3NH3X

Complex of 6-hydroxy-l-nicotine oxidase with final ketone product formed during catalytic turnover
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nh3X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nh3X02
3P1WA 2GR3A 2JBVA 2RGOA 4Y4LA 2C73A 4WX1A 1OJTA 2X8GA 3T37A 4BK2A 1PHHA 2IVDA 3UTFA 2BXRA 2PHHA 4OPTA 2W0HA 2XFOA 1N4UA 3DK9A 4O5UA 2WPCA 1JRXA 3CPHG 4B1BA 1ZP0A 1V59A 1YQZA 4K5RA 2GR2A 1DODA 3PS9A 3UTGA 3P4RA 2XVIA 4YTPA 1NHQA 4B66A 2X3NA 3DJDA 1Y56A 3H8LA 3AE9A 1LPFA 1D7LA 4TLZA 4XXGA 2OAMA 2XLTA 4GDEA 4GDPA 1CF3A 2XVHA 4H4ZA 4TLXA 5EBKA 1PBDA 4U2LA 1UKVG 4H4SA 2C7GA 4U2SA 1XDIA 3SM8A 2Q7VA 2WOWA 4AP3A 3FBSA 1D4DA 1K4QA 1FECA 1GRFA 2H88A 3F8PA 4EMJA 1D4EA 2X8HA 2GF3A 3KPFA 1Q1RA 3AE5A 5EB4A 1EL8A 2YWLA 5KVHA 2BS2A 4JN9A 2YG5A 4H2RA 1DJQA 4Y4NA 4IA5A 1F3PA 1YQ3A 4EQXA 3GRSA 1TRBA 4RG4A 2GRTA 2XVJA 5FS6A 3COXA 3KVEA 1CC4A 1GRHA 1LTXR 4Z43A 5JCMA 2J3NA 3EPTA 1GESA 1GSNA 4Z2TA 1LJ1A 3ALJA 4X9NA 5HHFA 4C74A 3RHAA 4GUVA 4J2WA 2BK4A 4H7UA 4DGKA 5JCLA 3NGCX 1DJNA 3UTEA 4A6NA 2OA1A 2RABA 4K7ZA 1X31B 2VVLA 4U8LA 4H4UA 2R4EA 3REDA 1E1LA 1KFYA 1DXLA 1Q1WA 2A89A 4JQ9A 3GSIA 4IVOB 2TMDA 1MO9A 5BULA 4H2QA 2O9ZA 3P4PA 3AYJA 1ELIA 2NVKX 3ALLA 4DSGA 1PN0A 3NTAA 2ZZCA 4KPRA 3V3NA 2YG7A 3C96A 1S3BA 3GYIA 5GSNA 4B69A 4BK1A 3FPZA 4OPDA 3AD7B 3NK2X 3VRBA 4CBQA 3QSEA 2XYOA 1LQUA 3AEBA 3ICTA 3AE1A 1TYPA 1F8WA 4U8KA 4OCGA 4LIIA 1GNDA 2WPFA 1NPXA 1ZMDA 3VR9A 2WETA 4PABA 1VG0A 2BCPA 3AECA 4JDRA 1CJ3A 2C70A 1B37A 2XCGA 2YVGA 2WDRA 2GVCA 3GDPA 4AOSA 2F5ZA 5TR3A 3DK4A 3CNPA 2WDQA 3V76A 1FOHA 4B67A 2V5ZA 2GAGB 4Y4MA 1S3EA 3DJEA 3DJJA 2VRMA 3AE2A 2HQMA 4CRTA 1RP0A 1CC6A 3SGLA 2Q0KA 3DGHA 3NKSA 2B9WA 2AR8A 3UP5A 2WPEA 4TM4A 3GWFA 1JNRA 2C64A 2C66A 2YLSA 3EANA 2CULA 1E6EA 4NEVA 5DBJA 3BI2A 3L8KA 2GMJA 3K30A 4GF7A 3E1TA 4U8PA 3UKAA 3G5RA 1BGJA 5KVIA 1FL2A 4YSYA 5J7XA 1D4CA 1OJDA 2YLTA 3GYJA 2BS4A 5U25A 4EQRA 2BABA 2WOVA 1ZOVA 2YM1A 3HZLA 1DNCA 4A65A 2B9XA 3ISHA 1ZKQA 4DSHA 4B63A 3AE8A 3AEGA 2R0CA 3NN6X 4IV9A 1NHSA 3GWDA 2B76A 1JU2A 2QAEA 3AE6A 3URHA 2FJAA 2FJBA 3LOVA 3AYLA 2C67A 2V6OA 4A5LA 1GXFA 3R9UA 1JNZA 3D1CA 2YLWA 3RNMA 3NK1X 1D7YA 2OLNA 4MJWA 4YSXA 3CGCA 2YVJA 4O5QA 4FDCB 4U8NA 2GV8A 2X8CA 4EIQA 4CNJA 3SQPA 1CHUA 3QFBA 4K22A 2R0PA 1K0IA 4NTCA 3ICRA 1Y56B 2R45A 2NPXA 3D8XA 4NTEA 4LA1A 3AYIA 5KOXA 3ZDNA 3I6DA 1NHPA 2BS3A 1GV4A 2R46A 3AEDA 3G5SA 2GEWA 1GT8A 1GRBA 3I3LA 1VDCA 1VG9A 4OPGA 3UKFA 5C2TA 1L9EA 1PBCA 4EIPA 3BNMA 4K5SA 1N4VA 1AOGA 1GRAA 1OJAA 2YG4A 2WBAA 1E1NA 4ZCDA 2RGJA 4YSZA 4CY6A 1EL7A 3FIMB 4CY8A 1H6VA 1H83A 4FK1C 2X99A 1DOEA 2A8XA 2YG3A 3AEFA 1S2QA 4AT2A 3EAOA 1L9DA 3KKJA 4H4PA 2E5VA 4H4TA 4GRTA 1MXTA 2ZZ0A 3BNUA 3CPIG 1REOA 3CGDA 2QA1A 2BA9A 2C72A 5C3JA 1PS9A 2GQWA 3KD9A 1GEUA 2VZ2A 4YTMA 4EM3A 2YLZA 4AP1A 2R0GA 1LV0A 5HXIA 3IHGA 3QSMA 5JCKA 4Z25A 1TDEA 1RSGA 2C3DA 3UTHA 4HA6A 4A6NB 5FS8A 1M6IA 2IIDA 3VRDB 4X9MA 2EQ8A 1H81A 3AE3A 3GD3A 3NH3X 4J36A 4UDQA 1PJ7A 1QJDA 1P2HA 3K7QX 4H4VA 2QCUA 5BRTA 1BF3A 3S5WA 1BKWA 1B5QA 4OPIA 2C65A 4YT0A 1KF6A 4Z44A 2YLXA 1GTHA 1PJ6A 1CL0A 1DOCA 1H84A 1F8RA 1KNRA 3AEEA 1GREA 4H2PA 3CNDA 4B64A 3VRAA 3QFAA 2YQUA 3IF9A 1TDOA 1OJ9A 1JRZA 1FEBA 1ZDLA 4OVIA 3BI4A 5M0ZA 5JCIA 3H8IA 2WP6A 4ZN0A 4H50A 4D03A 4J33A 1IUWA 3AB1A 2BXSA 1ZOYA 2APGA 3K7MX 2OALA 4TM3A 2WESA 4EMWA 1E7PA 2Y6QA 4KX6A 4RSLA 3S61A 2C75A 4ECHA 1NENA 4RG3A 1IUUA 1Z6LA 2YR6A 3Q6JA 4JNAA 1SEZA 4E0VA 4WCTA 3AXBA 3NLCA 1YKJA 1N1PA 3II4A 2WS3A 4NEWA 3GD4A 1L0VA 2Z5XA 3ITJA 4HB9A 2OLOA 1NG4A 5BVAA 3CIRA 4ICYA 4JY2A 4C5OA 1NG3A 3C4NA 4J56A 4XWZA 3RP6A 3NG7X 5CQFA 4EQWA 2XLPA 3AE7A 3NYEA 1GPEA 1F6MA 1ZX9A 5U63A 4C3YA 4UP3A 1N4WA 4J57A 1CJ2A 4H2NA 2WU5A 1H7WA 4DNAA 1KDGA 5BUKA 3G5QA 2X50A 3UKQA 2FJEA 4FX9A 2XLRA 1F8SA 5LV9A 2V3BA 4C3XA 1IUTA 3QVPA 3VR8A 1E1KA 5FS9A 2R9ZA 2CVJA 3QSSA 2YG6A 3UKLA 1H7XA 5M10A 2BC1A 3ADAB 3FG2P 4P9SA 2RGHA 2BCGG 1DOBA 3AWIA 3IHMA 3V3OA 4ADWA 3M13A 4H4XA 4H4YA 2VQ7A 1PBBA 2IVEA 4UDRA 1GTEA 4X4JA 3L1RA 4BJYA 4C77A 3QVRA 4B68A 4A9WA 3UKHA 3IWAA 5IQ4A 5HY5A 3H4KA 1PBFA 4K8DA 2DKIA 2Q6UA 1GOSA 3LJPA 3ABVA 3UOZA 4A99A 3ZYXA 5IPYA 3ATRA 3NRNA 3ATQA 2QA2A 2C76A 3CPJG 3NT6A 1GRTA 4J34A 5U1OA 1PXBA 1RYIA 2GB0A 4BURA 1B8SA 3NTDA 2V61A 1D5TA 4APNA 3DH9A 2XFQA 3ICSA 4M52A 1IJHA 3AD8B 2AQJA 4N9XA 1GRGA 1JEHA 5ER0A 1ZY8A 2JK6A 4U8OA 1VRQB 4U8MA 4YKGA 2Z5YA 1K0JA 3NHOX 3NN0X 3NYFA 2YR4A 1KSUA 3DK8A 4AT0A 2GQFA 2XLSA 1E39A 2JKCA 3DA1A 4TM1A 3UKKA 2GH5A 4BJZA 2XVFA 2WP5A 1YQ4A 3VQRA 3P9UA 1ZK7A 3BI5A 3DGZA 3UOVA 2VRLA 1TYTA 4U2TA 1NEKA 1EL5A 4EQSA 2TPRA 3UOXA 4BK3A 2E4GA 2BK5A 3CGBA 4YKFA 1L9CA 3FMWA 2ACZA 3IC9A 2ARDA 4YTNA 1PXCA 2FBWA 3DMEA 3QJ4A 1B4VA 3NNEA 3KA7A 1O95A 1QLBA 2YAUA 3CN8A 4ZCCA 4NZHA 4IA6A 1JOAA 1NHRA 2GR0A 5FMHA 3LZWA 3O0HA 1BZLA 2FJDA 4OPLA 2H89A 3EF6A 5KRQA 2YR5A 1NDAA 1NAAA 2EQ7A 2BYBA 3GDNA 4OPCA 4CNKA 4REKA 1CBOA 3LADA 1GERA 2JB2A 1FCDA 2ZBWA 3CTYA 4Z2UA 4J31A 2XVEA 3CGEA 3CNSA 1XPQA 4Z26A 4U8JA 3OC4A 1OJCA 2E1MA 1YY5A 1ZMCA 1GALA 1P2EA 4XWRA 5J60A 3LXDA 3RP7A 1KSSA 1H82A 1PXAA 4YSHA 2UZZA 4IVMB 1O5WA 1K0LA 4I58A 3UKPA 1LQTA 1M64A 4H4WA 2XFNA 3PO7A 4D04A 1BWCA 2B9YA 2XFPA 2WOIA 2B7RA 5EOWA 1GETA 4Z2RA 1EL9A 3GMCA 2A87A 2JAEA 2CFYA 1S2YA 5JCNA 3PVCA 5FS7A 4USRA 3LZXA 2GMHA 2XFUA 4A7AA 1XHCA 1COYA 3SFEA 3UP4A 4LU6A 3P4SA 5CKUA 5KWFA 2Y6RA 2EQ6A 3ALMA 2V3AA 2WQYA 2ZZBA 3B6DA 3GMBA 5L46A 3B3RA 2C3CA 4Z24A 1Q9IA 1CJCA 3F8RA 3P4QA 4JNQA 3LB8A 5EB5A 5HYMA 4U8IA 2JB1A 2BK3A 2VOUA 2DKHA 1EBDA 1PBEA 3AEAA 4H4QA 5KOWA 2YLRA 1TDNA 3F8DA 1IUVA 4BV6A 3RP8A 4PAAA 2BC0A 3AE4A 2AAQA 1H86A 4B65A 4K2XA 1O94A 2EQ9A 4FK1A 1VQWA 3JSKA 3OZ2A 4UDPA 1Y0PA 2V60A 2GR1A 1PDHA 4H4RA 2XDOA 2Q0LA 2VVLG 1QO8A 2VQBA 3WE0A 4I59A 4OPUA 1TDKA 1IUSA 4TM0A 3NK0X 2WU2A 2VVMA 2I0ZA 4USQA 1W4XA 1XANA 1CC2A 1HYUA 3KU9A 2YVFA 2PYXA 2CDUA 3C4AA 4GR1A 3CNJA 1BGNA 1PJ5A 5GRTA 1IUXA 2GAHB 1JRYA 4A79A 4AOXA 3DJGX 3BHFA 3K7TA 3M0OA 3UOYA 2B7SA 4JY3A 1FEAA 3SFDA 1E1MA 2YM2A 3GRTA 5IQ1A 4CCQA 3NYCA 1KNPA 1LVLA 3CNTA 2XLUA 4YWOA 3M12A 4CCRA 2WEUA 1ONFA 2WHDA 3Q9TA 2WP9A 2BACA 3UCLA 2JB3A 5KXJA 3KLJA 1MOKA 3AD9B 1CJ4A 2R4JA 2WDVA 4EM4A 1TDFA 4EMIA 3BHKA 4GCMA 4YXDA 3NIXA 4NTDA
chains in the Genus database with same CATH superfamily
3P1WA 2GR3A 2JBVA 2RGOA 4Y4LA 2C73A 4WX1A 1OJTA 2X8GA 3T37A 4BK2A 1PHHA 2IVDA 3UTFA 2BXRA 2PHHA 4OPTA 2W0HA 2XFOA 1N4UA 3DK9A 4O5UA 2WPCA 1JRXA 3CPHG 4B1BA 1ZP0A 1V59A 1YQZA 4K5RA 2GR2A 1DODA 3PS9A 3UTGA 3P4RA 2XVIA 2C4CA 1NHQA 4YTPA 4B66A 2X3NA 3DJDA 1Y56A 3T31A 3H8LA 3AE9A 1LPFA 1D7LA 4TLZA 4XXGA 2OAMA 2XLTA 4GDEA 4GDPA 1CF3A 2XVHA 4H4ZA 4TLXA 5EBKA 1PBDA 4U2LA 1UKVG 4H4SA 2C7GA 4U2SA 1XDIA 3SM8A 2Q7VA 2WOWA 4AP3A 3FBSA 1D4DA 1K4QA 1FECA 1GRFA 2H88A 3F8PA 4EMJA 1D4EA 2X8HA 4G74A 2GF3A 3KPFA 1Q1RA 3AE5A 5EB4A 1EL8A 2YWLA 5KVHA 2BS2A 4JN9A 2YG5A 4H2RA 1DJQA 4Y4NA 4IA5A 1F3PA 1YQ3A 3SY4A 3T0KA 4EQXA 3GRSA 1TRBA 4RG4A 2GRTA 2XVJA 5FS6A 3COXA 3KVEA 1CC4A 1GRHA 1LTXR 4Z43A 5JCMA 2J3NA 3EPTA 1GESA 1GSNA 4Z2TA 1LJ1A 3ALJA 4II2A 4X9NA 5HHFA 2BRAA 4C74A 3RHAA 4GUVA 4J2WA 4II3A 2BK4A 4H7UA 4DGKA 5JCLA 3NGCX 1DJNA 3UTEA 4A6NA 2OA1A 4GAPA 2RABA 4K7ZA 1X31B 2VVLA 4U8LA 4H4UA 2R4EA 3REDA 1E1LA 1KFYA 1DXLA 1Q1WA 2A89A 4JQ9A 3GSIA 4IVOB 2TMDA 1MO9A 3HYXA 5BULA 4H2QA 2O9ZA 3P4PA 3AYJA 1ELIA 2NVKX 3ALLA 4DSGA 1PN0A 3NTAA 2ZZCA 4KPRA 3V3NA 2YG7A 3C96A 1S3BA 3GYIA 5GSNA 4B69A 4BK1A 3FPZA 4OPDA 3AD7B 3NK2X 3VRBA 4CBQA 3QSEA 2XYOA 1LQUA 3AEBA 3ICTA 3AE1A 1TYPA 1F8WA 4U8KA 4OCGA 4LIIA 1GNDA 2WPFA 1NPXA 1ZMDA 3VR9A 2WETA 4PABA 1VG0A 2BCPA 3AECA 4JDRA 1CJ3A 2C70A 1B37A 2XCGA 2YVGA 2WDRA 2GVCA 3GDPA 4AOSA 2F5ZA 5TR3A 3DK4A 3CNPA 2WDQA 3V76A 1FOHA 4B67A 2V5ZA 2GAGB 4Y4MA 1S3EA 3DJEA 3DJJA 2VRMA 3AE2A 2HQMA 4CRTA 1RP0A 1CC6A 3SGLA 2Q0KA 3DGHA 3NKSA 2B9WA 2AR8A 3UP5A 2WPEA 4TM4A 3GWFA 1JNRA 2C64A 2C66A 2YLSA 3EANA 2CULA 1E6EA 4NEVA 5DBJA 3BI2A 3L8KA 2GMJA 3K30A 4GF7A 3E1TA 4U8PA 3GYXA 3UKAA 3G5RA 1BGJA 5KVIA 1FL2A 4YSYA 5J7XA 1D4CA 1OJDA 2YLTA 3GYJA 2BS4A 5U25A 4EQRA 2BABA 2WOVA 1ZOVA 2YM1A 3HZLA 1DNCA 4A65A 2B9XA 3ISHA 1ZKQA 4DSHA 4B63A 3AE8A 3AEGA 5KMPA 2R0CA 3NN6X 4IV9A 1NHSA 3GWDA 2B76A 1JU2A 2QAEA 3AE6A 3URHA 2FJAA 2FJBA 3LOVA 3AYLA 2C67A 2V6OA 4A5LA 1GXFA 3R9UA 1JNZA 3D1CA 2YLWA 3RNMA 3NK1X 1D7YA 2OLNA 4MJWA 4YSXA 3CGCA 5KMSA 2YVJA 4O5QA 4FDCB 4U8NA 2GV8A 2X8CA 4EIQA 4CNJA 3SQPA 1CHUA 3QFBA 4K22A 2R0PA 1K0IA 4NTCA 3SXIA 3ICRA 1Y56B 2R45A 2NPXA 3D8XA 4NTEA 4LA1A 3AYIA 5KOXA 3HYWA 3I6DA 3ZDNA 1NHPA 2BS3A 1GV4A 2R46A 3AEDA 3G5SA 2GEWA 1GT8A 1GRBA 3I3LA 1VDCA 1VG9A 4OPGA 3UKFA 5C2TA 1L9EA 1PBCA 4EIPA 3BNMA 4K5SA 1N4VA 3T2ZA 1AOGA 1GRAA 1OJAA 2YG4A 2WBAA 1E1NA 4ZCDA 2RGJA 4YSZA 4CY6A 1EL7A 3FIMB 3T2YA 1H6VA 1H83A 4CY8A 4FK1C 2X99A 1DOEA 2A8XA 2YG3A 5KNLA 3AEFA 1S2QA 4AT2A 3EAOA 1L9DA 3KKJA 4H4PA 2E5VA 4H4TA 4GRTA 1MXTA 2ZZ0A 3BNUA 5KMQA 3CPIG 1REOA 3CGDA 3CMMA 2QA1A 2BA9A 2C72A 5C3JA 1PS9A 2GQWA 3KD9A 1GEUA 2VZ2A 4YTMA 4EM3A 2YLZA 4AP1A 2R0GA 1LV0A 5HXIA 3IHGA 3QSMA 4GAVA 5JCKA 4Z25A 1TDEA 1RSGA 2C3DA 3UTHA 4HA6A 4A6NB 5FS8A 1M6IA 2IIDA 3SZCA 3VRDB 4X9MA 2EQ8A 1H81A 3AE3A 3GD3A 3NH3X 4J36A 4UDQA 1PJ7A 1QJDA 1P2HA 3K7QX 4H4VA 2QCUA 5BRTA 1BF3A 3S5WA 1BKWA 1B5QA 4OPIA 2C65A 4YT0A 1KF6A 4Z44A 2YLXA 1GTHA 1PJ6A 1CL0A 1DOCA 1H84A 1F8RA 1KNRA 3AEEA 1GREA 4H2PA 3CNDA 4B64A 3VRAA 3QFAA 2YQUA 3IF9A 1TDOA 1OJ9A 1JRZA 1FEBA 1ZDLA 4OVIA 3BI4A 5M0ZA 5JCIA 3H8IA 2WP6A 4ZN0A 4H50A 4D03A 4J33A 1IUWA 3AB1A 2BXSA 1ZOYA 2APGA 3K7MX 2OALA 4TM3A 2WESA 4EMWA 1E7PA 2Y6QA 4KX6A 4RSLA 3S61A 2C75A 4ECHA 1NENA 4RG3A 3SZFA 1IUUA 1Z6LA 2YR6A 3Q6JA 4JNAA 1SEZA 4E0VA 4WCTA 3AXBA 3NLCA 1YKJA 1N1PA 3II4A 2WS3A 4NEWA 3GD4A 1L0VA 2Z5XA 3ITJA 4HB9A 2OLOA 1NG4A 5BVAA 3KPKA 3CIRA 4ICYA 4JY2A 4C5OA 1NG3A 3C4NA 4J56A 4XWZA 3RP6A 3NG7X 5CQFA 4EQWA 2XLPA 3AE7A 3NYEA 1GPEA 1F6MA 1ZX9A 5U63A 4C3YA 4UP3A 1N4WA 4J57A 4G6GA 1CJ2A 4H2NA 2WU5A 1H7WA 4DNAA 1KDGA 5BUKA 3G5QA 2X50A 3UKQA 2FJEA 4FX9A 2XLRA 1F8SA 5LV9A 2V3BA 4C3XA 1IUTA 3QVPA 3VR8A 1E1KA 5FS9A 3SZ0A 2R9ZA 2CVJA 3QSSA 2YG6A 4G6HA 1H7XA 3UKLA 2BC1A 5M10A 3ADAB 3FG2P 4P9SA 2RGHA 2BCGG 1DOBA 3AWIA 3IHMA 3V3OA 4ADWA 3M13A 4H4XA 4H4YA 2VQ7A 1PBBA 2IVEA 4UDRA 1GTEA 4X4JA 3L1RA 4BJYA 4C77A 3QVRA 4B68A 4A9WA 3UKHA 3IWAA 5IQ4A 5HY5A 3H4KA 1PBFA 4K8DA 2DKIA 2Q6UA 1GOSA 3LJPA 3ABVA 3UOZA 4A99A 3ZYXA 5IPYA 3ATRA 3NRNA 2BRYA 3ATQA 2QA2A 2C76A 3CPJG 3NT6A 1GRTA 4J34A 5U1OA 1PXBA 1RYIA 2GB0A 4BURA 1B8SA 3NTDA 2V61A 1D5TA 4APNA 3DH9A 2XFQA 3ICSA 4M52A 1IJHA 3AD8B 2AQJA 4NWZA 4N9XA 1GRGA 3HYVA 1JEHA 5ER0A 1ZY8A 2JK6A 4U8OA 1VRQB 4U8MA 4YKGA 2Z5YA 1K0JA 3NHOX 3NN0X 3NYFA 2YR4A 1KSUA 3DK8A 4AT0A 2GQFA 2XLSA 1E39A 2JKCA 3DA1A 4TM1A 3UKKA 2GH5A 4BJZA 2XVFA 2WP5A 1YQ4A 3VQRA 3P9UA 1ZK7A 3BI5A 3DGZA 3UOVA 2VRLA 1TYTA 4U2TA 1NEKA 1EL5A 4EQSA 2TPRA 3UOXA 4BK3A 2E4GA 2BK5A 3CGBA 4YKFA 1L9CA 3FMWA 2ACZA 3IC9A 2ARDA 4YTNA 1PXCA 2FBWA 3DMEA 3QJ4A 1B4VA 3NNEA 3KA7A 1O95A 1QLBA 2YAUA 3CN8A 4ZCCA 4NZHA 4IA6A 1JOAA 4G9KA 1NHRA 2GR0A 5FMHA 3LZWA 3O0HA 1BZLA 2FJDA 4OPLA 2H89A 3EF6A 5KRQA 2YR5A 4NNJA 1NDAA 1NAAA 2EQ7A 2BYBA 3GDNA 4OPCA 4CNKA 4REKA 1CBOA 3LADA 1GERA 2JB2A 1FCDA 2ZBWA 3CTYA 4Z2UA 3T14A 4J31A 2XVEA 3CGEA 3CNSA 1XPQA 4Z26A 4U8JA 3OC4A 1OJCA 3SZWA 2E1MA 1YY5A 1ZMCA 1GALA 4G73A 1P2EA 4XWRA 5J60A 3LXDA 3RP7A 1KSSA 1H82A 1PXAA 4YSHA 2UZZA 4IVMB 1O5WA 1K0LA 4I58A 3UKPA 3SX6A 1LQTA 1M64A 4H4WA 2XFNA 3PO7A 4D04A 1BWCA 2B9YA 2XFPA 2WOIA 2B7RA 5EOWA 1GETA 4Z2RA 1EL9A 3GMCA 2A87A 2JAEA 2CFYA 1S2YA 5JCNA 3PVCA 5FS7A 5KMRA 4USRA 3LZXA 2GMHA 2XFUA 4A7AA 1XHCA 1COYA 3SFEA 3UP4A 4LU6A 3P4SA 5CKUA 5KWFA 2Y6RA 2EQ6A 3ALMA 2V3AA 2WQYA 2ZZBA 3B6DA 3GMBA 5L46A 3B3RA 2C3CA 4Z24A 1Q9IA 1CJCA 3F8RA 3P4QA 4JNQA 3LB8A 5EB5A 5HYMA 4U8IA 2JB1A 2BK3A 2VOUA 2DKHA 1EBDA 1PBEA 3AEAA 4H4QA 3T2KA 5KOWA 2YLRA 1TDNA 3F8DA 1IUVA 4BV6A 3RP8A 4PAAA 2BC0A 3AE4A 2AAQA 1H86A 4B65A 4K2XA 1O94A 2EQ9A 4FK1A 1VQWA 3JSKA 3OZ2A 4UDPA 1Y0PA 3SYIA 2V60A 2GR1A 1PDHA 4H4RA 2XDOA 2Q0LA 2VVLG 1QO8A 2VQBA 3WE0A 4I59A 4OPUA 1TDKA 1IUSA 4TM0A 3NK0X 2WU2A 2VVMA 2I0ZA 4USQA 1W4XA 1XANA 1CC2A 1HYUA 3KU9A 2YVFA 2PYXA 2CDUA 3C4AA 4GR1A 3CNJA 1BGNA 1PJ5A 5GRTA 1IUXA 2GAHB 1JRYA 4A79A 4AOXA 3DJGX 3BHFA 3K7TA 3M0OA 3UOYA 2B7SA 4JY3A 1FEAA 3SFDA 1E1MA 2YM2A 3GRTA 5IQ1A 4CCQA 3NYCA 1KNPA 1LVLA 3CNTA 2XLUA 4YWOA 3M12A 4CCRA 2WEUA 1ONFA 2WHDA 3Q9TA 2WP9A 2BACA 3UCLA 2JB3A 5KXJA 3KLJA 1MOKA 3AD9B 1CJ4A 2R4JA 2WDVA 4EM4A 1TDFA 4EMIA 3BHKA 4GCMA 4YXDA 3NIXA 4NTDA
chains in the Genus database with same CATH topology
3P1WA 2GR3A 2JBVA 2RGOA 4Y4LA 2C73A 4WX1A 1OJTA 2X8GA 3T37A 4BK2A 1PHHA 2IVDA 3UTFA 2BXRA 2PHHA 4OPTA 2W0HA 2XFOA 1N4UA 3DK9A 4O5UA 2WPCA 1JRXA 3CPHG 4B1BA 1ZP0A 1V59A 1YQZA 4K5RA 2GR2A 1DODA 3PS9A 3UTGA 3P4RA 2XVIA 2C4CA 1NHQA 4YTPA 4B66A 2X3NA 3DJDA 1Y56A 3T31A 3H8LA 3AE9A 1LPFA 1D7LA 4TLZA 4XXGA 2OAMA 2XLTA 4GDEA 4GDPA 1CF3A 2XVHA 4H4ZA 4TLXA 5EBKA 1PBDA 4U2LA 1UKVG 4H4SA 2C7GA 4U2SA 1XDIA 3SM8A 2Q7VA 2WOWA 4AP3A 3FBSA 1D4DA 1K4QA 1FECA 1GRFA 2H88A 3F8PA 4EMJA 1D4EA 2X8HA 4G74A 2GF3A 3KPFA 1Q1RA 3AE5A 5EB4A 1EL8A 2YWLA 5KVHA 2BS2A 4JN9A 2YG5A 4H2RA 1DJQA 4Y4NA 4IA5A 1F3PA 1YQ3A 3SY4A 3T0KA 4EQXA 3GRSA 1TRBA 4RG4A 2GRTA 2XVJA 5FS6A 3COXA 3KVEA 1CC4A 1GRHA 1LTXR 4Z43A 5JCMA 2J3NA 3EPTA 1GESA 1GSNA 4Z2TA 1LJ1A 3ALJA 4II2A 4X9NA 5HHFA 2BRAA 4C74A 3RHAA 4GUVA 4J2WA 4II3A 2BK4A 4H7UA 4DGKA 5JCLA 3NGCX 1DJNA 3UTEA 4A6NA 2OA1A 4GAPA 2RABA 4K7ZA 1X31B 2VVLA 4U8LA 4H4UA 2R4EA 3REDA 1E1LA 1KFYA 1DXLA 1Q1WA 2A89A 4JQ9A 3GSIA 4IVOB 2TMDA 1MO9A 3HYXA 5BULA 4H2QA 2O9ZA 3P4PA 3AYJA 1ELIA 2NVKX 3ALLA 4DSGA 1PN0A 3NTAA 2ZZCA 4KPRA 3V3NA 2YG7A 3C96A 1S3BA 3GYIA 5GSNA 4B69A 4BK1A 3FPZA 4OPDA 3AD7B 3NK2X 3VRBA 4CBQA 3QSEA 2XYOA 1LQUA 3AEBA 3ICTA 3AE1A 1TYPA 1F8WA 4U8KA 4OCGA 4LIIA 1GNDA 2WPFA 1NPXA 1ZMDA 3VR9A 2WETA 4PABA 1VG0A 2BCPA 3AECA 4JDRA 1CJ3A 2C70A 1B37A 2XCGA 2YVGA 2WDRA 2GVCA 3GDPA 4AOSA 2F5ZA 5TR3A 3DK4A 3CNPA 2WDQA 3V76A 1FOHA 4B67A 2V5ZA 2GAGB 4Y4MA 1S3EA 3DJEA 3DJJA 2VRMA 3AE2A 2HQMA 4CRTA 1RP0A 1CC6A 3SGLA 2Q0KA 3DGHA 3NKSA 2B9WA 2AR8A 3UP5A 2WPEA 4TM4A 3GWFA 1JNRA 2C64A 2C66A 2YLSA 3EANA 2CULA 1E6EA 4NEVA 5DBJA 3BI2A 3L8KA 2GMJA 3K30A 4GF7A 3E1TA 4U8PA 3GYXA 3UKAA 3G5RA 1BGJA 5KVIA 1FL2A 4YSYA 5J7XA 1D4CA 1OJDA 2YLTA 3GYJA 2BS4A 5U25A 4EQRA 2BABA 2WOVA 1ZOVA 2YM1A 3HZLA 1DNCA 4A65A 2B9XA 3ISHA 1ZKQA 4DSHA 4B63A 3AE8A 3AEGA 5KMPA 2R0CA 3NN6X 4IV9A 1NHSA 3GWDA 2B76A 1JU2A 2QAEA 3AE6A 3URHA 2FJAA 2FJBA 3LOVA 3AYLA 2C67A 2V6OA 4A5LA 1GXFA 3R9UA 1JNZA 3D1CA 2YLWA 3RNMA 3NK1X 1D7YA 2OLNA 4MJWA 4YSXA 3CGCA 5KMSA 2YVJA 4O5QA 4FDCB 4U8NA 2GV8A 2X8CA 4EIQA 4CNJA 3SQPA 1CHUA 3QFBA 4K22A 2R0PA 1K0IA 4NTCA 3SXIA 3ICRA 1Y56B 2R45A 2NPXA 3D8XA 4NTEA 4LA1A 3AYIA 5KOXA 3HYWA 3I6DA 3ZDNA 1NHPA 2BS3A 1GV4A 2R46A 3AEDA 3G5SA 2GEWA 1GT8A 1GRBA 3I3LA 1VDCA 1VG9A 4OPGA 3UKFA 5C2TA 1L9EA 1PBCA 4EIPA 3BNMA 4K5SA 1N4VA 3T2ZA 1AOGA 1GRAA 1OJAA 2YG4A 2WBAA 1E1NA 4ZCDA 2RGJA 4YSZA 4CY6A 1EL7A 3FIMB 3T2YA 1H6VA 1H83A 4CY8A 4FK1C 2X99A 1DOEA 2A8XA 2YG3A 5KNLA 3AEFA 1S2QA 4AT2A 3EAOA 1L9DA 3KKJA 4H4PA 2E5VA 4H4TA 4GRTA 1MXTA 2ZZ0A 3BNUA 5KMQA 3CPIG 1REOA 3CGDA 3CMMA 2QA1A 2BA9A 2C72A 5C3JA 1PS9A 2GQWA 3KD9A 1GEUA 2VZ2A 4YTMA 4EM3A 2YLZA 4AP1A 2R0GA 1LV0A 5HXIA 3IHGA 3QSMA 4GAVA 5JCKA 4Z25A 1TDEA 1RSGA 2C3DA 3UTHA 4HA6A 4A6NB 5FS8A 1M6IA 2IIDA 3SZCA 3VRDB 4X9MA 2EQ8A 1H81A 3AE3A 3GD3A 3NH3X 4J36A 4UDQA 1PJ7A 1QJDA 1P2HA 3K7QX 4H4VA 2QCUA 5BRTA 1BF3A 3S5WA 1BKWA 1B5QA 4OPIA 2C65A 4YT0A 1KF6A 4Z44A 2YLXA 1GTHA 1PJ6A 1CL0A 1DOCA 1H84A 1F8RA 1KNRA 3AEEA 1GREA 4H2PA 3CNDA 4B64A 3VRAA 3QFAA 2YQUA 3IF9A 1TDOA 1OJ9A 1JRZA 1FEBA 1ZDLA 4OVIA 3BI4A 5M0ZA 5JCIA 3H8IA 2WP6A 4ZN0A 4H50A 4D03A 4J33A 1IUWA 3AB1A 2BXSA 1ZOYA 2APGA 3K7MX 2OALA 4TM3A 2WESA 4EMWA 1E7PA 2Y6QA 4KX6A 4RSLA 3S61A 2C75A 4ECHA 1NENA 4RG3A 3SZFA 1IUUA 1Z6LA 2YR6A 3Q6JA 4JNAA 1SEZA 4E0VA 4WCTA 3AXBA 3NLCA 1YKJA 1N1PA 3II4A 2WS3A 4NEWA 3GD4A 1L0VA 2Z5XA 3ITJA 4HB9A 2OLOA 1NG4A 5BVAA 3KPKA 3CIRA 4ICYA 4JY2A 4C5OA 1NG3A 3C4NA 4J56A 4XWZA 3RP6A 3NG7X 5CQFA 4EQWA 2XLPA 3AE7A 3NYEA 1GPEA 1F6MA 1ZX9A 5U63A 4C3YA 4UP3A 1N4WA 4J57A 4G6GA 1CJ2A 4H2NA 2WU5A 1H7WA 4DNAA 1KDGA 5BUKA 3G5QA 2X50A 3UKQA 2FJEA 4FX9A 2XLRA 1F8SA 5LV9A 2V3BA 4C3XA 1IUTA 3QVPA 3VR8A 1E1KA 5FS9A 3SZ0A 2R9ZA 2CVJA 3QSSA 2YG6A 4G6HA 1H7XA 3UKLA 2BC1A 5M10A 3ADAB 3FG2P 4P9SA 2RGHA 2BCGG 1DOBA 3AWIA 3IHMA 3V3OA 4ADWA 3M13A 4H4XA 4H4YA 2VQ7A 1PBBA 2IVEA 4UDRA 1GTEA 4X4JA 3L1RA 4BJYA 4C77A 3QVRA 4B68A 4A9WA 3UKHA 3IWAA 5IQ4A 5HY5A 3H4KA 1PBFA 4K8DA 2DKIA 2Q6UA 1GOSA 3LJPA 3ABVA 3UOZA 4A99A 3ZYXA 5IPYA 3ATRA 3NRNA 2BRYA 3ATQA 2QA2A 2C76A 3CPJG 3NT6A 1GRTA 4J34A 5U1OA 1PXBA 1RYIA 2GB0A 4BURA 1B8SA 3NTDA 2V61A 1D5TA 4APNA 3DH9A 2XFQA 3ICSA 4M52A 1IJHA 3AD8B 2AQJA 4NWZA 4N9XA 1GRGA 3HYVA 1JEHA 5ER0A 1ZY8A 2JK6A 4U8OA 1VRQB 4U8MA 4YKGA 2Z5YA 1K0JA 3NHOX 3NN0X 3NYFA 2YR4A 1KSUA 3DK8A 4AT0A 2GQFA 2XLSA 1E39A 2JKCA 3DA1A 4TM1A 3UKKA 2GH5A 4BJZA 2XVFA 2WP5A 1YQ4A 3VQRA 3P9UA 1ZK7A 3BI5A 3DGZA 3UOVA 2VRLA 1TYTA 4U2TA 1NEKA 1EL5A 4EQSA 2TPRA 3UOXA 4BK3A 2E4GA 2BK5A 3CGBA 4YKFA 1L9CA 3FMWA 2ACZA 3IC9A 2ARDA 4YTNA 1PXCA 2FBWA 3DMEA 3QJ4A 1B4VA 3NNEA 3KA7A 1O95A 1QLBA 2YAUA 3CN8A 4ZCCA 4NZHA 4IA6A 1JOAA 4G9KA 1NHRA 2GR0A 5FMHA 3LZWA 3O0HA 1BZLA 2FJDA 4OPLA 2H89A 3EF6A 5KRQA 2YR5A 4NNJA 1NDAA 1NAAA 2EQ7A 2BYBA 3GDNA 4OPCA 4CNKA 4REKA 1CBOA 3LADA 1GERA 2JB2A 1FCDA 2ZBWA 3CTYA 4Z2UA 3T14A 4J31A 2XVEA 3CGEA 3CNSA 1XPQA 4Z26A 4U8JA 3OC4A 1OJCA 3SZWA 2E1MA 1YY5A 1ZMCA 1GALA 4G73A 1P2EA 4XWRA 5J60A 3LXDA 3RP7A 1KSSA 1H82A 1PXAA 4YSHA 2UZZA 4IVMB 1O5WA 1K0LA 4I58A 3UKPA 3SX6A 1LQTA 1M64A 4H4WA 2XFNA 3PO7A 4D04A 1BWCA 2B9YA 2XFPA 2WOIA 2B7RA 5EOWA 1GETA 4Z2RA 1EL9A 3GMCA 2A87A 2JAEA 2CFYA 1S2YA 5JCNA 3PVCA 5FS7A 5KMRA 4USRA 3LZXA 2GMHA 2XFUA 4A7AA 1XHCA 1COYA 3SFEA 3UP4A 4LU6A 3P4SA 5CKUA 5KWFA 2Y6RA 2EQ6A 3ALMA 2V3AA 2WQYA 2ZZBA 3B6DA 3GMBA 5L46A 3B3RA 2C3CA 4Z24A 1Q9IA 1CJCA 3F8RA 3P4QA 4JNQA 3LB8A 5EB5A 5HYMA 4U8IA 2JB1A 2BK3A 2VOUA 2DKHA 1EBDA 1PBEA 3AEAA 4H4QA 3T2KA 5KOWA 2YLRA 1TDNA 3F8DA 1IUVA 4BV6A 3RP8A 4PAAA 2BC0A 3AE4A 2AAQA 1H86A 4B65A 4K2XA 1O94A 2EQ9A 4FK1A 1VQWA 3JSKA 3OZ2A 4UDPA 1Y0PA 3SYIA 2V60A 2GR1A 1PDHA 4H4RA 2XDOA 2Q0LA 2VVLG 1QO8A 2VQBA 3WE0A 4I59A 4OPUA 1TDKA 1IUSA 4TM0A 3NK0X 2WU2A 2VVMA 2I0ZA 4USQA 1W4XA 1XANA 1CC2A 1HYUA 3KU9A 2YVFA 2PYXA 2CDUA 3C4AA 4GR1A 3CNJA 1BGNA 1PJ5A 5GRTA 1IUXA 2GAHB 1JRYA 4A79A 4AOXA 3DJGX 3BHFA 3K7TA 3M0OA 3UOYA 2B7SA 4JY3A 1FEAA 3SFDA 1E1MA 2YM2A 3GRTA 5IQ1A 4CCQA 3NYCA 1KNPA 1LVLA 3CNTA 2XLUA 4YWOA 3M12A 4CCRA 2WEUA 1ONFA 2WHDA 3Q9TA 2WP9A 2BACA 3UCLA 2JB3A 5KXJA 3KLJA 1MOKA 3AD9B 1CJ4A 2R4JA 2WDVA 4EM4A 1TDFA 4EMIA 3BHKA 4GCMA 4YXDA 3NIXA 4NTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P1W A;  2GR3 A;  2JBV A;  2RGO A;  4Y4L A;  2C73 A;  4WX1 A;  1OJT A;  2X8G A;  3T37 A;  4BK2 A;  1PHH A;  2IVD A;  3UTF A;  2BXR A;  2PHH A;  4OPT A;  2W0H A;  2XFO A;  1N4U A;  3DK9 A;  4O5U A;  2WPC A;  1JRX A;  3CPH G;  4B1B A;  1ZP0 A;  1V59 A;  1YQZ A;  4K5R A;  2GR2 A;  1DOD A;  3PS9 A;  3UTG A;  3P4R A;  2XVI A;  4YTP A;  1NHQ A;  4B66 A;  2X3N A;  3DJD A;  1Y56 A;  3H8L A;  3AE9 A;  1LPF A;  1D7L A;  4TLZ A;  4XXG A;  2OAM A;  2XLT A;  4GDE A;  4GDP A;  1CF3 A;  2XVH A;  4H4Z A;  4TLX A;  5EBK A;  1PBD A;  4U2L A;  1UKV G;  4H4S A;  2C7G A;  4U2S A;  1XDI A;  3SM8 A;  2Q7V A;  2WOW A;  4AP3 A;  3FBS A;  1D4D A;  1K4Q A;  1FEC A;  1GRF A;  2H88 A;  3F8P A;  4EMJ A;  1D4E A;  2X8H A;  2GF3 A;  3KPF A;  1Q1R A;  3AE5 A;  5EB4 A;  1EL8 A;  2YWL A;  5KVH A;  2BS2 A;  4JN9 A;  2YG5 A;  4H2R A;  1DJQ A;  4Y4N A;  4IA5 A;  1F3P A;  1YQ3 A;  4EQX A;  3GRS A;  1TRB A;  4RG4 A;  2GRT A;  2XVJ A;  5FS6 A;  3COX A;  3KVE A;  1CC4 A;  1GRH A;  1LTX R;  4Z43 A;  5JCM A;  2J3N A;  3EPT A;  1GES A;  1GSN A;  4Z2T A;  1LJ1 A;  3ALJ A;  4X9N A;  5HHF A;  4C74 A;  3RHA A;  4GUV A;  4J2W A;  2BK4 A;  4H7U A;  4DGK A;  5JCL A;  3NGC X;  1DJN A;  3UTE A;  4A6N A;  2OA1 A;  2RAB A;  4K7Z A;  1X31 B;  2VVL A;  4U8L A;  4H4U A;  2R4E A;  3RED A;  1E1L A;  1KFY A;  1DXL A;  1Q1W A;  2A89 A;  4JQ9 A;  3GSI A;  4IVO B;  2TMD A;  1MO9 A;  5BUL A;  4H2Q A;  2O9Z A;  3P4P A;  3AYJ A;  1ELI A;  2NVK X;  3ALL A;  4DSG A;  1PN0 A;  3NTA A;  2ZZC A;  4KPR A;  3V3N A;  2YG7 A;  3C96 A;  1S3B A;  3GYI A;  5GSN A;  4B69 A;  4BK1 A;  3FPZ A;  4OPD A;  3AD7 B;  3NK2 X;  3VRB A;  4CBQ A;  3QSE A;  2XYO A;  1LQU A;  3AEB A;  3ICT A;  3AE1 A;  1TYP A;  1F8W A;  4U8K A;  4OCG A;  4LII A;  1GND A;  2WPF A;  1NPX A;  1ZMD A;  3VR9 A;  2WET A;  4PAB A;  1VG0 A;  2BCP A;  3AEC A;  4JDR A;  1CJ3 A;  2C70 A;  1B37 A;  2XCG A;  2YVG A;  2WDR A;  2GVC A;  3GDP A;  4AOS A;  2F5Z A;  5TR3 A;  3DK4 A;  3CNP A;  2WDQ A;  3V76 A;  1FOH A;  4B67 A;  2V5Z A;  2GAG B;  4Y4M A;  1S3E A;  3DJE A;  3DJJ A;  2VRM A;  3AE2 A;  2HQM A;  4CRT A;  1RP0 A;  1CC6 A;  3SGL A;  2Q0K A;  3DGH A;  3NKS A;  2B9W A;  2AR8 A;  3UP5 A;  2WPE A;  4TM4 A;  3GWF A;  1JNR A;  2C64 A;  2C66 A;  2YLS A;  3EAN A;  2CUL A;  1E6E A;  4NEV A;  5DBJ A;  3BI2 A;  3L8K A;  2GMJ A;  3K30 A;  4GF7 A;  3E1T A;  4U8P A;  3UKA A;  3G5R A;  1BGJ A;  5KVI A;  1FL2 A;  4YSY A;  5J7X A;  1D4C A;  1OJD A;  2YLT A;  3GYJ A;  2BS4 A;  5U25 A;  4EQR A;  2BAB A;  2WOV A;  1ZOV A;  2YM1 A;  3HZL A;  1DNC A;  4A65 A;  2B9X A;  3ISH A;  1ZKQ A;  4DSH A;  4B63 A;  3AE8 A;  3AEG A;  2R0C A;  3NN6 X;  4IV9 A;  1NHS A;  3GWD A;  2B76 A;  1JU2 A;  2QAE A;  3AE6 A;  3URH A;  2FJA A;  2FJB A;  3LOV A;  3AYL A;  2C67 A;  2V6O A;  4A5L A;  1GXF A;  3R9U A;  1JNZ A;  3D1C A;  2YLW A;  3RNM A;  3NK1 X;  1D7Y A;  2OLN A;  4MJW A;  4YSX A;  3CGC A;  2YVJ A;  4O5Q A;  4FDC B;  4U8N A;  2GV8 A;  2X8C A;  4EIQ A;  4CNJ A;  3SQP A;  1CHU A;  3QFB A;  4K22 A;  2R0P A;  1K0I A;  4NTC A;  3ICR A;  1Y56 B;  2R45 A;  2NPX A;  3D8X A;  4NTE A;  4LA1 A;  3AYI A;  5KOX A;  3ZDN A;  3I6D A;  1NHP A;  2BS3 A;  1GV4 A;  2R46 A;  3AED A;  3G5S A;  2GEW A;  1GT8 A;  1GRB A;  3I3L A;  1VDC A;  1VG9 A;  4OPG A;  3UKF A;  5C2T A;  1L9E A;  1PBC A;  4EIP A;  3BNM A;  4K5S A;  1N4V A;  1AOG A;  1GRA A;  1OJA A;  2YG4 A;  2WBA A;  1E1N A;  4ZCD A;  2RGJ A;  4YSZ A;  4CY6 A;  1EL7 A;  3FIM B;  4CY8 A;  1H6V A;  1H83 A;  4FK1 C;  2X99 A;  1DOE A;  2A8X A;  2YG3 A;  3AEF A;  1S2Q A;  4AT2 A;  3EAO A;  1L9D A;  3KKJ A;  4H4P A;  2E5V A;  4H4T A;  4GRT A;  1MXT A;  2ZZ0 A;  3BNU A;  3CPI G;  1REO A;  3CGD A;  2QA1 A;  2BA9 A;  2C72 A;  5C3J A;  1PS9 A;  2GQW A;  3KD9 A;  1GEU A;  2VZ2 A;  4YTM A;  4EM3 A;  2YLZ A;  4AP1 A;  2R0G A;  1LV0 A;  5HXI A;  3IHG A;  3QSM A;  5JCK A;  4Z25 A;  1TDE A;  1RSG A;  2C3D A;  3UTH A;  4HA6 A;  4A6N B;  5FS8 A;  1M6I A;  2IID A;  3VRD B;  4X9M A;  2EQ8 A;  1H81 A;  3AE3 A;  3GD3 A;  3NH3 X;  4J36 A;  4UDQ A;  1PJ7 A;  1QJD A;  1P2H A;  3K7Q X;  4H4V A;  2QCU A;  5BRT A;  1BF3 A;  3S5W A;  1BKW A;  1B5Q A;  4OPI A;  2C65 A;  4YT0 A;  1KF6 A;  4Z44 A;  2YLX A;  1GTH A;  1PJ6 A;  1CL0 A;  1DOC A;  1H84 A;  1F8R A;  1KNR A;  3AEE A;  1GRE A;  4H2P A;  3CND A;  4B64 A;  3VRA A;  3QFA A;  2YQU A;  3IF9 A;  1TDO A;  1OJ9 A;  1JRZ A;  1FEB A;  1ZDL A;  4OVI A;  3BI4 A;  5M0Z A;  5JCI A;  3H8I A;  2WP6 A;  4ZN0 A;  4H50 A;  4D03 A;  4J33 A;  1IUW A;  3AB1 A;  2BXS A;  1ZOY A;  2APG A;  3K7M X;  2OAL A;  4TM3 A;  2WES A;  4EMW A;  1E7P A;  2Y6Q A;  4KX6 A;  4RSL A;  3S61 A;  2C75 A;  4ECH A;  1NEN A;  4RG3 A;  1IUU A;  1Z6L A;  2YR6 A;  3Q6J A;  4JNA A;  1SEZ A;  4E0V A;  4WCT A;  3AXB A;  3NLC A;  1YKJ A;  1N1P A;  3II4 A;  2WS3 A;  4NEW A;  3GD4 A;  1L0V A;  2Z5X A;  3ITJ A;  4HB9 A;  2OLO A;  1NG4 A;  5BVA A;  3CIR A;  4ICY A;  4JY2 A;  4C5O A;  1NG3 A;  3C4N A;  4J56 A;  4XWZ A;  3RP6 A;  3NG7 X;  5CQF A;  4EQW A;  2XLP A;  3AE7 A;  3NYE A;  1GPE A;  1F6M A;  1ZX9 A;  5U63 A;  4C3Y A;  4UP3 A;  1N4W A;  4J57 A;  1CJ2 A;  4H2N A;  2WU5 A;  1H7W A;  4DNA A;  1KDG A;  5BUK A;  3G5Q A;  2X50 A;  3UKQ A;  2FJE A;  4FX9 A;  2XLR A;  1F8S A;  5LV9 A;  2V3B A;  4C3X A;  1IUT A;  3QVP A;  3VR8 A;  1E1K A;  5FS9 A;  2R9Z A;  2CVJ A;  3QSS A;  2YG6 A;  3UKL A;  1H7X A;  5M10 A;  2BC1 A;  3ADA B;  3FG2 P;  4P9S A;  2RGH A;  2BCG G;  1DOB A;  3AWI A;  3IHM A;  3V3O A;  4ADW A;  3M13 A;  4H4X A;  4H4Y A;  2VQ7 A;  1PBB A;  2IVE A;  4UDR A;  1GTE A;  4X4J A;  3L1R A;  4BJY A;  4C77 A;  3QVR A;  4B68 A;  4A9W A;  3UKH A;  3IWA A;  5IQ4 A;  5HY5 A;  3H4K A;  1PBF A;  4K8D A;  2DKI A;  2Q6U A;  1GOS A;  3LJP A;  3ABV A;  3UOZ A;  4A99 A;  3ZYX A;  5IPY A;  3ATR A;  3NRN A;  3ATQ A;  2QA2 A;  2C76 A;  3CPJ G;  3NT6 A;  1GRT A;  4J34 A;  5U1O A;  1PXB A;  1RYI A;  2GB0 A;  4BUR A;  1B8S A;  3NTD A;  2V61 A;  1D5T A;  4APN A;  3DH9 A;  2XFQ A;  3ICS A;  4M52 A;  1IJH A;  3AD8 B;  2AQJ A;  4N9X A;  1GRG A;  1JEH A;  5ER0 A;  1ZY8 A;  2JK6 A;  4U8O A;  1VRQ B;  4U8M A;  4YKG A;  2Z5Y A;  1K0J A;  3NHO X;  3NN0 X;  3NYF A;  2YR4 A;  1KSU A;  3DK8 A;  4AT0 A;  2GQF A;  2XLS A;  1E39 A;  2JKC A;  3DA1 A;  4TM1 A;  3UKK A;  2GH5 A;  4BJZ A;  2XVF A;  2WP5 A;  1YQ4 A;  3VQR A;  3P9U A;  1ZK7 A;  3BI5 A;  3DGZ A;  3UOV A;  2VRL A;  1TYT A;  4U2T A;  1NEK A;  1EL5 A;  4EQS A;  2TPR A;  3UOX A;  4BK3 A;  2E4G A;  2BK5 A;  3CGB A;  4YKF A;  1L9C A;  3FMW A;  2ACZ A;  3IC9 A;  2ARD A;  4YTN A;  1PXC A;  2FBW A;  3DME A;  3QJ4 A;  1B4V A;  3NNE A;  3KA7 A;  1O95 A;  1QLB A;  2YAU A;  3CN8 A;  4ZCC A;  4NZH A;  4IA6 A;  1JOA A;  1NHR A;  2GR0 A;  5FMH A;  3LZW A;  3O0H A;  1BZL A;  2FJD A;  4OPL A;  2H89 A;  3EF6 A;  5KRQ A;  2YR5 A;  1NDA A;  1NAA A;  2EQ7 A;  2BYB A;  3GDN A;  4OPC A;  4CNK A;  4REK A;  1CBO A;  3LAD A;  1GER A;  2JB2 A;  1FCD A;  2ZBW A;  3CTY A;  4Z2U A;  4J31 A;  2XVE A;  3CGE A;  3CNS A;  1XPQ A;  4Z26 A;  4U8J A;  3OC4 A;  1OJC A;  2E1M A;  1YY5 A;  1ZMC A;  1GAL A;  1P2E A;  4XWR A;  5J60 A;  3LXD A;  3RP7 A;  1KSS A;  1H82 A;  1PXA A;  4YSH A;  2UZZ A;  4IVM B;  1O5W A;  1K0L A;  4I58 A;  3UKP A;  1LQT A;  1M64 A;  4H4W A;  2XFN A;  3PO7 A;  4D04 A;  1BWC A;  2B9Y A;  2XFP A;  2WOI A;  2B7R A;  5EOW A;  1GET A;  4Z2R A;  1EL9 A;  3GMC A;  2A87 A;  2JAE A;  2CFY A;  1S2Y A;  5JCN A;  3PVC A;  5FS7 A;  4USR A;  3LZX A;  2GMH A;  2XFU A;  4A7A A;  1XHC A;  1COY A;  3SFE A;  3UP4 A;  4LU6 A;  3P4S A;  5CKU A;  5KWF A;  2Y6R A;  2EQ6 A;  3ALM A;  2V3A A;  2WQY A;  2ZZB A;  3B6D A;  3GMB A;  5L46 A;  3B3R A;  2C3C A;  4Z24 A;  1Q9I A;  1CJC A;  3F8R A;  3P4Q A;  4JNQ A;  3LB8 A;  5EB5 A;  5HYM A;  4U8I A;  2JB1 A;  2BK3 A;  2VOU A;  2DKH A;  1EBD A;  1PBE A;  3AEA A;  4H4Q A;  5KOW A;  2YLR A;  1TDN A;  3F8D A;  1IUV A;  4BV6 A;  3RP8 A;  4PAA A;  2BC0 A;  3AE4 A;  2AAQ A;  1H86 A;  4B65 A;  4K2X A;  1O94 A;  2EQ9 A;  4FK1 A;  1VQW A;  3JSK A;  3OZ2 A;  4UDP A;  1Y0P A;  2V60 A;  2GR1 A;  1PDH A;  4H4R A;  2XDO A;  2Q0L A;  2VVL G;  1QO8 A;  2VQB A;  3WE0 A;  4I59 A;  4OPU A;  1TDK A;  1IUS A;  4TM0 A;  3NK0 X;  2WU2 A;  2VVM A;  2I0Z A;  4USQ A;  1W4X A;  1XAN A;  1CC2 A;  1HYU A;  3KU9 A;  2YVF A;  2PYX A;  2CDU A;  3C4A A;  4GR1 A;  3CNJ A;  1BGN A;  1PJ5 A;  5GRT A;  1IUX A;  2GAH B;  1JRY A;  4A79 A;  4AOX A;  3DJG X;  3BHF A;  3K7T A;  3M0O A;  3UOY A;  2B7S A;  4JY3 A;  1FEA A;  3SFD A;  1E1M A;  2YM2 A;  3GRT A;  5IQ1 A;  4CCQ A;  3NYC A;  1KNP A;  1LVL A;  3CNT A;  2XLU A;  4YWO A;  3M12 A;  4CCR A;  2WEU A;  1ONF A;  2WHD A;  3Q9T A;  2WP9 A;  2BAC A;  3UCL A;  2JB3 A;  5KXJ A;  3KLJ A;  1MOK A;  3AD9 B;  1CJ4 A;  2R4J A;  2WDV A;  4EM4 A;  1TDF A;  4EMI A;  3BHK A;  4GCM A;  4YXD A;  3NIX A;  4NTD A; 
#chains in the Genus database with same CATH topology
 3P1W A;  2GR3 A;  2JBV A;  2RGO A;  4Y4L A;  2C73 A;  4WX1 A;  1OJT A;  2X8G A;  3T37 A;  4BK2 A;  1PHH A;  2IVD A;  3UTF A;  2BXR A;  2PHH A;  4OPT A;  2W0H A;  2XFO A;  1N4U A;  3DK9 A;  4O5U A;  2WPC A;  1JRX A;  3CPH G;  4B1B A;  1ZP0 A;  1V59 A;  1YQZ A;  4K5R A;  2GR2 A;  1DOD A;  3PS9 A;  3UTG A;  3P4R A;  2XVI A;  2C4C A;  1NHQ A;  4YTP A;  4B66 A;  2X3N A;  3DJD A;  1Y56 A;  3T31 A;  3H8L A;  3AE9 A;  1LPF A;  1D7L A;  4TLZ A;  4XXG A;  2OAM A;  2XLT A;  4GDE A;  4GDP A;  1CF3 A;  2XVH A;  4H4Z A;  4TLX A;  5EBK A;  1PBD A;  4U2L A;  1UKV G;  4H4S A;  2C7G A;  4U2S A;  1XDI A;  3SM8 A;  2Q7V A;  2WOW A;  4AP3 A;  3FBS A;  1D4D A;  1K4Q A;  1FEC A;  1GRF A;  2H88 A;  3F8P A;  4EMJ A;  1D4E A;  2X8H A;  4G74 A;  2GF3 A;  3KPF A;  1Q1R A;  3AE5 A;  5EB4 A;  1EL8 A;  2YWL A;  5KVH A;  2BS2 A;  4JN9 A;  2YG5 A;  4H2R A;  1DJQ A;  4Y4N A;  4IA5 A;  1F3P A;  1YQ3 A;  3SY4 A;  3T0K A;  4EQX A;  3GRS A;  1TRB A;  4RG4 A;  2GRT A;  2XVJ A;  5FS6 A;  3COX A;  3KVE A;  1CC4 A;  1GRH A;  1LTX R;  4Z43 A;  5JCM A;  2J3N A;  3EPT A;  1GES A;  1GSN A;  4Z2T A;  1LJ1 A;  3ALJ A;  4II2 A;  4X9N A;  5HHF A;  2BRA A;  4C74 A;  3RHA A;  4GUV A;  4J2W A;  4II3 A;  2BK4 A;  4H7U A;  4DGK A;  5JCL A;  3NGC X;  1DJN A;  3UTE A;  4A6N A;  2OA1 A;  4GAP A;  2RAB A;  4K7Z A;  1X31 B;  2VVL A;  4U8L A;  4H4U A;  2R4E A;  3RED A;  1E1L A;  1KFY A;  1DXL A;  1Q1W A;  2A89 A;  4JQ9 A;  3GSI A;  4IVO B;  2TMD A;  1MO9 A;  3HYX A;  5BUL A;  4H2Q A;  2O9Z A;  3P4P A;  3AYJ A;  1ELI A;  2NVK X;  3ALL A;  4DSG A;  1PN0 A;  3NTA A;  2ZZC A;  4KPR A;  3V3N A;  2YG7 A;  3C96 A;  1S3B A;  3GYI A;  5GSN A;  4B69 A;  4BK1 A;  3FPZ A;  4OPD A;  3AD7 B;  3NK2 X;  3VRB A;  4CBQ A;  3QSE A;  2XYO A;  1LQU A;  3AEB A;  3ICT A;  3AE1 A;  1TYP A;  1F8W A;  4U8K A;  4OCG A;  4LII A;  1GND A;  2WPF A;  1NPX A;  1ZMD A;  3VR9 A;  2WET A;  4PAB A;  1VG0 A;  2BCP A;  3AEC A;  4JDR A;  1CJ3 A;  2C70 A;  1B37 A;  2XCG A;  2YVG A;  2WDR A;  2GVC A;  3GDP A;  4AOS A;  2F5Z A;  5TR3 A;  3DK4 A;  3CNP A;  2WDQ A;  3V76 A;  1FOH A;  4B67 A;  2V5Z A;  2GAG B;  4Y4M A;  1S3E A;  3DJE A;  3DJJ A;  2VRM A;  3AE2 A;  2HQM A;  4CRT A;  1RP0 A;  1CC6 A;  3SGL A;  2Q0K A;  3DGH A;  3NKS A;  2B9W A;  2AR8 A;  3UP5 A;  2WPE A;  4TM4 A;  3GWF A;  1JNR A;  2C64 A;  2C66 A;  2YLS A;  3EAN A;  2CUL A;  1E6E A;  4NEV A;  5DBJ A;  3BI2 A;  3L8K A;  2GMJ A;  3K30 A;  4GF7 A;  3E1T A;  4U8P A;  3GYX A;  3UKA A;  3G5R A;  1BGJ A;  5KVI A;  1FL2 A;  4YSY A;  5J7X A;  1D4C A;  1OJD A;  2YLT A;  3GYJ A;  2BS4 A;  5U25 A;  4EQR A;  2BAB A;  2WOV A;  1ZOV A;  2YM1 A;  3HZL A;  1DNC A;  4A65 A;  2B9X A;  3ISH A;  1ZKQ A;  4DSH A;  4B63 A;  3AE8 A;  3AEG A;  5KMP A;  2R0C A;  3NN6 X;  4IV9 A;  1NHS A;  3GWD A;  2B76 A;  1JU2 A;  2QAE A;  3AE6 A;  3URH A;  2FJA A;  2FJB A;  3LOV A;  3AYL A;  2C67 A;  2V6O A;  4A5L A;  1GXF A;  3R9U A;  1JNZ A;  3D1C A;  2YLW A;  3RNM A;  3NK1 X;  1D7Y A;  2OLN A;  4MJW A;  4YSX A;  3CGC A;  5KMS A;  2YVJ A;  4O5Q A;  4FDC B;  4U8N A;  2GV8 A;  2X8C A;  4EIQ A;  4CNJ A;  3SQP A;  1CHU A;  3QFB A;  4K22 A;  2R0P A;  1K0I A;  4NTC A;  3SXI A;  3ICR A;  1Y56 B;  2R45 A;  2NPX A;  3D8X A;  4NTE A;  4LA1 A;  3AYI A;  5KOX A;  3HYW A;  3I6D A;  3ZDN A;  1NHP A;  2BS3 A;  1GV4 A;  2R46 A;  3AED A;  3G5S A;  2GEW A;  1GT8 A;  1GRB A;  3I3L A;  1VDC A;  1VG9 A;  4OPG A;  3UKF A;  5C2T A;  1L9E A;  1PBC A;  4EIP A;  3BNM A;  4K5S A;  1N4V A;  3T2Z A;  1AOG A;  1GRA A;  1OJA A;  2YG4 A;  2WBA A;  1E1N A;  4ZCD A;  2RGJ A;  4YSZ A;  4CY6 A;  1EL7 A;  3FIM B;  3T2Y A;  1H6V A;  1H83 A;  4CY8 A;  4FK1 C;  2X99 A;  1DOE A;  2A8X A;  2YG3 A;  5KNL A;  3AEF A;  1S2Q A;  4AT2 A;  3EAO A;  1L9D A;  3KKJ A;  4H4P A;  2E5V A;  4H4T A;  4GRT A;  1MXT A;  2ZZ0 A;  3BNU A;  5KMQ A;  3CPI G;  1REO A;  3CGD A;  3CMM A;  2QA1 A;  2BA9 A;  2C72 A;  5C3J A;  1PS9 A;  2GQW A;  3KD9 A;  1GEU A;  2VZ2 A;  4YTM A;  4EM3 A;  2YLZ A;  4AP1 A;  2R0G A;  1LV0 A;  5HXI A;  3IHG A;  3QSM A;  4GAV A;  5JCK A;  4Z25 A;  1TDE A;  1RSG A;  2C3D A;  3UTH A;  4HA6 A;  4A6N B;  5FS8 A;  1M6I A;  2IID A;  3SZC A;  3VRD B;  4X9M A;  2EQ8 A;  1H81 A;  3AE3 A;  3GD3 A;  3NH3 X;  4J36 A;  4UDQ A;  1PJ7 A;  1QJD A;  1P2H A;  3K7Q X;  4H4V A;  2QCU A;  5BRT A;  1BF3 A;  3S5W A;  1BKW A;  1B5Q A;  4OPI A;  2C65 A;  4YT0 A;  1KF6 A;  4Z44 A;  2YLX A;  1GTH A;  1PJ6 A;  1CL0 A;  1DOC A;  1H84 A;  1F8R A;  1KNR A;  3AEE A;  1GRE A;  4H2P A;  3CND A;  4B64 A;  3VRA A;  3QFA A;  2YQU A;  3IF9 A;  1TDO A;  1OJ9 A;  1JRZ A;  1FEB A;  1ZDL A;  4OVI A;  3BI4 A;  5M0Z A;  5JCI A;  3H8I A;  2WP6 A;  4ZN0 A;  4H50 A;  4D03 A;  4J33 A;  1IUW A;  3AB1 A;  2BXS A;  1ZOY A;  2APG A;  3K7M X;  2OAL A;  4TM3 A;  2WES A;  4EMW A;  1E7P A;  2Y6Q A;  4KX6 A;  4RSL A;  3S61 A;  2C75 A;  4ECH A;  1NEN A;  4RG3 A;  3SZF A;  1IUU A;  1Z6L A;  2YR6 A;  3Q6J A;  4JNA A;  1SEZ A;  4E0V A;  4WCT A;  3AXB A;  3NLC A;  1YKJ A;  1N1P A;  3II4 A;  2WS3 A;  4NEW A;  3GD4 A;  1L0V A;  2Z5X A;  3ITJ A;  4HB9 A;  2OLO A;  1NG4 A;  5BVA A;  3KPK A;  3CIR A;  4ICY A;  4JY2 A;  4C5O A;  1NG3 A;  3C4N A;  4J56 A;  4XWZ A;  3RP6 A;  3NG7 X;  5CQF A;  4EQW A;  2XLP A;  3AE7 A;  3NYE A;  1GPE A;  1F6M A;  1ZX9 A;  5U63 A;  4C3Y A;  4UP3 A;  1N4W A;  4J57 A;  4G6G A;  1CJ2 A;  4H2N A;  2WU5 A;  1H7W A;  4DNA A;  1KDG A;  5BUK A;  3G5Q A;  2X50 A;  3UKQ A;  2FJE A;  4FX9 A;  2XLR A;  1F8S A;  5LV9 A;  2V3B A;  4C3X A;  1IUT A;  3QVP A;  3VR8 A;  1E1K A;  5FS9 A;  3SZ0 A;  2R9Z A;  2CVJ A;  3QSS A;  2YG6 A;  4G6H A;  1H7X A;  3UKL A;  2BC1 A;  5M10 A;  3ADA B;  3FG2 P;  4P9S A;  2RGH A;  2BCG G;  1DOB A;  3AWI A;  3IHM A;  3V3O A;  4ADW A;  3M13 A;  4H4X A;  4H4Y A;  2VQ7 A;  1PBB A;  2IVE A;  4UDR A;  1GTE A;  4X4J A;  3L1R A;  4BJY A;  4C77 A;  3QVR A;  4B68 A;  4A9W A;  3UKH A;  3IWA A;  5IQ4 A;  5HY5 A;  3H4K A;  1PBF A;  4K8D A;  2DKI A;  2Q6U A;  1GOS A;  3LJP A;  3ABV A;  3UOZ A;  4A99 A;  3ZYX A;  5IPY A;  3ATR A;  3NRN A;  2BRY A;  3ATQ A;  2QA2 A;  2C76 A;  3CPJ G;  3NT6 A;  1GRT A;  4J34 A;  5U1O A;  1PXB A;  1RYI A;  2GB0 A;  4BUR A;  1B8S A;  3NTD A;  2V61 A;  1D5T A;  4APN A;  3DH9 A;  2XFQ A;  3ICS A;  4M52 A;  1IJH A;  3AD8 B;  2AQJ A;  4NWZ A;  4N9X A;  1GRG A;  3HYV A;  1JEH A;  5ER0 A;  1ZY8 A;  2JK6 A;  4U8O A;  1VRQ B;  4U8M A;  4YKG A;  2Z5Y A;  1K0J A;  3NHO X;  3NN0 X;  3NYF A;  2YR4 A;  1KSU A;  3DK8 A;  4AT0 A;  2GQF A;  2XLS A;  1E39 A;  2JKC A;  3DA1 A;  4TM1 A;  3UKK A;  2GH5 A;  4BJZ A;  2XVF A;  2WP5 A;  1YQ4 A;  3VQR A;  3P9U A;  1ZK7 A;  3BI5 A;  3DGZ A;  3UOV A;  2VRL A;  1TYT A;  4U2T A;  1NEK A;  1EL5 A;  4EQS A;  2TPR A;  3UOX A;  4BK3 A;  2E4G A;  2BK5 A;  3CGB A;  4YKF A;  1L9C A;  3FMW A;  2ACZ A;  3IC9 A;  2ARD A;  4YTN A;  1PXC A;  2FBW A;  3DME A;  3QJ4 A;  1B4V A;  3NNE A;  3KA7 A;  1O95 A;  1QLB A;  2YAU A;  3CN8 A;  4ZCC A;  4NZH A;  4IA6 A;  1JOA A;  4G9K A;  1NHR A;  2GR0 A;  5FMH A;  3LZW A;  3O0H A;  1BZL A;  2FJD A;  4OPL A;  2H89 A;  3EF6 A;  5KRQ A;  2YR5 A;  4NNJ A;  1NDA A;  1NAA A;  2EQ7 A;  2BYB A;  3GDN A;  4OPC A;  4CNK A;  4REK A;  1CBO A;  3LAD A;  1GER A;  2JB2 A;  1FCD A;  2ZBW A;  3CTY A;  4Z2U A;  3T14 A;  4J31 A;  2XVE A;  3CGE A;  3CNS A;  1XPQ A;  4Z26 A;  4U8J A;  3OC4 A;  1OJC A;  3SZW A;  2E1M A;  1YY5 A;  1ZMC A;  1GAL A;  4G73 A;  1P2E A;  4XWR A;  5J60 A;  3LXD A;  3RP7 A;  1KSS A;  1H82 A;  1PXA A;  4YSH A;  2UZZ A;  4IVM B;  1O5W A;  1K0L A;  4I58 A;  3UKP A;  3SX6 A;  1LQT A;  1M64 A;  4H4W A;  2XFN A;  3PO7 A;  4D04 A;  1BWC A;  2B9Y A;  2XFP A;  2WOI A;  2B7R A;  5EOW A;  1GET A;  4Z2R A;  1EL9 A;  3GMC A;  2A87 A;  2JAE A;  2CFY A;  1S2Y A;  5JCN A;  3PVC A;  5FS7 A;  5KMR A;  4USR A;  3LZX A;  2GMH A;  2XFU A;  4A7A A;  1XHC A;  1COY A;  3SFE A;  3UP4 A;  4LU6 A;  3P4S A;  5CKU A;  5KWF A;  2Y6R A;  2EQ6 A;  3ALM A;  2V3A A;  2WQY A;  2ZZB A;  3B6D A;  3GMB A;  5L46 A;  3B3R A;  2C3C A;  4Z24 A;  1Q9I A;  1CJC A;  3F8R A;  3P4Q A;  4JNQ A;  3LB8 A;  5EB5 A;  5HYM A;  4U8I A;  2JB1 A;  2BK3 A;  2VOU A;  2DKH A;  1EBD A;  1PBE A;  3AEA A;  4H4Q A;  3T2K A;  5KOW A;  2YLR A;  1TDN A;  3F8D A;  1IUV A;  4BV6 A;  3RP8 A;  4PAA A;  2BC0 A;  3AE4 A;  2AAQ A;  1H86 A;  4B65 A;  4K2X A;  1O94 A;  2EQ9 A;  4FK1 A;  1VQW A;  3JSK A;  3OZ2 A;  4UDP A;  1Y0P A;  3SYI A;  2V60 A;  2GR1 A;  1PDH A;  4H4R A;  2XDO A;  2Q0L A;  2VVL G;  1QO8 A;  2VQB A;  3WE0 A;  4I59 A;  4OPU A;  1TDK A;  1IUS A;  4TM0 A;  3NK0 X;  2WU2 A;  2VVM A;  2I0Z A;  4USQ A;  1W4X A;  1XAN A;  1CC2 A;  1HYU A;  3KU9 A;  2YVF A;  2PYX A;  2CDU A;  3C4A A;  4GR1 A;  3CNJ A;  1BGN A;  1PJ5 A;  5GRT A;  1IUX A;  2GAH B;  1JRY A;  4A79 A;  4AOX A;  3DJG X;  3BHF A;  3K7T A;  3M0O A;  3UOY A;  2B7S A;  4JY3 A;  1FEA A;  3SFD A;  1E1M A;  2YM2 A;  3GRT A;  5IQ1 A;  4CCQ A;  3NYC A;  1KNP A;  1LVL A;  3CNT A;  2XLU A;  4YWO A;  3M12 A;  4CCR A;  2WEU A;  1ONF A;  2WHD A;  3Q9T A;  2WP9 A;  2BAC A;  3UCL A;  2JB3 A;  5KXJ A;  3KLJ A;  1MOK A;  3AD9 B;  1CJ4 A;  2R4J A;  2WDV A;  4EM4 A;  1TDF A;  4EMI A;  3BHK A;  4GCM A;  4YXD A;  3NIX A;  4NTD A; 
#chains in the Genus database with same CATH homology
 3P1W A;  2GR3 A;  2JBV A;  2RGO A;  4Y4L A;  2C73 A;  4WX1 A;  1OJT A;  2X8G A;  3T37 A;  4BK2 A;  1PHH A;  2IVD A;  3UTF A;  2BXR A;  2PHH A;  4OPT A;  2W0H A;  2XFO A;  1N4U A;  3DK9 A;  4O5U A;  2WPC A;  1JRX A;  3CPH G;  4B1B A;  1ZP0 A;  1V59 A;  1YQZ A;  4K5R A;  2GR2 A;  1DOD A;  3PS9 A;  3UTG A;  3P4R A;  2XVI A;  2C4C A;  1NHQ A;  4YTP A;  4B66 A;  2X3N A;  3DJD A;  1Y56 A;  3T31 A;  3H8L A;  3AE9 A;  1LPF A;  1D7L A;  4TLZ A;  4XXG A;  2OAM A;  2XLT A;  4GDE A;  4GDP A;  1CF3 A;  2XVH A;  4H4Z A;  4TLX A;  5EBK A;  1PBD A;  4U2L A;  1UKV G;  4H4S A;  2C7G A;  4U2S A;  1XDI A;  3SM8 A;  2Q7V A;  2WOW A;  4AP3 A;  3FBS A;  1D4D A;  1K4Q A;  1FEC A;  1GRF A;  2H88 A;  3F8P A;  4EMJ A;  1D4E A;  2X8H A;  4G74 A;  2GF3 A;  3KPF A;  1Q1R A;  3AE5 A;  5EB4 A;  1EL8 A;  2YWL A;  5KVH A;  2BS2 A;  4JN9 A;  2YG5 A;  4H2R A;  1DJQ A;  4Y4N A;  4IA5 A;  1F3P A;  1YQ3 A;  3SY4 A;  3T0K A;  4EQX A;  3GRS A;  1TRB A;  4RG4 A;  2GRT A;  2XVJ A;  5FS6 A;  3COX A;  3KVE A;  1CC4 A;  1GRH A;  1LTX R;  4Z43 A;  5JCM A;  2J3N A;  3EPT A;  1GES A;  1GSN A;  4Z2T A;  1LJ1 A;  3ALJ A;  4II2 A;  4X9N A;  5HHF A;  2BRA A;  4C74 A;  3RHA A;  4GUV A;  4J2W A;  4II3 A;  2BK4 A;  4H7U A;  4DGK A;  5JCL A;  3NGC X;  1DJN A;  3UTE A;  4A6N A;  2OA1 A;  4GAP A;  2RAB A;  4K7Z A;  1X31 B;  2VVL A;  4U8L A;  4H4U A;  2R4E A;  3RED A;  1E1L A;  1KFY A;  1DXL A;  1Q1W A;  2A89 A;  4JQ9 A;  3GSI A;  4IVO B;  2TMD A;  1MO9 A;  3HYX A;  5BUL A;  4H2Q A;  2O9Z A;  3P4P A;  3AYJ A;  1ELI A;  2NVK X;  3ALL A;  4DSG A;  1PN0 A;  3NTA A;  2ZZC A;  4KPR A;  3V3N A;  2YG7 A;  3C96 A;  1S3B A;  3GYI A;  5GSN A;  4B69 A;  4BK1 A;  3FPZ A;  4OPD A;  3AD7 B;  3NK2 X;  3VRB A;  4CBQ A;  3QSE A;  2XYO A;  1LQU A;  3AEB A;  3ICT A;  3AE1 A;  1TYP A;  1F8W A;  4U8K A;  4OCG A;  4LII A;  1GND A;  2WPF A;  1NPX A;  1ZMD A;  3VR9 A;  2WET A;  4PAB A;  1VG0 A;  2BCP A;  3AEC A;  4JDR A;  1CJ3 A;  2C70 A;  1B37 A;  2XCG A;  2YVG A;  2WDR A;  2GVC A;  3GDP A;  4AOS A;  2F5Z A;  5TR3 A;  3DK4 A;  3CNP A;  2WDQ A;  3V76 A;  1FOH A;  4B67 A;  2V5Z A;  2GAG B;  4Y4M A;  1S3E A;  3DJE A;  3DJJ A;  2VRM A;  3AE2 A;  2HQM A;  4CRT A;  1RP0 A;  1CC6 A;  3SGL A;  2Q0K A;  3DGH A;  3NKS A;  2B9W A;  2AR8 A;  3UP5 A;  2WPE A;  4TM4 A;  3GWF A;  1JNR A;  2C64 A;  2C66 A;  2YLS A;  3EAN A;  2CUL A;  1E6E A;  4NEV A;  5DBJ A;  3BI2 A;  3L8K A;  2GMJ A;  3K30 A;  4GF7 A;  3E1T A;  4U8P A;  3GYX A;  3UKA A;  3G5R A;  1BGJ A;  5KVI A;  1FL2 A;  4YSY A;  5J7X A;  1D4C A;  1OJD A;  2YLT A;  3GYJ A;  2BS4 A;  5U25 A;  4EQR A;  2BAB A;  2WOV A;  1ZOV A;  2YM1 A;  3HZL A;  1DNC A;  4A65 A;  2B9X A;  3ISH A;  1ZKQ A;  4DSH A;  4B63 A;  3AE8 A;  3AEG A;  5KMP A;  2R0C A;  3NN6 X;  4IV9 A;  1NHS A;  3GWD A;  2B76 A;  1JU2 A;  2QAE A;  3AE6 A;  3URH A;  2FJA A;  2FJB A;  3LOV A;  3AYL A;  2C67 A;  2V6O A;  4A5L A;  1GXF A;  3R9U A;  1JNZ A;  3D1C A;  2YLW A;  3RNM A;  3NK1 X;  1D7Y A;  2OLN A;  4MJW A;  4YSX A;  3CGC A;  5KMS A;  2YVJ A;  4O5Q A;  4FDC B;  4U8N A;  2GV8 A;  2X8C A;  4EIQ A;  4CNJ A;  3SQP A;  1CHU A;  3QFB A;  4K22 A;  2R0P A;  1K0I A;  4NTC A;  3SXI A;  3ICR A;  1Y56 B;  2R45 A;  2NPX A;  3D8X A;  4NTE A;  4LA1 A;  3AYI A;  5KOX A;  3HYW A;  3I6D A;  3ZDN A;  1NHP A;  2BS3 A;  1GV4 A;  2R46 A;  3AED A;  3G5S A;  2GEW A;  1GT8 A;  1GRB A;  3I3L A;  1VDC A;  1VG9 A;  4OPG A;  3UKF A;  5C2T A;  1L9E A;  1PBC A;  4EIP A;  3BNM A;  4K5S A;  1N4V A;  3T2Z A;  1AOG A;  1GRA A;  1OJA A;  2YG4 A;  2WBA A;  1E1N A;  4ZCD A;  2RGJ A;  4YSZ A;  4CY6 A;  1EL7 A;  3FIM B;  3T2Y A;  1H6V A;  1H83 A;  4CY8 A;  4FK1 C;  2X99 A;  1DOE A;  2A8X A;  2YG3 A;  5KNL A;  3AEF A;  1S2Q A;  4AT2 A;  3EAO A;  1L9D A;  3KKJ A;  4H4P A;  2E5V A;  4H4T A;  4GRT A;  1MXT A;  2ZZ0 A;  3BNU A;  5KMQ A;  3CPI G;  1REO A;  3CGD A;  3CMM A;  2QA1 A;  2BA9 A;  2C72 A;  5C3J A;  1PS9 A;  2GQW A;  3KD9 A;  1GEU A;  2VZ2 A;  4YTM A;  4EM3 A;  2YLZ A;  4AP1 A;  2R0G A;  1LV0 A;  5HXI A;  3IHG A;  3QSM A;  4GAV A;  5JCK A;  4Z25 A;  1TDE A;  1RSG A;  2C3D A;  3UTH A;  4HA6 A;  4A6N B;  5FS8 A;  1M6I A;  2IID A;  3SZC A;  3VRD B;  4X9M A;  2EQ8 A;  1H81 A;  3AE3 A;  3GD3 A;  3NH3 X;  4J36 A;  4UDQ A;  1PJ7 A;  1QJD A;  1P2H A;  3K7Q X;  4H4V A;  2QCU A;  5BRT A;  1BF3 A;  3S5W A;  1BKW A;  1B5Q A;  4OPI A;  2C65 A;  4YT0 A;  1KF6 A;  4Z44 A;  2YLX A;  1GTH A;  1PJ6 A;  1CL0 A;  1DOC A;  1H84 A;  1F8R A;  1KNR A;  3AEE A;  1GRE A;  4H2P A;  3CND A;  4B64 A;  3VRA A;  3QFA A;  2YQU A;  3IF9 A;  1TDO A;  1OJ9 A;  1JRZ A;  1FEB A;  1ZDL A;  4OVI A;  3BI4 A;  5M0Z A;  5JCI A;  3H8I A;  2WP6 A;  4ZN0 A;  4H50 A;  4D03 A;  4J33 A;  1IUW A;  3AB1 A;  2BXS A;  1ZOY A;  2APG A;  3K7M X;  2OAL A;  4TM3 A;  2WES A;  4EMW A;  1E7P A;  2Y6Q A;  4KX6 A;  4RSL A;  3S61 A;  2C75 A;  4ECH A;  1NEN A;  4RG3 A;  3SZF A;  1IUU A;  1Z6L A;  2YR6 A;  3Q6J A;  4JNA A;  1SEZ A;  4E0V A;  4WCT A;  3AXB A;  3NLC A;  1YKJ A;  1N1P A;  3II4 A;  2WS3 A;  4NEW A;  3GD4 A;  1L0V A;  2Z5X A;  3ITJ A;  4HB9 A;  2OLO A;  1NG4 A;  5BVA A;  3KPK A;  3CIR A;  4ICY A;  4JY2 A;  4C5O A;  1NG3 A;  3C4N A;  4J56 A;  4XWZ A;  3RP6 A;  3NG7 X;  5CQF A;  4EQW A;  2XLP A;  3AE7 A;  3NYE A;  1GPE A;  1F6M A;  1ZX9 A;  5U63 A;  4C3Y A;  4UP3 A;  1N4W A;  4J57 A;  4G6G A;  1CJ2 A;  4H2N A;  2WU5 A;  1H7W A;  4DNA A;  1KDG A;  5BUK A;  3G5Q A;  2X50 A;  3UKQ A;  2FJE A;  4FX9 A;  2XLR A;  1F8S A;  5LV9 A;  2V3B A;  4C3X A;  1IUT A;  3QVP A;  3VR8 A;  1E1K A;  5FS9 A;  3SZ0 A;  2R9Z A;  2CVJ A;  3QSS A;  2YG6 A;  4G6H A;  1H7X A;  3UKL A;  2BC1 A;  5M10 A;  3ADA B;  3FG2 P;  4P9S A;  2RGH A;  2BCG G;  1DOB A;  3AWI A;  3IHM A;  3V3O A;  4ADW A;  3M13 A;  4H4X A;  4H4Y A;  2VQ7 A;  1PBB A;  2IVE A;  4UDR A;  1GTE A;  4X4J A;  3L1R A;  4BJY A;  4C77 A;  3QVR A;  4B68 A;  4A9W A;  3UKH A;  3IWA A;  5IQ4 A;  5HY5 A;  3H4K A;  1PBF A;  4K8D A;  2DKI A;  2Q6U A;  1GOS A;  3LJP A;  3ABV A;  3UOZ A;  4A99 A;  3ZYX A;  5IPY A;  3ATR A;  3NRN A;  2BRY A;  3ATQ A;  2QA2 A;  2C76 A;  3CPJ G;  3NT6 A;  1GRT A;  4J34 A;  5U1O A;  1PXB A;  1RYI A;  2GB0 A;  4BUR A;  1B8S A;  3NTD A;  2V61 A;  1D5T A;  4APN A;  3DH9 A;  2XFQ A;  3ICS A;  4M52 A;  1IJH A;  3AD8 B;  2AQJ A;  4NWZ A;  4N9X A;  1GRG A;  3HYV A;  1JEH A;  5ER0 A;  1ZY8 A;  2JK6 A;  4U8O A;  1VRQ B;  4U8M A;  4YKG A;  2Z5Y A;  1K0J A;  3NHO X;  3NN0 X;  3NYF A;  2YR4 A;  1KSU A;  3DK8 A;  4AT0 A;  2GQF A;  2XLS A;  1E39 A;  2JKC A;  3DA1 A;  4TM1 A;  3UKK A;  2GH5 A;  4BJZ A;  2XVF A;  2WP5 A;  1YQ4 A;  3VQR A;  3P9U A;  1ZK7 A;  3BI5 A;  3DGZ A;  3UOV A;  2VRL A;  1TYT A;  4U2T A;  1NEK A;  1EL5 A;  4EQS A;  2TPR A;  3UOX A;  4BK3 A;  2E4G A;  2BK5 A;  3CGB A;  4YKF A;  1L9C A;  3FMW A;  2ACZ A;  3IC9 A;  2ARD A;  4YTN A;  1PXC A;  2FBW A;  3DME A;  3QJ4 A;  1B4V A;  3NNE A;  3KA7 A;  1O95 A;  1QLB A;  2YAU A;  3CN8 A;  4ZCC A;  4NZH A;  4IA6 A;  1JOA A;  4G9K A;  1NHR A;  2GR0 A;  5FMH A;  3LZW A;  3O0H A;  1BZL A;  2FJD A;  4OPL A;  2H89 A;  3EF6 A;  5KRQ A;  2YR5 A;  4NNJ A;  1NDA A;  1NAA A;  2EQ7 A;  2BYB A;  3GDN A;  4OPC A;  4CNK A;  4REK A;  1CBO A;  3LAD A;  1GER A;  2JB2 A;  1FCD A;  2ZBW A;  3CTY A;  4Z2U A;  3T14 A;  4J31 A;  2XVE A;  3CGE A;  3CNS A;  1XPQ A;  4Z26 A;  4U8J A;  3OC4 A;  1OJC A;  3SZW A;  2E1M A;  1YY5 A;  1ZMC A;  1GAL A;  4G73 A;  1P2E A;  4XWR A;  5J60 A;  3LXD A;  3RP7 A;  1KSS A;  1H82 A;  1PXA A;  4YSH A;  2UZZ A;  4IVM B;  1O5W A;  1K0L A;  4I58 A;  3UKP A;  3SX6 A;  1LQT A;  1M64 A;  4H4W A;  2XFN A;  3PO7 A;  4D04 A;  1BWC A;  2B9Y A;  2XFP A;  2WOI A;  2B7R A;  5EOW A;  1GET A;  4Z2R A;  1EL9 A;  3GMC A;  2A87 A;  2JAE A;  2CFY A;  1S2Y A;  5JCN A;  3PVC A;  5FS7 A;  5KMR A;  4USR A;  3LZX A;  2GMH A;  2XFU A;  4A7A A;  1XHC A;  1COY A;  3SFE A;  3UP4 A;  4LU6 A;  3P4S A;  5CKU A;  5KWF A;  2Y6R A;  2EQ6 A;  3ALM A;  2V3A A;  2WQY A;  2ZZB A;  3B6D A;  3GMB A;  5L46 A;  3B3R A;  2C3C A;  4Z24 A;  1Q9I A;  1CJC A;  3F8R A;  3P4Q A;  4JNQ A;  3LB8 A;  5EB5 A;  5HYM A;  4U8I A;  2JB1 A;  2BK3 A;  2VOU A;  2DKH A;  1EBD A;  1PBE A;  3AEA A;  4H4Q A;  3T2K A;  5KOW A;  2YLR A;  1TDN A;  3F8D A;  1IUV A;  4BV6 A;  3RP8 A;  4PAA A;  2BC0 A;  3AE4 A;  2AAQ A;  1H86 A;  4B65 A;  4K2X A;  1O94 A;  2EQ9 A;  4FK1 A;  1VQW A;  3JSK A;  3OZ2 A;  4UDP A;  1Y0P A;  3SYI A;  2V60 A;  2GR1 A;  1PDH A;  4H4R A;  2XDO A;  2Q0L A;  2VVL G;  1QO8 A;  2VQB A;  3WE0 A;  4I59 A;  4OPU A;  1TDK A;  1IUS A;  4TM0 A;  3NK0 X;  2WU2 A;  2VVM A;  2I0Z A;  4USQ A;  1W4X A;  1XAN A;  1CC2 A;  1HYU A;  3KU9 A;  2YVF A;  2PYX A;  2CDU A;  3C4A A;  4GR1 A;  3CNJ A;  1BGN A;  1PJ5 A;  5GRT A;  1IUX A;  2GAH B;  1JRY A;  4A79 A;  4AOX A;  3DJG X;  3BHF A;  3K7T A;  3M0O A;  3UOY A;  2B7S A;  4JY3 A;  1FEA A;  3SFD A;  1E1M A;  2YM2 A;  3GRT A;  5IQ1 A;  4CCQ A;  3NYC A;  1KNP A;  1LVL A;  3CNT A;  2XLU A;  4YWO A;  3M12 A;  4CCR A;  2WEU A;  1ONF A;  2WHD A;  3Q9T A;  2WP9 A;  2BAC A;  3UCL A;  2JB3 A;  5KXJ A;  3KLJ A;  1MOK A;  3AD9 B;  1CJ4 A;  2R4J A;  2WDV A;  4EM4 A;  1TDF A;  4EMI A;  3BHK A;  4GCM A;  4YXD A;  3NIX A;  4NTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...