5KMRA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 3.0 angstrom resolution.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
total genus 112
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmrA00
3SZCA 3T2KA 3T2ZA 3T2YA 4G73A 3T14A 3SXIA 3SZWA 3HYXA 3SZ0A 3T31A 3HYWA 3KPKA 4NWZA 5KMQA 3SY4A 3T0KA 3SX6A 5KMPA 4G6GA 4GAVA 3SZFA 5KMRA 4GAPA 5KMSA 4G6HA 3HYVA 4G74A 4G9KA 3SYIA
chains in the Genus database with same CATH superfamily
2C7GA 2ZZ0A 2FBWA 1PBDA 1QO8A 2WEUA 4EIPA 5JCMA 4CRTA 1N1PA 1XPQA 2FJAA 3SXIA 1M6IA 1MXTA 3GYIA 1CL0A 1ZX9A 2BYBA 1YKJA 3P4PA 4YSYA 4Z2RA 2WOWA 3BHFA 3I3LA 3LXDA 3RP6A 4A7AA 1L0VA 1LVLA 2TPRA 3DK9A 1ONFA 2YVFA 2YQUA 3ADAB 3FG2P 4OPIA 1GT8A 4I58A 2VZ2A 5IQ1A 2F5ZA 3UKAA 4CY6A 4A5LA 1LQUA 2OLNA 1K0IA 1PDHA 1Q1RA 2QA2A 2X8GA 2WU5A 3CNSA 1E1MA 4YTNA 4CNJA 2GR3A 2AR8A 2BABA 2CFYA 1CC6A 1P2EA 2WDQA 3ATQA 3HYVA 5KVHA 3EF6A 2FJEA 3VR9A 1Z6LA 4JDRA 2XLUA 3KVEA 4KPRA 2BCPA 2OLOA 4NNJA 3SZCA 4CNKA 3AXBA 5EBKA 4YTMA 1GETA 3T14A 2B76A 2VVLA 4NTEA 5U1OA 1KDGA 3NK2X 1ZOVA 3UCLA 1GXFA 3T31A 3Q9TA 3UKFA 4U2TA 3UOZA 4UDRA 3EPTA 2GRTA 3F8PA 4Z26A 2A8XA 1GTHA 1NHQA 1ZY8A 4IA6A 3DK4A 3SX6A 1UKVG 3NN0X 5CKUA 3UTEA 1PXCA 1IUTA 3C4AA 2XFQA 4H2PA 2V61A 2ZZCA 2CDUA 3AE7A 5U25A 3VR8A 3GDNA 2QA1A 5KMRA 3UKQA 1LQTA 1OJDA 2GB0A 2VVLG 3DK8A 5FS6A 5J7XA 1DXLA 1D7LA 3DGZA 4WX1A 1RSGA 4C74A 1KF6A 3HZLA 3UP4A 5C2TA 1PBFA 2YM1A 1F3PA 1K0JA 4G73A 5LV9A 2OAMA 3CPJG 1Y56B 2AQJA 1DOCA 3QFAA 3QSEA 3UTGA 2XLSA 2GV8A 2VRLA 4H4YA 3M13A 2Q0KA 4NWZA 5KMQA 1BGNA 4OPCA 4Z25A 3ICTA 5JCIA 2Y6RA 4RSLA 2C64A 1OJTA 3UTFA 4U8KA 3NIXA 2C65A 4DSHA 4N9XA 2Q0LA 3DJDA 1SEZA 3BI4A 4OPLA 3KPFA 5FS7A 3UKPA 3AE5A 4A79A 4B69A 2UZZA 2A87A 1VQWA 1VDCA 2EQ6A 2I0ZA 2IIDA 3ALJA 2RABA 2JB2A 2A89A 2BS4A 1B4VA 1TDKA 3SGLA 1H7WA 3T2ZA 4HA6A 4GCMA 1F8SA 3HYXA 2GEWA 3P9UA 2GQWA 3REDA 1XANA 2C70A 2IVDA 5KVIA 4BK1A 2Y6QA 3QJ4A 5KOXA 2BXRA 1B5QA 2YLSA 3CN8A 3H8IA 1TDOA 4UDQA 1LJ1A 3UKHA 1D7YA 1TDFA 1YY5A 3FIMB 1PJ7A 1ZK7A 2ARDA 1JEHA 4ICYA 2JB1A 1H7XA 2WDRA 4EQRA 5TR3A 4RG3A 3KA7A 3P1WA 1DJQA 4B66A 5C3JA 1H6VA 5FS8A 4EMWA 3DA1A 3AYIA 4TLZA 1K0LA 3LADA 2XLRA 4TM3A 3GD4A 4U8NA 2DKHA 1OJCA 1N4WA 3AECA 4JY2A 3WE0A 5KWFA 4BK2A 4YWOA 4B68A 4H2RA 1H81A 1Y0PA 3ITJA 5EB4A 1S3BA 4IV9A 1B37A 1E1KA 1BZLA 4O5UA 2B7SA 1GRHA 3GWDA 4U8LA 4OPGA 4P9SA 4AT0A 4C5OA 4GF7A 2VOUA 3V3OA 3II4A 4D03A 3E1TA 3VRAA 5KNLA 1PN0A 1NG3A 4Z44A 1F8WA 1LTXR 1S2QA 2JKCA 2HQMA 3DH9A 2WHDA 4PAAA 3GD3A 5GRTA 3IHGA 1H84A 4U8IA 2NPXA 1PBCA 4J57A 1BWCA 3AB1A 3NHOX 3LZXA 2V6OA 2YLZA 2C73A 1BF3A 4BJYA 4EM3A 2APGA 1GRBA 1MO9A 2X50A 3NGCX 1M64A 3Q6JA 2B9XA 1YQZA 4B67A 2XDOA 3AE9A 4GDPA 3AEEA 2BXSA 4G6HA 4C3XA 3G5SA 3BNUA 3FPZA 2BRAA 2BA9A 3KU9A 1E1LA 3CNDA 3CPIG 3G5RA 1VG0A 1PS9A 1PBEA 3NYFA 1IUSA 4YT0A 3AD7B 4GDEA 4YSXA 2BK5A 1ZP0A 2Q7VA 5KRQA 4H4UA 4KX6A 4CY8A 4EIQA 3G5QA 1FOHA 1PJ6A 4J34A 3AE1A 5EB5A 4EMIA 3CNTA 4Z24A 2WU2A 3ICRA 5CQFA 2ACZA 4X9NA 2FJDA 2X3NA 3AE8A 3NH3X 1H83A 3AD9B 3GDPA 4H4PA 3AEDA 3D1CA 1CHUA 2YG4A 4EQWA 2GR0A 2Z5YA 3K30A 1NPXA 2C67A 1P2HA 5FMHA 3QVRA 1B8SA 4Y4MA 1ZDLA 1V59A 1ZMDA 4U8OA 2XVJA 3NN6X 4AOXA 3EAOA 3UKKA 1N4VA 3QSMA 4K2XA 3K7TA 3ALLA 4RG4A 1GPEA 3QFBA 1GV4A 2R0PA 1EL7A 1NENA 2GH5A 1NHRA 3SZWA 4ECHA 3CMMA 2J3NA 3AE6A 2YLWA 3FBSA 4H4VA 2XCGA 1H86A 2GR2A 2R0GA 2WETA 3ABVA 1KSUA 4NEVA 4YTPA 3SFEA 1CC2A 1RP0A 2WDVA 2WQYA 3KD9A 4ZCDA 3ZYXA 4Y4LA 3ATRA 4BJZA 4Y4NA 4J31A 3AEBA 1PHHA 2EQ8A 2XVEA 2GR1A 2H88A 2CULA 4LIIA 4CCQA 2XVFA 4JQ9A 4UP3A 5FS9A 4H4TA 4BV6A 1O95A 2YG7A 4H4SA 1BKWA 4TM1A 5M10A 5HHFA 1FCDA 5JCNA 3D8XA 4NEWA 3QSSA 4EQXA 2XVIA 1QLBA 4A65A 1PXBA 3GRSA 4O5QA 4GR1A 2EQ9A 1KFYA 3IC9A 4B63A 4B65A 3CNPA 4FX9A 5IQ4A 1LV0A 1DODA 1IUUA 3HYWA 1TDNA 1F6MA 4I59A 1E7PA 3IHMA 2JK6A 2R4JA 2C4CA 3GWFA 4NZHA 2XFUA 4EMJA 2YLTA 1X31B 2R4EA 3AE3A 5KMPA 3ICSA 4WCTA 3NT6A 1O94A 1DOBA 3KLJA 4FDCB 4K5SA 1JNRA 2VRMA 4X9MA 1ZMCA 4G74A 1VRQB 3RP8A 2WP9A 2OALA 2XVHA 3FMWA 1HYUA 2ZZBA 2TMDA 4D04A 3AEGA 4IA5A 2GF3A 4AOSA 2WP5A 1JOAA 2WPEA 5U63A 2H89A 2PHHA 5GSNA 5KXJA 3ALMA 1E1NA 3PO7A 4TM0A 3I6DA 3LJPA 1D5TA 2QCUA 3GYXA 2YLXA 1JNZA 2GQFA 1GRFA 4A99A 2BS3A 1EL9A 4YKGA 4ZN0A 2X99A 1Q1WA 3NNEA 5JCKA 3H4KA 4IVOB 3F8RA 1ZKQA 4GUVA 4OPDA 5KMSA 2O9ZA 1GOSA 3BNMA 3C4NA 3M0OA 1Q9IA 3V76A 4G9KA 1CJCA 1AOGA 2YVJA 2VQ7A 3RP7A 2WESA 5KOWA 4FK1C 3OZ2A 1KNPA 2JAEA 1NHPA 4K7ZA 4IVMB 1GESA 1EL5A 1ZOYA 2YAUA 3NK1X 2YWLA 4NTDA 3UP5A 2YVGA 3F8DA 4TLXA 4X4JA 4FK1A 3SM8A 2V60A 1XHCA 2NVKX 4U8PA 1N4UA 2YLRA 3IF9A 1IUXA 4DNAA 2BC1A 2GAHB 1NAAA 1D4EA 1VG9A 4CBQA 1CJ3A 3PS9A 3LZWA 4K8DA 3NYEA 1W4XA 2BK3A 4G6GA 5HXIA 2WOIA 2XLPA 4GAPA 4ZCCA 4Z2TA 5IPYA 3CGEA 1EBDA 1MOKA 2FJBA 2V3AA 4XWRA 1GERA 1GEUA 1PXAA 4U8MA 3C96A 3LOVA 2XFNA 3NKSA 1L9EA 3NK0X 3NYCA 4CCRA 2YR5A 1QJDA 3URHA 3VRDB 3RNMA 1L9DA 4A6NA 1JRYA 4A6NB 4AP1A 2R9ZA 5DBJA 3SZ0A 3CGCA 3CNJA 4H2NA 3VRBA 2C72A 1S3EA 4C3YA 2EQ7A 4AP3A 3AWIA 1KSSA 3AE2A 2X8CA 3O0HA 1JRXA 4HB9A 3RHAA 1IUWA 3AYLA 4B1BA 4U2SA 3CGDA 1EL8A 3OC4A 3R9UA 1K4QA 1S2YA 1IJHA 4GAVA 1E6EA 3KKJA 2YG3A 4LA1A 4H4XA 1OJ9A 2DKIA 2OA1A 3M12A 4UDPA 2B7RA 1FECA 1GALA 2GMHA 4PABA 3CPHG 1NG4A 4XXGA 2B9WA 2BCGG 3SYIA 4TM4A 2BS2A 4REKA 1DOEA 2Q6UA 3P4SA 4LU6A 4BURA 2XLTA 3NTDA 4JN9A 1ELIA 4XWZA 1O5WA 4ADWA 4II3A 1TRBA 2E4GA 2YG5A 5BRTA 4YXDA 4YSZA 1LPFA 2CVJA 3L1RA 4U8JA 1CJ2A 2ZBWA 3V3NA 4K22A 4JY3A 1DJNA 3AEFA 3SY4A 1GNDA 4J2WA 3B3RA 4OPUA 3S5WA 3L8KA 4A9WA 1DNCA 1COYA 1NHSA 1NDAA 2YG6A 1GRAA 1RYIA 4USRA 3ZDNA 4Z43A 4GRTA 3GRTA 4JNAA 4DGKA 2V3BA 3DJGX 2WOVA 4NTCA 1H82A 2B9YA 2R46A 3GYJA 3UOVA 1CJ4A 3BI5A 4DSGA 4EQSA 1L9CA 1TDEA 2WP6A 4OCGA 4AT2A 3GSIA 3P4RA 3UTHA 3T2YA 1IUVA 1Y56A 2RGHA 2W0HA 2C66A 3P4QA 3SQPA 1CF3A 1JU2A 3EANA 2PYXA 4BK3A 1YQ4A 3BHKA 4B64A 2BACA 5EOWA 4E0VA 4JNQA 3CGBA 1YQ3A 5L46A 3T0KA 3QVPA 3K7QX 2Z5XA 2XYOA 1D4DA 1GREA 3UOYA 3IWAA 5ER0A 4Z2UA 3GMBA 1FL2A 3SZFA 4II2A 1NEKA 5BVAA 5BUKA 2YM2A 2BRYA 1KNRA 3SFDA 1TYPA 2RGOA 3AYJA 4H50A 2C75A 3ISHA 5M0ZA 4YSHA 1E39A 1CC4A 4OPTA 4C77A 2WPFA 2JB3A 2C76A 3DJEA 3AEAA 2YR6A 2WBAA 3T2KA 3UKLA 3NTAA 4K5RA 3B6DA 3CIRA 1GTEA 2C3DA 3COXA 3DMEA 4J56A 1CBOA 2WPCA 1FEBA 3GMCA 1XDIA 4H4ZA 3VQRA 3PVCA 4APNA 2E1MA 3NLCA 4USQA 3DJJA 3JSKA 2AAQA 3CTYA 3AD8B 4MJWA 2X8HA 1D4CA 2C3CA 5BULA 3DGHA 2GAGB 4U2LA 5J60A 1TYTA 5JCLA 2JBVA 2VQBA 4H4RA 3T37A 3LB8A 4H4WA 3AE4A 4J33A 5HY5A 1PJ5A 3NG7X 4EM4A 2RGJA 2R0CA 2E5VA 1FEAA 3BI2A 2WS3A 2V5ZA 4M52A 1PBBA 2YR4A 3KPKA 3NRNA 2GMJA 4H2QA 1GRTA 1REOA 4H4QA 1BGJA 4YKFA 1JRZA 2IVEA 3H8LA 2XFPA 4J36A 2R45A 2BC0A 1GSNA 1GRGA 2VVMA 2XFOA 3S61A 5HYMA 3K7MX 2BK4A 2GVCA 2QAEA 4OVIA 1F8RA 4H7UA 1OJAA 3UOXA
chains in the Genus database with same CATH topology
2C7GA 2ZZ0A 2FBWA 1PBDA 1QO8A 2WEUA 4EIPA 5JCMA 4CRTA 1N1PA 1XPQA 2FJAA 3SXIA 1M6IA 1MXTA 3GYIA 1CL0A 1ZX9A 2BYBA 1YKJA 3P4PA 4YSYA 4Z2RA 2WOWA 3BHFA 3I3LA 3LXDA 3RP6A 4A7AA 1L0VA 1LVLA 2TPRA 3DK9A 1ONFA 2YVFA 2YQUA 3ADAB 3FG2P 4OPIA 1GT8A 4I58A 2VZ2A 5IQ1A 2F5ZA 3UKAA 4CY6A 4A5LA 1LQUA 2OLNA 1K0IA 1PDHA 1Q1RA 2QA2A 2X8GA 2WU5A 3CNSA 1E1MA 4YTNA 4CNJA 2GR3A 2AR8A 2BABA 2CFYA 1CC6A 1P2EA 2WDQA 3ATQA 3HYVA 5KVHA 3EF6A 2FJEA 3VR9A 1Z6LA 4JDRA 2XLUA 3KVEA 4KPRA 2BCPA 2OLOA 4NNJA 3SZCA 4CNKA 3AXBA 5EBKA 4YTMA 1GETA 3T14A 2B76A 2VVLA 4NTEA 5U1OA 1KDGA 3NK2X 1ZOVA 3UCLA 1GXFA 3T31A 3Q9TA 3UKFA 4U2TA 3UOZA 4UDRA 3EPTA 2GRTA 3F8PA 4Z26A 2A8XA 1GTHA 1NHQA 1ZY8A 4IA6A 3DK4A 3SX6A 1UKVG 3NN0X 5CKUA 3UTEA 1PXCA 1IUTA 3C4AA 2XFQA 4H2PA 2V61A 2ZZCA 2CDUA 3AE7A 5U25A 3VR8A 3GDNA 2QA1A 5KMRA 3UKQA 1LQTA 1OJDA 2GB0A 2VVLG 3DK8A 5FS6A 5J7XA 1DXLA 1D7LA 3DGZA 4WX1A 1RSGA 4C74A 1KF6A 3HZLA 3UP4A 5C2TA 1PBFA 2YM1A 1F3PA 1K0JA 4G73A 5LV9A 2OAMA 3CPJG 1Y56B 2AQJA 1DOCA 3QFAA 3QSEA 3UTGA 2XLSA 2GV8A 2VRLA 4H4YA 3M13A 2Q0KA 4NWZA 5KMQA 1BGNA 4OPCA 4Z25A 3ICTA 5JCIA 2Y6RA 4RSLA 2C64A 1OJTA 3UTFA 4U8KA 3NIXA 2C65A 4DSHA 4N9XA 2Q0LA 3DJDA 1SEZA 3BI4A 4OPLA 3KPFA 5FS7A 3UKPA 3AE5A 4A79A 4B69A 2UZZA 2A87A 1VQWA 1VDCA 2EQ6A 2I0ZA 2IIDA 3ALJA 2RABA 2JB2A 2A89A 2BS4A 1B4VA 1TDKA 3SGLA 1H7WA 3T2ZA 4HA6A 4GCMA 1F8SA 3HYXA 2GEWA 3P9UA 2GQWA 3REDA 1XANA 2C70A 2IVDA 5KVIA 4BK1A 2Y6QA 3QJ4A 5KOXA 2BXRA 1B5QA 2YLSA 3CN8A 3H8IA 1TDOA 4UDQA 1LJ1A 3UKHA 1D7YA 1TDFA 1YY5A 3FIMB 1PJ7A 1ZK7A 2ARDA 1JEHA 4ICYA 2JB1A 1H7XA 2WDRA 4EQRA 5TR3A 4RG3A 3KA7A 3P1WA 1DJQA 4B66A 5C3JA 1H6VA 5FS8A 4EMWA 3DA1A 3AYIA 4TLZA 1K0LA 3LADA 2XLRA 4TM3A 3GD4A 4U8NA 2DKHA 1OJCA 1N4WA 3AECA 4JY2A 3WE0A 5KWFA 4BK2A 4YWOA 4B68A 4H2RA 1H81A 1Y0PA 3ITJA 5EB4A 1S3BA 4IV9A 1B37A 1E1KA 1BZLA 4O5UA 2B7SA 1GRHA 3GWDA 4U8LA 4OPGA 4P9SA 4AT0A 4C5OA 4GF7A 2VOUA 3V3OA 3II4A 4D03A 3E1TA 3VRAA 5KNLA 1PN0A 1NG3A 4Z44A 1F8WA 1LTXR 1S2QA 2JKCA 2HQMA 3DH9A 2WHDA 4PAAA 3GD3A 5GRTA 3IHGA 1H84A 4U8IA 2NPXA 1PBCA 4J57A 1BWCA 3AB1A 3NHOX 3LZXA 2V6OA 2YLZA 2C73A 1BF3A 4BJYA 4EM3A 2APGA 1GRBA 1MO9A 2X50A 3NGCX 1M64A 3Q6JA 2B9XA 1YQZA 4B67A 2XDOA 3AE9A 4GDPA 3AEEA 2BXSA 4G6HA 4C3XA 3G5SA 3BNUA 3FPZA 2BRAA 2BA9A 3KU9A 1E1LA 3CNDA 3CPIG 3G5RA 1VG0A 1PS9A 1PBEA 3NYFA 1IUSA 4YT0A 3AD7B 4GDEA 4YSXA 2BK5A 1ZP0A 2Q7VA 5KRQA 4H4UA 4KX6A 4CY8A 4EIQA 3G5QA 1FOHA 1PJ6A 4J34A 3AE1A 5EB5A 4EMIA 3CNTA 4Z24A 2WU2A 3ICRA 5CQFA 2ACZA 4X9NA 2FJDA 2X3NA 3AE8A 3NH3X 1H83A 3AD9B 3GDPA 4H4PA 3AEDA 3D1CA 1CHUA 2YG4A 4EQWA 2GR0A 2Z5YA 3K30A 1NPXA 2C67A 1P2HA 5FMHA 3QVRA 1B8SA 4Y4MA 1ZDLA 1V59A 1ZMDA 4U8OA 2XVJA 3NN6X 4AOXA 3EAOA 3UKKA 1N4VA 3QSMA 4K2XA 3K7TA 3ALLA 4RG4A 1GPEA 3QFBA 1GV4A 2R0PA 1EL7A 1NENA 2GH5A 1NHRA 3SZWA 4ECHA 3CMMA 2J3NA 3AE6A 2YLWA 3FBSA 4H4VA 2XCGA 1H86A 2GR2A 2R0GA 2WETA 3ABVA 1KSUA 4NEVA 4YTPA 3SFEA 1CC2A 1RP0A 2WDVA 2WQYA 3KD9A 4ZCDA 3ZYXA 4Y4LA 3ATRA 4BJZA 4Y4NA 4J31A 3AEBA 1PHHA 2EQ8A 2XVEA 2GR1A 2H88A 2CULA 4LIIA 4CCQA 2XVFA 4JQ9A 4UP3A 5FS9A 4H4TA 4BV6A 1O95A 2YG7A 4H4SA 1BKWA 4TM1A 5M10A 5HHFA 1FCDA 5JCNA 3D8XA 4NEWA 3QSSA 4EQXA 2XVIA 1QLBA 4A65A 1PXBA 3GRSA 4O5QA 4GR1A 2EQ9A 1KFYA 3IC9A 4B63A 4B65A 3CNPA 4FX9A 5IQ4A 1LV0A 1DODA 1IUUA 3HYWA 1TDNA 1F6MA 4I59A 1E7PA 3IHMA 2JK6A 2R4JA 2C4CA 3GWFA 4NZHA 2XFUA 4EMJA 2YLTA 1X31B 2R4EA 3AE3A 5KMPA 3ICSA 4WCTA 3NT6A 1O94A 1DOBA 3KLJA 4FDCB 4K5SA 1JNRA 2VRMA 4X9MA 1ZMCA 4G74A 1VRQB 3RP8A 2WP9A 2OALA 2XVHA 3FMWA 1HYUA 2ZZBA 2TMDA 4D04A 3AEGA 4IA5A 2GF3A 4AOSA 2WP5A 1JOAA 2WPEA 5U63A 2H89A 2PHHA 5GSNA 5KXJA 3ALMA 1E1NA 3PO7A 4TM0A 3I6DA 3LJPA 1D5TA 2QCUA 3GYXA 2YLXA 1JNZA 2GQFA 1GRFA 4A99A 2BS3A 1EL9A 4YKGA 4ZN0A 2X99A 1Q1WA 3NNEA 5JCKA 3H4KA 4IVOB 3F8RA 1ZKQA 4GUVA 4OPDA 5KMSA 2O9ZA 1GOSA 3BNMA 3C4NA 3M0OA 1Q9IA 3V76A 4G9KA 1CJCA 1AOGA 2YVJA 2VQ7A 3RP7A 2WESA 5KOWA 4FK1C 3OZ2A 1KNPA 2JAEA 1NHPA 4K7ZA 4IVMB 1GESA 1EL5A 1ZOYA 2YAUA 3NK1X 2YWLA 4NTDA 3UP5A 2YVGA 3F8DA 4TLXA 4X4JA 4FK1A 3SM8A 2V60A 1XHCA 2NVKX 4U8PA 1N4UA 2YLRA 3IF9A 1IUXA 4DNAA 2BC1A 2GAHB 1NAAA 1D4EA 1VG9A 4CBQA 1CJ3A 3PS9A 3LZWA 4K8DA 3NYEA 1W4XA 2BK3A 4G6GA 5HXIA 2WOIA 2XLPA 4GAPA 4ZCCA 4Z2TA 5IPYA 3CGEA 1EBDA 1MOKA 2FJBA 2V3AA 4XWRA 1GERA 1GEUA 1PXAA 4U8MA 3C96A 3LOVA 2XFNA 3NKSA 1L9EA 3NK0X 3NYCA 4CCRA 2YR5A 1QJDA 3URHA 3VRDB 3RNMA 1L9DA 4A6NA 1JRYA 4A6NB 4AP1A 2R9ZA 5DBJA 3SZ0A 3CGCA 3CNJA 4H2NA 3VRBA 2C72A 1S3EA 4C3YA 2EQ7A 4AP3A 3AWIA 1KSSA 3AE2A 2X8CA 3O0HA 1JRXA 4HB9A 3RHAA 1IUWA 3AYLA 4B1BA 4U2SA 3CGDA 1EL8A 3OC4A 3R9UA 1K4QA 1S2YA 1IJHA 4GAVA 1E6EA 3KKJA 2YG3A 4LA1A 4H4XA 1OJ9A 2DKIA 2OA1A 3M12A 4UDPA 2B7RA 1FECA 1GALA 2GMHA 4PABA 3CPHG 1NG4A 4XXGA 2B9WA 2BCGG 3SYIA 4TM4A 2BS2A 4REKA 1DOEA 2Q6UA 3P4SA 4LU6A 4BURA 2XLTA 3NTDA 4JN9A 1ELIA 4XWZA 1O5WA 4ADWA 4II3A 1TRBA 2E4GA 2YG5A 5BRTA 4YXDA 4YSZA 1LPFA 2CVJA 3L1RA 4U8JA 1CJ2A 2ZBWA 3V3NA 4K22A 4JY3A 1DJNA 3AEFA 3SY4A 1GNDA 4J2WA 3B3RA 4OPUA 3S5WA 3L8KA 4A9WA 1DNCA 1COYA 1NHSA 1NDAA 2YG6A 1GRAA 1RYIA 4USRA 3ZDNA 4Z43A 4GRTA 3GRTA 4JNAA 4DGKA 2V3BA 3DJGX 2WOVA 4NTCA 1H82A 2B9YA 2R46A 3GYJA 3UOVA 1CJ4A 3BI5A 4DSGA 4EQSA 1L9CA 1TDEA 2WP6A 4OCGA 4AT2A 3GSIA 3P4RA 3UTHA 3T2YA 1IUVA 1Y56A 2RGHA 2W0HA 2C66A 3P4QA 3SQPA 1CF3A 1JU2A 3EANA 2PYXA 4BK3A 1YQ4A 3BHKA 4B64A 2BACA 5EOWA 4E0VA 4JNQA 3CGBA 1YQ3A 5L46A 3T0KA 3QVPA 3K7QX 2Z5XA 2XYOA 1D4DA 1GREA 3UOYA 3IWAA 5ER0A 4Z2UA 3GMBA 1FL2A 3SZFA 4II2A 1NEKA 5BVAA 5BUKA 2YM2A 2BRYA 1KNRA 3SFDA 1TYPA 2RGOA 3AYJA 4H50A 2C75A 3ISHA 5M0ZA 4YSHA 1E39A 1CC4A 4OPTA 4C77A 2WPFA 2JB3A 2C76A 3DJEA 3AEAA 2YR6A 2WBAA 3T2KA 3UKLA 3NTAA 4K5RA 3B6DA 3CIRA 1GTEA 2C3DA 3COXA 3DMEA 4J56A 1CBOA 2WPCA 1FEBA 3GMCA 1XDIA 4H4ZA 3VQRA 3PVCA 4APNA 2E1MA 3NLCA 4USQA 3DJJA 3JSKA 2AAQA 3CTYA 3AD8B 4MJWA 2X8HA 1D4CA 2C3CA 5BULA 3DGHA 2GAGB 4U2LA 5J60A 1TYTA 5JCLA 2JBVA 2VQBA 4H4RA 3T37A 3LB8A 4H4WA 3AE4A 4J33A 5HY5A 1PJ5A 3NG7X 4EM4A 2RGJA 2R0CA 2E5VA 1FEAA 3BI2A 2WS3A 2V5ZA 4M52A 1PBBA 2YR4A 3KPKA 3NRNA 2GMJA 4H2QA 1GRTA 1REOA 4H4QA 1BGJA 4YKFA 1JRZA 2IVEA 3H8LA 2XFPA 4J36A 2R45A 2BC0A 1GSNA 1GRGA 2VVMA 2XFOA 3S61A 5HYMA 3K7MX 2BK4A 2GVCA 2QAEA 4OVIA 1F8RA 4H7UA 1OJAA 3UOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZC A;  3T2K A;  3T2Z A;  3T2Y A;  4G73 A;  3T14 A;  3SXI A;  3SZW A;  3HYX A;  3SZ0 A;  3T31 A;  3HYW A;  3KPK A;  4NWZ A;  5KMQ A;  3SY4 A;  3T0K A;  3SX6 A;  5KMP A;  4G6G A;  4GAV A;  3SZF A;  5KMR A;  4GAP A;  5KMS A;  4G6H A;  3HYV A;  4G74 A;  4G9K A;  3SYI A; 
#chains in the Genus database with same CATH topology
 2C7G A;  2ZZ0 A;  2FBW A;  1PBD A;  1QO8 A;  2WEU A;  4EIP A;  5JCM A;  4CRT A;  1N1P A;  1XPQ A;  2FJA A;  3SXI A;  1M6I A;  1MXT A;  3GYI A;  1CL0 A;  1ZX9 A;  2BYB A;  1YKJ A;  3P4P A;  4YSY A;  4Z2R A;  2WOW A;  3BHF A;  3I3L A;  3LXD A;  3RP6 A;  4A7A A;  1L0V A;  1LVL A;  2TPR A;  3DK9 A;  1ONF A;  2YVF A;  2YQU A;  3ADA B;  3FG2 P;  4OPI A;  1GT8 A;  4I58 A;  2VZ2 A;  5IQ1 A;  2F5Z A;  3UKA A;  4CY6 A;  4A5L A;  1LQU A;  2OLN A;  1K0I A;  1PDH A;  1Q1R A;  2QA2 A;  2X8G A;  2WU5 A;  3CNS A;  1E1M A;  4YTN A;  4CNJ A;  2GR3 A;  2AR8 A;  2BAB A;  2CFY A;  1CC6 A;  1P2E A;  2WDQ A;  3ATQ A;  3HYV A;  5KVH A;  3EF6 A;  2FJE A;  3VR9 A;  1Z6L A;  4JDR A;  2XLU A;  3KVE A;  4KPR A;  2BCP A;  2OLO A;  4NNJ A;  3SZC A;  4CNK A;  3AXB A;  5EBK A;  4YTM A;  1GET A;  3T14 A;  2B76 A;  2VVL A;  4NTE A;  5U1O A;  1KDG A;  3NK2 X;  1ZOV A;  3UCL A;  1GXF A;  3T31 A;  3Q9T A;  3UKF A;  4U2T A;  3UOZ A;  4UDR A;  3EPT A;  2GRT A;  3F8P A;  4Z26 A;  2A8X A;  1GTH A;  1NHQ A;  1ZY8 A;  4IA6 A;  3DK4 A;  3SX6 A;  1UKV G;  3NN0 X;  5CKU A;  3UTE A;  1PXC A;  1IUT A;  3C4A A;  2XFQ A;  4H2P A;  2V61 A;  2ZZC A;  2CDU A;  3AE7 A;  5U25 A;  3VR8 A;  3GDN A;  2QA1 A;  5KMR A;  3UKQ A;  1LQT A;  1OJD A;  2GB0 A;  2VVL G;  3DK8 A;  5FS6 A;  5J7X A;  1DXL A;  1D7L A;  3DGZ A;  4WX1 A;  1RSG A;  4C74 A;  1KF6 A;  3HZL A;  3UP4 A;  5C2T A;  1PBF A;  2YM1 A;  1F3P A;  1K0J A;  4G73 A;  5LV9 A;  2OAM A;  3CPJ G;  1Y56 B;  2AQJ A;  1DOC A;  3QFA A;  3QSE A;  3UTG A;  2XLS A;  2GV8 A;  2VRL A;  4H4Y A;  3M13 A;  2Q0K A;  4NWZ A;  5KMQ A;  1BGN A;  4OPC A;  4Z25 A;  3ICT A;  5JCI A;  2Y6R A;  4RSL A;  2C64 A;  1OJT A;  3UTF A;  4U8K A;  3NIX A;  2C65 A;  4DSH A;  4N9X A;  2Q0L A;  3DJD A;  1SEZ A;  3BI4 A;  4OPL A;  3KPF A;  5FS7 A;  3UKP A;  3AE5 A;  4A79 A;  4B69 A;  2UZZ A;  2A87 A;  1VQW A;  1VDC A;  2EQ6 A;  2I0Z A;  2IID A;  3ALJ A;  2RAB A;  2JB2 A;  2A89 A;  2BS4 A;  1B4V A;  1TDK A;  3SGL A;  1H7W A;  3T2Z A;  4HA6 A;  4GCM A;  1F8S A;  3HYX A;  2GEW A;  3P9U A;  2GQW A;  3RED A;  1XAN A;  2C70 A;  2IVD A;  5KVI A;  4BK1 A;  2Y6Q A;  3QJ4 A;  5KOX A;  2BXR A;  1B5Q A;  2YLS A;  3CN8 A;  3H8I A;  1TDO A;  4UDQ A;  1LJ1 A;  3UKH A;  1D7Y A;  1TDF A;  1YY5 A;  3FIM B;  1PJ7 A;  1ZK7 A;  2ARD A;  1JEH A;  4ICY A;  2JB1 A;  1H7X A;  2WDR A;  4EQR A;  5TR3 A;  4RG3 A;  3KA7 A;  3P1W A;  1DJQ A;  4B66 A;  5C3J A;  1H6V A;  5FS8 A;  4EMW A;  3DA1 A;  3AYI A;  4TLZ A;  1K0L A;  3LAD A;  2XLR A;  4TM3 A;  3GD4 A;  4U8N A;  2DKH A;  1OJC A;  1N4W A;  3AEC A;  4JY2 A;  3WE0 A;  5KWF A;  4BK2 A;  4YWO A;  4B68 A;  4H2R A;  1H81 A;  1Y0P A;  3ITJ A;  5EB4 A;  1S3B A;  4IV9 A;  1B37 A;  1E1K A;  1BZL A;  4O5U A;  2B7S A;  1GRH A;  3GWD A;  4U8L A;  4OPG A;  4P9S A;  4AT0 A;  4C5O A;  4GF7 A;  2VOU A;  3V3O A;  3II4 A;  4D03 A;  3E1T A;  3VRA A;  5KNL A;  1PN0 A;  1NG3 A;  4Z44 A;  1F8W A;  1LTX R;  1S2Q A;  2JKC A;  2HQM A;  3DH9 A;  2WHD A;  4PAA A;  3GD3 A;  5GRT A;  3IHG A;  1H84 A;  4U8I A;  2NPX A;  1PBC A;  4J57 A;  1BWC A;  3AB1 A;  3NHO X;  3LZX A;  2V6O A;  2YLZ A;  2C73 A;  1BF3 A;  4BJY A;  4EM3 A;  2APG A;  1GRB A;  1MO9 A;  2X50 A;  3NGC X;  1M64 A;  3Q6J A;  2B9X A;  1YQZ A;  4B67 A;  2XDO A;  3AE9 A;  4GDP A;  3AEE A;  2BXS A;  4G6H A;  4C3X A;  3G5S A;  3BNU A;  3FPZ A;  2BRA A;  2BA9 A;  3KU9 A;  1E1L A;  3CND A;  3CPI G;  3G5R A;  1VG0 A;  1PS9 A;  1PBE A;  3NYF A;  1IUS A;  4YT0 A;  3AD7 B;  4GDE A;  4YSX A;  2BK5 A;  1ZP0 A;  2Q7V A;  5KRQ A;  4H4U A;  4KX6 A;  4CY8 A;  4EIQ A;  3G5Q A;  1FOH A;  1PJ6 A;  4J34 A;  3AE1 A;  5EB5 A;  4EMI A;  3CNT A;  4Z24 A;  2WU2 A;  3ICR A;  5CQF A;  2ACZ A;  4X9N A;  2FJD A;  2X3N A;  3AE8 A;  3NH3 X;  1H83 A;  3AD9 B;  3GDP A;  4H4P A;  3AED A;  3D1C A;  1CHU A;  2YG4 A;  4EQW A;  2GR0 A;  2Z5Y A;  3K30 A;  1NPX A;  2C67 A;  1P2H A;  5FMH A;  3QVR A;  1B8S A;  4Y4M A;  1ZDL A;  1V59 A;  1ZMD A;  4U8O A;  2XVJ A;  3NN6 X;  4AOX A;  3EAO A;  3UKK A;  1N4V A;  3QSM A;  4K2X A;  3K7T A;  3ALL A;  4RG4 A;  1GPE A;  3QFB A;  1GV4 A;  2R0P A;  1EL7 A;  1NEN A;  2GH5 A;  1NHR A;  3SZW A;  4ECH A;  3CMM A;  2J3N A;  3AE6 A;  2YLW A;  3FBS A;  4H4V A;  2XCG A;  1H86 A;  2GR2 A;  2R0G A;  2WET A;  3ABV A;  1KSU A;  4NEV A;  4YTP A;  3SFE A;  1CC2 A;  1RP0 A;  2WDV A;  2WQY A;  3KD9 A;  4ZCD A;  3ZYX A;  4Y4L A;  3ATR A;  4BJZ A;  4Y4N A;  4J31 A;  3AEB A;  1PHH A;  2EQ8 A;  2XVE A;  2GR1 A;  2H88 A;  2CUL A;  4LII A;  4CCQ A;  2XVF A;  4JQ9 A;  4UP3 A;  5FS9 A;  4H4T A;  4BV6 A;  1O95 A;  2YG7 A;  4H4S A;  1BKW A;  4TM1 A;  5M10 A;  5HHF A;  1FCD A;  5JCN A;  3D8X A;  4NEW A;  3QSS A;  4EQX A;  2XVI A;  1QLB A;  4A65 A;  1PXB A;  3GRS A;  4O5Q A;  4GR1 A;  2EQ9 A;  1KFY A;  3IC9 A;  4B63 A;  4B65 A;  3CNP A;  4FX9 A;  5IQ4 A;  1LV0 A;  1DOD A;  1IUU A;  3HYW A;  1TDN A;  1F6M A;  4I59 A;  1E7P A;  3IHM A;  2JK6 A;  2R4J A;  2C4C A;  3GWF A;  4NZH A;  2XFU A;  4EMJ A;  2YLT A;  1X31 B;  2R4E A;  3AE3 A;  5KMP A;  3ICS A;  4WCT A;  3NT6 A;  1O94 A;  1DOB A;  3KLJ A;  4FDC B;  4K5S A;  1JNR A;  2VRM A;  4X9M A;  1ZMC A;  4G74 A;  1VRQ B;  3RP8 A;  2WP9 A;  2OAL A;  2XVH A;  3FMW A;  1HYU A;  2ZZB A;  2TMD A;  4D04 A;  3AEG A;  4IA5 A;  2GF3 A;  4AOS A;  2WP5 A;  1JOA A;  2WPE A;  5U63 A;  2H89 A;  2PHH A;  5GSN A;  5KXJ A;  3ALM A;  1E1N A;  3PO7 A;  4TM0 A;  3I6D A;  3LJP A;  1D5T A;  2QCU A;  3GYX A;  2YLX A;  1JNZ A;  2GQF A;  1GRF A;  4A99 A;  2BS3 A;  1EL9 A;  4YKG A;  4ZN0 A;  2X99 A;  1Q1W A;  3NNE A;  5JCK A;  3H4K A;  4IVO B;  3F8R A;  1ZKQ A;  4GUV A;  4OPD A;  5KMS A;  2O9Z A;  1GOS A;  3BNM A;  3C4N A;  3M0O A;  1Q9I A;  3V76 A;  4G9K A;  1CJC A;  1AOG A;  2YVJ A;  2VQ7 A;  3RP7 A;  2WES A;  5KOW A;  4FK1 C;  3OZ2 A;  1KNP A;  2JAE A;  1NHP A;  4K7Z A;  4IVM B;  1GES A;  1EL5 A;  1ZOY A;  2YAU A;  3NK1 X;  2YWL A;  4NTD A;  3UP5 A;  2YVG A;  3F8D A;  4TLX A;  4X4J A;  4FK1 A;  3SM8 A;  2V60 A;  1XHC A;  2NVK X;  4U8P A;  1N4U A;  2YLR A;  3IF9 A;  1IUX A;  4DNA A;  2BC1 A;  2GAH B;  1NAA A;  1D4E A;  1VG9 A;  4CBQ A;  1CJ3 A;  3PS9 A;  3LZW A;  4K8D A;  3NYE A;  1W4X A;  2BK3 A;  4G6G A;  5HXI A;  2WOI A;  2XLP A;  4GAP A;  4ZCC A;  4Z2T A;  5IPY A;  3CGE A;  1EBD A;  1MOK A;  2FJB A;  2V3A A;  4XWR A;  1GER A;  1GEU A;  1PXA A;  4U8M A;  3C96 A;  3LOV A;  2XFN A;  3NKS A;  1L9E A;  3NK0 X;  3NYC A;  4CCR A;  2YR5 A;  1QJD A;  3URH A;  3VRD B;  3RNM A;  1L9D A;  4A6N A;  1JRY A;  4A6N B;  4AP1 A;  2R9Z A;  5DBJ A;  3SZ0 A;  3CGC A;  3CNJ A;  4H2N A;  3VRB A;  2C72 A;  1S3E A;  4C3Y A;  2EQ7 A;  4AP3 A;  3AWI A;  1KSS A;  3AE2 A;  2X8C A;  3O0H A;  1JRX A;  4HB9 A;  3RHA A;  1IUW A;  3AYL A;  4B1B A;  4U2S A;  3CGD A;  1EL8 A;  3OC4 A;  3R9U A;  1K4Q A;  1S2Y A;  1IJH A;  4GAV A;  1E6E A;  3KKJ A;  2YG3 A;  4LA1 A;  4H4X A;  1OJ9 A;  2DKI A;  2OA1 A;  3M12 A;  4UDP A;  2B7R A;  1FEC A;  1GAL A;  2GMH A;  4PAB A;  3CPH G;  1NG4 A;  4XXG A;  2B9W A;  2BCG G;  3SYI A;  4TM4 A;  2BS2 A;  4REK A;  1DOE A;  2Q6U A;  3P4S A;  4LU6 A;  4BUR A;  2XLT A;  3NTD A;  4JN9 A;  1ELI A;  4XWZ A;  1O5W A;  4ADW A;  4II3 A;  1TRB A;  2E4G A;  2YG5 A;  5BRT A;  4YXD A;  4YSZ A;  1LPF A;  2CVJ A;  3L1R A;  4U8J A;  1CJ2 A;  2ZBW A;  3V3N A;  4K22 A;  4JY3 A;  1DJN A;  3AEF A;  3SY4 A;  1GND A;  4J2W A;  3B3R A;  4OPU A;  3S5W A;  3L8K A;  4A9W A;  1DNC A;  1COY A;  1NHS A;  1NDA A;  2YG6 A;  1GRA A;  1RYI A;  4USR A;  3ZDN A;  4Z43 A;  4GRT A;  3GRT A;  4JNA A;  4DGK A;  2V3B A;  3DJG X;  2WOV A;  4NTC A;  1H82 A;  2B9Y A;  2R46 A;  3GYJ A;  3UOV A;  1CJ4 A;  3BI5 A;  4DSG A;  4EQS A;  1L9C A;  1TDE A;  2WP6 A;  4OCG A;  4AT2 A;  3GSI A;  3P4R A;  3UTH A;  3T2Y A;  1IUV A;  1Y56 A;  2RGH A;  2W0H A;  2C66 A;  3P4Q A;  3SQP A;  1CF3 A;  1JU2 A;  3EAN A;  2PYX A;  4BK3 A;  1YQ4 A;  3BHK A;  4B64 A;  2BAC A;  5EOW A;  4E0V A;  4JNQ A;  3CGB A;  1YQ3 A;  5L46 A;  3T0K A;  3QVP A;  3K7Q X;  2Z5X A;  2XYO A;  1D4D A;  1GRE A;  3UOY A;  3IWA A;  5ER0 A;  4Z2U A;  3GMB A;  1FL2 A;  3SZF A;  4II2 A;  1NEK A;  5BVA A;  5BUK A;  2YM2 A;  2BRY A;  1KNR A;  3SFD A;  1TYP A;  2RGO A;  3AYJ A;  4H50 A;  2C75 A;  3ISH A;  5M0Z A;  4YSH A;  1E39 A;  1CC4 A;  4OPT A;  4C77 A;  2WPF A;  2JB3 A;  2C76 A;  3DJE A;  3AEA A;  2YR6 A;  2WBA A;  3T2K A;  3UKL A;  3NTA A;  4K5R A;  3B6D A;  3CIR A;  1GTE A;  2C3D A;  3COX A;  3DME A;  4J56 A;  1CBO A;  2WPC A;  1FEB A;  3GMC A;  1XDI A;  4H4Z A;  3VQR A;  3PVC A;  4APN A;  2E1M A;  3NLC A;  4USQ A;  3DJJ A;  3JSK A;  2AAQ A;  3CTY A;  3AD8 B;  4MJW A;  2X8H A;  1D4C A;  2C3C A;  5BUL A;  3DGH A;  2GAG B;  4U2L A;  5J60 A;  1TYT A;  5JCL A;  2JBV A;  2VQB A;  4H4R A;  3T37 A;  3LB8 A;  4H4W A;  3AE4 A;  4J33 A;  5HY5 A;  1PJ5 A;  3NG7 X;  4EM4 A;  2RGJ A;  2R0C A;  2E5V A;  1FEA A;  3BI2 A;  2WS3 A;  2V5Z A;  4M52 A;  1PBB A;  2YR4 A;  3KPK A;  3NRN A;  2GMJ A;  4H2Q A;  1GRT A;  1REO A;  4H4Q A;  1BGJ A;  4YKF A;  1JRZ A;  2IVE A;  3H8L A;  2XFP A;  4J36 A;  2R45 A;  2BC0 A;  1GSN A;  1GRG A;  2VVM A;  2XFO A;  3S61 A;  5HYM A;  3K7M X;  2BK4 A;  2GVC A;  2QAE A;  4OVI A;  1F8R A;  4H7U A;  1OJA A;  3UOX A; 
#chains in the Genus database with same CATH homology
 2C7G A;  2ZZ0 A;  2FBW A;  1PBD A;  1QO8 A;  2WEU A;  4EIP A;  5JCM A;  4CRT A;  1N1P A;  1XPQ A;  2FJA A;  3SXI A;  1M6I A;  1MXT A;  3GYI A;  1CL0 A;  1ZX9 A;  2BYB A;  1YKJ A;  3P4P A;  4YSY A;  4Z2R A;  2WOW A;  3BHF A;  3I3L A;  3LXD A;  3RP6 A;  4A7A A;  1L0V A;  1LVL A;  2TPR A;  3DK9 A;  1ONF A;  2YVF A;  2YQU A;  3ADA B;  3FG2 P;  4OPI A;  1GT8 A;  4I58 A;  2VZ2 A;  5IQ1 A;  2F5Z A;  3UKA A;  4CY6 A;  4A5L A;  1LQU A;  2OLN A;  1K0I A;  1PDH A;  1Q1R A;  2QA2 A;  2X8G A;  2WU5 A;  3CNS A;  1E1M A;  4YTN A;  4CNJ A;  2GR3 A;  2AR8 A;  2BAB A;  2CFY A;  1CC6 A;  1P2E A;  2WDQ A;  3ATQ A;  3HYV A;  5KVH A;  3EF6 A;  2FJE A;  3VR9 A;  1Z6L A;  4JDR A;  2XLU A;  3KVE A;  4KPR A;  2BCP A;  2OLO A;  4NNJ A;  3SZC A;  4CNK A;  3AXB A;  5EBK A;  4YTM A;  1GET A;  3T14 A;  2B76 A;  2VVL A;  4NTE A;  5U1O A;  1KDG A;  3NK2 X;  1ZOV A;  3UCL A;  1GXF A;  3T31 A;  3Q9T A;  3UKF A;  4U2T A;  3UOZ A;  4UDR A;  3EPT A;  2GRT A;  3F8P A;  4Z26 A;  2A8X A;  1GTH A;  1NHQ A;  1ZY8 A;  4IA6 A;  3DK4 A;  3SX6 A;  1UKV G;  3NN0 X;  5CKU A;  3UTE A;  1PXC A;  1IUT A;  3C4A A;  2XFQ A;  4H2P A;  2V61 A;  2ZZC A;  2CDU A;  3AE7 A;  5U25 A;  3VR8 A;  3GDN A;  2QA1 A;  5KMR A;  3UKQ A;  1LQT A;  1OJD A;  2GB0 A;  2VVL G;  3DK8 A;  5FS6 A;  5J7X A;  1DXL A;  1D7L A;  3DGZ A;  4WX1 A;  1RSG A;  4C74 A;  1KF6 A;  3HZL A;  3UP4 A;  5C2T A;  1PBF A;  2YM1 A;  1F3P A;  1K0J A;  4G73 A;  5LV9 A;  2OAM A;  3CPJ G;  1Y56 B;  2AQJ A;  1DOC A;  3QFA A;  3QSE A;  3UTG A;  2XLS A;  2GV8 A;  2VRL A;  4H4Y A;  3M13 A;  2Q0K A;  4NWZ A;  5KMQ A;  1BGN A;  4OPC A;  4Z25 A;  3ICT A;  5JCI A;  2Y6R A;  4RSL A;  2C64 A;  1OJT A;  3UTF A;  4U8K A;  3NIX A;  2C65 A;  4DSH A;  4N9X A;  2Q0L A;  3DJD A;  1SEZ A;  3BI4 A;  4OPL A;  3KPF A;  5FS7 A;  3UKP A;  3AE5 A;  4A79 A;  4B69 A;  2UZZ A;  2A87 A;  1VQW A;  1VDC A;  2EQ6 A;  2I0Z A;  2IID A;  3ALJ A;  2RAB A;  2JB2 A;  2A89 A;  2BS4 A;  1B4V A;  1TDK A;  3SGL A;  1H7W A;  3T2Z A;  4HA6 A;  4GCM A;  1F8S A;  3HYX A;  2GEW A;  3P9U A;  2GQW A;  3RED A;  1XAN A;  2C70 A;  2IVD A;  5KVI A;  4BK1 A;  2Y6Q A;  3QJ4 A;  5KOX A;  2BXR A;  1B5Q A;  2YLS A;  3CN8 A;  3H8I A;  1TDO A;  4UDQ A;  1LJ1 A;  3UKH A;  1D7Y A;  1TDF A;  1YY5 A;  3FIM B;  1PJ7 A;  1ZK7 A;  2ARD A;  1JEH A;  4ICY A;  2JB1 A;  1H7X A;  2WDR A;  4EQR A;  5TR3 A;  4RG3 A;  3KA7 A;  3P1W A;  1DJQ A;  4B66 A;  5C3J A;  1H6V A;  5FS8 A;  4EMW A;  3DA1 A;  3AYI A;  4TLZ A;  1K0L A;  3LAD A;  2XLR A;  4TM3 A;  3GD4 A;  4U8N A;  2DKH A;  1OJC A;  1N4W A;  3AEC A;  4JY2 A;  3WE0 A;  5KWF A;  4BK2 A;  4YWO A;  4B68 A;  4H2R A;  1H81 A;  1Y0P A;  3ITJ A;  5EB4 A;  1S3B A;  4IV9 A;  1B37 A;  1E1K A;  1BZL A;  4O5U A;  2B7S A;  1GRH A;  3GWD A;  4U8L A;  4OPG A;  4P9S A;  4AT0 A;  4C5O A;  4GF7 A;  2VOU A;  3V3O A;  3II4 A;  4D03 A;  3E1T A;  3VRA A;  5KNL A;  1PN0 A;  1NG3 A;  4Z44 A;  1F8W A;  1LTX R;  1S2Q A;  2JKC A;  2HQM A;  3DH9 A;  2WHD A;  4PAA A;  3GD3 A;  5GRT A;  3IHG A;  1H84 A;  4U8I A;  2NPX A;  1PBC A;  4J57 A;  1BWC A;  3AB1 A;  3NHO X;  3LZX A;  2V6O A;  2YLZ A;  2C73 A;  1BF3 A;  4BJY A;  4EM3 A;  2APG A;  1GRB A;  1MO9 A;  2X50 A;  3NGC X;  1M64 A;  3Q6J A;  2B9X A;  1YQZ A;  4B67 A;  2XDO A;  3AE9 A;  4GDP A;  3AEE A;  2BXS A;  4G6H A;  4C3X A;  3G5S A;  3BNU A;  3FPZ A;  2BRA A;  2BA9 A;  3KU9 A;  1E1L A;  3CND A;  3CPI G;  3G5R A;  1VG0 A;  1PS9 A;  1PBE A;  3NYF A;  1IUS A;  4YT0 A;  3AD7 B;  4GDE A;  4YSX A;  2BK5 A;  1ZP0 A;  2Q7V A;  5KRQ A;  4H4U A;  4KX6 A;  4CY8 A;  4EIQ A;  3G5Q A;  1FOH A;  1PJ6 A;  4J34 A;  3AE1 A;  5EB5 A;  4EMI A;  3CNT A;  4Z24 A;  2WU2 A;  3ICR A;  5CQF A;  2ACZ A;  4X9N A;  2FJD A;  2X3N A;  3AE8 A;  3NH3 X;  1H83 A;  3AD9 B;  3GDP A;  4H4P A;  3AED A;  3D1C A;  1CHU A;  2YG4 A;  4EQW A;  2GR0 A;  2Z5Y A;  3K30 A;  1NPX A;  2C67 A;  1P2H A;  5FMH A;  3QVR A;  1B8S A;  4Y4M A;  1ZDL A;  1V59 A;  1ZMD A;  4U8O A;  2XVJ A;  3NN6 X;  4AOX A;  3EAO A;  3UKK A;  1N4V A;  3QSM A;  4K2X A;  3K7T A;  3ALL A;  4RG4 A;  1GPE A;  3QFB A;  1GV4 A;  2R0P A;  1EL7 A;  1NEN A;  2GH5 A;  1NHR A;  3SZW A;  4ECH A;  3CMM A;  2J3N A;  3AE6 A;  2YLW A;  3FBS A;  4H4V A;  2XCG A;  1H86 A;  2GR2 A;  2R0G A;  2WET A;  3ABV A;  1KSU A;  4NEV A;  4YTP A;  3SFE A;  1CC2 A;  1RP0 A;  2WDV A;  2WQY A;  3KD9 A;  4ZCD A;  3ZYX A;  4Y4L A;  3ATR A;  4BJZ A;  4Y4N A;  4J31 A;  3AEB A;  1PHH A;  2EQ8 A;  2XVE A;  2GR1 A;  2H88 A;  2CUL A;  4LII A;  4CCQ A;  2XVF A;  4JQ9 A;  4UP3 A;  5FS9 A;  4H4T A;  4BV6 A;  1O95 A;  2YG7 A;  4H4S A;  1BKW A;  4TM1 A;  5M10 A;  5HHF A;  1FCD A;  5JCN A;  3D8X A;  4NEW A;  3QSS A;  4EQX A;  2XVI A;  1QLB A;  4A65 A;  1PXB A;  3GRS A;  4O5Q A;  4GR1 A;  2EQ9 A;  1KFY A;  3IC9 A;  4B63 A;  4B65 A;  3CNP A;  4FX9 A;  5IQ4 A;  1LV0 A;  1DOD A;  1IUU A;  3HYW A;  1TDN A;  1F6M A;  4I59 A;  1E7P A;  3IHM A;  2JK6 A;  2R4J A;  2C4C A;  3GWF A;  4NZH A;  2XFU A;  4EMJ A;  2YLT A;  1X31 B;  2R4E A;  3AE3 A;  5KMP A;  3ICS A;  4WCT A;  3NT6 A;  1O94 A;  1DOB A;  3KLJ A;  4FDC B;  4K5S A;  1JNR A;  2VRM A;  4X9M A;  1ZMC A;  4G74 A;  1VRQ B;  3RP8 A;  2WP9 A;  2OAL A;  2XVH A;  3FMW A;  1HYU A;  2ZZB A;  2TMD A;  4D04 A;  3AEG A;  4IA5 A;  2GF3 A;  4AOS A;  2WP5 A;  1JOA A;  2WPE A;  5U63 A;  2H89 A;  2PHH A;  5GSN A;  5KXJ A;  3ALM A;  1E1N A;  3PO7 A;  4TM0 A;  3I6D A;  3LJP A;  1D5T A;  2QCU A;  3GYX A;  2YLX A;  1JNZ A;  2GQF A;  1GRF A;  4A99 A;  2BS3 A;  1EL9 A;  4YKG A;  4ZN0 A;  2X99 A;  1Q1W A;  3NNE A;  5JCK A;  3H4K A;  4IVO B;  3F8R A;  1ZKQ A;  4GUV A;  4OPD A;  5KMS A;  2O9Z A;  1GOS A;  3BNM A;  3C4N A;  3M0O A;  1Q9I A;  3V76 A;  4G9K A;  1CJC A;  1AOG A;  2YVJ A;  2VQ7 A;  3RP7 A;  2WES A;  5KOW A;  4FK1 C;  3OZ2 A;  1KNP A;  2JAE A;  1NHP A;  4K7Z A;  4IVM B;  1GES A;  1EL5 A;  1ZOY A;  2YAU A;  3NK1 X;  2YWL A;  4NTD A;  3UP5 A;  2YVG A;  3F8D A;  4TLX A;  4X4J A;  4FK1 A;  3SM8 A;  2V60 A;  1XHC A;  2NVK X;  4U8P A;  1N4U A;  2YLR A;  3IF9 A;  1IUX A;  4DNA A;  2BC1 A;  2GAH B;  1NAA A;  1D4E A;  1VG9 A;  4CBQ A;  1CJ3 A;  3PS9 A;  3LZW A;  4K8D A;  3NYE A;  1W4X A;  2BK3 A;  4G6G A;  5HXI A;  2WOI A;  2XLP A;  4GAP A;  4ZCC A;  4Z2T A;  5IPY A;  3CGE A;  1EBD A;  1MOK A;  2FJB A;  2V3A A;  4XWR A;  1GER A;  1GEU A;  1PXA A;  4U8M A;  3C96 A;  3LOV A;  2XFN A;  3NKS A;  1L9E A;  3NK0 X;  3NYC A;  4CCR A;  2YR5 A;  1QJD A;  3URH A;  3VRD B;  3RNM A;  1L9D A;  4A6N A;  1JRY A;  4A6N B;  4AP1 A;  2R9Z A;  5DBJ A;  3SZ0 A;  3CGC A;  3CNJ A;  4H2N A;  3VRB A;  2C72 A;  1S3E A;  4C3Y A;  2EQ7 A;  4AP3 A;  3AWI A;  1KSS A;  3AE2 A;  2X8C A;  3O0H A;  1JRX A;  4HB9 A;  3RHA A;  1IUW A;  3AYL A;  4B1B A;  4U2S A;  3CGD A;  1EL8 A;  3OC4 A;  3R9U A;  1K4Q A;  1S2Y A;  1IJH A;  4GAV A;  1E6E A;  3KKJ A;  2YG3 A;  4LA1 A;  4H4X A;  1OJ9 A;  2DKI A;  2OA1 A;  3M12 A;  4UDP A;  2B7R A;  1FEC A;  1GAL A;  2GMH A;  4PAB A;  3CPH G;  1NG4 A;  4XXG A;  2B9W A;  2BCG G;  3SYI A;  4TM4 A;  2BS2 A;  4REK A;  1DOE A;  2Q6U A;  3P4S A;  4LU6 A;  4BUR A;  2XLT A;  3NTD A;  4JN9 A;  1ELI A;  4XWZ A;  1O5W A;  4ADW A;  4II3 A;  1TRB A;  2E4G A;  2YG5 A;  5BRT A;  4YXD A;  4YSZ A;  1LPF A;  2CVJ A;  3L1R A;  4U8J A;  1CJ2 A;  2ZBW A;  3V3N A;  4K22 A;  4JY3 A;  1DJN A;  3AEF A;  3SY4 A;  1GND A;  4J2W A;  3B3R A;  4OPU A;  3S5W A;  3L8K A;  4A9W A;  1DNC A;  1COY A;  1NHS A;  1NDA A;  2YG6 A;  1GRA A;  1RYI A;  4USR A;  3ZDN A;  4Z43 A;  4GRT A;  3GRT A;  4JNA A;  4DGK A;  2V3B A;  3DJG X;  2WOV A;  4NTC A;  1H82 A;  2B9Y A;  2R46 A;  3GYJ A;  3UOV A;  1CJ4 A;  3BI5 A;  4DSG A;  4EQS A;  1L9C A;  1TDE A;  2WP6 A;  4OCG A;  4AT2 A;  3GSI A;  3P4R A;  3UTH A;  3T2Y A;  1IUV A;  1Y56 A;  2RGH A;  2W0H A;  2C66 A;  3P4Q A;  3SQP A;  1CF3 A;  1JU2 A;  3EAN A;  2PYX A;  4BK3 A;  1YQ4 A;  3BHK A;  4B64 A;  2BAC A;  5EOW A;  4E0V A;  4JNQ A;  3CGB A;  1YQ3 A;  5L46 A;  3T0K A;  3QVP A;  3K7Q X;  2Z5X A;  2XYO A;  1D4D A;  1GRE A;  3UOY A;  3IWA A;  5ER0 A;  4Z2U A;  3GMB A;  1FL2 A;  3SZF A;  4II2 A;  1NEK A;  5BVA A;  5BUK A;  2YM2 A;  2BRY A;  1KNR A;  3SFD A;  1TYP A;  2RGO A;  3AYJ A;  4H50 A;  2C75 A;  3ISH A;  5M0Z A;  4YSH A;  1E39 A;  1CC4 A;  4OPT A;  4C77 A;  2WPF A;  2JB3 A;  2C76 A;  3DJE A;  3AEA A;  2YR6 A;  2WBA A;  3T2K A;  3UKL A;  3NTA A;  4K5R A;  3B6D A;  3CIR A;  1GTE A;  2C3D A;  3COX A;  3DME A;  4J56 A;  1CBO A;  2WPC A;  1FEB A;  3GMC A;  1XDI A;  4H4Z A;  3VQR A;  3PVC A;  4APN A;  2E1M A;  3NLC A;  4USQ A;  3DJJ A;  3JSK A;  2AAQ A;  3CTY A;  3AD8 B;  4MJW A;  2X8H A;  1D4C A;  2C3C A;  5BUL A;  3DGH A;  2GAG B;  4U2L A;  5J60 A;  1TYT A;  5JCL A;  2JBV A;  2VQB A;  4H4R A;  3T37 A;  3LB8 A;  4H4W A;  3AE4 A;  4J33 A;  5HY5 A;  1PJ5 A;  3NG7 X;  4EM4 A;  2RGJ A;  2R0C A;  2E5V A;  1FEA A;  3BI2 A;  2WS3 A;  2V5Z A;  4M52 A;  1PBB A;  2YR4 A;  3KPK A;  3NRN A;  2GMJ A;  4H2Q A;  1GRT A;  1REO A;  4H4Q A;  1BGJ A;  4YKF A;  1JRZ A;  2IVE A;  3H8L A;  2XFP A;  4J36 A;  2R45 A;  2BC0 A;  1GSN A;  1GRG A;  2VVM A;  2XFO A;  3S61 A;  5HYM A;  3K7M X;  2BK4 A;  2GVC A;  2QAE A;  4OVI A;  1F8R A;  4H7U A;  1OJA A;  3UOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...