5KMRA

The structure of type ii nadh dehydrogenase from caldalkalibacillus thermarum complexed with nad+ at 3.0 angstrom resolution.
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 112
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmrA00
3KPKA 5KMQA 4G74A 3HYWA 3SZFA 3SZWA 3T14A 3T31A 5KMPA 3SY4A 3SZ0A 5KMSA 3T2YA 3SXIA 4GAVA 4G6GA 3T2ZA 3HYVA 4GAPA 4G6HA 3T0KA 3HYXA 3T2KA 4G9KA 4NWZA 4G73A 3SYIA 3SX6A 5KMRA 3SZCA
chains in the Genus database with same CATH superfamily
1DJNA 3SGLA 1H7XA 3UKQA 1JRYA 3URHA 2IVEA 3RHAA 2YM1A 3UOYA 2NVKX 2B9WA 3M12A 3C4AA 4C3YA 1DOBA 2C64A 2JK6A 1CF3A 1ONFA 3UKPA 4H4ZA 2Q0KA 1IUWA 3AEBA 2BRAA 2VRMA 3CGDA 2GAGB 4REKA 4C77A 5KRQA 4Z2RA 2X8CA 1CJ2A 4O5UA 2E4GA 5FS6A 4CY8A 1SEZA 1TYPA 3DGZA 5BUKA 1QJDA 1CBOA 1CC2A 2UZZA 4GAPA 3LB8A 1LQTA 3T0KA 1DXLA 4II3A 3IHGA 2WBAA 5KVIA 1EL8A 1H7WA 2F5ZA 2XFPA 4K5SA 3AD7B 4AP3A 4Z24A 3DJEA 3CIRA 4IVMB 1GREA 1D5TA 1GT8A 3EAOA 1PHHA 2JKCA 3CNPA 4UDQA 4ADWA 3M13A 4FDCB 3QSSA 1YQ3A 3C4NA 1JU2A 3T31A 1K0JA 1IUVA 1ZY8A 4YSHA 3SY4A 3AEDA 5L46A 3GRTA 4GRTA 4J33A 4LIIA 4OPCA 4YSXA 4E0VA 4AOXA 1NDAA 3LXDA 3LZXA 4ZCCA 4H4TA 3DMEA 2JB3A 1N4VA 3Q9TA 2YQUA 3S61A 1JRZA 2C66A 1GTHA 4USQA 1H84A 2IIDA 2JB1A 4KX6A 3G5QA 5EOWA 3SX6A 4H2RA 4PABA 4EMJA 4K7ZA 4NEVA 2XLUA 4GDPA 2C7GA 4JNQA 4J34A 1Y56B 4TM0A 3II4A 2WPCA 1DNCA 4RG3A 1PJ5A 4JY3A 2Y6QA 3T2YA 4AT0A 2WOIA 4B66A 5KNLA 2EQ6A 3G5SA 2FJEA 4GUVA 2WPEA 3JSKA 4TLXA 1Z6LA 3H4KA 2GQWA 4X9MA 4YT0A 2WDRA 1CJ4A 1PXAA 3HYXA 2BK5A 3BI5A 3UKLA 1REOA 2OLOA 1ZK7A 4FK1A 5ER0A 3QFBA 3KA7A 3SFDA 2R46A 3DA1A 4AOSA 3NHOX 4WCTA 4YXDA 2B9YA 2BXRA 4A6NB 1NENA 3GYIA 3QVPA 5CQFA 4GDEA 1W4XA 5FMHA 2PYXA 1ZX9A 3CMMA 4H4YA 4OPUA 2RGOA 4K22A 2ZZCA 4B69A 4D03A 3V3OA 1VG0A 3RP6A 2WP6A 1GRAA 1EL5A 2I0ZA 3GD4A 3VRAA 2B9XA 1TDOA 3AE8A 1GESA 2VVMA 4Z2TA 3UCLA 4YSYA 4H50A 3UOXA 4P9SA 1Q9IA 3NRNA 3P4PA 1GNDA 5FS8A 1OJDA 1Y0PA 3BI4A 2R0CA 3IWAA 5KOWA 2YVJA 1K0LA 1GTEA 1IJHA 3NKSA 5FS7A 1CJCA 2ZBWA 2BXSA 1XPQA 4U2TA 3UTEA 2JB2A 1RP0A 2WOVA 3DH9A 2WDQA 3COXA 2CULA 2V3AA 2XFQA 4K5RA 3UKFA 2BA9A 2OLNA 4BK3A 5JCKA 3NTDA 2X8HA 1OJ9A 1TDKA 3BHKA 3L1RA 3PVCA 4NEWA 2Z5YA 4TM1A 3K7MX 5FS9A 4H4PA 4JN9A 5TR3A 4OPDA 4H2NA 5EBKA 3NTAA 2GV8A 1GEUA 3H8LA 4JY2A 5IQ1A 4ZN0A 1YQZA 4C3XA 1Q1RA 1YKJA 4BV6A 3NYFA 3ICTA 1X31B 3UP4A 1OJAA 3KKJA 3IF9A 4A65A 3ALJA 2A8XA 2BK4A 1YY5A 3UOVA 3ALMA 2WOWA 3CTYA 3CN8A 2X8GA 5HHFA 4J56A 1N4WA 1E1LA 1XANA 2AR8A 4YTPA 1MXTA 2GR3A 3EANA 3REDA 1BGJA 1H6VA 3BNMA 1IUTA 1PJ7A 4EM3A 4CNJA 2VQ7A 2NPXA 2YR5A 3K30A 4EQWA 2R4JA 4H4VA 5KMSA 1DJQA 2AQJA 3KD9A 1PBEA 1GETA 4GAVA 3DJGX 3C96A 4DSGA 1OJCA 2WEUA 1B5QA 2V5ZA 3ADAB 2XLSA 1PJ6A 3UKHA 1UKVG 2BACA 5CKUA 1TDEA 3AE7A 1B8SA 1Q1WA 2Q7VA 4OPTA 4IV9A 1E7PA 1H86A 4YKGA 1DOCA 3FBSA 5J7XA 2CVJA 1QO8A 2JAEA 1PBFA 2VVLG 2BCPA 4YKFA 1N1PA 5M10A 3NLCA 3H8IA 4U8PA 3AD8B 5BVAA 1E39A 2JBVA 4BJYA 3GYJA 4DSHA 2B7RA 3UKKA 2PHHA 3AECA 1O5WA 3NT6A 3P4SA 4B64A 3P1WA 4XXGA 5EB5A 1KNRA 4K8DA 4NTEA 1GSNA 3AE5A 2WESA 3FMWA 1L9CA 3FIMB 2BK3A 3ITJA 3OZ2A 2DKHA 4U8IA 5C3JA 4EQSA 4DGKA 4C74A 1KSUA 1P2EA 4H4RA 2VOUA 1D7LA 1H83A 1PXCA 1EL7A 4H4UA 2WQYA 2OA1A 1RSGA 2WHDA 1KDGA 4BK1A 4A79A 5KMRA 4EMIA 3G5RA 5U25A 3AD9B 1KNPA 3DGHA 4CY6A 4G74A 1FECA 2TMDA 3NG7X 3SZWA 1GRHA 3DK8A 2XCGA 3T14A 4M52A 3AE1A 1H82A 2VVLA 3KU9A 4GR1A 1IUUA 1KSSA 3T37A 5JCIA 4TLZA 2BS2A 4MJWA 5KXJA 3ICRA 3QSEA 4U8NA 3RP8A 4TM4A 3V3NA 4EIQA 4LA1A 4A5LA 2GEWA 3P4RA 1GRBA 4B1BA 1JNZA 3HYVA 2GR0A 1EL9A 3ATQA 4JDRA 1Y56A 2EQ9A 3AE3A 3T2KA 4EIPA 1JOAA 2GB0A 3AE9A 2YR6A 3PO7A 5IQ4A 5HY5A 1PDHA 1B4VA 5J60A 1NPXA 4Z43A 2E5VA 1F3PA 2OAMA 3NIXA 2WPFA 1QLBA 4IA5A 4H4SA 4NZHA 1TDNA 3QVRA 1GALA 1PN0A 1BF3A 1M6IA 2C76A 4RSLA 4Y4LA 2EQ8A 1S2YA 1F8SA 4N9XA 5EB4A 4H4QA 2EQ7A 2V61A 2A89A 1GRGA 2BS3A 4ICYA 4A6NA 4BURA 1LTXR 1VQWA 2VZ2A 3GRSA 3ALLA 1P2HA 1XDIA 2C3DA 2Z5XA 2A87A 3SQPA 4OPIA 4B67A 1CC4A 4J31A 2ARDA 3NK2X 2C72A 2GMJA 4U8JA 1NEKA 2QAEA 3S5WA 3AEEA 2HQMA 4CCRA 4EM4A 2BYBA 2GVCA 1GRFA 4XWRA 2W0HA 3GD3A 5KMQA 4C5OA 4NTCA 4OVIA 2QA1A 2YLZA 2R0PA 2C75A 5M0ZA 3AE4A 2C70A 4Y4NA 1RYIA 2R0GA 4YTMA 4Z44A 1E1MA 2GRTA 3RP7A 2YM2A 2XVJA 2R45A 3AE2A 4NNJA 4Z26A 3UTFA 1JRXA 2XVEA 3L8KA 4OPGA 1NG4A 2WDVA 4EQXA 2GQFA 4HB9A 4USRA 1ZMCA 2GAHB 4AP1A 3AYJA 2XVFA 1ZP0A 3KLJA 4NWZA 3D8XA 2X99A 2ZZBA 3GWDA 3NNEA 4CRTA 4EQRA 1IUSA 5DBJA 3AB1A 3KPKA 1GXFA 3CPIG 3DJJA 4OCGA 3GYXA 3NK0X 3ABVA 3LADA 3SFEA 2WP5A 2FJDA 2E1MA 1OJTA 4TM3A 1NAAA 2IVDA 3VQRA 3VRDB 4H4XA 4J57A 4H2QA 4KPRA 2XFOA 4LU6A 2XVIA 2XLPA 2GR1A 4U8MA 1GERA 1FCDA 2X50A 2GF3A 4U2LA 2AAQA 3LOVA 4CCQA 5HYMA 3CNSA 1O95A 2GMHA 1D4CA 2V60A 2XLTA 3F8DA 1ZDLA 1E1KA 2XLRA 3NK1X 1L9EA 4O5QA 3CPHG 2B76A 1HYUA 3GMBA 3UTHA 4UP3A 5C2TA 1D4EA 1GOSA 1YQ4A 4CBQA 4YWOA 4X4JA 1CL0A 2YVGA 1S3BA 2ZZ0A 1F8RA 1BGNA 4ECHA 1MOKA 1MO9A 3AEGA 3SZFA 5BRTA 3DJDA 3B3RA 1PBCA 1VDCA 1PBDA 3AEAA 3UOZA 2R9ZA 1CHUA 5JCNA 2XYOA 4FK1C 4H7UA 4U8OA 4YSZA 2WETA 2BS4A 4PAAA 4K2XA 1KFYA 1LV0A 2VQBA 3VR8A 2CDUA 2RABA 1M64A 3IC9A 2YG6A 3QSMA 4B65A 2Q0LA 4G6HA 4I58A 5HXIA 3BI2A 2VRLA 3GMCA 4Z25A 1FL2A 2B7SA 3GWFA 5JCMA 3SYIA 3CNTA 3AYLA 5LV9A 4IVOB 2YAUA 4D04A 3KVEA 2Y6RA 4H4WA 4BJZA 3CPJG 3M0OA 1FEAA 3ISHA 1BZLA 1K0IA 1V59A 3NYCA 4EMWA 4DNAA 1ELIA 2WU5A 3Q6JA 3GDNA 2H88A 5U1OA 3HZLA 3NN0X 2C4CA 4BK2A 2C3CA 1D7YA 1FEBA 2XFUA 3PS9A 1AOGA 1L0VA 2YLRA 2V3BA 3CNDA 3E1TA 5KWFA 4H2PA 1ZOYA 4XWZA 2GH5A 3ATRA 2C65A 4NTDA 1E6EA 3K7TA 4APNA 3DK9A 5IPYA 3I3LA 4G73A 1NHRA 2WS3A 3AEFA 3IHMA 1F8WA 3NGCX 1B37A 1E1NA 1EBDA 1L9DA 3B6DA 3I6DA 4A99A 2C73A 3VRBA 1N4UA 2ACZA 1NG3A 3HYWA 1TDFA 3FG2P 3R9UA 1LJ1A 3P4QA 3FPZA 3O0HA 2RGHA 3CGCA 2BCGG 3VR9A 5JCLA 3D1CA 3GDPA 4JQ9A 1COYA 3EF6A 1VRQB 4B63A 4UDRA 1DODA 3CGBA 4B68A 2YLXA 1H81A 3ZYXA 2XFNA 2QA2A 4CNKA 3NYEA 5U63A 2CFYA 1NHPA 2R4EA 2YLSA 3BNUA 3LZWA 1NHQA 1O94A 1PBBA 3SM8A 4GCMA 2TPRA 1ZOVA 1IUXA 1JNRA 4J36A 1DOEA 4J2WA 2YVFA 2BRYA 4U8LA 1S3EA 2YWLA 1FOHA 1ZMDA 3QJ4A 1CJ3A 3GSIA 2GR2A 5KMPA 1ZKQA 4U8KA 4UDPA 3P9UA 3SXIA 4OPLA 1GRTA 2FJAA 1F6MA 2WP9A 3UKAA 4YTNA 3F8PA 2V6OA 2BC0A 2YLTA 1BKWA 4IA6A 4RG4A 4G6GA 3T2ZA 3ZDNA 5GSNA 4JNAA 3F8RA 1LPFA 3CNJA 3UP5A 1S2QA 4FX9A 3AYIA 3AWIA 1LVLA 1TRBA 1JEHA 2FBWA 2YG7A 2YG4A 2C67A 3LJPA 2H89A 5KOXA 3SZCA 1PXBA 2FJBA 4Z2UA 4GF7A 1GV4A 2YG5A 1XHCA 2O9ZA 3NN6X 2RGJA 1VG9A 3BHFA 1GPEA 4I59A 3UTGA 3WE0A 4HA6A 3AXBA 4X9NA 5GRTA 3SZ0A 1K4QA 2APGA 1PS9A 1TYTA 2OALA 2WU2A 3DK4A 2BABA 4AT2A 2X3NA 1D4DA 1NHSA 2QCUA 4A7AA 2DKIA 3OC4A 3K7QX 5BULA 2Q6UA 5KVHA 2YR4A 2BC1A 4WX1A 3KPFA 4ZCDA 3V76A 3NH3X 3CGEA 3RNMA 1KF6A 3ICSA 2YG3A 2YLWA 2XVHA 4G9KA 4Y4MA 3AE6A 3QFAA 1BWCA 2XDOA 3EPTA 4II2A 1CC6A 4U2SA 4A9WA 1LQUA 2J3NA
chains in the Genus database with same CATH topology
1DJNA 3SGLA 1H7XA 3UKQA 1JRYA 3URHA 2IVEA 3RHAA 2YM1A 3UOYA 2NVKX 2B9WA 3M12A 3C4AA 4C3YA 1DOBA 2C64A 2JK6A 1CF3A 1ONFA 3UKPA 4H4ZA 2Q0KA 1IUWA 3AEBA 2BRAA 2VRMA 3CGDA 2GAGB 4REKA 4C77A 5KRQA 4Z2RA 2X8CA 1CJ2A 4O5UA 2E4GA 5FS6A 4CY8A 1SEZA 1TYPA 3DGZA 5BUKA 1QJDA 1CBOA 1CC2A 2UZZA 4GAPA 3LB8A 1LQTA 3T0KA 1DXLA 4II3A 3IHGA 2WBAA 5KVIA 1EL8A 1H7WA 2F5ZA 2XFPA 4K5SA 3AD7B 4AP3A 4Z24A 3DJEA 3CIRA 4IVMB 1GREA 1D5TA 1GT8A 3EAOA 1PHHA 2JKCA 3CNPA 4UDQA 4ADWA 3M13A 4FDCB 3QSSA 1YQ3A 3C4NA 1JU2A 3T31A 1K0JA 1IUVA 1ZY8A 4YSHA 3SY4A 3AEDA 5L46A 3GRTA 4GRTA 4J33A 4LIIA 4OPCA 4YSXA 4E0VA 4AOXA 1NDAA 3LXDA 3LZXA 4ZCCA 4H4TA 3DMEA 2JB3A 1N4VA 3Q9TA 2YQUA 3S61A 1JRZA 2C66A 1GTHA 4USQA 1H84A 2IIDA 2JB1A 4KX6A 3G5QA 5EOWA 3SX6A 4H2RA 4PABA 4EMJA 4K7ZA 4NEVA 2XLUA 4GDPA 2C7GA 4JNQA 4J34A 1Y56B 4TM0A 3II4A 2WPCA 1DNCA 4RG3A 1PJ5A 4JY3A 2Y6QA 3T2YA 4AT0A 2WOIA 4B66A 5KNLA 2EQ6A 3G5SA 2FJEA 4GUVA 2WPEA 3JSKA 4TLXA 1Z6LA 3H4KA 2GQWA 4X9MA 4YT0A 2WDRA 1CJ4A 1PXAA 3HYXA 2BK5A 3BI5A 3UKLA 1REOA 2OLOA 1ZK7A 4FK1A 5ER0A 3QFBA 3KA7A 3SFDA 2R46A 3DA1A 4AOSA 3NHOX 4WCTA 4YXDA 2B9YA 2BXRA 4A6NB 1NENA 3GYIA 3QVPA 5CQFA 4GDEA 1W4XA 5FMHA 2PYXA 1ZX9A 3CMMA 4H4YA 4OPUA 2RGOA 4K22A 2ZZCA 4B69A 4D03A 3V3OA 1VG0A 3RP6A 2WP6A 1GRAA 1EL5A 2I0ZA 3GD4A 3VRAA 2B9XA 1TDOA 3AE8A 1GESA 2VVMA 4Z2TA 3UCLA 4YSYA 4H50A 3UOXA 4P9SA 1Q9IA 3NRNA 3P4PA 1GNDA 5FS8A 1OJDA 1Y0PA 3BI4A 2R0CA 3IWAA 5KOWA 2YVJA 1K0LA 1GTEA 1IJHA 3NKSA 5FS7A 1CJCA 2ZBWA 2BXSA 1XPQA 4U2TA 3UTEA 2JB2A 1RP0A 2WOVA 3DH9A 2WDQA 3COXA 2CULA 2V3AA 2XFQA 4K5RA 3UKFA 2BA9A 2OLNA 4BK3A 5JCKA 3NTDA 2X8HA 1OJ9A 1TDKA 3BHKA 3L1RA 3PVCA 4NEWA 2Z5YA 4TM1A 3K7MX 5FS9A 4H4PA 4JN9A 5TR3A 4OPDA 4H2NA 5EBKA 3NTAA 2GV8A 1GEUA 3H8LA 4JY2A 5IQ1A 4ZN0A 1YQZA 4C3XA 1Q1RA 1YKJA 4BV6A 3NYFA 3ICTA 1X31B 3UP4A 1OJAA 3KKJA 3IF9A 4A65A 3ALJA 2A8XA 2BK4A 1YY5A 3UOVA 3ALMA 2WOWA 3CTYA 3CN8A 2X8GA 5HHFA 4J56A 1N4WA 1E1LA 1XANA 2AR8A 4YTPA 1MXTA 2GR3A 3EANA 3REDA 1BGJA 1H6VA 3BNMA 1IUTA 1PJ7A 4EM3A 4CNJA 2VQ7A 2NPXA 2YR5A 3K30A 4EQWA 2R4JA 4H4VA 5KMSA 1DJQA 2AQJA 3KD9A 1PBEA 1GETA 4GAVA 3DJGX 3C96A 4DSGA 1OJCA 2WEUA 1B5QA 2V5ZA 3ADAB 2XLSA 1PJ6A 3UKHA 1UKVG 2BACA 5CKUA 1TDEA 3AE7A 1B8SA 1Q1WA 2Q7VA 4OPTA 4IV9A 1E7PA 1H86A 4YKGA 1DOCA 3FBSA 5J7XA 2CVJA 1QO8A 2JAEA 1PBFA 2VVLG 2BCPA 4YKFA 1N1PA 5M10A 3NLCA 3H8IA 4U8PA 3AD8B 5BVAA 1E39A 2JBVA 4BJYA 3GYJA 4DSHA 2B7RA 3UKKA 2PHHA 3AECA 1O5WA 3NT6A 3P4SA 4B64A 3P1WA 4XXGA 5EB5A 1KNRA 4K8DA 4NTEA 1GSNA 3AE5A 2WESA 3FMWA 1L9CA 3FIMB 2BK3A 3ITJA 3OZ2A 2DKHA 4U8IA 5C3JA 4EQSA 4DGKA 4C74A 1KSUA 1P2EA 4H4RA 2VOUA 1D7LA 1H83A 1PXCA 1EL7A 4H4UA 2WQYA 2OA1A 1RSGA 2WHDA 1KDGA 4BK1A 4A79A 5KMRA 4EMIA 3G5RA 5U25A 3AD9B 1KNPA 3DGHA 4CY6A 4G74A 1FECA 2TMDA 3NG7X 3SZWA 1GRHA 3DK8A 2XCGA 3T14A 4M52A 3AE1A 1H82A 2VVLA 3KU9A 4GR1A 1IUUA 1KSSA 3T37A 5JCIA 4TLZA 2BS2A 4MJWA 5KXJA 3ICRA 3QSEA 4U8NA 3RP8A 4TM4A 3V3NA 4EIQA 4LA1A 4A5LA 2GEWA 3P4RA 1GRBA 4B1BA 1JNZA 3HYVA 2GR0A 1EL9A 3ATQA 4JDRA 1Y56A 2EQ9A 3AE3A 3T2KA 4EIPA 1JOAA 2GB0A 3AE9A 2YR6A 3PO7A 5IQ4A 5HY5A 1PDHA 1B4VA 5J60A 1NPXA 4Z43A 2E5VA 1F3PA 2OAMA 3NIXA 2WPFA 1QLBA 4IA5A 4H4SA 4NZHA 1TDNA 3QVRA 1GALA 1PN0A 1BF3A 1M6IA 2C76A 4RSLA 4Y4LA 2EQ8A 1S2YA 1F8SA 4N9XA 5EB4A 4H4QA 2EQ7A 2V61A 2A89A 1GRGA 2BS3A 4ICYA 4A6NA 4BURA 1LTXR 1VQWA 2VZ2A 3GRSA 3ALLA 1P2HA 1XDIA 2C3DA 2Z5XA 2A87A 3SQPA 4OPIA 4B67A 1CC4A 4J31A 2ARDA 3NK2X 2C72A 2GMJA 4U8JA 1NEKA 2QAEA 3S5WA 3AEEA 2HQMA 4CCRA 4EM4A 2BYBA 2GVCA 1GRFA 4XWRA 2W0HA 3GD3A 5KMQA 4C5OA 4NTCA 4OVIA 2QA1A 2YLZA 2R0PA 2C75A 5M0ZA 3AE4A 2C70A 4Y4NA 1RYIA 2R0GA 4YTMA 4Z44A 1E1MA 2GRTA 3RP7A 2YM2A 2XVJA 2R45A 3AE2A 4NNJA 4Z26A 3UTFA 1JRXA 2XVEA 3L8KA 4OPGA 1NG4A 2WDVA 4EQXA 2GQFA 4HB9A 4USRA 1ZMCA 2GAHB 4AP1A 3AYJA 2XVFA 1ZP0A 3KLJA 4NWZA 3D8XA 2X99A 2ZZBA 3GWDA 3NNEA 4CRTA 4EQRA 1IUSA 5DBJA 3AB1A 3KPKA 1GXFA 3CPIG 3DJJA 4OCGA 3GYXA 3NK0X 3ABVA 3LADA 3SFEA 2WP5A 2FJDA 2E1MA 1OJTA 4TM3A 1NAAA 2IVDA 3VQRA 3VRDB 4H4XA 4J57A 4H2QA 4KPRA 2XFOA 4LU6A 2XVIA 2XLPA 2GR1A 4U8MA 1GERA 1FCDA 2X50A 2GF3A 4U2LA 2AAQA 3LOVA 4CCQA 5HYMA 3CNSA 1O95A 2GMHA 1D4CA 2V60A 2XLTA 3F8DA 1ZDLA 1E1KA 2XLRA 3NK1X 1L9EA 4O5QA 3CPHG 2B76A 1HYUA 3GMBA 3UTHA 4UP3A 5C2TA 1D4EA 1GOSA 1YQ4A 4CBQA 4YWOA 4X4JA 1CL0A 2YVGA 1S3BA 2ZZ0A 1F8RA 1BGNA 4ECHA 1MOKA 1MO9A 3AEGA 3SZFA 5BRTA 3DJDA 3B3RA 1PBCA 1VDCA 1PBDA 3AEAA 3UOZA 2R9ZA 1CHUA 5JCNA 2XYOA 4FK1C 4H7UA 4U8OA 4YSZA 2WETA 2BS4A 4PAAA 4K2XA 1KFYA 1LV0A 2VQBA 3VR8A 2CDUA 2RABA 1M64A 3IC9A 2YG6A 3QSMA 4B65A 2Q0LA 4G6HA 4I58A 5HXIA 3BI2A 2VRLA 3GMCA 4Z25A 1FL2A 2B7SA 3GWFA 5JCMA 3SYIA 3CNTA 3AYLA 5LV9A 4IVOB 2YAUA 4D04A 3KVEA 2Y6RA 4H4WA 4BJZA 3CPJG 3M0OA 1FEAA 3ISHA 1BZLA 1K0IA 1V59A 3NYCA 4EMWA 4DNAA 1ELIA 2WU5A 3Q6JA 3GDNA 2H88A 5U1OA 3HZLA 3NN0X 2C4CA 4BK2A 2C3CA 1D7YA 1FEBA 2XFUA 3PS9A 1AOGA 1L0VA 2YLRA 2V3BA 3CNDA 3E1TA 5KWFA 4H2PA 1ZOYA 4XWZA 2GH5A 3ATRA 2C65A 4NTDA 1E6EA 3K7TA 4APNA 3DK9A 5IPYA 3I3LA 4G73A 1NHRA 2WS3A 3AEFA 3IHMA 1F8WA 3NGCX 1B37A 1E1NA 1EBDA 1L9DA 3B6DA 3I6DA 4A99A 2C73A 3VRBA 1N4UA 2ACZA 1NG3A 3HYWA 1TDFA 3FG2P 3R9UA 1LJ1A 3P4QA 3FPZA 3O0HA 2RGHA 3CGCA 2BCGG 3VR9A 5JCLA 3D1CA 3GDPA 4JQ9A 1COYA 3EF6A 1VRQB 4B63A 4UDRA 1DODA 3CGBA 4B68A 2YLXA 1H81A 3ZYXA 2XFNA 2QA2A 4CNKA 3NYEA 5U63A 2CFYA 1NHPA 2R4EA 2YLSA 3BNUA 3LZWA 1NHQA 1O94A 1PBBA 3SM8A 4GCMA 2TPRA 1ZOVA 1IUXA 1JNRA 4J36A 1DOEA 4J2WA 2YVFA 2BRYA 4U8LA 1S3EA 2YWLA 1FOHA 1ZMDA 3QJ4A 1CJ3A 3GSIA 2GR2A 5KMPA 1ZKQA 4U8KA 4UDPA 3P9UA 3SXIA 4OPLA 1GRTA 2FJAA 1F6MA 2WP9A 3UKAA 4YTNA 3F8PA 2V6OA 2BC0A 2YLTA 1BKWA 4IA6A 4RG4A 4G6GA 3T2ZA 3ZDNA 5GSNA 4JNAA 3F8RA 1LPFA 3CNJA 3UP5A 1S2QA 4FX9A 3AYIA 3AWIA 1LVLA 1TRBA 1JEHA 2FBWA 2YG7A 2YG4A 2C67A 3LJPA 2H89A 5KOXA 3SZCA 1PXBA 2FJBA 4Z2UA 4GF7A 1GV4A 2YG5A 1XHCA 2O9ZA 3NN6X 2RGJA 1VG9A 3BHFA 1GPEA 4I59A 3UTGA 3WE0A 4HA6A 3AXBA 4X9NA 5GRTA 3SZ0A 1K4QA 2APGA 1PS9A 1TYTA 2OALA 2WU2A 3DK4A 2BABA 4AT2A 2X3NA 1D4DA 1NHSA 2QCUA 4A7AA 2DKIA 3OC4A 3K7QX 5BULA 2Q6UA 5KVHA 2YR4A 2BC1A 4WX1A 3KPFA 4ZCDA 3V76A 3NH3X 3CGEA 3RNMA 1KF6A 3ICSA 2YG3A 2YLWA 2XVHA 4G9KA 4Y4MA 3AE6A 3QFAA 1BWCA 2XDOA 3EPTA 4II2A 1CC6A 4U2SA 4A9WA 1LQUA 2J3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPK A;  5KMQ A;  4G74 A;  3HYW A;  3SZF A;  3SZW A;  3T14 A;  3T31 A;  5KMP A;  3SY4 A;  3SZ0 A;  5KMS A;  3T2Y A;  3SXI A;  4GAV A;  4G6G A;  3T2Z A;  3HYV A;  4GAP A;  4G6H A;  3T0K A;  3HYX A;  3T2K A;  4G9K A;  4NWZ A;  4G73 A;  3SYI A;  3SX6 A;  5KMR A;  3SZC A; 
#chains in the Genus database with same CATH topology
 1DJN A;  3SGL A;  1H7X A;  3UKQ A;  1JRY A;  3URH A;  2IVE A;  3RHA A;  2YM1 A;  3UOY A;  2NVK X;  2B9W A;  3M12 A;  3C4A A;  4C3Y A;  1DOB A;  2C64 A;  2JK6 A;  1CF3 A;  1ONF A;  3UKP A;  4H4Z A;  2Q0K A;  1IUW A;  3AEB A;  2BRA A;  2VRM A;  3CGD A;  2GAG B;  4REK A;  4C77 A;  5KRQ A;  4Z2R A;  2X8C A;  1CJ2 A;  4O5U A;  2E4G A;  5FS6 A;  4CY8 A;  1SEZ A;  1TYP A;  3DGZ A;  5BUK A;  1QJD A;  1CBO A;  1CC2 A;  2UZZ A;  4GAP A;  3LB8 A;  1LQT A;  3T0K A;  1DXL A;  4II3 A;  3IHG A;  2WBA A;  5KVI A;  1EL8 A;  1H7W A;  2F5Z A;  2XFP A;  4K5S A;  3AD7 B;  4AP3 A;  4Z24 A;  3DJE A;  3CIR A;  4IVM B;  1GRE A;  1D5T A;  1GT8 A;  3EAO A;  1PHH A;  2JKC A;  3CNP A;  4UDQ A;  4ADW A;  3M13 A;  4FDC B;  3QSS A;  1YQ3 A;  3C4N A;  1JU2 A;  3T31 A;  1K0J A;  1IUV A;  1ZY8 A;  4YSH A;  3SY4 A;  3AED A;  5L46 A;  3GRT A;  4GRT A;  4J33 A;  4LII A;  4OPC A;  4YSX A;  4E0V A;  4AOX A;  1NDA A;  3LXD A;  3LZX A;  4ZCC A;  4H4T A;  3DME A;  2JB3 A;  1N4V A;  3Q9T A;  2YQU A;  3S61 A;  1JRZ A;  2C66 A;  1GTH A;  4USQ A;  1H84 A;  2IID A;  2JB1 A;  4KX6 A;  3G5Q A;  5EOW A;  3SX6 A;  4H2R A;  4PAB A;  4EMJ A;  4K7Z A;  4NEV A;  2XLU A;  4GDP A;  2C7G A;  4JNQ A;  4J34 A;  1Y56 B;  4TM0 A;  3II4 A;  2WPC A;  1DNC A;  4RG3 A;  1PJ5 A;  4JY3 A;  2Y6Q A;  3T2Y A;  4AT0 A;  2WOI A;  4B66 A;  5KNL A;  2EQ6 A;  3G5S A;  2FJE A;  4GUV A;  2WPE A;  3JSK A;  4TLX A;  1Z6L A;  3H4K A;  2GQW A;  4X9M A;  4YT0 A;  2WDR A;  1CJ4 A;  1PXA A;  3HYX A;  2BK5 A;  3BI5 A;  3UKL A;  1REO A;  2OLO A;  1ZK7 A;  4FK1 A;  5ER0 A;  3QFB A;  3KA7 A;  3SFD A;  2R46 A;  3DA1 A;  4AOS A;  3NHO X;  4WCT A;  4YXD A;  2B9Y A;  2BXR A;  4A6N B;  1NEN A;  3GYI A;  3QVP A;  5CQF A;  4GDE A;  1W4X A;  5FMH A;  2PYX A;  1ZX9 A;  3CMM A;  4H4Y A;  4OPU A;  2RGO A;  4K22 A;  2ZZC A;  4B69 A;  4D03 A;  3V3O A;  1VG0 A;  3RP6 A;  2WP6 A;  1GRA A;  1EL5 A;  2I0Z A;  3GD4 A;  3VRA A;  2B9X A;  1TDO A;  3AE8 A;  1GES A;  2VVM A;  4Z2T A;  3UCL A;  4YSY A;  4H50 A;  3UOX A;  4P9S A;  1Q9I A;  3NRN A;  3P4P A;  1GND A;  5FS8 A;  1OJD A;  1Y0P A;  3BI4 A;  2R0C A;  3IWA A;  5KOW A;  2YVJ A;  1K0L A;  1GTE A;  1IJH A;  3NKS A;  5FS7 A;  1CJC A;  2ZBW A;  2BXS A;  1XPQ A;  4U2T A;  3UTE A;  2JB2 A;  1RP0 A;  2WOV A;  3DH9 A;  2WDQ A;  3COX A;  2CUL A;  2V3A A;  2XFQ A;  4K5R A;  3UKF A;  2BA9 A;  2OLN A;  4BK3 A;  5JCK A;  3NTD A;  2X8H A;  1OJ9 A;  1TDK A;  3BHK A;  3L1R A;  3PVC A;  4NEW A;  2Z5Y A;  4TM1 A;  3K7M X;  5FS9 A;  4H4P A;  4JN9 A;  5TR3 A;  4OPD A;  4H2N A;  5EBK A;  3NTA A;  2GV8 A;  1GEU A;  3H8L A;  4JY2 A;  5IQ1 A;  4ZN0 A;  1YQZ A;  4C3X A;  1Q1R A;  1YKJ A;  4BV6 A;  3NYF A;  3ICT A;  1X31 B;  3UP4 A;  1OJA A;  3KKJ A;  3IF9 A;  4A65 A;  3ALJ A;  2A8X A;  2BK4 A;  1YY5 A;  3UOV A;  3ALM A;  2WOW A;  3CTY A;  3CN8 A;  2X8G A;  5HHF A;  4J56 A;  1N4W A;  1E1L A;  1XAN A;  2AR8 A;  4YTP A;  1MXT A;  2GR3 A;  3EAN A;  3RED A;  1BGJ A;  1H6V A;  3BNM A;  1IUT A;  1PJ7 A;  4EM3 A;  4CNJ A;  2VQ7 A;  2NPX A;  2YR5 A;  3K30 A;  4EQW A;  2R4J A;  4H4V A;  5KMS A;  1DJQ A;  2AQJ A;  3KD9 A;  1PBE A;  1GET A;  4GAV A;  3DJG X;  3C96 A;  4DSG A;  1OJC A;  2WEU A;  1B5Q A;  2V5Z A;  3ADA B;  2XLS A;  1PJ6 A;  3UKH A;  1UKV G;  2BAC A;  5CKU A;  1TDE A;  3AE7 A;  1B8S A;  1Q1W A;  2Q7V A;  4OPT A;  4IV9 A;  1E7P A;  1H86 A;  4YKG A;  1DOC A;  3FBS A;  5J7X A;  2CVJ A;  1QO8 A;  2JAE A;  1PBF A;  2VVL G;  2BCP A;  4YKF A;  1N1P A;  5M10 A;  3NLC A;  3H8I A;  4U8P A;  3AD8 B;  5BVA A;  1E39 A;  2JBV A;  4BJY A;  3GYJ A;  4DSH A;  2B7R A;  3UKK A;  2PHH A;  3AEC A;  1O5W A;  3NT6 A;  3P4S A;  4B64 A;  3P1W A;  4XXG A;  5EB5 A;  1KNR A;  4K8D A;  4NTE A;  1GSN A;  3AE5 A;  2WES A;  3FMW A;  1L9C A;  3FIM B;  2BK3 A;  3ITJ A;  3OZ2 A;  2DKH A;  4U8I A;  5C3J A;  4EQS A;  4DGK A;  4C74 A;  1KSU A;  1P2E A;  4H4R A;  2VOU A;  1D7L A;  1H83 A;  1PXC A;  1EL7 A;  4H4U A;  2WQY A;  2OA1 A;  1RSG A;  2WHD A;  1KDG A;  4BK1 A;  4A79 A;  5KMR A;  4EMI A;  3G5R A;  5U25 A;  3AD9 B;  1KNP A;  3DGH A;  4CY6 A;  4G74 A;  1FEC A;  2TMD A;  3NG7 X;  3SZW A;  1GRH A;  3DK8 A;  2XCG A;  3T14 A;  4M52 A;  3AE1 A;  1H82 A;  2VVL A;  3KU9 A;  4GR1 A;  1IUU A;  1KSS A;  3T37 A;  5JCI A;  4TLZ A;  2BS2 A;  4MJW A;  5KXJ A;  3ICR A;  3QSE A;  4U8N A;  3RP8 A;  4TM4 A;  3V3N A;  4EIQ A;  4LA1 A;  4A5L A;  2GEW A;  3P4R A;  1GRB A;  4B1B A;  1JNZ A;  3HYV A;  2GR0 A;  1EL9 A;  3ATQ A;  4JDR A;  1Y56 A;  2EQ9 A;  3AE3 A;  3T2K A;  4EIP A;  1JOA A;  2GB0 A;  3AE9 A;  2YR6 A;  3PO7 A;  5IQ4 A;  5HY5 A;  1PDH A;  1B4V A;  5J60 A;  1NPX A;  4Z43 A;  2E5V A;  1F3P A;  2OAM A;  3NIX A;  2WPF A;  1QLB A;  4IA5 A;  4H4S A;  4NZH A;  1TDN A;  3QVR A;  1GAL A;  1PN0 A;  1BF3 A;  1M6I A;  2C76 A;  4RSL A;  4Y4L A;  2EQ8 A;  1S2Y A;  1F8S A;  4N9X A;  5EB4 A;  4H4Q A;  2EQ7 A;  2V61 A;  2A89 A;  1GRG A;  2BS3 A;  4ICY A;  4A6N A;  4BUR A;  1LTX R;  1VQW A;  2VZ2 A;  3GRS A;  3ALL A;  1P2H A;  1XDI A;  2C3D A;  2Z5X A;  2A87 A;  3SQP A;  4OPI A;  4B67 A;  1CC4 A;  4J31 A;  2ARD A;  3NK2 X;  2C72 A;  2GMJ A;  4U8J A;  1NEK A;  2QAE A;  3S5W A;  3AEE A;  2HQM A;  4CCR A;  4EM4 A;  2BYB A;  2GVC A;  1GRF A;  4XWR A;  2W0H A;  3GD3 A;  5KMQ A;  4C5O A;  4NTC A;  4OVI A;  2QA1 A;  2YLZ A;  2R0P A;  2C75 A;  5M0Z A;  3AE4 A;  2C70 A;  4Y4N A;  1RYI A;  2R0G A;  4YTM A;  4Z44 A;  1E1M A;  2GRT A;  3RP7 A;  2YM2 A;  2XVJ A;  2R45 A;  3AE2 A;  4NNJ A;  4Z26 A;  3UTF A;  1JRX A;  2XVE A;  3L8K A;  4OPG A;  1NG4 A;  2WDV A;  4EQX A;  2GQF A;  4HB9 A;  4USR A;  1ZMC A;  2GAH B;  4AP1 A;  3AYJ A;  2XVF A;  1ZP0 A;  3KLJ A;  4NWZ A;  3D8X A;  2X99 A;  2ZZB A;  3GWD A;  3NNE A;  4CRT A;  4EQR A;  1IUS A;  5DBJ A;  3AB1 A;  3KPK A;  1GXF A;  3CPI G;  3DJJ A;  4OCG A;  3GYX A;  3NK0 X;  3ABV A;  3LAD A;  3SFE A;  2WP5 A;  2FJD A;  2E1M A;  1OJT A;  4TM3 A;  1NAA A;  2IVD A;  3VQR A;  3VRD B;  4H4X A;  4J57 A;  4H2Q A;  4KPR A;  2XFO A;  4LU6 A;  2XVI A;  2XLP A;  2GR1 A;  4U8M A;  1GER A;  1FCD A;  2X50 A;  2GF3 A;  4U2L A;  2AAQ A;  3LOV A;  4CCQ A;  5HYM A;  3CNS A;  1O95 A;  2GMH A;  1D4C A;  2V60 A;  2XLT A;  3F8D A;  1ZDL A;  1E1K A;  2XLR A;  3NK1 X;  1L9E A;  4O5Q A;  3CPH G;  2B76 A;  1HYU A;  3GMB A;  3UTH A;  4UP3 A;  5C2T A;  1D4E A;  1GOS A;  1YQ4 A;  4CBQ A;  4YWO A;  4X4J A;  1CL0 A;  2YVG A;  1S3B A;  2ZZ0 A;  1F8R A;  1BGN A;  4ECH A;  1MOK A;  1MO9 A;  3AEG A;  3SZF A;  5BRT A;  3DJD A;  3B3R A;  1PBC A;  1VDC A;  1PBD A;  3AEA A;  3UOZ A;  2R9Z A;  1CHU A;  5JCN A;  2XYO A;  4FK1 C;  4H7U A;  4U8O A;  4YSZ A;  2WET A;  2BS4 A;  4PAA A;  4K2X A;  1KFY A;  1LV0 A;  2VQB A;  3VR8 A;  2CDU A;  2RAB A;  1M64 A;  3IC9 A;  2YG6 A;  3QSM A;  4B65 A;  2Q0L A;  4G6H A;  4I58 A;  5HXI A;  3BI2 A;  2VRL A;  3GMC A;  4Z25 A;  1FL2 A;  2B7S A;  3GWF A;  5JCM A;  3SYI A;  3CNT A;  3AYL A;  5LV9 A;  4IVO B;  2YAU A;  4D04 A;  3KVE A;  2Y6R A;  4H4W A;  4BJZ A;  3CPJ G;  3M0O A;  1FEA A;  3ISH A;  1BZL A;  1K0I A;  1V59 A;  3NYC A;  4EMW A;  4DNA A;  1ELI A;  2WU5 A;  3Q6J A;  3GDN A;  2H88 A;  5U1O A;  3HZL A;  3NN0 X;  2C4C A;  4BK2 A;  2C3C A;  1D7Y A;  1FEB A;  2XFU A;  3PS9 A;  1AOG A;  1L0V A;  2YLR A;  2V3B A;  3CND A;  3E1T A;  5KWF A;  4H2P A;  1ZOY A;  4XWZ A;  2GH5 A;  3ATR A;  2C65 A;  4NTD A;  1E6E A;  3K7T A;  4APN A;  3DK9 A;  5IPY A;  3I3L A;  4G73 A;  1NHR A;  2WS3 A;  3AEF A;  3IHM A;  1F8W A;  3NGC X;  1B37 A;  1E1N A;  1EBD A;  1L9D A;  3B6D A;  3I6D A;  4A99 A;  2C73 A;  3VRB A;  1N4U A;  2ACZ A;  1NG3 A;  3HYW A;  1TDF A;  3FG2 P;  3R9U A;  1LJ1 A;  3P4Q A;  3FPZ A;  3O0H A;  2RGH A;  3CGC A;  2BCG G;  3VR9 A;  5JCL A;  3D1C A;  3GDP A;  4JQ9 A;  1COY A;  3EF6 A;  1VRQ B;  4B63 A;  4UDR A;  1DOD A;  3CGB A;  4B68 A;  2YLX A;  1H81 A;  3ZYX A;  2XFN A;  2QA2 A;  4CNK A;  3NYE A;  5U63 A;  2CFY A;  1NHP A;  2R4E A;  2YLS A;  3BNU A;  3LZW A;  1NHQ A;  1O94 A;  1PBB A;  3SM8 A;  4GCM A;  2TPR A;  1ZOV A;  1IUX A;  1JNR A;  4J36 A;  1DOE A;  4J2W A;  2YVF A;  2BRY A;  4U8L A;  1S3E A;  2YWL A;  1FOH A;  1ZMD A;  3QJ4 A;  1CJ3 A;  3GSI A;  2GR2 A;  5KMP A;  1ZKQ A;  4U8K A;  4UDP A;  3P9U A;  3SXI A;  4OPL A;  1GRT A;  2FJA A;  1F6M A;  2WP9 A;  3UKA A;  4YTN A;  3F8P A;  2V6O A;  2BC0 A;  2YLT A;  1BKW A;  4IA6 A;  4RG4 A;  4G6G A;  3T2Z A;  3ZDN A;  5GSN A;  4JNA A;  3F8R A;  1LPF A;  3CNJ A;  3UP5 A;  1S2Q A;  4FX9 A;  3AYI A;  3AWI A;  1LVL A;  1TRB A;  1JEH A;  2FBW A;  2YG7 A;  2YG4 A;  2C67 A;  3LJP A;  2H89 A;  5KOX A;  3SZC A;  1PXB A;  2FJB A;  4Z2U A;  4GF7 A;  1GV4 A;  2YG5 A;  1XHC A;  2O9Z A;  3NN6 X;  2RGJ A;  1VG9 A;  3BHF A;  1GPE A;  4I59 A;  3UTG A;  3WE0 A;  4HA6 A;  3AXB A;  4X9N A;  5GRT A;  3SZ0 A;  1K4Q A;  2APG A;  1PS9 A;  1TYT A;  2OAL A;  2WU2 A;  3DK4 A;  2BAB A;  4AT2 A;  2X3N A;  1D4D A;  1NHS A;  2QCU A;  4A7A A;  2DKI A;  3OC4 A;  3K7Q X;  5BUL A;  2Q6U A;  5KVH A;  2YR4 A;  2BC1 A;  4WX1 A;  3KPF A;  4ZCD A;  3V76 A;  3NH3 X;  3CGE A;  3RNM A;  1KF6 A;  3ICS A;  2YG3 A;  2YLW A;  2XVH A;  4G9K A;  4Y4M A;  3AE6 A;  3QFA A;  1BWC A;  2XDO A;  3EPT A;  4II2 A;  1CC6 A;  4U2S A;  4A9W A;  1LQU A;  2J3N A; 
#chains in the Genus database with same CATH homology
 1DJN A;  3SGL A;  1H7X A;  3UKQ A;  1JRY A;  3URH A;  2IVE A;  3RHA A;  2YM1 A;  3UOY A;  2NVK X;  2B9W A;  3M12 A;  3C4A A;  4C3Y A;  1DOB A;  2C64 A;  2JK6 A;  1CF3 A;  1ONF A;  3UKP A;  4H4Z A;  2Q0K A;  1IUW A;  3AEB A;  2BRA A;  2VRM A;  3CGD A;  2GAG B;  4REK A;  4C77 A;  5KRQ A;  4Z2R A;  2X8C A;  1CJ2 A;  4O5U A;  2E4G A;  5FS6 A;  4CY8 A;  1SEZ A;  1TYP A;  3DGZ A;  5BUK A;  1QJD A;  1CBO A;  1CC2 A;  2UZZ A;  4GAP A;  3LB8 A;  1LQT A;  3T0K A;  1DXL A;  4II3 A;  3IHG A;  2WBA A;  5KVI A;  1EL8 A;  1H7W A;  2F5Z A;  2XFP A;  4K5S A;  3AD7 B;  4AP3 A;  4Z24 A;  3DJE A;  3CIR A;  4IVM B;  1GRE A;  1D5T A;  1GT8 A;  3EAO A;  1PHH A;  2JKC A;  3CNP A;  4UDQ A;  4ADW A;  3M13 A;  4FDC B;  3QSS A;  1YQ3 A;  3C4N A;  1JU2 A;  3T31 A;  1K0J A;  1IUV A;  1ZY8 A;  4YSH A;  3SY4 A;  3AED A;  5L46 A;  3GRT A;  4GRT A;  4J33 A;  4LII A;  4OPC A;  4YSX A;  4E0V A;  4AOX A;  1NDA A;  3LXD A;  3LZX A;  4ZCC A;  4H4T A;  3DME A;  2JB3 A;  1N4V A;  3Q9T A;  2YQU A;  3S61 A;  1JRZ A;  2C66 A;  1GTH A;  4USQ A;  1H84 A;  2IID A;  2JB1 A;  4KX6 A;  3G5Q A;  5EOW A;  3SX6 A;  4H2R A;  4PAB A;  4EMJ A;  4K7Z A;  4NEV A;  2XLU A;  4GDP A;  2C7G A;  4JNQ A;  4J34 A;  1Y56 B;  4TM0 A;  3II4 A;  2WPC A;  1DNC A;  4RG3 A;  1PJ5 A;  4JY3 A;  2Y6Q A;  3T2Y A;  4AT0 A;  2WOI A;  4B66 A;  5KNL A;  2EQ6 A;  3G5S A;  2FJE A;  4GUV A;  2WPE A;  3JSK A;  4TLX A;  1Z6L A;  3H4K A;  2GQW A;  4X9M A;  4YT0 A;  2WDR A;  1CJ4 A;  1PXA A;  3HYX A;  2BK5 A;  3BI5 A;  3UKL A;  1REO A;  2OLO A;  1ZK7 A;  4FK1 A;  5ER0 A;  3QFB A;  3KA7 A;  3SFD A;  2R46 A;  3DA1 A;  4AOS A;  3NHO X;  4WCT A;  4YXD A;  2B9Y A;  2BXR A;  4A6N B;  1NEN A;  3GYI A;  3QVP A;  5CQF A;  4GDE A;  1W4X A;  5FMH A;  2PYX A;  1ZX9 A;  3CMM A;  4H4Y A;  4OPU A;  2RGO A;  4K22 A;  2ZZC A;  4B69 A;  4D03 A;  3V3O A;  1VG0 A;  3RP6 A;  2WP6 A;  1GRA A;  1EL5 A;  2I0Z A;  3GD4 A;  3VRA A;  2B9X A;  1TDO A;  3AE8 A;  1GES A;  2VVM A;  4Z2T A;  3UCL A;  4YSY A;  4H50 A;  3UOX A;  4P9S A;  1Q9I A;  3NRN A;  3P4P A;  1GND A;  5FS8 A;  1OJD A;  1Y0P A;  3BI4 A;  2R0C A;  3IWA A;  5KOW A;  2YVJ A;  1K0L A;  1GTE A;  1IJH A;  3NKS A;  5FS7 A;  1CJC A;  2ZBW A;  2BXS A;  1XPQ A;  4U2T A;  3UTE A;  2JB2 A;  1RP0 A;  2WOV A;  3DH9 A;  2WDQ A;  3COX A;  2CUL A;  2V3A A;  2XFQ A;  4K5R A;  3UKF A;  2BA9 A;  2OLN A;  4BK3 A;  5JCK A;  3NTD A;  2X8H A;  1OJ9 A;  1TDK A;  3BHK A;  3L1R A;  3PVC A;  4NEW A;  2Z5Y A;  4TM1 A;  3K7M X;  5FS9 A;  4H4P A;  4JN9 A;  5TR3 A;  4OPD A;  4H2N A;  5EBK A;  3NTA A;  2GV8 A;  1GEU A;  3H8L A;  4JY2 A;  5IQ1 A;  4ZN0 A;  1YQZ A;  4C3X A;  1Q1R A;  1YKJ A;  4BV6 A;  3NYF A;  3ICT A;  1X31 B;  3UP4 A;  1OJA A;  3KKJ A;  3IF9 A;  4A65 A;  3ALJ A;  2A8X A;  2BK4 A;  1YY5 A;  3UOV A;  3ALM A;  2WOW A;  3CTY A;  3CN8 A;  2X8G A;  5HHF A;  4J56 A;  1N4W A;  1E1L A;  1XAN A;  2AR8 A;  4YTP A;  1MXT A;  2GR3 A;  3EAN A;  3RED A;  1BGJ A;  1H6V A;  3BNM A;  1IUT A;  1PJ7 A;  4EM3 A;  4CNJ A;  2VQ7 A;  2NPX A;  2YR5 A;  3K30 A;  4EQW A;  2R4J A;  4H4V A;  5KMS A;  1DJQ A;  2AQJ A;  3KD9 A;  1PBE A;  1GET A;  4GAV A;  3DJG X;  3C96 A;  4DSG A;  1OJC A;  2WEU A;  1B5Q A;  2V5Z A;  3ADA B;  2XLS A;  1PJ6 A;  3UKH A;  1UKV G;  2BAC A;  5CKU A;  1TDE A;  3AE7 A;  1B8S A;  1Q1W A;  2Q7V A;  4OPT A;  4IV9 A;  1E7P A;  1H86 A;  4YKG A;  1DOC A;  3FBS A;  5J7X A;  2CVJ A;  1QO8 A;  2JAE A;  1PBF A;  2VVL G;  2BCP A;  4YKF A;  1N1P A;  5M10 A;  3NLC A;  3H8I A;  4U8P A;  3AD8 B;  5BVA A;  1E39 A;  2JBV A;  4BJY A;  3GYJ A;  4DSH A;  2B7R A;  3UKK A;  2PHH A;  3AEC A;  1O5W A;  3NT6 A;  3P4S A;  4B64 A;  3P1W A;  4XXG A;  5EB5 A;  1KNR A;  4K8D A;  4NTE A;  1GSN A;  3AE5 A;  2WES A;  3FMW A;  1L9C A;  3FIM B;  2BK3 A;  3ITJ A;  3OZ2 A;  2DKH A;  4U8I A;  5C3J A;  4EQS A;  4DGK A;  4C74 A;  1KSU A;  1P2E A;  4H4R A;  2VOU A;  1D7L A;  1H83 A;  1PXC A;  1EL7 A;  4H4U A;  2WQY A;  2OA1 A;  1RSG A;  2WHD A;  1KDG A;  4BK1 A;  4A79 A;  5KMR A;  4EMI A;  3G5R A;  5U25 A;  3AD9 B;  1KNP A;  3DGH A;  4CY6 A;  4G74 A;  1FEC A;  2TMD A;  3NG7 X;  3SZW A;  1GRH A;  3DK8 A;  2XCG A;  3T14 A;  4M52 A;  3AE1 A;  1H82 A;  2VVL A;  3KU9 A;  4GR1 A;  1IUU A;  1KSS A;  3T37 A;  5JCI A;  4TLZ A;  2BS2 A;  4MJW A;  5KXJ A;  3ICR A;  3QSE A;  4U8N A;  3RP8 A;  4TM4 A;  3V3N A;  4EIQ A;  4LA1 A;  4A5L A;  2GEW A;  3P4R A;  1GRB A;  4B1B A;  1JNZ A;  3HYV A;  2GR0 A;  1EL9 A;  3ATQ A;  4JDR A;  1Y56 A;  2EQ9 A;  3AE3 A;  3T2K A;  4EIP A;  1JOA A;  2GB0 A;  3AE9 A;  2YR6 A;  3PO7 A;  5IQ4 A;  5HY5 A;  1PDH A;  1B4V A;  5J60 A;  1NPX A;  4Z43 A;  2E5V A;  1F3P A;  2OAM A;  3NIX A;  2WPF A;  1QLB A;  4IA5 A;  4H4S A;  4NZH A;  1TDN A;  3QVR A;  1GAL A;  1PN0 A;  1BF3 A;  1M6I A;  2C76 A;  4RSL A;  4Y4L A;  2EQ8 A;  1S2Y A;  1F8S A;  4N9X A;  5EB4 A;  4H4Q A;  2EQ7 A;  2V61 A;  2A89 A;  1GRG A;  2BS3 A;  4ICY A;  4A6N A;  4BUR A;  1LTX R;  1VQW A;  2VZ2 A;  3GRS A;  3ALL A;  1P2H A;  1XDI A;  2C3D A;  2Z5X A;  2A87 A;  3SQP A;  4OPI A;  4B67 A;  1CC4 A;  4J31 A;  2ARD A;  3NK2 X;  2C72 A;  2GMJ A;  4U8J A;  1NEK A;  2QAE A;  3S5W A;  3AEE A;  2HQM A;  4CCR A;  4EM4 A;  2BYB A;  2GVC A;  1GRF A;  4XWR A;  2W0H A;  3GD3 A;  5KMQ A;  4C5O A;  4NTC A;  4OVI A;  2QA1 A;  2YLZ A;  2R0P A;  2C75 A;  5M0Z A;  3AE4 A;  2C70 A;  4Y4N A;  1RYI A;  2R0G A;  4YTM A;  4Z44 A;  1E1M A;  2GRT A;  3RP7 A;  2YM2 A;  2XVJ A;  2R45 A;  3AE2 A;  4NNJ A;  4Z26 A;  3UTF A;  1JRX A;  2XVE A;  3L8K A;  4OPG A;  1NG4 A;  2WDV A;  4EQX A;  2GQF A;  4HB9 A;  4USR A;  1ZMC A;  2GAH B;  4AP1 A;  3AYJ A;  2XVF A;  1ZP0 A;  3KLJ A;  4NWZ A;  3D8X A;  2X99 A;  2ZZB A;  3GWD A;  3NNE A;  4CRT A;  4EQR A;  1IUS A;  5DBJ A;  3AB1 A;  3KPK A;  1GXF A;  3CPI G;  3DJJ A;  4OCG A;  3GYX A;  3NK0 X;  3ABV A;  3LAD A;  3SFE A;  2WP5 A;  2FJD A;  2E1M A;  1OJT A;  4TM3 A;  1NAA A;  2IVD A;  3VQR A;  3VRD B;  4H4X A;  4J57 A;  4H2Q A;  4KPR A;  2XFO A;  4LU6 A;  2XVI A;  2XLP A;  2GR1 A;  4U8M A;  1GER A;  1FCD A;  2X50 A;  2GF3 A;  4U2L A;  2AAQ A;  3LOV A;  4CCQ A;  5HYM A;  3CNS A;  1O95 A;  2GMH A;  1D4C A;  2V60 A;  2XLT A;  3F8D A;  1ZDL A;  1E1K A;  2XLR A;  3NK1 X;  1L9E A;  4O5Q A;  3CPH G;  2B76 A;  1HYU A;  3GMB A;  3UTH A;  4UP3 A;  5C2T A;  1D4E A;  1GOS A;  1YQ4 A;  4CBQ A;  4YWO A;  4X4J A;  1CL0 A;  2YVG A;  1S3B A;  2ZZ0 A;  1F8R A;  1BGN A;  4ECH A;  1MOK A;  1MO9 A;  3AEG A;  3SZF A;  5BRT A;  3DJD A;  3B3R A;  1PBC A;  1VDC A;  1PBD A;  3AEA A;  3UOZ A;  2R9Z A;  1CHU A;  5JCN A;  2XYO A;  4FK1 C;  4H7U A;  4U8O A;  4YSZ A;  2WET A;  2BS4 A;  4PAA A;  4K2X A;  1KFY A;  1LV0 A;  2VQB A;  3VR8 A;  2CDU A;  2RAB A;  1M64 A;  3IC9 A;  2YG6 A;  3QSM A;  4B65 A;  2Q0L A;  4G6H A;  4I58 A;  5HXI A;  3BI2 A;  2VRL A;  3GMC A;  4Z25 A;  1FL2 A;  2B7S A;  3GWF A;  5JCM A;  3SYI A;  3CNT A;  3AYL A;  5LV9 A;  4IVO B;  2YAU A;  4D04 A;  3KVE A;  2Y6R A;  4H4W A;  4BJZ A;  3CPJ G;  3M0O A;  1FEA A;  3ISH A;  1BZL A;  1K0I A;  1V59 A;  3NYC A;  4EMW A;  4DNA A;  1ELI A;  2WU5 A;  3Q6J A;  3GDN A;  2H88 A;  5U1O A;  3HZL A;  3NN0 X;  2C4C A;  4BK2 A;  2C3C A;  1D7Y A;  1FEB A;  2XFU A;  3PS9 A;  1AOG A;  1L0V A;  2YLR A;  2V3B A;  3CND A;  3E1T A;  5KWF A;  4H2P A;  1ZOY A;  4XWZ A;  2GH5 A;  3ATR A;  2C65 A;  4NTD A;  1E6E A;  3K7T A;  4APN A;  3DK9 A;  5IPY A;  3I3L A;  4G73 A;  1NHR A;  2WS3 A;  3AEF A;  3IHM A;  1F8W A;  3NGC X;  1B37 A;  1E1N A;  1EBD A;  1L9D A;  3B6D A;  3I6D A;  4A99 A;  2C73 A;  3VRB A;  1N4U A;  2ACZ A;  1NG3 A;  3HYW A;  1TDF A;  3FG2 P;  3R9U A;  1LJ1 A;  3P4Q A;  3FPZ A;  3O0H A;  2RGH A;  3CGC A;  2BCG G;  3VR9 A;  5JCL A;  3D1C A;  3GDP A;  4JQ9 A;  1COY A;  3EF6 A;  1VRQ B;  4B63 A;  4UDR A;  1DOD A;  3CGB A;  4B68 A;  2YLX A;  1H81 A;  3ZYX A;  2XFN A;  2QA2 A;  4CNK A;  3NYE A;  5U63 A;  2CFY A;  1NHP A;  2R4E A;  2YLS A;  3BNU A;  3LZW A;  1NHQ A;  1O94 A;  1PBB A;  3SM8 A;  4GCM A;  2TPR A;  1ZOV A;  1IUX A;  1JNR A;  4J36 A;  1DOE A;  4J2W A;  2YVF A;  2BRY A;  4U8L A;  1S3E A;  2YWL A;  1FOH A;  1ZMD A;  3QJ4 A;  1CJ3 A;  3GSI A;  2GR2 A;  5KMP A;  1ZKQ A;  4U8K A;  4UDP A;  3P9U A;  3SXI A;  4OPL A;  1GRT A;  2FJA A;  1F6M A;  2WP9 A;  3UKA A;  4YTN A;  3F8P A;  2V6O A;  2BC0 A;  2YLT A;  1BKW A;  4IA6 A;  4RG4 A;  4G6G A;  3T2Z A;  3ZDN A;  5GSN A;  4JNA A;  3F8R A;  1LPF A;  3CNJ A;  3UP5 A;  1S2Q A;  4FX9 A;  3AYI A;  3AWI A;  1LVL A;  1TRB A;  1JEH A;  2FBW A;  2YG7 A;  2YG4 A;  2C67 A;  3LJP A;  2H89 A;  5KOX A;  3SZC A;  1PXB A;  2FJB A;  4Z2U A;  4GF7 A;  1GV4 A;  2YG5 A;  1XHC A;  2O9Z A;  3NN6 X;  2RGJ A;  1VG9 A;  3BHF A;  1GPE A;  4I59 A;  3UTG A;  3WE0 A;  4HA6 A;  3AXB A;  4X9N A;  5GRT A;  3SZ0 A;  1K4Q A;  2APG A;  1PS9 A;  1TYT A;  2OAL A;  2WU2 A;  3DK4 A;  2BAB A;  4AT2 A;  2X3N A;  1D4D A;  1NHS A;  2QCU A;  4A7A A;  2DKI A;  3OC4 A;  3K7Q X;  5BUL A;  2Q6U A;  5KVH A;  2YR4 A;  2BC1 A;  4WX1 A;  3KPF A;  4ZCD A;  3V76 A;  3NH3 X;  3CGE A;  3RNM A;  1KF6 A;  3ICS A;  2YG3 A;  2YLW A;  2XVH A;  4G9K A;  4Y4M A;  3AE6 A;  3QFA A;  1BWC A;  2XDO A;  3EPT A;  4II2 A;  1CC6 A;  4U2S A;  4A9W A;  1LQU A;  2J3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...