5KMRA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 3.0 angstrom resolution.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 112
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmrA00
3T31A 3HYVA 3SY4A 3SYIA 5KMPA 4NWZA 5KMSA 4GAVA 4G73A 3HYWA 3SX6A 3T2ZA 4G9KA 3SXIA 4G74A 3T14A 5KMRA 3HYXA 3SZFA 4G6GA 3T2YA 3T2KA 3T0KA 3SZWA 3SZCA 3KPKA 4GAPA 3SZ0A 4G6HA 5KMQA
chains in the Genus database with same CATH superfamily
1GRTA 2C70A 2YR6A 1LQUA 3VR9A 2GR1A 3VRDB 1Z6LA 3BI2A 5FS7A 3P4RA 1TDEA 1FEBA 2YAUA 1PXAA 1H6VA 3G5SA 1B8SA 1CC4A 3FMWA 4OPCA 3P9UA 4OPLA 3EANA 4U2SA 2X3NA 3FBSA 3T2ZA 1O94A 3NGCX 1GETA 3D1CA 4ZCDA 2VVLG 2ZZBA 4FX9A 1E7PA 1EL7A 4H4YA 3ZYXA 2Z5XA 4YSYA 2WETA 3LJPA 2JB2A 3FIMB 2GAHB 1GTHA 1COYA 3P4PA 1CF3A 1F6MA 4O5QA 4Z2TA 2R0CA 3CNTA 5BRTA 4B67A 3G5RA 4USRA 2R45A 1GRHA 1P2HA 2PHHA 2RGHA 1VQWA 1BF3A 4GDEA 2BS4A 2WS3A 4K8DA 5EB4A 3RP6A 1IUXA 2WOWA 4WCTA 4FDCB 3E1TA 4TM4A 1GRAA 1B37A 1D4DA 3IHMA 4APNA 3AE5A 1PS9A 2Q6UA 1B4VA 1L9CA 5EOWA 4U8LA 1VG9A 4H50A 5FS6A 3JSKA 3VRAA 2W0HA 3C96A 1NG3A 1XANA 5IQ4A 1S2QA 2O9ZA 4GR1A 1H7WA 4LIIA 3COXA 4EQRA 3CGDA 3IF9A 4H4ZA 4GUVA 2C76A 5HY5A 3GYIA 1EL9A 1TDFA 2IVEA 3CGEA 3NK1X 3Q9TA 3PVCA 4RSLA 3PS9A 4C77A 1GSNA 1LV0A 2YLSA 2QA1A 2FJDA 2CVJA 1ZOVA 2YG7A 4NWZA 1BGNA 2YM1A 3AEFA 3CNDA 3OZ2A 4IA5A 3SZ0A 3AD7B 3UP4A 1BGJA 1GT8A 2VZ2A 2XVEA 1E1LA 5FMHA 2GMHA 3GRSA 2WDQA 5U1OA 5C2TA 1DJQA 3L1RA 2C3CA 3DGZA 4B1BA 3WE0A 1OJCA 1BZLA 1E1NA 1Y56A 3KLJA 3AE4A 4REKA 2NPXA 3UKLA 5KRQA 1F8SA 2R0PA 4YKGA 3KD9A 2C73A 2GEWA 2OALA 2WEUA 4O5UA 4A65A 3DK8A 1SEZA 1GXFA 2BCPA 1GNDA 1Q1WA 1FL2A 4ZCCA 4Z2RA 3ICRA 4B68A 1H82A 3G5QA 3L8KA 4BJYA 4YSZA 3HYVA 1H86A 3ALMA 1REOA 1FEAA 1YKJA 2H88A 3P4SA 4Y4MA 2UZZA 3CNSA 2B76A 4EIQA 5M0ZA 1K0LA 4JN9A 5KOWA 4DSHA 2WOVA 3NH3X 2XFOA 3OC4A 2GQWA 2GRTA 4GCMA 3QVPA 3R9UA 1Q9IA 3RHAA 1D5TA 3NYEA 4JNAA 4AP3A 4II2A 4TM3A 4H4VA 4H2QA 4EM3A 3ISHA 5FS8A 1QJDA 1IJHA 4H7UA 3NRNA 5JCKA 3CPHG 3CGBA 2IVDA 1FECA 4YSXA 1LVLA 1OJDA 2YLRA 1TYPA 4XWZA 5IQ1A 2ACZA 2FBWA 2OLOA 2BS3A 3NYCA 3RP8A 4J34A 4CRTA 3H4KA 2JKCA 3IHGA 5CQFA 3SYIA 1MO9A 2YG3A 3AXBA 5DBJA 5HHFA 2WOIA 2GR3A 3ADAB 1Q1RA 1GTEA 3EF6A 1NAAA 1TDNA 2E4GA 2ZZCA 3ALLA 3FPZA 4H4SA 2TPRA 2OLNA 1XHCA 1HYUA 3SX6A 3UKFA 3CN8A 3O0HA 4Y4NA 2GB0A 1D4CA 2VRLA 3VR8A 5J60A 1ZMDA 1K4QA 4E0VA 4K5SA 5L46A 4BURA 1VG0A 3CNPA 4ICYA 2XCGA 1GOSA 4OPDA 3GRTA 4A7AA 5U25A 4AOSA 1B5QA 3KPKA 3F8RA 3QJ4A 3DK9A 1PBEA 2WPCA 2R46A 2YG5A 2QCUA 3AEDA 2BC0A 3SY4A 1D4EA 1F8RA 3AE7A 3K7QX 1JNZA 1ELIA 3P1WA 3I6DA 2XLSA 1JEHA 1IUWA 3DJGX 2BRAA 4U8MA 4DGKA 3CGCA 3NIXA 4USQA 2XYOA 2EQ8A 2J3NA 2F5ZA 4H2RA 3AE6A 4LA1A 2VVMA 2CFYA 4CCQA 3LB8A 1O95A 2OAMA 2V3AA 4WX1A 2I0ZA 3GWDA 4K22A 4UP3A 3T2YA 3I3LA 3C4AA 2VRMA 3UKPA 3UKKA 4YTPA 4GAPA 4JDRA 4U8OA 5EB5A 4C3YA 4CY8A 2QAEA 2XLPA 1GESA 4BK1A 3M13A 2BK4A 3D8XA 4OPIA 4YWOA 3AE1A 2RGJA 2QA2A 1ZP0A 4GAVA 1PDHA 5HYMA 1VRQB 3SM8A 1CC2A 2BABA 3NNEA 2VQ7A 5GRTA 4J2WA 3AECA 4X9MA 4XXGA 2PYXA 1CJCA 4LU6A 4EM4A 2BK3A 4A6NA 2AAQA 3SFEA 5HXIA 3PO7A 4B63A 1PJ6A 3SZFA 1GRFA 4NEWA 4XWRA 4A5LA 1Y56B 1NHRA 2WPEA 1K0JA 3ATQA 1S2YA 4RG3A 2JBVA 4U8IA 2V61A 3QFBA 3CPIG 2GMJA 2Y6RA 1E1MA 4TLXA 3T31A 3UTFA 3DJEA 3GWFA 2YM2A 2ZBWA 1NPXA 3AEEA 4AT0A 1DXLA 4D03A 2GH5A 3LOVA 4U8NA 4B69A 3H8IA 1D7LA 4J33A 1CBOA 3GMBA 2C75A 4Z2UA 5JCIA 2WQYA 2C64A 4CCRA 3RNMA 4TM0A 3UKQA 4ZN0A 5M10A 2C3DA 4K7ZA 1KNPA 3F8DA 4IVOB 4A9WA 3DJDA 2XVJA 3UTGA 1H81A 1CJ3A 4G6GA 2CDUA 2GR2A 4K2XA 1NDAA 2R9ZA 3T0KA 4OVIA 3SZWA 2A89A 5ER0A 3AE8A 4G6HA 2JB3A 1FOHA 3NHOX 1GRBA 3NTDA 4MJWA 3DK4A 3CMMA 2GAGB 3DJJA 1LQTA 4N9XA 5BUKA 3NN6X 2C72A 2VQBA 1TDKA 4H4RA 4YKFA 5LV9A 3KPFA 2C7GA 2ARDA 4UDQA 1KDGA 2JB1A 1M6IA 4EMWA 2VVLA 2Y6QA 3NK0X 3B6DA 3V3NA 2YVGA 3AE3A 5JCMA 4GRTA 1DOBA 2X8GA 3BHKA 2B9WA 2Q0LA 3UTHA 4D04A 2C67A 4ADWA 2GR0A 3AB1A 1Y0PA 2WP9A 1GRGA 1YQ3A 1GREA 2XFPA 3GDPA 4CY6A 2YQUA 3SZCA 1PBFA 3H8LA 4NZHA 4B65A 2YVFA 5KOXA 3NN0X 4CNJA 1E1KA 1NHSA 2YWLA 3BI5A 4H4PA 1W4XA 2BC1A 3LZXA 3UOZA 4EQWA 5KNLA 4P9SA 3GMCA 3NG7X 4JY3A 4JNQA 3EAOA 3AE9A 3P4QA 4AOXA 1P2EA 5KMSA 1DOEA 4YXDA 2WPFA 3QFAA 4IA6A 4H2PA 1AOGA 3QVRA 2YR4A 1JRXA 2OA1A 3AEBA 1O5WA 3II4A 1IUTA 3ITJA 1BKWA 5EBKA 4X9NA 1YQZA 4KPRA 1H84A 1LTXR 3EPTA 5KMRA 2A8XA 1LPFA 2Q7VA 2ZZ0A 3AYJA 1S3EA 4OPTA 1ZOYA 2TMDA 2WP6A 3M12A 3KVEA 1S3BA 2YR5A 4X4JA 3AD9B 4OCGA 5KXJA 1PJ7A 1TRBA 4OPGA 3CIRA 3GD3A 3UKHA 4H2NA 1QLBA 3V3OA 2XDOA 3UCLA 1JOAA 2WDVA 2X8CA 2Z5YA 3DMEA 5TR3A 4Z26A 3VQRA 2XFQA 3SGLA 3IC9A 2E1MA 3GYJA 2BACA 1N4WA 1CC6A 2B9XA 4NNJA 4CBQA 1X31B 2WESA 3Q6JA 1XPQA 2R0GA 1EBDA 3AEGA 1KNRA 5GSNA 2A87A 3T14A 1PN0A 1KSUA 1V59A 1YY5A 1ZMCA 3K30A 2FJBA 4EQSA 4C3XA 1M64A 4A6NB 2WP5A 3UOXA 2BRYA 3AE2A 4ECHA 4EIPA 3AYIA 3T37A 2Q0KA 2FJEA 5KWFA 5FS9A 4Z24A 4B64A 4U2LA 1EL5A 2BCGG 2B7SA 2YLWA 4I59A 4UDRA 1JRYA 2X8HA 3UP5A 4GF7A 3C4NA 1DODA 3QSSA 1NEKA 2XLRA 2XLUA 4YTNA 2R4EA 2XVFA 3URHA 4EQXA 2V60A 4NTEA 4Y4LA 2C65A 1L9EA 5KVIA 1F3PA 3B3RA 2BA9A 5JCNA 3NYFA 1MOKA 2RGOA 2XLTA 2BXRA 4Z25A 2C66A 2E5VA 2APGA 2B7RA 3T2KA 1FCDA 4NEVA 3BHFA 3K7TA 3UTEA 3ATRA 3HZLA 1PXBA 3GSIA 4C5OA 5BVAA 1DNCA 1ZY8A 4H4XA 1N4VA 2DKIA 3FG2P 1PBBA 2AQJA 2AR8A 3NLCA 1GEUA 1F8WA 2BXSA 2RABA 5U63A 3SQPA 4EMIA 2WHDA 3S5WA 4YSHA 1IUUA 3REDA 1TDOA 1L0VA 1CJ2A 5IPYA 1GALA 1JRZA 1EL8A 4EMJA 3SXIA 3AEAA 4BK3A 1PXCA 2R4JA 3NTAA 3QSMA 3SFDA 4DNAA 1IUSA 1GERA 3HYXA 3GYXA 2YG4A 4HB9A 3LADA 4AT2A 3AD8B 3RP7A 4PAAA 3DGHA 1CL0A 2XVIA 1KFYA 2V3BA 3ABVA 2GF3A 3UOYA 2DKHA 2WBAA 4AP1A 3CTYA 1OJAA 2X50A 4M52A 1OJ9A 2FJAA 2WDRA 1NG4A 3KA7A 4K5RA 4H4UA 1ZDLA 2X99A 4H4WA 1JU2A 1PBDA 2GQFA 2WU5A 1MXTA 3HYWA 4JY2A 4BK2A 2XFNA 3GDNA 1H83A 4G9KA 3VRBA 4TLZA 1D7YA 4BJZA 3ALJA 1IUVA 2BS2A 4G74A 4UDPA 1RSGA 4TM1A 4HA6A 4U8KA 3NK2X 4RG4A 4J56A 4IVMB 3V76A 1CJ4A 4CNKA 2BYBA 2XFUA 2YLXA 4FK1C 4Z44A 1ONFA 1NHPA 1N1PA 1BWCA 1CHUA 3K7MX 4IV9A 3NT6A 5BULA 5KMPA 2YG6A 2JAEA 4U2TA 2JK6A 1GV4A 3ZDNA 2HQMA 1UKVG 4H4TA 1ZKQA 3DH9A 5CKUA 5J7XA 4J36A 1JNRA 2V5ZA 4KX6A 5JCLA 4J57A 3UKAA 3CNJA 1TYTA 2EQ7A 4J31A 1GPEA 3UOVA 1K0IA 3IWAA 5C3JA 1VDCA 4YT0A 4I58A 1PJ5A 3NKSA 3M0OA 1N4UA 2VOUA 3ICSA 2B9YA 2EQ6A 1YQ4A 4C74A 1KF6A 3BNMA 2XVHA 3DA1A 2BK5A 4NTDA 1H7XA 4U8PA 2YVJA 4GDPA 1NHQA 2H89A 2IIDA 1LJ1A 1OJTA 1RYIA 3CPJG 4OPUA 4YTMA 4BV6A 2EQ9A 3BNUA 3GD4A 1PBCA 5KVHA 1KSSA 1E6EA 2GV8A 4G73A 3BI4A 3QSEA 1L9DA 2YLZA 1ZX9A 3KKJA 4H4QA 1E39A 4A99A 2CULA 3AWIA 3F8PA 3KU9A 1NENA 4NTCA 1QO8A 1RP0A 2C4CA 4JQ9A 4U8JA 3ICTA 2YLTA 3AYLA 3LXDA 1ZK7A 3LZWA 4II3A 1DOCA 4A79A 1PHHA 4DSGA 4Z43A 2WU2A 1XDIA 4FK1A 1DJNA 2NVKX 4PABA 3S61A 4B66A 5KMQA 2GVCA 2V6OA
chains in the Genus database with same CATH topology
1GRTA 2C70A 2YR6A 1LQUA 3VR9A 2GR1A 3VRDB 1Z6LA 3BI2A 5FS7A 3P4RA 1TDEA 1FEBA 2YAUA 1PXAA 1H6VA 3G5SA 1B8SA 1CC4A 3FMWA 4OPCA 3P9UA 4OPLA 3EANA 4U2SA 2X3NA 3FBSA 3T2ZA 1O94A 3NGCX 1GETA 3D1CA 4ZCDA 2VVLG 2ZZBA 4FX9A 1E7PA 1EL7A 4H4YA 3ZYXA 2Z5XA 4YSYA 2WETA 3LJPA 2JB2A 3FIMB 2GAHB 1GTHA 1COYA 3P4PA 1CF3A 1F6MA 4O5QA 4Z2TA 2R0CA 3CNTA 5BRTA 4B67A 3G5RA 4USRA 2R45A 1GRHA 1P2HA 2PHHA 2RGHA 1VQWA 1BF3A 4GDEA 2BS4A 2WS3A 4K8DA 5EB4A 3RP6A 1IUXA 2WOWA 4WCTA 4FDCB 3E1TA 4TM4A 1GRAA 1B37A 1D4DA 3IHMA 4APNA 3AE5A 1PS9A 2Q6UA 1B4VA 1L9CA 5EOWA 4U8LA 1VG9A 4H50A 5FS6A 3JSKA 3VRAA 2W0HA 3C96A 1NG3A 1XANA 5IQ4A 1S2QA 2O9ZA 4GR1A 1H7WA 4LIIA 3COXA 4EQRA 3CGDA 3IF9A 4H4ZA 4GUVA 2C76A 5HY5A 3GYIA 1EL9A 1TDFA 2IVEA 3CGEA 3NK1X 3Q9TA 3PVCA 4RSLA 3PS9A 4C77A 1GSNA 1LV0A 2YLSA 2QA1A 2FJDA 2CVJA 1ZOVA 2YG7A 4NWZA 1BGNA 2YM1A 3AEFA 3CNDA 3OZ2A 4IA5A 3SZ0A 3AD7B 3UP4A 1BGJA 1GT8A 2VZ2A 2XVEA 1E1LA 5FMHA 2GMHA 3GRSA 2WDQA 5U1OA 5C2TA 1DJQA 3L1RA 2C3CA 3DGZA 4B1BA 3WE0A 1OJCA 1BZLA 1E1NA 1Y56A 3KLJA 3AE4A 4REKA 2NPXA 3UKLA 5KRQA 1F8SA 2R0PA 4YKGA 3KD9A 2C73A 2GEWA 2OALA 2WEUA 4O5UA 4A65A 3DK8A 1SEZA 1GXFA 2BCPA 1GNDA 1Q1WA 1FL2A 4ZCCA 4Z2RA 3ICRA 4B68A 1H82A 3G5QA 3L8KA 4BJYA 4YSZA 3HYVA 1H86A 3ALMA 1REOA 1FEAA 1YKJA 2H88A 3P4SA 4Y4MA 2UZZA 3CNSA 2B76A 4EIQA 5M0ZA 1K0LA 4JN9A 5KOWA 4DSHA 2WOVA 3NH3X 2XFOA 3OC4A 2GQWA 2GRTA 4GCMA 3QVPA 3R9UA 1Q9IA 3RHAA 1D5TA 3NYEA 4JNAA 4AP3A 4II2A 4TM3A 4H4VA 4H2QA 4EM3A 3ISHA 5FS8A 1QJDA 1IJHA 4H7UA 3NRNA 5JCKA 3CPHG 3CGBA 2IVDA 1FECA 4YSXA 1LVLA 1OJDA 2YLRA 1TYPA 4XWZA 5IQ1A 2ACZA 2FBWA 2OLOA 2BS3A 3NYCA 3RP8A 4J34A 4CRTA 3H4KA 2JKCA 3IHGA 5CQFA 3SYIA 1MO9A 2YG3A 3AXBA 5DBJA 5HHFA 2WOIA 2GR3A 3ADAB 1Q1RA 1GTEA 3EF6A 1NAAA 1TDNA 2E4GA 2ZZCA 3ALLA 3FPZA 4H4SA 2TPRA 2OLNA 1XHCA 1HYUA 3SX6A 3UKFA 3CN8A 3O0HA 4Y4NA 2GB0A 1D4CA 2VRLA 3VR8A 5J60A 1ZMDA 1K4QA 4E0VA 4K5SA 5L46A 4BURA 1VG0A 3CNPA 4ICYA 2XCGA 1GOSA 4OPDA 3GRTA 4A7AA 5U25A 4AOSA 1B5QA 3KPKA 3F8RA 3QJ4A 3DK9A 1PBEA 2WPCA 2R46A 2YG5A 2QCUA 3AEDA 2BC0A 3SY4A 1D4EA 1F8RA 3AE7A 3K7QX 1JNZA 1ELIA 3P1WA 3I6DA 2XLSA 1JEHA 1IUWA 3DJGX 2BRAA 4U8MA 4DGKA 3CGCA 3NIXA 4USQA 2XYOA 2EQ8A 2J3NA 2F5ZA 4H2RA 3AE6A 4LA1A 2VVMA 2CFYA 4CCQA 3LB8A 1O95A 2OAMA 2V3AA 4WX1A 2I0ZA 3GWDA 4K22A 4UP3A 3T2YA 3I3LA 3C4AA 2VRMA 3UKPA 3UKKA 4YTPA 4GAPA 4JDRA 4U8OA 5EB5A 4C3YA 4CY8A 2QAEA 2XLPA 1GESA 4BK1A 3M13A 2BK4A 3D8XA 4OPIA 4YWOA 3AE1A 2RGJA 2QA2A 1ZP0A 4GAVA 1PDHA 5HYMA 1VRQB 3SM8A 1CC2A 2BABA 3NNEA 2VQ7A 5GRTA 4J2WA 3AECA 4X9MA 4XXGA 2PYXA 1CJCA 4LU6A 4EM4A 2BK3A 4A6NA 2AAQA 3SFEA 5HXIA 3PO7A 4B63A 1PJ6A 3SZFA 1GRFA 4NEWA 4XWRA 4A5LA 1Y56B 1NHRA 2WPEA 1K0JA 3ATQA 1S2YA 4RG3A 2JBVA 4U8IA 2V61A 3QFBA 3CPIG 2GMJA 2Y6RA 1E1MA 4TLXA 3T31A 3UTFA 3DJEA 3GWFA 2YM2A 2ZBWA 1NPXA 3AEEA 4AT0A 1DXLA 4D03A 2GH5A 3LOVA 4U8NA 4B69A 3H8IA 1D7LA 4J33A 1CBOA 3GMBA 2C75A 4Z2UA 5JCIA 2WQYA 2C64A 4CCRA 3RNMA 4TM0A 3UKQA 4ZN0A 5M10A 2C3DA 4K7ZA 1KNPA 3F8DA 4IVOB 4A9WA 3DJDA 2XVJA 3UTGA 1H81A 1CJ3A 4G6GA 2CDUA 2GR2A 4K2XA 1NDAA 2R9ZA 3T0KA 4OVIA 3SZWA 2A89A 5ER0A 3AE8A 4G6HA 2JB3A 1FOHA 3NHOX 1GRBA 3NTDA 4MJWA 3DK4A 3CMMA 2GAGB 3DJJA 1LQTA 4N9XA 5BUKA 3NN6X 2C72A 2VQBA 1TDKA 4H4RA 4YKFA 5LV9A 3KPFA 2C7GA 2ARDA 4UDQA 1KDGA 2JB1A 1M6IA 4EMWA 2VVLA 2Y6QA 3NK0X 3B6DA 3V3NA 2YVGA 3AE3A 5JCMA 4GRTA 1DOBA 2X8GA 3BHKA 2B9WA 2Q0LA 3UTHA 4D04A 2C67A 4ADWA 2GR0A 3AB1A 1Y0PA 2WP9A 1GRGA 1YQ3A 1GREA 2XFPA 3GDPA 4CY6A 2YQUA 3SZCA 1PBFA 3H8LA 4NZHA 4B65A 2YVFA 5KOXA 3NN0X 4CNJA 1E1KA 1NHSA 2YWLA 3BI5A 4H4PA 1W4XA 2BC1A 3LZXA 3UOZA 4EQWA 5KNLA 4P9SA 3GMCA 3NG7X 4JY3A 4JNQA 3EAOA 3AE9A 3P4QA 4AOXA 1P2EA 5KMSA 1DOEA 4YXDA 2WPFA 3QFAA 4IA6A 4H2PA 1AOGA 3QVRA 2YR4A 1JRXA 2OA1A 3AEBA 1O5WA 3II4A 1IUTA 3ITJA 1BKWA 5EBKA 4X9NA 1YQZA 4KPRA 1H84A 1LTXR 3EPTA 5KMRA 2A8XA 1LPFA 2Q7VA 2ZZ0A 3AYJA 1S3EA 4OPTA 1ZOYA 2TMDA 2WP6A 3M12A 3KVEA 1S3BA 2YR5A 4X4JA 3AD9B 4OCGA 5KXJA 1PJ7A 1TRBA 4OPGA 3CIRA 3GD3A 3UKHA 4H2NA 1QLBA 3V3OA 2XDOA 3UCLA 1JOAA 2WDVA 2X8CA 2Z5YA 3DMEA 5TR3A 4Z26A 3VQRA 2XFQA 3SGLA 3IC9A 2E1MA 3GYJA 2BACA 1N4WA 1CC6A 2B9XA 4NNJA 4CBQA 1X31B 2WESA 3Q6JA 1XPQA 2R0GA 1EBDA 3AEGA 1KNRA 5GSNA 2A87A 3T14A 1PN0A 1KSUA 1V59A 1YY5A 1ZMCA 3K30A 2FJBA 4EQSA 4C3XA 1M64A 4A6NB 2WP5A 3UOXA 2BRYA 3AE2A 4ECHA 4EIPA 3AYIA 3T37A 2Q0KA 2FJEA 5KWFA 5FS9A 4Z24A 4B64A 4U2LA 1EL5A 2BCGG 2B7SA 2YLWA 4I59A 4UDRA 1JRYA 2X8HA 3UP5A 4GF7A 3C4NA 1DODA 3QSSA 1NEKA 2XLRA 2XLUA 4YTNA 2R4EA 2XVFA 3URHA 4EQXA 2V60A 4NTEA 4Y4LA 2C65A 1L9EA 5KVIA 1F3PA 3B3RA 2BA9A 5JCNA 3NYFA 1MOKA 2RGOA 2XLTA 2BXRA 4Z25A 2C66A 2E5VA 2APGA 2B7RA 3T2KA 1FCDA 4NEVA 3BHFA 3K7TA 3UTEA 3ATRA 3HZLA 1PXBA 3GSIA 4C5OA 5BVAA 1DNCA 1ZY8A 4H4XA 1N4VA 2DKIA 3FG2P 1PBBA 2AQJA 2AR8A 3NLCA 1GEUA 1F8WA 2BXSA 2RABA 5U63A 3SQPA 4EMIA 2WHDA 3S5WA 4YSHA 1IUUA 3REDA 1TDOA 1L0VA 1CJ2A 5IPYA 1GALA 1JRZA 1EL8A 4EMJA 3SXIA 3AEAA 4BK3A 1PXCA 2R4JA 3NTAA 3QSMA 3SFDA 4DNAA 1IUSA 1GERA 3HYXA 3GYXA 2YG4A 4HB9A 3LADA 4AT2A 3AD8B 3RP7A 4PAAA 3DGHA 1CL0A 2XVIA 1KFYA 2V3BA 3ABVA 2GF3A 3UOYA 2DKHA 2WBAA 4AP1A 3CTYA 1OJAA 2X50A 4M52A 1OJ9A 2FJAA 2WDRA 1NG4A 3KA7A 4K5RA 4H4UA 1ZDLA 2X99A 4H4WA 1JU2A 1PBDA 2GQFA 2WU5A 1MXTA 3HYWA 4JY2A 4BK2A 2XFNA 3GDNA 1H83A 4G9KA 3VRBA 4TLZA 1D7YA 4BJZA 3ALJA 1IUVA 2BS2A 4G74A 4UDPA 1RSGA 4TM1A 4HA6A 4U8KA 3NK2X 4RG4A 4J56A 4IVMB 3V76A 1CJ4A 4CNKA 2BYBA 2XFUA 2YLXA 4FK1C 4Z44A 1ONFA 1NHPA 1N1PA 1BWCA 1CHUA 3K7MX 4IV9A 3NT6A 5BULA 5KMPA 2YG6A 2JAEA 4U2TA 2JK6A 1GV4A 3ZDNA 2HQMA 1UKVG 4H4TA 1ZKQA 3DH9A 5CKUA 5J7XA 4J36A 1JNRA 2V5ZA 4KX6A 5JCLA 4J57A 3UKAA 3CNJA 1TYTA 2EQ7A 4J31A 1GPEA 3UOVA 1K0IA 3IWAA 5C3JA 1VDCA 4YT0A 4I58A 1PJ5A 3NKSA 3M0OA 1N4UA 2VOUA 3ICSA 2B9YA 2EQ6A 1YQ4A 4C74A 1KF6A 3BNMA 2XVHA 3DA1A 2BK5A 4NTDA 1H7XA 4U8PA 2YVJA 4GDPA 1NHQA 2H89A 2IIDA 1LJ1A 1OJTA 1RYIA 3CPJG 4OPUA 4YTMA 4BV6A 2EQ9A 3BNUA 3GD4A 1PBCA 5KVHA 1KSSA 1E6EA 2GV8A 4G73A 3BI4A 3QSEA 1L9DA 2YLZA 1ZX9A 3KKJA 4H4QA 1E39A 4A99A 2CULA 3AWIA 3F8PA 3KU9A 1NENA 4NTCA 1QO8A 1RP0A 2C4CA 4JQ9A 4U8JA 3ICTA 2YLTA 3AYLA 3LXDA 1ZK7A 3LZWA 4II3A 1DOCA 4A79A 1PHHA 4DSGA 4Z43A 2WU2A 1XDIA 4FK1A 1DJNA 2NVKX 4PABA 3S61A 4B66A 5KMQA 2GVCA 2V6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T31 A;  3HYV A;  3SY4 A;  3SYI A;  5KMP A;  4NWZ A;  5KMS A;  4GAV A;  4G73 A;  3HYW A;  3SX6 A;  3T2Z A;  4G9K A;  3SXI A;  4G74 A;  3T14 A;  5KMR A;  3HYX A;  3SZF A;  4G6G A;  3T2Y A;  3T2K A;  3T0K A;  3SZW A;  3SZC A;  3KPK A;  4GAP A;  3SZ0 A;  4G6H A;  5KMQ A; 
#chains in the Genus database with same CATH topology
 1GRT A;  2C70 A;  2YR6 A;  1LQU A;  3VR9 A;  2GR1 A;  3VRD B;  1Z6L A;  3BI2 A;  5FS7 A;  3P4R A;  1TDE A;  1FEB A;  2YAU A;  1PXA A;  1H6V A;  3G5S A;  1B8S A;  1CC4 A;  3FMW A;  4OPC A;  3P9U A;  4OPL A;  3EAN A;  4U2S A;  2X3N A;  3FBS A;  3T2Z A;  1O94 A;  3NGC X;  1GET A;  3D1C A;  4ZCD A;  2VVL G;  2ZZB A;  4FX9 A;  1E7P A;  1EL7 A;  4H4Y A;  3ZYX A;  2Z5X A;  4YSY A;  2WET A;  3LJP A;  2JB2 A;  3FIM B;  2GAH B;  1GTH A;  1COY A;  3P4P A;  1CF3 A;  1F6M A;  4O5Q A;  4Z2T A;  2R0C A;  3CNT A;  5BRT A;  4B67 A;  3G5R A;  4USR A;  2R45 A;  1GRH A;  1P2H A;  2PHH A;  2RGH A;  1VQW A;  1BF3 A;  4GDE A;  2BS4 A;  2WS3 A;  4K8D A;  5EB4 A;  3RP6 A;  1IUX A;  2WOW A;  4WCT A;  4FDC B;  3E1T A;  4TM4 A;  1GRA A;  1B37 A;  1D4D A;  3IHM A;  4APN A;  3AE5 A;  1PS9 A;  2Q6U A;  1B4V A;  1L9C A;  5EOW A;  4U8L A;  1VG9 A;  4H50 A;  5FS6 A;  3JSK A;  3VRA A;  2W0H A;  3C96 A;  1NG3 A;  1XAN A;  5IQ4 A;  1S2Q A;  2O9Z A;  4GR1 A;  1H7W A;  4LII A;  3COX A;  4EQR A;  3CGD A;  3IF9 A;  4H4Z A;  4GUV A;  2C76 A;  5HY5 A;  3GYI A;  1EL9 A;  1TDF A;  2IVE A;  3CGE A;  3NK1 X;  3Q9T A;  3PVC A;  4RSL A;  3PS9 A;  4C77 A;  1GSN A;  1LV0 A;  2YLS A;  2QA1 A;  2FJD A;  2CVJ A;  1ZOV A;  2YG7 A;  4NWZ A;  1BGN A;  2YM1 A;  3AEF A;  3CND A;  3OZ2 A;  4IA5 A;  3SZ0 A;  3AD7 B;  3UP4 A;  1BGJ A;  1GT8 A;  2VZ2 A;  2XVE A;  1E1L A;  5FMH A;  2GMH A;  3GRS A;  2WDQ A;  5U1O A;  5C2T A;  1DJQ A;  3L1R A;  2C3C A;  3DGZ A;  4B1B A;  3WE0 A;  1OJC A;  1BZL A;  1E1N A;  1Y56 A;  3KLJ A;  3AE4 A;  4REK A;  2NPX A;  3UKL A;  5KRQ A;  1F8S A;  2R0P A;  4YKG A;  3KD9 A;  2C73 A;  2GEW A;  2OAL A;  2WEU A;  4O5U A;  4A65 A;  3DK8 A;  1SEZ A;  1GXF A;  2BCP A;  1GND A;  1Q1W A;  1FL2 A;  4ZCC A;  4Z2R A;  3ICR A;  4B68 A;  1H82 A;  3G5Q A;  3L8K A;  4BJY A;  4YSZ A;  3HYV A;  1H86 A;  3ALM A;  1REO A;  1FEA A;  1YKJ A;  2H88 A;  3P4S A;  4Y4M A;  2UZZ A;  3CNS A;  2B76 A;  4EIQ A;  5M0Z A;  1K0L A;  4JN9 A;  5KOW A;  4DSH A;  2WOV A;  3NH3 X;  2XFO A;  3OC4 A;  2GQW A;  2GRT A;  4GCM A;  3QVP A;  3R9U A;  1Q9I A;  3RHA A;  1D5T A;  3NYE A;  4JNA A;  4AP3 A;  4II2 A;  4TM3 A;  4H4V A;  4H2Q A;  4EM3 A;  3ISH A;  5FS8 A;  1QJD A;  1IJH A;  4H7U A;  3NRN A;  5JCK A;  3CPH G;  3CGB A;  2IVD A;  1FEC A;  4YSX A;  1LVL A;  1OJD A;  2YLR A;  1TYP A;  4XWZ A;  5IQ1 A;  2ACZ A;  2FBW A;  2OLO A;  2BS3 A;  3NYC A;  3RP8 A;  4J34 A;  4CRT A;  3H4K A;  2JKC A;  3IHG A;  5CQF A;  3SYI A;  1MO9 A;  2YG3 A;  3AXB A;  5DBJ A;  5HHF A;  2WOI A;  2GR3 A;  3ADA B;  1Q1R A;  1GTE A;  3EF6 A;  1NAA A;  1TDN A;  2E4G A;  2ZZC A;  3ALL A;  3FPZ A;  4H4S A;  2TPR A;  2OLN A;  1XHC A;  1HYU A;  3SX6 A;  3UKF A;  3CN8 A;  3O0H A;  4Y4N A;  2GB0 A;  1D4C A;  2VRL A;  3VR8 A;  5J60 A;  1ZMD A;  1K4Q A;  4E0V A;  4K5S A;  5L46 A;  4BUR A;  1VG0 A;  3CNP A;  4ICY A;  2XCG A;  1GOS A;  4OPD A;  3GRT A;  4A7A A;  5U25 A;  4AOS A;  1B5Q A;  3KPK A;  3F8R A;  3QJ4 A;  3DK9 A;  1PBE A;  2WPC A;  2R46 A;  2YG5 A;  2QCU A;  3AED A;  2BC0 A;  3SY4 A;  1D4E A;  1F8R A;  3AE7 A;  3K7Q X;  1JNZ A;  1ELI A;  3P1W A;  3I6D A;  2XLS A;  1JEH A;  1IUW A;  3DJG X;  2BRA A;  4U8M A;  4DGK A;  3CGC A;  3NIX A;  4USQ A;  2XYO A;  2EQ8 A;  2J3N A;  2F5Z A;  4H2R A;  3AE6 A;  4LA1 A;  2VVM A;  2CFY A;  4CCQ A;  3LB8 A;  1O95 A;  2OAM A;  2V3A A;  4WX1 A;  2I0Z A;  3GWD A;  4K22 A;  4UP3 A;  3T2Y A;  3I3L A;  3C4A A;  2VRM A;  3UKP A;  3UKK A;  4YTP A;  4GAP A;  4JDR A;  4U8O A;  5EB5 A;  4C3Y A;  4CY8 A;  2QAE A;  2XLP A;  1GES A;  4BK1 A;  3M13 A;  2BK4 A;  3D8X A;  4OPI A;  4YWO A;  3AE1 A;  2RGJ A;  2QA2 A;  1ZP0 A;  4GAV A;  1PDH A;  5HYM A;  1VRQ B;  3SM8 A;  1CC2 A;  2BAB A;  3NNE A;  2VQ7 A;  5GRT A;  4J2W A;  3AEC A;  4X9M A;  4XXG A;  2PYX A;  1CJC A;  4LU6 A;  4EM4 A;  2BK3 A;  4A6N A;  2AAQ A;  3SFE A;  5HXI A;  3PO7 A;  4B63 A;  1PJ6 A;  3SZF A;  1GRF A;  4NEW A;  4XWR A;  4A5L A;  1Y56 B;  1NHR A;  2WPE A;  1K0J A;  3ATQ A;  1S2Y A;  4RG3 A;  2JBV A;  4U8I A;  2V61 A;  3QFB A;  3CPI G;  2GMJ A;  2Y6R A;  1E1M A;  4TLX A;  3T31 A;  3UTF A;  3DJE A;  3GWF A;  2YM2 A;  2ZBW A;  1NPX A;  3AEE A;  4AT0 A;  1DXL A;  4D03 A;  2GH5 A;  3LOV A;  4U8N A;  4B69 A;  3H8I A;  1D7L A;  4J33 A;  1CBO A;  3GMB A;  2C75 A;  4Z2U A;  5JCI A;  2WQY A;  2C64 A;  4CCR A;  3RNM A;  4TM0 A;  3UKQ A;  4ZN0 A;  5M10 A;  2C3D A;  4K7Z A;  1KNP A;  3F8D A;  4IVO B;  4A9W A;  3DJD A;  2XVJ A;  3UTG A;  1H81 A;  1CJ3 A;  4G6G A;  2CDU A;  2GR2 A;  4K2X A;  1NDA A;  2R9Z A;  3T0K A;  4OVI A;  3SZW A;  2A89 A;  5ER0 A;  3AE8 A;  4G6H A;  2JB3 A;  1FOH A;  3NHO X;  1GRB A;  3NTD A;  4MJW A;  3DK4 A;  3CMM A;  2GAG B;  3DJJ A;  1LQT A;  4N9X A;  5BUK A;  3NN6 X;  2C72 A;  2VQB A;  1TDK A;  4H4R A;  4YKF A;  5LV9 A;  3KPF A;  2C7G A;  2ARD A;  4UDQ A;  1KDG A;  2JB1 A;  1M6I A;  4EMW A;  2VVL A;  2Y6Q A;  3NK0 X;  3B6D A;  3V3N A;  2YVG A;  3AE3 A;  5JCM A;  4GRT A;  1DOB A;  2X8G A;  3BHK A;  2B9W A;  2Q0L A;  3UTH A;  4D04 A;  2C67 A;  4ADW A;  2GR0 A;  3AB1 A;  1Y0P A;  2WP9 A;  1GRG A;  1YQ3 A;  1GRE A;  2XFP A;  3GDP A;  4CY6 A;  2YQU A;  3SZC A;  1PBF A;  3H8L A;  4NZH A;  4B65 A;  2YVF A;  5KOX A;  3NN0 X;  4CNJ A;  1E1K A;  1NHS A;  2YWL A;  3BI5 A;  4H4P A;  1W4X A;  2BC1 A;  3LZX A;  3UOZ A;  4EQW A;  5KNL A;  4P9S A;  3GMC A;  3NG7 X;  4JY3 A;  4JNQ A;  3EAO A;  3AE9 A;  3P4Q A;  4AOX A;  1P2E A;  5KMS A;  1DOE A;  4YXD A;  2WPF A;  3QFA A;  4IA6 A;  4H2P A;  1AOG A;  3QVR A;  2YR4 A;  1JRX A;  2OA1 A;  3AEB A;  1O5W A;  3II4 A;  1IUT A;  3ITJ A;  1BKW A;  5EBK A;  4X9N A;  1YQZ A;  4KPR A;  1H84 A;  1LTX R;  3EPT A;  5KMR A;  2A8X A;  1LPF A;  2Q7V A;  2ZZ0 A;  3AYJ A;  1S3E A;  4OPT A;  1ZOY A;  2TMD A;  2WP6 A;  3M12 A;  3KVE A;  1S3B A;  2YR5 A;  4X4J A;  3AD9 B;  4OCG A;  5KXJ A;  1PJ7 A;  1TRB A;  4OPG A;  3CIR A;  3GD3 A;  3UKH A;  4H2N A;  1QLB A;  3V3O A;  2XDO A;  3UCL A;  1JOA A;  2WDV A;  2X8C A;  2Z5Y A;  3DME A;  5TR3 A;  4Z26 A;  3VQR A;  2XFQ A;  3SGL A;  3IC9 A;  2E1M A;  3GYJ A;  2BAC A;  1N4W A;  1CC6 A;  2B9X A;  4NNJ A;  4CBQ A;  1X31 B;  2WES A;  3Q6J A;  1XPQ A;  2R0G A;  1EBD A;  3AEG A;  1KNR A;  5GSN A;  2A87 A;  3T14 A;  1PN0 A;  1KSU A;  1V59 A;  1YY5 A;  1ZMC A;  3K30 A;  2FJB A;  4EQS A;  4C3X A;  1M64 A;  4A6N B;  2WP5 A;  3UOX A;  2BRY A;  3AE2 A;  4ECH A;  4EIP A;  3AYI A;  3T37 A;  2Q0K A;  2FJE A;  5KWF A;  5FS9 A;  4Z24 A;  4B64 A;  4U2L A;  1EL5 A;  2BCG G;  2B7S A;  2YLW A;  4I59 A;  4UDR A;  1JRY A;  2X8H A;  3UP5 A;  4GF7 A;  3C4N A;  1DOD A;  3QSS A;  1NEK A;  2XLR A;  2XLU A;  4YTN A;  2R4E A;  2XVF A;  3URH A;  4EQX A;  2V60 A;  4NTE A;  4Y4L A;  2C65 A;  1L9E A;  5KVI A;  1F3P A;  3B3R A;  2BA9 A;  5JCN A;  3NYF A;  1MOK A;  2RGO A;  2XLT A;  2BXR A;  4Z25 A;  2C66 A;  2E5V A;  2APG A;  2B7R A;  3T2K A;  1FCD A;  4NEV A;  3BHF A;  3K7T A;  3UTE A;  3ATR A;  3HZL A;  1PXB A;  3GSI A;  4C5O A;  5BVA A;  1DNC A;  1ZY8 A;  4H4X A;  1N4V A;  2DKI A;  3FG2 P;  1PBB A;  2AQJ A;  2AR8 A;  3NLC A;  1GEU A;  1F8W A;  2BXS A;  2RAB A;  5U63 A;  3SQP A;  4EMI A;  2WHD A;  3S5W A;  4YSH A;  1IUU A;  3RED A;  1TDO A;  1L0V A;  1CJ2 A;  5IPY A;  1GAL A;  1JRZ A;  1EL8 A;  4EMJ A;  3SXI A;  3AEA A;  4BK3 A;  1PXC A;  2R4J A;  3NTA A;  3QSM A;  3SFD A;  4DNA A;  1IUS A;  1GER A;  3HYX A;  3GYX A;  2YG4 A;  4HB9 A;  3LAD A;  4AT2 A;  3AD8 B;  3RP7 A;  4PAA A;  3DGH A;  1CL0 A;  2XVI A;  1KFY A;  2V3B A;  3ABV A;  2GF3 A;  3UOY A;  2DKH A;  2WBA A;  4AP1 A;  3CTY A;  1OJA A;  2X50 A;  4M52 A;  1OJ9 A;  2FJA A;  2WDR A;  1NG4 A;  3KA7 A;  4K5R A;  4H4U A;  1ZDL A;  2X99 A;  4H4W A;  1JU2 A;  1PBD A;  2GQF A;  2WU5 A;  1MXT A;  3HYW A;  4JY2 A;  4BK2 A;  2XFN A;  3GDN A;  1H83 A;  4G9K A;  3VRB A;  4TLZ A;  1D7Y A;  4BJZ A;  3ALJ A;  1IUV A;  2BS2 A;  4G74 A;  4UDP A;  1RSG A;  4TM1 A;  4HA6 A;  4U8K A;  3NK2 X;  4RG4 A;  4J56 A;  4IVM B;  3V76 A;  1CJ4 A;  4CNK A;  2BYB A;  2XFU A;  2YLX A;  4FK1 C;  4Z44 A;  1ONF A;  1NHP A;  1N1P A;  1BWC A;  1CHU A;  3K7M X;  4IV9 A;  3NT6 A;  5BUL A;  5KMP A;  2YG6 A;  2JAE A;  4U2T A;  2JK6 A;  1GV4 A;  3ZDN A;  2HQM A;  1UKV G;  4H4T A;  1ZKQ A;  3DH9 A;  5CKU A;  5J7X A;  4J36 A;  1JNR A;  2V5Z A;  4KX6 A;  5JCL A;  4J57 A;  3UKA A;  3CNJ A;  1TYT A;  2EQ7 A;  4J31 A;  1GPE A;  3UOV A;  1K0I A;  3IWA A;  5C3J A;  1VDC A;  4YT0 A;  4I58 A;  1PJ5 A;  3NKS A;  3M0O A;  1N4U A;  2VOU A;  3ICS A;  2B9Y A;  2EQ6 A;  1YQ4 A;  4C74 A;  1KF6 A;  3BNM A;  2XVH A;  3DA1 A;  2BK5 A;  4NTD A;  1H7X A;  4U8P A;  2YVJ A;  4GDP A;  1NHQ A;  2H89 A;  2IID A;  1LJ1 A;  1OJT A;  1RYI A;  3CPJ G;  4OPU A;  4YTM A;  4BV6 A;  2EQ9 A;  3BNU A;  3GD4 A;  1PBC A;  5KVH A;  1KSS A;  1E6E A;  2GV8 A;  4G73 A;  3BI4 A;  3QSE A;  1L9D A;  2YLZ A;  1ZX9 A;  3KKJ A;  4H4Q A;  1E39 A;  4A99 A;  2CUL A;  3AWI A;  3F8P A;  3KU9 A;  1NEN A;  4NTC A;  1QO8 A;  1RP0 A;  2C4C A;  4JQ9 A;  4U8J A;  3ICT A;  2YLT A;  3AYL A;  3LXD A;  1ZK7 A;  3LZW A;  4II3 A;  1DOC A;  4A79 A;  1PHH A;  4DSG A;  4Z43 A;  2WU2 A;  1XDI A;  4FK1 A;  1DJN A;  2NVK X;  4PAB A;  3S61 A;  4B66 A;  5KMQ A;  2GVC A;  2V6O A; 
#chains in the Genus database with same CATH homology
 1GRT A;  2C70 A;  2YR6 A;  1LQU A;  3VR9 A;  2GR1 A;  3VRD B;  1Z6L A;  3BI2 A;  5FS7 A;  3P4R A;  1TDE A;  1FEB A;  2YAU A;  1PXA A;  1H6V A;  3G5S A;  1B8S A;  1CC4 A;  3FMW A;  4OPC A;  3P9U A;  4OPL A;  3EAN A;  4U2S A;  2X3N A;  3FBS A;  3T2Z A;  1O94 A;  3NGC X;  1GET A;  3D1C A;  4ZCD A;  2VVL G;  2ZZB A;  4FX9 A;  1E7P A;  1EL7 A;  4H4Y A;  3ZYX A;  2Z5X A;  4YSY A;  2WET A;  3LJP A;  2JB2 A;  3FIM B;  2GAH B;  1GTH A;  1COY A;  3P4P A;  1CF3 A;  1F6M A;  4O5Q A;  4Z2T A;  2R0C A;  3CNT A;  5BRT A;  4B67 A;  3G5R A;  4USR A;  2R45 A;  1GRH A;  1P2H A;  2PHH A;  2RGH A;  1VQW A;  1BF3 A;  4GDE A;  2BS4 A;  2WS3 A;  4K8D A;  5EB4 A;  3RP6 A;  1IUX A;  2WOW A;  4WCT A;  4FDC B;  3E1T A;  4TM4 A;  1GRA A;  1B37 A;  1D4D A;  3IHM A;  4APN A;  3AE5 A;  1PS9 A;  2Q6U A;  1B4V A;  1L9C A;  5EOW A;  4U8L A;  1VG9 A;  4H50 A;  5FS6 A;  3JSK A;  3VRA A;  2W0H A;  3C96 A;  1NG3 A;  1XAN A;  5IQ4 A;  1S2Q A;  2O9Z A;  4GR1 A;  1H7W A;  4LII A;  3COX A;  4EQR A;  3CGD A;  3IF9 A;  4H4Z A;  4GUV A;  2C76 A;  5HY5 A;  3GYI A;  1EL9 A;  1TDF A;  2IVE A;  3CGE A;  3NK1 X;  3Q9T A;  3PVC A;  4RSL A;  3PS9 A;  4C77 A;  1GSN A;  1LV0 A;  2YLS A;  2QA1 A;  2FJD A;  2CVJ A;  1ZOV A;  2YG7 A;  4NWZ A;  1BGN A;  2YM1 A;  3AEF A;  3CND A;  3OZ2 A;  4IA5 A;  3SZ0 A;  3AD7 B;  3UP4 A;  1BGJ A;  1GT8 A;  2VZ2 A;  2XVE A;  1E1L A;  5FMH A;  2GMH A;  3GRS A;  2WDQ A;  5U1O A;  5C2T A;  1DJQ A;  3L1R A;  2C3C A;  3DGZ A;  4B1B A;  3WE0 A;  1OJC A;  1BZL A;  1E1N A;  1Y56 A;  3KLJ A;  3AE4 A;  4REK A;  2NPX A;  3UKL A;  5KRQ A;  1F8S A;  2R0P A;  4YKG A;  3KD9 A;  2C73 A;  2GEW A;  2OAL A;  2WEU A;  4O5U A;  4A65 A;  3DK8 A;  1SEZ A;  1GXF A;  2BCP A;  1GND A;  1Q1W A;  1FL2 A;  4ZCC A;  4Z2R A;  3ICR A;  4B68 A;  1H82 A;  3G5Q A;  3L8K A;  4BJY A;  4YSZ A;  3HYV A;  1H86 A;  3ALM A;  1REO A;  1FEA A;  1YKJ A;  2H88 A;  3P4S A;  4Y4M A;  2UZZ A;  3CNS A;  2B76 A;  4EIQ A;  5M0Z A;  1K0L A;  4JN9 A;  5KOW A;  4DSH A;  2WOV A;  3NH3 X;  2XFO A;  3OC4 A;  2GQW A;  2GRT A;  4GCM A;  3QVP A;  3R9U A;  1Q9I A;  3RHA A;  1D5T A;  3NYE A;  4JNA A;  4AP3 A;  4II2 A;  4TM3 A;  4H4V A;  4H2Q A;  4EM3 A;  3ISH A;  5FS8 A;  1QJD A;  1IJH A;  4H7U A;  3NRN A;  5JCK A;  3CPH G;  3CGB A;  2IVD A;  1FEC A;  4YSX A;  1LVL A;  1OJD A;  2YLR A;  1TYP A;  4XWZ A;  5IQ1 A;  2ACZ A;  2FBW A;  2OLO A;  2BS3 A;  3NYC A;  3RP8 A;  4J34 A;  4CRT A;  3H4K A;  2JKC A;  3IHG A;  5CQF A;  3SYI A;  1MO9 A;  2YG3 A;  3AXB A;  5DBJ A;  5HHF A;  2WOI A;  2GR3 A;  3ADA B;  1Q1R A;  1GTE A;  3EF6 A;  1NAA A;  1TDN A;  2E4G A;  2ZZC A;  3ALL A;  3FPZ A;  4H4S A;  2TPR A;  2OLN A;  1XHC A;  1HYU A;  3SX6 A;  3UKF A;  3CN8 A;  3O0H A;  4Y4N A;  2GB0 A;  1D4C A;  2VRL A;  3VR8 A;  5J60 A;  1ZMD A;  1K4Q A;  4E0V A;  4K5S A;  5L46 A;  4BUR A;  1VG0 A;  3CNP A;  4ICY A;  2XCG A;  1GOS A;  4OPD A;  3GRT A;  4A7A A;  5U25 A;  4AOS A;  1B5Q A;  3KPK A;  3F8R A;  3QJ4 A;  3DK9 A;  1PBE A;  2WPC A;  2R46 A;  2YG5 A;  2QCU A;  3AED A;  2BC0 A;  3SY4 A;  1D4E A;  1F8R A;  3AE7 A;  3K7Q X;  1JNZ A;  1ELI A;  3P1W A;  3I6D A;  2XLS A;  1JEH A;  1IUW A;  3DJG X;  2BRA A;  4U8M A;  4DGK A;  3CGC A;  3NIX A;  4USQ A;  2XYO A;  2EQ8 A;  2J3N A;  2F5Z A;  4H2R A;  3AE6 A;  4LA1 A;  2VVM A;  2CFY A;  4CCQ A;  3LB8 A;  1O95 A;  2OAM A;  2V3A A;  4WX1 A;  2I0Z A;  3GWD A;  4K22 A;  4UP3 A;  3T2Y A;  3I3L A;  3C4A A;  2VRM A;  3UKP A;  3UKK A;  4YTP A;  4GAP A;  4JDR A;  4U8O A;  5EB5 A;  4C3Y A;  4CY8 A;  2QAE A;  2XLP A;  1GES A;  4BK1 A;  3M13 A;  2BK4 A;  3D8X A;  4OPI A;  4YWO A;  3AE1 A;  2RGJ A;  2QA2 A;  1ZP0 A;  4GAV A;  1PDH A;  5HYM A;  1VRQ B;  3SM8 A;  1CC2 A;  2BAB A;  3NNE A;  2VQ7 A;  5GRT A;  4J2W A;  3AEC A;  4X9M A;  4XXG A;  2PYX A;  1CJC A;  4LU6 A;  4EM4 A;  2BK3 A;  4A6N A;  2AAQ A;  3SFE A;  5HXI A;  3PO7 A;  4B63 A;  1PJ6 A;  3SZF A;  1GRF A;  4NEW A;  4XWR A;  4A5L A;  1Y56 B;  1NHR A;  2WPE A;  1K0J A;  3ATQ A;  1S2Y A;  4RG3 A;  2JBV A;  4U8I A;  2V61 A;  3QFB A;  3CPI G;  2GMJ A;  2Y6R A;  1E1M A;  4TLX A;  3T31 A;  3UTF A;  3DJE A;  3GWF A;  2YM2 A;  2ZBW A;  1NPX A;  3AEE A;  4AT0 A;  1DXL A;  4D03 A;  2GH5 A;  3LOV A;  4U8N A;  4B69 A;  3H8I A;  1D7L A;  4J33 A;  1CBO A;  3GMB A;  2C75 A;  4Z2U A;  5JCI A;  2WQY A;  2C64 A;  4CCR A;  3RNM A;  4TM0 A;  3UKQ A;  4ZN0 A;  5M10 A;  2C3D A;  4K7Z A;  1KNP A;  3F8D A;  4IVO B;  4A9W A;  3DJD A;  2XVJ A;  3UTG A;  1H81 A;  1CJ3 A;  4G6G A;  2CDU A;  2GR2 A;  4K2X A;  1NDA A;  2R9Z A;  3T0K A;  4OVI A;  3SZW A;  2A89 A;  5ER0 A;  3AE8 A;  4G6H A;  2JB3 A;  1FOH A;  3NHO X;  1GRB A;  3NTD A;  4MJW A;  3DK4 A;  3CMM A;  2GAG B;  3DJJ A;  1LQT A;  4N9X A;  5BUK A;  3NN6 X;  2C72 A;  2VQB A;  1TDK A;  4H4R A;  4YKF A;  5LV9 A;  3KPF A;  2C7G A;  2ARD A;  4UDQ A;  1KDG A;  2JB1 A;  1M6I A;  4EMW A;  2VVL A;  2Y6Q A;  3NK0 X;  3B6D A;  3V3N A;  2YVG A;  3AE3 A;  5JCM A;  4GRT A;  1DOB A;  2X8G A;  3BHK A;  2B9W A;  2Q0L A;  3UTH A;  4D04 A;  2C67 A;  4ADW A;  2GR0 A;  3AB1 A;  1Y0P A;  2WP9 A;  1GRG A;  1YQ3 A;  1GRE A;  2XFP A;  3GDP A;  4CY6 A;  2YQU A;  3SZC A;  1PBF A;  3H8L A;  4NZH A;  4B65 A;  2YVF A;  5KOX A;  3NN0 X;  4CNJ A;  1E1K A;  1NHS A;  2YWL A;  3BI5 A;  4H4P A;  1W4X A;  2BC1 A;  3LZX A;  3UOZ A;  4EQW A;  5KNL A;  4P9S A;  3GMC A;  3NG7 X;  4JY3 A;  4JNQ A;  3EAO A;  3AE9 A;  3P4Q A;  4AOX A;  1P2E A;  5KMS A;  1DOE A;  4YXD A;  2WPF A;  3QFA A;  4IA6 A;  4H2P A;  1AOG A;  3QVR A;  2YR4 A;  1JRX A;  2OA1 A;  3AEB A;  1O5W A;  3II4 A;  1IUT A;  3ITJ A;  1BKW A;  5EBK A;  4X9N A;  1YQZ A;  4KPR A;  1H84 A;  1LTX R;  3EPT A;  5KMR A;  2A8X A;  1LPF A;  2Q7V A;  2ZZ0 A;  3AYJ A;  1S3E A;  4OPT A;  1ZOY A;  2TMD A;  2WP6 A;  3M12 A;  3KVE A;  1S3B A;  2YR5 A;  4X4J A;  3AD9 B;  4OCG A;  5KXJ A;  1PJ7 A;  1TRB A;  4OPG A;  3CIR A;  3GD3 A;  3UKH A;  4H2N A;  1QLB A;  3V3O A;  2XDO A;  3UCL A;  1JOA A;  2WDV A;  2X8C A;  2Z5Y A;  3DME A;  5TR3 A;  4Z26 A;  3VQR A;  2XFQ A;  3SGL A;  3IC9 A;  2E1M A;  3GYJ A;  2BAC A;  1N4W A;  1CC6 A;  2B9X A;  4NNJ A;  4CBQ A;  1X31 B;  2WES A;  3Q6J A;  1XPQ A;  2R0G A;  1EBD A;  3AEG A;  1KNR A;  5GSN A;  2A87 A;  3T14 A;  1PN0 A;  1KSU A;  1V59 A;  1YY5 A;  1ZMC A;  3K30 A;  2FJB A;  4EQS A;  4C3X A;  1M64 A;  4A6N B;  2WP5 A;  3UOX A;  2BRY A;  3AE2 A;  4ECH A;  4EIP A;  3AYI A;  3T37 A;  2Q0K A;  2FJE A;  5KWF A;  5FS9 A;  4Z24 A;  4B64 A;  4U2L A;  1EL5 A;  2BCG G;  2B7S A;  2YLW A;  4I59 A;  4UDR A;  1JRY A;  2X8H A;  3UP5 A;  4GF7 A;  3C4N A;  1DOD A;  3QSS A;  1NEK A;  2XLR A;  2XLU A;  4YTN A;  2R4E A;  2XVF A;  3URH A;  4EQX A;  2V60 A;  4NTE A;  4Y4L A;  2C65 A;  1L9E A;  5KVI A;  1F3P A;  3B3R A;  2BA9 A;  5JCN A;  3NYF A;  1MOK A;  2RGO A;  2XLT A;  2BXR A;  4Z25 A;  2C66 A;  2E5V A;  2APG A;  2B7R A;  3T2K A;  1FCD A;  4NEV A;  3BHF A;  3K7T A;  3UTE A;  3ATR A;  3HZL A;  1PXB A;  3GSI A;  4C5O A;  5BVA A;  1DNC A;  1ZY8 A;  4H4X A;  1N4V A;  2DKI A;  3FG2 P;  1PBB A;  2AQJ A;  2AR8 A;  3NLC A;  1GEU A;  1F8W A;  2BXS A;  2RAB A;  5U63 A;  3SQP A;  4EMI A;  2WHD A;  3S5W A;  4YSH A;  1IUU A;  3RED A;  1TDO A;  1L0V A;  1CJ2 A;  5IPY A;  1GAL A;  1JRZ A;  1EL8 A;  4EMJ A;  3SXI A;  3AEA A;  4BK3 A;  1PXC A;  2R4J A;  3NTA A;  3QSM A;  3SFD A;  4DNA A;  1IUS A;  1GER A;  3HYX A;  3GYX A;  2YG4 A;  4HB9 A;  3LAD A;  4AT2 A;  3AD8 B;  3RP7 A;  4PAA A;  3DGH A;  1CL0 A;  2XVI A;  1KFY A;  2V3B A;  3ABV A;  2GF3 A;  3UOY A;  2DKH A;  2WBA A;  4AP1 A;  3CTY A;  1OJA A;  2X50 A;  4M52 A;  1OJ9 A;  2FJA A;  2WDR A;  1NG4 A;  3KA7 A;  4K5R A;  4H4U A;  1ZDL A;  2X99 A;  4H4W A;  1JU2 A;  1PBD A;  2GQF A;  2WU5 A;  1MXT A;  3HYW A;  4JY2 A;  4BK2 A;  2XFN A;  3GDN A;  1H83 A;  4G9K A;  3VRB A;  4TLZ A;  1D7Y A;  4BJZ A;  3ALJ A;  1IUV A;  2BS2 A;  4G74 A;  4UDP A;  1RSG A;  4TM1 A;  4HA6 A;  4U8K A;  3NK2 X;  4RG4 A;  4J56 A;  4IVM B;  3V76 A;  1CJ4 A;  4CNK A;  2BYB A;  2XFU A;  2YLX A;  4FK1 C;  4Z44 A;  1ONF A;  1NHP A;  1N1P A;  1BWC A;  1CHU A;  3K7M X;  4IV9 A;  3NT6 A;  5BUL A;  5KMP A;  2YG6 A;  2JAE A;  4U2T A;  2JK6 A;  1GV4 A;  3ZDN A;  2HQM A;  1UKV G;  4H4T A;  1ZKQ A;  3DH9 A;  5CKU A;  5J7X A;  4J36 A;  1JNR A;  2V5Z A;  4KX6 A;  5JCL A;  4J57 A;  3UKA A;  3CNJ A;  1TYT A;  2EQ7 A;  4J31 A;  1GPE A;  3UOV A;  1K0I A;  3IWA A;  5C3J A;  1VDC A;  4YT0 A;  4I58 A;  1PJ5 A;  3NKS A;  3M0O A;  1N4U A;  2VOU A;  3ICS A;  2B9Y A;  2EQ6 A;  1YQ4 A;  4C74 A;  1KF6 A;  3BNM A;  2XVH A;  3DA1 A;  2BK5 A;  4NTD A;  1H7X A;  4U8P A;  2YVJ A;  4GDP A;  1NHQ A;  2H89 A;  2IID A;  1LJ1 A;  1OJT A;  1RYI A;  3CPJ G;  4OPU A;  4YTM A;  4BV6 A;  2EQ9 A;  3BNU A;  3GD4 A;  1PBC A;  5KVH A;  1KSS A;  1E6E A;  2GV8 A;  4G73 A;  3BI4 A;  3QSE A;  1L9D A;  2YLZ A;  1ZX9 A;  3KKJ A;  4H4Q A;  1E39 A;  4A99 A;  2CUL A;  3AWI A;  3F8P A;  3KU9 A;  1NEN A;  4NTC A;  1QO8 A;  1RP0 A;  2C4C A;  4JQ9 A;  4U8J A;  3ICT A;  2YLT A;  3AYL A;  3LXD A;  1ZK7 A;  3LZW A;  4II3 A;  1DOC A;  4A79 A;  1PHH A;  4DSG A;  4Z43 A;  2WU2 A;  1XDI A;  4FK1 A;  1DJN A;  2NVK X;  4PAB A;  3S61 A;  4B66 A;  5KMQ A;  2GVC A;  2V6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...