3NH3X

Complex of 6-hydroxy-l-nicotine oxidase with final ketone product formed during catalytic turnover
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nh3X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nh3X02
3NGCX 1H82A 2GR3A 4B69A 3UOVA 1GT8A 2X8GA 2YR6A 1JU2A 3BI4A 2QAEA 2GMHA 3AXBA 1BWCA 1CJCA 3P4QA 4UDPA 4CY8A 1ELIA 2R9ZA 3ATQA 3F8DA 2YLXA 4J36A 4NTDA 3RP6A 2BK5A 3FG2P 2WBAA 1K0JA 2J3NA 2BC1A 1PHHA 3RP8A 4EMWA 1ZK7A 3LZWA 2XFQA 4C3XA 3LXDA 3ADAB 2R46A 2BCPA 3CNTA 2B76A 4J2WA 1KSUA 1TYTA 3NYCA 4LA1A 4LIIA 1GTHA 3VRDB 4Z2TA 5BUKA 2V61A 2ACZA 1CJ2A 3UKQA 2GR0A 1CBOA 1F8WA 4Z2RA 4K22A 4MJWA 3C96A 2R0PA 1CC4A 3K7TA 4B68A 3GYJA 1JRYA 1O94A 4B63A 2VVMA 1B37A 4GRTA 1F8RA 1D7LA 4U8MA 4IVOB 5EOWA 3F8RA 1PN0A 3QVPA 1V59A 4H4UA 4IVMB 3RHAA 5EBKA 3NG7X 4TM1A 5KRQA 3O0HA 2JKCA 1ZMCA 3FIMB 2WU5A 1NG4A 2C76A 3NK1X 3QVRA 1GRTA 1KDGA 2WQYA 2YM2A 2YVJA 3M12A 1RSGA 3V3NA 5CKUA 1ZDLA 2XLPA 3CN8A 1O95A 1KF6A 5KVIA 1DNCA 2WPCA 4BV6A 3KLJA 3KVEA 4U8LA 1PXBA 4ICYA 2GEWA 3AEEA 1JRXA 5BRTA 3CGDA 3GMBA 1TDNA 2XFUA 2QA1A 1YY5A 5HYMA 1E1MA 1ZY8A 1KNPA 3Q9TA 3EANA 4EM3A 3DGZA 4GDEA 3E1TA 1NG3A 4K2XA 4OPGA 5IQ1A 2YWLA 4B1BA 1D7YA 4X9NA 1UKVG 2DKHA 3EAOA 4TM0A 1VG0A 2YLSA 4OCGA 4YTNA 1GESA 3UTGA 2ZZ0A 3KPFA 4A65A 4DSGA 4K5RA 4OPIA 1DOCA 2ZZCA 1CC2A 3AE1A 2C3CA 4X4JA 4H2RA 4XWZA 1E39A 3VR9A 3II4A 1NHSA 1KFYA 3P4SA 1MO9A 1YKJA 5CQFA 4AP3A 1GSNA 1E1KA 3COXA 2IVEA 4FK1A 2BA9A 4A6NB 2VRMA 3H4KA 4NEVA 1NAAA 4K7ZA 1Q1RA 1BF3A 1ZOVA 1OJ9A 2QA2A 4H2PA 5EB4A 4JDRA 2C7GA 2BS3A 4EIQA 2JBVA 5TR3A 1QO8A 2XVEA 1COYA 1JNRA 1M64A 1N1PA 1LVLA 2OA1A 1L9DA 2WETA 4A9WA 4A7AA 4BURA 1NEKA 1OJAA 3GMCA 2OLNA 4H4QA 4USQA 3V76A 4OPUA 2YLZA 3CPIG 5JCIA 3VR8A 2GRTA 3KA7A 3CIRA 3AECA 3NN0X 2YLRA 4IV9A 2A87A 5U1OA 3QSSA 4CCRA 1TYPA 2VZ2A 3LB8A 1L9EA 4J33A 1NHRA 4TM3A 3GDNA 3NH3X 2V3BA 2E4GA 3AYIA 4HA6A 2XVJA 4IA5A 4APNA 4C3YA 1TDFA 5IPYA 4NZHA 2UZZA 4GDPA 1LJ1A 3CGBA 3JSKA 1H7XA 5FMHA 2Z5YA 4AP1A 4JY3A 3AEAA 3DJGX 1PJ7A 2A89A 4J34A 2B9YA 5U63A 1GOSA 5KOXA 2GH5A 3SQPA 3UP5A 2Y6QA 1CJ3A 3VQRA 2R0CA 2BK3A 1PBCA 2XLSA 2XLUA 3CNJA 4H4WA 4N9XA 2GVCA 4YTPA 3AYJA 2WEUA 2YG5A 4C77A 3ICTA 4KX6A 1GNDA 1F6MA 1GRGA 3UTEA 4H4YA 4TM4A 3GRTA 3BNUA 5J60A 2VVLG 1PS9A 4TLZA 2Q7VA 2YG7A 4J31A 3IF9A 2GAGB 4JNQA 2H88A 3CNDA 4CBQA 4CNKA 1CF3A 3NK0X 1QLBA 3ATRA 3NN6X 4UP3A 4DGKA 1AOGA 1OJCA 1KNRA 2WS3A 1IUVA 2XLRA 1D4DA 1OJTA 4XWRA 4EMJA 1E1LA 1PJ5A 2RABA 4YXDA 4H50A 4YTMA 5KOWA 1Y56B 1PBEA 2AR8A 3P4PA 2VQBA 1IUTA 2B7SA 3GWFA 4J57A 3BHKA 2RGHA 3CPJG 4A5LA 1GRFA 2GQFA 1GXFA 3GWDA 3AD8B 4NTCA 3KU9A 2Q6UA 3ICRA 1B5QA 2WDVA 1TDEA 2ZBWA 4PAAA 2XDOA 2XVIA 4FK1C 3M13A 1IUUA 3NYEA 2PHHA 4H4VA 1BGNA 5ER0A 4BJYA 1MXTA 3GDPA 3AD7B 2Q0LA 2YR4A 1IJHA 3OC4A 1FECA 2YG6A 2BYBA 5FS9A 4USRA 3ALJA 5C3JA 1N4WA 1GALA 3NRNA 1N4VA 4M52A 3BI2A 2B9XA 3BNMA 3UOYA 4UDQA 1W4XA 1NHQA 2V3AA 2WP6A 3K7MX 2YQUA 3NNEA 2WP9A 1PDHA 4GF7A 3T37A 4CRTA 4EQSA 3B3RA 5C2TA 4EIPA 1JRZA 3CTYA 5JCMA 1DJQA 3P9UA 1BGJA 4GR1A 5BVAA 4Y4NA 1JNZA 3L8KA 2AQJA 4JY2A 3UOZA 4H4ZA 2CVJA 1ONFA 2ARDA 3D1CA 1DXLA 3QSMA 4RSLA 4ZCCA 3ALLA 3GSIA 2RGOA 3UTHA 2NVKX 1Y0PA 1IUSA 2IIDA 3PVCA 2JB1A 3QSEA 2B9WA 1XPQA 1H84A 1H86A 1RYIA 2X8HA 2VQ7A 5JCNA 3CGCA 4JNAA 2EQ9A 2GR1A 1JEHA 2TMDA 1JOAA 2R0GA 4U8PA 4Z44A 1M6IA 3UKHA 4D04A 2TPRA 1L0VA 1E7PA 3DH9A 4AOSA 3NIXA 4EQWA 1BKWA 3UKAA 3ITJA 1HYUA 2VVLA 4TLXA 4I59A 3AE8A 4Y4LA 1FL2A 4FDCB 5JCKA 1RP0A 3UKFA 4Z24A 3RP7A 4A6NA 2BC0A 1PXCA 4U2LA 4YKFA 3ZDNA 4AT2A 4I58A 3FPZA 3ICSA 1H6VA 4BK1A 3GYIA 1GETA 4ZCDA 1K0IA 2GQWA 3SFEA 2B7RA 1GTEA 3UP4A 3S5WA 2GR2A 3GD3A 4B64A 5M10A 3C4NA 4GCMA 2BS4A 1FCDA 4B66A 5BULA 2R45A 1DJNA 5FS7A 3KD9A 3DJJA 2C67A 2FJDA 1S3EA 2X50A 3AE6A 1YQ3A 3AWIA 1EL8A 1IUXA 2WPEA 3AE5A 2EQ7A 2VRLA 1Q9IA 5EB5A 2WPFA 3IC9A 1CJ4A 1VDCA 3NYFA 1LQUA 3AE2A 3VRBA 4U8OA 4XXGA 5LV9A 2Z5XA 2X8CA 3AE3A 1LTXR 4NEWA 3V3OA 2V5ZA 1LV0A 1TDOA 3NLCA 3LJPA 1Z6LA 3EPTA 3LZXA 4UDRA 1VQWA 2WP5A 4O5UA 3LOVA 1VRQB 3QFBA 1F3PA 1S2QA 3D8XA 4YSXA 2BK4A 2WOWA 4X9MA 2WU2A 4Z2UA 3I6DA 3HZLA 3NK2X 2YM1A 3Q6JA 3DMEA 3M0OA 3P4RA 4FX9A 4B67A 4GUVA 3IHMA 2O9ZA 3AEBA 1FEBA 3C4AA 1K0LA 4U8KA 2OAMA 4U8NA 3G5QA 3PS9A 1S2YA 2C73A 1SEZA 2HQMA 1O5WA 4C74A 2OALA 1PXAA 2XFOA 2GF3A 2YR5A 2APGA 4OVIA 4PABA 5U25A 1NHPA 3K7QX 3BHFA 2CDUA 4AT0A 3GD4A 3KKJA 1EBDA 1KSSA 1L9CA 3NHOX 1ZKQA 3SGLA 1Y56A 4Z25A 1K4QA 3UKLA 4YSYA 2E1MA 1TRBA 5L46A 3BI5A 4K5SA 3B6DA 3VRAA 1FEAA 2GMJA 1LPFA 4OPTA 4Y4MA 4CY6A 1GPEA 2X3NA 4OPLA 4P9SA 2C75A 3CPHG 1LQTA 3AB1A 2V60A 3AE4A 4AOXA 4CCQA 5IQ4A 2XYOA 2WESA 3AYLA 1MOKA 3DJDA 3CNSA 2RGJA 4BJZA 2NPXA 3DK8A 4YSHA 4C5OA 4YKGA 1CC6A 4ECHA 3OZ2A 2YLTA 1NDAA 1NPXA 1EL5A 1GRHA 1H81A 2E5VA 3DJEA 4HB9A 1E1NA 4DNAA 2YG3A 2IVDA 1BZLA 1Q1WA 1TDKA 2JB2A 3EF6A 4KPRA 1N4UA 4H4SA 2AAQA 5KVHA 5HHFA 3ABVA 1PBFA 2GAHB 4H4RA 3S61A 4JQ9A 4U2SA 5KXJA 2BACA 4EQXA 1D4EA 1NENA 1OJDA 3DK4A 2VOUA 5GRTA 2H89A 2XFNA 3CNPA 3PO7A 1REOA 5FS8A 3G5SA 4OPDA 3UKPA 4B65A 2BS2A 1X31B 2Y6RA 4EQRA 1XANA 2GB0A 3AEFA 2FBWA 4ADWA 2C3DA 1GRAA 3SFDA 3AE9A 4O5QA 1YQZA 1H83A 3G5RA 2C66A 3UTFA 3CGEA 2WOVA 5M0ZA 3UKKA 4EM4A 2V6OA 4H4TA 1DODA 1VG9A 3RNMA 2OLOA 2C72A 1D5TA 3H8LA 4D03A 4YWOA 2YAUA 3UOXA 4ZN0A 4U8IA 3NT6A 4YSZA 2BXRA 4RG4A 1YQ4A 2FJBA 1FOHA 4BK3A 5KWFA 2WHDA 4RG3A 3UCLA 4DSHA 1CHUA 1S3BA 2CFYA 3AD9B 2WDQA 4K8DA 1GV4A 4OPCA 2C64A 4A99A 4WCTA 2FJAA 2CULA 1H7WA 5J7XA 2EQ6A 2XLTA 4H2NA 1XDIA 2F5ZA 1CL0A 1XHCA 2BABA 4H4XA 2XCGA 4H4PA 1PBBA 3F8PA 1GREA 1EL9A 3NTDA 3R9UA 3L1RA 2BXSA 4E0VA 1E6EA 1DOEA 1ZX9A 4A79A 4Z43A 2I0ZA 4CNJA 3WE0A 4IA6A 5DBJA 4NTEA 1QJDA 3SM8A 2XVFA 2WDRA 3NKSA 2XFPA 4U2TA 3DGHA 2YG4A 3DK9A 4WX1A 1B8SA 2FJEA 2X99A 1GRBA 2WOIA 3ALMA 1ZOYA 3K30A 5HY5A 4BK2A 4Z26A 4EMIA 1EL7A 3AE7A 1D4CA 1PJ6A 1F8SA 3URHA 2EQ8A 2JK6A 2W0HA 3ZYXA 5HXIA 4H2QA 1DOBA 5GSNA 2R4JA 1B4VA 2DKIA 2R4EA 3AEGA 3GRSA 2BCGG 3FBSA 3IHGA 3LADA 4J56A 5FS6A 1GEUA 1P2HA 2XVHA 3NTAA 3DA1A 3IWAA 4H7UA 4U8JA 2YVGA 2YVFA 4REKA 3QFAA 2JAEA 2GV8A 3H8IA 3P1WA 1P2EA 2C70A 2ZZBA 3FMWA 1IUWA 2QCUA 3AEDA 3I3LA 3ISHA 2Q0KA 5JCLA 2YLWA 1PBDA 4LU6A 4YT0A 3REDA 1GERA 2A8XA 2JB3A 1ZMDA 4JN9A 1ZP0A 2PYXA 2C65A 3QJ4A
chains in the Genus database with same CATH superfamily
3NGCX 1H82A 2GR3A 4B69A 3UOVA 1GT8A 2X8GA 2YR6A 1JU2A 3BI4A 2QAEA 2GMHA 3AXBA 1BWCA 1CJCA 3P4QA 4UDPA 3SZ0A 4CY8A 1ELIA 2R9ZA 3ATQA 3F8DA 2YLXA 4J36A 4NTDA 3RP6A 2BK5A 3FG2P 3SZFA 2WBAA 1K0JA 2J3NA 2BC1A 1PHHA 3RP8A 4EMWA 1ZK7A 3LZWA 2XFQA 4C3XA 3LXDA 3ADAB 2R46A 2BCPA 3CNTA 2B76A 3T2ZA 4J2WA 4G73A 1KSUA 1TYTA 3NYCA 4LA1A 4LIIA 1GTHA 3VRDB 4Z2TA 5BUKA 2V61A 2ACZA 1CJ2A 3UKQA 2GR0A 1CBOA 1F8WA 4Z2RA 4K22A 4MJWA 3C96A 2R0PA 1CC4A 3K7TA 4B68A 3GYJA 1JRYA 1O94A 4B63A 2VVMA 1B37A 4GRTA 1F8RA 1D7LA 4U8MA 4IVOB 5EOWA 3F8RA 1PN0A 3QVPA 1V59A 4H4UA 4IVMB 3RHAA 5EBKA 3NG7X 3SX6A 4TM1A 5KRQA 3O0HA 2JKCA 1ZMCA 3FIMB 2WU5A 1NG4A 2C76A 3NK1X 3QVRA 1GRTA 1KDGA 2WQYA 2YM2A 2YVJA 3M12A 1RSGA 4II2A 5CKUA 3V3NA 1ZDLA 2XLPA 3CN8A 1O95A 1KF6A 5KVIA 1DNCA 2WPCA 4BV6A 3KLJA 3KVEA 4U8LA 1PXBA 3T2YA 4ICYA 2GEWA 3AEEA 1JRXA 5BRTA 3CGDA 3GMBA 1TDNA 2XFUA 2QA1A 1YY5A 5HYMA 1E1MA 1ZY8A 1KNPA 3Q9TA 3EANA 4EM3A 3DGZA 4GDEA 3E1TA 1NG3A 4K2XA 3HYXA 4OPGA 2YWLA 5IQ1A 1D7YA 4B1BA 4X9NA 1UKVG 2DKHA 3EAOA 4TM0A 1VG0A 2YLSA 4OCGA 4YTNA 1GESA 3UTGA 2ZZ0A 3KPFA 4A65A 4DSGA 4K5RA 4OPIA 1DOCA 2ZZCA 5KMPA 1CC2A 3AE1A 2C3CA 4X4JA 4H2RA 4XWZA 1E39A 3VR9A 3II4A 1NHSA 1KFYA 3P4SA 1MO9A 1YKJA 5CQFA 4AP3A 1GSNA 3SXIA 1E1KA 3T2KA 3COXA 2IVEA 4FK1A 2BA9A 4A6NB 2VRMA 3H4KA 4NEVA 1NAAA 4K7ZA 1Q1RA 1BF3A 1ZOVA 1OJ9A 2QA2A 4H2PA 5EB4A 4JDRA 2C7GA 2BS3A 4EIQA 2JBVA 5TR3A 1QO8A 2XVEA 1COYA 1JNRA 1M64A 1N1PA 1LVLA 2OA1A 1L9DA 2WETA 4A9WA 4A7AA 4BURA 1NEKA 1OJAA 3GMCA 2OLNA 4H4QA 4USQA 3V76A 4OPUA 2YLZA 3CPIG 5JCIA 3VR8A 2GRTA 3KA7A 3CIRA 3AECA 3NN0X 2YLRA 4IV9A 3T14A 2A87A 5U1OA 3QSSA 4CCRA 1TYPA 2VZ2A 3LB8A 1L9EA 4J33A 1NHRA 4TM3A 3GDNA 3NH3X 2V3BA 2E4GA 3AYIA 4HA6A 2XVJA 4IA5A 4APNA 4C3YA 1TDFA 5IPYA 4NZHA 2UZZA 4GDPA 1LJ1A 3CGBA 3JSKA 1H7XA 5FMHA 2Z5YA 4AP1A 4JY3A 3AEAA 3DJGX 1PJ7A 2A89A 4J34A 2B9YA 5U63A 1GOSA 5KOXA 2GH5A 4GAPA 3SQPA 3UP5A 2Y6QA 1CJ3A 3VQRA 2R0CA 2BK3A 1PBCA 2XLSA 2XLUA 3CNJA 4H4WA 4N9XA 2GVCA 3HYVA 4YTPA 3AYJA 2WEUA 2YG5A 4C77A 3ICTA 4KX6A 1GNDA 1F6MA 1GRGA 3UTEA 4H4YA 4TM4A 3GRTA 3BNUA 5J60A 2VVLG 1PS9A 4TLZA 2Q7VA 2YG7A 4GAVA 4J31A 3IF9A 2GAGB 4JNQA 2H88A 3CNDA 4CBQA 3SZCA 4CNKA 1CF3A 3NK0X 1QLBA 3ATRA 3NN6X 4UP3A 4DGKA 1AOGA 1OJCA 1KNRA 2WS3A 1IUVA 2XLRA 1D4DA 1OJTA 4XWRA 4EMJA 1E1LA 1PJ5A 2RABA 4YXDA 4H50A 4YTMA 5KOWA 1Y56B 1PBEA 2AR8A 3P4PA 2VQBA 1IUTA 2B7SA 3GWFA 4J57A 3BHKA 2RGHA 3CPJG 4A5LA 1GRFA 2GQFA 1GXFA 3GWDA 3AD8B 4G74A 3KU9A 2Q6UA 4NTCA 3ICRA 1B5QA 2WDVA 1TDEA 2ZBWA 4PAAA 2XDOA 2XVIA 4FK1C 3M13A 1IUUA 3NYEA 2PHHA 4H4VA 1BGNA 4II3A 5ER0A 4BJYA 1MXTA 3GDPA 3AD7B 2Q0LA 2YR4A 1IJHA 3OC4A 1FECA 2YG6A 2BYBA 5FS9A 4USRA 3ALJA 5C3JA 1N4WA 1GALA 3NRNA 1N4VA 4M52A 3BI2A 2B9XA 3BNMA 3UOYA 4UDQA 1W4XA 1NHQA 2V3AA 2WP6A 3HYWA 2YQUA 3K7MX 2WP9A 1PDHA 3NNEA 4GF7A 3T37A 4CRTA 4EQSA 3B3RA 5C2TA 4EIPA 1JRZA 3CTYA 5JCMA 1DJQA 3P9UA 1BGJA 4GR1A 5BVAA 4Y4NA 1JNZA 3L8KA 2AQJA 4JY2A 3UOZA 3KPKA 4H4ZA 2CVJA 1ONFA 2ARDA 3D1CA 1DXLA 3QSMA 4RSLA 4ZCCA 3ALLA 3GSIA 2RGOA 3UTHA 2NVKX 1Y0PA 1IUSA 2IIDA 3PVCA 2JB1A 3QSEA 2B9WA 1XPQA 1H84A 1H86A 1RYIA 2X8HA 2VQ7A 5JCNA 3CGCA 4JNAA 2EQ9A 2GR1A 1JEHA 2TMDA 1JOAA 2R0GA 4U8PA 4Z44A 1M6IA 3UKHA 4D04A 2TPRA 1L0VA 1E7PA 3DH9A 4AOSA 3NIXA 4EQWA 1BKWA 3SYIA 3UKAA 3ITJA 1HYUA 2VVLA 4TLXA 4I59A 3T0KA 3AE8A 4Y4LA 1FL2A 4FDCB 5JCKA 1RP0A 3UKFA 4Z24A 3RP7A 4A6NA 2BC0A 1PXCA 4U2LA 4YKFA 3ZDNA 4AT2A 4I58A 3FPZA 5KMQA 3ICSA 1H6VA 4BK1A 3GYIA 1GETA 4NWZA 1K0IA 2GQWA 4ZCDA 2B7RA 1GTEA 3SFEA 3S5WA 2GR2A 3GD3A 3UP4A 4B64A 5M10A 3C4NA 4GCMA 2BS4A 1FCDA 4B66A 5BULA 2R45A 1DJNA 5FS7A 3KD9A 3DJJA 2C67A 2FJDA 1S3EA 2X50A 3AE6A 1YQ3A 3AWIA 1EL8A 1IUXA 2WPEA 3AE5A 2EQ7A 2VRLA 1Q9IA 5EB5A 2WPFA 3IC9A 3SZWA 1CJ4A 1VDCA 2C4CA 3NYFA 1LQUA 3AE2A 3VRBA 3SY4A 4U8OA 4XXGA 5LV9A 2Z5XA 4G9KA 2X8CA 3AE3A 1LTXR 4NEWA 3V3OA 2V5ZA 1LV0A 1TDOA 3NLCA 3LJPA 1Z6LA 3EPTA 3LZXA 4UDRA 1VQWA 2WP5A 4O5UA 3LOVA 1VRQB 3QFBA 1F3PA 1S2QA 3D8XA 2BRAA 2BK4A 2WOWA 4YSXA 4X9MA 2WU2A 4Z2UA 3I6DA 3HZLA 3NK2X 2YM1A 3Q6JA 3DMEA 3M0OA 3P4RA 4FX9A 4B67A 4GUVA 3IHMA 2O9ZA 3AEBA 1FEBA 3C4AA 5KMRA 1K0LA 4U8KA 2OAMA 4U8NA 3G5QA 3PS9A 1S2YA 2C73A 1SEZA 2HQMA 1O5WA 4C74A 2OALA 1PXAA 2XFOA 2GF3A 2YR5A 2APGA 4OVIA 4PABA 5U25A 1NHPA 3K7QX 3BHFA 2CDUA 4AT0A 3GD4A 3KKJA 1EBDA 1KSSA 1L9CA 3NHOX 1ZKQA 3SGLA 1Y56A 4Z25A 1K4QA 3UKLA 4YSYA 2E1MA 1TRBA 5L46A 3BI5A 4K5SA 3B6DA 3VRAA 1FEAA 2GMJA 1LPFA 4OPTA 4Y4MA 4CY6A 1GPEA 4G6HA 2X3NA 4OPLA 4P9SA 2C75A 3CPHG 1LQTA 3AB1A 2V60A 3AE4A 4AOXA 4CCQA 5IQ4A 2XYOA 2WESA 3AYLA 1MOKA 3DJDA 3CNSA 2RGJA 4BJZA 2NPXA 3DK8A 4YSHA 4C5OA 4YKGA 1CC6A 4ECHA 3OZ2A 2YLTA 1NDAA 1NPXA 1EL5A 1GRHA 1H81A 2E5VA 3DJEA 4HB9A 1E1NA 4DNAA 2YG3A 2IVDA 1BZLA 1Q1WA 1TDKA 2JB2A 3EF6A 4KPRA 1N4UA 4H4SA 2AAQA 5KVHA 5HHFA 3ABVA 1PBFA 2GAHB 4H4RA 3S61A 4JQ9A 4U2SA 5KXJA 2BACA 4EQXA 1D4EA 1NENA 1OJDA 3DK4A 2VOUA 5GRTA 2H89A 2XFNA 3CNPA 3PO7A 1REOA 5FS8A 3G5SA 4OPDA 3UKPA 4B65A 2BS2A 1X31B 2Y6RA 4EQRA 1XANA 2GB0A 3AEFA 2FBWA 4ADWA 2C3DA 1GRAA 3SFDA 3AE9A 4O5QA 1YQZA 1H83A 3G5RA 2C66A 3UTFA 3CGEA 2WOVA 5M0ZA 3UKKA 5KNLA 3T31A 4EM4A 2V6OA 4G6GA 4H4TA 1DODA 1VG9A 3RNMA 2OLOA 2C72A 1D5TA 3H8LA 4D03A 4YWOA 2YAUA 3UOXA 4ZN0A 4U8IA 3NT6A 4YSZA 2BXRA 4RG4A 1YQ4A 2FJBA 1FOHA 4BK3A 5KWFA 2WHDA 4RG3A 3UCLA 4DSHA 1CHUA 1S3BA 5KMSA 2CFYA 3AD9B 2WDQA 4K8DA 1GV4A 4OPCA 2C64A 4A99A 4WCTA 2FJAA 2CULA 1H7WA 5J7XA 2EQ6A 2XLTA 4H2NA 1XDIA 2F5ZA 1CL0A 1XHCA 2BABA 4H4XA 2XCGA 4H4PA 1PBBA 3F8PA 1GREA 1EL9A 3NTDA 3R9UA 3L1RA 5FS6A 2BXSA 4E0VA 1E6EA 1DOEA 1ZX9A 4A79A 4Z43A 2I0ZA 4CNJA 3WE0A 4IA6A 5DBJA 4NTEA 1QJDA 3CMMA 3SM8A 2XVFA 2WDRA 3NKSA 2XFPA 4U2TA 2BRYA 3DGHA 2YG4A 3DK9A 4WX1A 1B8SA 2FJEA 2X99A 1GRBA 2WOIA 3ALMA 1ZOYA 3K30A 5HY5A 4BK2A 4Z26A 4EMIA 1EL7A 3AE7A 1D4CA 1PJ6A 1F8SA 3URHA 2EQ8A 2JK6A 2W0HA 3ZYXA 5HXIA 4H2QA 1DOBA 5GSNA 2R4JA 1B4VA 2DKIA 2R4EA 3AEGA 3GRSA 2BCGG 3FBSA 3GYXA 3IHGA 3LADA 4J56A 1GEUA 1P2HA 2XVHA 3NTAA 3DA1A 3IWAA 4H7UA 4U8JA 2YVGA 2YVFA 4NNJA 3QFAA 4REKA 2JAEA 2GV8A 3H8IA 3P1WA 1P2EA 2C70A 2ZZBA 3FMWA 1IUWA 2QCUA 3AEDA 3I3LA 3ISHA 2Q0KA 5JCLA 2YLWA 1PBDA 4LU6A 4YT0A 3REDA 1GERA 2A8XA 2JB3A 1ZMDA 4JN9A 1ZP0A 2PYXA 2C65A 3QJ4A
chains in the Genus database with same CATH topology
3NGCX 1H82A 2GR3A 4B69A 3UOVA 1GT8A 2X8GA 2YR6A 1JU2A 3BI4A 2QAEA 2GMHA 3AXBA 1BWCA 1CJCA 3P4QA 4UDPA 3SZ0A 4CY8A 1ELIA 2R9ZA 3ATQA 3F8DA 2YLXA 4J36A 4NTDA 3RP6A 2BK5A 3FG2P 3SZFA 2WBAA 1K0JA 2J3NA 2BC1A 1PHHA 3RP8A 4EMWA 1ZK7A 3LZWA 2XFQA 4C3XA 3LXDA 3ADAB 2R46A 2BCPA 3CNTA 2B76A 3T2ZA 4J2WA 4G73A 1KSUA 1TYTA 3NYCA 4LA1A 4LIIA 1GTHA 3VRDB 4Z2TA 5BUKA 2V61A 2ACZA 1CJ2A 3UKQA 2GR0A 1CBOA 1F8WA 4Z2RA 4K22A 4MJWA 3C96A 2R0PA 1CC4A 3K7TA 4B68A 3GYJA 1JRYA 1O94A 4B63A 2VVMA 1B37A 4GRTA 1F8RA 1D7LA 4U8MA 4IVOB 5EOWA 3F8RA 1PN0A 3QVPA 1V59A 4H4UA 4IVMB 3RHAA 5EBKA 3NG7X 3SX6A 4TM1A 5KRQA 3O0HA 2JKCA 1ZMCA 3FIMB 2WU5A 1NG4A 2C76A 3NK1X 3QVRA 1GRTA 1KDGA 2WQYA 2YM2A 2YVJA 3M12A 1RSGA 4II2A 5CKUA 3V3NA 1ZDLA 2XLPA 3CN8A 1O95A 1KF6A 5KVIA 1DNCA 2WPCA 4BV6A 3KLJA 3KVEA 4U8LA 1PXBA 3T2YA 4ICYA 2GEWA 3AEEA 1JRXA 5BRTA 3CGDA 3GMBA 1TDNA 2XFUA 2QA1A 1YY5A 5HYMA 1E1MA 1ZY8A 1KNPA 3Q9TA 3EANA 4EM3A 3DGZA 4GDEA 3E1TA 1NG3A 4K2XA 3HYXA 4OPGA 2YWLA 5IQ1A 1D7YA 4B1BA 4X9NA 1UKVG 2DKHA 3EAOA 4TM0A 1VG0A 2YLSA 4OCGA 4YTNA 1GESA 3UTGA 2ZZ0A 3KPFA 4A65A 4DSGA 4K5RA 4OPIA 1DOCA 2ZZCA 5KMPA 1CC2A 3AE1A 2C3CA 4X4JA 4H2RA 4XWZA 1E39A 3VR9A 3II4A 1NHSA 1KFYA 3P4SA 1MO9A 1YKJA 5CQFA 4AP3A 1GSNA 3SXIA 1E1KA 3T2KA 3COXA 2IVEA 4FK1A 2BA9A 4A6NB 2VRMA 3H4KA 4NEVA 1NAAA 4K7ZA 1Q1RA 1BF3A 1ZOVA 1OJ9A 2QA2A 4H2PA 5EB4A 4JDRA 2C7GA 2BS3A 4EIQA 2JBVA 5TR3A 1QO8A 2XVEA 1COYA 1JNRA 1M64A 1N1PA 1LVLA 2OA1A 1L9DA 2WETA 4A9WA 4A7AA 4BURA 1NEKA 1OJAA 3GMCA 2OLNA 4H4QA 4USQA 3V76A 4OPUA 2YLZA 3CPIG 5JCIA 3VR8A 2GRTA 3KA7A 3CIRA 3AECA 3NN0X 2YLRA 4IV9A 3T14A 2A87A 5U1OA 3QSSA 4CCRA 1TYPA 2VZ2A 3LB8A 1L9EA 4J33A 1NHRA 4TM3A 3GDNA 3NH3X 2V3BA 2E4GA 3AYIA 4HA6A 2XVJA 4IA5A 4APNA 4C3YA 1TDFA 5IPYA 4NZHA 2UZZA 4GDPA 1LJ1A 3CGBA 3JSKA 1H7XA 5FMHA 2Z5YA 4AP1A 4JY3A 3AEAA 3DJGX 1PJ7A 2A89A 4J34A 2B9YA 5U63A 1GOSA 5KOXA 2GH5A 4GAPA 3SQPA 3UP5A 2Y6QA 1CJ3A 3VQRA 2R0CA 2BK3A 1PBCA 2XLSA 2XLUA 3CNJA 4H4WA 4N9XA 2GVCA 3HYVA 4YTPA 3AYJA 2WEUA 2YG5A 4C77A 3ICTA 4KX6A 1GNDA 1F6MA 1GRGA 3UTEA 4H4YA 4TM4A 3GRTA 3BNUA 5J60A 2VVLG 1PS9A 4TLZA 2Q7VA 2YG7A 4GAVA 4J31A 3IF9A 2GAGB 4JNQA 2H88A 3CNDA 4CBQA 3SZCA 4CNKA 1CF3A 3NK0X 1QLBA 3ATRA 3NN6X 4UP3A 4DGKA 1AOGA 1OJCA 1KNRA 2WS3A 1IUVA 2XLRA 1D4DA 1OJTA 4XWRA 4EMJA 1E1LA 1PJ5A 2RABA 4YXDA 4H50A 4YTMA 5KOWA 1Y56B 1PBEA 2AR8A 3P4PA 2VQBA 1IUTA 2B7SA 3GWFA 4J57A 3BHKA 2RGHA 3CPJG 4A5LA 1GRFA 2GQFA 1GXFA 3GWDA 3AD8B 4G74A 3KU9A 2Q6UA 4NTCA 3ICRA 1B5QA 2WDVA 1TDEA 2ZBWA 4PAAA 2XDOA 2XVIA 4FK1C 3M13A 1IUUA 3NYEA 2PHHA 4H4VA 1BGNA 4II3A 5ER0A 4BJYA 1MXTA 3GDPA 3AD7B 2Q0LA 2YR4A 1IJHA 3OC4A 1FECA 2YG6A 2BYBA 5FS9A 4USRA 3ALJA 5C3JA 1N4WA 1GALA 3NRNA 1N4VA 4M52A 3BI2A 2B9XA 3BNMA 3UOYA 4UDQA 1W4XA 1NHQA 2V3AA 2WP6A 3HYWA 2YQUA 3K7MX 2WP9A 1PDHA 3NNEA 4GF7A 3T37A 4CRTA 4EQSA 3B3RA 5C2TA 4EIPA 1JRZA 3CTYA 5JCMA 1DJQA 3P9UA 1BGJA 4GR1A 5BVAA 4Y4NA 1JNZA 3L8KA 2AQJA 4JY2A 3UOZA 3KPKA 4H4ZA 2CVJA 1ONFA 2ARDA 3D1CA 1DXLA 3QSMA 4RSLA 4ZCCA 3ALLA 3GSIA 2RGOA 3UTHA 2NVKX 1Y0PA 1IUSA 2IIDA 3PVCA 2JB1A 3QSEA 2B9WA 1XPQA 1H84A 1H86A 1RYIA 2X8HA 2VQ7A 5JCNA 3CGCA 4JNAA 2EQ9A 2GR1A 1JEHA 2TMDA 1JOAA 2R0GA 4U8PA 4Z44A 1M6IA 3UKHA 4D04A 2TPRA 1L0VA 1E7PA 3DH9A 4AOSA 3NIXA 4EQWA 1BKWA 3SYIA 3UKAA 3ITJA 1HYUA 2VVLA 4TLXA 4I59A 3T0KA 3AE8A 4Y4LA 1FL2A 4FDCB 5JCKA 1RP0A 3UKFA 4Z24A 3RP7A 4A6NA 2BC0A 1PXCA 4U2LA 4YKFA 3ZDNA 4AT2A 4I58A 3FPZA 5KMQA 3ICSA 1H6VA 4BK1A 3GYIA 1GETA 4NWZA 1K0IA 2GQWA 4ZCDA 2B7RA 1GTEA 3SFEA 3S5WA 2GR2A 3GD3A 3UP4A 4B64A 5M10A 3C4NA 4GCMA 2BS4A 1FCDA 4B66A 5BULA 2R45A 1DJNA 5FS7A 3KD9A 3DJJA 2C67A 2FJDA 1S3EA 2X50A 3AE6A 1YQ3A 3AWIA 1EL8A 1IUXA 2WPEA 3AE5A 2EQ7A 2VRLA 1Q9IA 5EB5A 2WPFA 3IC9A 3SZWA 1CJ4A 1VDCA 2C4CA 3NYFA 1LQUA 3AE2A 3VRBA 3SY4A 4U8OA 4XXGA 5LV9A 2Z5XA 4G9KA 2X8CA 3AE3A 1LTXR 4NEWA 3V3OA 2V5ZA 1LV0A 1TDOA 3NLCA 3LJPA 1Z6LA 3EPTA 3LZXA 4UDRA 1VQWA 2WP5A 4O5UA 3LOVA 1VRQB 3QFBA 1F3PA 1S2QA 3D8XA 2BRAA 2BK4A 2WOWA 4YSXA 4X9MA 2WU2A 4Z2UA 3I6DA 3HZLA 3NK2X 2YM1A 3Q6JA 3DMEA 3M0OA 3P4RA 4FX9A 4B67A 4GUVA 3IHMA 2O9ZA 3AEBA 1FEBA 3C4AA 5KMRA 1K0LA 4U8KA 2OAMA 4U8NA 3G5QA 3PS9A 1S2YA 2C73A 1SEZA 2HQMA 1O5WA 4C74A 2OALA 1PXAA 2XFOA 2GF3A 2YR5A 2APGA 4OVIA 4PABA 5U25A 1NHPA 3K7QX 3BHFA 2CDUA 4AT0A 3GD4A 3KKJA 1EBDA 1KSSA 1L9CA 3NHOX 1ZKQA 3SGLA 1Y56A 4Z25A 1K4QA 3UKLA 4YSYA 2E1MA 1TRBA 5L46A 3BI5A 4K5SA 3B6DA 3VRAA 1FEAA 2GMJA 1LPFA 4OPTA 4Y4MA 4CY6A 1GPEA 4G6HA 2X3NA 4OPLA 4P9SA 2C75A 3CPHG 1LQTA 3AB1A 2V60A 3AE4A 4AOXA 4CCQA 5IQ4A 2XYOA 2WESA 3AYLA 1MOKA 3DJDA 3CNSA 2RGJA 4BJZA 2NPXA 3DK8A 4YSHA 4C5OA 4YKGA 1CC6A 4ECHA 3OZ2A 2YLTA 1NDAA 1NPXA 1EL5A 1GRHA 1H81A 2E5VA 3DJEA 4HB9A 1E1NA 4DNAA 2YG3A 2IVDA 1BZLA 1Q1WA 1TDKA 2JB2A 3EF6A 4KPRA 1N4UA 4H4SA 2AAQA 5KVHA 5HHFA 3ABVA 1PBFA 2GAHB 4H4RA 3S61A 4JQ9A 4U2SA 5KXJA 2BACA 4EQXA 1D4EA 1NENA 1OJDA 3DK4A 2VOUA 5GRTA 2H89A 2XFNA 3CNPA 3PO7A 1REOA 5FS8A 3G5SA 4OPDA 3UKPA 4B65A 2BS2A 1X31B 2Y6RA 4EQRA 1XANA 2GB0A 3AEFA 2FBWA 4ADWA 2C3DA 1GRAA 3SFDA 3AE9A 4O5QA 1YQZA 1H83A 3G5RA 2C66A 3UTFA 3CGEA 2WOVA 5M0ZA 3UKKA 5KNLA 3T31A 4EM4A 2V6OA 4G6GA 4H4TA 1DODA 1VG9A 3RNMA 2OLOA 2C72A 1D5TA 3H8LA 4D03A 4YWOA 2YAUA 3UOXA 4ZN0A 4U8IA 3NT6A 4YSZA 2BXRA 4RG4A 1YQ4A 2FJBA 1FOHA 4BK3A 5KWFA 2WHDA 4RG3A 3UCLA 4DSHA 1CHUA 1S3BA 5KMSA 2CFYA 3AD9B 2WDQA 4K8DA 1GV4A 4OPCA 2C64A 4A99A 4WCTA 2FJAA 2CULA 1H7WA 5J7XA 2EQ6A 2XLTA 4H2NA 1XDIA 2F5ZA 1CL0A 1XHCA 2BABA 4H4XA 2XCGA 4H4PA 1PBBA 3F8PA 1GREA 1EL9A 3NTDA 3R9UA 3L1RA 5FS6A 2BXSA 4E0VA 1E6EA 1DOEA 1ZX9A 4A79A 4Z43A 2I0ZA 4CNJA 3WE0A 4IA6A 5DBJA 4NTEA 1QJDA 3CMMA 3SM8A 2XVFA 2WDRA 3NKSA 2XFPA 4U2TA 2BRYA 3DGHA 2YG4A 3DK9A 4WX1A 1B8SA 2FJEA 2X99A 1GRBA 2WOIA 3ALMA 1ZOYA 3K30A 5HY5A 4BK2A 4Z26A 4EMIA 1EL7A 3AE7A 1D4CA 1PJ6A 1F8SA 3URHA 2EQ8A 2JK6A 2W0HA 3ZYXA 5HXIA 4H2QA 1DOBA 5GSNA 2R4JA 1B4VA 2DKIA 2R4EA 3AEGA 3GRSA 2BCGG 3FBSA 3GYXA 3IHGA 3LADA 4J56A 1GEUA 1P2HA 2XVHA 3NTAA 3DA1A 3IWAA 4H7UA 4U8JA 2YVGA 2YVFA 4NNJA 3QFAA 4REKA 2JAEA 2GV8A 3H8IA 3P1WA 1P2EA 2C70A 2ZZBA 3FMWA 1IUWA 2QCUA 3AEDA 3I3LA 3ISHA 2Q0KA 5JCLA 2YLWA 1PBDA 4LU6A 4YT0A 3REDA 1GERA 2A8XA 2JB3A 1ZMDA 4JN9A 1ZP0A 2PYXA 2C65A 3QJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGC X;  1H82 A;  2GR3 A;  4B69 A;  3UOV A;  1GT8 A;  2X8G A;  2YR6 A;  1JU2 A;  3BI4 A;  2QAE A;  2GMH A;  3AXB A;  1BWC A;  1CJC A;  3P4Q A;  4UDP A;  4CY8 A;  1ELI A;  2R9Z A;  3ATQ A;  3F8D A;  2YLX A;  4J36 A;  4NTD A;  3RP6 A;  2BK5 A;  3FG2 P;  2WBA A;  1K0J A;  2J3N A;  2BC1 A;  1PHH A;  3RP8 A;  4EMW A;  1ZK7 A;  3LZW A;  2XFQ A;  4C3X A;  3LXD A;  3ADA B;  2R46 A;  2BCP A;  3CNT A;  2B76 A;  4J2W A;  1KSU A;  1TYT A;  3NYC A;  4LA1 A;  4LII A;  1GTH A;  3VRD B;  4Z2T A;  5BUK A;  2V61 A;  2ACZ A;  1CJ2 A;  3UKQ A;  2GR0 A;  1CBO A;  1F8W A;  4Z2R A;  4K22 A;  4MJW A;  3C96 A;  2R0P A;  1CC4 A;  3K7T A;  4B68 A;  3GYJ A;  1JRY A;  1O94 A;  4B63 A;  2VVM A;  1B37 A;  4GRT A;  1F8R A;  1D7L A;  4U8M A;  4IVO B;  5EOW A;  3F8R A;  1PN0 A;  3QVP A;  1V59 A;  4H4U A;  4IVM B;  3RHA A;  5EBK A;  3NG7 X;  4TM1 A;  5KRQ A;  3O0H A;  2JKC A;  1ZMC A;  3FIM B;  2WU5 A;  1NG4 A;  2C76 A;  3NK1 X;  3QVR A;  1GRT A;  1KDG A;  2WQY A;  2YM2 A;  2YVJ A;  3M12 A;  1RSG A;  3V3N A;  5CKU A;  1ZDL A;  2XLP A;  3CN8 A;  1O95 A;  1KF6 A;  5KVI A;  1DNC A;  2WPC A;  4BV6 A;  3KLJ A;  3KVE A;  4U8L A;  1PXB A;  4ICY A;  2GEW A;  3AEE A;  1JRX A;  5BRT A;  3CGD A;  3GMB A;  1TDN A;  2XFU A;  2QA1 A;  1YY5 A;  5HYM A;  1E1M A;  1ZY8 A;  1KNP A;  3Q9T A;  3EAN A;  4EM3 A;  3DGZ A;  4GDE A;  3E1T A;  1NG3 A;  4K2X A;  4OPG A;  5IQ1 A;  2YWL A;  4B1B A;  1D7Y A;  4X9N A;  1UKV G;  2DKH A;  3EAO A;  4TM0 A;  1VG0 A;  2YLS A;  4OCG A;  4YTN A;  1GES A;  3UTG A;  2ZZ0 A;  3KPF A;  4A65 A;  4DSG A;  4K5R A;  4OPI A;  1DOC A;  2ZZC A;  1CC2 A;  3AE1 A;  2C3C A;  4X4J A;  4H2R A;  4XWZ A;  1E39 A;  3VR9 A;  3II4 A;  1NHS A;  1KFY A;  3P4S A;  1MO9 A;  1YKJ A;  5CQF A;  4AP3 A;  1GSN A;  1E1K A;  3COX A;  2IVE A;  4FK1 A;  2BA9 A;  4A6N B;  2VRM A;  3H4K A;  4NEV A;  1NAA A;  4K7Z A;  1Q1R A;  1BF3 A;  1ZOV A;  1OJ9 A;  2QA2 A;  4H2P A;  5EB4 A;  4JDR A;  2C7G A;  2BS3 A;  4EIQ A;  2JBV A;  5TR3 A;  1QO8 A;  2XVE A;  1COY A;  1JNR A;  1M64 A;  1N1P A;  1LVL A;  2OA1 A;  1L9D A;  2WET A;  4A9W A;  4A7A A;  4BUR A;  1NEK A;  1OJA A;  3GMC A;  2OLN A;  4H4Q A;  4USQ A;  3V76 A;  4OPU A;  2YLZ A;  3CPI G;  5JCI A;  3VR8 A;  2GRT A;  3KA7 A;  3CIR A;  3AEC A;  3NN0 X;  2YLR A;  4IV9 A;  2A87 A;  5U1O A;  3QSS A;  4CCR A;  1TYP A;  2VZ2 A;  3LB8 A;  1L9E A;  4J33 A;  1NHR A;  4TM3 A;  3GDN A;  3NH3 X;  2V3B A;  2E4G A;  3AYI A;  4HA6 A;  2XVJ A;  4IA5 A;  4APN A;  4C3Y A;  1TDF A;  5IPY A;  4NZH A;  2UZZ A;  4GDP A;  1LJ1 A;  3CGB A;  3JSK A;  1H7X A;  5FMH A;  2Z5Y A;  4AP1 A;  4JY3 A;  3AEA A;  3DJG X;  1PJ7 A;  2A89 A;  4J34 A;  2B9Y A;  5U63 A;  1GOS A;  5KOX A;  2GH5 A;  3SQP A;  3UP5 A;  2Y6Q A;  1CJ3 A;  3VQR A;  2R0C A;  2BK3 A;  1PBC A;  2XLS A;  2XLU A;  3CNJ A;  4H4W A;  4N9X A;  2GVC A;  4YTP A;  3AYJ A;  2WEU A;  2YG5 A;  4C77 A;  3ICT A;  4KX6 A;  1GND A;  1F6M A;  1GRG A;  3UTE A;  4H4Y A;  4TM4 A;  3GRT A;  3BNU A;  5J60 A;  2VVL G;  1PS9 A;  4TLZ A;  2Q7V A;  2YG7 A;  4J31 A;  3IF9 A;  2GAG B;  4JNQ A;  2H88 A;  3CND A;  4CBQ A;  4CNK A;  1CF3 A;  3NK0 X;  1QLB A;  3ATR A;  3NN6 X;  4UP3 A;  4DGK A;  1AOG A;  1OJC A;  1KNR A;  2WS3 A;  1IUV A;  2XLR A;  1D4D A;  1OJT A;  4XWR A;  4EMJ A;  1E1L A;  1PJ5 A;  2RAB A;  4YXD A;  4H50 A;  4YTM A;  5KOW A;  1Y56 B;  1PBE A;  2AR8 A;  3P4P A;  2VQB A;  1IUT A;  2B7S A;  3GWF A;  4J57 A;  3BHK A;  2RGH A;  3CPJ G;  4A5L A;  1GRF A;  2GQF A;  1GXF A;  3GWD A;  3AD8 B;  4NTC A;  3KU9 A;  2Q6U A;  3ICR A;  1B5Q A;  2WDV A;  1TDE A;  2ZBW A;  4PAA A;  2XDO A;  2XVI A;  4FK1 C;  3M13 A;  1IUU A;  3NYE A;  2PHH A;  4H4V A;  1BGN A;  5ER0 A;  4BJY A;  1MXT A;  3GDP A;  3AD7 B;  2Q0L A;  2YR4 A;  1IJH A;  3OC4 A;  1FEC A;  2YG6 A;  2BYB A;  5FS9 A;  4USR A;  3ALJ A;  5C3J A;  1N4W A;  1GAL A;  3NRN A;  1N4V A;  4M52 A;  3BI2 A;  2B9X A;  3BNM A;  3UOY A;  4UDQ A;  1W4X A;  1NHQ A;  2V3A A;  2WP6 A;  3K7M X;  2YQU A;  3NNE A;  2WP9 A;  1PDH A;  4GF7 A;  3T37 A;  4CRT A;  4EQS A;  3B3R A;  5C2T A;  4EIP A;  1JRZ A;  3CTY A;  5JCM A;  1DJQ A;  3P9U A;  1BGJ A;  4GR1 A;  5BVA A;  4Y4N A;  1JNZ A;  3L8K A;  2AQJ A;  4JY2 A;  3UOZ A;  4H4Z A;  2CVJ A;  1ONF A;  2ARD A;  3D1C A;  1DXL A;  3QSM A;  4RSL A;  4ZCC A;  3ALL A;  3GSI A;  2RGO A;  3UTH A;  2NVK X;  1Y0P A;  1IUS A;  2IID A;  3PVC A;  2JB1 A;  3QSE A;  2B9W A;  1XPQ A;  1H84 A;  1H86 A;  1RYI A;  2X8H A;  2VQ7 A;  5JCN A;  3CGC A;  4JNA A;  2EQ9 A;  2GR1 A;  1JEH A;  2TMD A;  1JOA A;  2R0G A;  4U8P A;  4Z44 A;  1M6I A;  3UKH A;  4D04 A;  2TPR A;  1L0V A;  1E7P A;  3DH9 A;  4AOS A;  3NIX A;  4EQW A;  1BKW A;  3UKA A;  3ITJ A;  1HYU A;  2VVL A;  4TLX A;  4I59 A;  3AE8 A;  4Y4L A;  1FL2 A;  4FDC B;  5JCK A;  1RP0 A;  3UKF A;  4Z24 A;  3RP7 A;  4A6N A;  2BC0 A;  1PXC A;  4U2L A;  4YKF A;  3ZDN A;  4AT2 A;  4I58 A;  3FPZ A;  3ICS A;  1H6V A;  4BK1 A;  3GYI A;  1GET A;  4ZCD A;  1K0I A;  2GQW A;  3SFE A;  2B7R A;  1GTE A;  3UP4 A;  3S5W A;  2GR2 A;  3GD3 A;  4B64 A;  5M10 A;  3C4N A;  4GCM A;  2BS4 A;  1FCD A;  4B66 A;  5BUL A;  2R45 A;  1DJN A;  5FS7 A;  3KD9 A;  3DJJ A;  2C67 A;  2FJD A;  1S3E A;  2X50 A;  3AE6 A;  1YQ3 A;  3AWI A;  1EL8 A;  1IUX A;  2WPE A;  3AE5 A;  2EQ7 A;  2VRL A;  1Q9I A;  5EB5 A;  2WPF A;  3IC9 A;  1CJ4 A;  1VDC A;  3NYF A;  1LQU A;  3AE2 A;  3VRB A;  4U8O A;  4XXG A;  5LV9 A;  2Z5X A;  2X8C A;  3AE3 A;  1LTX R;  4NEW A;  3V3O A;  2V5Z A;  1LV0 A;  1TDO A;  3NLC A;  3LJP A;  1Z6L A;  3EPT A;  3LZX A;  4UDR A;  1VQW A;  2WP5 A;  4O5U A;  3LOV A;  1VRQ B;  3QFB A;  1F3P A;  1S2Q A;  3D8X A;  4YSX A;  2BK4 A;  2WOW A;  4X9M A;  2WU2 A;  4Z2U A;  3I6D A;  3HZL A;  3NK2 X;  2YM1 A;  3Q6J A;  3DME A;  3M0O A;  3P4R A;  4FX9 A;  4B67 A;  4GUV A;  3IHM A;  2O9Z A;  3AEB A;  1FEB A;  3C4A A;  1K0L A;  4U8K A;  2OAM A;  4U8N A;  3G5Q A;  3PS9 A;  1S2Y A;  2C73 A;  1SEZ A;  2HQM A;  1O5W A;  4C74 A;  2OAL A;  1PXA A;  2XFO A;  2GF3 A;  2YR5 A;  2APG A;  4OVI A;  4PAB A;  5U25 A;  1NHP A;  3K7Q X;  3BHF A;  2CDU A;  4AT0 A;  3GD4 A;  3KKJ A;  1EBD A;  1KSS A;  1L9C A;  3NHO X;  1ZKQ A;  3SGL A;  1Y56 A;  4Z25 A;  1K4Q A;  3UKL A;  4YSY A;  2E1M A;  1TRB A;  5L46 A;  3BI5 A;  4K5S A;  3B6D A;  3VRA A;  1FEA A;  2GMJ A;  1LPF A;  4OPT A;  4Y4M A;  4CY6 A;  1GPE A;  2X3N A;  4OPL A;  4P9S A;  2C75 A;  3CPH G;  1LQT A;  3AB1 A;  2V60 A;  3AE4 A;  4AOX A;  4CCQ A;  5IQ4 A;  2XYO A;  2WES A;  3AYL A;  1MOK A;  3DJD A;  3CNS A;  2RGJ A;  4BJZ A;  2NPX A;  3DK8 A;  4YSH A;  4C5O A;  4YKG A;  1CC6 A;  4ECH A;  3OZ2 A;  2YLT A;  1NDA A;  1NPX A;  1EL5 A;  1GRH A;  1H81 A;  2E5V A;  3DJE A;  4HB9 A;  1E1N A;  4DNA A;  2YG3 A;  2IVD A;  1BZL A;  1Q1W A;  1TDK A;  2JB2 A;  3EF6 A;  4KPR A;  1N4U A;  4H4S A;  2AAQ A;  5KVH A;  5HHF A;  3ABV A;  1PBF A;  2GAH B;  4H4R A;  3S61 A;  4JQ9 A;  4U2S A;  5KXJ A;  2BAC A;  4EQX A;  1D4E A;  1NEN A;  1OJD A;  3DK4 A;  2VOU A;  5GRT A;  2H89 A;  2XFN A;  3CNP A;  3PO7 A;  1REO A;  5FS8 A;  3G5S A;  4OPD A;  3UKP A;  4B65 A;  2BS2 A;  1X31 B;  2Y6R A;  4EQR A;  1XAN A;  2GB0 A;  3AEF A;  2FBW A;  4ADW A;  2C3D A;  1GRA A;  3SFD A;  3AE9 A;  4O5Q A;  1YQZ A;  1H83 A;  3G5R A;  2C66 A;  3UTF A;  3CGE A;  2WOV A;  5M0Z A;  3UKK A;  4EM4 A;  2V6O A;  4H4T A;  1DOD A;  1VG9 A;  3RNM A;  2OLO A;  2C72 A;  1D5T A;  3H8L A;  4D03 A;  4YWO A;  2YAU A;  3UOX A;  4ZN0 A;  4U8I A;  3NT6 A;  4YSZ A;  2BXR A;  4RG4 A;  1YQ4 A;  2FJB A;  1FOH A;  4BK3 A;  5KWF A;  2WHD A;  4RG3 A;  3UCL A;  4DSH A;  1CHU A;  1S3B A;  2CFY A;  3AD9 B;  2WDQ A;  4K8D A;  1GV4 A;  4OPC A;  2C64 A;  4A99 A;  4WCT A;  2FJA A;  2CUL A;  1H7W A;  5J7X A;  2EQ6 A;  2XLT A;  4H2N A;  1XDI A;  2F5Z A;  1CL0 A;  1XHC A;  2BAB A;  4H4X A;  2XCG A;  4H4P A;  1PBB A;  3F8P A;  1GRE A;  1EL9 A;  3NTD A;  3R9U A;  3L1R A;  2BXS A;  4E0V A;  1E6E A;  1DOE A;  1ZX9 A;  4A79 A;  4Z43 A;  2I0Z A;  4CNJ A;  3WE0 A;  4IA6 A;  5DBJ A;  4NTE A;  1QJD A;  3SM8 A;  2XVF A;  2WDR A;  3NKS A;  2XFP A;  4U2T A;  3DGH A;  2YG4 A;  3DK9 A;  4WX1 A;  1B8S A;  2FJE A;  2X99 A;  1GRB A;  2WOI A;  3ALM A;  1ZOY A;  3K30 A;  5HY5 A;  4BK2 A;  4Z26 A;  4EMI A;  1EL7 A;  3AE7 A;  1D4C A;  1PJ6 A;  1F8S A;  3URH A;  2EQ8 A;  2JK6 A;  2W0H A;  3ZYX A;  5HXI A;  4H2Q A;  1DOB A;  5GSN A;  2R4J A;  1B4V A;  2DKI A;  2R4E A;  3AEG A;  3GRS A;  2BCG G;  3FBS A;  3IHG A;  3LAD A;  4J56 A;  5FS6 A;  1GEU A;  1P2H A;  2XVH A;  3NTA A;  3DA1 A;  3IWA A;  4H7U A;  4U8J A;  2YVG A;  2YVF A;  4REK A;  3QFA A;  2JAE A;  2GV8 A;  3H8I A;  3P1W A;  1P2E A;  2C70 A;  2ZZB A;  3FMW A;  1IUW A;  2QCU A;  3AED A;  3I3L A;  3ISH A;  2Q0K A;  5JCL A;  2YLW A;  1PBD A;  4LU6 A;  4YT0 A;  3RED A;  1GER A;  2A8X A;  2JB3 A;  1ZMD A;  4JN9 A;  1ZP0 A;  2PYX A;  2C65 A;  3QJ4 A; 
#chains in the Genus database with same CATH topology
 3NGC X;  1H82 A;  2GR3 A;  4B69 A;  3UOV A;  1GT8 A;  2X8G A;  2YR6 A;  1JU2 A;  3BI4 A;  2QAE A;  2GMH A;  3AXB A;  1BWC A;  1CJC A;  3P4Q A;  4UDP A;  3SZ0 A;  4CY8 A;  1ELI A;  2R9Z A;  3ATQ A;  3F8D A;  2YLX A;  4J36 A;  4NTD A;  3RP6 A;  2BK5 A;  3FG2 P;  3SZF A;  2WBA A;  1K0J A;  2J3N A;  2BC1 A;  1PHH A;  3RP8 A;  4EMW A;  1ZK7 A;  3LZW A;  2XFQ A;  4C3X A;  3LXD A;  3ADA B;  2R46 A;  2BCP A;  3CNT A;  2B76 A;  3T2Z A;  4J2W A;  4G73 A;  1KSU A;  1TYT A;  3NYC A;  4LA1 A;  4LII A;  1GTH A;  3VRD B;  4Z2T A;  5BUK A;  2V61 A;  2ACZ A;  1CJ2 A;  3UKQ A;  2GR0 A;  1CBO A;  1F8W A;  4Z2R A;  4K22 A;  4MJW A;  3C96 A;  2R0P A;  1CC4 A;  3K7T A;  4B68 A;  3GYJ A;  1JRY A;  1O94 A;  4B63 A;  2VVM A;  1B37 A;  4GRT A;  1F8R A;  1D7L A;  4U8M A;  4IVO B;  5EOW A;  3F8R A;  1PN0 A;  3QVP A;  1V59 A;  4H4U A;  4IVM B;  3RHA A;  5EBK A;  3NG7 X;  3SX6 A;  4TM1 A;  5KRQ A;  3O0H A;  2JKC A;  1ZMC A;  3FIM B;  2WU5 A;  1NG4 A;  2C76 A;  3NK1 X;  3QVR A;  1GRT A;  1KDG A;  2WQY A;  2YM2 A;  2YVJ A;  3M12 A;  1RSG A;  4II2 A;  5CKU A;  3V3N A;  1ZDL A;  2XLP A;  3CN8 A;  1O95 A;  1KF6 A;  5KVI A;  1DNC A;  2WPC A;  4BV6 A;  3KLJ A;  3KVE A;  4U8L A;  1PXB A;  3T2Y A;  4ICY A;  2GEW A;  3AEE A;  1JRX A;  5BRT A;  3CGD A;  3GMB A;  1TDN A;  2XFU A;  2QA1 A;  1YY5 A;  5HYM A;  1E1M A;  1ZY8 A;  1KNP A;  3Q9T A;  3EAN A;  4EM3 A;  3DGZ A;  4GDE A;  3E1T A;  1NG3 A;  4K2X A;  3HYX A;  4OPG A;  2YWL A;  5IQ1 A;  1D7Y A;  4B1B A;  4X9N A;  1UKV G;  2DKH A;  3EAO A;  4TM0 A;  1VG0 A;  2YLS A;  4OCG A;  4YTN A;  1GES A;  3UTG A;  2ZZ0 A;  3KPF A;  4A65 A;  4DSG A;  4K5R A;  4OPI A;  1DOC A;  2ZZC A;  5KMP A;  1CC2 A;  3AE1 A;  2C3C A;  4X4J A;  4H2R A;  4XWZ A;  1E39 A;  3VR9 A;  3II4 A;  1NHS A;  1KFY A;  3P4S A;  1MO9 A;  1YKJ A;  5CQF A;  4AP3 A;  1GSN A;  3SXI A;  1E1K A;  3T2K A;  3COX A;  2IVE A;  4FK1 A;  2BA9 A;  4A6N B;  2VRM A;  3H4K A;  4NEV A;  1NAA A;  4K7Z A;  1Q1R A;  1BF3 A;  1ZOV A;  1OJ9 A;  2QA2 A;  4H2P A;  5EB4 A;  4JDR A;  2C7G A;  2BS3 A;  4EIQ A;  2JBV A;  5TR3 A;  1QO8 A;  2XVE A;  1COY A;  1JNR A;  1M64 A;  1N1P A;  1LVL A;  2OA1 A;  1L9D A;  2WET A;  4A9W A;  4A7A A;  4BUR A;  1NEK A;  1OJA A;  3GMC A;  2OLN A;  4H4Q A;  4USQ A;  3V76 A;  4OPU A;  2YLZ A;  3CPI G;  5JCI A;  3VR8 A;  2GRT A;  3KA7 A;  3CIR A;  3AEC A;  3NN0 X;  2YLR A;  4IV9 A;  3T14 A;  2A87 A;  5U1O A;  3QSS A;  4CCR A;  1TYP A;  2VZ2 A;  3LB8 A;  1L9E A;  4J33 A;  1NHR A;  4TM3 A;  3GDN A;  3NH3 X;  2V3B A;  2E4G A;  3AYI A;  4HA6 A;  2XVJ A;  4IA5 A;  4APN A;  4C3Y A;  1TDF A;  5IPY A;  4NZH A;  2UZZ A;  4GDP A;  1LJ1 A;  3CGB A;  3JSK A;  1H7X A;  5FMH A;  2Z5Y A;  4AP1 A;  4JY3 A;  3AEA A;  3DJG X;  1PJ7 A;  2A89 A;  4J34 A;  2B9Y A;  5U63 A;  1GOS A;  5KOX A;  2GH5 A;  4GAP A;  3SQP A;  3UP5 A;  2Y6Q A;  1CJ3 A;  3VQR A;  2R0C A;  2BK3 A;  1PBC A;  2XLS A;  2XLU A;  3CNJ A;  4H4W A;  4N9X A;  2GVC A;  3HYV A;  4YTP A;  3AYJ A;  2WEU A;  2YG5 A;  4C77 A;  3ICT A;  4KX6 A;  1GND A;  1F6M A;  1GRG A;  3UTE A;  4H4Y A;  4TM4 A;  3GRT A;  3BNU A;  5J60 A;  2VVL G;  1PS9 A;  4TLZ A;  2Q7V A;  2YG7 A;  4GAV A;  4J31 A;  3IF9 A;  2GAG B;  4JNQ A;  2H88 A;  3CND A;  4CBQ A;  3SZC A;  4CNK A;  1CF3 A;  3NK0 X;  1QLB A;  3ATR A;  3NN6 X;  4UP3 A;  4DGK A;  1AOG A;  1OJC A;  1KNR A;  2WS3 A;  1IUV A;  2XLR A;  1D4D A;  1OJT A;  4XWR A;  4EMJ A;  1E1L A;  1PJ5 A;  2RAB A;  4YXD A;  4H50 A;  4YTM A;  5KOW A;  1Y56 B;  1PBE A;  2AR8 A;  3P4P A;  2VQB A;  1IUT A;  2B7S A;  3GWF A;  4J57 A;  3BHK A;  2RGH A;  3CPJ G;  4A5L A;  1GRF A;  2GQF A;  1GXF A;  3GWD A;  3AD8 B;  4G74 A;  3KU9 A;  2Q6U A;  4NTC A;  3ICR A;  1B5Q A;  2WDV A;  1TDE A;  2ZBW A;  4PAA A;  2XDO A;  2XVI A;  4FK1 C;  3M13 A;  1IUU A;  3NYE A;  2PHH A;  4H4V A;  1BGN A;  4II3 A;  5ER0 A;  4BJY A;  1MXT A;  3GDP A;  3AD7 B;  2Q0L A;  2YR4 A;  1IJH A;  3OC4 A;  1FEC A;  2YG6 A;  2BYB A;  5FS9 A;  4USR A;  3ALJ A;  5C3J A;  1N4W A;  1GAL A;  3NRN A;  1N4V A;  4M52 A;  3BI2 A;  2B9X A;  3BNM A;  3UOY A;  4UDQ A;  1W4X A;  1NHQ A;  2V3A A;  2WP6 A;  3HYW A;  2YQU A;  3K7M X;  2WP9 A;  1PDH A;  3NNE A;  4GF7 A;  3T37 A;  4CRT A;  4EQS A;  3B3R A;  5C2T A;  4EIP A;  1JRZ A;  3CTY A;  5JCM A;  1DJQ A;  3P9U A;  1BGJ A;  4GR1 A;  5BVA A;  4Y4N A;  1JNZ A;  3L8K A;  2AQJ A;  4JY2 A;  3UOZ A;  3KPK A;  4H4Z A;  2CVJ A;  1ONF A;  2ARD A;  3D1C A;  1DXL A;  3QSM A;  4RSL A;  4ZCC A;  3ALL A;  3GSI A;  2RGO A;  3UTH A;  2NVK X;  1Y0P A;  1IUS A;  2IID A;  3PVC A;  2JB1 A;  3QSE A;  2B9W A;  1XPQ A;  1H84 A;  1H86 A;  1RYI A;  2X8H A;  2VQ7 A;  5JCN A;  3CGC A;  4JNA A;  2EQ9 A;  2GR1 A;  1JEH A;  2TMD A;  1JOA A;  2R0G A;  4U8P A;  4Z44 A;  1M6I A;  3UKH A;  4D04 A;  2TPR A;  1L0V A;  1E7P A;  3DH9 A;  4AOS A;  3NIX A;  4EQW A;  1BKW A;  3SYI A;  3UKA A;  3ITJ A;  1HYU A;  2VVL A;  4TLX A;  4I59 A;  3T0K A;  3AE8 A;  4Y4L A;  1FL2 A;  4FDC B;  5JCK A;  1RP0 A;  3UKF A;  4Z24 A;  3RP7 A;  4A6N A;  2BC0 A;  1PXC A;  4U2L A;  4YKF A;  3ZDN A;  4AT2 A;  4I58 A;  3FPZ A;  5KMQ A;  3ICS A;  1H6V A;  4BK1 A;  3GYI A;  1GET A;  4NWZ A;  1K0I A;  2GQW A;  4ZCD A;  2B7R A;  1GTE A;  3SFE A;  3S5W A;  2GR2 A;  3GD3 A;  3UP4 A;  4B64 A;  5M10 A;  3C4N A;  4GCM A;  2BS4 A;  1FCD A;  4B66 A;  5BUL A;  2R45 A;  1DJN A;  5FS7 A;  3KD9 A;  3DJJ A;  2C67 A;  2FJD A;  1S3E A;  2X50 A;  3AE6 A;  1YQ3 A;  3AWI A;  1EL8 A;  1IUX A;  2WPE A;  3AE5 A;  2EQ7 A;  2VRL A;  1Q9I A;  5EB5 A;  2WPF A;  3IC9 A;  3SZW A;  1CJ4 A;  1VDC A;  2C4C A;  3NYF A;  1LQU A;  3AE2 A;  3VRB A;  3SY4 A;  4U8O A;  4XXG A;  5LV9 A;  2Z5X A;  4G9K A;  2X8C A;  3AE3 A;  1LTX R;  4NEW A;  3V3O A;  2V5Z A;  1LV0 A;  1TDO A;  3NLC A;  3LJP A;  1Z6L A;  3EPT A;  3LZX A;  4UDR A;  1VQW A;  2WP5 A;  4O5U A;  3LOV A;  1VRQ B;  3QFB A;  1F3P A;  1S2Q A;  3D8X A;  2BRA A;  2BK4 A;  2WOW A;  4YSX A;  4X9M A;  2WU2 A;  4Z2U A;  3I6D A;  3HZL A;  3NK2 X;  2YM1 A;  3Q6J A;  3DME A;  3M0O A;  3P4R A;  4FX9 A;  4B67 A;  4GUV A;  3IHM A;  2O9Z A;  3AEB A;  1FEB A;  3C4A A;  5KMR A;  1K0L A;  4U8K A;  2OAM A;  4U8N A;  3G5Q A;  3PS9 A;  1S2Y A;  2C73 A;  1SEZ A;  2HQM A;  1O5W A;  4C74 A;  2OAL A;  1PXA A;  2XFO A;  2GF3 A;  2YR5 A;  2APG A;  4OVI A;  4PAB A;  5U25 A;  1NHP A;  3K7Q X;  3BHF A;  2CDU A;  4AT0 A;  3GD4 A;  3KKJ A;  1EBD A;  1KSS A;  1L9C A;  3NHO X;  1ZKQ A;  3SGL A;  1Y56 A;  4Z25 A;  1K4Q A;  3UKL A;  4YSY A;  2E1M A;  1TRB A;  5L46 A;  3BI5 A;  4K5S A;  3B6D A;  3VRA A;  1FEA A;  2GMJ A;  1LPF A;  4OPT A;  4Y4M A;  4CY6 A;  1GPE A;  4G6H A;  2X3N A;  4OPL A;  4P9S A;  2C75 A;  3CPH G;  1LQT A;  3AB1 A;  2V60 A;  3AE4 A;  4AOX A;  4CCQ A;  5IQ4 A;  2XYO A;  2WES A;  3AYL A;  1MOK A;  3DJD A;  3CNS A;  2RGJ A;  4BJZ A;  2NPX A;  3DK8 A;  4YSH A;  4C5O A;  4YKG A;  1CC6 A;  4ECH A;  3OZ2 A;  2YLT A;  1NDA A;  1NPX A;  1EL5 A;  1GRH A;  1H81 A;  2E5V A;  3DJE A;  4HB9 A;  1E1N A;  4DNA A;  2YG3 A;  2IVD A;  1BZL A;  1Q1W A;  1TDK A;  2JB2 A;  3EF6 A;  4KPR A;  1N4U A;  4H4S A;  2AAQ A;  5KVH A;  5HHF A;  3ABV A;  1PBF A;  2GAH B;  4H4R A;  3S61 A;  4JQ9 A;  4U2S A;  5KXJ A;  2BAC A;  4EQX A;  1D4E A;  1NEN A;  1OJD A;  3DK4 A;  2VOU A;  5GRT A;  2H89 A;  2XFN A;  3CNP A;  3PO7 A;  1REO A;  5FS8 A;  3G5S A;  4OPD A;  3UKP A;  4B65 A;  2BS2 A;  1X31 B;  2Y6R A;  4EQR A;  1XAN A;  2GB0 A;  3AEF A;  2FBW A;  4ADW A;  2C3D A;  1GRA A;  3SFD A;  3AE9 A;  4O5Q A;  1YQZ A;  1H83 A;  3G5R A;  2C66 A;  3UTF A;  3CGE A;  2WOV A;  5M0Z A;  3UKK A;  5KNL A;  3T31 A;  4EM4 A;  2V6O A;  4G6G A;  4H4T A;  1DOD A;  1VG9 A;  3RNM A;  2OLO A;  2C72 A;  1D5T A;  3H8L A;  4D03 A;  4YWO A;  2YAU A;  3UOX A;  4ZN0 A;  4U8I A;  3NT6 A;  4YSZ A;  2BXR A;  4RG4 A;  1YQ4 A;  2FJB A;  1FOH A;  4BK3 A;  5KWF A;  2WHD A;  4RG3 A;  3UCL A;  4DSH A;  1CHU A;  1S3B A;  5KMS A;  2CFY A;  3AD9 B;  2WDQ A;  4K8D A;  1GV4 A;  4OPC A;  2C64 A;  4A99 A;  4WCT A;  2FJA A;  2CUL A;  1H7W A;  5J7X A;  2EQ6 A;  2XLT A;  4H2N A;  1XDI A;  2F5Z A;  1CL0 A;  1XHC A;  2BAB A;  4H4X A;  2XCG A;  4H4P A;  1PBB A;  3F8P A;  1GRE A;  1EL9 A;  3NTD A;  3R9U A;  3L1R A;  5FS6 A;  2BXS A;  4E0V A;  1E6E A;  1DOE A;  1ZX9 A;  4A79 A;  4Z43 A;  2I0Z A;  4CNJ A;  3WE0 A;  4IA6 A;  5DBJ A;  4NTE A;  1QJD A;  3CMM A;  3SM8 A;  2XVF A;  2WDR A;  3NKS A;  2XFP A;  4U2T A;  2BRY A;  3DGH A;  2YG4 A;  3DK9 A;  4WX1 A;  1B8S A;  2FJE A;  2X99 A;  1GRB A;  2WOI A;  3ALM A;  1ZOY A;  3K30 A;  5HY5 A;  4BK2 A;  4Z26 A;  4EMI A;  1EL7 A;  3AE7 A;  1D4C A;  1PJ6 A;  1F8S A;  3URH A;  2EQ8 A;  2JK6 A;  2W0H A;  3ZYX A;  5HXI A;  4H2Q A;  1DOB A;  5GSN A;  2R4J A;  1B4V A;  2DKI A;  2R4E A;  3AEG A;  3GRS A;  2BCG G;  3FBS A;  3GYX A;  3IHG A;  3LAD A;  4J56 A;  1GEU A;  1P2H A;  2XVH A;  3NTA A;  3DA1 A;  3IWA A;  4H7U A;  4U8J A;  2YVG A;  2YVF A;  4NNJ A;  3QFA A;  4REK A;  2JAE A;  2GV8 A;  3H8I A;  3P1W A;  1P2E A;  2C70 A;  2ZZB A;  3FMW A;  1IUW A;  2QCU A;  3AED A;  3I3L A;  3ISH A;  2Q0K A;  5JCL A;  2YLW A;  1PBD A;  4LU6 A;  4YT0 A;  3RED A;  1GER A;  2A8X A;  2JB3 A;  1ZMD A;  4JN9 A;  1ZP0 A;  2PYX A;  2C65 A;  3QJ4 A; 
#chains in the Genus database with same CATH homology
 3NGC X;  1H82 A;  2GR3 A;  4B69 A;  3UOV A;  1GT8 A;  2X8G A;  2YR6 A;  1JU2 A;  3BI4 A;  2QAE A;  2GMH A;  3AXB A;  1BWC A;  1CJC A;  3P4Q A;  4UDP A;  3SZ0 A;  4CY8 A;  1ELI A;  2R9Z A;  3ATQ A;  3F8D A;  2YLX A;  4J36 A;  4NTD A;  3RP6 A;  2BK5 A;  3FG2 P;  3SZF A;  2WBA A;  1K0J A;  2J3N A;  2BC1 A;  1PHH A;  3RP8 A;  4EMW A;  1ZK7 A;  3LZW A;  2XFQ A;  4C3X A;  3LXD A;  3ADA B;  2R46 A;  2BCP A;  3CNT A;  2B76 A;  3T2Z A;  4J2W A;  4G73 A;  1KSU A;  1TYT A;  3NYC A;  4LA1 A;  4LII A;  1GTH A;  3VRD B;  4Z2T A;  5BUK A;  2V61 A;  2ACZ A;  1CJ2 A;  3UKQ A;  2GR0 A;  1CBO A;  1F8W A;  4Z2R A;  4K22 A;  4MJW A;  3C96 A;  2R0P A;  1CC4 A;  3K7T A;  4B68 A;  3GYJ A;  1JRY A;  1O94 A;  4B63 A;  2VVM A;  1B37 A;  4GRT A;  1F8R A;  1D7L A;  4U8M A;  4IVO B;  5EOW A;  3F8R A;  1PN0 A;  3QVP A;  1V59 A;  4H4U A;  4IVM B;  3RHA A;  5EBK A;  3NG7 X;  3SX6 A;  4TM1 A;  5KRQ A;  3O0H A;  2JKC A;  1ZMC A;  3FIM B;  2WU5 A;  1NG4 A;  2C76 A;  3NK1 X;  3QVR A;  1GRT A;  1KDG A;  2WQY A;  2YM2 A;  2YVJ A;  3M12 A;  1RSG A;  4II2 A;  5CKU A;  3V3N A;  1ZDL A;  2XLP A;  3CN8 A;  1O95 A;  1KF6 A;  5KVI A;  1DNC A;  2WPC A;  4BV6 A;  3KLJ A;  3KVE A;  4U8L A;  1PXB A;  3T2Y A;  4ICY A;  2GEW A;  3AEE A;  1JRX A;  5BRT A;  3CGD A;  3GMB A;  1TDN A;  2XFU A;  2QA1 A;  1YY5 A;  5HYM A;  1E1M A;  1ZY8 A;  1KNP A;  3Q9T A;  3EAN A;  4EM3 A;  3DGZ A;  4GDE A;  3E1T A;  1NG3 A;  4K2X A;  3HYX A;  4OPG A;  2YWL A;  5IQ1 A;  1D7Y A;  4B1B A;  4X9N A;  1UKV G;  2DKH A;  3EAO A;  4TM0 A;  1VG0 A;  2YLS A;  4OCG A;  4YTN A;  1GES A;  3UTG A;  2ZZ0 A;  3KPF A;  4A65 A;  4DSG A;  4K5R A;  4OPI A;  1DOC A;  2ZZC A;  5KMP A;  1CC2 A;  3AE1 A;  2C3C A;  4X4J A;  4H2R A;  4XWZ A;  1E39 A;  3VR9 A;  3II4 A;  1NHS A;  1KFY A;  3P4S A;  1MO9 A;  1YKJ A;  5CQF A;  4AP3 A;  1GSN A;  3SXI A;  1E1K A;  3T2K A;  3COX A;  2IVE A;  4FK1 A;  2BA9 A;  4A6N B;  2VRM A;  3H4K A;  4NEV A;  1NAA A;  4K7Z A;  1Q1R A;  1BF3 A;  1ZOV A;  1OJ9 A;  2QA2 A;  4H2P A;  5EB4 A;  4JDR A;  2C7G A;  2BS3 A;  4EIQ A;  2JBV A;  5TR3 A;  1QO8 A;  2XVE A;  1COY A;  1JNR A;  1M64 A;  1N1P A;  1LVL A;  2OA1 A;  1L9D A;  2WET A;  4A9W A;  4A7A A;  4BUR A;  1NEK A;  1OJA A;  3GMC A;  2OLN A;  4H4Q A;  4USQ A;  3V76 A;  4OPU A;  2YLZ A;  3CPI G;  5JCI A;  3VR8 A;  2GRT A;  3KA7 A;  3CIR A;  3AEC A;  3NN0 X;  2YLR A;  4IV9 A;  3T14 A;  2A87 A;  5U1O A;  3QSS A;  4CCR A;  1TYP A;  2VZ2 A;  3LB8 A;  1L9E A;  4J33 A;  1NHR A;  4TM3 A;  3GDN A;  3NH3 X;  2V3B A;  2E4G A;  3AYI A;  4HA6 A;  2XVJ A;  4IA5 A;  4APN A;  4C3Y A;  1TDF A;  5IPY A;  4NZH A;  2UZZ A;  4GDP A;  1LJ1 A;  3CGB A;  3JSK A;  1H7X A;  5FMH A;  2Z5Y A;  4AP1 A;  4JY3 A;  3AEA A;  3DJG X;  1PJ7 A;  2A89 A;  4J34 A;  2B9Y A;  5U63 A;  1GOS A;  5KOX A;  2GH5 A;  4GAP A;  3SQP A;  3UP5 A;  2Y6Q A;  1CJ3 A;  3VQR A;  2R0C A;  2BK3 A;  1PBC A;  2XLS A;  2XLU A;  3CNJ A;  4H4W A;  4N9X A;  2GVC A;  3HYV A;  4YTP A;  3AYJ A;  2WEU A;  2YG5 A;  4C77 A;  3ICT A;  4KX6 A;  1GND A;  1F6M A;  1GRG A;  3UTE A;  4H4Y A;  4TM4 A;  3GRT A;  3BNU A;  5J60 A;  2VVL G;  1PS9 A;  4TLZ A;  2Q7V A;  2YG7 A;  4GAV A;  4J31 A;  3IF9 A;  2GAG B;  4JNQ A;  2H88 A;  3CND A;  4CBQ A;  3SZC A;  4CNK A;  1CF3 A;  3NK0 X;  1QLB A;  3ATR A;  3NN6 X;  4UP3 A;  4DGK A;  1AOG A;  1OJC A;  1KNR A;  2WS3 A;  1IUV A;  2XLR A;  1D4D A;  1OJT A;  4XWR A;  4EMJ A;  1E1L A;  1PJ5 A;  2RAB A;  4YXD A;  4H50 A;  4YTM A;  5KOW A;  1Y56 B;  1PBE A;  2AR8 A;  3P4P A;  2VQB A;  1IUT A;  2B7S A;  3GWF A;  4J57 A;  3BHK A;  2RGH A;  3CPJ G;  4A5L A;  1GRF A;  2GQF A;  1GXF A;  3GWD A;  3AD8 B;  4G74 A;  3KU9 A;  2Q6U A;  4NTC A;  3ICR A;  1B5Q A;  2WDV A;  1TDE A;  2ZBW A;  4PAA A;  2XDO A;  2XVI A;  4FK1 C;  3M13 A;  1IUU A;  3NYE A;  2PHH A;  4H4V A;  1BGN A;  4II3 A;  5ER0 A;  4BJY A;  1MXT A;  3GDP A;  3AD7 B;  2Q0L A;  2YR4 A;  1IJH A;  3OC4 A;  1FEC A;  2YG6 A;  2BYB A;  5FS9 A;  4USR A;  3ALJ A;  5C3J A;  1N4W A;  1GAL A;  3NRN A;  1N4V A;  4M52 A;  3BI2 A;  2B9X A;  3BNM A;  3UOY A;  4UDQ A;  1W4X A;  1NHQ A;  2V3A A;  2WP6 A;  3HYW A;  2YQU A;  3K7M X;  2WP9 A;  1PDH A;  3NNE A;  4GF7 A;  3T37 A;  4CRT A;  4EQS A;  3B3R A;  5C2T A;  4EIP A;  1JRZ A;  3CTY A;  5JCM A;  1DJQ A;  3P9U A;  1BGJ A;  4GR1 A;  5BVA A;  4Y4N A;  1JNZ A;  3L8K A;  2AQJ A;  4JY2 A;  3UOZ A;  3KPK A;  4H4Z A;  2CVJ A;  1ONF A;  2ARD A;  3D1C A;  1DXL A;  3QSM A;  4RSL A;  4ZCC A;  3ALL A;  3GSI A;  2RGO A;  3UTH A;  2NVK X;  1Y0P A;  1IUS A;  2IID A;  3PVC A;  2JB1 A;  3QSE A;  2B9W A;  1XPQ A;  1H84 A;  1H86 A;  1RYI A;  2X8H A;  2VQ7 A;  5JCN A;  3CGC A;  4JNA A;  2EQ9 A;  2GR1 A;  1JEH A;  2TMD A;  1JOA A;  2R0G A;  4U8P A;  4Z44 A;  1M6I A;  3UKH A;  4D04 A;  2TPR A;  1L0V A;  1E7P A;  3DH9 A;  4AOS A;  3NIX A;  4EQW A;  1BKW A;  3SYI A;  3UKA A;  3ITJ A;  1HYU A;  2VVL A;  4TLX A;  4I59 A;  3T0K A;  3AE8 A;  4Y4L A;  1FL2 A;  4FDC B;  5JCK A;  1RP0 A;  3UKF A;  4Z24 A;  3RP7 A;  4A6N A;  2BC0 A;  1PXC A;  4U2L A;  4YKF A;  3ZDN A;  4AT2 A;  4I58 A;  3FPZ A;  5KMQ A;  3ICS A;  1H6V A;  4BK1 A;  3GYI A;  1GET A;  4NWZ A;  1K0I A;  2GQW A;  4ZCD A;  2B7R A;  1GTE A;  3SFE A;  3S5W A;  2GR2 A;  3GD3 A;  3UP4 A;  4B64 A;  5M10 A;  3C4N A;  4GCM A;  2BS4 A;  1FCD A;  4B66 A;  5BUL A;  2R45 A;  1DJN A;  5FS7 A;  3KD9 A;  3DJJ A;  2C67 A;  2FJD A;  1S3E A;  2X50 A;  3AE6 A;  1YQ3 A;  3AWI A;  1EL8 A;  1IUX A;  2WPE A;  3AE5 A;  2EQ7 A;  2VRL A;  1Q9I A;  5EB5 A;  2WPF A;  3IC9 A;  3SZW A;  1CJ4 A;  1VDC A;  2C4C A;  3NYF A;  1LQU A;  3AE2 A;  3VRB A;  3SY4 A;  4U8O A;  4XXG A;  5LV9 A;  2Z5X A;  4G9K A;  2X8C A;  3AE3 A;  1LTX R;  4NEW A;  3V3O A;  2V5Z A;  1LV0 A;  1TDO A;  3NLC A;  3LJP A;  1Z6L A;  3EPT A;  3LZX A;  4UDR A;  1VQW A;  2WP5 A;  4O5U A;  3LOV A;  1VRQ B;  3QFB A;  1F3P A;  1S2Q A;  3D8X A;  2BRA A;  2BK4 A;  2WOW A;  4YSX A;  4X9M A;  2WU2 A;  4Z2U A;  3I6D A;  3HZL A;  3NK2 X;  2YM1 A;  3Q6J A;  3DME A;  3M0O A;  3P4R A;  4FX9 A;  4B67 A;  4GUV A;  3IHM A;  2O9Z A;  3AEB A;  1FEB A;  3C4A A;  5KMR A;  1K0L A;  4U8K A;  2OAM A;  4U8N A;  3G5Q A;  3PS9 A;  1S2Y A;  2C73 A;  1SEZ A;  2HQM A;  1O5W A;  4C74 A;  2OAL A;  1PXA A;  2XFO A;  2GF3 A;  2YR5 A;  2APG A;  4OVI A;  4PAB A;  5U25 A;  1NHP A;  3K7Q X;  3BHF A;  2CDU A;  4AT0 A;  3GD4 A;  3KKJ A;  1EBD A;  1KSS A;  1L9C A;  3NHO X;  1ZKQ A;  3SGL A;  1Y56 A;  4Z25 A;  1K4Q A;  3UKL A;  4YSY A;  2E1M A;  1TRB A;  5L46 A;  3BI5 A;  4K5S A;  3B6D A;  3VRA A;  1FEA A;  2GMJ A;  1LPF A;  4OPT A;  4Y4M A;  4CY6 A;  1GPE A;  4G6H A;  2X3N A;  4OPL A;  4P9S A;  2C75 A;  3CPH G;  1LQT A;  3AB1 A;  2V60 A;  3AE4 A;  4AOX A;  4CCQ A;  5IQ4 A;  2XYO A;  2WES A;  3AYL A;  1MOK A;  3DJD A;  3CNS A;  2RGJ A;  4BJZ A;  2NPX A;  3DK8 A;  4YSH A;  4C5O A;  4YKG A;  1CC6 A;  4ECH A;  3OZ2 A;  2YLT A;  1NDA A;  1NPX A;  1EL5 A;  1GRH A;  1H81 A;  2E5V A;  3DJE A;  4HB9 A;  1E1N A;  4DNA A;  2YG3 A;  2IVD A;  1BZL A;  1Q1W A;  1TDK A;  2JB2 A;  3EF6 A;  4KPR A;  1N4U A;  4H4S A;  2AAQ A;  5KVH A;  5HHF A;  3ABV A;  1PBF A;  2GAH B;  4H4R A;  3S61 A;  4JQ9 A;  4U2S A;  5KXJ A;  2BAC A;  4EQX A;  1D4E A;  1NEN A;  1OJD A;  3DK4 A;  2VOU A;  5GRT A;  2H89 A;  2XFN A;  3CNP A;  3PO7 A;  1REO A;  5FS8 A;  3G5S A;  4OPD A;  3UKP A;  4B65 A;  2BS2 A;  1X31 B;  2Y6R A;  4EQR A;  1XAN A;  2GB0 A;  3AEF A;  2FBW A;  4ADW A;  2C3D A;  1GRA A;  3SFD A;  3AE9 A;  4O5Q A;  1YQZ A;  1H83 A;  3G5R A;  2C66 A;  3UTF A;  3CGE A;  2WOV A;  5M0Z A;  3UKK A;  5KNL A;  3T31 A;  4EM4 A;  2V6O A;  4G6G A;  4H4T A;  1DOD A;  1VG9 A;  3RNM A;  2OLO A;  2C72 A;  1D5T A;  3H8L A;  4D03 A;  4YWO A;  2YAU A;  3UOX A;  4ZN0 A;  4U8I A;  3NT6 A;  4YSZ A;  2BXR A;  4RG4 A;  1YQ4 A;  2FJB A;  1FOH A;  4BK3 A;  5KWF A;  2WHD A;  4RG3 A;  3UCL A;  4DSH A;  1CHU A;  1S3B A;  5KMS A;  2CFY A;  3AD9 B;  2WDQ A;  4K8D A;  1GV4 A;  4OPC A;  2C64 A;  4A99 A;  4WCT A;  2FJA A;  2CUL A;  1H7W A;  5J7X A;  2EQ6 A;  2XLT A;  4H2N A;  1XDI A;  2F5Z A;  1CL0 A;  1XHC A;  2BAB A;  4H4X A;  2XCG A;  4H4P A;  1PBB A;  3F8P A;  1GRE A;  1EL9 A;  3NTD A;  3R9U A;  3L1R A;  5FS6 A;  2BXS A;  4E0V A;  1E6E A;  1DOE A;  1ZX9 A;  4A79 A;  4Z43 A;  2I0Z A;  4CNJ A;  3WE0 A;  4IA6 A;  5DBJ A;  4NTE A;  1QJD A;  3CMM A;  3SM8 A;  2XVF A;  2WDR A;  3NKS A;  2XFP A;  4U2T A;  2BRY A;  3DGH A;  2YG4 A;  3DK9 A;  4WX1 A;  1B8S A;  2FJE A;  2X99 A;  1GRB A;  2WOI A;  3ALM A;  1ZOY A;  3K30 A;  5HY5 A;  4BK2 A;  4Z26 A;  4EMI A;  1EL7 A;  3AE7 A;  1D4C A;  1PJ6 A;  1F8S A;  3URH A;  2EQ8 A;  2JK6 A;  2W0H A;  3ZYX A;  5HXI A;  4H2Q A;  1DOB A;  5GSN A;  2R4J A;  1B4V A;  2DKI A;  2R4E A;  3AEG A;  3GRS A;  2BCG G;  3FBS A;  3GYX A;  3IHG A;  3LAD A;  4J56 A;  1GEU A;  1P2H A;  2XVH A;  3NTA A;  3DA1 A;  3IWA A;  4H7U A;  4U8J A;  2YVG A;  2YVF A;  4NNJ A;  3QFA A;  4REK A;  2JAE A;  2GV8 A;  3H8I A;  3P1W A;  1P2E A;  2C70 A;  2ZZB A;  3FMW A;  1IUW A;  2QCU A;  3AED A;  3I3L A;  3ISH A;  2Q0K A;  5JCL A;  2YLW A;  1PBD A;  4LU6 A;  4YT0 A;  3RED A;  1GER A;  2A8X A;  2JB3 A;  1ZMD A;  4JN9 A;  1ZP0 A;  2PYX A;  2C65 A;  3QJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...