5KMRA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 3.0 angstrom resolution.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
total genus 112
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmrA00
4G9KA 3HYXA 5KMPA 3T0KA 4G73A 3T2ZA 3SY4A 5KMSA 4GAVA 4GAPA 3SYIA 3KPKA 4G6HA 4G6GA 3SZCA 3HYWA 3HYVA 3SZFA 3SX6A 3SXIA 4G74A 5KMRA 3T14A 3SZ0A 3T2YA 4NWZA 3T31A 3T2KA 5KMQA 3SZWA
chains in the Genus database with same CATH superfamily
4DSGA 4ZN0A 1GREA 3I3LA 1GTEA 3K7TA 1L0VA 4RSLA 4EMIA 2V6OA 3UOYA 4O5UA 4U2SA 4G73A 3P4RA 2QA1A 2WHDA 2JKCA 3SY4A 1ZK7A 1W4XA 5JCMA 3GRTA 3BI2A 5J60A 4H4UA 1ZDLA 2YQUA 1KSUA 1XANA 3BI5A 1NAAA 2APGA 2B76A 1NENA 1GPEA 4RG3A 4Z25A 4LU6A 2V3BA 3H4KA 1PXBA 3UOVA 3CNJA 4U8MA 5U63A 3AD9B 3DGHA 5KVIA 1Q1RA 3LOVA 1KSSA 2YG6A 3SZ0A 4CY8A 4I59A 4K7ZA 2BC0A 2E4GA 2YLRA 1NPXA 2GR3A 3P9UA 3GYIA 3Q6JA 5JCIA 3QFAA 1YQ3A 4IV9A 4PABA 3NRNA 1N4UA 3IHMA 4NEWA 1CHUA 5GSNA 3DJDA 4A5LA 1AOGA 2IVDA 4J57A 3M12A 1GRBA 3KVEA 2EQ6A 2FJDA 2VOUA 1XPQA 1O5WA 2PHHA 4JNAA 2XFOA 2RABA 3I6DA 2YG7A 2YVGA 1PBDA 5U1OA 2WEUA 4C3XA 4DGKA 1NHPA 5LV9A 2O9ZA 2UZZA 2X8CA 3GMCA 4Y4MA 4J2WA 3CIRA 1JEHA 2YG5A 1MO9A 3F8RA 2XLRA 3GRSA 4J34A 3VRAA 2C67A 1IUSA 4XWZA 2WU2A 3L1RA 4UDRA 5HYMA 2R0CA 1CC4A 2AAQA 1PBBA 3AECA 5KMQA 2XVHA 5KVHA 1E39A 1OJ9A 1TDOA 5KWFA 2R4EA 2XVFA 2BRAA 4B64A 5KMPA 4KX6A 2GR0A 1FEAA 2R45A 4H7UA 2GB0A 2FJAA 1GRTA 2ZZ0A 1LJ1A 4J56A 1DODA 5KNLA 2TMDA 4N9XA 4FX9A 5M0ZA 3KPKA 4ADWA 2NVKX 1IUXA 4K8DA 1DJQA 2WU5A 2CDUA 4H4XA 2R46A 1YQZA 2YAUA 1GTHA 2WP5A 1DXLA 4YT0A 3GD3A 2RGHA 3NN6X 1JRZA 3ISHA 3KKJA 3BHKA 5EB4A 3QVRA 3T2YA 1ZMDA 3ICTA 2FBWA 3C4AA 4OPLA 2A8XA 2XVEA 3ALLA 3QFBA 1L9CA 1QLBA 1OJCA 3GD4A 3VRBA 3LADA 3T0KA 4U2TA 1NHSA 2Q6UA 3O0HA 3CPJG 3ATRA 3P4QA 3T2ZA 3LB8A 4EM3A 3CNTA 1H83A 3K7QX 3SZCA 3KPFA 4C5OA 1CJCA 4GDPA 1MXTA 2BC1A 2CVJA 1ZY8A 4A65A 5HY5A 1CJ4A 4JNQA 3NK0X 1TRBA 3ATQA 2AR8A 3IWAA 2GMJA 4H4SA 4YSZA 4APNA 3AE3A 4P9SA 2YVFA 4HB9A 1QO8A 4MJWA 2RGJA 4U8LA 2BCPA 1GT8A 4XWRA 3E1TA 2OAMA 2X3NA 2W0HA 2WOWA 5IQ4A 2XYOA 2VVLG 3M0OA 1Y56B 4A9WA 1Z6LA 4A99A 2HQMA 1CJ2A 3H8IA 4OPGA 3VR8A 4USRA 3SYIA 5EOWA 2OLOA 1GESA 4G6HA 4GUVA 4YTNA 1VG0A 3P1WA 3EANA 3NYEA 3DK9A 3CGEA 2J3NA 4C74A 3COXA 3FMWA 4HA6A 5KOXA 1IJHA 2VRLA 1O95A 1CBOA 3T37A 3AEBA 1ZMCA 3LZWA 4A6NB 4X9MA 1GSNA 4A79A 1LQUA 2FJEA 3PVCA 1GETA 4Y4LA 4TM1A 4BURA 1CF3A 1K0JA 1D4CA 1D4DA 3CNSA 2QCUA 3GDNA 4IVOB 4H2NA 3UOZA 2XLUA 4IVMB 4CCQA 2DKIA 2C65A 4OPIA 1BF3A 1PJ6A 3VQRA 4YSYA 3AE6A 2JB2A 4A7AA 1VDCA 1GEUA 2GVCA 3D8XA 3UKHA 2VZ2A 1D4EA 1HYUA 5CQFA 3D1CA 1ZP0A 1E7PA 1CJ3A 1NG4A 1RYIA 4NTCA 4Y4NA 1E1KA 2B9XA 3EF6A 4OPDA 3GWDA 3AE9A 1ZOYA 2BABA 1REOA 1DJNA 2XLSA 4Z2RA 5KOWA 3S5WA 2WDQA 3UKFA 3URHA 4B1BA 4GR1A 2XCGA 1Q9IA 3AEEA 2WDRA 3DMEA 2Y6RA 4PAAA 4K2XA 3UTHA 3JSKA 5CKUA 3AEAA 1F8WA 2H88A 2R9ZA 4DNAA 3REDA 1FECA 1L9DA 3ITJA 4I58A 5FMHA 4BK1A 2WQYA 1PXAA 5IQ1A 4YWOA 3S61A 3AYJA 1E1LA 3UP5A 4EQWA 2ACZA 1OJDA 4BJYA 3CN8A 3CPHG 3NYCA 5EBKA 1E1MA 2JB3A 2Z5XA 3SFDA 4U8IA 3NHOX 3GYJA 1D5TA 4G74A 2GR2A 3AD7B 2WPEA 3AYIA 3BNUA 4YTMA 3CNPA 2WPFA 5FS6A 2WOIA 1GV4A 3B6DA 3FG2P 5C2TA 3SFEA 1H7WA 2ZBWA 2C66A 3GMBA 4B63A 4Z44A 1B4VA 2E1MA 3NTAA 1ZOVA 2BYBA 5JCNA 2DKHA 4II3A 1CL0A 3NG7X 4XXGA 1LPFA 4X9NA 4AOXA 3L8KA 4DSHA 4E0VA 4B69A 3AWIA 1YKJA 2NPXA 3SX6A 3RNMA 4AT0A 2B9YA 2V60A 1GXFA 1NDAA 1IUUA 2FJBA 4LIIA 3ZYXA 4Z26A 4K5SA 1IUVA 2XVJA 1PN0A 4H2PA 3QSSA 4OPCA 4D03A 1D7YA 2XFQA 2YM2A 1BGNA 4EQRA 4FDCB 1YY5A 2GQWA 4G9KA 1H84A 2RGOA 1H82A 2BS2A 2VRMA 1PS9A 3HYXA 1EL8A 1RSGA 4H4PA 2XFPA 4NEVA 1NHRA 3QSMA 1TDFA 5FS7A 2E5VA 3AE4A 1S3EA 3ALMA 1M64A 4CY6A 3G5SA 2C75A 1QJDA 2VQBA 3NIXA 1EL9A 2C3DA 1GERA 3UKAA 1NHQA 3CGBA 3UKPA 4NTDA 1KF6A 2PYXA 2BS3A 3LZXA 4U8PA 4B68A 2C72A 1TDNA 3FIMB 3UCLA 2XFNA 4H4YA 3WE0A 3V76A 5KXJA 2H89A 2WPCA 1JNRA 2BK3A 3M13A 4BJZA 1BZLA 2BXSA 2X50A 2Q0LA 3CNDA 3AE7A 2YG4A 1M6IA 3FPZA 1F8SA 4EIPA 3ICRA 3UTFA 3BNMA 3DGZA 4X4JA 5KRQA 3DJJA 5KMSA 3K7MX 3NK1X 4JY3A 3HYWA 4ECHA 2C73A 4LA1A 1L9EA 1PBFA 2V5ZA 2C3CA 3ALJA 5KMRA 1IUWA 1P2HA 1JRXA 5BRTA 2BXRA 2B7RA 3SQPA 3GYXA 1F6MA 4WCTA 4GCMA 4REKA 1V59A 5BULA 3F8PA 3NGCX 4USQA 4H2RA 2I0ZA 4TLXA 1ZKQA 3EAOA 3AE1A 2BCGG 1NEKA 1PJ5A 1MOKA 4UDQA 4TM3A 5TR3A 3C96A 3RP8A 1GALA 1F3PA 1BWCA 3NKSA 1S2QA 2ZZCA 4YKFA 1PHHA 3P4PA 1ONFA 3BI4A 5HXIA 2YM1A 5BVAA 3AYLA 4AOSA 2QAEA 3GDPA 3P4SA 2GAHB 2VVLA 4J36A 4NNJA 4AT2A 3ICSA 2XFUA 2Y6QA 4NTEA 3AEGA 1TDKA 3DK8A 1LV0A 3G5QA 3F8DA 4OCGA 3IHGA 3LJPA 5J7XA 1EL7A 2XDOA 4OVIA 2Q7VA 4YKGA 2BA9A 5BUKA 2GMHA 2IVEA 1PBCA 2GV8A 1S2YA 2WBAA 3C4NA 3EPTA 3T31A 4EMJA 2GRTA 1GRAA 3RHAA 1H6VA 2WOVA 3RP6A 1BKWA 2YLWA 3IF9A 3R9UA 1E6EA 4IA6A 1XHCA 4JQ9A 2ZZBA 4K22A 4GDEA 3BHFA 1P2EA 3NNEA 1GRGA 2BRYA 2R4JA 1N4VA 2WP6A 3LXDA 1GOSA 4GRTA 4U8NA 4ZCDA 5DBJA 4YXDA 2YG3A 4EQXA 4YSXA 4JY2A 2WDVA 4CRTA 2YLZA 1Y0PA 3II4A 1Y56A 2JB1A 3OC4A 1CC6A 2C64A 2GR1A 3DA1A 3UOXA 3NLCA 3SGLA 4H4ZA 4BK2A 4RG4A 3DJEA 5GRTA 2R0PA 1EBDA 3AB1A 4C77A 3PS9A 2GEWA 1D7LA 1FL2A 2CFYA 4H4WA 5FS9A 2JBVA 3CGCA 5HHFA 2EQ8A 3CPIG 1KNRA 2QA2A 1EL5A 1B37A 1K0LA 4J33A 4OPUA 3UKLA 4D04A 3NYFA 3ZDNA 1OJTA 4CBQA 1NG3A 2GQFA 5JCLA 3DJGX 1K0IA 1LTXR 3HZLA 3VRDB 1LVLA 3NT6A 4U8KA 1FOHA 3HYVA 1H7XA 4TLZA 2C4CA 3K30A 4B66A 4JN9A 2JK6A 4H4QA 3SXIA 3GSIA 4AP1A 2WS3A 4YTPA 1H86A 1DOEA 3AEDA 1KDGA 5FS8A 2YLSA 3UKKA 3NH3X 2V61A 1LQTA 2YWLA 2V3AA 2BK5A 5ER0A 4EIQA 1FCDA 4FK1C 5M10A 3UKQA 4Z2TA 1DNCA 1JU2A 2BACA 4CNJA 3SM8A 3SZWA 3DH9A 2BK4A 4ICYA 4J31A 4EM4A 2WETA 3CTYA 3QJ4A 2VVMA 1B8SA 2C76A 1B5QA 4NZHA 4GAVA 3PO7A 1GNDA 2IIDA 1JOAA 3SZFA 2X99A 1DOBA 1UKVG 1DOCA 4Z2UA 4ZCCA 1ZX9A 1RP0A 4FK1A 3AE5A 2XVIA 2R0GA 1F8RA 3B3RA 1S3BA 2WP9A 3IC9A 3UTEA 1BGJA 3G5RA 4U2LA 4M52A 3T2KA 5C3JA 1OJAA 1XDIA 1PJ7A 2ARDA 3ABVA 3GWFA 4JDRA 3UP4A 4CCRA 3ADAB 3OZ2A 3Q9TA 1TDEA 2C70A 3KU9A 1N4WA 1TYPA 4B67A 1IUTA 1PBEA 4H4RA 4IA5A 2A89A 4U8JA 1E1NA 1VRQB 2OA1A 3AXBA 2YLTA 4GAPA 2OALA 4H4TA 2GF3A 5U25A 1COYA 4U8OA 5L46A 2X8GA 3KLJA 3CMMA 2JAEA 4H2QA 1VQWA 2EQ7A 5JCKA 3UTGA 1N1PA 4Z24A 5EB5A 2Q0KA 2EQ9A 4AP3A 4CNKA 1JRYA 2BS4A 2C7GA 2X8HA 3V3NA 4Z43A 2B7SA 1H81A 1PDHA 3NTDA 1KFYA 2XLPA 3H8LA 3KD9A 5IPYA 1ELIA 4K5RA 2XLTA 1PXCA 2OLNA 1VG9A 3FBSA 3NN0X 2YR6A 4G6GA 2AQJA 4TM0A 4H4VA 3QVPA 4EQSA 2GAGB 3RP7A 1FEBA 2CULA 4BK3A 4A6NA 2YVJA 2TPRA 1K4QA 3AE2A 2YLXA 3QSEA 2GH5A 1KNPA 4O5QA 4GF7A 4KPRA 4BV6A 2YR5A 3AD8B 4H50A 4YSHA 1CC2A 1SEZA 1GRFA 2YR4A 2A87A 3DK4A 4II2A 3NK2X 3AE8A 1O94A 4C3YA 3V3OA 1GRHA 2Z5YA 1JNZA 1Q1WA 3CGDA 4EMWA 4TM4A 4OPTA 4UP3A 2WESA 3T14A 2B9WA 3AEFA 4WX1A 3VR9A 2VQ7A 3KA7A 4NWZA 1YQ4A 1X31B 2F5ZA 4UDPA 4B65A 1TYTA
chains in the Genus database with same CATH topology
4DSGA 4ZN0A 1GREA 3I3LA 1GTEA 3K7TA 1L0VA 4RSLA 4EMIA 2V6OA 3UOYA 4O5UA 4U2SA 4G73A 3P4RA 2QA1A 2WHDA 2JKCA 3SY4A 1ZK7A 1W4XA 5JCMA 3GRTA 3BI2A 5J60A 4H4UA 1ZDLA 2YQUA 1KSUA 1XANA 3BI5A 1NAAA 2APGA 2B76A 1NENA 1GPEA 4RG3A 4Z25A 4LU6A 2V3BA 3H4KA 1PXBA 3UOVA 3CNJA 4U8MA 5U63A 3AD9B 3DGHA 5KVIA 1Q1RA 3LOVA 1KSSA 2YG6A 3SZ0A 4CY8A 4I59A 4K7ZA 2BC0A 2E4GA 2YLRA 1NPXA 2GR3A 3P9UA 3GYIA 3Q6JA 5JCIA 3QFAA 1YQ3A 4IV9A 4PABA 3NRNA 1N4UA 3IHMA 4NEWA 1CHUA 5GSNA 3DJDA 4A5LA 1AOGA 2IVDA 4J57A 3M12A 1GRBA 3KVEA 2EQ6A 2FJDA 2VOUA 1XPQA 1O5WA 2PHHA 4JNAA 2XFOA 2RABA 3I6DA 2YG7A 2YVGA 1PBDA 5U1OA 2WEUA 4C3XA 4DGKA 1NHPA 5LV9A 2O9ZA 2UZZA 2X8CA 3GMCA 4Y4MA 4J2WA 3CIRA 1JEHA 2YG5A 1MO9A 3F8RA 2XLRA 3GRSA 4J34A 3VRAA 2C67A 1IUSA 4XWZA 2WU2A 3L1RA 4UDRA 5HYMA 2R0CA 1CC4A 2AAQA 1PBBA 3AECA 5KMQA 2XVHA 5KVHA 1E39A 1OJ9A 1TDOA 5KWFA 2R4EA 2XVFA 2BRAA 4B64A 5KMPA 4KX6A 2GR0A 1FEAA 2R45A 4H7UA 2GB0A 2FJAA 1GRTA 2ZZ0A 1LJ1A 4J56A 1DODA 5KNLA 2TMDA 4N9XA 4FX9A 5M0ZA 3KPKA 4ADWA 2NVKX 1IUXA 4K8DA 1DJQA 2WU5A 2CDUA 4H4XA 2R46A 1YQZA 2YAUA 1GTHA 2WP5A 1DXLA 4YT0A 3GD3A 2RGHA 3NN6X 1JRZA 3ISHA 3KKJA 3BHKA 5EB4A 3QVRA 3T2YA 1ZMDA 3ICTA 2FBWA 3C4AA 4OPLA 2A8XA 2XVEA 3ALLA 3QFBA 1L9CA 1QLBA 1OJCA 3GD4A 3VRBA 3LADA 3T0KA 4U2TA 1NHSA 2Q6UA 3O0HA 3CPJG 3ATRA 3P4QA 3T2ZA 3LB8A 4EM3A 3CNTA 1H83A 3K7QX 3SZCA 3KPFA 4C5OA 1CJCA 4GDPA 1MXTA 2BC1A 2CVJA 1ZY8A 4A65A 5HY5A 1CJ4A 4JNQA 3NK0X 1TRBA 3ATQA 2AR8A 3IWAA 2GMJA 4H4SA 4YSZA 4APNA 3AE3A 4P9SA 2YVFA 4HB9A 1QO8A 4MJWA 2RGJA 4U8LA 2BCPA 1GT8A 4XWRA 3E1TA 2OAMA 2X3NA 2W0HA 2WOWA 5IQ4A 2XYOA 2VVLG 3M0OA 1Y56B 4A9WA 1Z6LA 4A99A 2HQMA 1CJ2A 3H8IA 4OPGA 3VR8A 4USRA 3SYIA 5EOWA 2OLOA 1GESA 4G6HA 4GUVA 4YTNA 1VG0A 3P1WA 3EANA 3NYEA 3DK9A 3CGEA 2J3NA 4C74A 3COXA 3FMWA 4HA6A 5KOXA 1IJHA 2VRLA 1O95A 1CBOA 3T37A 3AEBA 1ZMCA 3LZWA 4A6NB 4X9MA 1GSNA 4A79A 1LQUA 2FJEA 3PVCA 1GETA 4Y4LA 4TM1A 4BURA 1CF3A 1K0JA 1D4CA 1D4DA 3CNSA 2QCUA 3GDNA 4IVOB 4H2NA 3UOZA 2XLUA 4IVMB 4CCQA 2DKIA 2C65A 4OPIA 1BF3A 1PJ6A 3VQRA 4YSYA 3AE6A 2JB2A 4A7AA 1VDCA 1GEUA 2GVCA 3D8XA 3UKHA 2VZ2A 1D4EA 1HYUA 5CQFA 3D1CA 1ZP0A 1E7PA 1CJ3A 1NG4A 1RYIA 4NTCA 4Y4NA 1E1KA 2B9XA 3EF6A 4OPDA 3GWDA 3AE9A 1ZOYA 2BABA 1REOA 1DJNA 2XLSA 4Z2RA 5KOWA 3S5WA 2WDQA 3UKFA 3URHA 4B1BA 4GR1A 2XCGA 1Q9IA 3AEEA 2WDRA 3DMEA 2Y6RA 4PAAA 4K2XA 3UTHA 3JSKA 5CKUA 3AEAA 1F8WA 2H88A 2R9ZA 4DNAA 3REDA 1FECA 1L9DA 3ITJA 4I58A 5FMHA 4BK1A 2WQYA 1PXAA 5IQ1A 4YWOA 3S61A 3AYJA 1E1LA 3UP5A 4EQWA 2ACZA 1OJDA 4BJYA 3CN8A 3CPHG 3NYCA 5EBKA 1E1MA 2JB3A 2Z5XA 3SFDA 4U8IA 3NHOX 3GYJA 1D5TA 4G74A 2GR2A 3AD7B 2WPEA 3AYIA 3BNUA 4YTMA 3CNPA 2WPFA 5FS6A 2WOIA 1GV4A 3B6DA 3FG2P 5C2TA 3SFEA 1H7WA 2ZBWA 2C66A 3GMBA 4B63A 4Z44A 1B4VA 2E1MA 3NTAA 1ZOVA 2BYBA 5JCNA 2DKHA 4II3A 1CL0A 3NG7X 4XXGA 1LPFA 4X9NA 4AOXA 3L8KA 4DSHA 4E0VA 4B69A 3AWIA 1YKJA 2NPXA 3SX6A 3RNMA 4AT0A 2B9YA 2V60A 1GXFA 1NDAA 1IUUA 2FJBA 4LIIA 3ZYXA 4Z26A 4K5SA 1IUVA 2XVJA 1PN0A 4H2PA 3QSSA 4OPCA 4D03A 1D7YA 2XFQA 2YM2A 1BGNA 4EQRA 4FDCB 1YY5A 2GQWA 4G9KA 1H84A 2RGOA 1H82A 2BS2A 2VRMA 1PS9A 3HYXA 1EL8A 1RSGA 4H4PA 2XFPA 4NEVA 1NHRA 3QSMA 1TDFA 5FS7A 2E5VA 3AE4A 1S3EA 3ALMA 1M64A 4CY6A 3G5SA 2C75A 1QJDA 2VQBA 3NIXA 1EL9A 2C3DA 1GERA 3UKAA 1NHQA 3CGBA 3UKPA 4NTDA 1KF6A 2PYXA 2BS3A 3LZXA 4U8PA 4B68A 2C72A 1TDNA 3FIMB 3UCLA 2XFNA 4H4YA 3WE0A 3V76A 5KXJA 2H89A 2WPCA 1JNRA 2BK3A 3M13A 4BJZA 1BZLA 2BXSA 2X50A 2Q0LA 3CNDA 3AE7A 2YG4A 1M6IA 3FPZA 1F8SA 4EIPA 3ICRA 3UTFA 3BNMA 3DGZA 4X4JA 5KRQA 3DJJA 5KMSA 3K7MX 3NK1X 4JY3A 3HYWA 4ECHA 2C73A 4LA1A 1L9EA 1PBFA 2V5ZA 2C3CA 3ALJA 5KMRA 1IUWA 1P2HA 1JRXA 5BRTA 2BXRA 2B7RA 3SQPA 3GYXA 1F6MA 4WCTA 4GCMA 4REKA 1V59A 5BULA 3F8PA 3NGCX 4USQA 4H2RA 2I0ZA 4TLXA 1ZKQA 3EAOA 3AE1A 2BCGG 1NEKA 1PJ5A 1MOKA 4UDQA 4TM3A 5TR3A 3C96A 3RP8A 1GALA 1F3PA 1BWCA 3NKSA 1S2QA 2ZZCA 4YKFA 1PHHA 3P4PA 1ONFA 3BI4A 5HXIA 2YM1A 5BVAA 3AYLA 4AOSA 2QAEA 3GDPA 3P4SA 2GAHB 2VVLA 4J36A 4NNJA 4AT2A 3ICSA 2XFUA 2Y6QA 4NTEA 3AEGA 1TDKA 3DK8A 1LV0A 3G5QA 3F8DA 4OCGA 3IHGA 3LJPA 5J7XA 1EL7A 2XDOA 4OVIA 2Q7VA 4YKGA 2BA9A 5BUKA 2GMHA 2IVEA 1PBCA 2GV8A 1S2YA 2WBAA 3C4NA 3EPTA 3T31A 4EMJA 2GRTA 1GRAA 3RHAA 1H6VA 2WOVA 3RP6A 1BKWA 2YLWA 3IF9A 3R9UA 1E6EA 4IA6A 1XHCA 4JQ9A 2ZZBA 4K22A 4GDEA 3BHFA 1P2EA 3NNEA 1GRGA 2BRYA 2R4JA 1N4VA 2WP6A 3LXDA 1GOSA 4GRTA 4U8NA 4ZCDA 5DBJA 4YXDA 2YG3A 4EQXA 4YSXA 4JY2A 2WDVA 4CRTA 2YLZA 1Y0PA 3II4A 1Y56A 2JB1A 3OC4A 1CC6A 2C64A 2GR1A 3DA1A 3UOXA 3NLCA 3SGLA 4H4ZA 4BK2A 4RG4A 3DJEA 5GRTA 2R0PA 1EBDA 3AB1A 4C77A 3PS9A 2GEWA 1D7LA 1FL2A 2CFYA 4H4WA 5FS9A 2JBVA 3CGCA 5HHFA 2EQ8A 3CPIG 1KNRA 2QA2A 1EL5A 1B37A 1K0LA 4J33A 4OPUA 3UKLA 4D04A 3NYFA 3ZDNA 1OJTA 4CBQA 1NG3A 2GQFA 5JCLA 3DJGX 1K0IA 1LTXR 3HZLA 3VRDB 1LVLA 3NT6A 4U8KA 1FOHA 3HYVA 1H7XA 4TLZA 2C4CA 3K30A 4B66A 4JN9A 2JK6A 4H4QA 3SXIA 3GSIA 4AP1A 2WS3A 4YTPA 1H86A 1DOEA 3AEDA 1KDGA 5FS8A 2YLSA 3UKKA 3NH3X 2V61A 1LQTA 2YWLA 2V3AA 2BK5A 5ER0A 4EIQA 1FCDA 4FK1C 5M10A 3UKQA 4Z2TA 1DNCA 1JU2A 2BACA 4CNJA 3SM8A 3SZWA 3DH9A 2BK4A 4ICYA 4J31A 4EM4A 2WETA 3CTYA 3QJ4A 2VVMA 1B8SA 2C76A 1B5QA 4NZHA 4GAVA 3PO7A 1GNDA 2IIDA 1JOAA 3SZFA 2X99A 1DOBA 1UKVG 1DOCA 4Z2UA 4ZCCA 1ZX9A 1RP0A 4FK1A 3AE5A 2XVIA 2R0GA 1F8RA 3B3RA 1S3BA 2WP9A 3IC9A 3UTEA 1BGJA 3G5RA 4U2LA 4M52A 3T2KA 5C3JA 1OJAA 1XDIA 1PJ7A 2ARDA 3ABVA 3GWFA 4JDRA 3UP4A 4CCRA 3ADAB 3OZ2A 3Q9TA 1TDEA 2C70A 3KU9A 1N4WA 1TYPA 4B67A 1IUTA 1PBEA 4H4RA 4IA5A 2A89A 4U8JA 1E1NA 1VRQB 2OA1A 3AXBA 2YLTA 4GAPA 2OALA 4H4TA 2GF3A 5U25A 1COYA 4U8OA 5L46A 2X8GA 3KLJA 3CMMA 2JAEA 4H2QA 1VQWA 2EQ7A 5JCKA 3UTGA 1N1PA 4Z24A 5EB5A 2Q0KA 2EQ9A 4AP3A 4CNKA 1JRYA 2BS4A 2C7GA 2X8HA 3V3NA 4Z43A 2B7SA 1H81A 1PDHA 3NTDA 1KFYA 2XLPA 3H8LA 3KD9A 5IPYA 1ELIA 4K5RA 2XLTA 1PXCA 2OLNA 1VG9A 3FBSA 3NN0X 2YR6A 4G6GA 2AQJA 4TM0A 4H4VA 3QVPA 4EQSA 2GAGB 3RP7A 1FEBA 2CULA 4BK3A 4A6NA 2YVJA 2TPRA 1K4QA 3AE2A 2YLXA 3QSEA 2GH5A 1KNPA 4O5QA 4GF7A 4KPRA 4BV6A 2YR5A 3AD8B 4H50A 4YSHA 1CC2A 1SEZA 1GRFA 2YR4A 2A87A 3DK4A 4II2A 3NK2X 3AE8A 1O94A 4C3YA 3V3OA 1GRHA 2Z5YA 1JNZA 1Q1WA 3CGDA 4EMWA 4TM4A 4OPTA 4UP3A 2WESA 3T14A 2B9WA 3AEFA 4WX1A 3VR9A 2VQ7A 3KA7A 4NWZA 1YQ4A 1X31B 2F5ZA 4UDPA 4B65A 1TYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9K A;  3HYX A;  5KMP A;  3T0K A;  4G73 A;  3T2Z A;  3SY4 A;  5KMS A;  4GAV A;  4GAP A;  3SYI A;  3KPK A;  4G6H A;  4G6G A;  3SZC A;  3HYW A;  3HYV A;  3SZF A;  3SX6 A;  3SXI A;  4G74 A;  5KMR A;  3T14 A;  3SZ0 A;  3T2Y A;  4NWZ A;  3T31 A;  3T2K A;  5KMQ A;  3SZW A; 
#chains in the Genus database with same CATH topology
 4DSG A;  4ZN0 A;  1GRE A;  3I3L A;  1GTE A;  3K7T A;  1L0V A;  4RSL A;  4EMI A;  2V6O A;  3UOY A;  4O5U A;  4U2S A;  4G73 A;  3P4R A;  2QA1 A;  2WHD A;  2JKC A;  3SY4 A;  1ZK7 A;  1W4X A;  5JCM A;  3GRT A;  3BI2 A;  5J60 A;  4H4U A;  1ZDL A;  2YQU A;  1KSU A;  1XAN A;  3BI5 A;  1NAA A;  2APG A;  2B76 A;  1NEN A;  1GPE A;  4RG3 A;  4Z25 A;  4LU6 A;  2V3B A;  3H4K A;  1PXB A;  3UOV A;  3CNJ A;  4U8M A;  5U63 A;  3AD9 B;  3DGH A;  5KVI A;  1Q1R A;  3LOV A;  1KSS A;  2YG6 A;  3SZ0 A;  4CY8 A;  4I59 A;  4K7Z A;  2BC0 A;  2E4G A;  2YLR A;  1NPX A;  2GR3 A;  3P9U A;  3GYI A;  3Q6J A;  5JCI A;  3QFA A;  1YQ3 A;  4IV9 A;  4PAB A;  3NRN A;  1N4U A;  3IHM A;  4NEW A;  1CHU A;  5GSN A;  3DJD A;  4A5L A;  1AOG A;  2IVD A;  4J57 A;  3M12 A;  1GRB A;  3KVE A;  2EQ6 A;  2FJD A;  2VOU A;  1XPQ A;  1O5W A;  2PHH A;  4JNA A;  2XFO A;  2RAB A;  3I6D A;  2YG7 A;  2YVG A;  1PBD A;  5U1O A;  2WEU A;  4C3X A;  4DGK A;  1NHP A;  5LV9 A;  2O9Z A;  2UZZ A;  2X8C A;  3GMC A;  4Y4M A;  4J2W A;  3CIR A;  1JEH A;  2YG5 A;  1MO9 A;  3F8R A;  2XLR A;  3GRS A;  4J34 A;  3VRA A;  2C67 A;  1IUS A;  4XWZ A;  2WU2 A;  3L1R A;  4UDR A;  5HYM A;  2R0C A;  1CC4 A;  2AAQ A;  1PBB A;  3AEC A;  5KMQ A;  2XVH A;  5KVH A;  1E39 A;  1OJ9 A;  1TDO A;  5KWF A;  2R4E A;  2XVF A;  2BRA A;  4B64 A;  5KMP A;  4KX6 A;  2GR0 A;  1FEA A;  2R45 A;  4H7U A;  2GB0 A;  2FJA A;  1GRT A;  2ZZ0 A;  1LJ1 A;  4J56 A;  1DOD A;  5KNL A;  2TMD A;  4N9X A;  4FX9 A;  5M0Z A;  3KPK A;  4ADW A;  2NVK X;  1IUX A;  4K8D A;  1DJQ A;  2WU5 A;  2CDU A;  4H4X A;  2R46 A;  1YQZ A;  2YAU A;  1GTH A;  2WP5 A;  1DXL A;  4YT0 A;  3GD3 A;  2RGH A;  3NN6 X;  1JRZ A;  3ISH A;  3KKJ A;  3BHK A;  5EB4 A;  3QVR A;  3T2Y A;  1ZMD A;  3ICT A;  2FBW A;  3C4A A;  4OPL A;  2A8X A;  2XVE A;  3ALL A;  3QFB A;  1L9C A;  1QLB A;  1OJC A;  3GD4 A;  3VRB A;  3LAD A;  3T0K A;  4U2T A;  1NHS A;  2Q6U A;  3O0H A;  3CPJ G;  3ATR A;  3P4Q A;  3T2Z A;  3LB8 A;  4EM3 A;  3CNT A;  1H83 A;  3K7Q X;  3SZC A;  3KPF A;  4C5O A;  1CJC A;  4GDP A;  1MXT A;  2BC1 A;  2CVJ A;  1ZY8 A;  4A65 A;  5HY5 A;  1CJ4 A;  4JNQ A;  3NK0 X;  1TRB A;  3ATQ A;  2AR8 A;  3IWA A;  2GMJ A;  4H4S A;  4YSZ A;  4APN A;  3AE3 A;  4P9S A;  2YVF A;  4HB9 A;  1QO8 A;  4MJW A;  2RGJ A;  4U8L A;  2BCP A;  1GT8 A;  4XWR A;  3E1T A;  2OAM A;  2X3N A;  2W0H A;  2WOW A;  5IQ4 A;  2XYO A;  2VVL G;  3M0O A;  1Y56 B;  4A9W A;  1Z6L A;  4A99 A;  2HQM A;  1CJ2 A;  3H8I A;  4OPG A;  3VR8 A;  4USR A;  3SYI A;  5EOW A;  2OLO A;  1GES A;  4G6H A;  4GUV A;  4YTN A;  1VG0 A;  3P1W A;  3EAN A;  3NYE A;  3DK9 A;  3CGE A;  2J3N A;  4C74 A;  3COX A;  3FMW A;  4HA6 A;  5KOX A;  1IJH A;  2VRL A;  1O95 A;  1CBO A;  3T37 A;  3AEB A;  1ZMC A;  3LZW A;  4A6N B;  4X9M A;  1GSN A;  4A79 A;  1LQU A;  2FJE A;  3PVC A;  1GET A;  4Y4L A;  4TM1 A;  4BUR A;  1CF3 A;  1K0J A;  1D4C A;  1D4D A;  3CNS A;  2QCU A;  3GDN A;  4IVO B;  4H2N A;  3UOZ A;  2XLU A;  4IVM B;  4CCQ A;  2DKI A;  2C65 A;  4OPI A;  1BF3 A;  1PJ6 A;  3VQR A;  4YSY A;  3AE6 A;  2JB2 A;  4A7A A;  1VDC A;  1GEU A;  2GVC A;  3D8X A;  3UKH A;  2VZ2 A;  1D4E A;  1HYU A;  5CQF A;  3D1C A;  1ZP0 A;  1E7P A;  1CJ3 A;  1NG4 A;  1RYI A;  4NTC A;  4Y4N A;  1E1K A;  2B9X A;  3EF6 A;  4OPD A;  3GWD A;  3AE9 A;  1ZOY A;  2BAB A;  1REO A;  1DJN A;  2XLS A;  4Z2R A;  5KOW A;  3S5W A;  2WDQ A;  3UKF A;  3URH A;  4B1B A;  4GR1 A;  2XCG A;  1Q9I A;  3AEE A;  2WDR A;  3DME A;  2Y6R A;  4PAA A;  4K2X A;  3UTH A;  3JSK A;  5CKU A;  3AEA A;  1F8W A;  2H88 A;  2R9Z A;  4DNA A;  3RED A;  1FEC A;  1L9D A;  3ITJ A;  4I58 A;  5FMH A;  4BK1 A;  2WQY A;  1PXA A;  5IQ1 A;  4YWO A;  3S61 A;  3AYJ A;  1E1L A;  3UP5 A;  4EQW A;  2ACZ A;  1OJD A;  4BJY A;  3CN8 A;  3CPH G;  3NYC A;  5EBK A;  1E1M A;  2JB3 A;  2Z5X A;  3SFD A;  4U8I A;  3NHO X;  3GYJ A;  1D5T A;  4G74 A;  2GR2 A;  3AD7 B;  2WPE A;  3AYI A;  3BNU A;  4YTM A;  3CNP A;  2WPF A;  5FS6 A;  2WOI A;  1GV4 A;  3B6D A;  3FG2 P;  5C2T A;  3SFE A;  1H7W A;  2ZBW A;  2C66 A;  3GMB A;  4B63 A;  4Z44 A;  1B4V A;  2E1M A;  3NTA A;  1ZOV A;  2BYB A;  5JCN A;  2DKH A;  4II3 A;  1CL0 A;  3NG7 X;  4XXG A;  1LPF A;  4X9N A;  4AOX A;  3L8K A;  4DSH A;  4E0V A;  4B69 A;  3AWI A;  1YKJ A;  2NPX A;  3SX6 A;  3RNM A;  4AT0 A;  2B9Y A;  2V60 A;  1GXF A;  1NDA A;  1IUU A;  2FJB A;  4LII A;  3ZYX A;  4Z26 A;  4K5S A;  1IUV A;  2XVJ A;  1PN0 A;  4H2P A;  3QSS A;  4OPC A;  4D03 A;  1D7Y A;  2XFQ A;  2YM2 A;  1BGN A;  4EQR A;  4FDC B;  1YY5 A;  2GQW A;  4G9K A;  1H84 A;  2RGO A;  1H82 A;  2BS2 A;  2VRM A;  1PS9 A;  3HYX A;  1EL8 A;  1RSG A;  4H4P A;  2XFP A;  4NEV A;  1NHR A;  3QSM A;  1TDF A;  5FS7 A;  2E5V A;  3AE4 A;  1S3E A;  3ALM A;  1M64 A;  4CY6 A;  3G5S A;  2C75 A;  1QJD A;  2VQB A;  3NIX A;  1EL9 A;  2C3D A;  1GER A;  3UKA A;  1NHQ A;  3CGB A;  3UKP A;  4NTD A;  1KF6 A;  2PYX A;  2BS3 A;  3LZX A;  4U8P A;  4B68 A;  2C72 A;  1TDN A;  3FIM B;  3UCL A;  2XFN A;  4H4Y A;  3WE0 A;  3V76 A;  5KXJ A;  2H89 A;  2WPC A;  1JNR A;  2BK3 A;  3M13 A;  4BJZ A;  1BZL A;  2BXS A;  2X50 A;  2Q0L A;  3CND A;  3AE7 A;  2YG4 A;  1M6I A;  3FPZ A;  1F8S A;  4EIP A;  3ICR A;  3UTF A;  3BNM A;  3DGZ A;  4X4J A;  5KRQ A;  3DJJ A;  5KMS A;  3K7M X;  3NK1 X;  4JY3 A;  3HYW A;  4ECH A;  2C73 A;  4LA1 A;  1L9E A;  1PBF A;  2V5Z A;  2C3C A;  3ALJ A;  5KMR A;  1IUW A;  1P2H A;  1JRX A;  5BRT A;  2BXR A;  2B7R A;  3SQP A;  3GYX A;  1F6M A;  4WCT A;  4GCM A;  4REK A;  1V59 A;  5BUL A;  3F8P A;  3NGC X;  4USQ A;  4H2R A;  2I0Z A;  4TLX A;  1ZKQ A;  3EAO A;  3AE1 A;  2BCG G;  1NEK A;  1PJ5 A;  1MOK A;  4UDQ A;  4TM3 A;  5TR3 A;  3C96 A;  3RP8 A;  1GAL A;  1F3P A;  1BWC A;  3NKS A;  1S2Q A;  2ZZC A;  4YKF A;  1PHH A;  3P4P A;  1ONF A;  3BI4 A;  5HXI A;  2YM1 A;  5BVA A;  3AYL A;  4AOS A;  2QAE A;  3GDP A;  3P4S A;  2GAH B;  2VVL A;  4J36 A;  4NNJ A;  4AT2 A;  3ICS A;  2XFU A;  2Y6Q A;  4NTE A;  3AEG A;  1TDK A;  3DK8 A;  1LV0 A;  3G5Q A;  3F8D A;  4OCG A;  3IHG A;  3LJP A;  5J7X A;  1EL7 A;  2XDO A;  4OVI A;  2Q7V A;  4YKG A;  2BA9 A;  5BUK A;  2GMH A;  2IVE A;  1PBC A;  2GV8 A;  1S2Y A;  2WBA A;  3C4N A;  3EPT A;  3T31 A;  4EMJ A;  2GRT A;  1GRA A;  3RHA A;  1H6V A;  2WOV A;  3RP6 A;  1BKW A;  2YLW A;  3IF9 A;  3R9U A;  1E6E A;  4IA6 A;  1XHC A;  4JQ9 A;  2ZZB A;  4K22 A;  4GDE A;  3BHF A;  1P2E A;  3NNE A;  1GRG A;  2BRY A;  2R4J A;  1N4V A;  2WP6 A;  3LXD A;  1GOS A;  4GRT A;  4U8N A;  4ZCD A;  5DBJ A;  4YXD A;  2YG3 A;  4EQX A;  4YSX A;  4JY2 A;  2WDV A;  4CRT A;  2YLZ A;  1Y0P A;  3II4 A;  1Y56 A;  2JB1 A;  3OC4 A;  1CC6 A;  2C64 A;  2GR1 A;  3DA1 A;  3UOX A;  3NLC A;  3SGL A;  4H4Z A;  4BK2 A;  4RG4 A;  3DJE A;  5GRT A;  2R0P A;  1EBD A;  3AB1 A;  4C77 A;  3PS9 A;  2GEW A;  1D7L A;  1FL2 A;  2CFY A;  4H4W A;  5FS9 A;  2JBV A;  3CGC A;  5HHF A;  2EQ8 A;  3CPI G;  1KNR A;  2QA2 A;  1EL5 A;  1B37 A;  1K0L A;  4J33 A;  4OPU A;  3UKL A;  4D04 A;  3NYF A;  3ZDN A;  1OJT A;  4CBQ A;  1NG3 A;  2GQF A;  5JCL A;  3DJG X;  1K0I A;  1LTX R;  3HZL A;  3VRD B;  1LVL A;  3NT6 A;  4U8K A;  1FOH A;  3HYV A;  1H7X A;  4TLZ A;  2C4C A;  3K30 A;  4B66 A;  4JN9 A;  2JK6 A;  4H4Q A;  3SXI A;  3GSI A;  4AP1 A;  2WS3 A;  4YTP A;  1H86 A;  1DOE A;  3AED A;  1KDG A;  5FS8 A;  2YLS A;  3UKK A;  3NH3 X;  2V61 A;  1LQT A;  2YWL A;  2V3A A;  2BK5 A;  5ER0 A;  4EIQ A;  1FCD A;  4FK1 C;  5M10 A;  3UKQ A;  4Z2T A;  1DNC A;  1JU2 A;  2BAC A;  4CNJ A;  3SM8 A;  3SZW A;  3DH9 A;  2BK4 A;  4ICY A;  4J31 A;  4EM4 A;  2WET A;  3CTY A;  3QJ4 A;  2VVM A;  1B8S A;  2C76 A;  1B5Q A;  4NZH A;  4GAV A;  3PO7 A;  1GND A;  2IID A;  1JOA A;  3SZF A;  2X99 A;  1DOB A;  1UKV G;  1DOC A;  4Z2U A;  4ZCC A;  1ZX9 A;  1RP0 A;  4FK1 A;  3AE5 A;  2XVI A;  2R0G A;  1F8R A;  3B3R A;  1S3B A;  2WP9 A;  3IC9 A;  3UTE A;  1BGJ A;  3G5R A;  4U2L A;  4M52 A;  3T2K A;  5C3J A;  1OJA A;  1XDI A;  1PJ7 A;  2ARD A;  3ABV A;  3GWF A;  4JDR A;  3UP4 A;  4CCR A;  3ADA B;  3OZ2 A;  3Q9T A;  1TDE A;  2C70 A;  3KU9 A;  1N4W A;  1TYP A;  4B67 A;  1IUT A;  1PBE A;  4H4R A;  4IA5 A;  2A89 A;  4U8J A;  1E1N A;  1VRQ B;  2OA1 A;  3AXB A;  2YLT A;  4GAP A;  2OAL A;  4H4T A;  2GF3 A;  5U25 A;  1COY A;  4U8O A;  5L46 A;  2X8G A;  3KLJ A;  3CMM A;  2JAE A;  4H2Q A;  1VQW A;  2EQ7 A;  5JCK A;  3UTG A;  1N1P A;  4Z24 A;  5EB5 A;  2Q0K A;  2EQ9 A;  4AP3 A;  4CNK A;  1JRY A;  2BS4 A;  2C7G A;  2X8H A;  3V3N A;  4Z43 A;  2B7S A;  1H81 A;  1PDH A;  3NTD A;  1KFY A;  2XLP A;  3H8L A;  3KD9 A;  5IPY A;  1ELI A;  4K5R A;  2XLT A;  1PXC A;  2OLN A;  1VG9 A;  3FBS A;  3NN0 X;  2YR6 A;  4G6G A;  2AQJ A;  4TM0 A;  4H4V A;  3QVP A;  4EQS A;  2GAG B;  3RP7 A;  1FEB A;  2CUL A;  4BK3 A;  4A6N A;  2YVJ A;  2TPR A;  1K4Q A;  3AE2 A;  2YLX A;  3QSE A;  2GH5 A;  1KNP A;  4O5Q A;  4GF7 A;  4KPR A;  4BV6 A;  2YR5 A;  3AD8 B;  4H50 A;  4YSH A;  1CC2 A;  1SEZ A;  1GRF A;  2YR4 A;  2A87 A;  3DK4 A;  4II2 A;  3NK2 X;  3AE8 A;  1O94 A;  4C3Y A;  3V3O A;  1GRH A;  2Z5Y A;  1JNZ A;  1Q1W A;  3CGD A;  4EMW A;  4TM4 A;  4OPT A;  4UP3 A;  2WES A;  3T14 A;  2B9W A;  3AEF A;  4WX1 A;  3VR9 A;  2VQ7 A;  3KA7 A;  4NWZ A;  1YQ4 A;  1X31 B;  2F5Z A;  4UDP A;  4B65 A;  1TYT A; 
#chains in the Genus database with same CATH homology
 4DSG A;  4ZN0 A;  1GRE A;  3I3L A;  1GTE A;  3K7T A;  1L0V A;  4RSL A;  4EMI A;  2V6O A;  3UOY A;  4O5U A;  4U2S A;  4G73 A;  3P4R A;  2QA1 A;  2WHD A;  2JKC A;  3SY4 A;  1ZK7 A;  1W4X A;  5JCM A;  3GRT A;  3BI2 A;  5J60 A;  4H4U A;  1ZDL A;  2YQU A;  1KSU A;  1XAN A;  3BI5 A;  1NAA A;  2APG A;  2B76 A;  1NEN A;  1GPE A;  4RG3 A;  4Z25 A;  4LU6 A;  2V3B A;  3H4K A;  1PXB A;  3UOV A;  3CNJ A;  4U8M A;  5U63 A;  3AD9 B;  3DGH A;  5KVI A;  1Q1R A;  3LOV A;  1KSS A;  2YG6 A;  3SZ0 A;  4CY8 A;  4I59 A;  4K7Z A;  2BC0 A;  2E4G A;  2YLR A;  1NPX A;  2GR3 A;  3P9U A;  3GYI A;  3Q6J A;  5JCI A;  3QFA A;  1YQ3 A;  4IV9 A;  4PAB A;  3NRN A;  1N4U A;  3IHM A;  4NEW A;  1CHU A;  5GSN A;  3DJD A;  4A5L A;  1AOG A;  2IVD A;  4J57 A;  3M12 A;  1GRB A;  3KVE A;  2EQ6 A;  2FJD A;  2VOU A;  1XPQ A;  1O5W A;  2PHH A;  4JNA A;  2XFO A;  2RAB A;  3I6D A;  2YG7 A;  2YVG A;  1PBD A;  5U1O A;  2WEU A;  4C3X A;  4DGK A;  1NHP A;  5LV9 A;  2O9Z A;  2UZZ A;  2X8C A;  3GMC A;  4Y4M A;  4J2W A;  3CIR A;  1JEH A;  2YG5 A;  1MO9 A;  3F8R A;  2XLR A;  3GRS A;  4J34 A;  3VRA A;  2C67 A;  1IUS A;  4XWZ A;  2WU2 A;  3L1R A;  4UDR A;  5HYM A;  2R0C A;  1CC4 A;  2AAQ A;  1PBB A;  3AEC A;  5KMQ A;  2XVH A;  5KVH A;  1E39 A;  1OJ9 A;  1TDO A;  5KWF A;  2R4E A;  2XVF A;  2BRA A;  4B64 A;  5KMP A;  4KX6 A;  2GR0 A;  1FEA A;  2R45 A;  4H7U A;  2GB0 A;  2FJA A;  1GRT A;  2ZZ0 A;  1LJ1 A;  4J56 A;  1DOD A;  5KNL A;  2TMD A;  4N9X A;  4FX9 A;  5M0Z A;  3KPK A;  4ADW A;  2NVK X;  1IUX A;  4K8D A;  1DJQ A;  2WU5 A;  2CDU A;  4H4X A;  2R46 A;  1YQZ A;  2YAU A;  1GTH A;  2WP5 A;  1DXL A;  4YT0 A;  3GD3 A;  2RGH A;  3NN6 X;  1JRZ A;  3ISH A;  3KKJ A;  3BHK A;  5EB4 A;  3QVR A;  3T2Y A;  1ZMD A;  3ICT A;  2FBW A;  3C4A A;  4OPL A;  2A8X A;  2XVE A;  3ALL A;  3QFB A;  1L9C A;  1QLB A;  1OJC A;  3GD4 A;  3VRB A;  3LAD A;  3T0K A;  4U2T A;  1NHS A;  2Q6U A;  3O0H A;  3CPJ G;  3ATR A;  3P4Q A;  3T2Z A;  3LB8 A;  4EM3 A;  3CNT A;  1H83 A;  3K7Q X;  3SZC A;  3KPF A;  4C5O A;  1CJC A;  4GDP A;  1MXT A;  2BC1 A;  2CVJ A;  1ZY8 A;  4A65 A;  5HY5 A;  1CJ4 A;  4JNQ A;  3NK0 X;  1TRB A;  3ATQ A;  2AR8 A;  3IWA A;  2GMJ A;  4H4S A;  4YSZ A;  4APN A;  3AE3 A;  4P9S A;  2YVF A;  4HB9 A;  1QO8 A;  4MJW A;  2RGJ A;  4U8L A;  2BCP A;  1GT8 A;  4XWR A;  3E1T A;  2OAM A;  2X3N A;  2W0H A;  2WOW A;  5IQ4 A;  2XYO A;  2VVL G;  3M0O A;  1Y56 B;  4A9W A;  1Z6L A;  4A99 A;  2HQM A;  1CJ2 A;  3H8I A;  4OPG A;  3VR8 A;  4USR A;  3SYI A;  5EOW A;  2OLO A;  1GES A;  4G6H A;  4GUV A;  4YTN A;  1VG0 A;  3P1W A;  3EAN A;  3NYE A;  3DK9 A;  3CGE A;  2J3N A;  4C74 A;  3COX A;  3FMW A;  4HA6 A;  5KOX A;  1IJH A;  2VRL A;  1O95 A;  1CBO A;  3T37 A;  3AEB A;  1ZMC A;  3LZW A;  4A6N B;  4X9M A;  1GSN A;  4A79 A;  1LQU A;  2FJE A;  3PVC A;  1GET A;  4Y4L A;  4TM1 A;  4BUR A;  1CF3 A;  1K0J A;  1D4C A;  1D4D A;  3CNS A;  2QCU A;  3GDN A;  4IVO B;  4H2N A;  3UOZ A;  2XLU A;  4IVM B;  4CCQ A;  2DKI A;  2C65 A;  4OPI A;  1BF3 A;  1PJ6 A;  3VQR A;  4YSY A;  3AE6 A;  2JB2 A;  4A7A A;  1VDC A;  1GEU A;  2GVC A;  3D8X A;  3UKH A;  2VZ2 A;  1D4E A;  1HYU A;  5CQF A;  3D1C A;  1ZP0 A;  1E7P A;  1CJ3 A;  1NG4 A;  1RYI A;  4NTC A;  4Y4N A;  1E1K A;  2B9X A;  3EF6 A;  4OPD A;  3GWD A;  3AE9 A;  1ZOY A;  2BAB A;  1REO A;  1DJN A;  2XLS A;  4Z2R A;  5KOW A;  3S5W A;  2WDQ A;  3UKF A;  3URH A;  4B1B A;  4GR1 A;  2XCG A;  1Q9I A;  3AEE A;  2WDR A;  3DME A;  2Y6R A;  4PAA A;  4K2X A;  3UTH A;  3JSK A;  5CKU A;  3AEA A;  1F8W A;  2H88 A;  2R9Z A;  4DNA A;  3RED A;  1FEC A;  1L9D A;  3ITJ A;  4I58 A;  5FMH A;  4BK1 A;  2WQY A;  1PXA A;  5IQ1 A;  4YWO A;  3S61 A;  3AYJ A;  1E1L A;  3UP5 A;  4EQW A;  2ACZ A;  1OJD A;  4BJY A;  3CN8 A;  3CPH G;  3NYC A;  5EBK A;  1E1M A;  2JB3 A;  2Z5X A;  3SFD A;  4U8I A;  3NHO X;  3GYJ A;  1D5T A;  4G74 A;  2GR2 A;  3AD7 B;  2WPE A;  3AYI A;  3BNU A;  4YTM A;  3CNP A;  2WPF A;  5FS6 A;  2WOI A;  1GV4 A;  3B6D A;  3FG2 P;  5C2T A;  3SFE A;  1H7W A;  2ZBW A;  2C66 A;  3GMB A;  4B63 A;  4Z44 A;  1B4V A;  2E1M A;  3NTA A;  1ZOV A;  2BYB A;  5JCN A;  2DKH A;  4II3 A;  1CL0 A;  3NG7 X;  4XXG A;  1LPF A;  4X9N A;  4AOX A;  3L8K A;  4DSH A;  4E0V A;  4B69 A;  3AWI A;  1YKJ A;  2NPX A;  3SX6 A;  3RNM A;  4AT0 A;  2B9Y A;  2V60 A;  1GXF A;  1NDA A;  1IUU A;  2FJB A;  4LII A;  3ZYX A;  4Z26 A;  4K5S A;  1IUV A;  2XVJ A;  1PN0 A;  4H2P A;  3QSS A;  4OPC A;  4D03 A;  1D7Y A;  2XFQ A;  2YM2 A;  1BGN A;  4EQR A;  4FDC B;  1YY5 A;  2GQW A;  4G9K A;  1H84 A;  2RGO A;  1H82 A;  2BS2 A;  2VRM A;  1PS9 A;  3HYX A;  1EL8 A;  1RSG A;  4H4P A;  2XFP A;  4NEV A;  1NHR A;  3QSM A;  1TDF A;  5FS7 A;  2E5V A;  3AE4 A;  1S3E A;  3ALM A;  1M64 A;  4CY6 A;  3G5S A;  2C75 A;  1QJD A;  2VQB A;  3NIX A;  1EL9 A;  2C3D A;  1GER A;  3UKA A;  1NHQ A;  3CGB A;  3UKP A;  4NTD A;  1KF6 A;  2PYX A;  2BS3 A;  3LZX A;  4U8P A;  4B68 A;  2C72 A;  1TDN A;  3FIM B;  3UCL A;  2XFN A;  4H4Y A;  3WE0 A;  3V76 A;  5KXJ A;  2H89 A;  2WPC A;  1JNR A;  2BK3 A;  3M13 A;  4BJZ A;  1BZL A;  2BXS A;  2X50 A;  2Q0L A;  3CND A;  3AE7 A;  2YG4 A;  1M6I A;  3FPZ A;  1F8S A;  4EIP A;  3ICR A;  3UTF A;  3BNM A;  3DGZ A;  4X4J A;  5KRQ A;  3DJJ A;  5KMS A;  3K7M X;  3NK1 X;  4JY3 A;  3HYW A;  4ECH A;  2C73 A;  4LA1 A;  1L9E A;  1PBF A;  2V5Z A;  2C3C A;  3ALJ A;  5KMR A;  1IUW A;  1P2H A;  1JRX A;  5BRT A;  2BXR A;  2B7R A;  3SQP A;  3GYX A;  1F6M A;  4WCT A;  4GCM A;  4REK A;  1V59 A;  5BUL A;  3F8P A;  3NGC X;  4USQ A;  4H2R A;  2I0Z A;  4TLX A;  1ZKQ A;  3EAO A;  3AE1 A;  2BCG G;  1NEK A;  1PJ5 A;  1MOK A;  4UDQ A;  4TM3 A;  5TR3 A;  3C96 A;  3RP8 A;  1GAL A;  1F3P A;  1BWC A;  3NKS A;  1S2Q A;  2ZZC A;  4YKF A;  1PHH A;  3P4P A;  1ONF A;  3BI4 A;  5HXI A;  2YM1 A;  5BVA A;  3AYL A;  4AOS A;  2QAE A;  3GDP A;  3P4S A;  2GAH B;  2VVL A;  4J36 A;  4NNJ A;  4AT2 A;  3ICS A;  2XFU A;  2Y6Q A;  4NTE A;  3AEG A;  1TDK A;  3DK8 A;  1LV0 A;  3G5Q A;  3F8D A;  4OCG A;  3IHG A;  3LJP A;  5J7X A;  1EL7 A;  2XDO A;  4OVI A;  2Q7V A;  4YKG A;  2BA9 A;  5BUK A;  2GMH A;  2IVE A;  1PBC A;  2GV8 A;  1S2Y A;  2WBA A;  3C4N A;  3EPT A;  3T31 A;  4EMJ A;  2GRT A;  1GRA A;  3RHA A;  1H6V A;  2WOV A;  3RP6 A;  1BKW A;  2YLW A;  3IF9 A;  3R9U A;  1E6E A;  4IA6 A;  1XHC A;  4JQ9 A;  2ZZB A;  4K22 A;  4GDE A;  3BHF A;  1P2E A;  3NNE A;  1GRG A;  2BRY A;  2R4J A;  1N4V A;  2WP6 A;  3LXD A;  1GOS A;  4GRT A;  4U8N A;  4ZCD A;  5DBJ A;  4YXD A;  2YG3 A;  4EQX A;  4YSX A;  4JY2 A;  2WDV A;  4CRT A;  2YLZ A;  1Y0P A;  3II4 A;  1Y56 A;  2JB1 A;  3OC4 A;  1CC6 A;  2C64 A;  2GR1 A;  3DA1 A;  3UOX A;  3NLC A;  3SGL A;  4H4Z A;  4BK2 A;  4RG4 A;  3DJE A;  5GRT A;  2R0P A;  1EBD A;  3AB1 A;  4C77 A;  3PS9 A;  2GEW A;  1D7L A;  1FL2 A;  2CFY A;  4H4W A;  5FS9 A;  2JBV A;  3CGC A;  5HHF A;  2EQ8 A;  3CPI G;  1KNR A;  2QA2 A;  1EL5 A;  1B37 A;  1K0L A;  4J33 A;  4OPU A;  3UKL A;  4D04 A;  3NYF A;  3ZDN A;  1OJT A;  4CBQ A;  1NG3 A;  2GQF A;  5JCL A;  3DJG X;  1K0I A;  1LTX R;  3HZL A;  3VRD B;  1LVL A;  3NT6 A;  4U8K A;  1FOH A;  3HYV A;  1H7X A;  4TLZ A;  2C4C A;  3K30 A;  4B66 A;  4JN9 A;  2JK6 A;  4H4Q A;  3SXI A;  3GSI A;  4AP1 A;  2WS3 A;  4YTP A;  1H86 A;  1DOE A;  3AED A;  1KDG A;  5FS8 A;  2YLS A;  3UKK A;  3NH3 X;  2V61 A;  1LQT A;  2YWL A;  2V3A A;  2BK5 A;  5ER0 A;  4EIQ A;  1FCD A;  4FK1 C;  5M10 A;  3UKQ A;  4Z2T A;  1DNC A;  1JU2 A;  2BAC A;  4CNJ A;  3SM8 A;  3SZW A;  3DH9 A;  2BK4 A;  4ICY A;  4J31 A;  4EM4 A;  2WET A;  3CTY A;  3QJ4 A;  2VVM A;  1B8S A;  2C76 A;  1B5Q A;  4NZH A;  4GAV A;  3PO7 A;  1GND A;  2IID A;  1JOA A;  3SZF A;  2X99 A;  1DOB A;  1UKV G;  1DOC A;  4Z2U A;  4ZCC A;  1ZX9 A;  1RP0 A;  4FK1 A;  3AE5 A;  2XVI A;  2R0G A;  1F8R A;  3B3R A;  1S3B A;  2WP9 A;  3IC9 A;  3UTE A;  1BGJ A;  3G5R A;  4U2L A;  4M52 A;  3T2K A;  5C3J A;  1OJA A;  1XDI A;  1PJ7 A;  2ARD A;  3ABV A;  3GWF A;  4JDR A;  3UP4 A;  4CCR A;  3ADA B;  3OZ2 A;  3Q9T A;  1TDE A;  2C70 A;  3KU9 A;  1N4W A;  1TYP A;  4B67 A;  1IUT A;  1PBE A;  4H4R A;  4IA5 A;  2A89 A;  4U8J A;  1E1N A;  1VRQ B;  2OA1 A;  3AXB A;  2YLT A;  4GAP A;  2OAL A;  4H4T A;  2GF3 A;  5U25 A;  1COY A;  4U8O A;  5L46 A;  2X8G A;  3KLJ A;  3CMM A;  2JAE A;  4H2Q A;  1VQW A;  2EQ7 A;  5JCK A;  3UTG A;  1N1P A;  4Z24 A;  5EB5 A;  2Q0K A;  2EQ9 A;  4AP3 A;  4CNK A;  1JRY A;  2BS4 A;  2C7G A;  2X8H A;  3V3N A;  4Z43 A;  2B7S A;  1H81 A;  1PDH A;  3NTD A;  1KFY A;  2XLP A;  3H8L A;  3KD9 A;  5IPY A;  1ELI A;  4K5R A;  2XLT A;  1PXC A;  2OLN A;  1VG9 A;  3FBS A;  3NN0 X;  2YR6 A;  4G6G A;  2AQJ A;  4TM0 A;  4H4V A;  3QVP A;  4EQS A;  2GAG B;  3RP7 A;  1FEB A;  2CUL A;  4BK3 A;  4A6N A;  2YVJ A;  2TPR A;  1K4Q A;  3AE2 A;  2YLX A;  3QSE A;  2GH5 A;  1KNP A;  4O5Q A;  4GF7 A;  4KPR A;  4BV6 A;  2YR5 A;  3AD8 B;  4H50 A;  4YSH A;  1CC2 A;  1SEZ A;  1GRF A;  2YR4 A;  2A87 A;  3DK4 A;  4II2 A;  3NK2 X;  3AE8 A;  1O94 A;  4C3Y A;  3V3O A;  1GRH A;  2Z5Y A;  1JNZ A;  1Q1W A;  3CGD A;  4EMW A;  4TM4 A;  4OPT A;  4UP3 A;  2WES A;  3T14 A;  2B9W A;  3AEF A;  4WX1 A;  3VR9 A;  2VQ7 A;  3KA7 A;  4NWZ A;  1YQ4 A;  1X31 B;  2F5Z A;  4UDP A;  4B65 A;  1TYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...