2XLUA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with thionadp
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
b'MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
molecule tags Oxidoreductase
source organism Methylophaga aminisulfidivorans
publication title Joint-Functions of Protein Residues and Nadp(H) in Oxygen-Activation by Flavin-Containing Monooxygenase
pubmed doi rcsb
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA02
2OLNA 3AD8B 1NHQA 1PXBA 2JB2A 2Q0KA 3C96A 4H4UA 5KRQA 1F8RA 2YR4A 3IHGA 1NHPA 3AEEA 1ZY8A 4GCMA 4B64A 4YTPA 3H4KA 1ZK7A 1E1KA 3LB8A 4CNJA 2YAUA 4GUVA 3SFEA 1H6VA 2RGHA 3G5RA 1FOHA 5BUKA 5FS6A 4YWOA 1KNRA 1DOCA 1GEUA 3PVCA 1RSGA 1PHHA 4Z43A 4K7ZA 3AE7A 4UP3A 3M0OA 1LQUA 4A5LA 4Z25A 1YKJA 3LZWA 5U25A 5J60A 2JKCA 1JRZA 3REDA 2JAEA 1FL2A 2R9ZA 3ZDNA 2PYXA 1TDOA 4E0VA 3E1TA 2FJAA 4LU6A 3CNDA 2W0HA 4X9MA 1H7WA 2OA1A 4ICYA 1H81A 1DOEA 2GV8A 2R45A 3DK4A 1LJ1A 2R4EA 3AEBA 3G5QA 4IA6A 3UOYA 1Q9IA 1M64A 2B9YA 4YXDA 3UKAA 1MXTA 3DA1A 3KLJA 4AP3A 1TRBA 3T37A 3IF9A 1VRQB 3WE0A 1PJ6A 5KVIA 2F5ZA 2V61A 1JNRA 1L9DA 4C77A 2VQ7A 2C70A 1JNZA 1FEAA 2TMDA 4LIIA 3HZLA 1VG0A 1BZLA 2E1MA 3UKHA 5HXIA 2C65A 2O9ZA 2OAMA 4BJZA 1NPXA 2FJEA 1E1NA 2V3AA 4JY3A 4BK1A 2C73A 2C67A 2XFNA 3CNJA 1H83A 4OPTA 1Z6LA 1W4XA 3NN6X 4APNA 2YVGA 2BXRA 3M12A 3H8LA 1GESA 1KF6A 3S61A 3GWDA 3URHA 3BI5A 3Q6JA 3D8XA 2X99A 3CNSA 4BJYA 1LPFA 5JCIA 2RGJA 3NTDA 3D1CA 3ICTA 3NIXA 1O95A 1ZMCA 4FDCB 4CY6A 3EANA 4KPRA 3UTHA 1NHSA 2GB0A 2PHHA 1B37A 1KDGA 4YSYA 3P4RA 3NK2X 4A7AA 5GSNA 2GR3A 1YQZA 3CNPA 3LJPA 4A65A 2BXSA 5BRTA 5IPYA 4USRA 3QJ4A 4IVOB 4EQWA 4OPIA 5HHFA 3H8IA 4GDEA 1COYA 1BKWA 4HB9A 5U1OA 5FS8A 1TDEA 1JU2A 2BABA 3UTFA 2Q7VA 3RHAA 2WOVA 3BNMA 3UKPA 2WOWA 2VRLA 2X3NA 4CBQA 1GRFA 3DJJA 1NENA 4X4JA 2HQMA 2WP5A 1F6MA 3QVPA 3UOVA 1EL7A 3ABVA 3I6DA 2Y6QA 4P9SA 1EL9A 1GT8A 1PXAA 4H4SA 3UOZA 4EQXA 5C2TA 3AYIA 4BURA 2WPCA 2EQ6A 2RGOA 4EM4A 5BVAA 3NTAA 4U8OA 2IVDA 1MO9A 2BC1A 4NEWA 1N1PA 3VQRA 5C3JA 2XLUA 1GRBA 5CQFA 4Z26A 1GRGA 1ZOYA 5M10A 4Z24A 4H2QA 1Q1RA 4YKGA 1FCDA 2BA9A 1ELIA 4H2RA 3CTYA 4XWZA 2WDVA 2BCPA 4GR1A 4DNAA 3CN8A 1E6EA 5LV9A 5BULA 1OJ9A 4YSHA 2X8CA 4H4XA 1BGJA 1CJ4A 3DGZA 4WCTA 1DOBA 3AE1A 2WU5A 2YLZA 4YT0A 2XFUA 2WP9A 4RG3A 3O0HA 5KOXA 3AE6A 1GREA 2B9XA 2XLPA 1L9EA 2C75A 3AWIA 3RNMA 3II4A 1CC4A 3G5SA 1V59A 2AAQA 4FK1C 2X8GA 4NTEA 4U8NA 2YG5A 2EQ9A 3P1WA 1IJHA 3ATQA 3NYFA 2A89A 3GSIA 3GYJA 4EQRA 3CIRA 3LZXA 4DGKA 2YWLA 1JEHA 1EL8A 3CPIG 4XWRA 3SFDA 5L46A 1DXLA 3AE8A 4HA6A 4RSLA 4CY8A 1PBDA 2DKIA 3OZ2A 1OJDA 2XVEA 1GRHA 3CNTA 2GQWA 3EAOA 3NYEA 1NAAA 4K22A 3SM8A 1SEZA 2C3CA 3AXBA 2XVHA 2GR0A 3DK8A 1L9CA 5JCMA 3AYJA 4ZCCA 3GD3A 1D7YA 3V3OA 3AEAA 1VG9A 2XYOA 2WPFA 1CBOA 1ZP0A 3AE4A 3K7TA 3AEFA 2C66A 3GDNA 4K5SA 1KNPA 3UOXA 3F8PA 1KSUA 3AD7B 1RYIA 1F8SA 2WU2A 3NKSA 4AOSA 2YM2A 3K30A 4A6NA 3B3RA 2WHDA 3AB1A 1PDHA 4JN9A 3NT6A 4H4TA 2ZZ0A 2XFQA 3CPHG 1Y56A 3KPFA 2ZZBA 1D4DA 2XVJA 2FBWA 3ISHA 2NVKX 4EIQA 1YQ4A 3GRSA 3RP6A 2R4JA 3LXDA 3NN0X 1D7LA 4Z2TA 2BACA 3GWFA 4FK1A 4O5UA 4ZN0A 2C76A 4EMWA 1O94A 2OALA 4FX9A 5KVHA 4Y4MA 4U8JA 1N4WA 3UKKA 2Z5YA 1LQTA 4IV9A 4CCQA 1H7XA 2ACZA 4RG4A 1GRAA 2VQBA 4B66A 4I59A 2ZBWA 1GPEA 2YG3A 1IUSA 2XLSA 3UKQA 1QJDA 4UDPA 3B6DA 4OPUA 4WX1A 1ZX9A 1PJ7A 2BYBA 3AE3A 4A9WA 3AEDA 4J33A 1O5WA 4O5QA 4CCRA 2YLXA 4B69A 2V6OA 4Y4NA 4Z2UA 5JCKA 1S3EA 4J31A 5HY5A 1NG3A 1TDKA 3QFBA 4YKFA 2AR8A 4MJWA 4BK2A 1VDCA 1GSNA 3IC9A 4ZCDA 2ARDA 2YLWA 2JB3A 2YR5A 2GEWA 2YG7A 1X31B 1TYPA 4D03A 1IUXA 2BK4A 1MOKA 2GVCA 3ALJA 4CNKA 1E1MA 1E1LA 4K2XA 2XDOA 3COXA 5JCNA 1BWCA 4PABA 3AE9A 3QSSA 3NK0X 4C74A 3NH3X 4AT2A 4H2NA 4EM3A 3R9UA 2WBAA 1CC6A 2RABA 4OPLA 3CGDA 1NEKA 1D4EA 2YM1A 1GOSA 4GDPA 3ALMA 1H84A 3LADA 1PJ5A 5EB4A 1NDAA 2YVFA 1HYUA 3BHKA 3RP8A 3K7MX 4LA1A 3UKFA 2WP6A 1GRTA 1OJAA 2YLRA 3ADAB 4YTMA 2XFOA 1ZDLA 4C5OA 2CFYA 1N4VA 4PAAA 5U63A 2GR2A 4U2SA 2B7SA 4J57A 1CJCA 2BS3A 3P4SA 3NLCA 4A6NB 4KX6A 4EMJA 2YLSA 3GMBA 3CPJG 1GETA 2YR6A 3BI4A 1S3BA 1ZKQA 3GDPA 4M52A 4TM4A 5EBKA 4YTNA 2WESA 4K8DA 1OJCA 3DJDA 5EOWA 1KFYA 4U2TA 5IQ4A 2CDUA 3LOVA 2GQFA 3NRNA 4NZHA 4X9NA 2J3NA 4B63A 1AOGA 2VVMA 4U8KA 1Q1WA 4OPDA 1GTEA 2AQJA 2H88A 1NG4A 2C7GA 5KWFA 1Y0PA 1ZOVA 1S2YA 1PBCA 2XVFA 3SGLA 5M0ZA 4J2WA 4H4QA 2A87A 4EIPA 1LV0A 3KVEA 1EL5A 2GRTA 2TPRA 3PO7A 3VRBA 4BK3A 2Q0LA 3GD4A 1GALA 4JY2A 5KOWA 3CGCA 4C3YA 1F3PA 3VRAA 2DKHA 3C4AA 4TLZA 4D04A 4TM3A 4A99A 3AE5A 3C4NA 1IUUA 1E7PA 3UP4A 1JRXA 3DJEA 3FPZA 3V3NA 1H82A 3ALLA 3CGBA 1CJ3A 3QVRA 3QFAA 5EB5A 4B68A 4OVIA 3VR9A 2VZ2A 4Z2RA 1LTXR 2BK3A 4H4ZA 3DMEA 2QAEA 2WQYA 2JB1A 3P9UA 3KU9A 5ER0A 3ITJA 2GAHB 2Z5XA 3NYCA 5FMHA 5KXJA 2BS2A 3I3LA 2GR1A 3DJGX 4EMIA 1K0JA 3IHMA 4OPGA 5J7XA 2XCGA 3BI2A 3PS9A 4ECHA 5GRTA 3EF6A 3AYLA 3NHOX 2CULA 3L1RA 3BNUA 3L8KA 4J56A 1P2EA 2WETA 3AD9B 2I0ZA 3NG7X 1GTHA 3KD9A 4OPCA 4TM1A 3V76A 3Q9TA 1GV4A 3RP7A 1XANA 2QA2A 1TDFA 2XFPA 2YQUA 4U2LA 2R0GA 4U8LA 4I58A 1DODA 4DSGA 1KSSA 1ONFA 1JRYA 3P4PA 1K0IA 3GRTA 2YG4A 1K4QA 1PS9A 4XXGA 1PBFA 4U8PA 1D4CA 5CKUA 3ZYXA 1EBDA 2VOUA 1D5TA 1Y56B 1DJNA 2R46A 4BV6A 4JNAA 4H4RA 4Z44A 4B67A 1K0LA 4H4VA 1E39A 2WDRA 2NPXA 2EQ8A 4JNQA 4U8MA 4USQA 2WDQA 5JCLA 1P2HA 5HYMA 2EQ7A 2B7RA 1XPQA 2XLTA 1H86A 3IWAA 3F8DA 2B9WA 1N4UA 2V60A 1DJQA 3FBSA 1PBBA 3GYIA 2GH5A 1F8WA 1L0VA 3VR8A 3AECA 2UZZA 3UTGA 4H4YA 2GF3A 2YG6A 3UKLA 4EQSA 4OCGA 2CVJA 4J36A 4UDRA 4C3XA 3K7QX 4TLXA 2JK6A 3NNEA 1CL0A 1B8SA 1CC2A 2IIDA 2VVLG 2X50A 3JSKA 4H4WA 2Q6UA 4JDRA 1CJ2A 3FMWA 2C3DA 2GAGB 1LVLA 4YSZA 2APGA 1CF3A 1PXCA 1VQWA 4JQ9A 4TM0A 1UKVG 1ZMDA 4GRTA 1GERA 2BS4A 3F8RA 4IVMB 3ATRA 1IUTA 1GXFA 1M6IA 4DSHA 2WPEA 4H4PA 3OC4A 5DBJA 4ADWA 2C72A 2H89A 3NK1X 2FJDA 1YY5A 5IQ1A 2FJBA 1TYTA 1B5QA 2GMJA 5TR3A 3EPTA 3AEGA 1BF3A 2Y6RA 3SQPA 2GMHA 3UP5A 1S2QA 2BC0A 4H2PA 1PBEA 2WS3A 2C64A 2V3BA 4Y4LA 3NGCX 1NHRA 3FIMB 2VRMA 2WOIA 4N9XA 5FS9A 1YQ3A 1QO8A 3DK9A 3M13A 3UTEA 2B76A 3S5WA 1REOA 1OJTA 1FECA 1TDNA 3ICRA 4H50A 4NTCA 4B65A 4J34A 1GNDA 3P4QA 4CRTA 2A8XA 1QLBA 1FEBA 2VVLA 2ZZCA 2X8HA 4AT0A 2IVEA 2YVJA 1RP0A 3CGEA 3UCLA 2R0CA 4AOXA 2R0PA 2V5ZA 2XVIA 1JOAA 2WEUA 2BK5A 1IUWA 1IUVA 3GMCA 3ICSA 3BHFA 3AE2A 4U8IA 1CHUA 2XLRA 4IA5A 3FG2P 4A79A 1BGNA 3KKJA 1B4VA 4B1BA 4YSXA 4REKA 4H7UA 2QA1A 1DNCA 1XHCA 4NTDA 2E4GA 2QCUA 2YLTA 4NEVA 2BCGG 3DGHA 3KA7A 2E5VA 4GF7A 2OLOA 4UDQA 3QSMA 4AP1A 1XDIA 3QSEA 5FS7A 3VRDB 4K5RA 2JBVA 3DH9A 1PN0A
chains in the Genus database with same CATH superfamily
2OLNA 3AD8B 1NHQA 1PXBA 2JB2A 2Q0KA 3C96A 4H4UA 5KRQA 1F8RA 2YR4A 3IHGA 1NHPA 3AEEA 1ZY8A 4GCMA 4B64A 4YTPA 3H4KA 1ZK7A 1E1KA 3LB8A 4CNJA 2YAUA 4GUVA 3SFEA 1H6VA 2RGHA 3G5RA 1FOHA 5BUKA 5FS6A 4YWOA 1KNRA 1DOCA 1GEUA 3PVCA 1RSGA 1PHHA 4Z43A 4K7ZA 3AE7A 4UP3A 3M0OA 1LQUA 4A5LA 4Z25A 1YKJA 3LZWA 5U25A 5J60A 2JKCA 1JRZA 3REDA 2JAEA 1FL2A 2R9ZA 3ZDNA 2PYXA 1TDOA 4E0VA 3E1TA 2FJAA 4LU6A 3CNDA 2W0HA 4X9MA 1H7WA 2OA1A 4ICYA 1H81A 1DOEA 2GV8A 2R45A 3DK4A 1LJ1A 2R4EA 3AEBA 3G5QA 4IA6A 3T0KA 1Q9IA 1M64A 2B9YA 4YXDA 3UKAA 1MXTA 3DA1A 3KLJA 4AP3A 1TRBA 3T37A 3IF9A 1VRQB 3WE0A 1PJ6A 5KVIA 2F5ZA 2V61A 1JNRA 1L9DA 4C77A 2VQ7A 2C70A 1JNZA 1FEAA 2TMDA 4G74A 3HZLA 4LIIA 1VG0A 1BZLA 2E1MA 3UKHA 5HXIA 2C65A 2O9ZA 2OAMA 4BJZA 1NPXA 2FJEA 1E1NA 2V3AA 4JY3A 4BK1A 2C73A 2C67A 2XFNA 3CNJA 1H83A 4OPTA 1Z6LA 1W4XA 3NN6X 4G9KA 4APNA 2YVGA 2BXRA 3M12A 3H8LA 1GESA 1KF6A 3S61A 3GWDA 3URHA 3BI5A 3Q6JA 3D8XA 2X99A 3CNSA 4BJYA 1LPFA 5JCIA 2RGJA 3NTDA 3D1CA 3ICTA 3NIXA 1O95A 1ZMCA 4FDCB 4CY6A 3EANA 4KPRA 3UTHA 1NHSA 2GB0A 2PHHA 1B37A 1KDGA 4YSYA 3P4RA 3NK2X 4A7AA 5GSNA 2GR3A 1YQZA 3CNPA 3LJPA 4A65A 2BXSA 5BRTA 5IPYA 4USRA 3QJ4A 4IVOB 4EQWA 4OPIA 5HHFA 3H8IA 4GDEA 1COYA 1BKWA 4HB9A 5U1OA 5FS8A 1TDEA 1JU2A 2BABA 3UTFA 2Q7VA 3RHAA 2WOVA 3BNMA 3UKPA 2WOWA 2VRLA 2X3NA 4CBQA 1GRFA 3DJJA 1NENA 4X4JA 2HQMA 2WP5A 1F6MA 3QVPA 3UOVA 1EL7A 3ABVA 3I6DA 2Y6QA 4P9SA 1EL9A 1GT8A 1PXAA 4H4SA 3UOZA 4EQXA 5C2TA 3AYIA 4BURA 2WPCA 2EQ6A 2RGOA 4EM4A 5BVAA 3NTAA 4II2A 4U8OA 1MO9A 2BC1A 4NEWA 2IVDA 1N1PA 3T2YA 3VQRA 5C3JA 2XLUA 1GRBA 5CQFA 4Z26A 1GRGA 1ZOYA 5M10A 4Z24A 4H2QA 1Q1RA 4YKGA 1FCDA 2BA9A 1ELIA 4H2RA 3CTYA 4XWZA 2WDVA 2BCPA 4GR1A 4DNAA 3CN8A 1E6EA 5LV9A 5BULA 1OJ9A 4YSHA 2X8CA 4H4XA 1BGJA 1CJ4A 3DGZA 4WCTA 1DOBA 3AE1A 2WU5A 2YLZA 3SZ0A 4YT0A 2XFUA 2WP9A 4RG3A 3O0HA 5KOXA 3AE6A 1GREA 2B9XA 2XLPA 1L9EA 2C75A 3AWIA 3RNMA 3II4A 1CC4A 3G5SA 1V59A 2AAQA 4FK1C 2X8GA 4NTEA 4U8NA 2YG5A 2EQ9A 3P1WA 1IJHA 3ATQA 4GAPA 3NYFA 2A89A 3GSIA 3GYJA 5KMSA 4EQRA 3CIRA 3LZXA 4DGKA 2YWLA 1JEHA 1EL8A 3CPIG 4XWRA 3SFDA 5L46A 1DXLA 3AE8A 4HA6A 4RSLA 4CY8A 1PBDA 2DKIA 3OZ2A 1OJDA 2XVEA 1GRHA 3CNTA 2GQWA 3EAOA 3NYEA 1NAAA 4K22A 3SM8A 1SEZA 2C3CA 3AXBA 2XVHA 2GR0A 3DK8A 1L9CA 5JCMA 3AYJA 4ZCCA 3GD3A 1D7YA 3V3OA 3AEAA 1VG9A 2XYOA 2WPFA 1CBOA 1ZP0A 3AE4A 3K7TA 3AEFA 2C66A 3GDNA 4K5SA 1KNPA 3UOXA 3F8PA 3SZCA 1KSUA 3AD7B 1RYIA 1F8SA 2WU2A 3NKSA 4AOSA 2YM2A 3K30A 4A6NA 3B3RA 2WHDA 3AB1A 1PDHA 4JN9A 3NT6A 4H4TA 2ZZ0A 2XFQA 3CPHG 1Y56A 3KPFA 2ZZBA 1D4DA 2XVJA 2FBWA 3ISHA 2NVKX 4EIQA 1YQ4A 3GRSA 3RP6A 2R4JA 3LXDA 3NN0X 1D7LA 4Z2TA 2BACA 3GWFA 4FK1A 4O5UA 4ZN0A 2C76A 4EMWA 1O94A 2OALA 4FX9A 5KVHA 4Y4MA 4U8JA 1N4WA 3UKKA 2Z5YA 1LQTA 4IV9A 4CCQA 1H7XA 2ACZA 4RG4A 1GRAA 2VQBA 4B66A 4I59A 2ZBWA 5KMQA 1GPEA 2YG3A 1IUSA 2XLSA 3UKQA 1QJDA 4UDPA 3B6DA 4OPUA 4WX1A 1ZX9A 1PJ7A 2BYBA 3AE3A 4A9WA 3HYWA 3AEDA 4J33A 1O5WA 4O5QA 4CCRA 3SYIA 2YLXA 4B69A 2V6OA 4Y4NA 4Z2UA 5JCKA 1S3EA 4J31A 5HY5A 1NG3A 1TDKA 3QFBA 4YKFA 2AR8A 4MJWA 4BK2A 1VDCA 1GSNA 3IC9A 4ZCDA 3T14A 2ARDA 2YLWA 2JB3A 2YR5A 2GEWA 2YG7A 3SX6A 1X31B 1TYPA 4D03A 1IUXA 2BK4A 1MOKA 2GVCA 3ALJA 4CNKA 1E1MA 1E1LA 4K2XA 2XDOA 3COXA 5JCNA 1BWCA 4PABA 3AE9A 3QSSA 3NK0X 4C74A 5KMRA 3NH3X 4AT2A 4H2NA 4EM3A 3R9UA 2WBAA 1CC6A 2BRAA 2RABA 3CGDA 1NEKA 4OPLA 1D4EA 2YM1A 1GOSA 4GDPA 3ALMA 1H84A 3LADA 1PJ5A 5EB4A 1NDAA 2YVFA 1HYUA 3BHKA 3RP8A 3K7MX 4LA1A 3UKFA 2WP6A 1GRTA 1OJAA 2YLRA 3ADAB 4YTMA 2XFOA 1ZDLA 4C5OA 2CFYA 1N4VA 4PAAA 5U63A 2GR2A 4G6HA 4U2SA 2B7SA 4J57A 1CJCA 2BS3A 3P4SA 3NLCA 4A6NB 4KX6A 4EMJA 2YLSA 3GMBA 3CPJG 1GETA 2YR6A 3BI4A 1S3BA 1ZKQA 3GDPA 4M52A 4TM4A 5EBKA 4YTNA 2WESA 4K8DA 1OJCA 3DJDA 5EOWA 1KFYA 4U2TA 5IQ4A 2CDUA 3LOVA 2GQFA 3UOYA 3NRNA 4NZHA 4X9NA 2J3NA 4B63A 1AOGA 2VVMA 4U8KA 1Q1WA 4OPDA 3SXIA 1GTEA 2AQJA 2H88A 1NG4A 2C7GA 5KWFA 1Y0PA 5KMPA 1ZOVA 3SZWA 1S2YA 1PBCA 2XVFA 3SGLA 5M0ZA 4J2WA 4H4QA 2A87A 4EIPA 1LV0A 3KVEA 1EL5A 2GRTA 2TPRA 3PO7A 3VRBA 4BK3A 2Q0LA 3GD4A 1GALA 4JY2A 3KPKA 5KOWA 3CGCA 4C3YA 1F3PA 3VRAA 2DKHA 3C4AA 4TLZA 4D04A 4TM3A 4A99A 3AE5A 3C4NA 1IUUA 1E7PA 3UP4A 1JRXA 3DJEA 3FPZA 3V3NA 1H82A 3ALLA 3CGBA 1CJ3A 3QVRA 3QFAA 5EB5A 4B68A 4OVIA 3VR9A 2VZ2A 4Z2RA 1LTXR 2BK3A 4H4ZA 3DMEA 2QAEA 2WQYA 2JB1A 3P9UA 3KU9A 5ER0A 3ITJA 2GAHB 2Z5XA 3NYCA 5FMHA 5KXJA 2BS2A 3I3LA 2GR1A 3DJGX 4EMIA 1K0JA 3IHMA 4OPGA 5J7XA 2XCGA 3BI2A 3PS9A 4ECHA 5GRTA 3EF6A 3SY4A 3AYLA 3NHOX 2CULA 3L1RA 3BNUA 3L8KA 4J56A 1P2EA 2WETA 3AD9B 2I0ZA 3NG7X 1GTHA 3KD9A 4OPCA 4TM1A 3V76A 3Q9TA 1GV4A 3RP7A 3HYVA 1XANA 2QA2A 1TDFA 2XFPA 2YQUA 4U2LA 2R0GA 4U8LA 4I58A 1DODA 4DSGA 1KSSA 1ONFA 1JRYA 3P4PA 1K0IA 3GRTA 2YG4A 1K4QA 1PS9A 4XXGA 1PBFA 4U8PA 1D4CA 5CKUA 3ZYXA 1EBDA 2VOUA 1D5TA 1Y56B 1DJNA 2R46A 3T31A 4BV6A 4JNAA 4H4RA 4Z44A 4B67A 1K0LA 4H4VA 1E39A 2WDRA 2NPXA 2EQ8A 4JNQA 4U8MA 4USQA 2WDQA 3SZFA 5JCLA 1P2HA 5HYMA 2EQ7A 2B7RA 1XPQA 2XLTA 1H86A 3IWAA 3GYXA 3F8DA 2B9WA 1N4UA 2V60A 1DJQA 3FBSA 1PBBA 3GYIA 2GH5A 1F8WA 1L0VA 3VR8A 3AECA 2UZZA 3UTGA 4H4YA 2GF3A 2YG6A 3UKLA 4EQSA 4OCGA 2CVJA 4J36A 4UDRA 4C3XA 3K7QX 4TLXA 2JK6A 3NNEA 1CL0A 1B8SA 1CC2A 2IIDA 2VVLG 2X50A 3JSKA 4G73A 2Q6UA 4G6GA 4H4WA 4JDRA 1CJ2A 3FMWA 2C3DA 2GAGB 1LVLA 4YSZA 2APGA 1CF3A 1PXCA 1VQWA 4JQ9A 4TM0A 1UKVG 3CMMA 1ZMDA 4GRTA 1GERA 2BS4A 3F8RA 4IVMB 3ATRA 1IUTA 1GXFA 1M6IA 4DSHA 2WPEA 4H4PA 3OC4A 5DBJA 4ADWA 2C72A 2H89A 3NK1X 2FJDA 1YY5A 5IQ1A 2FJBA 1TYTA 1B5QA 2GMJA 5TR3A 3EPTA 3AEGA 1BF3A 2BRYA 2Y6RA 3SQPA 2GMHA 3UP5A 1S2QA 2BC0A 4H2PA 1PBEA 2WS3A 2C64A 2V3BA 3T2ZA 4Y4LA 3NGCX 1NHRA 3FIMB 2VRMA 2WOIA 4N9XA 5FS9A 1YQ3A 1QO8A 3DK9A 3M13A 3UTEA 2B76A 3S5WA 1REOA 1OJTA 1FECA 1TDNA 3ICRA 4H50A 4NTCA 4B65A 4J34A 1GNDA 3P4QA 4CRTA 2A8XA 1QLBA 1FEBA 2VVLA 2ZZCA 2X8HA 4AT0A 4NWZA 2IVEA 2YVJA 1RP0A 3CGEA 3UCLA 2R0CA 4AOXA 2R0PA 2V5ZA 2XVIA 1JOAA 2WEUA 2BK5A 1IUWA 1IUVA 3GMCA 3ICSA 4NNJA 3BHFA 3AE2A 4U8IA 1CHUA 2XLRA 4IA5A 3FG2P 3HYXA 1BGNA 4II3A 3KKJA 4A79A 1B4VA 4B1BA 4YSXA 4REKA 4H7UA 2QA1A 1DNCA 1XHCA 4NTDA 2E4GA 2QCUA 2YLTA 4NEVA 2BCGG 3DGHA 3KA7A 3T2KA 2E5VA 4GF7A 2OLOA 4UDQA 3QSMA 4AP1A 1XDIA 3QSEA 5FS7A 3VRDB 4K5RA 4GAVA 5KNLA 2JBVA 3DH9A 2C4CA 1PN0A
chains in the Genus database with same CATH topology
2OLNA 3AD8B 1NHQA 1PXBA 2JB2A 2Q0KA 3C96A 4H4UA 5KRQA 1F8RA 2YR4A 3IHGA 1NHPA 3AEEA 1ZY8A 4GCMA 4B64A 4YTPA 3H4KA 1ZK7A 1E1KA 3LB8A 4CNJA 2YAUA 4GUVA 3SFEA 1H6VA 2RGHA 3G5RA 1FOHA 5BUKA 5FS6A 4YWOA 1KNRA 1DOCA 1GEUA 3PVCA 1RSGA 1PHHA 4Z43A 4K7ZA 3AE7A 4UP3A 3M0OA 1LQUA 4A5LA 4Z25A 1YKJA 3LZWA 5U25A 5J60A 2JKCA 1JRZA 3REDA 2JAEA 1FL2A 2R9ZA 3ZDNA 2PYXA 1TDOA 4E0VA 3E1TA 2FJAA 4LU6A 3CNDA 2W0HA 4X9MA 1H7WA 2OA1A 4ICYA 1H81A 1DOEA 2GV8A 2R45A 3DK4A 1LJ1A 2R4EA 3AEBA 3G5QA 4IA6A 3T0KA 1Q9IA 1M64A 2B9YA 4YXDA 3UKAA 1MXTA 3DA1A 3KLJA 4AP3A 1TRBA 3T37A 3IF9A 1VRQB 3WE0A 1PJ6A 5KVIA 2F5ZA 2V61A 1JNRA 1L9DA 4C77A 2VQ7A 2C70A 1JNZA 1FEAA 2TMDA 4G74A 3HZLA 4LIIA 1VG0A 1BZLA 2E1MA 3UKHA 5HXIA 2C65A 2O9ZA 2OAMA 4BJZA 1NPXA 2FJEA 1E1NA 2V3AA 4JY3A 4BK1A 2C73A 2C67A 2XFNA 3CNJA 1H83A 4OPTA 1Z6LA 1W4XA 3NN6X 4G9KA 4APNA 2YVGA 2BXRA 3M12A 3H8LA 1GESA 1KF6A 3S61A 3GWDA 3URHA 3BI5A 3Q6JA 3D8XA 2X99A 3CNSA 4BJYA 1LPFA 5JCIA 2RGJA 3NTDA 3D1CA 3ICTA 3NIXA 1O95A 1ZMCA 4FDCB 4CY6A 3EANA 4KPRA 3UTHA 1NHSA 2GB0A 2PHHA 1B37A 1KDGA 4YSYA 3P4RA 3NK2X 4A7AA 5GSNA 2GR3A 1YQZA 3CNPA 3LJPA 4A65A 2BXSA 5BRTA 5IPYA 4USRA 3QJ4A 4IVOB 4EQWA 4OPIA 5HHFA 3H8IA 4GDEA 1COYA 1BKWA 4HB9A 5U1OA 5FS8A 1TDEA 1JU2A 2BABA 3UTFA 2Q7VA 3RHAA 2WOVA 3BNMA 3UKPA 2WOWA 2VRLA 2X3NA 4CBQA 1GRFA 3DJJA 1NENA 4X4JA 2HQMA 2WP5A 1F6MA 3QVPA 3UOVA 1EL7A 3ABVA 3I6DA 2Y6QA 4P9SA 1EL9A 1GT8A 1PXAA 4H4SA 3UOZA 4EQXA 5C2TA 3AYIA 4BURA 2WPCA 2EQ6A 2RGOA 4EM4A 5BVAA 3NTAA 4II2A 4U8OA 1MO9A 2BC1A 4NEWA 2IVDA 1N1PA 3T2YA 3VQRA 5C3JA 2XLUA 1GRBA 5CQFA 4Z26A 1GRGA 1ZOYA 5M10A 4Z24A 4H2QA 1Q1RA 4YKGA 1FCDA 2BA9A 1ELIA 4H2RA 3CTYA 4XWZA 2WDVA 2BCPA 4GR1A 4DNAA 3CN8A 1E6EA 5LV9A 5BULA 1OJ9A 4YSHA 2X8CA 4H4XA 1BGJA 1CJ4A 3DGZA 4WCTA 1DOBA 3AE1A 2WU5A 2YLZA 3SZ0A 4YT0A 2XFUA 2WP9A 4RG3A 3O0HA 5KOXA 3AE6A 1GREA 2B9XA 2XLPA 1L9EA 2C75A 3AWIA 3RNMA 3II4A 1CC4A 3G5SA 1V59A 2AAQA 4FK1C 2X8GA 4NTEA 4U8NA 2YG5A 2EQ9A 3P1WA 1IJHA 3ATQA 4GAPA 3NYFA 2A89A 3GSIA 3GYJA 5KMSA 4EQRA 3CIRA 3LZXA 4DGKA 2YWLA 1JEHA 1EL8A 3CPIG 4XWRA 3SFDA 5L46A 1DXLA 3AE8A 4HA6A 4RSLA 4CY8A 1PBDA 2DKIA 3OZ2A 1OJDA 2XVEA 1GRHA 3CNTA 2GQWA 3EAOA 3NYEA 1NAAA 4K22A 3SM8A 1SEZA 2C3CA 3AXBA 2XVHA 2GR0A 3DK8A 1L9CA 5JCMA 3AYJA 4ZCCA 3GD3A 1D7YA 3V3OA 3AEAA 1VG9A 2XYOA 2WPFA 1CBOA 1ZP0A 3AE4A 3K7TA 3AEFA 2C66A 3GDNA 4K5SA 1KNPA 3UOXA 3F8PA 3SZCA 1KSUA 3AD7B 1RYIA 1F8SA 2WU2A 3NKSA 4AOSA 2YM2A 3K30A 4A6NA 3B3RA 2WHDA 3AB1A 1PDHA 4JN9A 3NT6A 4H4TA 2ZZ0A 2XFQA 3CPHG 1Y56A 3KPFA 2ZZBA 1D4DA 2XVJA 2FBWA 3ISHA 2NVKX 4EIQA 1YQ4A 3GRSA 3RP6A 2R4JA 3LXDA 3NN0X 1D7LA 4Z2TA 2BACA 3GWFA 4FK1A 4O5UA 4ZN0A 2C76A 4EMWA 1O94A 2OALA 4FX9A 5KVHA 4Y4MA 4U8JA 1N4WA 3UKKA 2Z5YA 1LQTA 4IV9A 4CCQA 1H7XA 2ACZA 4RG4A 1GRAA 2VQBA 4B66A 4I59A 2ZBWA 5KMQA 1GPEA 2YG3A 1IUSA 2XLSA 3UKQA 1QJDA 4UDPA 3B6DA 4OPUA 4WX1A 1ZX9A 1PJ7A 2BYBA 3AE3A 4A9WA 3HYWA 3AEDA 4J33A 1O5WA 4O5QA 4CCRA 3SYIA 2YLXA 4B69A 2V6OA 4Y4NA 4Z2UA 5JCKA 1S3EA 4J31A 5HY5A 1NG3A 1TDKA 3QFBA 4YKFA 2AR8A 4MJWA 4BK2A 1VDCA 1GSNA 3IC9A 4ZCDA 3T14A 2ARDA 2YLWA 2JB3A 2YR5A 2GEWA 2YG7A 3SX6A 1X31B 1TYPA 4D03A 1IUXA 2BK4A 1MOKA 2GVCA 3ALJA 4CNKA 1E1MA 1E1LA 4K2XA 2XDOA 3COXA 5JCNA 1BWCA 4PABA 3AE9A 3QSSA 3NK0X 4C74A 5KMRA 3NH3X 4AT2A 4H2NA 4EM3A 3R9UA 2WBAA 1CC6A 2BRAA 2RABA 3CGDA 1NEKA 4OPLA 1D4EA 2YM1A 1GOSA 4GDPA 3ALMA 1H84A 3LADA 1PJ5A 5EB4A 1NDAA 2YVFA 1HYUA 3BHKA 3RP8A 3K7MX 4LA1A 3UKFA 2WP6A 1GRTA 1OJAA 2YLRA 3ADAB 4YTMA 2XFOA 1ZDLA 4C5OA 2CFYA 1N4VA 4PAAA 5U63A 2GR2A 4G6HA 4U2SA 2B7SA 4J57A 1CJCA 2BS3A 3P4SA 3NLCA 4A6NB 4KX6A 4EMJA 2YLSA 3GMBA 3CPJG 1GETA 2YR6A 3BI4A 1S3BA 1ZKQA 3GDPA 4M52A 4TM4A 5EBKA 4YTNA 2WESA 4K8DA 1OJCA 3DJDA 5EOWA 1KFYA 4U2TA 5IQ4A 2CDUA 3LOVA 2GQFA 3UOYA 3NRNA 4NZHA 4X9NA 2J3NA 4B63A 1AOGA 2VVMA 4U8KA 1Q1WA 4OPDA 3SXIA 1GTEA 2AQJA 2H88A 1NG4A 2C7GA 5KWFA 1Y0PA 5KMPA 1ZOVA 3SZWA 1S2YA 1PBCA 2XVFA 3SGLA 5M0ZA 4J2WA 4H4QA 2A87A 4EIPA 1LV0A 3KVEA 1EL5A 2GRTA 2TPRA 3PO7A 3VRBA 4BK3A 2Q0LA 3GD4A 1GALA 4JY2A 3KPKA 5KOWA 3CGCA 4C3YA 1F3PA 3VRAA 2DKHA 3C4AA 4TLZA 4D04A 4TM3A 4A99A 3AE5A 3C4NA 1IUUA 1E7PA 3UP4A 1JRXA 3DJEA 3FPZA 3V3NA 1H82A 3ALLA 3CGBA 1CJ3A 3QVRA 3QFAA 5EB5A 4B68A 4OVIA 3VR9A 2VZ2A 4Z2RA 1LTXR 2BK3A 4H4ZA 3DMEA 2QAEA 2WQYA 2JB1A 3P9UA 3KU9A 5ER0A 3ITJA 2GAHB 2Z5XA 3NYCA 5FMHA 5KXJA 2BS2A 3I3LA 2GR1A 3DJGX 4EMIA 1K0JA 3IHMA 4OPGA 5J7XA 2XCGA 3BI2A 3PS9A 4ECHA 5GRTA 3EF6A 3SY4A 3AYLA 3NHOX 2CULA 3L1RA 3BNUA 3L8KA 4J56A 1P2EA 2WETA 3AD9B 2I0ZA 3NG7X 1GTHA 3KD9A 4OPCA 4TM1A 3V76A 3Q9TA 1GV4A 3RP7A 3HYVA 1XANA 2QA2A 1TDFA 2XFPA 2YQUA 4U2LA 2R0GA 4U8LA 4I58A 1DODA 4DSGA 1KSSA 1ONFA 1JRYA 3P4PA 1K0IA 3GRTA 2YG4A 1K4QA 1PS9A 4XXGA 1PBFA 4U8PA 1D4CA 5CKUA 3ZYXA 1EBDA 2VOUA 1D5TA 1Y56B 1DJNA 2R46A 3T31A 4BV6A 4JNAA 4H4RA 4Z44A 4B67A 1K0LA 4H4VA 1E39A 2WDRA 2NPXA 2EQ8A 4JNQA 4U8MA 4USQA 2WDQA 3SZFA 5JCLA 1P2HA 5HYMA 2EQ7A 2B7RA 1XPQA 2XLTA 1H86A 3IWAA 3GYXA 3F8DA 2B9WA 1N4UA 2V60A 1DJQA 3FBSA 1PBBA 3GYIA 2GH5A 1F8WA 1L0VA 3VR8A 3AECA 2UZZA 3UTGA 4H4YA 2GF3A 2YG6A 3UKLA 4EQSA 4OCGA 2CVJA 4J36A 4UDRA 4C3XA 3K7QX 4TLXA 2JK6A 3NNEA 1CL0A 1B8SA 1CC2A 2IIDA 2VVLG 2X50A 3JSKA 4G73A 2Q6UA 4G6GA 4H4WA 4JDRA 1CJ2A 3FMWA 2C3DA 2GAGB 1LVLA 4YSZA 2APGA 1CF3A 1PXCA 1VQWA 4JQ9A 4TM0A 1UKVG 3CMMA 1ZMDA 4GRTA 1GERA 2BS4A 3F8RA 4IVMB 3ATRA 1IUTA 1GXFA 1M6IA 4DSHA 2WPEA 4H4PA 3OC4A 5DBJA 4ADWA 2C72A 2H89A 3NK1X 2FJDA 1YY5A 5IQ1A 2FJBA 1TYTA 1B5QA 2GMJA 5TR3A 3EPTA 3AEGA 1BF3A 2BRYA 2Y6RA 3SQPA 2GMHA 3UP5A 1S2QA 2BC0A 4H2PA 1PBEA 2WS3A 2C64A 2V3BA 3T2ZA 4Y4LA 3NGCX 1NHRA 3FIMB 2VRMA 2WOIA 4N9XA 5FS9A 1YQ3A 1QO8A 3DK9A 3M13A 3UTEA 2B76A 3S5WA 1REOA 1OJTA 1FECA 1TDNA 3ICRA 4H50A 4NTCA 4B65A 4J34A 1GNDA 3P4QA 4CRTA 2A8XA 1QLBA 1FEBA 2VVLA 2ZZCA 2X8HA 4AT0A 4NWZA 2IVEA 2YVJA 1RP0A 3CGEA 3UCLA 2R0CA 4AOXA 2R0PA 2V5ZA 2XVIA 1JOAA 2WEUA 2BK5A 1IUWA 1IUVA 3GMCA 3ICSA 4NNJA 3BHFA 3AE2A 4U8IA 1CHUA 2XLRA 4IA5A 3FG2P 3HYXA 1BGNA 4II3A 3KKJA 4A79A 1B4VA 4B1BA 4YSXA 4REKA 4H7UA 2QA1A 1DNCA 1XHCA 4NTDA 2E4GA 2QCUA 2YLTA 4NEVA 2BCGG 3DGHA 3KA7A 3T2KA 2E5VA 4GF7A 2OLOA 4UDQA 3QSMA 4AP1A 1XDIA 3QSEA 5FS7A 3VRDB 4K5RA 4GAVA 5KNLA 2JBVA 3DH9A 2C4CA 1PN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLN A;  3AD8 B;  1NHQ A;  1PXB A;  2JB2 A;  2Q0K A;  3C96 A;  4H4U A;  5KRQ A;  1F8R A;  2YR4 A;  3IHG A;  1NHP A;  3AEE A;  1ZY8 A;  4GCM A;  4B64 A;  4YTP A;  3H4K A;  1ZK7 A;  1E1K A;  3LB8 A;  4CNJ A;  2YAU A;  4GUV A;  3SFE A;  1H6V A;  2RGH A;  3G5R A;  1FOH A;  5BUK A;  5FS6 A;  4YWO A;  1KNR A;  1DOC A;  1GEU A;  3PVC A;  1RSG A;  1PHH A;  4Z43 A;  4K7Z A;  3AE7 A;  4UP3 A;  3M0O A;  1LQU A;  4A5L A;  4Z25 A;  1YKJ A;  3LZW A;  5U25 A;  5J60 A;  2JKC A;  1JRZ A;  3RED A;  2JAE A;  1FL2 A;  2R9Z A;  3ZDN A;  2PYX A;  1TDO A;  4E0V A;  3E1T A;  2FJA A;  4LU6 A;  3CND A;  2W0H A;  4X9M A;  1H7W A;  2OA1 A;  4ICY A;  1H81 A;  1DOE A;  2GV8 A;  2R45 A;  3DK4 A;  1LJ1 A;  2R4E A;  3AEB A;  3G5Q A;  4IA6 A;  3UOY A;  1Q9I A;  1M64 A;  2B9Y A;  4YXD A;  3UKA A;  1MXT A;  3DA1 A;  3KLJ A;  4AP3 A;  1TRB A;  3T37 A;  3IF9 A;  1VRQ B;  3WE0 A;  1PJ6 A;  5KVI A;  2F5Z A;  2V61 A;  1JNR A;  1L9D A;  4C77 A;  2VQ7 A;  2C70 A;  1JNZ A;  1FEA A;  2TMD A;  4LII A;  3HZL A;  1VG0 A;  1BZL A;  2E1M A;  3UKH A;  5HXI A;  2C65 A;  2O9Z A;  2OAM A;  4BJZ A;  1NPX A;  2FJE A;  1E1N A;  2V3A A;  4JY3 A;  4BK1 A;  2C73 A;  2C67 A;  2XFN A;  3CNJ A;  1H83 A;  4OPT A;  1Z6L A;  1W4X A;  3NN6 X;  4APN A;  2YVG A;  2BXR A;  3M12 A;  3H8L A;  1GES A;  1KF6 A;  3S61 A;  3GWD A;  3URH A;  3BI5 A;  3Q6J A;  3D8X A;  2X99 A;  3CNS A;  4BJY A;  1LPF A;  5JCI A;  2RGJ A;  3NTD A;  3D1C A;  3ICT A;  3NIX A;  1O95 A;  1ZMC A;  4FDC B;  4CY6 A;  3EAN A;  4KPR A;  3UTH A;  1NHS A;  2GB0 A;  2PHH A;  1B37 A;  1KDG A;  4YSY A;  3P4R A;  3NK2 X;  4A7A A;  5GSN A;  2GR3 A;  1YQZ A;  3CNP A;  3LJP A;  4A65 A;  2BXS A;  5BRT A;  5IPY A;  4USR A;  3QJ4 A;  4IVO B;  4EQW A;  4OPI A;  5HHF A;  3H8I A;  4GDE A;  1COY A;  1BKW A;  4HB9 A;  5U1O A;  5FS8 A;  1TDE A;  1JU2 A;  2BAB A;  3UTF A;  2Q7V A;  3RHA A;  2WOV A;  3BNM A;  3UKP A;  2WOW A;  2VRL A;  2X3N A;  4CBQ A;  1GRF A;  3DJJ A;  1NEN A;  4X4J A;  2HQM A;  2WP5 A;  1F6M A;  3QVP A;  3UOV A;  1EL7 A;  3ABV A;  3I6D A;  2Y6Q A;  4P9S A;  1EL9 A;  1GT8 A;  1PXA A;  4H4S A;  3UOZ A;  4EQX A;  5C2T A;  3AYI A;  4BUR A;  2WPC A;  2EQ6 A;  2RGO A;  4EM4 A;  5BVA A;  3NTA A;  4U8O A;  2IVD A;  1MO9 A;  2BC1 A;  4NEW A;  1N1P A;  3VQR A;  5C3J A;  2XLU A;  1GRB A;  5CQF A;  4Z26 A;  1GRG A;  1ZOY A;  5M10 A;  4Z24 A;  4H2Q A;  1Q1R A;  4YKG A;  1FCD A;  2BA9 A;  1ELI A;  4H2R A;  3CTY A;  4XWZ A;  2WDV A;  2BCP A;  4GR1 A;  4DNA A;  3CN8 A;  1E6E A;  5LV9 A;  5BUL A;  1OJ9 A;  4YSH A;  2X8C A;  4H4X A;  1BGJ A;  1CJ4 A;  3DGZ A;  4WCT A;  1DOB A;  3AE1 A;  2WU5 A;  2YLZ A;  4YT0 A;  2XFU A;  2WP9 A;  4RG3 A;  3O0H A;  5KOX A;  3AE6 A;  1GRE A;  2B9X A;  2XLP A;  1L9E A;  2C75 A;  3AWI A;  3RNM A;  3II4 A;  1CC4 A;  3G5S A;  1V59 A;  2AAQ A;  4FK1 C;  2X8G A;  4NTE A;  4U8N A;  2YG5 A;  2EQ9 A;  3P1W A;  1IJH A;  3ATQ A;  3NYF A;  2A89 A;  3GSI A;  3GYJ A;  4EQR A;  3CIR A;  3LZX A;  4DGK A;  2YWL A;  1JEH A;  1EL8 A;  3CPI G;  4XWR A;  3SFD A;  5L46 A;  1DXL A;  3AE8 A;  4HA6 A;  4RSL A;  4CY8 A;  1PBD A;  2DKI A;  3OZ2 A;  1OJD A;  2XVE A;  1GRH A;  3CNT A;  2GQW A;  3EAO A;  3NYE A;  1NAA A;  4K22 A;  3SM8 A;  1SEZ A;  2C3C A;  3AXB A;  2XVH A;  2GR0 A;  3DK8 A;  1L9C A;  5JCM A;  3AYJ A;  4ZCC A;  3GD3 A;  1D7Y A;  3V3O A;  3AEA A;  1VG9 A;  2XYO A;  2WPF A;  1CBO A;  1ZP0 A;  3AE4 A;  3K7T A;  3AEF A;  2C66 A;  3GDN A;  4K5S A;  1KNP A;  3UOX A;  3F8P A;  1KSU A;  3AD7 B;  1RYI A;  1F8S A;  2WU2 A;  3NKS A;  4AOS A;  2YM2 A;  3K30 A;  4A6N A;  3B3R A;  2WHD A;  3AB1 A;  1PDH A;  4JN9 A;  3NT6 A;  4H4T A;  2ZZ0 A;  2XFQ A;  3CPH G;  1Y56 A;  3KPF A;  2ZZB A;  1D4D A;  2XVJ A;  2FBW A;  3ISH A;  2NVK X;  4EIQ A;  1YQ4 A;  3GRS A;  3RP6 A;  2R4J A;  3LXD A;  3NN0 X;  1D7L A;  4Z2T A;  2BAC A;  3GWF A;  4FK1 A;  4O5U A;  4ZN0 A;  2C76 A;  4EMW A;  1O94 A;  2OAL A;  4FX9 A;  5KVH A;  4Y4M A;  4U8J A;  1N4W A;  3UKK A;  2Z5Y A;  1LQT A;  4IV9 A;  4CCQ A;  1H7X A;  2ACZ A;  4RG4 A;  1GRA A;  2VQB A;  4B66 A;  4I59 A;  2ZBW A;  1GPE A;  2YG3 A;  1IUS A;  2XLS A;  3UKQ A;  1QJD A;  4UDP A;  3B6D A;  4OPU A;  4WX1 A;  1ZX9 A;  1PJ7 A;  2BYB A;  3AE3 A;  4A9W A;  3AED A;  4J33 A;  1O5W A;  4O5Q A;  4CCR A;  2YLX A;  4B69 A;  2V6O A;  4Y4N A;  4Z2U A;  5JCK A;  1S3E A;  4J31 A;  5HY5 A;  1NG3 A;  1TDK A;  3QFB A;  4YKF A;  2AR8 A;  4MJW A;  4BK2 A;  1VDC A;  1GSN A;  3IC9 A;  4ZCD A;  2ARD A;  2YLW A;  2JB3 A;  2YR5 A;  2GEW A;  2YG7 A;  1X31 B;  1TYP A;  4D03 A;  1IUX A;  2BK4 A;  1MOK A;  2GVC A;  3ALJ A;  4CNK A;  1E1M A;  1E1L A;  4K2X A;  2XDO A;  3COX A;  5JCN A;  1BWC A;  4PAB A;  3AE9 A;  3QSS A;  3NK0 X;  4C74 A;  3NH3 X;  4AT2 A;  4H2N A;  4EM3 A;  3R9U A;  2WBA A;  1CC6 A;  2RAB A;  4OPL A;  3CGD A;  1NEK A;  1D4E A;  2YM1 A;  1GOS A;  4GDP A;  3ALM A;  1H84 A;  3LAD A;  1PJ5 A;  5EB4 A;  1NDA A;  2YVF A;  1HYU A;  3BHK A;  3RP8 A;  3K7M X;  4LA1 A;  3UKF A;  2WP6 A;  1GRT A;  1OJA A;  2YLR A;  3ADA B;  4YTM A;  2XFO A;  1ZDL A;  4C5O A;  2CFY A;  1N4V A;  4PAA A;  5U63 A;  2GR2 A;  4U2S A;  2B7S A;  4J57 A;  1CJC A;  2BS3 A;  3P4S A;  3NLC A;  4A6N B;  4KX6 A;  4EMJ A;  2YLS A;  3GMB A;  3CPJ G;  1GET A;  2YR6 A;  3BI4 A;  1S3B A;  1ZKQ A;  3GDP A;  4M52 A;  4TM4 A;  5EBK A;  4YTN A;  2WES A;  4K8D A;  1OJC A;  3DJD A;  5EOW A;  1KFY A;  4U2T A;  5IQ4 A;  2CDU A;  3LOV A;  2GQF A;  3NRN A;  4NZH A;  4X9N A;  2J3N A;  4B63 A;  1AOG A;  2VVM A;  4U8K A;  1Q1W A;  4OPD A;  1GTE A;  2AQJ A;  2H88 A;  1NG4 A;  2C7G A;  5KWF A;  1Y0P A;  1ZOV A;  1S2Y A;  1PBC A;  2XVF A;  3SGL A;  5M0Z A;  4J2W A;  4H4Q A;  2A87 A;  4EIP A;  1LV0 A;  3KVE A;  1EL5 A;  2GRT A;  2TPR A;  3PO7 A;  3VRB A;  4BK3 A;  2Q0L A;  3GD4 A;  1GAL A;  4JY2 A;  5KOW A;  3CGC A;  4C3Y A;  1F3P A;  3VRA A;  2DKH A;  3C4A A;  4TLZ A;  4D04 A;  4TM3 A;  4A99 A;  3AE5 A;  3C4N A;  1IUU A;  1E7P A;  3UP4 A;  1JRX A;  3DJE A;  3FPZ A;  3V3N A;  1H82 A;  3ALL A;  3CGB A;  1CJ3 A;  3QVR A;  3QFA A;  5EB5 A;  4B68 A;  4OVI A;  3VR9 A;  2VZ2 A;  4Z2R A;  1LTX R;  2BK3 A;  4H4Z A;  3DME A;  2QAE A;  2WQY A;  2JB1 A;  3P9U A;  3KU9 A;  5ER0 A;  3ITJ A;  2GAH B;  2Z5X A;  3NYC A;  5FMH A;  5KXJ A;  2BS2 A;  3I3L A;  2GR1 A;  3DJG X;  4EMI A;  1K0J A;  3IHM A;  4OPG A;  5J7X A;  2XCG A;  3BI2 A;  3PS9 A;  4ECH A;  5GRT A;  3EF6 A;  3AYL A;  3NHO X;  2CUL A;  3L1R A;  3BNU A;  3L8K A;  4J56 A;  1P2E A;  2WET A;  3AD9 B;  2I0Z A;  3NG7 X;  1GTH A;  3KD9 A;  4OPC A;  4TM1 A;  3V76 A;  3Q9T A;  1GV4 A;  3RP7 A;  1XAN A;  2QA2 A;  1TDF A;  2XFP A;  2YQU A;  4U2L A;  2R0G A;  4U8L A;  4I58 A;  1DOD A;  4DSG A;  1KSS A;  1ONF A;  1JRY A;  3P4P A;  1K0I A;  3GRT A;  2YG4 A;  1K4Q A;  1PS9 A;  4XXG A;  1PBF A;  4U8P A;  1D4C A;  5CKU A;  3ZYX A;  1EBD A;  2VOU A;  1D5T A;  1Y56 B;  1DJN A;  2R46 A;  4BV6 A;  4JNA A;  4H4R A;  4Z44 A;  4B67 A;  1K0L A;  4H4V A;  1E39 A;  2WDR A;  2NPX A;  2EQ8 A;  4JNQ A;  4U8M A;  4USQ A;  2WDQ A;  5JCL A;  1P2H A;  5HYM A;  2EQ7 A;  2B7R A;  1XPQ A;  2XLT A;  1H86 A;  3IWA A;  3F8D A;  2B9W A;  1N4U A;  2V60 A;  1DJQ A;  3FBS A;  1PBB A;  3GYI A;  2GH5 A;  1F8W A;  1L0V A;  3VR8 A;  3AEC A;  2UZZ A;  3UTG A;  4H4Y A;  2GF3 A;  2YG6 A;  3UKL A;  4EQS A;  4OCG A;  2CVJ A;  4J36 A;  4UDR A;  4C3X A;  3K7Q X;  4TLX A;  2JK6 A;  3NNE A;  1CL0 A;  1B8S A;  1CC2 A;  2IID A;  2VVL G;  2X50 A;  3JSK A;  4H4W A;  2Q6U A;  4JDR A;  1CJ2 A;  3FMW A;  2C3D A;  2GAG B;  1LVL A;  4YSZ A;  2APG A;  1CF3 A;  1PXC A;  1VQW A;  4JQ9 A;  4TM0 A;  1UKV G;  1ZMD A;  4GRT A;  1GER A;  2BS4 A;  3F8R A;  4IVM B;  3ATR A;  1IUT A;  1GXF A;  1M6I A;  4DSH A;  2WPE A;  4H4P A;  3OC4 A;  5DBJ A;  4ADW A;  2C72 A;  2H89 A;  3NK1 X;  2FJD A;  1YY5 A;  5IQ1 A;  2FJB A;  1TYT A;  1B5Q A;  2GMJ A;  5TR3 A;  3EPT A;  3AEG A;  1BF3 A;  2Y6R A;  3SQP A;  2GMH A;  3UP5 A;  1S2Q A;  2BC0 A;  4H2P A;  1PBE A;  2WS3 A;  2C64 A;  2V3B A;  4Y4L A;  3NGC X;  1NHR A;  3FIM B;  2VRM A;  2WOI A;  4N9X A;  5FS9 A;  1YQ3 A;  1QO8 A;  3DK9 A;  3M13 A;  3UTE A;  2B76 A;  3S5W A;  1REO A;  1OJT A;  1FEC A;  1TDN A;  3ICR A;  4H50 A;  4NTC A;  4B65 A;  4J34 A;  1GND A;  3P4Q A;  4CRT A;  2A8X A;  1QLB A;  1FEB A;  2VVL A;  2ZZC A;  2X8H A;  4AT0 A;  2IVE A;  2YVJ A;  1RP0 A;  3CGE A;  3UCL A;  2R0C A;  4AOX A;  2R0P A;  2V5Z A;  2XVI A;  1JOA A;  2WEU A;  2BK5 A;  1IUW A;  1IUV A;  3GMC A;  3ICS A;  3BHF A;  3AE2 A;  4U8I A;  1CHU A;  2XLR A;  4IA5 A;  3FG2 P;  4A79 A;  1BGN A;  3KKJ A;  1B4V A;  4B1B A;  4YSX A;  4REK A;  4H7U A;  2QA1 A;  1DNC A;  1XHC A;  4NTD A;  2E4G A;  2QCU A;  2YLT A;  4NEV A;  2BCG G;  3DGH A;  3KA7 A;  2E5V A;  4GF7 A;  2OLO A;  4UDQ A;  3QSM A;  4AP1 A;  1XDI A;  3QSE A;  5FS7 A;  3VRD B;  4K5R A;  2JBV A;  3DH9 A;  1PN0 A; 
#chains in the Genus database with same CATH topology
 2OLN A;  3AD8 B;  1NHQ A;  1PXB A;  2JB2 A;  2Q0K A;  3C96 A;  4H4U A;  5KRQ A;  1F8R A;  2YR4 A;  3IHG A;  1NHP A;  3AEE A;  1ZY8 A;  4GCM A;  4B64 A;  4YTP A;  3H4K A;  1ZK7 A;  1E1K A;  3LB8 A;  4CNJ A;  2YAU A;  4GUV A;  3SFE A;  1H6V A;  2RGH A;  3G5R A;  1FOH A;  5BUK A;  5FS6 A;  4YWO A;  1KNR A;  1DOC A;  1GEU A;  3PVC A;  1RSG A;  1PHH A;  4Z43 A;  4K7Z A;  3AE7 A;  4UP3 A;  3M0O A;  1LQU A;  4A5L A;  4Z25 A;  1YKJ A;  3LZW A;  5U25 A;  5J60 A;  2JKC A;  1JRZ A;  3RED A;  2JAE A;  1FL2 A;  2R9Z A;  3ZDN A;  2PYX A;  1TDO A;  4E0V A;  3E1T A;  2FJA A;  4LU6 A;  3CND A;  2W0H A;  4X9M A;  1H7W A;  2OA1 A;  4ICY A;  1H81 A;  1DOE A;  2GV8 A;  2R45 A;  3DK4 A;  1LJ1 A;  2R4E A;  3AEB A;  3G5Q A;  4IA6 A;  3T0K A;  1Q9I A;  1M64 A;  2B9Y A;  4YXD A;  3UKA A;  1MXT A;  3DA1 A;  3KLJ A;  4AP3 A;  1TRB A;  3T37 A;  3IF9 A;  1VRQ B;  3WE0 A;  1PJ6 A;  5KVI A;  2F5Z A;  2V61 A;  1JNR A;  1L9D A;  4C77 A;  2VQ7 A;  2C70 A;  1JNZ A;  1FEA A;  2TMD A;  4G74 A;  3HZL A;  4LII A;  1VG0 A;  1BZL A;  2E1M A;  3UKH A;  5HXI A;  2C65 A;  2O9Z A;  2OAM A;  4BJZ A;  1NPX A;  2FJE A;  1E1N A;  2V3A A;  4JY3 A;  4BK1 A;  2C73 A;  2C67 A;  2XFN A;  3CNJ A;  1H83 A;  4OPT A;  1Z6L A;  1W4X A;  3NN6 X;  4G9K A;  4APN A;  2YVG A;  2BXR A;  3M12 A;  3H8L A;  1GES A;  1KF6 A;  3S61 A;  3GWD A;  3URH A;  3BI5 A;  3Q6J A;  3D8X A;  2X99 A;  3CNS A;  4BJY A;  1LPF A;  5JCI A;  2RGJ A;  3NTD A;  3D1C A;  3ICT A;  3NIX A;  1O95 A;  1ZMC A;  4FDC B;  4CY6 A;  3EAN A;  4KPR A;  3UTH A;  1NHS A;  2GB0 A;  2PHH A;  1B37 A;  1KDG A;  4YSY A;  3P4R A;  3NK2 X;  4A7A A;  5GSN A;  2GR3 A;  1YQZ A;  3CNP A;  3LJP A;  4A65 A;  2BXS A;  5BRT A;  5IPY A;  4USR A;  3QJ4 A;  4IVO B;  4EQW A;  4OPI A;  5HHF A;  3H8I A;  4GDE A;  1COY A;  1BKW A;  4HB9 A;  5U1O A;  5FS8 A;  1TDE A;  1JU2 A;  2BAB A;  3UTF A;  2Q7V A;  3RHA A;  2WOV A;  3BNM A;  3UKP A;  2WOW A;  2VRL A;  2X3N A;  4CBQ A;  1GRF A;  3DJJ A;  1NEN A;  4X4J A;  2HQM A;  2WP5 A;  1F6M A;  3QVP A;  3UOV A;  1EL7 A;  3ABV A;  3I6D A;  2Y6Q A;  4P9S A;  1EL9 A;  1GT8 A;  1PXA A;  4H4S A;  3UOZ A;  4EQX A;  5C2T A;  3AYI A;  4BUR A;  2WPC A;  2EQ6 A;  2RGO A;  4EM4 A;  5BVA A;  3NTA A;  4II2 A;  4U8O A;  1MO9 A;  2BC1 A;  4NEW A;  2IVD A;  1N1P A;  3T2Y A;  3VQR A;  5C3J A;  2XLU A;  1GRB A;  5CQF A;  4Z26 A;  1GRG A;  1ZOY A;  5M10 A;  4Z24 A;  4H2Q A;  1Q1R A;  4YKG A;  1FCD A;  2BA9 A;  1ELI A;  4H2R A;  3CTY A;  4XWZ A;  2WDV A;  2BCP A;  4GR1 A;  4DNA A;  3CN8 A;  1E6E A;  5LV9 A;  5BUL A;  1OJ9 A;  4YSH A;  2X8C A;  4H4X A;  1BGJ A;  1CJ4 A;  3DGZ A;  4WCT A;  1DOB A;  3AE1 A;  2WU5 A;  2YLZ A;  3SZ0 A;  4YT0 A;  2XFU A;  2WP9 A;  4RG3 A;  3O0H A;  5KOX A;  3AE6 A;  1GRE A;  2B9X A;  2XLP A;  1L9E A;  2C75 A;  3AWI A;  3RNM A;  3II4 A;  1CC4 A;  3G5S A;  1V59 A;  2AAQ A;  4FK1 C;  2X8G A;  4NTE A;  4U8N A;  2YG5 A;  2EQ9 A;  3P1W A;  1IJH A;  3ATQ A;  4GAP A;  3NYF A;  2A89 A;  3GSI A;  3GYJ A;  5KMS A;  4EQR A;  3CIR A;  3LZX A;  4DGK A;  2YWL A;  1JEH A;  1EL8 A;  3CPI G;  4XWR A;  3SFD A;  5L46 A;  1DXL A;  3AE8 A;  4HA6 A;  4RSL A;  4CY8 A;  1PBD A;  2DKI A;  3OZ2 A;  1OJD A;  2XVE A;  1GRH A;  3CNT A;  2GQW A;  3EAO A;  3NYE A;  1NAA A;  4K22 A;  3SM8 A;  1SEZ A;  2C3C A;  3AXB A;  2XVH A;  2GR0 A;  3DK8 A;  1L9C A;  5JCM A;  3AYJ A;  4ZCC A;  3GD3 A;  1D7Y A;  3V3O A;  3AEA A;  1VG9 A;  2XYO A;  2WPF A;  1CBO A;  1ZP0 A;  3AE4 A;  3K7T A;  3AEF A;  2C66 A;  3GDN A;  4K5S A;  1KNP A;  3UOX A;  3F8P A;  3SZC A;  1KSU A;  3AD7 B;  1RYI A;  1F8S A;  2WU2 A;  3NKS A;  4AOS A;  2YM2 A;  3K30 A;  4A6N A;  3B3R A;  2WHD A;  3AB1 A;  1PDH A;  4JN9 A;  3NT6 A;  4H4T A;  2ZZ0 A;  2XFQ A;  3CPH G;  1Y56 A;  3KPF A;  2ZZB A;  1D4D A;  2XVJ A;  2FBW A;  3ISH A;  2NVK X;  4EIQ A;  1YQ4 A;  3GRS A;  3RP6 A;  2R4J A;  3LXD A;  3NN0 X;  1D7L A;  4Z2T A;  2BAC A;  3GWF A;  4FK1 A;  4O5U A;  4ZN0 A;  2C76 A;  4EMW A;  1O94 A;  2OAL A;  4FX9 A;  5KVH A;  4Y4M A;  4U8J A;  1N4W A;  3UKK A;  2Z5Y A;  1LQT A;  4IV9 A;  4CCQ A;  1H7X A;  2ACZ A;  4RG4 A;  1GRA A;  2VQB A;  4B66 A;  4I59 A;  2ZBW A;  5KMQ A;  1GPE A;  2YG3 A;  1IUS A;  2XLS A;  3UKQ A;  1QJD A;  4UDP A;  3B6D A;  4OPU A;  4WX1 A;  1ZX9 A;  1PJ7 A;  2BYB A;  3AE3 A;  4A9W A;  3HYW A;  3AED A;  4J33 A;  1O5W A;  4O5Q A;  4CCR A;  3SYI A;  2YLX A;  4B69 A;  2V6O A;  4Y4N A;  4Z2U A;  5JCK A;  1S3E A;  4J31 A;  5HY5 A;  1NG3 A;  1TDK A;  3QFB A;  4YKF A;  2AR8 A;  4MJW A;  4BK2 A;  1VDC A;  1GSN A;  3IC9 A;  4ZCD A;  3T14 A;  2ARD A;  2YLW A;  2JB3 A;  2YR5 A;  2GEW A;  2YG7 A;  3SX6 A;  1X31 B;  1TYP A;  4D03 A;  1IUX A;  2BK4 A;  1MOK A;  2GVC A;  3ALJ A;  4CNK A;  1E1M A;  1E1L A;  4K2X A;  2XDO A;  3COX A;  5JCN A;  1BWC A;  4PAB A;  3AE9 A;  3QSS A;  3NK0 X;  4C74 A;  5KMR A;  3NH3 X;  4AT2 A;  4H2N A;  4EM3 A;  3R9U A;  2WBA A;  1CC6 A;  2BRA A;  2RAB A;  3CGD A;  1NEK A;  4OPL A;  1D4E A;  2YM1 A;  1GOS A;  4GDP A;  3ALM A;  1H84 A;  3LAD A;  1PJ5 A;  5EB4 A;  1NDA A;  2YVF A;  1HYU A;  3BHK A;  3RP8 A;  3K7M X;  4LA1 A;  3UKF A;  2WP6 A;  1GRT A;  1OJA A;  2YLR A;  3ADA B;  4YTM A;  2XFO A;  1ZDL A;  4C5O A;  2CFY A;  1N4V A;  4PAA A;  5U63 A;  2GR2 A;  4G6H A;  4U2S A;  2B7S A;  4J57 A;  1CJC A;  2BS3 A;  3P4S A;  3NLC A;  4A6N B;  4KX6 A;  4EMJ A;  2YLS A;  3GMB A;  3CPJ G;  1GET A;  2YR6 A;  3BI4 A;  1S3B A;  1ZKQ A;  3GDP A;  4M52 A;  4TM4 A;  5EBK A;  4YTN A;  2WES A;  4K8D A;  1OJC A;  3DJD A;  5EOW A;  1KFY A;  4U2T A;  5IQ4 A;  2CDU A;  3LOV A;  2GQF A;  3UOY A;  3NRN A;  4NZH A;  4X9N A;  2J3N A;  4B63 A;  1AOG A;  2VVM A;  4U8K A;  1Q1W A;  4OPD A;  3SXI A;  1GTE A;  2AQJ A;  2H88 A;  1NG4 A;  2C7G A;  5KWF A;  1Y0P A;  5KMP A;  1ZOV A;  3SZW A;  1S2Y A;  1PBC A;  2XVF A;  3SGL A;  5M0Z A;  4J2W A;  4H4Q A;  2A87 A;  4EIP A;  1LV0 A;  3KVE A;  1EL5 A;  2GRT A;  2TPR A;  3PO7 A;  3VRB A;  4BK3 A;  2Q0L A;  3GD4 A;  1GAL A;  4JY2 A;  3KPK A;  5KOW A;  3CGC A;  4C3Y A;  1F3P A;  3VRA A;  2DKH A;  3C4A A;  4TLZ A;  4D04 A;  4TM3 A;  4A99 A;  3AE5 A;  3C4N A;  1IUU A;  1E7P A;  3UP4 A;  1JRX A;  3DJE A;  3FPZ A;  3V3N A;  1H82 A;  3ALL A;  3CGB A;  1CJ3 A;  3QVR A;  3QFA A;  5EB5 A;  4B68 A;  4OVI A;  3VR9 A;  2VZ2 A;  4Z2R A;  1LTX R;  2BK3 A;  4H4Z A;  3DME A;  2QAE A;  2WQY A;  2JB1 A;  3P9U A;  3KU9 A;  5ER0 A;  3ITJ A;  2GAH B;  2Z5X A;  3NYC A;  5FMH A;  5KXJ A;  2BS2 A;  3I3L A;  2GR1 A;  3DJG X;  4EMI A;  1K0J A;  3IHM A;  4OPG A;  5J7X A;  2XCG A;  3BI2 A;  3PS9 A;  4ECH A;  5GRT A;  3EF6 A;  3SY4 A;  3AYL A;  3NHO X;  2CUL A;  3L1R A;  3BNU A;  3L8K A;  4J56 A;  1P2E A;  2WET A;  3AD9 B;  2I0Z A;  3NG7 X;  1GTH A;  3KD9 A;  4OPC A;  4TM1 A;  3V76 A;  3Q9T A;  1GV4 A;  3RP7 A;  3HYV A;  1XAN A;  2QA2 A;  1TDF A;  2XFP A;  2YQU A;  4U2L A;  2R0G A;  4U8L A;  4I58 A;  1DOD A;  4DSG A;  1KSS A;  1ONF A;  1JRY A;  3P4P A;  1K0I A;  3GRT A;  2YG4 A;  1K4Q A;  1PS9 A;  4XXG A;  1PBF A;  4U8P A;  1D4C A;  5CKU A;  3ZYX A;  1EBD A;  2VOU A;  1D5T A;  1Y56 B;  1DJN A;  2R46 A;  3T31 A;  4BV6 A;  4JNA A;  4H4R A;  4Z44 A;  4B67 A;  1K0L A;  4H4V A;  1E39 A;  2WDR A;  2NPX A;  2EQ8 A;  4JNQ A;  4U8M A;  4USQ A;  2WDQ A;  3SZF A;  5JCL A;  1P2H A;  5HYM A;  2EQ7 A;  2B7R A;  1XPQ A;  2XLT A;  1H86 A;  3IWA A;  3GYX A;  3F8D A;  2B9W A;  1N4U A;  2V60 A;  1DJQ A;  3FBS A;  1PBB A;  3GYI A;  2GH5 A;  1F8W A;  1L0V A;  3VR8 A;  3AEC A;  2UZZ A;  3UTG A;  4H4Y A;  2GF3 A;  2YG6 A;  3UKL A;  4EQS A;  4OCG A;  2CVJ A;  4J36 A;  4UDR A;  4C3X A;  3K7Q X;  4TLX A;  2JK6 A;  3NNE A;  1CL0 A;  1B8S A;  1CC2 A;  2IID A;  2VVL G;  2X50 A;  3JSK A;  4G73 A;  2Q6U A;  4G6G A;  4H4W A;  4JDR A;  1CJ2 A;  3FMW A;  2C3D A;  2GAG B;  1LVL A;  4YSZ A;  2APG A;  1CF3 A;  1PXC A;  1VQW A;  4JQ9 A;  4TM0 A;  1UKV G;  3CMM A;  1ZMD A;  4GRT A;  1GER A;  2BS4 A;  3F8R A;  4IVM B;  3ATR A;  1IUT A;  1GXF A;  1M6I A;  4DSH A;  2WPE A;  4H4P A;  3OC4 A;  5DBJ A;  4ADW A;  2C72 A;  2H89 A;  3NK1 X;  2FJD A;  1YY5 A;  5IQ1 A;  2FJB A;  1TYT A;  1B5Q A;  2GMJ A;  5TR3 A;  3EPT A;  3AEG A;  1BF3 A;  2BRY A;  2Y6R A;  3SQP A;  2GMH A;  3UP5 A;  1S2Q A;  2BC0 A;  4H2P A;  1PBE A;  2WS3 A;  2C64 A;  2V3B A;  3T2Z A;  4Y4L A;  3NGC X;  1NHR A;  3FIM B;  2VRM A;  2WOI A;  4N9X A;  5FS9 A;  1YQ3 A;  1QO8 A;  3DK9 A;  3M13 A;  3UTE A;  2B76 A;  3S5W A;  1REO A;  1OJT A;  1FEC A;  1TDN A;  3ICR A;  4H50 A;  4NTC A;  4B65 A;  4J34 A;  1GND A;  3P4Q A;  4CRT A;  2A8X A;  1QLB A;  1FEB A;  2VVL A;  2ZZC A;  2X8H A;  4AT0 A;  4NWZ A;  2IVE A;  2YVJ A;  1RP0 A;  3CGE A;  3UCL A;  2R0C A;  4AOX A;  2R0P A;  2V5Z A;  2XVI A;  1JOA A;  2WEU A;  2BK5 A;  1IUW A;  1IUV A;  3GMC A;  3ICS A;  4NNJ A;  3BHF A;  3AE2 A;  4U8I A;  1CHU A;  2XLR A;  4IA5 A;  3FG2 P;  3HYX A;  1BGN A;  4II3 A;  3KKJ A;  4A79 A;  1B4V A;  4B1B A;  4YSX A;  4REK A;  4H7U A;  2QA1 A;  1DNC A;  1XHC A;  4NTD A;  2E4G A;  2QCU A;  2YLT A;  4NEV A;  2BCG G;  3DGH A;  3KA7 A;  3T2K A;  2E5V A;  4GF7 A;  2OLO A;  4UDQ A;  3QSM A;  4AP1 A;  1XDI A;  3QSE A;  5FS7 A;  3VRD B;  4K5R A;  4GAV A;  5KNL A;  2JBV A;  3DH9 A;  2C4C A;  1PN0 A; 
#chains in the Genus database with same CATH homology
 2OLN A;  3AD8 B;  1NHQ A;  1PXB A;  2JB2 A;  2Q0K A;  3C96 A;  4H4U A;  5KRQ A;  1F8R A;  2YR4 A;  3IHG A;  1NHP A;  3AEE A;  1ZY8 A;  4GCM A;  4B64 A;  4YTP A;  3H4K A;  1ZK7 A;  1E1K A;  3LB8 A;  4CNJ A;  2YAU A;  4GUV A;  3SFE A;  1H6V A;  2RGH A;  3G5R A;  1FOH A;  5BUK A;  5FS6 A;  4YWO A;  1KNR A;  1DOC A;  1GEU A;  3PVC A;  1RSG A;  1PHH A;  4Z43 A;  4K7Z A;  3AE7 A;  4UP3 A;  3M0O A;  1LQU A;  4A5L A;  4Z25 A;  1YKJ A;  3LZW A;  5U25 A;  5J60 A;  2JKC A;  1JRZ A;  3RED A;  2JAE A;  1FL2 A;  2R9Z A;  3ZDN A;  2PYX A;  1TDO A;  4E0V A;  3E1T A;  2FJA A;  4LU6 A;  3CND A;  2W0H A;  4X9M A;  1H7W A;  2OA1 A;  4ICY A;  1H81 A;  1DOE A;  2GV8 A;  2R45 A;  3DK4 A;  1LJ1 A;  2R4E A;  3AEB A;  3G5Q A;  4IA6 A;  3T0K A;  1Q9I A;  1M64 A;  2B9Y A;  4YXD A;  3UKA A;  1MXT A;  3DA1 A;  3KLJ A;  4AP3 A;  1TRB A;  3T37 A;  3IF9 A;  1VRQ B;  3WE0 A;  1PJ6 A;  5KVI A;  2F5Z A;  2V61 A;  1JNR A;  1L9D A;  4C77 A;  2VQ7 A;  2C70 A;  1JNZ A;  1FEA A;  2TMD A;  4G74 A;  3HZL A;  4LII A;  1VG0 A;  1BZL A;  2E1M A;  3UKH A;  5HXI A;  2C65 A;  2O9Z A;  2OAM A;  4BJZ A;  1NPX A;  2FJE A;  1E1N A;  2V3A A;  4JY3 A;  4BK1 A;  2C73 A;  2C67 A;  2XFN A;  3CNJ A;  1H83 A;  4OPT A;  1Z6L A;  1W4X A;  3NN6 X;  4G9K A;  4APN A;  2YVG A;  2BXR A;  3M12 A;  3H8L A;  1GES A;  1KF6 A;  3S61 A;  3GWD A;  3URH A;  3BI5 A;  3Q6J A;  3D8X A;  2X99 A;  3CNS A;  4BJY A;  1LPF A;  5JCI A;  2RGJ A;  3NTD A;  3D1C A;  3ICT A;  3NIX A;  1O95 A;  1ZMC A;  4FDC B;  4CY6 A;  3EAN A;  4KPR A;  3UTH A;  1NHS A;  2GB0 A;  2PHH A;  1B37 A;  1KDG A;  4YSY A;  3P4R A;  3NK2 X;  4A7A A;  5GSN A;  2GR3 A;  1YQZ A;  3CNP A;  3LJP A;  4A65 A;  2BXS A;  5BRT A;  5IPY A;  4USR A;  3QJ4 A;  4IVO B;  4EQW A;  4OPI A;  5HHF A;  3H8I A;  4GDE A;  1COY A;  1BKW A;  4HB9 A;  5U1O A;  5FS8 A;  1TDE A;  1JU2 A;  2BAB A;  3UTF A;  2Q7V A;  3RHA A;  2WOV A;  3BNM A;  3UKP A;  2WOW A;  2VRL A;  2X3N A;  4CBQ A;  1GRF A;  3DJJ A;  1NEN A;  4X4J A;  2HQM A;  2WP5 A;  1F6M A;  3QVP A;  3UOV A;  1EL7 A;  3ABV A;  3I6D A;  2Y6Q A;  4P9S A;  1EL9 A;  1GT8 A;  1PXA A;  4H4S A;  3UOZ A;  4EQX A;  5C2T A;  3AYI A;  4BUR A;  2WPC A;  2EQ6 A;  2RGO A;  4EM4 A;  5BVA A;  3NTA A;  4II2 A;  4U8O A;  1MO9 A;  2BC1 A;  4NEW A;  2IVD A;  1N1P A;  3T2Y A;  3VQR A;  5C3J A;  2XLU A;  1GRB A;  5CQF A;  4Z26 A;  1GRG A;  1ZOY A;  5M10 A;  4Z24 A;  4H2Q A;  1Q1R A;  4YKG A;  1FCD A;  2BA9 A;  1ELI A;  4H2R A;  3CTY A;  4XWZ A;  2WDV A;  2BCP A;  4GR1 A;  4DNA A;  3CN8 A;  1E6E A;  5LV9 A;  5BUL A;  1OJ9 A;  4YSH A;  2X8C A;  4H4X A;  1BGJ A;  1CJ4 A;  3DGZ A;  4WCT A;  1DOB A;  3AE1 A;  2WU5 A;  2YLZ A;  3SZ0 A;  4YT0 A;  2XFU A;  2WP9 A;  4RG3 A;  3O0H A;  5KOX A;  3AE6 A;  1GRE A;  2B9X A;  2XLP A;  1L9E A;  2C75 A;  3AWI A;  3RNM A;  3II4 A;  1CC4 A;  3G5S A;  1V59 A;  2AAQ A;  4FK1 C;  2X8G A;  4NTE A;  4U8N A;  2YG5 A;  2EQ9 A;  3P1W A;  1IJH A;  3ATQ A;  4GAP A;  3NYF A;  2A89 A;  3GSI A;  3GYJ A;  5KMS A;  4EQR A;  3CIR A;  3LZX A;  4DGK A;  2YWL A;  1JEH A;  1EL8 A;  3CPI G;  4XWR A;  3SFD A;  5L46 A;  1DXL A;  3AE8 A;  4HA6 A;  4RSL A;  4CY8 A;  1PBD A;  2DKI A;  3OZ2 A;  1OJD A;  2XVE A;  1GRH A;  3CNT A;  2GQW A;  3EAO A;  3NYE A;  1NAA A;  4K22 A;  3SM8 A;  1SEZ A;  2C3C A;  3AXB A;  2XVH A;  2GR0 A;  3DK8 A;  1L9C A;  5JCM A;  3AYJ A;  4ZCC A;  3GD3 A;  1D7Y A;  3V3O A;  3AEA A;  1VG9 A;  2XYO A;  2WPF A;  1CBO A;  1ZP0 A;  3AE4 A;  3K7T A;  3AEF A;  2C66 A;  3GDN A;  4K5S A;  1KNP A;  3UOX A;  3F8P A;  3SZC A;  1KSU A;  3AD7 B;  1RYI A;  1F8S A;  2WU2 A;  3NKS A;  4AOS A;  2YM2 A;  3K30 A;  4A6N A;  3B3R A;  2WHD A;  3AB1 A;  1PDH A;  4JN9 A;  3NT6 A;  4H4T A;  2ZZ0 A;  2XFQ A;  3CPH G;  1Y56 A;  3KPF A;  2ZZB A;  1D4D A;  2XVJ A;  2FBW A;  3ISH A;  2NVK X;  4EIQ A;  1YQ4 A;  3GRS A;  3RP6 A;  2R4J A;  3LXD A;  3NN0 X;  1D7L A;  4Z2T A;  2BAC A;  3GWF A;  4FK1 A;  4O5U A;  4ZN0 A;  2C76 A;  4EMW A;  1O94 A;  2OAL A;  4FX9 A;  5KVH A;  4Y4M A;  4U8J A;  1N4W A;  3UKK A;  2Z5Y A;  1LQT A;  4IV9 A;  4CCQ A;  1H7X A;  2ACZ A;  4RG4 A;  1GRA A;  2VQB A;  4B66 A;  4I59 A;  2ZBW A;  5KMQ A;  1GPE A;  2YG3 A;  1IUS A;  2XLS A;  3UKQ A;  1QJD A;  4UDP A;  3B6D A;  4OPU A;  4WX1 A;  1ZX9 A;  1PJ7 A;  2BYB A;  3AE3 A;  4A9W A;  3HYW A;  3AED A;  4J33 A;  1O5W A;  4O5Q A;  4CCR A;  3SYI A;  2YLX A;  4B69 A;  2V6O A;  4Y4N A;  4Z2U A;  5JCK A;  1S3E A;  4J31 A;  5HY5 A;  1NG3 A;  1TDK A;  3QFB A;  4YKF A;  2AR8 A;  4MJW A;  4BK2 A;  1VDC A;  1GSN A;  3IC9 A;  4ZCD A;  3T14 A;  2ARD A;  2YLW A;  2JB3 A;  2YR5 A;  2GEW A;  2YG7 A;  3SX6 A;  1X31 B;  1TYP A;  4D03 A;  1IUX A;  2BK4 A;  1MOK A;  2GVC A;  3ALJ A;  4CNK A;  1E1M A;  1E1L A;  4K2X A;  2XDO A;  3COX A;  5JCN A;  1BWC A;  4PAB A;  3AE9 A;  3QSS A;  3NK0 X;  4C74 A;  5KMR A;  3NH3 X;  4AT2 A;  4H2N A;  4EM3 A;  3R9U A;  2WBA A;  1CC6 A;  2BRA A;  2RAB A;  3CGD A;  1NEK A;  4OPL A;  1D4E A;  2YM1 A;  1GOS A;  4GDP A;  3ALM A;  1H84 A;  3LAD A;  1PJ5 A;  5EB4 A;  1NDA A;  2YVF A;  1HYU A;  3BHK A;  3RP8 A;  3K7M X;  4LA1 A;  3UKF A;  2WP6 A;  1GRT A;  1OJA A;  2YLR A;  3ADA B;  4YTM A;  2XFO A;  1ZDL A;  4C5O A;  2CFY A;  1N4V A;  4PAA A;  5U63 A;  2GR2 A;  4G6H A;  4U2S A;  2B7S A;  4J57 A;  1CJC A;  2BS3 A;  3P4S A;  3NLC A;  4A6N B;  4KX6 A;  4EMJ A;  2YLS A;  3GMB A;  3CPJ G;  1GET A;  2YR6 A;  3BI4 A;  1S3B A;  1ZKQ A;  3GDP A;  4M52 A;  4TM4 A;  5EBK A;  4YTN A;  2WES A;  4K8D A;  1OJC A;  3DJD A;  5EOW A;  1KFY A;  4U2T A;  5IQ4 A;  2CDU A;  3LOV A;  2GQF A;  3UOY A;  3NRN A;  4NZH A;  4X9N A;  2J3N A;  4B63 A;  1AOG A;  2VVM A;  4U8K A;  1Q1W A;  4OPD A;  3SXI A;  1GTE A;  2AQJ A;  2H88 A;  1NG4 A;  2C7G A;  5KWF A;  1Y0P A;  5KMP A;  1ZOV A;  3SZW A;  1S2Y A;  1PBC A;  2XVF A;  3SGL A;  5M0Z A;  4J2W A;  4H4Q A;  2A87 A;  4EIP A;  1LV0 A;  3KVE A;  1EL5 A;  2GRT A;  2TPR A;  3PO7 A;  3VRB A;  4BK3 A;  2Q0L A;  3GD4 A;  1GAL A;  4JY2 A;  3KPK A;  5KOW A;  3CGC A;  4C3Y A;  1F3P A;  3VRA A;  2DKH A;  3C4A A;  4TLZ A;  4D04 A;  4TM3 A;  4A99 A;  3AE5 A;  3C4N A;  1IUU A;  1E7P A;  3UP4 A;  1JRX A;  3DJE A;  3FPZ A;  3V3N A;  1H82 A;  3ALL A;  3CGB A;  1CJ3 A;  3QVR A;  3QFA A;  5EB5 A;  4B68 A;  4OVI A;  3VR9 A;  2VZ2 A;  4Z2R A;  1LTX R;  2BK3 A;  4H4Z A;  3DME A;  2QAE A;  2WQY A;  2JB1 A;  3P9U A;  3KU9 A;  5ER0 A;  3ITJ A;  2GAH B;  2Z5X A;  3NYC A;  5FMH A;  5KXJ A;  2BS2 A;  3I3L A;  2GR1 A;  3DJG X;  4EMI A;  1K0J A;  3IHM A;  4OPG A;  5J7X A;  2XCG A;  3BI2 A;  3PS9 A;  4ECH A;  5GRT A;  3EF6 A;  3SY4 A;  3AYL A;  3NHO X;  2CUL A;  3L1R A;  3BNU A;  3L8K A;  4J56 A;  1P2E A;  2WET A;  3AD9 B;  2I0Z A;  3NG7 X;  1GTH A;  3KD9 A;  4OPC A;  4TM1 A;  3V76 A;  3Q9T A;  1GV4 A;  3RP7 A;  3HYV A;  1XAN A;  2QA2 A;  1TDF A;  2XFP A;  2YQU A;  4U2L A;  2R0G A;  4U8L A;  4I58 A;  1DOD A;  4DSG A;  1KSS A;  1ONF A;  1JRY A;  3P4P A;  1K0I A;  3GRT A;  2YG4 A;  1K4Q A;  1PS9 A;  4XXG A;  1PBF A;  4U8P A;  1D4C A;  5CKU A;  3ZYX A;  1EBD A;  2VOU A;  1D5T A;  1Y56 B;  1DJN A;  2R46 A;  3T31 A;  4BV6 A;  4JNA A;  4H4R A;  4Z44 A;  4B67 A;  1K0L A;  4H4V A;  1E39 A;  2WDR A;  2NPX A;  2EQ8 A;  4JNQ A;  4U8M A;  4USQ A;  2WDQ A;  3SZF A;  5JCL A;  1P2H A;  5HYM A;  2EQ7 A;  2B7R A;  1XPQ A;  2XLT A;  1H86 A;  3IWA A;  3GYX A;  3F8D A;  2B9W A;  1N4U A;  2V60 A;  1DJQ A;  3FBS A;  1PBB A;  3GYI A;  2GH5 A;  1F8W A;  1L0V A;  3VR8 A;  3AEC A;  2UZZ A;  3UTG A;  4H4Y A;  2GF3 A;  2YG6 A;  3UKL A;  4EQS A;  4OCG A;  2CVJ A;  4J36 A;  4UDR A;  4C3X A;  3K7Q X;  4TLX A;  2JK6 A;  3NNE A;  1CL0 A;  1B8S A;  1CC2 A;  2IID A;  2VVL G;  2X50 A;  3JSK A;  4G73 A;  2Q6U A;  4G6G A;  4H4W A;  4JDR A;  1CJ2 A;  3FMW A;  2C3D A;  2GAG B;  1LVL A;  4YSZ A;  2APG A;  1CF3 A;  1PXC A;  1VQW A;  4JQ9 A;  4TM0 A;  1UKV G;  3CMM A;  1ZMD A;  4GRT A;  1GER A;  2BS4 A;  3F8R A;  4IVM B;  3ATR A;  1IUT A;  1GXF A;  1M6I A;  4DSH A;  2WPE A;  4H4P A;  3OC4 A;  5DBJ A;  4ADW A;  2C72 A;  2H89 A;  3NK1 X;  2FJD A;  1YY5 A;  5IQ1 A;  2FJB A;  1TYT A;  1B5Q A;  2GMJ A;  5TR3 A;  3EPT A;  3AEG A;  1BF3 A;  2BRY A;  2Y6R A;  3SQP A;  2GMH A;  3UP5 A;  1S2Q A;  2BC0 A;  4H2P A;  1PBE A;  2WS3 A;  2C64 A;  2V3B A;  3T2Z A;  4Y4L A;  3NGC X;  1NHR A;  3FIM B;  2VRM A;  2WOI A;  4N9X A;  5FS9 A;  1YQ3 A;  1QO8 A;  3DK9 A;  3M13 A;  3UTE A;  2B76 A;  3S5W A;  1REO A;  1OJT A;  1FEC A;  1TDN A;  3ICR A;  4H50 A;  4NTC A;  4B65 A;  4J34 A;  1GND A;  3P4Q A;  4CRT A;  2A8X A;  1QLB A;  1FEB A;  2VVL A;  2ZZC A;  2X8H A;  4AT0 A;  4NWZ A;  2IVE A;  2YVJ A;  1RP0 A;  3CGE A;  3UCL A;  2R0C A;  4AOX A;  2R0P A;  2V5Z A;  2XVI A;  1JOA A;  2WEU A;  2BK5 A;  1IUW A;  1IUV A;  3GMC A;  3ICS A;  4NNJ A;  3BHF A;  3AE2 A;  4U8I A;  1CHU A;  2XLR A;  4IA5 A;  3FG2 P;  3HYX A;  1BGN A;  4II3 A;  3KKJ A;  4A79 A;  1B4V A;  4B1B A;  4YSX A;  4REK A;  4H7U A;  2QA1 A;  1DNC A;  1XHC A;  4NTD A;  2E4G A;  2QCU A;  2YLT A;  4NEV A;  2BCG G;  3DGH A;  3KA7 A;  3T2K A;  2E5V A;  4GF7 A;  2OLO A;  4UDQ A;  3QSM A;  4AP1 A;  1XDI A;  3QSE A;  5FS7 A;  3VRD B;  4K5R A;  4GAV A;  5KNL A;  2JBV A;  3DH9 A;  2C4C A;  1PN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...