3NH3X

Complex of 6-hydroxy-l-nicotine oxidase with final ketone product formed during catalytic turnover
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 143
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nh3X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nh3X02
2FBWA 1E6EA 1F8WA 4O5UA 1NEKA 1N1PA 2X8CA 3I3LA 1CJ4A 4X9NA 4YSZA 4FK1C 1NHQA 2C75A 1DOBA 2OAMA 3H8IA 4LIIA 1JEHA 4DGKA 1JU2A 3AYIA 2R9ZA 2VVLG 1P2EA 4H2PA 2GAGB 2C67A 1H7XA 1KSSA 1V59A 3QSMA 3ALMA 3AD8B 4OPDA 2JKCA 4ECHA 2JB2A 3AE6A 1DJNA 3KA7A 1LQUA 1CC2A 1FEBA 2XVFA 3ATQA 3RP6A 3UKQA 2DKHA 4CNJA 1BF3A 4KX6A 4C3YA 1MOKA 1N4VA 3S61A 2V61A 2WP6A 1LJ1A 1VQWA 3H8LA 4YWOA 3SM8A 3E1TA 5FMHA 3BNMA 2XFUA 1F8SA 1K0JA 1EL7A 2YG7A 2NPXA 2YG4A 2WDRA 4OCGA 1GRGA 1GT8A 1YQ3A 2BK5A 4H4UA 2X50A 3GWFA 1ZOYA 4FX9A 1DODA 1IUXA 1L9DA 1O95A 2Q0KA 1PN0A 3NK1X 1RYIA 3CTYA 1IUTA 1NAAA 2WQYA 1L9CA 4OPCA 4XWZA 2W0HA 2E4GA 2C66A 2GB0A 4AP1A 1E1NA 2BYBA 2FJBA 1DXLA 3BI5A 3P4RA 4K8DA 4U8PA 5FS9A 2BS2A 3BNUA 3CN8A 4U2LA 2EQ9A 3SQPA 1MXTA 2B7SA 1PJ6A 4IVMB 3UKKA 3IF9A 2FJEA 2A89A 2EQ6A 1RSGA 4U2TA 2C3DA 3NN6X 1PBEA 4P9SA 1GALA 1E1MA 1Q1WA 2BS4A 2Y6RA 4OPGA 5ER0A 4Z2RA 1VDCA 5U1OA 3UTFA 2GMHA 4H4YA 1GTHA 1ZK7A 4H4WA 2JAEA 2AR8A 4YXDA 4DNAA 5EB4A 1CHUA 4B1BA 3KLJA 5HHFA 1KNRA 5BRTA 1NG4A 1S3BA 1YQ4A 1IUSA 4A9WA 4DSGA 1B37A 4JY3A 3R9UA 3CPIG 1YKJA 2PHHA 2XYOA 1GESA 3ATRA 4AOXA 2GRTA 4BK1A 4EM4A 2APGA 2XLRA 2YLZA 4YKFA 1KNPA 4H4VA 2X99A 4J56A 3DMEA 3ICRA 3S5WA 3UKAA 4Z25A 3DA1A 3UP5A 3FG2P 1D4DA 5FS6A 3QFBA 2GQFA 1TDKA 4Z2UA 5JCNA 3CNJA 2R0GA 4U8LA 1LV0A 3KKJA 1OJTA 2Z5XA 1ZMDA 2R4EA 3KPFA 3AECA 2YG5A 4WCTA 2YAUA 4CBQA 2R0PA 4EMJA 3RP8A 4NEWA 3IHMA 3B3RA 2B76A 4I58A 5TR3A 5KXJA 2GQWA 2J3NA 1IUVA 5IQ1A 2GVCA 3DJEA 3LZXA 3AEDA 4EM3A 1K0LA 1ZKQA 1MO9A 1VRQB 2BCPA 1SEZA 4H4PA 2JB3A 1CC4A 3RHAA 3UP4A 2GEWA 1YY5A 4GR1A 1ONFA 4YTPA 1GRFA 5CKUA 4B67A 1EL8A 2C65A 3AYJA 2YM1A 4C3XA 2HQMA 1QO8A 1E7PA 2C72A 3AE5A 3RP7A 2F5ZA 1PHHA 5JCLA 3DGHA 2C7GA 2YG3A 2WU2A 3ICSA 3PVCA 3JSKA 3IHGA 2WU5A 1PBFA 3D1CA 2BS3A 3QJ4A 4H4TA 5JCMA 2C3CA 2QA2A 1IUWA 3VRAA 2WP9A 3ABVA 2X3NA 3M12A 1S3EA 3NK0X 1L0VA 4CY8A 1CF3A 3F8PA 3CPHG 1Y0PA 4TM0A 1XANA 4H2NA 4H2QA 4OPUA 2UZZA 2C70A 1TDFA 3OZ2A 3AE9A 1ZOVA 2X8GA 3ALLA 3AEAA 3GD3A 5KRQA 4CCQA 4J2WA 4BJZA 3DJJA 3M13A 1OJCA 4YT0A 5C2TA 1ELIA 1NHSA 2YR4A 2Z5YA 1E39A 2VZ2A 2XCGA 3G5SA 2YLTA 1JOAA 4YTMA 5LV9A 3KVEA 4U8KA 3DK8A 4TLZA 4EIQA 3AE3A 4AOSA 3UCLA 3NNEA 3LADA 4ICYA 2BXSA 4KPRA 4U8JA 4EQRA 1FOHA 4Z24A 4Z44A 4Z2TA 2NVKX 1QLBA 4O5QA 3K7TA 4EQXA 5BUKA 2QAEA 1BGNA 2BC1A 2JK6A 4XXGA 1CJ3A 4K22A 3AE4A 2XFNA 3NN0X 4OPIA 3NHOX 3T37A 4B69A 2VOUA 2YVJA 3NGCX 1GREA 3EANA 4YSXA 1L9EA 3CNPA 2VRLA 3LOVA 3BI2A 2E5VA 3AD7B 3NTAA 1H82A 2B9WA 1XDIA 3BHKA 2VVLA 1PXBA 3G5RA 4CNKA 3P4QA 1EL9A 3CPJG 4MJWA 5U25A 1NPXA 4JNQA 2WDQA 3QVPA 5HYMA 1UKVG 4NEVA 4PAAA 2Q0LA 4HA6A 1GETA 1BGJA 3GYIA 3ICTA 1D5TA 2I0ZA 1O94A 2B9XA 4WX1A 1X31B 2WOVA 1M64A 4H4XA 4A99A 3HZLA 2EQ7A 1IUUA 1PJ7A 2R0CA 3AWIA 3K7MX 3GDNA 1TYTA 4RSLA 4D03A 1LTXR 1FECA 3NYFA 5C3JA 4J36A 2YR6A 2VVMA 3AB1A 4E0VA 2JB1A 1TDEA 1ZX9A 3UKLA 3NRNA 2BABA 2EQ8A 3FBSA 2WHDA 3C96A 2V3BA 3GRSA 1YQZA 2XLTA 3URHA 1CJCA 1EBDA 1M6IA 3GMCA 2WBAA 1XPQA 1DOEA 3BI4A 3AYLA 1QJDA 3G5QA 3II4A 4U8MA 3UOXA 2H88A 1AOGA 1COYA 4IA6A 4JY2A 2ZBWA 1H7WA 2GR2A 3ALJA 3V76A 4BK3A 5J60A 5DBJA 4YSYA 1HYUA 4K7ZA 4TLXA 1H6VA 2B7RA 4J33A 4HB9A 4USRA 5L46A 4BJYA 3F8RA 3K30A 1TRBA 2H89A 3DJGX 1NG3A 2XLPA 4GF7A 2CDUA 3I6DA 4NZHA 2YLSA 4IVOB 1FEAA 3IWAA 3AEEA 2XFPA 4NTDA 2VRMA 3UOVA 3L8KA 1DNCA 1N4UA 4J34A 4OPLA 1GEUA 3VR9A 3FMWA 4J31A 2Y6QA 4EQSA 2IVDA 5KVHA 1GRAA 2XFQA 1O5WA 3CNDA 4GDEA 3NLCA 2VQBA 1KSUA 2RGHA 3OC4A 1PBCA 3BHFA 3GRTA 5U63A 2YLRA 2YG6A 4H2RA 1ZP0A 2WDVA 2AAQA 2YR5A 3C4AA 4UP3A 3CGDA 3LZWA 3UTEA 1OJAA 2GR3A 4U8NA 1DJQA 1PXCA 1Q9IA 2B9YA 3GD4A 2AQJA 4A7AA 4B65A 1JNRA 1GSNA 4B63A 1ZY8A 2XVHA 3ADAB 1E1KA 4UDRA 3H4KA 2ARDA 2R45A 3LXDA 5FS8A 4C77A 1TDOA 2GH5A 4BURA 3NH3X 1PDHA 3FPZA 2WOIA 2X8HA 2ZZBA 1JRYA 3AEGA 1NHRA 4D04A 3QSSA 5KOXA 3SFEA 1PJ5A 1XHCA 3P1WA 4ZN0A 3P4SA 3DGZA 3LB8A 2E1MA 4U2SA 1PBBA 1GOSA 3UKPA 1BKWA 2Q7VA 2YVGA 1GNDA 3P9UA 2WS3A 4H4QA 2BC0A 3P4PA 3AE2A 3ZDNA 5HY5A 4ZCCA 1BZLA 1NHPA 3QFAA 1K0IA 3CIRA 3UOYA 2XLUA 1S2YA 2ZZCA 1F6MA 1B5QA 4X4JA 4B64A 1GTEA 3NYEA 4NTCA 2GF3A 2ZZ0A 3IC9A 4PABA 4USQA 2YQUA 1PXAA 2A87A 1H84A 4Y4LA 3AD9B 4BK2A 4EQWA 1GPEA 1GV4A 3UKHA 3NK2X 1KF6A 4JDRA 5HXIA 4RG4A 4CCRA 5EB5A 3F8DA 1H86A 2XFOA 2VQ7A 1LQTA 1CBOA 2QA1A 3DK4A 4GCMA 1B8SA 2YM2A 4AT0A 4RG3A 4UDQA 3CGCA 3QSEA 3D8XA 3NKSA 1Q1RA 2OLOA 5KWFA 4ZCDA 1OJ9A 2BK4A 4A79A 4FK1A 1D4CA 3DK9A 2CULA 2ACZA 3AXBA 4JNAA 2R4JA 4K5RA 1D7YA 3WE0A 4REKA 2BCGG 3KD9A 4IA5A 3UTHA 1OJDA 1EL5A 5KOWA 3VRBA 3AE1A 1Y56A 1P2HA 3GMBA 1B4VA 2V5ZA 4BV6A 2OLNA 2XLSA 5BVAA 2TMDA 4A6NB 4H4ZA 1CL0A 3Q6JA 3EPTA 1D7LA 3M0OA 3AEFA 4AT2A 1ZDLA 4EIPA 2WETA 4OVIA 5JCIA 3NYCA 3EF6A 2DKIA 3NIXA 2GR1A 2BXRA 2WPFA 4EMIA 3VQRA 2IIDA 2JBVA 2RGJA 2C73A 4H7UA 4ADWA 2BACA 1ZMCA 1GXFA 2CFYA 4EMWA 2IVEA 2WEUA 2XDOA 4B68A 4UDPA 4LA1A 4OPTA 4Z43A 1GRHA 5M0ZA 2GAHB 1GRTA 2XVJA 2WPEA 4X9MA 3V3OA 3LJPA 4TM3A 4U8OA 3ZYXA 5EBKA 2RGOA 1CC6A 4Z26A 2GR0A 3AEBA 2O9ZA 4K5SA 4APNA 3DJDA 1Y56B 5BULA 1PBDA 1NDAA 3AE7A 3CNTA 4TM1A 3GYJA 2BA9A 1JRXA 1H81A 1Z6LA 3Q9TA 5EOWA 3V3NA 5IPYA 4GUVA 4CRTA 4J57A 2FJAA 4K2XA 5CQFA 2GMJA 1VG0A 3CGEA 3NT6A 1F8RA 2YWLA 1W4XA 1K4QA 1LPFA 1REOA 4H4SA 2BK3A 3B6DA 3FIMB 4NTEA 5M10A 1D4EA 4N9XA 3KU9A 3VRDB 1S2QA 2CVJA 2RABA 2C64A 2V60A 4JQ9A 2FJDA 1VG9A 1N4WA 2PYXA 2R46A 2XVEA 3K7QX 4M52A 3C4NA 3SFDA 2YLXA 4Y4NA 4AP3A 1RP0A 3PO7A 4Y4MA 3NTDA 1E1LA 4JN9A 4FDCB 2QCUA 1PS9A 3AE8A 4A5LA 1JRZA 1H83A 2TPRA 3UKFA 1FCDA 2A8XA 1KDGA 3RNMA 3L1RA 3UOZA 4C74A 3EAOA 5FS7A 1NENA 3VR8A 2V6OA 4A65A 4A6NA 3ITJA 4TM4A 4H4RA 3DH9A 1GRBA 2OA1A 4XWRA 5IQ4A 2C76A 1F3PA 4C5OA 3GSIA 2GV8A 3GWDA 2YVFA 1JNZA 1LVLA 5GRTA 5GSNA 3NG7X 2WPCA 4YSHA 1GERA 5KVIA 4DSHA 4GRTA 4IV9A 2Q6UA 3CGBA 4B66A 3QVRA 4YKGA 3REDA 1FL2A 2WOWA 5JCKA 2V3AA 3PS9A 5J7XA 2WESA 2YLWA 1TDNA 1TYPA 2XVIA 1KFYA 3O0HA 4YTNA 3COXA 3SGLA 1DOCA 4GDPA 4CY6A 1CJ2A 1IJHA 4LU6A 4U8IA 2OALA 3GDPA 3UTGA 3CNSA 1BWCA 4H50A 4I59A 2WP5A 3ISHA
chains in the Genus database with same CATH superfamily
2FBWA 1E6EA 1F8WA 4O5UA 1NEKA 1N1PA 2X8CA 3I3LA 1CJ4A 4X9NA 4YSZA 4FK1C 1NHQA 2C75A 1DOBA 2OAMA 3H8IA 4LIIA 1JEHA 4DGKA 1JU2A 3AYIA 2R9ZA 2VVLG 1P2EA 4H2PA 2GAGB 2C67A 1H7XA 1KSSA 1V59A 3QSMA 4GAPA 3ALMA 3AD8B 4OPDA 2JKCA 4ECHA 2JB2A 3AE6A 1DJNA 3KA7A 1LQUA 1CC2A 1FEBA 2XVFA 3ATQA 3RP6A 3T2YA 2DKHA 3UKQA 4CNJA 1BF3A 4KX6A 4C3YA 1MOKA 1N4VA 3S61A 2V61A 2WP6A 1LJ1A 1VQWA 3H8LA 4YWOA 3SM8A 3E1TA 5FMHA 3BNMA 2XFUA 1F8SA 1K0JA 1EL7A 2YG7A 2NPXA 2YG4A 2WDRA 3SX6A 4OCGA 1GRGA 1GT8A 1YQ3A 2BK5A 4H4UA 3T31A 2X50A 3GWFA 1ZOYA 4FX9A 1DODA 1IUXA 1L9DA 1O95A 2Q0KA 1PN0A 3NK1X 1RYIA 3CTYA 1IUTA 1NAAA 2WQYA 1L9CA 4OPCA 4XWZA 2W0HA 2E4GA 2C66A 2GB0A 4AP1A 1E1NA 2BYBA 2FJBA 1DXLA 3BI5A 3P4RA 4K8DA 4U8PA 5FS9A 2BS2A 3BNUA 3CN8A 3KPKA 2EQ9A 4U2LA 3SQPA 1MXTA 2B7SA 1PJ6A 4IVMB 3UKKA 3IF9A 3CMMA 2FJEA 2A89A 2EQ6A 4II2A 1RSGA 4U2TA 2C3DA 3NN6X 1PBEA 4P9SA 1GALA 1E1MA 1Q1WA 2BS4A 2Y6RA 4OPGA 5ER0A 4Z2RA 1VDCA 5U1OA 3UTFA 2GMHA 4H4YA 1GTHA 1ZK7A 4H4WA 2JAEA 2AR8A 4YXDA 4DNAA 5EB4A 1CHUA 4B1BA 3KLJA 5HHFA 1KNRA 5BRTA 1NG4A 1S3BA 1YQ4A 1IUSA 4A9WA 4DSGA 1B37A 4JY3A 3R9UA 3CPIG 1YKJA 2PHHA 2XYOA 1GESA 3ATRA 4AOXA 2GRTA 4BK1A 4EM4A 2APGA 2XLRA 2YLZA 4YKFA 1KNPA 4H4VA 2X99A 4J56A 3DMEA 3ICRA 3S5WA 3UKAA 4Z25A 3DA1A 3UP5A 3FG2P 1D4DA 5FS6A 3QFBA 2GQFA 1TDKA 4Z2UA 5JCNA 3CNJA 2R0GA 4U8LA 1LV0A 3KKJA 1OJTA 2Z5XA 1ZMDA 2R4EA 3KPFA 3AECA 2YG5A 4WCTA 2YAUA 5KMSA 4CBQA 2R0PA 4EMJA 3RP8A 4NEWA 3IHMA 3B3RA 2B76A 4I58A 5TR3A 5KXJA 2GQWA 2J3NA 1IUVA 5IQ1A 2GVCA 3DJEA 3LZXA 3AEDA 4EM3A 1K0LA 1ZKQA 1MO9A 1VRQB 2BCPA 1SEZA 4H4PA 2JB3A 1CC4A 3RHAA 3UP4A 4G6HA 2GEWA 1YY5A 4GR1A 1ONFA 4YTPA 5KMPA 1GRFA 5CKUA 4B67A 1EL8A 2C65A 3SZWA 3AYJA 2YM1A 4C3XA 2HQMA 1QO8A 1E7PA 2C72A 3AE5A 3HYXA 2F5ZA 1PHHA 3RP7A 5JCLA 3DGHA 2C7GA 2YG3A 2WU2A 3ICSA 3PVCA 3JSKA 3IHGA 2WU5A 1PBFA 3D1CA 2BS3A 3QJ4A 4H4TA 5JCMA 2C3CA 2QA2A 1IUWA 4II3A 3VRAA 2WP9A 3ABVA 2X3NA 3M12A 1S3EA 3NK0X 1L0VA 4CY8A 1CF3A 3F8PA 3CPHG 1Y0PA 4TM0A 1XANA 4H2NA 4H2QA 4OPUA 2UZZA 2C70A 1TDFA 3OZ2A 3AE9A 1ZOVA 2X8GA 3ALLA 3AEAA 3GD3A 5KRQA 4CCQA 4J2WA 4BJZA 3DJJA 3M13A 1OJCA 4YT0A 5C2TA 3GYXA 2C4CA 1ELIA 1NHSA 2YR4A 3HYWA 2Z5YA 1E39A 2VZ2A 2XCGA 3G5SA 2YLTA 1JOAA 4YTMA 5LV9A 3KVEA 4U8KA 3SZFA 3DK8A 4TLZA 4EIQA 3AE3A 4AOSA 3UCLA 3NNEA 3LADA 4ICYA 2BXSA 4KPRA 4U8JA 4EQRA 1FOHA 4Z24A 4Z44A 4Z2TA 2NVKX 1QLBA 4O5QA 3K7TA 4EQXA 5BUKA 2QAEA 1BGNA 2BC1A 2JK6A 4XXGA 1CJ3A 4K22A 3AE4A 2XFNA 3NN0X 4OPIA 3NHOX 5KMQA 3T37A 4B69A 2VOUA 2YVJA 3NGCX 1GREA 3EANA 4YSXA 1L9EA 3CNPA 2VRLA 3LOVA 3BI2A 2E5VA 3AD7B 3NTAA 1H82A 2B9WA 1XDIA 3BHKA 2VVLA 1PXBA 3G5RA 4CNKA 3P4QA 1EL9A 3CPJG 4MJWA 5U25A 1NPXA 4JNQA 2WDQA 3QVPA 5HYMA 1UKVG 4NEVA 4PAAA 2Q0LA 4HA6A 1GETA 1BGJA 3GYIA 3ICTA 1D5TA 2I0ZA 1O94A 2B9XA 4WX1A 1X31B 2WOVA 1M64A 4G73A 4H4XA 4A99A 3HZLA 3T0KA 2EQ7A 1IUUA 1PJ7A 2R0CA 3AWIA 3K7MX 3GDNA 1TYTA 4RSLA 4D03A 1LTXR 1FECA 3NYFA 5C3JA 4J36A 2YR6A 2VVMA 3AB1A 4E0VA 2JB1A 1TDEA 1ZX9A 3UKLA 3NRNA 2BABA 2EQ8A 3FBSA 2WHDA 3C96A 2V3BA 3GRSA 1YQZA 2XLTA 3URHA 1CJCA 1EBDA 1M6IA 3GMCA 2WBAA 1XPQA 1DOEA 3BI4A 3AYLA 1QJDA 3G5QA 3II4A 4U8MA 3UOXA 2H88A 1AOGA 1COYA 4IA6A 4JY2A 2ZBWA 1H7WA 2GR2A 3ALJA 3V76A 4BK3A 5J60A 5DBJA 4YSYA 1HYUA 4K7ZA 4TLXA 1H6VA 2B7RA 4J33A 4HB9A 4USRA 5L46A 4BJYA 3F8RA 3K30A 2BRYA 1TRBA 2H89A 3DJGX 1NG3A 2XLPA 4GF7A 2CDUA 3I6DA 4NZHA 2YLSA 4IVOB 1FEAA 3IWAA 3AEEA 2XFPA 4NTDA 2VRMA 3UOVA 3L8KA 1DNCA 1N4UA 4J34A 4OPLA 1GEUA 3VR9A 3FMWA 4J31A 2Y6QA 4EQSA 2IVDA 5KVHA 1GRAA 2XFQA 1O5WA 3CNDA 4GDEA 3NLCA 2VQBA 1KSUA 2RGHA 3OC4A 1PBCA 3BHFA 3GRTA 5U63A 2YLRA 2YG6A 4H2RA 3SZ0A 1ZP0A 2WDVA 2AAQA 2YR5A 3C4AA 4GAVA 3CGDA 3LZWA 4UP3A 3UTEA 1OJAA 4G74A 2GR3A 4U8NA 4NNJA 1DJQA 1PXCA 1Q9IA 2B9YA 3GD4A 2AQJA 4A7AA 4B65A 1JNRA 1GSNA 4B63A 1ZY8A 2XVHA 3ADAB 3T2KA 1E1KA 4UDRA 3H4KA 2ARDA 2R45A 3LXDA 5FS8A 4C77A 1TDOA 2GH5A 4BURA 3NH3X 1PDHA 3FPZA 2WOIA 2X8HA 2ZZBA 1JRYA 3AEGA 1NHRA 4D04A 3QSSA 5KOXA 5KMRA 3SFEA 1PJ5A 1XHCA 3P1WA 4ZN0A 3P4SA 3DGZA 3LB8A 2E1MA 4U2SA 1PBBA 1GOSA 3UKPA 1BKWA 2Q7VA 2YVGA 1GNDA 3P9UA 2WS3A 4H4QA 2BC0A 3P4PA 3AE2A 3ZDNA 5HY5A 4ZCCA 1BZLA 1NHPA 3QFAA 1K0IA 3CIRA 3UOYA 2XLUA 1S2YA 2ZZCA 1F6MA 1B5QA 3HYVA 4X4JA 1GTEA 3NYEA 4B64A 4NTCA 2GF3A 2ZZ0A 3IC9A 4PABA 4USQA 2YQUA 1PXAA 2A87A 1H84A 4Y4LA 3AD9B 4BK2A 4EQWA 1GPEA 1GV4A 3T2ZA 3NK2X 3UKHA 1KF6A 4JDRA 5HXIA 3SXIA 4RG4A 4CCRA 5EB5A 3F8DA 1H86A 2XFOA 2VQ7A 1LQTA 1CBOA 2QA1A 3DK4A 4GCMA 5KNLA 1B8SA 2YM2A 4AT0A 4RG3A 4UDQA 3CGCA 3QSEA 3D8XA 3NKSA 1Q1RA 2BRAA 2OLOA 5KWFA 4ZCDA 1OJ9A 2BK4A 4A79A 4FK1A 1D4CA 3DK9A 2CULA 2ACZA 3AXBA 4JNAA 2R4JA 4K5RA 1D7YA 3WE0A 4REKA 2BCGG 3KD9A 4IA5A 3UTHA 1OJDA 1EL5A 5KOWA 3VRBA 3AE1A 1Y56A 1P2HA 3GMBA 1B4VA 2V5ZA 4BV6A 2OLNA 2XLSA 3SY4A 5BVAA 2TMDA 4A6NB 4H4ZA 1CL0A 3Q6JA 3EPTA 1D7LA 3M0OA 3AEFA 4AT2A 1ZDLA 4EIPA 2WETA 4OVIA 5JCIA 3NYCA 3EF6A 2DKIA 3NIXA 2GR1A 2BXRA 2WPFA 4EMIA 3VQRA 2IIDA 2JBVA 2RGJA 2C73A 4H7UA 4ADWA 2BACA 1ZMCA 1GXFA 2CFYA 4EMWA 2IVEA 2WEUA 2XDOA 4B68A 4UDPA 4LA1A 4OPTA 4Z43A 1GRHA 5M0ZA 2GAHB 1GRTA 2XVJA 2WPEA 3SZCA 4X9MA 3V3OA 3LJPA 4TM3A 4U8OA 3ZYXA 5EBKA 2RGOA 1CC6A 4Z26A 2GR0A 3AEBA 2O9ZA 4K5SA 4APNA 3DJDA 1Y56B 5BULA 1PBDA 1NDAA 3AE7A 3CNTA 4TM1A 3GYJA 2BA9A 1JRXA 1H81A 1Z6LA 3Q9TA 5EOWA 3V3NA 5IPYA 4GUVA 4CRTA 4J57A 2FJAA 4K2XA 5CQFA 3SYIA 2GMJA 1VG0A 3CGEA 3NT6A 1F8RA 2YWLA 1W4XA 4NWZA 1K4QA 1LPFA 1REOA 4H4SA 2BK3A 3B6DA 3FIMB 4NTEA 5M10A 1D4EA 4N9XA 3KU9A 3VRDB 1S2QA 2CVJA 2RABA 2C64A 2V60A 4JQ9A 2FJDA 1VG9A 1N4WA 2PYXA 2R46A 2XVEA 3K7QX 4M52A 3C4NA 3SFDA 2YLXA 4Y4NA 4AP3A 1RP0A 3PO7A 4Y4MA 3NTDA 1E1LA 4JN9A 4FDCB 2QCUA 1PS9A 3AE8A 4A5LA 1JRZA 1H83A 2TPRA 3UKFA 1FCDA 2A8XA 1KDGA 3RNMA 3L1RA 3UOZA 4C74A 3EAOA 4G6GA 5FS7A 1NENA 3VR8A 2V6OA 4A65A 4A6NA 3ITJA 4TM4A 4G9KA 4H4RA 3DH9A 1GRBA 2OA1A 4XWRA 5IQ4A 2C76A 1F3PA 4C5OA 3GSIA 2GV8A 3GWDA 2YVFA 1JNZA 1LVLA 5GRTA 5GSNA 3NG7X 2WPCA 4YSHA 1GERA 5KVIA 4DSHA 4GRTA 3T14A 4IV9A 2Q6UA 3CGBA 4B66A 3QVRA 4YKGA 3REDA 1FL2A 2WOWA 5JCKA 2V3AA 3PS9A 5J7XA 2WESA 2YLWA 1TDNA 1TYPA 2XVIA 1KFYA 3O0HA 4YTNA 3COXA 3SGLA 1DOCA 4GDPA 4CY6A 1CJ2A 1IJHA 4LU6A 4U8IA 2OALA 3GDPA 3UTGA 3CNSA 1BWCA 4H50A 4I59A 2WP5A 3ISHA
chains in the Genus database with same CATH topology
2FBWA 1E6EA 1F8WA 4O5UA 1NEKA 1N1PA 2X8CA 3I3LA 1CJ4A 4X9NA 4YSZA 4FK1C 1NHQA 2C75A 1DOBA 2OAMA 3H8IA 4LIIA 1JEHA 4DGKA 1JU2A 3AYIA 2R9ZA 2VVLG 1P2EA 4H2PA 2GAGB 2C67A 1H7XA 1KSSA 1V59A 3QSMA 4GAPA 3ALMA 3AD8B 4OPDA 2JKCA 4ECHA 2JB2A 3AE6A 1DJNA 3KA7A 1LQUA 1CC2A 1FEBA 2XVFA 3ATQA 3RP6A 3T2YA 2DKHA 3UKQA 4CNJA 1BF3A 4KX6A 4C3YA 1MOKA 1N4VA 3S61A 2V61A 2WP6A 1LJ1A 1VQWA 3H8LA 4YWOA 3SM8A 3E1TA 5FMHA 3BNMA 2XFUA 1F8SA 1K0JA 1EL7A 2YG7A 2NPXA 2YG4A 2WDRA 3SX6A 4OCGA 1GRGA 1GT8A 1YQ3A 2BK5A 4H4UA 3T31A 2X50A 3GWFA 1ZOYA 4FX9A 1DODA 1IUXA 1L9DA 1O95A 2Q0KA 1PN0A 3NK1X 1RYIA 3CTYA 1IUTA 1NAAA 2WQYA 1L9CA 4OPCA 4XWZA 2W0HA 2E4GA 2C66A 2GB0A 4AP1A 1E1NA 2BYBA 2FJBA 1DXLA 3BI5A 3P4RA 4K8DA 4U8PA 5FS9A 2BS2A 3BNUA 3CN8A 3KPKA 2EQ9A 4U2LA 3SQPA 1MXTA 2B7SA 1PJ6A 4IVMB 3UKKA 3IF9A 3CMMA 2FJEA 2A89A 2EQ6A 4II2A 1RSGA 4U2TA 2C3DA 3NN6X 1PBEA 4P9SA 1GALA 1E1MA 1Q1WA 2BS4A 2Y6RA 4OPGA 5ER0A 4Z2RA 1VDCA 5U1OA 3UTFA 2GMHA 4H4YA 1GTHA 1ZK7A 4H4WA 2JAEA 2AR8A 4YXDA 4DNAA 5EB4A 1CHUA 4B1BA 3KLJA 5HHFA 1KNRA 5BRTA 1NG4A 1S3BA 1YQ4A 1IUSA 4A9WA 4DSGA 1B37A 4JY3A 3R9UA 3CPIG 1YKJA 2PHHA 2XYOA 1GESA 3ATRA 4AOXA 2GRTA 4BK1A 4EM4A 2APGA 2XLRA 2YLZA 4YKFA 1KNPA 4H4VA 2X99A 4J56A 3DMEA 3ICRA 3S5WA 3UKAA 4Z25A 3DA1A 3UP5A 3FG2P 1D4DA 5FS6A 3QFBA 2GQFA 1TDKA 4Z2UA 5JCNA 3CNJA 2R0GA 4U8LA 1LV0A 3KKJA 1OJTA 2Z5XA 1ZMDA 2R4EA 3KPFA 3AECA 2YG5A 4WCTA 2YAUA 5KMSA 4CBQA 2R0PA 4EMJA 3RP8A 4NEWA 3IHMA 3B3RA 2B76A 4I58A 5TR3A 5KXJA 2GQWA 2J3NA 1IUVA 5IQ1A 2GVCA 3DJEA 3LZXA 3AEDA 4EM3A 1K0LA 1ZKQA 1MO9A 1VRQB 2BCPA 1SEZA 4H4PA 2JB3A 1CC4A 3RHAA 3UP4A 4G6HA 2GEWA 1YY5A 4GR1A 1ONFA 4YTPA 5KMPA 1GRFA 5CKUA 4B67A 1EL8A 2C65A 3SZWA 3AYJA 2YM1A 4C3XA 2HQMA 1QO8A 1E7PA 2C72A 3AE5A 3HYXA 2F5ZA 1PHHA 3RP7A 5JCLA 3DGHA 2C7GA 2YG3A 2WU2A 3ICSA 3PVCA 3JSKA 3IHGA 2WU5A 1PBFA 3D1CA 2BS3A 3QJ4A 4H4TA 5JCMA 2C3CA 2QA2A 1IUWA 4II3A 3VRAA 2WP9A 3ABVA 2X3NA 3M12A 1S3EA 3NK0X 1L0VA 4CY8A 1CF3A 3F8PA 3CPHG 1Y0PA 4TM0A 1XANA 4H2NA 4H2QA 4OPUA 2UZZA 2C70A 1TDFA 3OZ2A 3AE9A 1ZOVA 2X8GA 3ALLA 3AEAA 3GD3A 5KRQA 4CCQA 4J2WA 4BJZA 3DJJA 3M13A 1OJCA 4YT0A 5C2TA 3GYXA 2C4CA 1ELIA 1NHSA 2YR4A 3HYWA 2Z5YA 1E39A 2VZ2A 2XCGA 3G5SA 2YLTA 1JOAA 4YTMA 5LV9A 3KVEA 4U8KA 3SZFA 3DK8A 4TLZA 4EIQA 3AE3A 4AOSA 3UCLA 3NNEA 3LADA 4ICYA 2BXSA 4KPRA 4U8JA 4EQRA 1FOHA 4Z24A 4Z44A 4Z2TA 2NVKX 1QLBA 4O5QA 3K7TA 4EQXA 5BUKA 2QAEA 1BGNA 2BC1A 2JK6A 4XXGA 1CJ3A 4K22A 3AE4A 2XFNA 3NN0X 4OPIA 3NHOX 5KMQA 3T37A 4B69A 2VOUA 2YVJA 3NGCX 1GREA 3EANA 4YSXA 1L9EA 3CNPA 2VRLA 3LOVA 3BI2A 2E5VA 3AD7B 3NTAA 1H82A 2B9WA 1XDIA 3BHKA 2VVLA 1PXBA 3G5RA 4CNKA 3P4QA 1EL9A 3CPJG 4MJWA 5U25A 1NPXA 4JNQA 2WDQA 3QVPA 5HYMA 1UKVG 4NEVA 4PAAA 2Q0LA 4HA6A 1GETA 1BGJA 3GYIA 3ICTA 1D5TA 2I0ZA 1O94A 2B9XA 4WX1A 1X31B 2WOVA 1M64A 4G73A 4H4XA 4A99A 3HZLA 3T0KA 2EQ7A 1IUUA 1PJ7A 2R0CA 3AWIA 3K7MX 3GDNA 1TYTA 4RSLA 4D03A 1LTXR 1FECA 3NYFA 5C3JA 4J36A 2YR6A 2VVMA 3AB1A 4E0VA 2JB1A 1TDEA 1ZX9A 3UKLA 3NRNA 2BABA 2EQ8A 3FBSA 2WHDA 3C96A 2V3BA 3GRSA 1YQZA 2XLTA 3URHA 1CJCA 1EBDA 1M6IA 3GMCA 2WBAA 1XPQA 1DOEA 3BI4A 3AYLA 1QJDA 3G5QA 3II4A 4U8MA 3UOXA 2H88A 1AOGA 1COYA 4IA6A 4JY2A 2ZBWA 1H7WA 2GR2A 3ALJA 3V76A 4BK3A 5J60A 5DBJA 4YSYA 1HYUA 4K7ZA 4TLXA 1H6VA 2B7RA 4J33A 4HB9A 4USRA 5L46A 4BJYA 3F8RA 3K30A 2BRYA 1TRBA 2H89A 3DJGX 1NG3A 2XLPA 4GF7A 2CDUA 3I6DA 4NZHA 2YLSA 4IVOB 1FEAA 3IWAA 3AEEA 2XFPA 4NTDA 2VRMA 3UOVA 3L8KA 1DNCA 1N4UA 4J34A 4OPLA 1GEUA 3VR9A 3FMWA 4J31A 2Y6QA 4EQSA 2IVDA 5KVHA 1GRAA 2XFQA 1O5WA 3CNDA 4GDEA 3NLCA 2VQBA 1KSUA 2RGHA 3OC4A 1PBCA 3BHFA 3GRTA 5U63A 2YLRA 2YG6A 4H2RA 3SZ0A 1ZP0A 2WDVA 2AAQA 2YR5A 3C4AA 4GAVA 3CGDA 3LZWA 4UP3A 3UTEA 1OJAA 4G74A 2GR3A 4U8NA 4NNJA 1DJQA 1PXCA 1Q9IA 2B9YA 3GD4A 2AQJA 4A7AA 4B65A 1JNRA 1GSNA 4B63A 1ZY8A 2XVHA 3ADAB 3T2KA 1E1KA 4UDRA 3H4KA 2ARDA 2R45A 3LXDA 5FS8A 4C77A 1TDOA 2GH5A 4BURA 3NH3X 1PDHA 3FPZA 2WOIA 2X8HA 2ZZBA 1JRYA 3AEGA 1NHRA 4D04A 3QSSA 5KOXA 5KMRA 3SFEA 1PJ5A 1XHCA 3P1WA 4ZN0A 3P4SA 3DGZA 3LB8A 2E1MA 4U2SA 1PBBA 1GOSA 3UKPA 1BKWA 2Q7VA 2YVGA 1GNDA 3P9UA 2WS3A 4H4QA 2BC0A 3P4PA 3AE2A 3ZDNA 5HY5A 4ZCCA 1BZLA 1NHPA 3QFAA 1K0IA 3CIRA 3UOYA 2XLUA 1S2YA 2ZZCA 1F6MA 1B5QA 3HYVA 4X4JA 1GTEA 3NYEA 4B64A 4NTCA 2GF3A 2ZZ0A 3IC9A 4PABA 4USQA 2YQUA 1PXAA 2A87A 1H84A 4Y4LA 3AD9B 4BK2A 4EQWA 1GPEA 1GV4A 3T2ZA 3NK2X 3UKHA 1KF6A 4JDRA 5HXIA 3SXIA 4RG4A 4CCRA 5EB5A 3F8DA 1H86A 2XFOA 2VQ7A 1LQTA 1CBOA 2QA1A 3DK4A 4GCMA 5KNLA 1B8SA 2YM2A 4AT0A 4RG3A 4UDQA 3CGCA 3QSEA 3D8XA 3NKSA 1Q1RA 2BRAA 2OLOA 5KWFA 4ZCDA 1OJ9A 2BK4A 4A79A 4FK1A 1D4CA 3DK9A 2CULA 2ACZA 3AXBA 4JNAA 2R4JA 4K5RA 1D7YA 3WE0A 4REKA 2BCGG 3KD9A 4IA5A 3UTHA 1OJDA 1EL5A 5KOWA 3VRBA 3AE1A 1Y56A 1P2HA 3GMBA 1B4VA 2V5ZA 4BV6A 2OLNA 2XLSA 3SY4A 5BVAA 2TMDA 4A6NB 4H4ZA 1CL0A 3Q6JA 3EPTA 1D7LA 3M0OA 3AEFA 4AT2A 1ZDLA 4EIPA 2WETA 4OVIA 5JCIA 3NYCA 3EF6A 2DKIA 3NIXA 2GR1A 2BXRA 2WPFA 4EMIA 3VQRA 2IIDA 2JBVA 2RGJA 2C73A 4H7UA 4ADWA 2BACA 1ZMCA 1GXFA 2CFYA 4EMWA 2IVEA 2WEUA 2XDOA 4B68A 4UDPA 4LA1A 4OPTA 4Z43A 1GRHA 5M0ZA 2GAHB 1GRTA 2XVJA 2WPEA 3SZCA 4X9MA 3V3OA 3LJPA 4TM3A 4U8OA 3ZYXA 5EBKA 2RGOA 1CC6A 4Z26A 2GR0A 3AEBA 2O9ZA 4K5SA 4APNA 3DJDA 1Y56B 5BULA 1PBDA 1NDAA 3AE7A 3CNTA 4TM1A 3GYJA 2BA9A 1JRXA 1H81A 1Z6LA 3Q9TA 5EOWA 3V3NA 5IPYA 4GUVA 4CRTA 4J57A 2FJAA 4K2XA 5CQFA 3SYIA 2GMJA 1VG0A 3CGEA 3NT6A 1F8RA 2YWLA 1W4XA 4NWZA 1K4QA 1LPFA 1REOA 4H4SA 2BK3A 3B6DA 3FIMB 4NTEA 5M10A 1D4EA 4N9XA 3KU9A 3VRDB 1S2QA 2CVJA 2RABA 2C64A 2V60A 4JQ9A 2FJDA 1VG9A 1N4WA 2PYXA 2R46A 2XVEA 3K7QX 4M52A 3C4NA 3SFDA 2YLXA 4Y4NA 4AP3A 1RP0A 3PO7A 4Y4MA 3NTDA 1E1LA 4JN9A 4FDCB 2QCUA 1PS9A 3AE8A 4A5LA 1JRZA 1H83A 2TPRA 3UKFA 1FCDA 2A8XA 1KDGA 3RNMA 3L1RA 3UOZA 4C74A 3EAOA 4G6GA 5FS7A 1NENA 3VR8A 2V6OA 4A65A 4A6NA 3ITJA 4TM4A 4G9KA 4H4RA 3DH9A 1GRBA 2OA1A 4XWRA 5IQ4A 2C76A 1F3PA 4C5OA 3GSIA 2GV8A 3GWDA 2YVFA 1JNZA 1LVLA 5GRTA 5GSNA 3NG7X 2WPCA 4YSHA 1GERA 5KVIA 4DSHA 4GRTA 3T14A 4IV9A 2Q6UA 3CGBA 4B66A 3QVRA 4YKGA 3REDA 1FL2A 2WOWA 5JCKA 2V3AA 3PS9A 5J7XA 2WESA 2YLWA 1TDNA 1TYPA 2XVIA 1KFYA 3O0HA 4YTNA 3COXA 3SGLA 1DOCA 4GDPA 4CY6A 1CJ2A 1IJHA 4LU6A 4U8IA 2OALA 3GDPA 3UTGA 3CNSA 1BWCA 4H50A 4I59A 2WP5A 3ISHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBW A;  1E6E A;  1F8W A;  4O5U A;  1NEK A;  1N1P A;  2X8C A;  3I3L A;  1CJ4 A;  4X9N A;  4YSZ A;  4FK1 C;  1NHQ A;  2C75 A;  1DOB A;  2OAM A;  3H8I A;  4LII A;  1JEH A;  4DGK A;  1JU2 A;  3AYI A;  2R9Z A;  2VVL G;  1P2E A;  4H2P A;  2GAG B;  2C67 A;  1H7X A;  1KSS A;  1V59 A;  3QSM A;  3ALM A;  3AD8 B;  4OPD A;  2JKC A;  4ECH A;  2JB2 A;  3AE6 A;  1DJN A;  3KA7 A;  1LQU A;  1CC2 A;  1FEB A;  2XVF A;  3ATQ A;  3RP6 A;  3UKQ A;  2DKH A;  4CNJ A;  1BF3 A;  4KX6 A;  4C3Y A;  1MOK A;  1N4V A;  3S61 A;  2V61 A;  2WP6 A;  1LJ1 A;  1VQW A;  3H8L A;  4YWO A;  3SM8 A;  3E1T A;  5FMH A;  3BNM A;  2XFU A;  1F8S A;  1K0J A;  1EL7 A;  2YG7 A;  2NPX A;  2YG4 A;  2WDR A;  4OCG A;  1GRG A;  1GT8 A;  1YQ3 A;  2BK5 A;  4H4U A;  2X50 A;  3GWF A;  1ZOY A;  4FX9 A;  1DOD A;  1IUX A;  1L9D A;  1O95 A;  2Q0K A;  1PN0 A;  3NK1 X;  1RYI A;  3CTY A;  1IUT A;  1NAA A;  2WQY A;  1L9C A;  4OPC A;  4XWZ A;  2W0H A;  2E4G A;  2C66 A;  2GB0 A;  4AP1 A;  1E1N A;  2BYB A;  2FJB A;  1DXL A;  3BI5 A;  3P4R A;  4K8D A;  4U8P A;  5FS9 A;  2BS2 A;  3BNU A;  3CN8 A;  4U2L A;  2EQ9 A;  3SQP A;  1MXT A;  2B7S A;  1PJ6 A;  4IVM B;  3UKK A;  3IF9 A;  2FJE A;  2A89 A;  2EQ6 A;  1RSG A;  4U2T A;  2C3D A;  3NN6 X;  1PBE A;  4P9S A;  1GAL A;  1E1M A;  1Q1W A;  2BS4 A;  2Y6R A;  4OPG A;  5ER0 A;  4Z2R A;  1VDC A;  5U1O A;  3UTF A;  2GMH A;  4H4Y A;  1GTH A;  1ZK7 A;  4H4W A;  2JAE A;  2AR8 A;  4YXD A;  4DNA A;  5EB4 A;  1CHU A;  4B1B A;  3KLJ A;  5HHF A;  1KNR A;  5BRT A;  1NG4 A;  1S3B A;  1YQ4 A;  1IUS A;  4A9W A;  4DSG A;  1B37 A;  4JY3 A;  3R9U A;  3CPI G;  1YKJ A;  2PHH A;  2XYO A;  1GES A;  3ATR A;  4AOX A;  2GRT A;  4BK1 A;  4EM4 A;  2APG A;  2XLR A;  2YLZ A;  4YKF A;  1KNP A;  4H4V A;  2X99 A;  4J56 A;  3DME A;  3ICR A;  3S5W A;  3UKA A;  4Z25 A;  3DA1 A;  3UP5 A;  3FG2 P;  1D4D A;  5FS6 A;  3QFB A;  2GQF A;  1TDK A;  4Z2U A;  5JCN A;  3CNJ A;  2R0G A;  4U8L A;  1LV0 A;  3KKJ A;  1OJT A;  2Z5X A;  1ZMD A;  2R4E A;  3KPF A;  3AEC A;  2YG5 A;  4WCT A;  2YAU A;  4CBQ A;  2R0P A;  4EMJ A;  3RP8 A;  4NEW A;  3IHM A;  3B3R A;  2B76 A;  4I58 A;  5TR3 A;  5KXJ A;  2GQW A;  2J3N A;  1IUV A;  5IQ1 A;  2GVC A;  3DJE A;  3LZX A;  3AED A;  4EM3 A;  1K0L A;  1ZKQ A;  1MO9 A;  1VRQ B;  2BCP A;  1SEZ A;  4H4P A;  2JB3 A;  1CC4 A;  3RHA A;  3UP4 A;  2GEW A;  1YY5 A;  4GR1 A;  1ONF A;  4YTP A;  1GRF A;  5CKU A;  4B67 A;  1EL8 A;  2C65 A;  3AYJ A;  2YM1 A;  4C3X A;  2HQM A;  1QO8 A;  1E7P A;  2C72 A;  3AE5 A;  3RP7 A;  2F5Z A;  1PHH A;  5JCL A;  3DGH A;  2C7G A;  2YG3 A;  2WU2 A;  3ICS A;  3PVC A;  3JSK A;  3IHG A;  2WU5 A;  1PBF A;  3D1C A;  2BS3 A;  3QJ4 A;  4H4T A;  5JCM A;  2C3C A;  2QA2 A;  1IUW A;  3VRA A;  2WP9 A;  3ABV A;  2X3N A;  3M12 A;  1S3E A;  3NK0 X;  1L0V A;  4CY8 A;  1CF3 A;  3F8P A;  3CPH G;  1Y0P A;  4TM0 A;  1XAN A;  4H2N A;  4H2Q A;  4OPU A;  2UZZ A;  2C70 A;  1TDF A;  3OZ2 A;  3AE9 A;  1ZOV A;  2X8G A;  3ALL A;  3AEA A;  3GD3 A;  5KRQ A;  4CCQ A;  4J2W A;  4BJZ A;  3DJJ A;  3M13 A;  1OJC A;  4YT0 A;  5C2T A;  1ELI A;  1NHS A;  2YR4 A;  2Z5Y A;  1E39 A;  2VZ2 A;  2XCG A;  3G5S A;  2YLT A;  1JOA A;  4YTM A;  5LV9 A;  3KVE A;  4U8K A;  3DK8 A;  4TLZ A;  4EIQ A;  3AE3 A;  4AOS A;  3UCL A;  3NNE A;  3LAD A;  4ICY A;  2BXS A;  4KPR A;  4U8J A;  4EQR A;  1FOH A;  4Z24 A;  4Z44 A;  4Z2T A;  2NVK X;  1QLB A;  4O5Q A;  3K7T A;  4EQX A;  5BUK A;  2QAE A;  1BGN A;  2BC1 A;  2JK6 A;  4XXG A;  1CJ3 A;  4K22 A;  3AE4 A;  2XFN A;  3NN0 X;  4OPI A;  3NHO X;  3T37 A;  4B69 A;  2VOU A;  2YVJ A;  3NGC X;  1GRE A;  3EAN A;  4YSX A;  1L9E A;  3CNP A;  2VRL A;  3LOV A;  3BI2 A;  2E5V A;  3AD7 B;  3NTA A;  1H82 A;  2B9W A;  1XDI A;  3BHK A;  2VVL A;  1PXB A;  3G5R A;  4CNK A;  3P4Q A;  1EL9 A;  3CPJ G;  4MJW A;  5U25 A;  1NPX A;  4JNQ A;  2WDQ A;  3QVP A;  5HYM A;  1UKV G;  4NEV A;  4PAA A;  2Q0L A;  4HA6 A;  1GET A;  1BGJ A;  3GYI A;  3ICT A;  1D5T A;  2I0Z A;  1O94 A;  2B9X A;  4WX1 A;  1X31 B;  2WOV A;  1M64 A;  4H4X A;  4A99 A;  3HZL A;  2EQ7 A;  1IUU A;  1PJ7 A;  2R0C A;  3AWI A;  3K7M X;  3GDN A;  1TYT A;  4RSL A;  4D03 A;  1LTX R;  1FEC A;  3NYF A;  5C3J A;  4J36 A;  2YR6 A;  2VVM A;  3AB1 A;  4E0V A;  2JB1 A;  1TDE A;  1ZX9 A;  3UKL A;  3NRN A;  2BAB A;  2EQ8 A;  3FBS A;  2WHD A;  3C96 A;  2V3B A;  3GRS A;  1YQZ A;  2XLT A;  3URH A;  1CJC A;  1EBD A;  1M6I A;  3GMC A;  2WBA A;  1XPQ A;  1DOE A;  3BI4 A;  3AYL A;  1QJD A;  3G5Q A;  3II4 A;  4U8M A;  3UOX A;  2H88 A;  1AOG A;  1COY A;  4IA6 A;  4JY2 A;  2ZBW A;  1H7W A;  2GR2 A;  3ALJ A;  3V76 A;  4BK3 A;  5J60 A;  5DBJ A;  4YSY A;  1HYU A;  4K7Z A;  4TLX A;  1H6V A;  2B7R A;  4J33 A;  4HB9 A;  4USR A;  5L46 A;  4BJY A;  3F8R A;  3K30 A;  1TRB A;  2H89 A;  3DJG X;  1NG3 A;  2XLP A;  4GF7 A;  2CDU A;  3I6D A;  4NZH A;  2YLS A;  4IVO B;  1FEA A;  3IWA A;  3AEE A;  2XFP A;  4NTD A;  2VRM A;  3UOV A;  3L8K A;  1DNC A;  1N4U A;  4J34 A;  4OPL A;  1GEU A;  3VR9 A;  3FMW A;  4J31 A;  2Y6Q A;  4EQS A;  2IVD A;  5KVH A;  1GRA A;  2XFQ A;  1O5W A;  3CND A;  4GDE A;  3NLC A;  2VQB A;  1KSU A;  2RGH A;  3OC4 A;  1PBC A;  3BHF A;  3GRT A;  5U63 A;  2YLR A;  2YG6 A;  4H2R A;  1ZP0 A;  2WDV A;  2AAQ A;  2YR5 A;  3C4A A;  4UP3 A;  3CGD A;  3LZW A;  3UTE A;  1OJA A;  2GR3 A;  4U8N A;  1DJQ A;  1PXC A;  1Q9I A;  2B9Y A;  3GD4 A;  2AQJ A;  4A7A A;  4B65 A;  1JNR A;  1GSN A;  4B63 A;  1ZY8 A;  2XVH A;  3ADA B;  1E1K A;  4UDR A;  3H4K A;  2ARD A;  2R45 A;  3LXD A;  5FS8 A;  4C77 A;  1TDO A;  2GH5 A;  4BUR A;  3NH3 X;  1PDH A;  3FPZ A;  2WOI A;  2X8H A;  2ZZB A;  1JRY A;  3AEG A;  1NHR A;  4D04 A;  3QSS A;  5KOX A;  3SFE A;  1PJ5 A;  1XHC A;  3P1W A;  4ZN0 A;  3P4S A;  3DGZ A;  3LB8 A;  2E1M A;  4U2S A;  1PBB A;  1GOS A;  3UKP A;  1BKW A;  2Q7V A;  2YVG A;  1GND A;  3P9U A;  2WS3 A;  4H4Q A;  2BC0 A;  3P4P A;  3AE2 A;  3ZDN A;  5HY5 A;  4ZCC A;  1BZL A;  1NHP A;  3QFA A;  1K0I A;  3CIR A;  3UOY A;  2XLU A;  1S2Y A;  2ZZC A;  1F6M A;  1B5Q A;  4X4J A;  4B64 A;  1GTE A;  3NYE A;  4NTC A;  2GF3 A;  2ZZ0 A;  3IC9 A;  4PAB A;  4USQ A;  2YQU A;  1PXA A;  2A87 A;  1H84 A;  4Y4L A;  3AD9 B;  4BK2 A;  4EQW A;  1GPE A;  1GV4 A;  3UKH A;  3NK2 X;  1KF6 A;  4JDR A;  5HXI A;  4RG4 A;  4CCR A;  5EB5 A;  3F8D A;  1H86 A;  2XFO A;  2VQ7 A;  1LQT A;  1CBO A;  2QA1 A;  3DK4 A;  4GCM A;  1B8S A;  2YM2 A;  4AT0 A;  4RG3 A;  4UDQ A;  3CGC A;  3QSE A;  3D8X A;  3NKS A;  1Q1R A;  2OLO A;  5KWF A;  4ZCD A;  1OJ9 A;  2BK4 A;  4A79 A;  4FK1 A;  1D4C A;  3DK9 A;  2CUL A;  2ACZ A;  3AXB A;  4JNA A;  2R4J A;  4K5R A;  1D7Y A;  3WE0 A;  4REK A;  2BCG G;  3KD9 A;  4IA5 A;  3UTH A;  1OJD A;  1EL5 A;  5KOW A;  3VRB A;  3AE1 A;  1Y56 A;  1P2H A;  3GMB A;  1B4V A;  2V5Z A;  4BV6 A;  2OLN A;  2XLS A;  5BVA A;  2TMD A;  4A6N B;  4H4Z A;  1CL0 A;  3Q6J A;  3EPT A;  1D7L A;  3M0O A;  3AEF A;  4AT2 A;  1ZDL A;  4EIP A;  2WET A;  4OVI A;  5JCI A;  3NYC A;  3EF6 A;  2DKI A;  3NIX A;  2GR1 A;  2BXR A;  2WPF A;  4EMI A;  3VQR A;  2IID A;  2JBV A;  2RGJ A;  2C73 A;  4H7U A;  4ADW A;  2BAC A;  1ZMC A;  1GXF A;  2CFY A;  4EMW A;  2IVE A;  2WEU A;  2XDO A;  4B68 A;  4UDP A;  4LA1 A;  4OPT A;  4Z43 A;  1GRH A;  5M0Z A;  2GAH B;  1GRT A;  2XVJ A;  2WPE A;  4X9M A;  3V3O A;  3LJP A;  4TM3 A;  4U8O A;  3ZYX A;  5EBK A;  2RGO A;  1CC6 A;  4Z26 A;  2GR0 A;  3AEB A;  2O9Z A;  4K5S A;  4APN A;  3DJD A;  1Y56 B;  5BUL A;  1PBD A;  1NDA A;  3AE7 A;  3CNT A;  4TM1 A;  3GYJ A;  2BA9 A;  1JRX A;  1H81 A;  1Z6L A;  3Q9T A;  5EOW A;  3V3N A;  5IPY A;  4GUV A;  4CRT A;  4J57 A;  2FJA A;  4K2X A;  5CQF A;  2GMJ A;  1VG0 A;  3CGE A;  3NT6 A;  1F8R A;  2YWL A;  1W4X A;  1K4Q A;  1LPF A;  1REO A;  4H4S A;  2BK3 A;  3B6D A;  3FIM B;  4NTE A;  5M10 A;  1D4E A;  4N9X A;  3KU9 A;  3VRD B;  1S2Q A;  2CVJ A;  2RAB A;  2C64 A;  2V60 A;  4JQ9 A;  2FJD A;  1VG9 A;  1N4W A;  2PYX A;  2R46 A;  2XVE A;  3K7Q X;  4M52 A;  3C4N A;  3SFD A;  2YLX A;  4Y4N A;  4AP3 A;  1RP0 A;  3PO7 A;  4Y4M A;  3NTD A;  1E1L A;  4JN9 A;  4FDC B;  2QCU A;  1PS9 A;  3AE8 A;  4A5L A;  1JRZ A;  1H83 A;  2TPR A;  3UKF A;  1FCD A;  2A8X A;  1KDG A;  3RNM A;  3L1R A;  3UOZ A;  4C74 A;  3EAO A;  5FS7 A;  1NEN A;  3VR8 A;  2V6O A;  4A65 A;  4A6N A;  3ITJ A;  4TM4 A;  4H4R A;  3DH9 A;  1GRB A;  2OA1 A;  4XWR A;  5IQ4 A;  2C76 A;  1F3P A;  4C5O A;  3GSI A;  2GV8 A;  3GWD A;  2YVF A;  1JNZ A;  1LVL A;  5GRT A;  5GSN A;  3NG7 X;  2WPC A;  4YSH A;  1GER A;  5KVI A;  4DSH A;  4GRT A;  4IV9 A;  2Q6U A;  3CGB A;  4B66 A;  3QVR A;  4YKG A;  3RED A;  1FL2 A;  2WOW A;  5JCK A;  2V3A A;  3PS9 A;  5J7X A;  2WES A;  2YLW A;  1TDN A;  1TYP A;  2XVI A;  1KFY A;  3O0H A;  4YTN A;  3COX A;  3SGL A;  1DOC A;  4GDP A;  4CY6 A;  1CJ2 A;  1IJH A;  4LU6 A;  4U8I A;  2OAL A;  3GDP A;  3UTG A;  3CNS A;  1BWC A;  4H50 A;  4I59 A;  2WP5 A;  3ISH A; 
#chains in the Genus database with same CATH topology
 2FBW A;  1E6E A;  1F8W A;  4O5U A;  1NEK A;  1N1P A;  2X8C A;  3I3L A;  1CJ4 A;  4X9N A;  4YSZ A;  4FK1 C;  1NHQ A;  2C75 A;  1DOB A;  2OAM A;  3H8I A;  4LII A;  1JEH A;  4DGK A;  1JU2 A;  3AYI A;  2R9Z A;  2VVL G;  1P2E A;  4H2P A;  2GAG B;  2C67 A;  1H7X A;  1KSS A;  1V59 A;  3QSM A;  4GAP A;  3ALM A;  3AD8 B;  4OPD A;  2JKC A;  4ECH A;  2JB2 A;  3AE6 A;  1DJN A;  3KA7 A;  1LQU A;  1CC2 A;  1FEB A;  2XVF A;  3ATQ A;  3RP6 A;  3T2Y A;  2DKH A;  3UKQ A;  4CNJ A;  1BF3 A;  4KX6 A;  4C3Y A;  1MOK A;  1N4V A;  3S61 A;  2V61 A;  2WP6 A;  1LJ1 A;  1VQW A;  3H8L A;  4YWO A;  3SM8 A;  3E1T A;  5FMH A;  3BNM A;  2XFU A;  1F8S A;  1K0J A;  1EL7 A;  2YG7 A;  2NPX A;  2YG4 A;  2WDR A;  3SX6 A;  4OCG A;  1GRG A;  1GT8 A;  1YQ3 A;  2BK5 A;  4H4U A;  3T31 A;  2X50 A;  3GWF A;  1ZOY A;  4FX9 A;  1DOD A;  1IUX A;  1L9D A;  1O95 A;  2Q0K A;  1PN0 A;  3NK1 X;  1RYI A;  3CTY A;  1IUT A;  1NAA A;  2WQY A;  1L9C A;  4OPC A;  4XWZ A;  2W0H A;  2E4G A;  2C66 A;  2GB0 A;  4AP1 A;  1E1N A;  2BYB A;  2FJB A;  1DXL A;  3BI5 A;  3P4R A;  4K8D A;  4U8P A;  5FS9 A;  2BS2 A;  3BNU A;  3CN8 A;  3KPK A;  2EQ9 A;  4U2L A;  3SQP A;  1MXT A;  2B7S A;  1PJ6 A;  4IVM B;  3UKK A;  3IF9 A;  3CMM A;  2FJE A;  2A89 A;  2EQ6 A;  4II2 A;  1RSG A;  4U2T A;  2C3D A;  3NN6 X;  1PBE A;  4P9S A;  1GAL A;  1E1M A;  1Q1W A;  2BS4 A;  2Y6R A;  4OPG A;  5ER0 A;  4Z2R A;  1VDC A;  5U1O A;  3UTF A;  2GMH A;  4H4Y A;  1GTH A;  1ZK7 A;  4H4W A;  2JAE A;  2AR8 A;  4YXD A;  4DNA A;  5EB4 A;  1CHU A;  4B1B A;  3KLJ A;  5HHF A;  1KNR A;  5BRT A;  1NG4 A;  1S3B A;  1YQ4 A;  1IUS A;  4A9W A;  4DSG A;  1B37 A;  4JY3 A;  3R9U A;  3CPI G;  1YKJ A;  2PHH A;  2XYO A;  1GES A;  3ATR A;  4AOX A;  2GRT A;  4BK1 A;  4EM4 A;  2APG A;  2XLR A;  2YLZ A;  4YKF A;  1KNP A;  4H4V A;  2X99 A;  4J56 A;  3DME A;  3ICR A;  3S5W A;  3UKA A;  4Z25 A;  3DA1 A;  3UP5 A;  3FG2 P;  1D4D A;  5FS6 A;  3QFB A;  2GQF A;  1TDK A;  4Z2U A;  5JCN A;  3CNJ A;  2R0G A;  4U8L A;  1LV0 A;  3KKJ A;  1OJT A;  2Z5X A;  1ZMD A;  2R4E A;  3KPF A;  3AEC A;  2YG5 A;  4WCT A;  2YAU A;  5KMS A;  4CBQ A;  2R0P A;  4EMJ A;  3RP8 A;  4NEW A;  3IHM A;  3B3R A;  2B76 A;  4I58 A;  5TR3 A;  5KXJ A;  2GQW A;  2J3N A;  1IUV A;  5IQ1 A;  2GVC A;  3DJE A;  3LZX A;  3AED A;  4EM3 A;  1K0L A;  1ZKQ A;  1MO9 A;  1VRQ B;  2BCP A;  1SEZ A;  4H4P A;  2JB3 A;  1CC4 A;  3RHA A;  3UP4 A;  4G6H A;  2GEW A;  1YY5 A;  4GR1 A;  1ONF A;  4YTP A;  5KMP A;  1GRF A;  5CKU A;  4B67 A;  1EL8 A;  2C65 A;  3SZW A;  3AYJ A;  2YM1 A;  4C3X A;  2HQM A;  1QO8 A;  1E7P A;  2C72 A;  3AE5 A;  3HYX A;  2F5Z A;  1PHH A;  3RP7 A;  5JCL A;  3DGH A;  2C7G A;  2YG3 A;  2WU2 A;  3ICS A;  3PVC A;  3JSK A;  3IHG A;  2WU5 A;  1PBF A;  3D1C A;  2BS3 A;  3QJ4 A;  4H4T A;  5JCM A;  2C3C A;  2QA2 A;  1IUW A;  4II3 A;  3VRA A;  2WP9 A;  3ABV A;  2X3N A;  3M12 A;  1S3E A;  3NK0 X;  1L0V A;  4CY8 A;  1CF3 A;  3F8P A;  3CPH G;  1Y0P A;  4TM0 A;  1XAN A;  4H2N A;  4H2Q A;  4OPU A;  2UZZ A;  2C70 A;  1TDF A;  3OZ2 A;  3AE9 A;  1ZOV A;  2X8G A;  3ALL A;  3AEA A;  3GD3 A;  5KRQ A;  4CCQ A;  4J2W A;  4BJZ A;  3DJJ A;  3M13 A;  1OJC A;  4YT0 A;  5C2T A;  3GYX A;  2C4C A;  1ELI A;  1NHS A;  2YR4 A;  3HYW A;  2Z5Y A;  1E39 A;  2VZ2 A;  2XCG A;  3G5S A;  2YLT A;  1JOA A;  4YTM A;  5LV9 A;  3KVE A;  4U8K A;  3SZF A;  3DK8 A;  4TLZ A;  4EIQ A;  3AE3 A;  4AOS A;  3UCL A;  3NNE A;  3LAD A;  4ICY A;  2BXS A;  4KPR A;  4U8J A;  4EQR A;  1FOH A;  4Z24 A;  4Z44 A;  4Z2T A;  2NVK X;  1QLB A;  4O5Q A;  3K7T A;  4EQX A;  5BUK A;  2QAE A;  1BGN A;  2BC1 A;  2JK6 A;  4XXG A;  1CJ3 A;  4K22 A;  3AE4 A;  2XFN A;  3NN0 X;  4OPI A;  3NHO X;  5KMQ A;  3T37 A;  4B69 A;  2VOU A;  2YVJ A;  3NGC X;  1GRE A;  3EAN A;  4YSX A;  1L9E A;  3CNP A;  2VRL A;  3LOV A;  3BI2 A;  2E5V A;  3AD7 B;  3NTA A;  1H82 A;  2B9W A;  1XDI A;  3BHK A;  2VVL A;  1PXB A;  3G5R A;  4CNK A;  3P4Q A;  1EL9 A;  3CPJ G;  4MJW A;  5U25 A;  1NPX A;  4JNQ A;  2WDQ A;  3QVP A;  5HYM A;  1UKV G;  4NEV A;  4PAA A;  2Q0L A;  4HA6 A;  1GET A;  1BGJ A;  3GYI A;  3ICT A;  1D5T A;  2I0Z A;  1O94 A;  2B9X A;  4WX1 A;  1X31 B;  2WOV A;  1M64 A;  4G73 A;  4H4X A;  4A99 A;  3HZL A;  3T0K A;  2EQ7 A;  1IUU A;  1PJ7 A;  2R0C A;  3AWI A;  3K7M X;  3GDN A;  1TYT A;  4RSL A;  4D03 A;  1LTX R;  1FEC A;  3NYF A;  5C3J A;  4J36 A;  2YR6 A;  2VVM A;  3AB1 A;  4E0V A;  2JB1 A;  1TDE A;  1ZX9 A;  3UKL A;  3NRN A;  2BAB A;  2EQ8 A;  3FBS A;  2WHD A;  3C96 A;  2V3B A;  3GRS A;  1YQZ A;  2XLT A;  3URH A;  1CJC A;  1EBD A;  1M6I A;  3GMC A;  2WBA A;  1XPQ A;  1DOE A;  3BI4 A;  3AYL A;  1QJD A;  3G5Q A;  3II4 A;  4U8M A;  3UOX A;  2H88 A;  1AOG A;  1COY A;  4IA6 A;  4JY2 A;  2ZBW A;  1H7W A;  2GR2 A;  3ALJ A;  3V76 A;  4BK3 A;  5J60 A;  5DBJ A;  4YSY A;  1HYU A;  4K7Z A;  4TLX A;  1H6V A;  2B7R A;  4J33 A;  4HB9 A;  4USR A;  5L46 A;  4BJY A;  3F8R A;  3K30 A;  2BRY A;  1TRB A;  2H89 A;  3DJG X;  1NG3 A;  2XLP A;  4GF7 A;  2CDU A;  3I6D A;  4NZH A;  2YLS A;  4IVO B;  1FEA A;  3IWA A;  3AEE A;  2XFP A;  4NTD A;  2VRM A;  3UOV A;  3L8K A;  1DNC A;  1N4U A;  4J34 A;  4OPL A;  1GEU A;  3VR9 A;  3FMW A;  4J31 A;  2Y6Q A;  4EQS A;  2IVD A;  5KVH A;  1GRA A;  2XFQ A;  1O5W A;  3CND A;  4GDE A;  3NLC A;  2VQB A;  1KSU A;  2RGH A;  3OC4 A;  1PBC A;  3BHF A;  3GRT A;  5U63 A;  2YLR A;  2YG6 A;  4H2R A;  3SZ0 A;  1ZP0 A;  2WDV A;  2AAQ A;  2YR5 A;  3C4A A;  4GAV A;  3CGD A;  3LZW A;  4UP3 A;  3UTE A;  1OJA A;  4G74 A;  2GR3 A;  4U8N A;  4NNJ A;  1DJQ A;  1PXC A;  1Q9I A;  2B9Y A;  3GD4 A;  2AQJ A;  4A7A A;  4B65 A;  1JNR A;  1GSN A;  4B63 A;  1ZY8 A;  2XVH A;  3ADA B;  3T2K A;  1E1K A;  4UDR A;  3H4K A;  2ARD A;  2R45 A;  3LXD A;  5FS8 A;  4C77 A;  1TDO A;  2GH5 A;  4BUR A;  3NH3 X;  1PDH A;  3FPZ A;  2WOI A;  2X8H A;  2ZZB A;  1JRY A;  3AEG A;  1NHR A;  4D04 A;  3QSS A;  5KOX A;  5KMR A;  3SFE A;  1PJ5 A;  1XHC A;  3P1W A;  4ZN0 A;  3P4S A;  3DGZ A;  3LB8 A;  2E1M A;  4U2S A;  1PBB A;  1GOS A;  3UKP A;  1BKW A;  2Q7V A;  2YVG A;  1GND A;  3P9U A;  2WS3 A;  4H4Q A;  2BC0 A;  3P4P A;  3AE2 A;  3ZDN A;  5HY5 A;  4ZCC A;  1BZL A;  1NHP A;  3QFA A;  1K0I A;  3CIR A;  3UOY A;  2XLU A;  1S2Y A;  2ZZC A;  1F6M A;  1B5Q A;  3HYV A;  4X4J A;  1GTE A;  3NYE A;  4B64 A;  4NTC A;  2GF3 A;  2ZZ0 A;  3IC9 A;  4PAB A;  4USQ A;  2YQU A;  1PXA A;  2A87 A;  1H84 A;  4Y4L A;  3AD9 B;  4BK2 A;  4EQW A;  1GPE A;  1GV4 A;  3T2Z A;  3NK2 X;  3UKH A;  1KF6 A;  4JDR A;  5HXI A;  3SXI A;  4RG4 A;  4CCR A;  5EB5 A;  3F8D A;  1H86 A;  2XFO A;  2VQ7 A;  1LQT A;  1CBO A;  2QA1 A;  3DK4 A;  4GCM A;  5KNL A;  1B8S A;  2YM2 A;  4AT0 A;  4RG3 A;  4UDQ A;  3CGC A;  3QSE A;  3D8X A;  3NKS A;  1Q1R A;  2BRA A;  2OLO A;  5KWF A;  4ZCD A;  1OJ9 A;  2BK4 A;  4A79 A;  4FK1 A;  1D4C A;  3DK9 A;  2CUL A;  2ACZ A;  3AXB A;  4JNA A;  2R4J A;  4K5R A;  1D7Y A;  3WE0 A;  4REK A;  2BCG G;  3KD9 A;  4IA5 A;  3UTH A;  1OJD A;  1EL5 A;  5KOW A;  3VRB A;  3AE1 A;  1Y56 A;  1P2H A;  3GMB A;  1B4V A;  2V5Z A;  4BV6 A;  2OLN A;  2XLS A;  3SY4 A;  5BVA A;  2TMD A;  4A6N B;  4H4Z A;  1CL0 A;  3Q6J A;  3EPT A;  1D7L A;  3M0O A;  3AEF A;  4AT2 A;  1ZDL A;  4EIP A;  2WET A;  4OVI A;  5JCI A;  3NYC A;  3EF6 A;  2DKI A;  3NIX A;  2GR1 A;  2BXR A;  2WPF A;  4EMI A;  3VQR A;  2IID A;  2JBV A;  2RGJ A;  2C73 A;  4H7U A;  4ADW A;  2BAC A;  1ZMC A;  1GXF A;  2CFY A;  4EMW A;  2IVE A;  2WEU A;  2XDO A;  4B68 A;  4UDP A;  4LA1 A;  4OPT A;  4Z43 A;  1GRH A;  5M0Z A;  2GAH B;  1GRT A;  2XVJ A;  2WPE A;  3SZC A;  4X9M A;  3V3O A;  3LJP A;  4TM3 A;  4U8O A;  3ZYX A;  5EBK A;  2RGO A;  1CC6 A;  4Z26 A;  2GR0 A;  3AEB A;  2O9Z A;  4K5S A;  4APN A;  3DJD A;  1Y56 B;  5BUL A;  1PBD A;  1NDA A;  3AE7 A;  3CNT A;  4TM1 A;  3GYJ A;  2BA9 A;  1JRX A;  1H81 A;  1Z6L A;  3Q9T A;  5EOW A;  3V3N A;  5IPY A;  4GUV A;  4CRT A;  4J57 A;  2FJA A;  4K2X A;  5CQF A;  3SYI A;  2GMJ A;  1VG0 A;  3CGE A;  3NT6 A;  1F8R A;  2YWL A;  1W4X A;  4NWZ A;  1K4Q A;  1LPF A;  1REO A;  4H4S A;  2BK3 A;  3B6D A;  3FIM B;  4NTE A;  5M10 A;  1D4E A;  4N9X A;  3KU9 A;  3VRD B;  1S2Q A;  2CVJ A;  2RAB A;  2C64 A;  2V60 A;  4JQ9 A;  2FJD A;  1VG9 A;  1N4W A;  2PYX A;  2R46 A;  2XVE A;  3K7Q X;  4M52 A;  3C4N A;  3SFD A;  2YLX A;  4Y4N A;  4AP3 A;  1RP0 A;  3PO7 A;  4Y4M A;  3NTD A;  1E1L A;  4JN9 A;  4FDC B;  2QCU A;  1PS9 A;  3AE8 A;  4A5L A;  1JRZ A;  1H83 A;  2TPR A;  3UKF A;  1FCD A;  2A8X A;  1KDG A;  3RNM A;  3L1R A;  3UOZ A;  4C74 A;  3EAO A;  4G6G A;  5FS7 A;  1NEN A;  3VR8 A;  2V6O A;  4A65 A;  4A6N A;  3ITJ A;  4TM4 A;  4G9K A;  4H4R A;  3DH9 A;  1GRB A;  2OA1 A;  4XWR A;  5IQ4 A;  2C76 A;  1F3P A;  4C5O A;  3GSI A;  2GV8 A;  3GWD A;  2YVF A;  1JNZ A;  1LVL A;  5GRT A;  5GSN A;  3NG7 X;  2WPC A;  4YSH A;  1GER A;  5KVI A;  4DSH A;  4GRT A;  3T14 A;  4IV9 A;  2Q6U A;  3CGB A;  4B66 A;  3QVR A;  4YKG A;  3RED A;  1FL2 A;  2WOW A;  5JCK A;  2V3A A;  3PS9 A;  5J7X A;  2WES A;  2YLW A;  1TDN A;  1TYP A;  2XVI A;  1KFY A;  3O0H A;  4YTN A;  3COX A;  3SGL A;  1DOC A;  4GDP A;  4CY6 A;  1CJ2 A;  1IJH A;  4LU6 A;  4U8I A;  2OAL A;  3GDP A;  3UTG A;  3CNS A;  1BWC A;  4H50 A;  4I59 A;  2WP5 A;  3ISH A; 
#chains in the Genus database with same CATH homology
 2FBW A;  1E6E A;  1F8W A;  4O5U A;  1NEK A;  1N1P A;  2X8C A;  3I3L A;  1CJ4 A;  4X9N A;  4YSZ A;  4FK1 C;  1NHQ A;  2C75 A;  1DOB A;  2OAM A;  3H8I A;  4LII A;  1JEH A;  4DGK A;  1JU2 A;  3AYI A;  2R9Z A;  2VVL G;  1P2E A;  4H2P A;  2GAG B;  2C67 A;  1H7X A;  1KSS A;  1V59 A;  3QSM A;  4GAP A;  3ALM A;  3AD8 B;  4OPD A;  2JKC A;  4ECH A;  2JB2 A;  3AE6 A;  1DJN A;  3KA7 A;  1LQU A;  1CC2 A;  1FEB A;  2XVF A;  3ATQ A;  3RP6 A;  3T2Y A;  2DKH A;  3UKQ A;  4CNJ A;  1BF3 A;  4KX6 A;  4C3Y A;  1MOK A;  1N4V A;  3S61 A;  2V61 A;  2WP6 A;  1LJ1 A;  1VQW A;  3H8L A;  4YWO A;  3SM8 A;  3E1T A;  5FMH A;  3BNM A;  2XFU A;  1F8S A;  1K0J A;  1EL7 A;  2YG7 A;  2NPX A;  2YG4 A;  2WDR A;  3SX6 A;  4OCG A;  1GRG A;  1GT8 A;  1YQ3 A;  2BK5 A;  4H4U A;  3T31 A;  2X50 A;  3GWF A;  1ZOY A;  4FX9 A;  1DOD A;  1IUX A;  1L9D A;  1O95 A;  2Q0K A;  1PN0 A;  3NK1 X;  1RYI A;  3CTY A;  1IUT A;  1NAA A;  2WQY A;  1L9C A;  4OPC A;  4XWZ A;  2W0H A;  2E4G A;  2C66 A;  2GB0 A;  4AP1 A;  1E1N A;  2BYB A;  2FJB A;  1DXL A;  3BI5 A;  3P4R A;  4K8D A;  4U8P A;  5FS9 A;  2BS2 A;  3BNU A;  3CN8 A;  3KPK A;  2EQ9 A;  4U2L A;  3SQP A;  1MXT A;  2B7S A;  1PJ6 A;  4IVM B;  3UKK A;  3IF9 A;  3CMM A;  2FJE A;  2A89 A;  2EQ6 A;  4II2 A;  1RSG A;  4U2T A;  2C3D A;  3NN6 X;  1PBE A;  4P9S A;  1GAL A;  1E1M A;  1Q1W A;  2BS4 A;  2Y6R A;  4OPG A;  5ER0 A;  4Z2R A;  1VDC A;  5U1O A;  3UTF A;  2GMH A;  4H4Y A;  1GTH A;  1ZK7 A;  4H4W A;  2JAE A;  2AR8 A;  4YXD A;  4DNA A;  5EB4 A;  1CHU A;  4B1B A;  3KLJ A;  5HHF A;  1KNR A;  5BRT A;  1NG4 A;  1S3B A;  1YQ4 A;  1IUS A;  4A9W A;  4DSG A;  1B37 A;  4JY3 A;  3R9U A;  3CPI G;  1YKJ A;  2PHH A;  2XYO A;  1GES A;  3ATR A;  4AOX A;  2GRT A;  4BK1 A;  4EM4 A;  2APG A;  2XLR A;  2YLZ A;  4YKF A;  1KNP A;  4H4V A;  2X99 A;  4J56 A;  3DME A;  3ICR A;  3S5W A;  3UKA A;  4Z25 A;  3DA1 A;  3UP5 A;  3FG2 P;  1D4D A;  5FS6 A;  3QFB A;  2GQF A;  1TDK A;  4Z2U A;  5JCN A;  3CNJ A;  2R0G A;  4U8L A;  1LV0 A;  3KKJ A;  1OJT A;  2Z5X A;  1ZMD A;  2R4E A;  3KPF A;  3AEC A;  2YG5 A;  4WCT A;  2YAU A;  5KMS A;  4CBQ A;  2R0P A;  4EMJ A;  3RP8 A;  4NEW A;  3IHM A;  3B3R A;  2B76 A;  4I58 A;  5TR3 A;  5KXJ A;  2GQW A;  2J3N A;  1IUV A;  5IQ1 A;  2GVC A;  3DJE A;  3LZX A;  3AED A;  4EM3 A;  1K0L A;  1ZKQ A;  1MO9 A;  1VRQ B;  2BCP A;  1SEZ A;  4H4P A;  2JB3 A;  1CC4 A;  3RHA A;  3UP4 A;  4G6H A;  2GEW A;  1YY5 A;  4GR1 A;  1ONF A;  4YTP A;  5KMP A;  1GRF A;  5CKU A;  4B67 A;  1EL8 A;  2C65 A;  3SZW A;  3AYJ A;  2YM1 A;  4C3X A;  2HQM A;  1QO8 A;  1E7P A;  2C72 A;  3AE5 A;  3HYX A;  2F5Z A;  1PHH A;  3RP7 A;  5JCL A;  3DGH A;  2C7G A;  2YG3 A;  2WU2 A;  3ICS A;  3PVC A;  3JSK A;  3IHG A;  2WU5 A;  1PBF A;  3D1C A;  2BS3 A;  3QJ4 A;  4H4T A;  5JCM A;  2C3C A;  2QA2 A;  1IUW A;  4II3 A;  3VRA A;  2WP9 A;  3ABV A;  2X3N A;  3M12 A;  1S3E A;  3NK0 X;  1L0V A;  4CY8 A;  1CF3 A;  3F8P A;  3CPH G;  1Y0P A;  4TM0 A;  1XAN A;  4H2N A;  4H2Q A;  4OPU A;  2UZZ A;  2C70 A;  1TDF A;  3OZ2 A;  3AE9 A;  1ZOV A;  2X8G A;  3ALL A;  3AEA A;  3GD3 A;  5KRQ A;  4CCQ A;  4J2W A;  4BJZ A;  3DJJ A;  3M13 A;  1OJC A;  4YT0 A;  5C2T A;  3GYX A;  2C4C A;  1ELI A;  1NHS A;  2YR4 A;  3HYW A;  2Z5Y A;  1E39 A;  2VZ2 A;  2XCG A;  3G5S A;  2YLT A;  1JOA A;  4YTM A;  5LV9 A;  3KVE A;  4U8K A;  3SZF A;  3DK8 A;  4TLZ A;  4EIQ A;  3AE3 A;  4AOS A;  3UCL A;  3NNE A;  3LAD A;  4ICY A;  2BXS A;  4KPR A;  4U8J A;  4EQR A;  1FOH A;  4Z24 A;  4Z44 A;  4Z2T A;  2NVK X;  1QLB A;  4O5Q A;  3K7T A;  4EQX A;  5BUK A;  2QAE A;  1BGN A;  2BC1 A;  2JK6 A;  4XXG A;  1CJ3 A;  4K22 A;  3AE4 A;  2XFN A;  3NN0 X;  4OPI A;  3NHO X;  5KMQ A;  3T37 A;  4B69 A;  2VOU A;  2YVJ A;  3NGC X;  1GRE A;  3EAN A;  4YSX A;  1L9E A;  3CNP A;  2VRL A;  3LOV A;  3BI2 A;  2E5V A;  3AD7 B;  3NTA A;  1H82 A;  2B9W A;  1XDI A;  3BHK A;  2VVL A;  1PXB A;  3G5R A;  4CNK A;  3P4Q A;  1EL9 A;  3CPJ G;  4MJW A;  5U25 A;  1NPX A;  4JNQ A;  2WDQ A;  3QVP A;  5HYM A;  1UKV G;  4NEV A;  4PAA A;  2Q0L A;  4HA6 A;  1GET A;  1BGJ A;  3GYI A;  3ICT A;  1D5T A;  2I0Z A;  1O94 A;  2B9X A;  4WX1 A;  1X31 B;  2WOV A;  1M64 A;  4G73 A;  4H4X A;  4A99 A;  3HZL A;  3T0K A;  2EQ7 A;  1IUU A;  1PJ7 A;  2R0C A;  3AWI A;  3K7M X;  3GDN A;  1TYT A;  4RSL A;  4D03 A;  1LTX R;  1FEC A;  3NYF A;  5C3J A;  4J36 A;  2YR6 A;  2VVM A;  3AB1 A;  4E0V A;  2JB1 A;  1TDE A;  1ZX9 A;  3UKL A;  3NRN A;  2BAB A;  2EQ8 A;  3FBS A;  2WHD A;  3C96 A;  2V3B A;  3GRS A;  1YQZ A;  2XLT A;  3URH A;  1CJC A;  1EBD A;  1M6I A;  3GMC A;  2WBA A;  1XPQ A;  1DOE A;  3BI4 A;  3AYL A;  1QJD A;  3G5Q A;  3II4 A;  4U8M A;  3UOX A;  2H88 A;  1AOG A;  1COY A;  4IA6 A;  4JY2 A;  2ZBW A;  1H7W A;  2GR2 A;  3ALJ A;  3V76 A;  4BK3 A;  5J60 A;  5DBJ A;  4YSY A;  1HYU A;  4K7Z A;  4TLX A;  1H6V A;  2B7R A;  4J33 A;  4HB9 A;  4USR A;  5L46 A;  4BJY A;  3F8R A;  3K30 A;  2BRY A;  1TRB A;  2H89 A;  3DJG X;  1NG3 A;  2XLP A;  4GF7 A;  2CDU A;  3I6D A;  4NZH A;  2YLS A;  4IVO B;  1FEA A;  3IWA A;  3AEE A;  2XFP A;  4NTD A;  2VRM A;  3UOV A;  3L8K A;  1DNC A;  1N4U A;  4J34 A;  4OPL A;  1GEU A;  3VR9 A;  3FMW A;  4J31 A;  2Y6Q A;  4EQS A;  2IVD A;  5KVH A;  1GRA A;  2XFQ A;  1O5W A;  3CND A;  4GDE A;  3NLC A;  2VQB A;  1KSU A;  2RGH A;  3OC4 A;  1PBC A;  3BHF A;  3GRT A;  5U63 A;  2YLR A;  2YG6 A;  4H2R A;  3SZ0 A;  1ZP0 A;  2WDV A;  2AAQ A;  2YR5 A;  3C4A A;  4GAV A;  3CGD A;  3LZW A;  4UP3 A;  3UTE A;  1OJA A;  4G74 A;  2GR3 A;  4U8N A;  4NNJ A;  1DJQ A;  1PXC A;  1Q9I A;  2B9Y A;  3GD4 A;  2AQJ A;  4A7A A;  4B65 A;  1JNR A;  1GSN A;  4B63 A;  1ZY8 A;  2XVH A;  3ADA B;  3T2K A;  1E1K A;  4UDR A;  3H4K A;  2ARD A;  2R45 A;  3LXD A;  5FS8 A;  4C77 A;  1TDO A;  2GH5 A;  4BUR A;  3NH3 X;  1PDH A;  3FPZ A;  2WOI A;  2X8H A;  2ZZB A;  1JRY A;  3AEG A;  1NHR A;  4D04 A;  3QSS A;  5KOX A;  5KMR A;  3SFE A;  1PJ5 A;  1XHC A;  3P1W A;  4ZN0 A;  3P4S A;  3DGZ A;  3LB8 A;  2E1M A;  4U2S A;  1PBB A;  1GOS A;  3UKP A;  1BKW A;  2Q7V A;  2YVG A;  1GND A;  3P9U A;  2WS3 A;  4H4Q A;  2BC0 A;  3P4P A;  3AE2 A;  3ZDN A;  5HY5 A;  4ZCC A;  1BZL A;  1NHP A;  3QFA A;  1K0I A;  3CIR A;  3UOY A;  2XLU A;  1S2Y A;  2ZZC A;  1F6M A;  1B5Q A;  3HYV A;  4X4J A;  1GTE A;  3NYE A;  4B64 A;  4NTC A;  2GF3 A;  2ZZ0 A;  3IC9 A;  4PAB A;  4USQ A;  2YQU A;  1PXA A;  2A87 A;  1H84 A;  4Y4L A;  3AD9 B;  4BK2 A;  4EQW A;  1GPE A;  1GV4 A;  3T2Z A;  3NK2 X;  3UKH A;  1KF6 A;  4JDR A;  5HXI A;  3SXI A;  4RG4 A;  4CCR A;  5EB5 A;  3F8D A;  1H86 A;  2XFO A;  2VQ7 A;  1LQT A;  1CBO A;  2QA1 A;  3DK4 A;  4GCM A;  5KNL A;  1B8S A;  2YM2 A;  4AT0 A;  4RG3 A;  4UDQ A;  3CGC A;  3QSE A;  3D8X A;  3NKS A;  1Q1R A;  2BRA A;  2OLO A;  5KWF A;  4ZCD A;  1OJ9 A;  2BK4 A;  4A79 A;  4FK1 A;  1D4C A;  3DK9 A;  2CUL A;  2ACZ A;  3AXB A;  4JNA A;  2R4J A;  4K5R A;  1D7Y A;  3WE0 A;  4REK A;  2BCG G;  3KD9 A;  4IA5 A;  3UTH A;  1OJD A;  1EL5 A;  5KOW A;  3VRB A;  3AE1 A;  1Y56 A;  1P2H A;  3GMB A;  1B4V A;  2V5Z A;  4BV6 A;  2OLN A;  2XLS A;  3SY4 A;  5BVA A;  2TMD A;  4A6N B;  4H4Z A;  1CL0 A;  3Q6J A;  3EPT A;  1D7L A;  3M0O A;  3AEF A;  4AT2 A;  1ZDL A;  4EIP A;  2WET A;  4OVI A;  5JCI A;  3NYC A;  3EF6 A;  2DKI A;  3NIX A;  2GR1 A;  2BXR A;  2WPF A;  4EMI A;  3VQR A;  2IID A;  2JBV A;  2RGJ A;  2C73 A;  4H7U A;  4ADW A;  2BAC A;  1ZMC A;  1GXF A;  2CFY A;  4EMW A;  2IVE A;  2WEU A;  2XDO A;  4B68 A;  4UDP A;  4LA1 A;  4OPT A;  4Z43 A;  1GRH A;  5M0Z A;  2GAH B;  1GRT A;  2XVJ A;  2WPE A;  3SZC A;  4X9M A;  3V3O A;  3LJP A;  4TM3 A;  4U8O A;  3ZYX A;  5EBK A;  2RGO A;  1CC6 A;  4Z26 A;  2GR0 A;  3AEB A;  2O9Z A;  4K5S A;  4APN A;  3DJD A;  1Y56 B;  5BUL A;  1PBD A;  1NDA A;  3AE7 A;  3CNT A;  4TM1 A;  3GYJ A;  2BA9 A;  1JRX A;  1H81 A;  1Z6L A;  3Q9T A;  5EOW A;  3V3N A;  5IPY A;  4GUV A;  4CRT A;  4J57 A;  2FJA A;  4K2X A;  5CQF A;  3SYI A;  2GMJ A;  1VG0 A;  3CGE A;  3NT6 A;  1F8R A;  2YWL A;  1W4X A;  4NWZ A;  1K4Q A;  1LPF A;  1REO A;  4H4S A;  2BK3 A;  3B6D A;  3FIM B;  4NTE A;  5M10 A;  1D4E A;  4N9X A;  3KU9 A;  3VRD B;  1S2Q A;  2CVJ A;  2RAB A;  2C64 A;  2V60 A;  4JQ9 A;  2FJD A;  1VG9 A;  1N4W A;  2PYX A;  2R46 A;  2XVE A;  3K7Q X;  4M52 A;  3C4N A;  3SFD A;  2YLX A;  4Y4N A;  4AP3 A;  1RP0 A;  3PO7 A;  4Y4M A;  3NTD A;  1E1L A;  4JN9 A;  4FDC B;  2QCU A;  1PS9 A;  3AE8 A;  4A5L A;  1JRZ A;  1H83 A;  2TPR A;  3UKF A;  1FCD A;  2A8X A;  1KDG A;  3RNM A;  3L1R A;  3UOZ A;  4C74 A;  3EAO A;  4G6G A;  5FS7 A;  1NEN A;  3VR8 A;  2V6O A;  4A65 A;  4A6N A;  3ITJ A;  4TM4 A;  4G9K A;  4H4R A;  3DH9 A;  1GRB A;  2OA1 A;  4XWR A;  5IQ4 A;  2C76 A;  1F3P A;  4C5O A;  3GSI A;  2GV8 A;  3GWD A;  2YVF A;  1JNZ A;  1LVL A;  5GRT A;  5GSN A;  3NG7 X;  2WPC A;  4YSH A;  1GER A;  5KVI A;  4DSH A;  4GRT A;  3T14 A;  4IV9 A;  2Q6U A;  3CGB A;  4B66 A;  3QVR A;  4YKG A;  3RED A;  1FL2 A;  2WOW A;  5JCK A;  2V3A A;  3PS9 A;  5J7X A;  2WES A;  2YLW A;  1TDN A;  1TYP A;  2XVI A;  1KFY A;  3O0H A;  4YTN A;  3COX A;  3SGL A;  1DOC A;  4GDP A;  4CY6 A;  1CJ2 A;  1IJH A;  4LU6 A;  4U8I A;  2OAL A;  3GDP A;  3UTG A;  3CNS A;  1BWC A;  4H50 A;  4I59 A;  2WP5 A;  3ISH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...