2XVI A;  2VQ7 A;  1COY A;  3ICS A;  3KLJ A;  4AP3 A;  1S2Y A;  2GH5 A;  3F8D A;  2VVL G;  4H4U A;  3VR9 A;  3UOX A;  2B76 A;  2UZZ A;  2WDQ A;  2ACZ A;  1K0J A;  1YQ4 A;  2Y6Q A;  1NG3 A;  3GYI A;  3CGD A;  4BK1 A;  2TMD A;  5FS6 A;  1NEN A;  1YQZ A;  4GR1 A;  3DJJ A;  2XFP A;  4H2Q A;  4X9M A;  1JEH A;  3GYX A;  3P1W A;  5JCM A;  3T2Z A;  2VVM A;  4K2X A;  1KF6 A;  2EQ6 A;  3IHM A;  1BGN A;  3G5R A;  4OPU A;  2WS3 A;  1IUX A;  1V59 A;  2YQU A;  3AYI A;  4YKF A;  1Q1W A;  3SXI A;  2YM1 A;  1X31 B;  3CNS A;  3UTH A;  1DOE A;  2EQ9 A;  1F8W A;  4AOX A;  2A8X A;  1CHU A;  2YG5 A;  2ZZB A;  3KPK A;  1MOK A;  3QSM A;  4WX1 A;  4CRT A;  1GND A;  3E1T A;  3AEB A;  2YVJ A;  3LAD A;  4GAP A;  3GWF A;  5C2T A;  2XFN A;  1NHP A;  4USR A;  1RP0 A;  2GMH A;  1ONF A;  3CN8 A;  4EIP A;  2GR0 A;  2V3B A;  4H50 A;  4D03 A;  2WPE A;  3IHG A;  4IA5 A;  2WPC A;  3K30 A;  4TM3 A;  4TM1 A;  1F3P A;  2QCU A;  4B63 A;  3SFD A;  5KXJ A;  3D8X A;  4KPR A;  3AYJ A;  3PS9 A;  2JKC A;  4I59 A;  3T31 A;  4C3Y A;  3KPF A;  1CBO A;  1E6E A;  4H2R A;  1GRB A;  1JRZ A;  4JN9 A;  2AAQ A;  3DK8 A;  3AE6 A;  2NVK X;  3BI4 A;  1BKW A;  4U8L A;  3AEG A;  1GT8 A;  3HYV A;  4TM0 A;  2FJB A;  2V5Z A;  1PBC A;  3UTG A;  3AEA A;  2VVL A;  2F5Z A;  5JCK A;  1LV0 A;  3OZ2 A;  4J34 A;  3P4S A;  1LQT A;  1TYT A;  2WOW A;  3UKP A;  1L9D A;  2CVJ A;  4B1B A;  4B64 A;  1K4Q A;  2X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...