3NH3X

Complex of 6-hydroxy-l-nicotine oxidase with final ketone product formed during catalytic turnover
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
b'MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nh3X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nh3X02
1GXFA 1OJAA 1H7XA 4CBQA 1F3PA 2YVFA 3BI5A 2OALA 3URHA 3DJGX 1Q1RA 3P9UA 2EQ9A 4Z43A 2GAHB 2OLNA 4YKGA 5FS6A 4EM4A 2YLTA 2ARDA 3NNEA 4AOXA 2B7SA 1ELIA 1VG0A 3AEBA 5TR3A 1KSUA 5ER0A 4NTEA 1DNCA 4JNQA 1GRGA 2DKIA 4O5UA 2GEWA 2YLWA 4B63A 2GR1A 3OZ2A 3LXDA 3NTAA 3P1WA 3UKAA 3D8XA 3AEAA 1DXLA 2QA2A 2JAEA 3F8DA 3V3OA 2WP5A 4JY2A 1H7WA 2WP9A 4YT0A 2ZZ0A 1JEHA 3ABVA 1D4CA 2R9ZA 3UOZA 3NH3X 2WPCA 1GESA 1N4UA 3LB8A 3CGDA 4Y4NA 1E6EA 1KFYA 1X31B 3PO7A 5CKUA 4WCTA 3B6DA 3EANA 3KU9A 4CCQA 1PBDA 3CNTA 5KVIA 3V3NA 3CIRA 4O5QA 3AEGA 3L1RA 3UKLA 2QAEA 2Y6QA 3QSSA 4Z2TA 5JCNA 1F8WA 2YR6A 4J36A 1VRQB 4AOSA 1CC4A 1L9EA 1P2EA 3GRSA 3P4RA 1XHCA 1ZP0A 3C4AA 2BK5A 2Q0LA 2WDRA 4JQ9A 1KNRA 3R9UA 3NN6X 4B64A 4U2LA 2APGA 3C4NA 1JU2A 4IA6A 3CN8A 4EMJA 2VVMA 2XFQA 4YTPA 2BCPA 2HQMA 1NG3A 1YKJA 1GRHA 4USRA 2Q7VA 4HB9A 1VQWA 5HY5A 4YSXA 3AD7B 2FJBA 4BV6A 1EL7A 3PS9A 1IUWA 4Z44A 1D4EA 1B8SA 3EPTA 2BABA 2WBAA 3UTFA 4EQXA 3F8PA 4EMWA 2TMDA 1PXCA 4CRTA 2WDVA 2C67A 2B76A 2WHDA 1JNRA 1JRXA 3SFEA 1PJ7A 1DOBA 1Y56A 4FX9A 3AE9A 4RG3A 1UKVG 3AEFA 5JCIA 2FJDA 5EBKA 4U2TA 3CGBA 3NK1X 4XWRA 3RHAA 3C96A 3AXBA 3QFBA 1ONFA 5KWFA 3NKSA 1F6MA 3DJJA 4H2RA 4NZHA 5KVHA 3H8IA 4ECHA 2JK6A 4JNAA 2CULA 3VRBA 4ZN0A 4LIIA 5U63A 4APNA 3CNDA 3ATQA 4D03A 3AE7A 4I58A 2BXSA 1REOA 1OJTA 4B69A 4EIQA 4HA6A 4NTCA 1ZMDA 1ZK7A 2YQUA 3FG2P 3DK4A 3NRNA 1OJ9A 4M52A 2YLZA 4TM0A 5JCKA 2C76A 3ZYXA 2YLXA 4AT0A 3G5QA 4B68A 2R4EA 4IV9A 2O9ZA 3IHMA 1FCDA 1IUTA 1D7YA 3VQRA 3AD9B 2PHHA 2YLRA 2YAUA 4X9MA 3UTGA 3I3LA 2XVEA 3AE1A 4OPIA 1YY5A 3DJDA 3ALJA 4BURA 2WOVA 3BHKA 1DODA 2YWLA 4BK2A 3DGHA 4E0VA 1MXTA 3NK0X 3UTEA 1NDAA 2YG6A 3UTHA 1YQ3A 4U8LA 5FS8A 2EQ7A 2WP6A 1Y0PA 2BC0A 2XDOA 3GYIA 4U8MA 3KKJA 2AR8A 1JOAA 1ZMCA 2C75A 1E1KA 1GTEA 3CNSA 4C3XA 3DK9A 4H4TA 5KXJA 3NTDA 3RNMA 1QLBA 5M10A 2H88A 4H4RA 3GYJA 3F8RA 1H83A 3AEEA 2IVDA 4A6NB 4DGKA 1CJ3A 2YVGA 3ALMA 1AOGA 3COXA 1E7PA 4Z2UA 4K2XA 3P4PA 3AD8B 5EOWA 2GR0A 2R0PA 1F8RA 2XVHA 4Y4LA 2R0GA 2W0HA 2BYBA 2XFNA 5U1OA 4EQSA 2RGOA 1E39A 1HYUA 1L9CA 5BULA 1PBFA 4GUVA 4TLXA 3VRDB 2WOWA 4H2QA 3Q9TA 3AE3A 3M12A 1PXBA 3UKKA 3LZXA 4B1BA 2B7RA 4H4XA 4MJWA 1Y56B 2ZZBA 3AE4A 3QSMA 4J56A 1TYTA 3M13A 4CY8A 2YG5A 3GD4A 3GDPA 4IVOB 4C5OA 1GRAA 4LU6A 3V76A 5BVAA 1TYPA 3CTYA 3QJ4A 4A65A 2XCGA 4UP3A 3GWFA 2E1MA 4FK1A 4KPRA 3NLCA 1NEKA 5JCLA 3NK2X 2WS3A 5EB5A 1H84A 2ZZCA 4CNKA 4J31A 3UKHA 1Z6LA 2JBVA 5HYMA 4A7AA 1TRBA 3K7QX 1O5WA 3NHOX 3G5SA 1QO8A 4NEWA 1ZKQA 5U25A 5L46A 4C74A 1CJ2A 1PBCA 4K22A 3P4SA 2BS4A 1DOCA 2OA1A 4A6NA 4WX1A 3VR8A 2R0CA 1RSGA 2FJAA 1VDCA 3KLJA 3KD9A 4USQA 4H7UA 3NYEA 1F8SA 4AP1A 4B66A 2IVEA 4OPGA 1GTHA 5J7XA 1H81A 1CBOA 1CHUA 1FECA 1PS9A 1LV0A 3ICTA 2BS3A 4ADWA 5C2TA 1MOKA 3AE6A 4GDEA 3ISHA 5BRTA 1D7LA 1GRFA 3NYCA 4YSYA 4TM4A 4LA1A 5JCMA 2FBWA 2ZBWA 2E4GA 1D5TA 1ZDLA 3PVCA 2BK3A 2A8XA 4IA5A 3H8LA 2CFYA 2RGHA 1GRBA 2X3NA 4DSHA 1LQTA 4XWZA 1BKWA 2Z5XA 5KOWA 3BI2A 3G5RA 4IVMB 2B9XA 3KVEA 2X99A 2PYXA 3BHFA 4OPLA 3AYIA 3M0OA 1PDHA 4GRTA 1XPQA 3HZLA 3NT6A 4EMIA 1K0IA 5FMHA 2GRTA 1S2QA 4YWOA 3BNUA 3BNMA 4U8PA 4H4PA 3AWIA 1M6IA 1L9DA 1N4WA 1NHRA 3DA1A 3GDNA 3K30A 3KA7A 3NN0X 5FS7A 1PXAA 2X8GA 3CPJG 4GCMA 2WU5A 4RG4A 2GH5A 2XLRA 3AEDA 2X50A 4Z25A 1BZLA 4GF7A 3KPFA 4Z2RA 3RP8A 3D1CA 2YVJA 3CGEA 3II4A 4J2WA 3ZDNA 4C77A 3SM8A 4D04A 2B9YA 1M64A 2OLOA 4DSGA 4YSHA 1DJNA 2C7GA 3ICRA 2XYOA 1IUSA 1ZOVA 3AYJA 1ZOYA 3NIXA 4JN9A 2V3BA 1TDEA 3S61A 4H4YA 2CDUA 3UKQA 4EM3A 1PBBA 3UCLA 5HHFA 1NG4A 2VRMA 4BK1A 4NEVA 3RP7A 3GMCA 1PN0A 1PJ6A 3QVRA 1GERA 5IQ4A 2C72A 4K7ZA 1D4DA 2BXRA 4H4UA 1RYIA 3AE2A 3OC4A 3FIMB 5GSNA 2Q6UA 2UZZA 3CPHG 3GSIA 2WEUA 1FL2A 1EL5A 1BGJA 2R4JA 2B9WA 2RGJA 2WESA 3JSKA 2GQWA 2JB3A 2V60A 1TDFA 2C70A 2VZ2A 2Q0KA 4Z24A 3ALLA 3AE8A 2AAQA 4K8DA 4A79A 1GALA 5HXIA 1H86A 4H4SA 1EBDA 1NPXA 4CY6A 5FS9A 2XVJA 4J34A 2C73A 3DJEA 4JY3A 2VVLA 2Z5YA 4FDCB 4K5RA 3VR9A 1LJ1A 1EL8A 3IWAA 1JNZA 3AE5A 1LPFA 2A87A 1W4XA 2YG4A 1E1NA 1BGNA 2BK4A 3EF6A 2FJEA 4X9NA 4CNJA 1P2HA 4B65A 2I0ZA 3CNJA 1GETA 4U8KA 4I59A 1O94A 1GSNA 4DNAA 4EQWA 3UOYA 2H89A 3DK8A 2XFOA 1JRZA 3LOVA 3T37A 2RABA 3FBSA 3WE0A 3P4QA 2AQJA 1Q1WA 4A9WA 2WQYA 2Y6RA 2EQ8A 2GAGB 2R46A 4U8IA 2R45A 4A5LA 1CL0A 5LV9A 3I6DA 2XFUA 2GV8A 2XFPA 2XLSA 2GQFA 3FMWA 1QJDA 5CQFA 1N4VA 2TPRA 1NHSA 4NTDA 3ATRA 1CC6A 1NHQA 1Q9IA 2GF3A 3B3RA 3H4KA 3LZWA 4J57A 1E1MA 2BS2A 2GB0A 2BCGG 1CJ4A 1NHPA 3EAOA 4OPTA 1CJCA 1KF6A 5J60A 3K7TA 1ZX9A 3SGLA 3ITJA 1LQUA 2JB2A 1MO9A 4P9SA 4U8JA 3ICSA 4OPCA 4BK3A 1OJCA 1B5QA 2YR5A 4PABA 4EQRA 3O0HA 1SEZA 3CPIG 4RSLA 1S2YA 2DKHA 4ZCDA 4YSZA 2X8HA 3UKPA 4EIPA 4AP3A 2JB1A 3UP5A 4AT2A 4KX6A 2CVJA 2QCUA 5GRTA 4B67A 2VRLA 4U8NA 3DGZA 1OJDA 2XVIA 2GMJA 5C3JA 1CF3A 4CCRA 1IUXA 3IC9A 3VRAA 4XXGA 1GEUA 4YTNA 2V6OA 2WPEA 4H50A 2GMHA 1YQZA 1N1PA 2WOIA 1K0JA 3IF9A 3UKFA 3LADA 4K5SA 4PAAA 4H4ZA 4REKA 3REDA 2NPXA 4H4VA 3AYLA 4UDPA 1B4VA 1GT8A 4A99A 1S3EA 3QSEA 3K7MX 4N9XA 3NYFA 3GD3A 4UDRA 1LVLA 2NVKX 2A89A 3L8KA 4H4WA 4OPUA 2VOUA 2BACA 2XLPA 4BJYA 4GR1A 1GNDA 2C3DA 1DJQA 1KNPA 4OVIA 4YKFA 2YM2A 2WU2A 3GRTA 3CNPA 5BUKA 3Q6JA 2OAMA 4TM3A 1V59A 4FK1C 1E1LA 1GPEA 3UOXA 1GV4A 4TM1A 1FEAA 5IPYA 1PBEA 4U8OA 5DBJA 2V5ZA 2XLTA 4ICYA 5EB4A 2VQ7A 3GWDA 4YTMA 4JDRA 1NAAA 2YG3A 3NGCX 1GREA 1K4QA 4H2NA 1VG9A 1EL9A 1RP0A 4U2SA 1NENA 1GOSA 1K0LA 2JKCA 3IHGA 1IJHA 1PJ5A 3AB1A 5M0ZA 2C64A 1DOEA 3AECA 2BC1A 4OCGA 1B37A 2ACZA 2YM1A 2J3NA 3QVPA 4C3YA 3BI4A 3GMBA 5KOXA 2WDQA 2VQBA 1TDOA 1O95A 2XVFA 3S5WA 4J33A 2GR3A 4Z26A 1H82A 5IQ1A 1GRTA 4ZCCA 4BJZA 1KSSA 3DMEA 2C3CA 1COYA 4GDPA 1H6VA 1FEBA 2QA1A 2XLUA 1IUUA 1LTXR 2YR4A 2C66A 4YXDA 1TDNA 4OPDA 5KRQA 1IUVA 2VVLG 3SQPA 3RP6A 2IIDA 1JRYA 1KDGA 2X8CA 2F5ZA 1BWCA 4TLZA 3QFAA 1BF3A 2EQ6A 4UDQA 2E5VA 3DH9A 1YQ4A 4H2PA 1CC2A 2BA9A 2C65A 3UOVA 4H4QA 1XDIA 2V3AA 1PHHA 1ZY8A 2WPFA 3ADAB 3LJPA 2WETA 3UP4A 3SFDA 2YLSA 3NG7X 1XANA 1TDKA 4Y4MA 1FOHA 1L0VA 1S3BA 2GR2A 2GVCA 2V61A 2YG7A 3CGCA 3E1TA 4X4JA 3FPZA
chains in the Genus database with same CATH superfamily
1GXFA 1OJAA 1H7XA 4CBQA 1F3PA 2YVFA 3BI5A 2OALA 3URHA 3DJGX 1Q1RA 3P9UA 2EQ9A 4Z43A 2GAHB 2OLNA 4YKGA 5FS6A 4EM4A 2YLTA 2ARDA 3NNEA 4AOXA 2B7SA 4G6GA 1ELIA 1VG0A 3AEBA 3HYWA 1KSUA 5ER0A 4NTEA 5TR3A 1DNCA 4JNQA 1GRGA 2DKIA 4O5UA 2GEWA 2YLWA 4B63A 2GR1A 3OZ2A 3LXDA 3NTAA 3P1WA 3UKAA 3D8XA 3AEAA 1DXLA 2QA2A 2JAEA 3F8DA 3V3OA 2WP5A 4JY2A 1H7WA 2WP9A 4YT0A 2ZZ0A 1JEHA 3ABVA 1D4CA 2R9ZA 3UOZA 3NH3X 2WPCA 1GESA 3SZCA 1N4UA 3LB8A 3CGDA 4Y4NA 1E6EA 1KFYA 1X31B 3PO7A 5CKUA 4WCTA 3B6DA 3EANA 3KU9A 4CCQA 1PBDA 3CNTA 5KVIA 3V3NA 3CIRA 4O5QA 3AEGA 3L1RA 3UKLA 2QAEA 2Y6QA 3QSSA 4Z2TA 5JCNA 1F8WA 2YR6A 4J36A 1VRQB 4AOSA 1CC4A 1L9EA 1P2EA 3GRSA 3P4RA 1XHCA 1ZP0A 3C4AA 2BK5A 2Q0LA 2WDRA 4JQ9A 1KNRA 3R9UA 3NN6X 4B64A 4U2LA 2APGA 3C4NA 1JU2A 3T31A 4IA6A 3CN8A 4EMJA 2VVMA 2XFQA 4YTPA 2BCPA 2HQMA 1NG3A 1YKJA 1GRHA 4USRA 2Q7VA 4HB9A 1VQWA 5HY5A 4YSXA 3AD7B 2FJBA 4BV6A 1EL7A 3PS9A 1IUWA 4Z44A 1D4EA 1B8SA 3EPTA 2BABA 2WBAA 3UTFA 4EQXA 3F8PA 4EMWA 2TMDA 1PXCA 4CRTA 2WDVA 2C67A 2B76A 2WHDA 1JNRA 1JRXA 3SFEA 1PJ7A 1DOBA 1Y56A 4FX9A 3AE9A 4RG3A 1UKVG 3AEFA 4NWZA 5JCIA 2FJDA 5EBKA 4U2TA 3CGBA 3NK1X 4XWRA 3RHAA 3C96A 3AXBA 3QFBA 1ONFA 5KWFA 3NKSA 1F6MA 3DJJA 4H2RA 4NZHA 5KVHA 3H8IA 4ECHA 2JK6A 4JNAA 2CULA 3VRBA 4ZN0A 4LIIA 5U63A 4APNA 3CNDA 3ATQA 4D03A 3AE7A 4I58A 2BXSA 1REOA 1OJTA 4B69A 4EIQA 4HA6A 4NTCA 3T2KA 1ZMDA 1ZK7A 2YQUA 3FG2P 3DK4A 3NRNA 1OJ9A 4M52A 2YLZA 4TM0A 5JCKA 2C76A 3ZYXA 2YLXA 4AT0A 3SX6A 3G5QA 4B68A 2R4EA 4IV9A 2O9ZA 3IHMA 1FCDA 1IUTA 1D7YA 3VQRA 3AD9B 2PHHA 2YLRA 2YAUA 4X9MA 3UTGA 3I3LA 2XVEA 4NNJA 3AE1A 4OPIA 1YY5A 3DJDA 3ALJA 3T2YA 4BURA 2WOVA 3BHKA 1DODA 2YWLA 4G9KA 4BK2A 3DGHA 4E0VA 1MXTA 3NK0X 3UTEA 1NDAA 2YG6A 3UTHA 1YQ3A 4U8LA 5FS8A 2EQ7A 2WP6A 1Y0PA 2BC0A 2XDOA 2BRAA 3GYIA 4U8MA 3T0KA 3KKJA 2AR8A 1JOAA 1ZMCA 2C75A 1E1KA 1GTEA 4G6HA 3CNSA 4C3XA 3DK9A 4H4TA 5KXJA 3NTDA 3RNMA 1QLBA 4II3A 5M10A 2H88A 4H4RA 3GYJA 3F8RA 1H83A 3AEEA 2IVDA 4A6NB 4DGKA 1CJ3A 2YVGA 3ALMA 1AOGA 3COXA 1E7PA 4Z2UA 4K2XA 3P4PA 3AD8B 5EOWA 2GR0A 2R0PA 1F8RA 2XVHA 4Y4LA 2R0GA 2W0HA 2BYBA 2XFNA 5U1OA 4EQSA 2RGOA 1E39A 1HYUA 1L9CA 5BULA 1PBFA 4GUVA 4TLXA 3VRDB 2WOWA 4H2QA 3Q9TA 3AE3A 3M12A 1PXBA 3UKKA 3LZXA 4B1BA 2B7RA 4H4XA 4MJWA 1Y56B 2ZZBA 3AE4A 3QSMA 3KPKA 4J56A 1TYTA 3M13A 4CY8A 2YG5A 3GD4A 3GDPA 4IVOB 4C5OA 1GRAA 4LU6A 3V76A 5BVAA 1TYPA 3CTYA 3QJ4A 4A65A 2XCGA 4UP3A 3GWFA 2E1MA 4FK1A 3SXIA 4KPRA 3NLCA 1NEKA 5JCLA 3NK2X 2WS3A 5EB5A 1H84A 2ZZCA 4CNKA 4J31A 3UKHA 1Z6LA 2JBVA 5HYMA 4A7AA 1TRBA 3K7QX 1O5WA 3NHOX 3G5SA 1QO8A 4NEWA 1ZKQA 5U25A 5L46A 4C74A 1CJ2A 1PBCA 4K22A 3P4SA 5KMRA 2BS4A 1DOCA 2OA1A 4A6NA 4WX1A 3VR8A 2R0CA 1RSGA 2FJAA 1VDCA 3KLJA 3KD9A 4USQA 4H7UA 3NYEA 1F8SA 4AP1A 4D04A 4B66A 2IVEA 4OPGA 1GTHA 5J7XA 1H81A 1CBOA 1CHUA 1FECA 1PS9A 1LV0A 3ICTA 2BS3A 4ADWA 5C2TA 1MOKA 3AE6A 4GDEA 3ISHA 5BRTA 1D7LA 1GRFA 3NYCA 4YSYA 4TM4A 4LA1A 5JCMA 5KMQA 2FBWA 2ZBWA 2E4GA 1D5TA 1ZDLA 3PVCA 3HYXA 2BK3A 2A8XA 4IA5A 3H8LA 3T2ZA 2CFYA 2RGHA 1GRBA 2X3NA 4DSHA 1LQTA 4XWZA 1BKWA 2Z5XA 5KOWA 3BI2A 3G5RA 4IVMB 2B9XA 3KVEA 2X99A 2PYXA 3BHFA 4OPLA 3AYIA 3M0OA 1PDHA 4GRTA 1XPQA 3HZLA 3NT6A 4EMIA 1K0IA 5FMHA 2GRTA 1S2QA 4YWOA 3BNUA 3HYVA 3BNMA 4U8PA 4H4PA 4GAPA 3AWIA 1M6IA 1L9DA 1N4WA 1NHRA 3DA1A 3GDNA 3K30A 3KA7A 3NN0X 5FS7A 1PXAA 2X8GA 3CPJG 4GCMA 2WU5A 4RG4A 2GH5A 2XLRA 3AEDA 2X50A 4Z25A 1BZLA 4GF7A 3KPFA 4Z2RA 3RP8A 3D1CA 2YVJA 3CGEA 3II4A 4J2WA 3T14A 3ZDNA 3SM8A 4C77A 2B9YA 1M64A 2OLOA 4DSGA 4YSHA 1DJNA 2C7GA 3ICRA 2XYOA 1IUSA 1ZOVA 3AYJA 1ZOYA 3NIXA 4JN9A 2V3BA 1TDEA 3S61A 4H4YA 2CDUA 3UKQA 4EM3A 1PBBA 3UCLA 5HHFA 1NG4A 2VRMA 4BK1A 4NEVA 3RP7A 3GMCA 1PN0A 1PJ6A 3QVRA 1GERA 4G74A 5IQ4A 2C72A 4K7ZA 1D4DA 2BXRA 4H4UA 1RYIA 3AE2A 3OC4A 3FIMB 5GSNA 2Q6UA 2UZZA 3CPHG 3GSIA 2WEUA 1FL2A 1EL5A 1BGJA 2R4JA 2B9WA 2RGJA 2WESA 3JSKA 2GQWA 2JB3A 2V60A 1TDFA 2C70A 2VZ2A 2Q0KA 4Z24A 3ALLA 3AE8A 2AAQA 4K8DA 4A79A 1GALA 5HXIA 1H86A 4H4SA 1EBDA 1NPXA 4CY6A 5FS9A 2XVJA 4J34A 2C73A 3DJEA 4JY3A 2VVLA 2Z5YA 4FDCB 4K5RA 3VR9A 1LJ1A 1EL8A 3SY4A 3IWAA 1JNZA 3AE5A 1LPFA 2A87A 1W4XA 2YG4A 1E1NA 1BGNA 2BK4A 3EF6A 2FJEA 4X9NA 4CNJA 1P2HA 4G73A 4B65A 2I0ZA 2C4CA 3CNJA 1GETA 4U8KA 3GYXA 4I59A 1O94A 1GSNA 4DNAA 4EQWA 5KMSA 3UOYA 2H89A 3DK8A 2XFOA 1JRZA 3LOVA 3T37A 2RABA 3FBSA 3WE0A 3P4QA 2AQJA 1Q1WA 4A9WA 2WQYA 2Y6RA 2EQ8A 2GAGB 2R46A 4U8IA 2R45A 4A5LA 1CL0A 5LV9A 3I6DA 2XFUA 2GV8A 2XFPA 2XLSA 2GQFA 3FMWA 1QJDA 5CQFA 1N4VA 2TPRA 1NHSA 4NTDA 3ATRA 1CC6A 1NHQA 1Q9IA 2GF3A 3B3RA 3H4KA 3LZWA 4J57A 1E1MA 2BS2A 2GB0A 2BCGG 1CJ4A 1NHPA 3EAOA 4OPTA 1CJCA 1KF6A 5J60A 3K7TA 1ZX9A 3SGLA 3ITJA 1LQUA 2JB2A 1MO9A 4P9SA 4U8JA 2BRYA 3ICSA 4OPCA 4BK3A 1OJCA 1B5QA 2YR5A 4PABA 4EQRA 3O0HA 1SEZA 3CPIG 4RSLA 1S2YA 2DKHA 4ZCDA 4YSZA 2X8HA 3UKPA 4EIPA 4AP3A 2JB1A 3UP5A 4AT2A 4KX6A 2CVJA 2QCUA 5GRTA 4B67A 5KNLA 2VRLA 4U8NA 3SZWA 3DGZA 1OJDA 2XVIA 2GMJA 5C3JA 1CF3A 4CCRA 5KMPA 1IUXA 3IC9A 3VRAA 4XXGA 1GEUA 4YTNA 2V6OA 2WPEA 4H50A 2GMHA 1YQZA 1N1PA 2WOIA 1K0JA 3IF9A 3UKFA 3LADA 4K5SA 4PAAA 4H4ZA 4REKA 3REDA 2NPXA 4H4VA 3AYLA 4UDPA 1B4VA 1GT8A 4A99A 1S3EA 3QSEA 3K7MX 4N9XA 3NYFA 3GD3A 4UDRA 1LVLA 2NVKX 3SYIA 2A89A 3L8KA 4H4WA 4GAVA 4OPUA 2VOUA 2BACA 2XLPA 4BJYA 4GR1A 1GNDA 2C3DA 4II2A 1DJQA 1KNPA 4OVIA 4YKFA 2YM2A 2WU2A 3GRTA 3CNPA 5BUKA 3Q6JA 2OAMA 4TM3A 1V59A 4FK1C 1E1LA 1GPEA 3UOXA 1GV4A 4TM1A 1FEAA 5IPYA 1PBEA 4U8OA 5DBJA 2V5ZA 2XLTA 4ICYA 5EB4A 2VQ7A 3GWDA 4YTMA 4JDRA 1NAAA 2YG3A 3NGCX 1GREA 1K4QA 4H2NA 1VG9A 3SZFA 1EL9A 1RP0A 4U2SA 1NENA 1GOSA 1K0LA 2JKCA 3IHGA 1IJHA 1PJ5A 3AB1A 5M0ZA 2C64A 1DOEA 3AECA 2BC1A 4OCGA 1B37A 2ACZA 2YM1A 2J3NA 3QVPA 4C3YA 3BI4A 3GMBA 5KOXA 2WDQA 2VQBA 1TDOA 1O95A 2XVFA 3S5WA 4J33A 2GR3A 4Z26A 1H82A 5IQ1A 1GRTA 4ZCCA 4BJZA 1KSSA 3DMEA 2C3CA 1COYA 3SZ0A 4GDPA 1H6VA 1FEBA 2QA1A 2XLUA 1IUUA 1LTXR 2YR4A 2C66A 4YXDA 1TDNA 4OPDA 3CMMA 5KRQA 1IUVA 2VVLG 3SQPA 3RP6A 2IIDA 1JRYA 1KDGA 2X8CA 2F5ZA 1BWCA 4TLZA 3QFAA 1BF3A 2EQ6A 4UDQA 2E5VA 3DH9A 1YQ4A 4H2PA 1CC2A 2BA9A 2C65A 3UOVA 4H4QA 1XDIA 2V3AA 1PHHA 1ZY8A 2WPFA 3ADAB 3LJPA 2WETA 3UP4A 3SFDA 2YLSA 3NG7X 1XANA 1TDKA 4Y4MA 1FOHA 1L0VA 1S3BA 2GR2A 2GVCA 2V61A 2YG7A 3CGCA 3E1TA 4X4JA 3FPZA
chains in the Genus database with same CATH topology
1GXFA 1OJAA 1H7XA 4CBQA 1F3PA 2YVFA 3BI5A 2OALA 3URHA 3DJGX 1Q1RA 3P9UA 2EQ9A 4Z43A 2GAHB 2OLNA 4YKGA 5FS6A 4EM4A 2YLTA 2ARDA 3NNEA 4AOXA 2B7SA 4G6GA 1ELIA 1VG0A 3AEBA 3HYWA 1KSUA 5ER0A 4NTEA 5TR3A 1DNCA 4JNQA 1GRGA 2DKIA 4O5UA 2GEWA 2YLWA 4B63A 2GR1A 3OZ2A 3LXDA 3NTAA 3P1WA 3UKAA 3D8XA 3AEAA 1DXLA 2QA2A 2JAEA 3F8DA 3V3OA 2WP5A 4JY2A 1H7WA 2WP9A 4YT0A 2ZZ0A 1JEHA 3ABVA 1D4CA 2R9ZA 3UOZA 3NH3X 2WPCA 1GESA 3SZCA 1N4UA 3LB8A 3CGDA 4Y4NA 1E6EA 1KFYA 1X31B 3PO7A 5CKUA 4WCTA 3B6DA 3EANA 3KU9A 4CCQA 1PBDA 3CNTA 5KVIA 3V3NA 3CIRA 4O5QA 3AEGA 3L1RA 3UKLA 2QAEA 2Y6QA 3QSSA 4Z2TA 5JCNA 1F8WA 2YR6A 4J36A 1VRQB 4AOSA 1CC4A 1L9EA 1P2EA 3GRSA 3P4RA 1XHCA 1ZP0A 3C4AA 2BK5A 2Q0LA 2WDRA 4JQ9A 1KNRA 3R9UA 3NN6X 4B64A 4U2LA 2APGA 3C4NA 1JU2A 3T31A 4IA6A 3CN8A 4EMJA 2VVMA 2XFQA 4YTPA 2BCPA 2HQMA 1NG3A 1YKJA 1GRHA 4USRA 2Q7VA 4HB9A 1VQWA 5HY5A 4YSXA 3AD7B 2FJBA 4BV6A 1EL7A 3PS9A 1IUWA 4Z44A 1D4EA 1B8SA 3EPTA 2BABA 2WBAA 3UTFA 4EQXA 3F8PA 4EMWA 2TMDA 1PXCA 4CRTA 2WDVA 2C67A 2B76A 2WHDA 1JNRA 1JRXA 3SFEA 1PJ7A 1DOBA 1Y56A 4FX9A 3AE9A 4RG3A 1UKVG 3AEFA 4NWZA 5JCIA 2FJDA 5EBKA 4U2TA 3CGBA 3NK1X 4XWRA 3RHAA 3C96A 3AXBA 3QFBA 1ONFA 5KWFA 3NKSA 1F6MA 3DJJA 4H2RA 4NZHA 5KVHA 3H8IA 4ECHA 2JK6A 4JNAA 2CULA 3VRBA 4ZN0A 4LIIA 5U63A 4APNA 3CNDA 3ATQA 4D03A 3AE7A 4I58A 2BXSA 1REOA 1OJTA 4B69A 4EIQA 4HA6A 4NTCA 3T2KA 1ZMDA 1ZK7A 2YQUA 3FG2P 3DK4A 3NRNA 1OJ9A 4M52A 2YLZA 4TM0A 5JCKA 2C76A 3ZYXA 2YLXA 4AT0A 3SX6A 3G5QA 4B68A 2R4EA 4IV9A 2O9ZA 3IHMA 1FCDA 1IUTA 1D7YA 3VQRA 3AD9B 2PHHA 2YLRA 2YAUA 4X9MA 3UTGA 3I3LA 2XVEA 4NNJA 3AE1A 4OPIA 1YY5A 3DJDA 3ALJA 3T2YA 4BURA 2WOVA 3BHKA 1DODA 2YWLA 4G9KA 4BK2A 3DGHA 4E0VA 1MXTA 3NK0X 3UTEA 1NDAA 2YG6A 3UTHA 1YQ3A 4U8LA 5FS8A 2EQ7A 2WP6A 1Y0PA 2BC0A 2XDOA 2BRAA 3GYIA 4U8MA 3T0KA 3KKJA 2AR8A 1JOAA 1ZMCA 2C75A 1E1KA 1GTEA 4G6HA 3CNSA 4C3XA 3DK9A 4H4TA 5KXJA 3NTDA 3RNMA 1QLBA 4II3A 5M10A 2H88A 4H4RA 3GYJA 3F8RA 1H83A 3AEEA 2IVDA 4A6NB 4DGKA 1CJ3A 2YVGA 3ALMA 1AOGA 3COXA 1E7PA 4Z2UA 4K2XA 3P4PA 3AD8B 5EOWA 2GR0A 2R0PA 1F8RA 2XVHA 4Y4LA 2R0GA 2W0HA 2BYBA 2XFNA 5U1OA 4EQSA 2RGOA 1E39A 1HYUA 1L9CA 5BULA 1PBFA 4GUVA 4TLXA 3VRDB 2WOWA 4H2QA 3Q9TA 3AE3A 3M12A 1PXBA 3UKKA 3LZXA 4B1BA 2B7RA 4H4XA 4MJWA 1Y56B 2ZZBA 3AE4A 3QSMA 3KPKA 4J56A 1TYTA 3M13A 4CY8A 2YG5A 3GD4A 3GDPA 4IVOB 4C5OA 1GRAA 4LU6A 3V76A 5BVAA 1TYPA 3CTYA 3QJ4A 4A65A 2XCGA 4UP3A 3GWFA 2E1MA 4FK1A 3SXIA 4KPRA 3NLCA 1NEKA 5JCLA 3NK2X 2WS3A 5EB5A 1H84A 2ZZCA 4CNKA 4J31A 3UKHA 1Z6LA 2JBVA 5HYMA 4A7AA 1TRBA 3K7QX 1O5WA 3NHOX 3G5SA 1QO8A 4NEWA 1ZKQA 5U25A 5L46A 4C74A 1CJ2A 1PBCA 4K22A 3P4SA 5KMRA 2BS4A 1DOCA 2OA1A 4A6NA 4WX1A 3VR8A 2R0CA 1RSGA 2FJAA 1VDCA 3KLJA 3KD9A 4USQA 4H7UA 3NYEA 1F8SA 4AP1A 4D04A 4B66A 2IVEA 4OPGA 1GTHA 5J7XA 1H81A 1CBOA 1CHUA 1FECA 1PS9A 1LV0A 3ICTA 2BS3A 4ADWA 5C2TA 1MOKA 3AE6A 4GDEA 3ISHA 5BRTA 1D7LA 1GRFA 3NYCA 4YSYA 4TM4A 4LA1A 5JCMA 5KMQA 2FBWA 2ZBWA 2E4GA 1D5TA 1ZDLA 3PVCA 3HYXA 2BK3A 2A8XA 4IA5A 3H8LA 3T2ZA 2CFYA 2RGHA 1GRBA 2X3NA 4DSHA 1LQTA 4XWZA 1BKWA 2Z5XA 5KOWA 3BI2A 3G5RA 4IVMB 2B9XA 3KVEA 2X99A 2PYXA 3BHFA 4OPLA 3AYIA 3M0OA 1PDHA 4GRTA 1XPQA 3HZLA 3NT6A 4EMIA 1K0IA 5FMHA 2GRTA 1S2QA 4YWOA 3BNUA 3HYVA 3BNMA 4U8PA 4H4PA 4GAPA 3AWIA 1M6IA 1L9DA 1N4WA 1NHRA 3DA1A 3GDNA 3K30A 3KA7A 3NN0X 5FS7A 1PXAA 2X8GA 3CPJG 4GCMA 2WU5A 4RG4A 2GH5A 2XLRA 3AEDA 2X50A 4Z25A 1BZLA 4GF7A 3KPFA 4Z2RA 3RP8A 3D1CA 2YVJA 3CGEA 3II4A 4J2WA 3T14A 3ZDNA 3SM8A 4C77A 2B9YA 1M64A 2OLOA 4DSGA 4YSHA 1DJNA 2C7GA 3ICRA 2XYOA 1IUSA 1ZOVA 3AYJA 1ZOYA 3NIXA 4JN9A 2V3BA 1TDEA 3S61A 4H4YA 2CDUA 3UKQA 4EM3A 1PBBA 3UCLA 5HHFA 1NG4A 2VRMA 4BK1A 4NEVA 3RP7A 3GMCA 1PN0A 1PJ6A 3QVRA 1GERA 4G74A 5IQ4A 2C72A 4K7ZA 1D4DA 2BXRA 4H4UA 1RYIA 3AE2A 3OC4A 3FIMB 5GSNA 2Q6UA 2UZZA 3CPHG 3GSIA 2WEUA 1FL2A 1EL5A 1BGJA 2R4JA 2B9WA 2RGJA 2WESA 3JSKA 2GQWA 2JB3A 2V60A 1TDFA 2C70A 2VZ2A 2Q0KA 4Z24A 3ALLA 3AE8A 2AAQA 4K8DA 4A79A 1GALA 5HXIA 1H86A 4H4SA 1EBDA 1NPXA 4CY6A 5FS9A 2XVJA 4J34A 2C73A 3DJEA 4JY3A 2VVLA 2Z5YA 4FDCB 4K5RA 3VR9A 1LJ1A 1EL8A 3SY4A 3IWAA 1JNZA 3AE5A 1LPFA 2A87A 1W4XA 2YG4A 1E1NA 1BGNA 2BK4A 3EF6A 2FJEA 4X9NA 4CNJA 1P2HA 4G73A 4B65A 2I0ZA 2C4CA 3CNJA 1GETA 4U8KA 3GYXA 4I59A 1O94A 1GSNA 4DNAA 4EQWA 5KMSA 3UOYA 2H89A 3DK8A 2XFOA 1JRZA 3LOVA 3T37A 2RABA 3FBSA 3WE0A 3P4QA 2AQJA 1Q1WA 4A9WA 2WQYA 2Y6RA 2EQ8A 2GAGB 2R46A 4U8IA 2R45A 4A5LA 1CL0A 5LV9A 3I6DA 2XFUA 2GV8A 2XFPA 2XLSA 2GQFA 3FMWA 1QJDA 5CQFA 1N4VA 2TPRA 1NHSA 4NTDA 3ATRA 1CC6A 1NHQA 1Q9IA 2GF3A 3B3RA 3H4KA 3LZWA 4J57A 1E1MA 2BS2A 2GB0A 2BCGG 1CJ4A 1NHPA 3EAOA 4OPTA 1CJCA 1KF6A 5J60A 3K7TA 1ZX9A 3SGLA 3ITJA 1LQUA 2JB2A 1MO9A 4P9SA 4U8JA 2BRYA 3ICSA 4OPCA 4BK3A 1OJCA 1B5QA 2YR5A 4PABA 4EQRA 3O0HA 1SEZA 3CPIG 4RSLA 1S2YA 2DKHA 4ZCDA 4YSZA 2X8HA 3UKPA 4EIPA 4AP3A 2JB1A 3UP5A 4AT2A 4KX6A 2CVJA 2QCUA 5GRTA 4B67A 5KNLA 2VRLA 4U8NA 3SZWA 3DGZA 1OJDA 2XVIA 2GMJA 5C3JA 1CF3A 4CCRA 5KMPA 1IUXA 3IC9A 3VRAA 4XXGA 1GEUA 4YTNA 2V6OA 2WPEA 4H50A 2GMHA 1YQZA 1N1PA 2WOIA 1K0JA 3IF9A 3UKFA 3LADA 4K5SA 4PAAA 4H4ZA 4REKA 3REDA 2NPXA 4H4VA 3AYLA 4UDPA 1B4VA 1GT8A 4A99A 1S3EA 3QSEA 3K7MX 4N9XA 3NYFA 3GD3A 4UDRA 1LVLA 2NVKX 3SYIA 2A89A 3L8KA 4H4WA 4GAVA 4OPUA 2VOUA 2BACA 2XLPA 4BJYA 4GR1A 1GNDA 2C3DA 4II2A 1DJQA 1KNPA 4OVIA 4YKFA 2YM2A 2WU2A 3GRTA 3CNPA 5BUKA 3Q6JA 2OAMA 4TM3A 1V59A 4FK1C 1E1LA 1GPEA 3UOXA 1GV4A 4TM1A 1FEAA 5IPYA 1PBEA 4U8OA 5DBJA 2V5ZA 2XLTA 4ICYA 5EB4A 2VQ7A 3GWDA 4YTMA 4JDRA 1NAAA 2YG3A 3NGCX 1GREA 1K4QA 4H2NA 1VG9A 3SZFA 1EL9A 1RP0A 4U2SA 1NENA 1GOSA 1K0LA 2JKCA 3IHGA 1IJHA 1PJ5A 3AB1A 5M0ZA 2C64A 1DOEA 3AECA 2BC1A 4OCGA 1B37A 2ACZA 2YM1A 2J3NA 3QVPA 4C3YA 3BI4A 3GMBA 5KOXA 2WDQA 2VQBA 1TDOA 1O95A 2XVFA 3S5WA 4J33A 2GR3A 4Z26A 1H82A 5IQ1A 1GRTA 4ZCCA 4BJZA 1KSSA 3DMEA 2C3CA 1COYA 3SZ0A 4GDPA 1H6VA 1FEBA 2QA1A 2XLUA 1IUUA 1LTXR 2YR4A 2C66A 4YXDA 1TDNA 4OPDA 3CMMA 5KRQA 1IUVA 2VVLG 3SQPA 3RP6A 2IIDA 1JRYA 1KDGA 2X8CA 2F5ZA 1BWCA 4TLZA 3QFAA 1BF3A 2EQ6A 4UDQA 2E5VA 3DH9A 1YQ4A 4H2PA 1CC2A 2BA9A 2C65A 3UOVA 4H4QA 1XDIA 2V3AA 1PHHA 1ZY8A 2WPFA 3ADAB 3LJPA 2WETA 3UP4A 3SFDA 2YLSA 3NG7X 1XANA 1TDKA 4Y4MA 1FOHA 1L0VA 1S3BA 2GR2A 2GVCA 2V61A 2YG7A 3CGCA 3E1TA 4X4JA 3FPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXF A;  1OJA A;  1H7X A;  4CBQ A;  1F3P A;  2YVF A;  3BI5 A;  2OAL A;  3URH A;  3DJG X;  1Q1R A;  3P9U A;  2EQ9 A;  4Z43 A;  2GAH B;  2OLN A;  4YKG A;  5FS6 A;  4EM4 A;  2YLT A;  2ARD A;  3NNE A;  4AOX A;  2B7S A;  1ELI A;  1VG0 A;  3AEB A;  5TR3 A;  1KSU A;  5ER0 A;  4NTE A;  1DNC A;  4JNQ A;  1GRG A;  2DKI A;  4O5U A;  2GEW A;  2YLW A;  4B63 A;  2GR1 A;  3OZ2 A;  3LXD A;  3NTA A;  3P1W A;  3UKA A;  3D8X A;  3AEA A;  1DXL A;  2QA2 A;  2JAE A;  3F8D A;  3V3O A;  2WP5 A;  4JY2 A;  1H7W A;  2WP9 A;  4YT0 A;  2ZZ0 A;  1JEH A;  3ABV A;  1D4C A;  2R9Z A;  3UOZ A;  3NH3 X;  2WPC A;  1GES A;  1N4U A;  3LB8 A;  3CGD A;  4Y4N A;  1E6E A;  1KFY A;  1X31 B;  3PO7 A;  5CKU A;  4WCT A;  3B6D A;  3EAN A;  3KU9 A;  4CCQ A;  1PBD A;  3CNT A;  5KVI A;  3V3N A;  3CIR A;  4O5Q A;  3AEG A;  3L1R A;  3UKL A;  2QAE A;  2Y6Q A;  3QSS A;  4Z2T A;  5JCN A;  1F8W A;  2YR6 A;  4J36 A;  1VRQ B;  4AOS A;  1CC4 A;  1L9E A;  1P2E A;  3GRS A;  3P4R A;  1XHC A;  1ZP0 A;  3C4A A;  2BK5 A;  2Q0L A;  2WDR A;  4JQ9 A;  1KNR A;  3R9U A;  3NN6 X;  4B64 A;  4U2L A;  2APG A;  3C4N A;  1JU2 A;  4IA6 A;  3CN8 A;  4EMJ A;  2VVM A;  2XFQ A;  4YTP A;  2BCP A;  2HQM A;  1NG3 A;  1YKJ A;  1GRH A;  4USR A;  2Q7V A;  4HB9 A;  1VQW A;  5HY5 A;  4YSX A;  3AD7 B;  2FJB A;  4BV6 A;  1EL7 A;  3PS9 A;  1IUW A;  4Z44 A;  1D4E A;  1B8S A;  3EPT A;  2BAB A;  2WBA A;  3UTF A;  4EQX A;  3F8P A;  4EMW A;  2TMD A;  1PXC A;  4CRT A;  2WDV A;  2C67 A;  2B76 A;  2WHD A;  1JNR A;  1JRX A;  3SFE A;  1PJ7 A;  1DOB A;  1Y56 A;  4FX9 A;  3AE9 A;  4RG3 A;  1UKV G;  3AEF A;  5JCI A;  2FJD A;  5EBK A;  4U2T A;  3CGB A;  3NK1 X;  4XWR A;  3RHA A;  3C96 A;  3AXB A;  3QFB A;  1ONF A;  5KWF A;  3NKS A;  1F6M A;  3DJJ A;  4H2R A;  4NZH A;  5KVH A;  3H8I A;  4ECH A;  2JK6 A;  4JNA A;  2CUL A;  3VRB A;  4ZN0 A;  4LII A;  5U63 A;  4APN A;  3CND A;  3ATQ A;  4D03 A;  3AE7 A;  4I58 A;  2BXS A;  1REO A;  1OJT A;  4B69 A;  4EIQ A;  4HA6 A;  4NTC A;  1ZMD A;  1ZK7 A;  2YQU A;  3FG2 P;  3DK4 A;  3NRN A;  1OJ9 A;  4M52 A;  2YLZ A;  4TM0 A;  5JCK A;  2C76 A;  3ZYX A;  2YLX A;  4AT0 A;  3G5Q A;  4B68 A;  2R4E A;  4IV9 A;  2O9Z A;  3IHM A;  1FCD A;  1IUT A;  1D7Y A;  3VQR A;  3AD9 B;  2PHH A;  2YLR A;  2YAU A;  4X9M A;  3UTG A;  3I3L A;  2XVE A;  3AE1 A;  4OPI A;  1YY5 A;  3DJD A;  3ALJ A;  4BUR A;  2WOV A;  3BHK A;  1DOD A;  2YWL A;  4BK2 A;  3DGH A;  4E0V A;  1MXT A;  3NK0 X;  3UTE A;  1NDA A;  2YG6 A;  3UTH A;  1YQ3 A;  4U8L A;  5FS8 A;  2EQ7 A;  2WP6 A;  1Y0P A;  2BC0 A;  2XDO A;  3GYI A;  4U8M A;  3KKJ A;  2AR8 A;  1JOA A;  1ZMC A;  2C75 A;  1E1K A;  1GTE A;  3CNS A;  4C3X A;  3DK9 A;  4H4T A;  5KXJ A;  3NTD A;  3RNM A;  1QLB A;  5M10 A;  2H88 A;  4H4R A;  3GYJ A;  3F8R A;  1H83 A;  3AEE A;  2IVD A;  4A6N B;  4DGK A;  1CJ3 A;  2YVG A;  3ALM A;  1AOG A;  3COX A;  1E7P A;  4Z2U A;  4K2X A;  3P4P A;  3AD8 B;  5EOW A;  2GR0 A;  2R0P A;  1F8R A;  2XVH A;  4Y4L A;  2R0G A;  2W0H A;  2BYB A;  2XFN A;  5U1O A;  4EQS A;  2RGO A;  1E39 A;  1HYU A;  1L9C A;  5BUL A;  1PBF A;  4GUV A;  4TLX A;  3VRD B;  2WOW A;  4H2Q A;  3Q9T A;  3AE3 A;  3M12 A;  1PXB A;  3UKK A;  3LZX A;  4B1B A;  2B7R A;  4H4X A;  4MJW A;  1Y56 B;  2ZZB A;  3AE4 A;  3QSM A;  4J56 A;  1TYT A;  3M13 A;  4CY8 A;  2YG5 A;  3GD4 A;  3GDP A;  4IVO B;  4C5O A;  1GRA A;  4LU6 A;  3V76 A;  5BVA A;  1TYP A;  3CTY A;  3QJ4 A;  4A65 A;  2XCG A;  4UP3 A;  3GWF A;  2E1M A;  4FK1 A;  4KPR A;  3NLC A;  1NEK A;  5JCL A;  3NK2 X;  2WS3 A;  5EB5 A;  1H84 A;  2ZZC A;  4CNK A;  4J31 A;  3UKH A;  1Z6L A;  2JBV A;  5HYM A;  4A7A A;  1TRB A;  3K7Q X;  1O5W A;  3NHO X;  3G5S A;  1QO8 A;  4NEW A;  1ZKQ A;  5U25 A;  5L46 A;  4C74 A;  1CJ2 A;  1PBC A;  4K22 A;  3P4S A;  2BS4 A;  1DOC A;  2OA1 A;  4A6N A;  4WX1 A;  3VR8 A;  2R0C A;  1RSG A;  2FJA A;  1VDC A;  3KLJ A;  3KD9 A;  4USQ A;  4H7U A;  3NYE A;  1F8S A;  4AP1 A;  4B66 A;  2IVE A;  4OPG A;  1GTH A;  5J7X A;  1H81 A;  1CBO A;  1CHU A;  1FEC A;  1PS9 A;  1LV0 A;  3ICT A;  2BS3 A;  4ADW A;  5C2T A;  1MOK A;  3AE6 A;  4GDE A;  3ISH A;  5BRT A;  1D7L A;  1GRF A;  3NYC A;  4YSY A;  4TM4 A;  4LA1 A;  5JCM A;  2FBW A;  2ZBW A;  2E4G A;  1D5T A;  1ZDL A;  3PVC A;  2BK3 A;  2A8X A;  4IA5 A;  3H8L A;  2CFY A;  2RGH A;  1GRB A;  2X3N A;  4DSH A;  1LQT A;  4XWZ A;  1BKW A;  2Z5X A;  5KOW A;  3BI2 A;  3G5R A;  4IVM B;  2B9X A;  3KVE A;  2X99 A;  2PYX A;  3BHF A;  4OPL A;  3AYI A;  3M0O A;  1PDH A;  4GRT A;  1XPQ A;  3HZL A;  3NT6 A;  4EMI A;  1K0I A;  5FMH A;  2GRT A;  1S2Q A;  4YWO A;  3BNU A;  3BNM A;  4U8P A;  4H4P A;  3AWI A;  1M6I A;  1L9D A;  1N4W A;  1NHR A;  3DA1 A;  3GDN A;  3K30 A;  3KA7 A;  3NN0 X;  5FS7 A;  1PXA A;  2X8G A;  3CPJ G;  4GCM A;  2WU5 A;  4RG4 A;  2GH5 A;  2XLR A;  3AED A;  2X50 A;  4Z25 A;  1BZL A;  4GF7 A;  3KPF A;  4Z2R A;  3RP8 A;  3D1C A;  2YVJ A;  3CGE A;  3II4 A;  4J2W A;  3ZDN A;  4C77 A;  3SM8 A;  4D04 A;  2B9Y A;  1M64 A;  2OLO A;  4DSG A;  4YSH A;  1DJN A;  2C7G A;  3ICR A;  2XYO A;  1IUS A;  1ZOV A;  3AYJ A;  1ZOY A;  3NIX A;  4JN9 A;  2V3B A;  1TDE A;  3S61 A;  4H4Y A;  2CDU A;  3UKQ A;  4EM3 A;  1PBB A;  3UCL A;  5HHF A;  1NG4 A;  2VRM A;  4BK1 A;  4NEV A;  3RP7 A;  3GMC A;  1PN0 A;  1PJ6 A;  3QVR A;  1GER A;  5IQ4 A;  2C72 A;  4K7Z A;  1D4D A;  2BXR A;  4H4U A;  1RYI A;  3AE2 A;  3OC4 A;  3FIM B;  5GSN A;  2Q6U A;  2UZZ A;  3CPH G;  3GSI A;  2WEU A;  1FL2 A;  1EL5 A;  1BGJ A;  2R4J A;  2B9W A;  2RGJ A;  2WES A;  3JSK A;  2GQW A;  2JB3 A;  2V60 A;  1TDF A;  2C70 A;  2VZ2 A;  2Q0K A;  4Z24 A;  3ALL A;  3AE8 A;  2AAQ A;  4K8D A;  4A79 A;  1GAL A;  5HXI A;  1H86 A;  4H4S A;  1EBD A;  1NPX A;  4CY6 A;  5FS9 A;  2XVJ A;  4J34 A;  2C73 A;  3DJE A;  4JY3 A;  2VVL A;  2Z5Y A;  4FDC B;  4K5R A;  3VR9 A;  1LJ1 A;  1EL8 A;  3IWA A;  1JNZ A;  3AE5 A;  1LPF A;  2A87 A;  1W4X A;  2YG4 A;  1E1N A;  1BGN A;  2BK4 A;  3EF6 A;  2FJE A;  4X9N A;  4CNJ A;  1P2H A;  4B65 A;  2I0Z A;  3CNJ A;  1GET A;  4U8K A;  4I59 A;  1O94 A;  1GSN A;  4DNA A;  4EQW A;  3UOY A;  2H89 A;  3DK8 A;  2XFO A;  1JRZ A;  3LOV A;  3T37 A;  2RAB A;  3FBS A;  3WE0 A;  3P4Q A;  2AQJ A;  1Q1W A;  4A9W A;  2WQY A;  2Y6R A;  2EQ8 A;  2GAG B;  2R46 A;  4U8I A;  2R45 A;  4A5L A;  1CL0 A;  5LV9 A;  3I6D A;  2XFU A;  2GV8 A;  2XFP A;  2XLS A;  2GQF A;  3FMW A;  1QJD A;  5CQF A;  1N4V A;  2TPR A;  1NHS A;  4NTD A;  3ATR A;  1CC6 A;  1NHQ A;  1Q9I A;  2GF3 A;  3B3R A;  3H4K A;  3LZW A;  4J57 A;  1E1M A;  2BS2 A;  2GB0 A;  2BCG G;  1CJ4 A;  1NHP A;  3EAO A;  4OPT A;  1CJC A;  1KF6 A;  5J60 A;  3K7T A;  1ZX9 A;  3SGL A;  3ITJ A;  1LQU A;  2JB2 A;  1MO9 A;  4P9S A;  4U8J A;  3ICS A;  4OPC A;  4BK3 A;  1OJC A;  1B5Q A;  2YR5 A;  4PAB A;  4EQR A;  3O0H A;  1SEZ A;  3CPI G;  4RSL A;  1S2Y A;  2DKH A;  4ZCD A;  4YSZ A;  2X8H A;  3UKP A;  4EIP A;  4AP3 A;  2JB1 A;  3UP5 A;  4AT2 A;  4KX6 A;  2CVJ A;  2QCU A;  5GRT A;  4B67 A;  2VRL A;  4U8N A;  3DGZ A;  1OJD A;  2XVI A;  2GMJ A;  5C3J A;  1CF3 A;  4CCR A;  1IUX A;  3IC9 A;  3VRA A;  4XXG A;  1GEU A;  4YTN A;  2V6O A;  2WPE A;  4H50 A;  2GMH A;  1YQZ A;  1N1P A;  2WOI A;  1K0J A;  3IF9 A;  3UKF A;  3LAD A;  4K5S A;  4PAA A;  4H4Z A;  4REK A;  3RED A;  2NPX A;  4H4V A;  3AYL A;  4UDP A;  1B4V A;  1GT8 A;  4A99 A;  1S3E A;  3QSE A;  3K7M X;  4N9X A;  3NYF A;  3GD3 A;  4UDR A;  1LVL A;  2NVK X;  2A89 A;  3L8K A;  4H4W A;  4OPU A;  2VOU A;  2BAC A;  2XLP A;  4BJY A;  4GR1 A;  1GND A;  2C3D A;  1DJQ A;  1KNP A;  4OVI A;  4YKF A;  2YM2 A;  2WU2 A;  3GRT A;  3CNP A;  5BUK A;  3Q6J A;  2OAM A;  4TM3 A;  1V59 A;  4FK1 C;  1E1L A;  1GPE A;  3UOX A;  1GV4 A;  4TM1 A;  1FEA A;  5IPY A;  1PBE A;  4U8O A;  5DBJ A;  2V5Z A;  2XLT A;  4ICY A;  5EB4 A;  2VQ7 A;  3GWD A;  4YTM A;  4JDR A;  1NAA A;  2YG3 A;  3NGC X;  1GRE A;  1K4Q A;  4H2N A;  1VG9 A;  1EL9 A;  1RP0 A;  4U2S A;  1NEN A;  1GOS A;  1K0L A;  2JKC A;  3IHG A;  1IJH A;  1PJ5 A;  3AB1 A;  5M0Z A;  2C64 A;  1DOE A;  3AEC A;  2BC1 A;  4OCG A;  1B37 A;  2ACZ A;  2YM1 A;  2J3N A;  3QVP A;  4C3Y A;  3BI4 A;  3GMB A;  5KOX A;  2WDQ A;  2VQB A;  1TDO A;  1O95 A;  2XVF A;  3S5W A;  4J33 A;  2GR3 A;  4Z26 A;  1H82 A;  5IQ1 A;  1GRT A;  4ZCC A;  4BJZ A;  1KSS A;  3DME A;  2C3C A;  1COY A;  4GDP A;  1H6V A;  1FEB A;  2QA1 A;  2XLU A;  1IUU A;  1LTX R;  2YR4 A;  2C66 A;  4YXD A;  1TDN A;  4OPD A;  5KRQ A;  1IUV A;  2VVL G;  3SQP A;  3RP6 A;  2IID A;  1JRY A;  1KDG A;  2X8C A;  2F5Z A;  1BWC A;  4TLZ A;  3QFA A;  1BF3 A;  2EQ6 A;  4UDQ A;  2E5V A;  3DH9 A;  1YQ4 A;  4H2P A;  1CC2 A;  2BA9 A;  2C65 A;  3UOV A;  4H4Q A;  1XDI A;  2V3A A;  1PHH A;  1ZY8 A;  2WPF A;  3ADA B;  3LJP A;  2WET A;  3UP4 A;  3SFD A;  2YLS A;  3NG7 X;  1XAN A;  1TDK A;  4Y4M A;  1FOH A;  1L0V A;  1S3B A;  2GR2 A;  2GVC A;  2V61 A;  2YG7 A;  3CGC A;  3E1T A;  4X4J A;  3FPZ A; 
#chains in the Genus database with same CATH topology
 1GXF A;  1OJA A;  1H7X A;  4CBQ A;  1F3P A;  2YVF A;  3BI5 A;  2OAL A;  3URH A;  3DJG X;  1Q1R A;  3P9U A;  2EQ9 A;  4Z43 A;  2GAH B;  2OLN A;  4YKG A;  5FS6 A;  4EM4 A;  2YLT A;  2ARD A;  3NNE A;  4AOX A;  2B7S A;  4G6G A;  1ELI A;  1VG0 A;  3AEB A;  3HYW A;  1KSU A;  5ER0 A;  4NTE A;  5TR3 A;  1DNC A;  4JNQ A;  1GRG A;  2DKI A;  4O5U A;  2GEW A;  2YLW A;  4B63 A;  2GR1 A;  3OZ2 A;  3LXD A;  3NTA A;  3P1W A;  3UKA A;  3D8X A;  3AEA A;  1DXL A;  2QA2 A;  2JAE A;  3F8D A;  3V3O A;  2WP5 A;  4JY2 A;  1H7W A;  2WP9 A;  4YT0 A;  2ZZ0 A;  1JEH A;  3ABV A;  1D4C A;  2R9Z A;  3UOZ A;  3NH3 X;  2WPC A;  1GES A;  3SZC A;  1N4U A;  3LB8 A;  3CGD A;  4Y4N A;  1E6E A;  1KFY A;  1X31 B;  3PO7 A;  5CKU A;  4WCT A;  3B6D A;  3EAN A;  3KU9 A;  4CCQ A;  1PBD A;  3CNT A;  5KVI A;  3V3N A;  3CIR A;  4O5Q A;  3AEG A;  3L1R A;  3UKL A;  2QAE A;  2Y6Q A;  3QSS A;  4Z2T A;  5JCN A;  1F8W A;  2YR6 A;  4J36 A;  1VRQ B;  4AOS A;  1CC4 A;  1L9E A;  1P2E A;  3GRS A;  3P4R A;  1XHC A;  1ZP0 A;  3C4A A;  2BK5 A;  2Q0L A;  2WDR A;  4JQ9 A;  1KNR A;  3R9U A;  3NN6 X;  4B64 A;  4U2L A;  2APG A;  3C4N A;  1JU2 A;  3T31 A;  4IA6 A;  3CN8 A;  4EMJ A;  2VVM A;  2XFQ A;  4YTP A;  2BCP A;  2HQM A;  1NG3 A;  1YKJ A;  1GRH A;  4USR A;  2Q7V A;  4HB9 A;  1VQW A;  5HY5 A;  4YSX A;  3AD7 B;  2FJB A;  4BV6 A;  1EL7 A;  3PS9 A;  1IUW A;  4Z44 A;  1D4E A;  1B8S A;  3EPT A;  2BAB A;  2WBA A;  3UTF A;  4EQX A;  3F8P A;  4EMW A;  2TMD A;  1PXC A;  4CRT A;  2WDV A;  2C67 A;  2B76 A;  2WHD A;  1JNR A;  1JRX A;  3SFE A;  1PJ7 A;  1DOB A;  1Y56 A;  4FX9 A;  3AE9 A;  4RG3 A;  1UKV G;  3AEF A;  4NWZ A;  5JCI A;  2FJD A;  5EBK A;  4U2T A;  3CGB A;  3NK1 X;  4XWR A;  3RHA A;  3C96 A;  3AXB A;  3QFB A;  1ONF A;  5KWF A;  3NKS A;  1F6M A;  3DJJ A;  4H2R A;  4NZH A;  5KVH A;  3H8I A;  4ECH A;  2JK6 A;  4JNA A;  2CUL A;  3VRB A;  4ZN0 A;  4LII A;  5U63 A;  4APN A;  3CND A;  3ATQ A;  4D03 A;  3AE7 A;  4I58 A;  2BXS A;  1REO A;  1OJT A;  4B69 A;  4EIQ A;  4HA6 A;  4NTC A;  3T2K A;  1ZMD A;  1ZK7 A;  2YQU A;  3FG2 P;  3DK4 A;  3NRN A;  1OJ9 A;  4M52 A;  2YLZ A;  4TM0 A;  5JCK A;  2C76 A;  3ZYX A;  2YLX A;  4AT0 A;  3SX6 A;  3G5Q A;  4B68 A;  2R4E A;  4IV9 A;  2O9Z A;  3IHM A;  1FCD A;  1IUT A;  1D7Y A;  3VQR A;  3AD9 B;  2PHH A;  2YLR A;  2YAU A;  4X9M A;  3UTG A;  3I3L A;  2XVE A;  4NNJ A;  3AE1 A;  4OPI A;  1YY5 A;  3DJD A;  3ALJ A;  3T2Y A;  4BUR A;  2WOV A;  3BHK A;  1DOD A;  2YWL A;  4G9K A;  4BK2 A;  3DGH A;  4E0V A;  1MXT A;  3NK0 X;  3UTE A;  1NDA A;  2YG6 A;  3UTH A;  1YQ3 A;  4U8L A;  5FS8 A;  2EQ7 A;  2WP6 A;  1Y0P A;  2BC0 A;  2XDO A;  2BRA A;  3GYI A;  4U8M A;  3T0K A;  3KKJ A;  2AR8 A;  1JOA A;  1ZMC A;  2C75 A;  1E1K A;  1GTE A;  4G6H A;  3CNS A;  4C3X A;  3DK9 A;  4H4T A;  5KXJ A;  3NTD A;  3RNM A;  1QLB A;  4II3 A;  5M10 A;  2H88 A;  4H4R A;  3GYJ A;  3F8R A;  1H83 A;  3AEE A;  2IVD A;  4A6N B;  4DGK A;  1CJ3 A;  2YVG A;  3ALM A;  1AOG A;  3COX A;  1E7P A;  4Z2U A;  4K2X A;  3P4P A;  3AD8 B;  5EOW A;  2GR0 A;  2R0P A;  1F8R A;  2XVH A;  4Y4L A;  2R0G A;  2W0H A;  2BYB A;  2XFN A;  5U1O A;  4EQS A;  2RGO A;  1E39 A;  1HYU A;  1L9C A;  5BUL A;  1PBF A;  4GUV A;  4TLX A;  3VRD B;  2WOW A;  4H2Q A;  3Q9T A;  3AE3 A;  3M12 A;  1PXB A;  3UKK A;  3LZX A;  4B1B A;  2B7R A;  4H4X A;  4MJW A;  1Y56 B;  2ZZB A;  3AE4 A;  3QSM A;  3KPK A;  4J56 A;  1TYT A;  3M13 A;  4CY8 A;  2YG5 A;  3GD4 A;  3GDP A;  4IVO B;  4C5O A;  1GRA A;  4LU6 A;  3V76 A;  5BVA A;  1TYP A;  3CTY A;  3QJ4 A;  4A65 A;  2XCG A;  4UP3 A;  3GWF A;  2E1M A;  4FK1 A;  3SXI A;  4KPR A;  3NLC A;  1NEK A;  5JCL A;  3NK2 X;  2WS3 A;  5EB5 A;  1H84 A;  2ZZC A;  4CNK A;  4J31 A;  3UKH A;  1Z6L A;  2JBV A;  5HYM A;  4A7A A;  1TRB A;  3K7Q X;  1O5W A;  3NHO X;  3G5S A;  1QO8 A;  4NEW A;  1ZKQ A;  5U25 A;  5L46 A;  4C74 A;  1CJ2 A;  1PBC A;  4K22 A;  3P4S A;  5KMR A;  2BS4 A;  1DOC A;  2OA1 A;  4A6N A;  4WX1 A;  3VR8 A;  2R0C A;  1RSG A;  2FJA A;  1VDC A;  3KLJ A;  3KD9 A;  4USQ A;  4H7U A;  3NYE A;  1F8S A;  4AP1 A;  4D04 A;  4B66 A;  2IVE A;  4OPG A;  1GTH A;  5J7X A;  1H81 A;  1CBO A;  1CHU A;  1FEC A;  1PS9 A;  1LV0 A;  3ICT A;  2BS3 A;  4ADW A;  5C2T A;  1MOK A;  3AE6 A;  4GDE A;  3ISH A;  5BRT A;  1D7L A;  1GRF A;  3NYC A;  4YSY A;  4TM4 A;  4LA1 A;  5JCM A;  5KMQ A;  2FBW A;  2ZBW A;  2E4G A;  1D5T A;  1ZDL A;  3PVC A;  3HYX A;  2BK3 A;  2A8X A;  4IA5 A;  3H8L A;  3T2Z A;  2CFY A;  2RGH A;  1GRB A;  2X3N A;  4DSH A;  1LQT A;  4XWZ A;  1BKW A;  2Z5X A;  5KOW A;  3BI2 A;  3G5R A;  4IVM B;  2B9X A;  3KVE A;  2X99 A;  2PYX A;  3BHF A;  4OPL A;  3AYI A;  3M0O A;  1PDH A;  4GRT A;  1XPQ A;  3HZL A;  3NT6 A;  4EMI A;  1K0I A;  5FMH A;  2GRT A;  1S2Q A;  4YWO A;  3BNU A;  3HYV A;  3BNM A;  4U8P A;  4H4P A;  4GAP A;  3AWI A;  1M6I A;  1L9D A;  1N4W A;  1NHR A;  3DA1 A;  3GDN A;  3K30 A;  3KA7 A;  3NN0 X;  5FS7 A;  1PXA A;  2X8G A;  3CPJ G;  4GCM A;  2WU5 A;  4RG4 A;  2GH5 A;  2XLR A;  3AED A;  2X50 A;  4Z25 A;  1BZL A;  4GF7 A;  3KPF A;  4Z2R A;  3RP8 A;  3D1C A;  2YVJ A;  3CGE A;  3II4 A;  4J2W A;  3T14 A;  3ZDN A;  3SM8 A;  4C77 A;  2B9Y A;  1M64 A;  2OLO A;  4DSG A;  4YSH A;  1DJN A;  2C7G A;  3ICR A;  2XYO A;  1IUS A;  1ZOV A;  3AYJ A;  1ZOY A;  3NIX A;  4JN9 A;  2V3B A;  1TDE A;  3S61 A;  4H4Y A;  2CDU A;  3UKQ A;  4EM3 A;  1PBB A;  3UCL A;  5HHF A;  1NG4 A;  2VRM A;  4BK1 A;  4NEV A;  3RP7 A;  3GMC A;  1PN0 A;  1PJ6 A;  3QVR A;  1GER A;  4G74 A;  5IQ4 A;  2C72 A;  4K7Z A;  1D4D A;  2BXR A;  4H4U A;  1RYI A;  3AE2 A;  3OC4 A;  3FIM B;  5GSN A;  2Q6U A;  2UZZ A;  3CPH G;  3GSI A;  2WEU A;  1FL2 A;  1EL5 A;  1BGJ A;  2R4J A;  2B9W A;  2RGJ A;  2WES A;  3JSK A;  2GQW A;  2JB3 A;  2V60 A;  1TDF A;  2C70 A;  2VZ2 A;  2Q0K A;  4Z24 A;  3ALL A;  3AE8 A;  2AAQ A;  4K8D A;  4A79 A;  1GAL A;  5HXI A;  1H86 A;  4H4S A;  1EBD A;  1NPX A;  4CY6 A;  5FS9 A;  2XVJ A;  4J34 A;  2C73 A;  3DJE A;  4JY3 A;  2VVL A;  2Z5Y A;  4FDC B;  4K5R A;  3VR9 A;  1LJ1 A;  1EL8 A;  3SY4 A;  3IWA A;  1JNZ A;  3AE5 A;  1LPF A;  2A87 A;  1W4X A;  2YG4 A;  1E1N A;  1BGN A;  2BK4 A;  3EF6 A;  2FJE A;  4X9N A;  4CNJ A;  1P2H A;  4G73 A;  4B65 A;  2I0Z A;  2C4C A;  3CNJ A;  1GET A;  4U8K A;  3GYX A;  4I59 A;  1O94 A;  1GSN A;  4DNA A;  4EQW A;  5KMS A;  3UOY A;  2H89 A;  3DK8 A;  2XFO A;  1JRZ A;  3LOV A;  3T37 A;  2RAB A;  3FBS A;  3WE0 A;  3P4Q A;  2AQJ A;  1Q1W A;  4A9W A;  2WQY A;  2Y6R A;  2EQ8 A;  2GAG B;  2R46 A;  4U8I A;  2R45 A;  4A5L A;  1CL0 A;  5LV9 A;  3I6D A;  2XFU A;  2GV8 A;  2XFP A;  2XLS A;  2GQF A;  3FMW A;  1QJD A;  5CQF A;  1N4V A;  2TPR A;  1NHS A;  4NTD A;  3ATR A;  1CC6 A;  1NHQ A;  1Q9I A;  2GF3 A;  3B3R A;  3H4K A;  3LZW A;  4J57 A;  1E1M A;  2BS2 A;  2GB0 A;  2BCG G;  1CJ4 A;  1NHP A;  3EAO A;  4OPT A;  1CJC A;  1KF6 A;  5J60 A;  3K7T A;  1ZX9 A;  3SGL A;  3ITJ A;  1LQU A;  2JB2 A;  1MO9 A;  4P9S A;  4U8J A;  2BRY A;  3ICS A;  4OPC A;  4BK3 A;  1OJC A;  1B5Q A;  2YR5 A;  4PAB A;  4EQR A;  3O0H A;  1SEZ A;  3CPI G;  4RSL A;  1S2Y A;  2DKH A;  4ZCD A;  4YSZ A;  2X8H A;  3UKP A;  4EIP A;  4AP3 A;  2JB1 A;  3UP5 A;  4AT2 A;  4KX6 A;  2CVJ A;  2QCU A;  5GRT A;  4B67 A;  5KNL A;  2VRL A;  4U8N A;  3SZW A;  3DGZ A;  1OJD A;  2XVI A;  2GMJ A;  5C3J A;  1CF3 A;  4CCR A;  5KMP A;  1IUX A;  3IC9 A;  3VRA A;  4XXG A;  1GEU A;  4YTN A;  2V6O A;  2WPE A;  4H50 A;  2GMH A;  1YQZ A;  1N1P A;  2WOI A;  1K0J A;  3IF9 A;  3UKF A;  3LAD A;  4K5S A;  4PAA A;  4H4Z A;  4REK A;  3RED A;  2NPX A;  4H4V A;  3AYL A;  4UDP A;  1B4V A;  1GT8 A;  4A99 A;  1S3E A;  3QSE A;  3K7M X;  4N9X A;  3NYF A;  3GD3 A;  4UDR A;  1LVL A;  2NVK X;  3SYI A;  2A89 A;  3L8K A;  4H4W A;  4GAV A;  4OPU A;  2VOU A;  2BAC A;  2XLP A;  4BJY A;  4GR1 A;  1GND A;  2C3D A;  4II2 A;  1DJQ A;  1KNP A;  4OVI A;  4YKF A;  2YM2 A;  2WU2 A;  3GRT A;  3CNP A;  5BUK A;  3Q6J A;  2OAM A;  4TM3 A;  1V59 A;  4FK1 C;  1E1L A;  1GPE A;  3UOX A;  1GV4 A;  4TM1 A;  1FEA A;  5IPY A;  1PBE A;  4U8O A;  5DBJ A;  2V5Z A;  2XLT A;  4ICY A;  5EB4 A;  2VQ7 A;  3GWD A;  4YTM A;  4JDR A;  1NAA A;  2YG3 A;  3NGC X;  1GRE A;  1K4Q A;  4H2N A;  1VG9 A;  3SZF A;  1EL9 A;  1RP0 A;  4U2S A;  1NEN A;  1GOS A;  1K0L A;  2JKC A;  3IHG A;  1IJH A;  1PJ5 A;  3AB1 A;  5M0Z A;  2C64 A;  1DOE A;  3AEC A;  2BC1 A;  4OCG A;  1B37 A;  2ACZ A;  2YM1 A;  2J3N A;  3QVP A;  4C3Y A;  3BI4 A;  3GMB A;  5KOX A;  2WDQ A;  2VQB A;  1TDO A;  1O95 A;  2XVF A;  3S5W A;  4J33 A;  2GR3 A;  4Z26 A;  1H82 A;  5IQ1 A;  1GRT A;  4ZCC A;  4BJZ A;  1KSS A;  3DME A;  2C3C A;  1COY A;  3SZ0 A;  4GDP A;  1H6V A;  1FEB A;  2QA1 A;  2XLU A;  1IUU A;  1LTX R;  2YR4 A;  2C66 A;  4YXD A;  1TDN A;  4OPD A;  3CMM A;  5KRQ A;  1IUV A;  2VVL G;  3SQP A;  3RP6 A;  2IID A;  1JRY A;  1KDG A;  2X8C A;  2F5Z A;  1BWC A;  4TLZ A;  3QFA A;  1BF3 A;  2EQ6 A;  4UDQ A;  2E5V A;  3DH9 A;  1YQ4 A;  4H2P A;  1CC2 A;  2BA9 A;  2C65 A;  3UOV A;  4H4Q A;  1XDI A;  2V3A A;  1PHH A;  1ZY8 A;  2WPF A;  3ADA B;  3LJP A;  2WET A;  3UP4 A;  3SFD A;  2YLS A;  3NG7 X;  1XAN A;  1TDK A;  4Y4M A;  1FOH A;  1L0V A;  1S3B A;  2GR2 A;  2GVC A;  2V61 A;  2YG7 A;  3CGC A;  3E1T A;  4X4J A;  3FPZ A; 
#chains in the Genus database with same CATH homology
 1GXF A;  1OJA A;  1H7X A;  4CBQ A;  1F3P A;  2YVF A;  3BI5 A;  2OAL A;  3URH A;  3DJG X;  1Q1R A;  3P9U A;  2EQ9 A;  4Z43 A;  2GAH B;  2OLN A;  4YKG A;  5FS6 A;  4EM4 A;  2YLT A;  2ARD A;  3NNE A;  4AOX A;  2B7S A;  4G6G A;  1ELI A;  1VG0 A;  3AEB A;  3HYW A;  1KSU A;  5ER0 A;  4NTE A;  5TR3 A;  1DNC A;  4JNQ A;  1GRG A;  2DKI A;  4O5U A;  2GEW A;  2YLW A;  4B63 A;  2GR1 A;  3OZ2 A;  3LXD A;  3NTA A;  3P1W A;  3UKA A;  3D8X A;  3AEA A;  1DXL A;  2QA2 A;  2JAE A;  3F8D A;  3V3O A;  2WP5 A;  4JY2 A;  1H7W A;  2WP9 A;  4YT0 A;  2ZZ0 A;  1JEH A;  3ABV A;  1D4C A;  2R9Z A;  3UOZ A;  3NH3 X;  2WPC A;  1GES A;  3SZC A;  1N4U A;  3LB8 A;  3CGD A;  4Y4N A;  1E6E A;  1KFY A;  1X31 B;  3PO7 A;  5CKU A;  4WCT A;  3B6D A;  3EAN A;  3KU9 A;  4CCQ A;  1PBD A;  3CNT A;  5KVI A;  3V3N A;  3CIR A;  4O5Q A;  3AEG A;  3L1R A;  3UKL A;  2QAE A;  2Y6Q A;  3QSS A;  4Z2T A;  5JCN A;  1F8W A;  2YR6 A;  4J36 A;  1VRQ B;  4AOS A;  1CC4 A;  1L9E A;  1P2E A;  3GRS A;  3P4R A;  1XHC A;  1ZP0 A;  3C4A A;  2BK5 A;  2Q0L A;  2WDR A;  4JQ9 A;  1KNR A;  3R9U A;  3NN6 X;  4B64 A;  4U2L A;  2APG A;  3C4N A;  1JU2 A;  3T31 A;  4IA6 A;  3CN8 A;  4EMJ A;  2VVM A;  2XFQ A;  4YTP A;  2BCP A;  2HQM A;  1NG3 A;  1YKJ A;  1GRH A;  4USR A;  2Q7V A;  4HB9 A;  1VQW A;  5HY5 A;  4YSX A;  3AD7 B;  2FJB A;  4BV6 A;  1EL7 A;  3PS9 A;  1IUW A;  4Z44 A;  1D4E A;  1B8S A;  3EPT A;  2BAB A;  2WBA A;  3UTF A;  4EQX A;  3F8P A;  4EMW A;  2TMD A;  1PXC A;  4CRT A;  2WDV A;  2C67 A;  2B76 A;  2WHD A;  1JNR A;  1JRX A;  3SFE A;  1PJ7 A;  1DOB A;  1Y56 A;  4FX9 A;  3AE9 A;  4RG3 A;  1UKV G;  3AEF A;  4NWZ A;  5JCI A;  2FJD A;  5EBK A;  4U2T A;  3CGB A;  3NK1 X;  4XWR A;  3RHA A;  3C96 A;  3AXB A;  3QFB A;  1ONF A;  5KWF A;  3NKS A;  1F6M A;  3DJJ A;  4H2R A;  4NZH A;  5KVH A;  3H8I A;  4ECH A;  2JK6 A;  4JNA A;  2CUL A;  3VRB A;  4ZN0 A;  4LII A;  5U63 A;  4APN A;  3CND A;  3ATQ A;  4D03 A;  3AE7 A;  4I58 A;  2BXS A;  1REO A;  1OJT A;  4B69 A;  4EIQ A;  4HA6 A;  4NTC A;  3T2K A;  1ZMD A;  1ZK7 A;  2YQU A;  3FG2 P;  3DK4 A;  3NRN A;  1OJ9 A;  4M52 A;  2YLZ A;  4TM0 A;  5JCK A;  2C76 A;  3ZYX A;  2YLX A;  4AT0 A;  3SX6 A;  3G5Q A;  4B68 A;  2R4E A;  4IV9 A;  2O9Z A;  3IHM A;  1FCD A;  1IUT A;  1D7Y A;  3VQR A;  3AD9 B;  2PHH A;  2YLR A;  2YAU A;  4X9M A;  3UTG A;  3I3L A;  2XVE A;  4NNJ A;  3AE1 A;  4OPI A;  1YY5 A;  3DJD A;  3ALJ A;  3T2Y A;  4BUR A;  2WOV A;  3BHK A;  1DOD A;  2YWL A;  4G9K A;  4BK2 A;  3DGH A;  4E0V A;  1MXT A;  3NK0 X;  3UTE A;  1NDA A;  2YG6 A;  3UTH A;  1YQ3 A;  4U8L A;  5FS8 A;  2EQ7 A;  2WP6 A;  1Y0P A;  2BC0 A;  2XDO A;  2BRA A;  3GYI A;  4U8M A;  3T0K A;  3KKJ A;  2AR8 A;  1JOA A;  1ZMC A;  2C75 A;  1E1K A;  1GTE A;  4G6H A;  3CNS A;  4C3X A;  3DK9 A;  4H4T A;  5KXJ A;  3NTD A;  3RNM A;  1QLB A;  4II3 A;  5M10 A;  2H88 A;  4H4R A;  3GYJ A;  3F8R A;  1H83 A;  3AEE A;  2IVD A;  4A6N B;  4DGK A;  1CJ3 A;  2YVG A;  3ALM A;  1AOG A;  3COX A;  1E7P A;  4Z2U A;  4K2X A;  3P4P A;  3AD8 B;  5EOW A;  2GR0 A;  2R0P A;  1F8R A;  2XVH A;  4Y4L A;  2R0G A;  2W0H A;  2BYB A;  2XFN A;  5U1O A;  4EQS A;  2RGO A;  1E39 A;  1HYU A;  1L9C A;  5BUL A;  1PBF A;  4GUV A;  4TLX A;  3VRD B;  2WOW A;  4H2Q A;  3Q9T A;  3AE3 A;  3M12 A;  1PXB A;  3UKK A;  3LZX A;  4B1B A;  2B7R A;  4H4X A;  4MJW A;  1Y56 B;  2ZZB A;  3AE4 A;  3QSM A;  3KPK A;  4J56 A;  1TYT A;  3M13 A;  4CY8 A;  2YG5 A;  3GD4 A;  3GDP A;  4IVO B;  4C5O A;  1GRA A;  4LU6 A;  3V76 A;  5BVA A;  1TYP A;  3CTY A;  3QJ4 A;  4A65 A;  2XCG A;  4UP3 A;  3GWF A;  2E1M A;  4FK1 A;  3SXI A;  4KPR A;  3NLC A;  1NEK A;  5JCL A;  3NK2 X;  2WS3 A;  5EB5 A;  1H84 A;  2ZZC A;  4CNK A;  4J31 A;  3UKH A;  1Z6L A;  2JBV A;  5HYM A;  4A7A A;  1TRB A;  3K7Q X;  1O5W A;  3NHO X;  3G5S A;  1QO8 A;  4NEW A;  1ZKQ A;  5U25 A;  5L46 A;  4C74 A;  1CJ2 A;  1PBC A;  4K22 A;  3P4S A;  5KMR A;  2BS4 A;  1DOC A;  2OA1 A;  4A6N A;  4WX1 A;  3VR8 A;  2R0C A;  1RSG A;  2FJA A;  1VDC A;  3KLJ A;  3KD9 A;  4USQ A;  4H7U A;  3NYE A;  1F8S A;  4AP1 A;  4D04 A;  4B66 A;  2IVE A;  4OPG A;  1GTH A;  5J7X A;  1H81 A;  1CBO A;  1CHU A;  1FEC A;  1PS9 A;  1LV0 A;  3ICT A;  2BS3 A;  4ADW A;  5C2T A;  1MOK A;  3AE6 A;  4GDE A;  3ISH A;  5BRT A;  1D7L A;  1GRF A;  3NYC A;  4YSY A;  4TM4 A;  4LA1 A;  5JCM A;  5KMQ A;  2FBW A;  2ZBW A;  2E4G A;  1D5T A;  1ZDL A;  3PVC A;  3HYX A;  2BK3 A;  2A8X A;  4IA5 A;  3H8L A;  3T2Z A;  2CFY A;  2RGH A;  1GRB A;  2X3N A;  4DSH A;  1LQT A;  4XWZ A;  1BKW A;  2Z5X A;  5KOW A;  3BI2 A;  3G5R A;  4IVM B;  2B9X A;  3KVE A;  2X99 A;  2PYX A;  3BHF A;  4OPL A;  3AYI A;  3M0O A;  1PDH A;  4GRT A;  1XPQ A;  3HZL A;  3NT6 A;  4EMI A;  1K0I A;  5FMH A;  2GRT A;  1S2Q A;  4YWO A;  3BNU A;  3HYV A;  3BNM A;  4U8P A;  4H4P A;  4GAP A;  3AWI A;  1M6I A;  1L9D A;  1N4W A;  1NHR A;  3DA1 A;  3GDN A;  3K30 A;  3KA7 A;  3NN0 X;  5FS7 A;  1PXA A;  2X8G A;  3CPJ G;  4GCM A;  2WU5 A;  4RG4 A;  2GH5 A;  2XLR A;  3AED A;  2X50 A;  4Z25 A;  1BZL A;  4GF7 A;  3KPF A;  4Z2R A;  3RP8 A;  3D1C A;  2YVJ A;  3CGE A;  3II4 A;  4J2W A;  3T14 A;  3ZDN A;  3SM8 A;  4C77 A;  2B9Y A;  1M64 A;  2OLO A;  4DSG A;  4YSH A;  1DJN A;  2C7G A;  3ICR A;  2XYO A;  1IUS A;  1ZOV A;  3AYJ A;  1ZOY A;  3NIX A;  4JN9 A;  2V3B A;  1TDE A;  3S61 A;  4H4Y A;  2CDU A;  3UKQ A;  4EM3 A;  1PBB A;  3UCL A;  5HHF A;  1NG4 A;  2VRM A;  4BK1 A;  4NEV A;  3RP7 A;  3GMC A;  1PN0 A;  1PJ6 A;  3QVR A;  1GER A;  4G74 A;  5IQ4 A;  2C72 A;  4K7Z A;  1D4D A;  2BXR A;  4H4U A;  1RYI A;  3AE2 A;  3OC4 A;  3FIM B;  5GSN A;  2Q6U A;  2UZZ A;  3CPH G;  3GSI A;  2WEU A;  1FL2 A;  1EL5 A;  1BGJ A;  2R4J A;  2B9W A;  2RGJ A;  2WES A;  3JSK A;  2GQW A;  2JB3 A;  2V60 A;  1TDF A;  2C70 A;  2VZ2 A;  2Q0K A;  4Z24 A;  3ALL A;  3AE8 A;  2AAQ A;  4K8D A;  4A79 A;  1GAL A;  5HXI A;  1H86 A;  4H4S A;  1EBD A;  1NPX A;  4CY6 A;  5FS9 A;  2XVJ A;  4J34 A;  2C73 A;  3DJE A;  4JY3 A;  2VVL A;  2Z5Y A;  4FDC B;  4K5R A;  3VR9 A;  1LJ1 A;  1EL8 A;  3SY4 A;  3IWA A;  1JNZ A;  3AE5 A;  1LPF A;  2A87 A;  1W4X A;  2YG4 A;  1E1N A;  1BGN A;  2BK4 A;  3EF6 A;  2FJE A;  4X9N A;  4CNJ A;  1P2H A;  4G73 A;  4B65 A;  2I0Z A;  2C4C A;  3CNJ A;  1GET A;  4U8K A;  3GYX A;  4I59 A;  1O94 A;  1GSN A;  4DNA A;  4EQW A;  5KMS A;  3UOY A;  2H89 A;  3DK8 A;  2XFO A;  1JRZ A;  3LOV A;  3T37 A;  2RAB A;  3FBS A;  3WE0 A;  3P4Q A;  2AQJ A;  1Q1W A;  4A9W A;  2WQY A;  2Y6R A;  2EQ8 A;  2GAG B;  2R46 A;  4U8I A;  2R45 A;  4A5L A;  1CL0 A;  5LV9 A;  3I6D A;  2XFU A;  2GV8 A;  2XFP A;  2XLS A;  2GQF A;  3FMW A;  1QJD A;  5CQF A;  1N4V A;  2TPR A;  1NHS A;  4NTD A;  3ATR A;  1CC6 A;  1NHQ A;  1Q9I A;  2GF3 A;  3B3R A;  3H4K A;  3LZW A;  4J57 A;  1E1M A;  2BS2 A;  2GB0 A;  2BCG G;  1CJ4 A;  1NHP A;  3EAO A;  4OPT A;  1CJC A;  1KF6 A;  5J60 A;  3K7T A;  1ZX9 A;  3SGL A;  3ITJ A;  1LQU A;  2JB2 A;  1MO9 A;  4P9S A;  4U8J A;  2BRY A;  3ICS A;  4OPC A;  4BK3 A;  1OJC A;  1B5Q A;  2YR5 A;  4PAB A;  4EQR A;  3O0H A;  1SEZ A;  3CPI G;  4RSL A;  1S2Y A;  2DKH A;  4ZCD A;  4YSZ A;  2X8H A;  3UKP A;  4EIP A;  4AP3 A;  2JB1 A;  3UP5 A;  4AT2 A;  4KX6 A;  2CVJ A;  2QCU A;  5GRT A;  4B67 A;  5KNL A;  2VRL A;  4U8N A;  3SZW A;  3DGZ A;  1OJD A;  2XVI A;  2GMJ A;  5C3J A;  1CF3 A;  4CCR A;  5KMP A;  1IUX A;  3IC9 A;  3VRA A;  4XXG A;  1GEU A;  4YTN A;  2V6O A;  2WPE A;  4H50 A;  2GMH A;  1YQZ A;  1N1P A;  2WOI A;  1K0J A;  3IF9 A;  3UKF A;  3LAD A;  4K5S A;  4PAA A;  4H4Z A;  4REK A;  3RED A;  2NPX A;  4H4V A;  3AYL A;  4UDP A;  1B4V A;  1GT8 A;  4A99 A;  1S3E A;  3QSE A;  3K7M X;  4N9X A;  3NYF A;  3GD3 A;  4UDR A;  1LVL A;  2NVK X;  3SYI A;  2A89 A;  3L8K A;  4H4W A;  4GAV A;  4OPU A;  2VOU A;  2BAC A;  2XLP A;  4BJY A;  4GR1 A;  1GND A;  2C3D A;  4II2 A;  1DJQ A;  1KNP A;  4OVI A;  4YKF A;  2YM2 A;  2WU2 A;  3GRT A;  3CNP A;  5BUK A;  3Q6J A;  2OAM A;  4TM3 A;  1V59 A;  4FK1 C;  1E1L A;  1GPE A;  3UOX A;  1GV4 A;  4TM1 A;  1FEA A;  5IPY A;  1PBE A;  4U8O A;  5DBJ A;  2V5Z A;  2XLT A;  4ICY A;  5EB4 A;  2VQ7 A;  3GWD A;  4YTM A;  4JDR A;  1NAA A;  2YG3 A;  3NGC X;  1GRE A;  1K4Q A;  4H2N A;  1VG9 A;  3SZF A;  1EL9 A;  1RP0 A;  4U2S A;  1NEN A;  1GOS A;  1K0L A;  2JKC A;  3IHG A;  1IJH A;  1PJ5 A;  3AB1 A;  5M0Z A;  2C64 A;  1DOE A;  3AEC A;  2BC1 A;  4OCG A;  1B37 A;  2ACZ A;  2YM1 A;  2J3N A;  3QVP A;  4C3Y A;  3BI4 A;  3GMB A;  5KOX A;  2WDQ A;  2VQB A;  1TDO A;  1O95 A;  2XVF A;  3S5W A;  4J33 A;  2GR3 A;  4Z26 A;  1H82 A;  5IQ1 A;  1GRT A;  4ZCC A;  4BJZ A;  1KSS A;  3DME A;  2C3C A;  1COY A;  3SZ0 A;  4GDP A;  1H6V A;  1FEB A;  2QA1 A;  2XLU A;  1IUU A;  1LTX R;  2YR4 A;  2C66 A;  4YXD A;  1TDN A;  4OPD A;  3CMM A;  5KRQ A;  1IUV A;  2VVL G;  3SQP A;  3RP6 A;  2IID A;  1JRY A;  1KDG A;  2X8C A;  2F5Z A;  1BWC A;  4TLZ A;  3QFA A;  1BF3 A;  2EQ6 A;  4UDQ A;  2E5V A;  3DH9 A;  1YQ4 A;  4H2P A;  1CC2 A;  2BA9 A;  2C65 A;  3UOV A;  4H4Q A;  1XDI A;  2V3A A;  1PHH A;  1ZY8 A;  2WPF A;  3ADA B;  3LJP A;  2WET A;  3UP4 A;  3SFD A;  2YLS A;  3NG7 X;  1XAN A;  1TDK A;  4Y4M A;  1FOH A;  1L0V A;  1S3B A;  2GR2 A;  2GVC A;  2V61 A;  2YG7 A;  3CGC A;  3E1T A;  4X4J A;  3FPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...