2XLUA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with thionadp
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint-Functions of Protein Residues and Nadp(H) in Oxygen-Activation by Flavin-Containing Monooxygenase
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA02
2XFQA 4AOSA 4BK3A 3NKSA 3K7TA 4Z43A 1LVLA 2RGJA 2GR2A 2YG6A 1B4VA 4J56A 1N4VA 4K5SA 1N1PA 3ALJA 2WP5A 2GQFA 4YTPA 2FJEA 3AE4A 3EANA 4FDCB 5KOXA 1UKVG 3V76A 2VVMA 4K2XA 4AP3A 2GR3A 3DJJA 4GRTA 2BA9A 4AOXA 3CNJA 3QSMA 1JOAA 4DSHA 3NK2X 3CPIG 2IVEA 1H83A 5HXIA 2WDVA 3KKJA 5JCIA 4NTEA 1DOCA 2RABA 1GV4A 3AYIA 3II4A 3RP8A 4U8MA 4YT0A 4H2PA 1GPEA 1QJDA 3NG7X 1ZKQA 1EL8A 3AE8A 3CPJG 3UKFA 3SM8A 1ONFA 1M64A 3NTAA 2BCGG 3RHAA 3UKAA 3UP4A 2I0ZA 1F8RA 2BC1A 4DGKA 2CVJA 4K5RA 3H8IA 4H4PA 5GRTA 2R46A 2GRTA 4J34A 3UTHA 3UTGA 3GRSA 2YG5A 2PYXA 4B65A 1YKJA 3KLJA 2A89A 2V5ZA 3E1TA 1XANA 4LU6A 1ZOYA 2W0HA 4WCTA 2B9WA 1P2HA 2C65A 2V60A 1PJ5A 1NEKA 2Q6UA 1DOEA 1GRFA 2OAMA 3AECA 2Q7VA 4ZN0A 3FG2P 1BKWA 2Q0KA 2XLRA 5KVIA 1CC2A 1PBDA 1IUSA 3BI2A 3UOXA 4A6NA 3RP7A 2C66A 1N4UA 4YWOA 2GR1A 4KPRA 4A6NB 2WU2A 4CRTA 2GB0A 1D4DA 4OCGA 5FMHA 1PS9A 1CJ2A 2B9YA 2JB3A 2VOUA 2XLSA 5BUKA 4RG3A 2WBAA 1K4QA 4H50A 3D1CA 2YR6A 1H82A 2WOIA 1RYIA 1GRBA 1OJAA 3KA7A 4YTNA 4NTCA 3VQRA 1JNZA 1VDCA 3NT6A 3AD9B 1ELIA 4NEWA 4U8IA 1GNDA 3LXDA 4A5LA 5HHFA 1NENA 1PXAA 2WPEA 2AAQA 4CY8A 2GVCA 4BV6A 1ZMDA 2BXRA 5U63A 4U8PA 5J7XA 3GDNA 2CFYA 5HY5A 1KNPA 2WQYA 4Y4NA 2NPXA 2WP9A 2B76A 3GMCA 2XFOA 3QVRA 4JY3A 2CDUA 3T37A 4EQRA 4C77A 3GD4A 3ICTA 4JN9A 2YLTA 2XLUA 2Y6QA 4M52A 2QA1A 5TR3A 2XVHA 4CNKA 1E1KA 1LJ1A 1O94A 1PBFA 1ZX9A 2C76A 1FEBA 2VVLA 3AD8B 1E7PA 4BURA 1M6IA 2IVDA 3M0OA 3NHOX 4A79A 3OZ2A 3AYJA 4C5OA 3UKQA 1PN0A 2XLTA 3P9UA 1KF6A 3K7QX 3AWIA 1OJTA 5JCKA 4A65A 3H8LA 4GR1A 1IUTA 3P4QA 1GRTA 3PO7A 1NHRA 1JRXA 2C3DA 4YTMA 4Z26A 3QSEA 4U8OA 4CCRA 2WOWA 1D7LA 3C96A 2Q0LA 1K0LA 4B63A 3NTDA 5C2TA 3NGCX 1B5QA 2VQ7A 2GAHB 1IUWA 2VRLA 3AD7B 2OALA 4EIQA 2C75A 1CJCA 2BABA 2WDQA 3VR8A 4YKGA 1TDEA 3NK0X 4TM4A 3PS9A 5EOWA 2V3AA 3O0HA 5KXJA 1YY5A 1FEAA 1Q9IA 4NTDA 2RGHA 2BC0A 4Z25A 3NRNA 1N4WA 2XVIA 2E1MA 2EQ8A 3BNUA 3GSIA 2BACA 2NVKX 4YSYA 1B37A 2AR8A 4OPGA 4U2SA 2XVEA 4P9SA 1MO9A 3S5WA 2O9ZA 1GERA 3DJEA 4ECHA 1TYPA 2YVGA 2VRMA 2IIDA 4EQXA 2R4JA 3IF9A 1D4EA 3S61A 3SFDA 3DK4A 1XDIA 1JRYA 4H4TA 4H2RA 3M12A 3IHMA 2EQ6A 3CNSA 5KVHA 3G5SA 4CNJA 3IC9A 3AE5A 2XFUA 1OJCA 4H7UA 1GSNA 1CC6A 3IHGA 4USQA 1Y56A 4IA6A 2JB1A 1S2YA 1KFYA 1TRBA 2XDOA 4FK1A 4IV9A 3NYCA 1X31B 3ABVA 1NG4A 5BVAA 1Y56B 1H6VA 2H88A 2AQJA 2JAEA 4USRA 4Z2TA 2BS3A 5ER0A 3UOZA 2XVFA 1TDFA 2GR0A 2JBVA 2JB2A 3Q9TA 3QJ4A 1CC4A 4J36A 1CJ4A 4X9NA 4GF7A 4U8NA 4APNA 4CCQA 2JK6A 3CGBA 4N9XA 4AP1A 2YQUA 4TM1A 2VVLG 2YVFA 3BI5A 4TM3A 4YSHA 5M10A 2WESA 3LZXA 1KDGA 1MXTA 3FPZA 4Z24A 5U1OA 4TLZA 3CGEA 4AT2A 1D4CA 1NHPA 3NIXA 1F8SA 2X50A 3G5RA 4GCMA 2YLSA 1S3BA 4J31A 3GWFA 3REDA 1GETA 4GUVA 1OJDA 2BS2A 4IVMB 5EB4A 5HYMA 1CF3A 3DJDA 3UOYA 1IUVA 4EIPA 3M13A 1L9EA 3BHFA 2X8CA 4H4WA 3F8RA 1FECA 1FOHA 2XFPA 3AE6A 3FBSA 4HB9A 1PHHA 1PJ7A 1GRAA 3KVEA 1RP0A 4JQ9A 2ZZCA 2R9ZA 2RGOA 3ICSA 2R45A 4YSZA 1NHQA 2R0PA 3P1WA 3VRDB 5FS9A 1QO8A 3DMEA 4XWRA 1BWCA 1K0JA 4X9MA 3QFAA 5FS7A 1DOBA 1PXCA 1DNCA 4K8DA 2GF3A 4RG4A 2OA1A 3SFEA 1YQ4A 2BYBA 2ZZ0A 3BNMA 3ALLA 1GESA 4IVOB 4E0VA 2WP6A 3CGCA 4UDPA 5L46A 1BGJA 4IA5A 4Z44A 2V61A 1AOGA 2OLOA 2R0GA 4KX6A 3GYIA 1W4XA 3ZDNA 4C3YA 1JRZA 3RNMA 3NK1X 1LV0A 3AEBA 2XLPA 2YAUA 3I6DA 4Z2RA 2BK5A 2UZZA 1D7YA 2WU5A 4UP3A 2YLZA 3NYFA 4H4YA 1VRQB 2FJBA 1IUXA 4GDEA 4K22A 4REKA 3LJPA 3B3RA 1O95A 2BK4A 3CPHG 2CULA 5BULA 3AE1A 3QVPA 2R4EA 2BCPA 2Y6RA 3UKKA 2EQ7A 2WETA 5KWFA 5FS8A 1NHSA 1PDHA 2WS3A 3AB1A 4O5QA 3QSSA 3NN6X 3COXA 4NEVA 4J33A 4YXDA 3UKPA 1S3EA 3AE3A 4YSXA 3LADA 4NZHA 4RSLA 3KU9A 4XWZA 1ZMCA 1OJ9A 3DK8A 1YQ3A 4UDQA 1ZDLA 2FBWA 2YVJA 1CHUA 4PABA 3HZLA 2QA2A 2TPRA 4OPTA 2DKIA 3VRAA 4X4JA 1PJ6A 3OC4A 3PVCA 4EQWA 1GRGA 4JDRA 4B69A 3NNEA 4EQSA 3ITJA 1GTEA 1GRHA 2BS4A 2B7SA 3DGZA 3NH3X 2JKCA 2APGA 2ZZBA 1BF3A 1MOKA 2A8XA 1ZY8A 3CTYA 4FK1C 4CBQA 4Y4LA 1IJHA 2ACZA 3AE2A 3BHKA 5M0ZA 4XXGA 1PXBA 3GD3A 4OPLA 4Y4MA 5BRTA 1V59A 1GALA 3EAOA 4U8JA 3P4RA 4ICYA 1B8SA 1H7WA 1GEUA 3AYLA 1ZP0A 2F5ZA 1PBBA 2J3NA 2C67A 2YG3A 2E5VA 4H2NA 2GH5A 2WEUA 4Z2UA 1CL0A 2YM1A 3GYJA 2EQ9A 4U8LA 4B66A 2YR5A 2HQMA 2GV8A 4JNAA 1IUUA 5EBKA 1H81A 1E39A 3EF6A 3GWDA 4HA6A 5J60A 1KSUA 1F3PA 1Q1RA 2V6OA 2ZBWA 2FJAA 5FS6A 1BGNA 1LPFA 1GTHA 1XHCA 2QAEA 4I58A 2X3NA 1QLBA 1TDNA 4H4ZA 3P4SA 1D5TA 3SGLA 2BK3A 4OVIA 1VG9A 1XPQA 3NYEA 1H86A 4A99A 1Q1WA 1CBOA 2YWLA 3L8KA 1EL9A 2ARDA 4OPUA 4B67A 2GMHA 3GRTA 4BJYA 1CJ3A 4WX1A 2Z5XA 4C3XA 3GDPA 2XFNA 2C64A 4ZCDA 4PAAA 1DODA 3DJGX 2C73A 3IWAA 3DH9A 1NAAA 2C7GA 2BXSA 3LB8A 4H4RA 4A9WA 5IQ1A 3NN0X 3NLCA 1TDOA 4C74A 2B7RA 5IPYA 4FX9A 4D04A 4O5UA 1Y0PA 2YLRA 1JEHA 1EBDA 3F8PA 2GMJA 1SEZA 1H7XA 3LZWA 3CNDA 1NPXA 2A87A 4JNQA 2H89A 1VQWA 1F6MA 3C4NA 1O5WA 1KNRA 2YG4A 5GSNA 2R0CA 4EMJA 1PBEA 3V3OA 3V3NA 3AXBA 4EMWA 2Z5YA 4H4SA 3DGHA 4B64A 1NG3A 2GEWA 4ADWA 2YG7A 2X99A 3KPFA 4K7ZA 4OPCA 1GT8A 1HYUA 4EM3A 1LTXR 1REOA 4H4QA 3ICRA 3P4PA 2XCGA 2FJDA 3ADAB 3CGDA 2V3BA 1COYA 3DK9A 3I3LA 1LQTA 1L9CA 1LQUA 4JY2A 3UTEA 4A7AA 4ZCCA 1GOSA 4U8KA 1KSSA 2DKHA 2WOVA 2WDRA 3FMWA 3UOVA 4J2WA 3L1RA 3QFBA 2YM2A 3D8XA 1PBCA 3B6DA 4OPDA 4MJWA 3UKLA 3UTFA 4TM0A 4U2TA 3Q6JA 1E1NA 1NDAA 3WE0A 3RP6A 3BI4A 3URHA 3F8DA 1K0IA 1ZK7A 1ZOVA 1Z6LA 1JU2A 3H4KA 3CNPA 5CQFA 4EMIA 3R9UA 1BZLA 2YR4A 4H2QA 2XVJA 3AE9A 5U25A 3G5QA 3ATQA 4B68A 1TYTA 1H84A 5DBJA 5JCNA 1S2QA 5JCMA 4H4XA 3KD9A 4I59A 5KOWA 3ATRA 4OPIA 1E1MA 3C4AA 1E6EA 3AEAA 3DA1A 3VRBA 3ALMA 1GXFA 1EL5A 5C3JA 2WPCA 3AE7A 3K30A 4B1BA 1P2EA 2GAGB 1TDKA 2X8HA 2TMDA 1DXLA 2YLWA 2XYOA 1RSGA 3UCLA 5KRQA 3ISHA 1DJQA 2PHHA 2GQWA 3UKHA 3FIMB 3CN8A 4UDRA 4GDPA 2OLNA 1DJNA 1GREA 4BJZA 3VR9A 5CKUA 4BK1A 4D03A 1FCDA 2C70A 2QCUA 4DSGA 2VZ2A 5JCLA 3SQPA 4YKFA 3AEFA 1EL7A 1YQZA 2B9XA 3GMBA 3UP5A 5LV9A 1L9DA 4H4UA 4AT0A 4LA1A 4EM4A 2WPFA 2WHDA 3AEEA 3EPTA 3ZYXA 4BK2A 4LIIA 3AEGA 5IQ4A 3CNTA 1F8WA 4TLXA 1L0VA 4CY6A 1JNRA 2VQBA 2X8GA 3K7MX 4H4VA 2E4GA 2YLXA 2C3CA 2C72A 3JSKA 1VG0A 5EB5A 1E1LA 3CIRA 3AEDA 4J57A 1FL2A 4DNAA 4U2LA 3LOVA
chains in the Genus database with same CATH superfamily
2XFQA 4AOSA 4BK3A 3NKSA 3K7TA 4Z43A 1LVLA 2RGJA 2GR2A 2YG6A 1B4VA 4J56A 1N4VA 4K5SA 1N1PA 3ALJA 2WP5A 2GQFA 4YTPA 2FJEA 3AE4A 3EANA 4FDCB 5KOXA 1UKVG 3V76A 2VVMA 4K2XA 4AP3A 2GR3A 3DJJA 4GRTA 2BA9A 4AOXA 3CNJA 3QSMA 1JOAA 4DSHA 3NK2X 3CPIG 2IVEA 1H83A 5HXIA 2WDVA 3KKJA 5JCIA 4NTEA 1DOCA 2RABA 1GV4A 3AYIA 3II4A 3RP8A 4U8MA 4YT0A 4H2PA 1GPEA 1QJDA 4NWZA 3NG7X 1ZKQA 1EL8A 3AE8A 3CPJG 3UKFA 3SM8A 1ONFA 1M64A 3NTAA 2BCGG 3RHAA 3UKAA 3UP4A 2I0ZA 1F8RA 2BC1A 4DGKA 2CVJA 4K5RA 3T2KA 3H8IA 4H4PA 5GRTA 2R46A 2GRTA 4J34A 3UTHA 3UTGA 3GRSA 2YG5A 2PYXA 4B65A 1YKJA 3KLJA 3T31A 2A89A 2V5ZA 3E1TA 1XANA 4LU6A 3GYXA 1ZOYA 2W0HA 4WCTA 2B9WA 4II2A 1P2HA 2C65A 2V60A 1PJ5A 1NEKA 2Q6UA 1DOEA 1GRFA 2OAMA 3AECA 2Q7VA 4ZN0A 3FG2P 1BKWA 2Q0KA 2XLRA 5KVIA 1CC2A 1PBDA 1IUSA 3BI2A 3UOXA 4A6NA 3RP7A 2C66A 1N4UA 4YWOA 2GR1A 2BRYA 4KPRA 4A6NB 2WU2A 4CRTA 2GB0A 1D4DA 4OCGA 5FMHA 1PS9A 1CJ2A 2B9YA 2JB3A 2VOUA 2XLSA 5BUKA 4RG3A 2WBAA 1K4QA 4H50A 3D1CA 2YR6A 1H82A 2WOIA 1RYIA 1GRBA 1OJAA 3KA7A 4YTNA 4NTCA 3VQRA 1JNZA 1VDCA 3NT6A 3AD9B 1ELIA 4NEWA 4U8IA 1GNDA 3LXDA 4A5LA 5HHFA 1NENA 1PXAA 2WPEA 2AAQA 4CY8A 2GVCA 4BV6A 1ZMDA 2BXRA 5U63A 4U8PA 5J7XA 3GDNA 2CFYA 5HY5A 1KNPA 2WQYA 4Y4NA 2NPXA 2WP9A 2B76A 3GMCA 2XFOA 3QVRA 4JY3A 2CDUA 3T37A 4EQRA 4C77A 3GD4A 3ICTA 4JN9A 2YLTA 2XLUA 2Y6QA 4M52A 2QA1A 5TR3A 2XVHA 4CNKA 1E1KA 1LJ1A 1O94A 1PBFA 1ZX9A 2C76A 1FEBA 2VVLA 3AD8B 1E7PA 4BURA 1M6IA 2IVDA 3M0OA 3NHOX 3SXIA 3OZ2A 3AYJA 4A79A 3UKQA 4C5OA 1PN0A 2XLTA 3P9UA 1KF6A 3K7QX 3AWIA 1OJTA 5JCKA 4A65A 3H8LA 4GR1A 1IUTA 3P4QA 3T2YA 1GRTA 3PO7A 1NHRA 4G74A 1JRXA 2C3DA 4YTMA 4Z26A 3QSEA 4U8OA 4CCRA 2WOWA 1D7LA 3C96A 2Q0LA 1K0LA 4B63A 3NTDA 5C2TA 3NGCX 1B5QA 2VQ7A 2GAHB 1IUWA 2VRLA 3AD7B 2OALA 4EIQA 2C75A 1CJCA 2BABA 2WDQA 3VR8A 4YKGA 3HYWA 1TDEA 3NK0X 4TM4A 3PS9A 5EOWA 2V3AA 3O0HA 5KXJA 1YY5A 1FEAA 1Q9IA 4NTDA 2RGHA 2BC0A 4Z25A 3NRNA 1N4WA 2XVIA 2E1MA 2EQ8A 3BNUA 3GSIA 2BACA 2NVKX 3SZ0A 1B37A 2AR8A 4OPGA 4U2SA 4YSYA 2XVEA 4P9SA 1MO9A 3S5WA 2O9ZA 1GERA 3DJEA 4ECHA 1TYPA 2YVGA 2VRMA 2IIDA 4EQXA 2R4JA 3IF9A 1D4EA 3S61A 3SFDA 3DK4A 1XDIA 1JRYA 4H4TA 4H2RA 3M12A 3IHMA 2EQ6A 3CNSA 5KVHA 3G5SA 4CNJA 3IC9A 3AE5A 2XFUA 1OJCA 4H7UA 1GSNA 1CC6A 3IHGA 4USQA 1Y56A 4IA6A 2JB1A 1S2YA 1KFYA 1TRBA 2XDOA 4FK1A 4IV9A 3NYCA 1X31B 3ABVA 1NG4A 5BVAA 1Y56B 1H6VA 2H88A 2AQJA 2JAEA 4USRA 3SZCA 4Z2TA 5KMRA 2BS3A 5ER0A 3UOZA 2XVFA 1TDFA 2GR0A 2JBVA 2JB2A 3Q9TA 3QJ4A 1CC4A 4J36A 1CJ4A 4X9NA 4GF7A 4U8NA 4APNA 4CCQA 2JK6A 3CGBA 4N9XA 4AP1A 2YQUA 4TM1A 2VVLG 2YVFA 3BI5A 4TM3A 4YSHA 5M10A 2WESA 3LZXA 1KDGA 1MXTA 3FPZA 4Z24A 5U1OA 4TLZA 3CGEA 4AT2A 1D4CA 1NHPA 3NIXA 1F8SA 2X50A 3G5RA 4GCMA 2YLSA 1S3BA 4G6GA 4J31A 3GWFA 3REDA 1GETA 4GUVA 1OJDA 3KPKA 3SZWA 2BS2A 4IVMB 5EB4A 5HYMA 1CF3A 3DJDA 3UOYA 1IUVA 4EIPA 3M13A 1L9EA 3BHFA 4GAPA 2X8CA 4H4WA 3F8RA 1FECA 1FOHA 2XFPA 3HYXA 3AE6A 3FBSA 4HB9A 1PHHA 1PJ7A 1GRAA 4GAVA 3KVEA 1RP0A 4JQ9A 2ZZCA 2R9ZA 2RGOA 3ICSA 2R45A 4YSZA 1NHQA 2R0PA 3P1WA 3VRDB 5FS9A 1QO8A 3DMEA 4XWRA 1BWCA 1K0JA 4X9MA 3QFAA 5FS7A 1DOBA 1PXCA 1DNCA 4K8DA 2GF3A 4RG4A 2OA1A 3SFEA 1YQ4A 2BYBA 2ZZ0A 3BNMA 3ALLA 1GESA 4IVOB 4E0VA 2WP6A 3CGCA 4UDPA 5L46A 1BGJA 4IA5A 4Z44A 2V61A 1AOGA 2OLOA 2R0GA 4KX6A 3GYIA 5KMSA 1W4XA 3ZDNA 4C3YA 1JRZA 3RNMA 3NK1X 1LV0A 3AEBA 2XLPA 2YAUA 3I6DA 4Z2RA 2BK5A 2UZZA 1D7YA 2WU5A 4UP3A 2YLZA 3NYFA 4H4YA 1VRQB 2FJBA 5KNLA 1IUXA 4GDEA 4K22A 4REKA 3LJPA 3B3RA 1O95A 2BK4A 3CPHG 2CULA 5BULA 3AE1A 3QVPA 2R4EA 2BCPA 2Y6RA 3UKKA 2EQ7A 2WETA 5KWFA 5FS8A 2BRAA 1NHSA 1PDHA 2WS3A 3AB1A 4O5QA 3QSSA 3NN6X 3COXA 4NEVA 4J33A 4YXDA 3UKPA 1S3EA 3AE3A 4YSXA 3LADA 4NZHA 4RSLA 3KU9A 4XWZA 1ZMCA 1OJ9A 3DK8A 1YQ3A 4UDQA 1ZDLA 2FBWA 2YVJA 1CHUA 4PABA 3T0KA 3HZLA 2QA2A 2TPRA 4OPTA 2DKIA 3VRAA 4X4JA 1PJ6A 3OC4A 3PVCA 4EQWA 1GRGA 4JDRA 4B69A 3NNEA 4EQSA 3ITJA 4G9KA 1GTEA 1GRHA 2BS4A 2B7SA 3DGZA 3NH3X 2JKCA 3SZFA 2APGA 2ZZBA 1BF3A 1MOKA 2A8XA 1ZY8A 3CTYA 4FK1C 4CBQA 4Y4LA 1IJHA 2ACZA 3AE2A 3BHKA 5M0ZA 4XXGA 1PXBA 3GD3A 4OPLA 4Y4MA 5BRTA 1V59A 1GALA 3EAOA 4U8JA 3P4RA 4ICYA 1B8SA 1H7WA 1GEUA 3AYLA 1ZP0A 2F5ZA 1PBBA 2J3NA 3SYIA 2C67A 2YG3A 2E5VA 4H2NA 2GH5A 2WEUA 4Z2UA 1CL0A 2YM1A 3GYJA 2EQ9A 4U8LA 4B66A 2YR5A 2HQMA 2GV8A 4JNAA 1IUUA 5EBKA 1H81A 1E39A 3EF6A 3GWDA 4HA6A 5J60A 1KSUA 1F3PA 1Q1RA 2V6OA 2ZBWA 2FJAA 5FS6A 1BGNA 3T14A 1LPFA 1GTHA 1XHCA 2QAEA 4I58A 2X3NA 1QLBA 1TDNA 4G73A 3SY4A 4H4ZA 3SX6A 3P4SA 1D5TA 3SGLA 2BK3A 4OVIA 1VG9A 1XPQA 3NYEA 1H86A 4A99A 1Q1WA 1CBOA 2YWLA 3L8KA 1EL9A 2ARDA 4OPUA 4B67A 2GMHA 3GRTA 4BJYA 1CJ3A 4WX1A 2Z5XA 4C3XA 3GDPA 2XFNA 2C64A 4ZCDA 4PAAA 1DODA 3DJGX 2C73A 3IWAA 4NNJA 3DH9A 1NAAA 2C7GA 2BXSA 3LB8A 4H4RA 4A9WA 5IQ1A 3NN0X 3NLCA 1TDOA 4C74A 2B7RA 5IPYA 4FX9A 4D04A 4O5UA 1Y0PA 2YLRA 1JEHA 1EBDA 3F8PA 2GMJA 1SEZA 1H7XA 3LZWA 3CNDA 1NPXA 2A87A 4JNQA 2H89A 1VQWA 1F6MA 3C4NA 1O5WA 1KNRA 2YG4A 5GSNA 2R0CA 4EMJA 1PBEA 3V3OA 3V3NA 3AXBA 4EMWA 2Z5YA 4H4SA 3DGHA 4B64A 1NG3A 2GEWA 4ADWA 2YG7A 2X99A 3KPFA 4K7ZA 4OPCA 1GT8A 1HYUA 4EM3A 1LTXR 1REOA 4H4QA 3ICRA 3P4PA 2XCGA 2FJDA 2C4CA 3ADAB 3CGDA 2V3BA 1COYA 3DK9A 3I3LA 1LQTA 1L9CA 1LQUA 4JY2A 3T2ZA 3UTEA 4A7AA 4ZCCA 1GOSA 4U8KA 1KSSA 2DKHA 2WOVA 2WDRA 3FMWA 3UOVA 4J2WA 3L1RA 3QFBA 2YM2A 3D8XA 1PBCA 3B6DA 4OPDA 4MJWA 3UKLA 3UTFA 4TM0A 4U2TA 3Q6JA 1E1NA 1NDAA 3WE0A 5KMQA 3RP6A 3BI4A 3URHA 3F8DA 1K0IA 1ZK7A 1ZOVA 1Z6LA 1JU2A 3H4KA 3CNPA 4G6HA 5CQFA 4EMIA 3R9UA 1BZLA 2YR4A 4H2QA 2XVJA 3AE9A 5U25A 3G5QA 3ATQA 4B68A 1TYTA 1H84A 5DBJA 5JCNA 1S2QA 5JCMA 4H4XA 3KD9A 4I59A 5KOWA 3ATRA 3HYVA 1E1MA 3C4AA 4OPIA 1E6EA 3AEAA 3DA1A 3VRBA 3ALMA 1GXFA 1EL5A 5C3JA 2WPCA 3AE7A 3K30A 4B1BA 1P2EA 2GAGB 1TDKA 2X8HA 2TMDA 1DXLA 2YLWA 2XYOA 1RSGA 3UCLA 5KRQA 3ISHA 1DJQA 4II3A 2PHHA 2GQWA 3UKHA 3FIMB 3CN8A 4UDRA 4GDPA 2OLNA 1DJNA 1GREA 4BJZA 3VR9A 5CKUA 5KMPA 4BK1A 4D03A 1FCDA 2C70A 2QCUA 4DSGA 2VZ2A 5JCLA 3SQPA 4YKFA 3AEFA 1EL7A 1YQZA 2B9XA 3GMBA 3UP5A 5LV9A 1L9DA 4H4UA 4AT0A 4LA1A 4EM4A 2WPFA 2WHDA 3AEEA 3EPTA 3ZYXA 4BK2A 4LIIA 3AEGA 5IQ4A 3CNTA 1F8WA 4TLXA 1L0VA 4CY6A 1JNRA 2VQBA 2X8GA 3K7MX 4H4VA 2E4GA 2YLXA 2C3CA 3CMMA 2C72A 3JSKA 1VG0A 5EB5A 1E1LA 3CIRA 3AEDA 4J57A 1FL2A 4DNAA 4U2LA 3LOVA
chains in the Genus database with same CATH topology
2XFQA 4AOSA 4BK3A 3NKSA 3K7TA 4Z43A 1LVLA 2RGJA 2GR2A 2YG6A 1B4VA 4J56A 1N4VA 4K5SA 1N1PA 3ALJA 2WP5A 2GQFA 4YTPA 2FJEA 3AE4A 3EANA 4FDCB 5KOXA 1UKVG 3V76A 2VVMA 4K2XA 4AP3A 2GR3A 3DJJA 4GRTA 2BA9A 4AOXA 3CNJA 3QSMA 1JOAA 4DSHA 3NK2X 3CPIG 2IVEA 1H83A 5HXIA 2WDVA 3KKJA 5JCIA 4NTEA 1DOCA 2RABA 1GV4A 3AYIA 3II4A 3RP8A 4U8MA 4YT0A 4H2PA 1GPEA 1QJDA 4NWZA 3NG7X 1ZKQA 1EL8A 3AE8A 3CPJG 3UKFA 3SM8A 1ONFA 1M64A 3NTAA 2BCGG 3RHAA 3UKAA 3UP4A 2I0ZA 1F8RA 2BC1A 4DGKA 2CVJA 4K5RA 3T2KA 3H8IA 4H4PA 5GRTA 2R46A 2GRTA 4J34A 3UTHA 3UTGA 3GRSA 2YG5A 2PYXA 4B65A 1YKJA 3KLJA 3T31A 2A89A 2V5ZA 3E1TA 1XANA 4LU6A 3GYXA 1ZOYA 2W0HA 4WCTA 2B9WA 4II2A 1P2HA 2C65A 2V60A 1PJ5A 1NEKA 2Q6UA 1DOEA 1GRFA 2OAMA 3AECA 2Q7VA 4ZN0A 3FG2P 1BKWA 2Q0KA 2XLRA 5KVIA 1CC2A 1PBDA 1IUSA 3BI2A 3UOXA 4A6NA 3RP7A 2C66A 1N4UA 4YWOA 2GR1A 2BRYA 4KPRA 4A6NB 2WU2A 4CRTA 2GB0A 1D4DA 4OCGA 5FMHA 1PS9A 1CJ2A 2B9YA 2JB3A 2VOUA 2XLSA 5BUKA 4RG3A 2WBAA 1K4QA 4H50A 3D1CA 2YR6A 1H82A 2WOIA 1RYIA 1GRBA 1OJAA 3KA7A 4YTNA 4NTCA 3VQRA 1JNZA 1VDCA 3NT6A 3AD9B 1ELIA 4NEWA 4U8IA 1GNDA 3LXDA 4A5LA 5HHFA 1NENA 1PXAA 2WPEA 2AAQA 4CY8A 2GVCA 4BV6A 1ZMDA 2BXRA 5U63A 4U8PA 5J7XA 3GDNA 2CFYA 5HY5A 1KNPA 2WQYA 4Y4NA 2NPXA 2WP9A 2B76A 3GMCA 2XFOA 3QVRA 4JY3A 2CDUA 3T37A 4EQRA 4C77A 3GD4A 3ICTA 4JN9A 2YLTA 2XLUA 2Y6QA 4M52A 2QA1A 5TR3A 2XVHA 4CNKA 1E1KA 1LJ1A 1O94A 1PBFA 1ZX9A 2C76A 1FEBA 2VVLA 3AD8B 1E7PA 4BURA 1M6IA 2IVDA 3M0OA 3NHOX 3SXIA 3OZ2A 3AYJA 4A79A 3UKQA 4C5OA 1PN0A 2XLTA 3P9UA 1KF6A 3K7QX 3AWIA 1OJTA 5JCKA 4A65A 3H8LA 4GR1A 1IUTA 3P4QA 3T2YA 1GRTA 3PO7A 1NHRA 4G74A 1JRXA 2C3DA 4YTMA 4Z26A 3QSEA 4U8OA 4CCRA 2WOWA 1D7LA 3C96A 2Q0LA 1K0LA 4B63A 3NTDA 5C2TA 3NGCX 1B5QA 2VQ7A 2GAHB 1IUWA 2VRLA 3AD7B 2OALA 4EIQA 2C75A 1CJCA 2BABA 2WDQA 3VR8A 4YKGA 3HYWA 1TDEA 3NK0X 4TM4A 3PS9A 5EOWA 2V3AA 3O0HA 5KXJA 1YY5A 1FEAA 1Q9IA 4NTDA 2RGHA 2BC0A 4Z25A 3NRNA 1N4WA 2XVIA 2E1MA 2EQ8A 3BNUA 3GSIA 2BACA 2NVKX 3SZ0A 1B37A 2AR8A 4OPGA 4U2SA 4YSYA 2XVEA 4P9SA 1MO9A 3S5WA 2O9ZA 1GERA 3DJEA 4ECHA 1TYPA 2YVGA 2VRMA 2IIDA 4EQXA 2R4JA 3IF9A 1D4EA 3S61A 3SFDA 3DK4A 1XDIA 1JRYA 4H4TA 4H2RA 3M12A 3IHMA 2EQ6A 3CNSA 5KVHA 3G5SA 4CNJA 3IC9A 3AE5A 2XFUA 1OJCA 4H7UA 1GSNA 1CC6A 3IHGA 4USQA 1Y56A 4IA6A 2JB1A 1S2YA 1KFYA 1TRBA 2XDOA 4FK1A 4IV9A 3NYCA 1X31B 3ABVA 1NG4A 5BVAA 1Y56B 1H6VA 2H88A 2AQJA 2JAEA 4USRA 3SZCA 4Z2TA 5KMRA 2BS3A 5ER0A 3UOZA 2XVFA 1TDFA 2GR0A 2JBVA 2JB2A 3Q9TA 3QJ4A 1CC4A 4J36A 1CJ4A 4X9NA 4GF7A 4U8NA 4APNA 4CCQA 2JK6A 3CGBA 4N9XA 4AP1A 2YQUA 4TM1A 2VVLG 2YVFA 3BI5A 4TM3A 4YSHA 5M10A 2WESA 3LZXA 1KDGA 1MXTA 3FPZA 4Z24A 5U1OA 4TLZA 3CGEA 4AT2A 1D4CA 1NHPA 3NIXA 1F8SA 2X50A 3G5RA 4GCMA 2YLSA 1S3BA 4G6GA 4J31A 3GWFA 3REDA 1GETA 4GUVA 1OJDA 3KPKA 3SZWA 2BS2A 4IVMB 5EB4A 5HYMA 1CF3A 3DJDA 3UOYA 1IUVA 4EIPA 3M13A 1L9EA 3BHFA 4GAPA 2X8CA 4H4WA 3F8RA 1FECA 1FOHA 2XFPA 3HYXA 3AE6A 3FBSA 4HB9A 1PHHA 1PJ7A 1GRAA 4GAVA 3KVEA 1RP0A 4JQ9A 2ZZCA 2R9ZA 2RGOA 3ICSA 2R45A 4YSZA 1NHQA 2R0PA 3P1WA 3VRDB 5FS9A 1QO8A 3DMEA 4XWRA 1BWCA 1K0JA 4X9MA 3QFAA 5FS7A 1DOBA 1PXCA 1DNCA 4K8DA 2GF3A 4RG4A 2OA1A 3SFEA 1YQ4A 2BYBA 2ZZ0A 3BNMA 3ALLA 1GESA 4IVOB 4E0VA 2WP6A 3CGCA 4UDPA 5L46A 1BGJA 4IA5A 4Z44A 2V61A 1AOGA 2OLOA 2R0GA 4KX6A 3GYIA 5KMSA 1W4XA 3ZDNA 4C3YA 1JRZA 3RNMA 3NK1X 1LV0A 3AEBA 2XLPA 2YAUA 3I6DA 4Z2RA 2BK5A 2UZZA 1D7YA 2WU5A 4UP3A 2YLZA 3NYFA 4H4YA 1VRQB 2FJBA 5KNLA 1IUXA 4GDEA 4K22A 4REKA 3LJPA 3B3RA 1O95A 2BK4A 3CPHG 2CULA 5BULA 3AE1A 3QVPA 2R4EA 2BCPA 2Y6RA 3UKKA 2EQ7A 2WETA 5KWFA 5FS8A 2BRAA 1NHSA 1PDHA 2WS3A 3AB1A 4O5QA 3QSSA 3NN6X 3COXA 4NEVA 4J33A 4YXDA 3UKPA 1S3EA 3AE3A 4YSXA 3LADA 4NZHA 4RSLA 3KU9A 4XWZA 1ZMCA 1OJ9A 3DK8A 1YQ3A 4UDQA 1ZDLA 2FBWA 2YVJA 1CHUA 4PABA 3T0KA 3HZLA 2QA2A 2TPRA 4OPTA 2DKIA 3VRAA 4X4JA 1PJ6A 3OC4A 3PVCA 4EQWA 1GRGA 4JDRA 4B69A 3NNEA 4EQSA 3ITJA 4G9KA 1GTEA 1GRHA 2BS4A 2B7SA 3DGZA 3NH3X 2JKCA 3SZFA 2APGA 2ZZBA 1BF3A 1MOKA 2A8XA 1ZY8A 3CTYA 4FK1C 4CBQA 4Y4LA 1IJHA 2ACZA 3AE2A 3BHKA 5M0ZA 4XXGA 1PXBA 3GD3A 4OPLA 4Y4MA 5BRTA 1V59A 1GALA 3EAOA 4U8JA 3P4RA 4ICYA 1B8SA 1H7WA 1GEUA 3AYLA 1ZP0A 2F5ZA 1PBBA 2J3NA 3SYIA 2C67A 2YG3A 2E5VA 4H2NA 2GH5A 2WEUA 4Z2UA 1CL0A 2YM1A 3GYJA 2EQ9A 4U8LA 4B66A 2YR5A 2HQMA 2GV8A 4JNAA 1IUUA 5EBKA 1H81A 1E39A 3EF6A 3GWDA 4HA6A 5J60A 1KSUA 1F3PA 1Q1RA 2V6OA 2ZBWA 2FJAA 5FS6A 1BGNA 3T14A 1LPFA 1GTHA 1XHCA 2QAEA 4I58A 2X3NA 1QLBA 1TDNA 4G73A 3SY4A 4H4ZA 3SX6A 3P4SA 1D5TA 3SGLA 2BK3A 4OVIA 1VG9A 1XPQA 3NYEA 1H86A 4A99A 1Q1WA 1CBOA 2YWLA 3L8KA 1EL9A 2ARDA 4OPUA 4B67A 2GMHA 3GRTA 4BJYA 1CJ3A 4WX1A 2Z5XA 4C3XA 3GDPA 2XFNA 2C64A 4ZCDA 4PAAA 1DODA 3DJGX 2C73A 3IWAA 4NNJA 3DH9A 1NAAA 2C7GA 2BXSA 3LB8A 4H4RA 4A9WA 5IQ1A 3NN0X 3NLCA 1TDOA 4C74A 2B7RA 5IPYA 4FX9A 4D04A 4O5UA 1Y0PA 2YLRA 1JEHA 1EBDA 3F8PA 2GMJA 1SEZA 1H7XA 3LZWA 3CNDA 1NPXA 2A87A 4JNQA 2H89A 1VQWA 1F6MA 3C4NA 1O5WA 1KNRA 2YG4A 5GSNA 2R0CA 4EMJA 1PBEA 3V3OA 3V3NA 3AXBA 4EMWA 2Z5YA 4H4SA 3DGHA 4B64A 1NG3A 2GEWA 4ADWA 2YG7A 2X99A 3KPFA 4K7ZA 4OPCA 1GT8A 1HYUA 4EM3A 1LTXR 1REOA 4H4QA 3ICRA 3P4PA 2XCGA 2FJDA 2C4CA 3ADAB 3CGDA 2V3BA 1COYA 3DK9A 3I3LA 1LQTA 1L9CA 1LQUA 4JY2A 3T2ZA 3UTEA 4A7AA 4ZCCA 1GOSA 4U8KA 1KSSA 2DKHA 2WOVA 2WDRA 3FMWA 3UOVA 4J2WA 3L1RA 3QFBA 2YM2A 3D8XA 1PBCA 3B6DA 4OPDA 4MJWA 3UKLA 3UTFA 4TM0A 4U2TA 3Q6JA 1E1NA 1NDAA 3WE0A 5KMQA 3RP6A 3BI4A 3URHA 3F8DA 1K0IA 1ZK7A 1ZOVA 1Z6LA 1JU2A 3H4KA 3CNPA 4G6HA 5CQFA 4EMIA 3R9UA 1BZLA 2YR4A 4H2QA 2XVJA 3AE9A 5U25A 3G5QA 3ATQA 4B68A 1TYTA 1H84A 5DBJA 5JCNA 1S2QA 5JCMA 4H4XA 3KD9A 4I59A 5KOWA 3ATRA 3HYVA 1E1MA 3C4AA 4OPIA 1E6EA 3AEAA 3DA1A 3VRBA 3ALMA 1GXFA 1EL5A 5C3JA 2WPCA 3AE7A 3K30A 4B1BA 1P2EA 2GAGB 1TDKA 2X8HA 2TMDA 1DXLA 2YLWA 2XYOA 1RSGA 3UCLA 5KRQA 3ISHA 1DJQA 4II3A 2PHHA 2GQWA 3UKHA 3FIMB 3CN8A 4UDRA 4GDPA 2OLNA 1DJNA 1GREA 4BJZA 3VR9A 5CKUA 5KMPA 4BK1A 4D03A 1FCDA 2C70A 2QCUA 4DSGA 2VZ2A 5JCLA 3SQPA 4YKFA 3AEFA 1EL7A 1YQZA 2B9XA 3GMBA 3UP5A 5LV9A 1L9DA 4H4UA 4AT0A 4LA1A 4EM4A 2WPFA 2WHDA 3AEEA 3EPTA 3ZYXA 4BK2A 4LIIA 3AEGA 5IQ4A 3CNTA 1F8WA 4TLXA 1L0VA 4CY6A 1JNRA 2VQBA 2X8GA 3K7MX 4H4VA 2E4GA 2YLXA 2C3CA 3CMMA 2C72A 3JSKA 1VG0A 5EB5A 1E1LA 3CIRA 3AEDA 4J57A 1FL2A 4DNAA 4U2LA 3LOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFQ A;  4AOS A;  4BK3 A;  3NKS A;  3K7T A;  4Z43 A;  1LVL A;  2RGJ A;  2GR2 A;  2YG6 A;  1B4V A;  4J56 A;  1N4V A;  4K5S A;  1N1P A;  3ALJ A;  2WP5 A;  2GQF A;  4YTP A;  2FJE A;  3AE4 A;  3EAN A;  4FDC B;  5KOX A;  1UKV G;  3V76 A;  2VVM A;  4K2X A;  4AP3 A;  2GR3 A;  3DJJ A;  4GRT A;  2BA9 A;  4AOX A;  3CNJ A;  3QSM A;  1JOA A;  4DSH A;  3NK2 X;  3CPI G;  2IVE A;  1H83 A;  5HXI A;  2WDV A;  3KKJ A;  5JCI A;  4NTE A;  1DOC A;  2RAB A;  1GV4 A;  3AYI A;  3II4 A;  3RP8 A;  4U8M A;  4YT0 A;  4H2P A;  1GPE A;  1QJD A;  3NG7 X;  1ZKQ A;  1EL8 A;  3AE8 A;  3CPJ G;  3UKF A;  3SM8 A;  1ONF A;  1M64 A;  3NTA A;  2BCG G;  3RHA A;  3UKA A;  3UP4 A;  2I0Z A;  1F8R A;  2BC1 A;  4DGK A;  2CVJ A;  4K5R A;  3H8I A;  4H4P A;  5GRT A;  2R46 A;  2GRT A;  4J34 A;  3UTH A;  3UTG A;  3GRS A;  2YG5 A;  2PYX A;  4B65 A;  1YKJ A;  3KLJ A;  2A89 A;  2V5Z A;  3E1T A;  1XAN A;  4LU6 A;  1ZOY A;  2W0H A;  4WCT A;  2B9W A;  1P2H A;  2C65 A;  2V60 A;  1PJ5 A;  1NEK A;  2Q6U A;  1DOE A;  1GRF A;  2OAM A;  3AEC A;  2Q7V A;  4ZN0 A;  3FG2 P;  1BKW A;  2Q0K A;  2XLR A;  5KVI A;  1CC2 A;  1PBD A;  1IUS A;  3BI2 A;  3UOX A;  4A6N A;  3RP7 A;  2C66 A;  1N4U A;  4YWO A;  2GR1 A;  4KPR A;  4A6N B;  2WU2 A;  4CRT A;  2GB0 A;  1D4D A;  4OCG A;  5FMH A;  1PS9 A;  1CJ2 A;  2B9Y A;  2JB3 A;  2VOU A;  2XLS A;  5BUK A;  4RG3 A;  2WBA A;  1K4Q A;  4H50 A;  3D1C A;  2YR6 A;  1H82 A;  2WOI A;  1RYI A;  1GRB A;  1OJA A;  3KA7 A;  4YTN A;  4NTC A;  3VQR A;  1JNZ A;  1VDC A;  3NT6 A;  3AD9 B;  1ELI A;  4NEW A;  4U8I A;  1GND A;  3LXD A;  4A5L A;  5HHF A;  1NEN A;  1PXA A;  2WPE A;  2AAQ A;  4CY8 A;  2GVC A;  4BV6 A;  1ZMD A;  2BXR A;  5U63 A;  4U8P A;  5J7X A;  3GDN A;  2CFY A;  5HY5 A;  1KNP A;  2WQY A;  4Y4N A;  2NPX A;  2WP9 A;  2B76 A;  3GMC A;  2XFO A;  3QVR A;  4JY3 A;  2CDU A;  3T37 A;  4EQR A;  4C77 A;  3GD4 A;  3ICT A;  4JN9 A;  2YLT A;  2XLU A;  2Y6Q A;  4M52 A;  2QA1 A;  5TR3 A;  2XVH A;  4CNK A;  1E1K A;  1LJ1 A;  1O94 A;  1PBF A;  1ZX9 A;  2C76 A;  1FEB A;  2VVL A;  3AD8 B;  1E7P A;  4BUR A;  1M6I A;  2IVD A;  3M0O A;  3NHO X;  4A79 A;  3OZ2 A;  3AYJ A;  4C5O A;  3UKQ A;  1PN0 A;  2XLT A;  3P9U A;  1KF6 A;  3K7Q X;  3AWI A;  1OJT A;  5JCK A;  4A65 A;  3H8L A;  4GR1 A;  1IUT A;  3P4Q A;  1GRT A;  3PO7 A;  1NHR A;  1JRX A;  2C3D A;  4YTM A;  4Z26 A;  3QSE A;  4U8O A;  4CCR A;  2WOW A;  1D7L A;  3C96 A;  2Q0L A;  1K0L A;  4B63 A;  3NTD A;  5C2T A;  3NGC X;  1B5Q A;  2VQ7 A;  2GAH B;  1IUW A;  2VRL A;  3AD7 B;  2OAL A;  4EIQ A;  2C75 A;  1CJC A;  2BAB A;  2WDQ A;  3VR8 A;  4YKG A;  1TDE A;  3NK0 X;  4TM4 A;  3PS9 A;  5EOW A;  2V3A A;  3O0H A;  5KXJ A;  1YY5 A;  1FEA A;  1Q9I A;  4NTD A;  2RGH A;  2BC0 A;  4Z25 A;  3NRN A;  1N4W A;  2XVI A;  2E1M A;  2EQ8 A;  3BNU A;  3GSI A;  2BAC A;  2NVK X;  4YSY A;  1B37 A;  2AR8 A;  4OPG A;  4U2S A;  2XVE A;  4P9S A;  1MO9 A;  3S5W A;  2O9Z A;  1GER A;  3DJE A;  4ECH A;  1TYP A;  2YVG A;  2VRM A;  2IID A;  4EQX A;  2R4J A;  3IF9 A;  1D4E A;  3S61 A;  3SFD A;  3DK4 A;  1XDI A;  1JRY A;  4H4T A;  4H2R A;  3M12 A;  3IHM A;  2EQ6 A;  3CNS A;  5KVH A;  3G5S A;  4CNJ A;  3IC9 A;  3AE5 A;  2XFU A;  1OJC A;  4H7U A;  1GSN A;  1CC6 A;  3IHG A;  4USQ A;  1Y56 A;  4IA6 A;  2JB1 A;  1S2Y A;  1KFY A;  1TRB A;  2XDO A;  4FK1 A;  4IV9 A;  3NYC A;  1X31 B;  3ABV A;  1NG4 A;  5BVA A;  1Y56 B;  1H6V A;  2H88 A;  2AQJ A;  2JAE A;  4USR A;  4Z2T A;  2BS3 A;  5ER0 A;  3UOZ A;  2XVF A;  1TDF A;  2GR0 A;  2JBV A;  2JB2 A;  3Q9T A;  3QJ4 A;  1CC4 A;  4J36 A;  1CJ4 A;  4X9N A;  4GF7 A;  4U8N A;  4APN A;  4CCQ A;  2JK6 A;  3CGB A;  4N9X A;  4AP1 A;  2YQU A;  4TM1 A;  2VVL G;  2YVF A;  3BI5 A;  4TM3 A;  4YSH A;  5M10 A;  2WES A;  3LZX A;  1KDG A;  1MXT A;  3FPZ A;  4Z24 A;  5U1O A;  4TLZ A;  3CGE A;  4AT2 A;  1D4C A;  1NHP A;  3NIX A;  1F8S A;  2X50 A;  3G5R A;  4GCM A;  2YLS A;  1S3B A;  4J31 A;  3GWF A;  3RED A;  1GET A;  4GUV A;  1OJD A;  2BS2 A;  4IVM B;  5EB4 A;  5HYM A;  1CF3 A;  3DJD A;  3UOY A;  1IUV A;  4EIP A;  3M13 A;  1L9E A;  3BHF A;  2X8C A;  4H4W A;  3F8R A;  1FEC A;  1FOH A;  2XFP A;  3AE6 A;  3FBS A;  4HB9 A;  1PHH A;  1PJ7 A;  1GRA A;  3KVE A;  1RP0 A;  4JQ9 A;  2ZZC A;  2R9Z A;  2RGO A;  3ICS A;  2R45 A;  4YSZ A;  1NHQ A;  2R0P A;  3P1W A;  3VRD B;  5FS9 A;  1QO8 A;  3DME A;  4XWR A;  1BWC A;  1K0J A;  4X9M A;  3QFA A;  5FS7 A;  1DOB A;  1PXC A;  1DNC A;  4K8D A;  2GF3 A;  4RG4 A;  2OA1 A;  3SFE A;  1YQ4 A;  2BYB A;  2ZZ0 A;  3BNM A;  3ALL A;  1GES A;  4IVO B;  4E0V A;  2WP6 A;  3CGC A;  4UDP A;  5L46 A;  1BGJ A;  4IA5 A;  4Z44 A;  2V61 A;  1AOG A;  2OLO A;  2R0G A;  4KX6 A;  3GYI A;  1W4X A;  3ZDN A;  4C3Y A;  1JRZ A;  3RNM A;  3NK1 X;  1LV0 A;  3AEB A;  2XLP A;  2YAU A;  3I6D A;  4Z2R A;  2BK5 A;  2UZZ A;  1D7Y A;  2WU5 A;  4UP3 A;  2YLZ A;  3NYF A;  4H4Y A;  1VRQ B;  2FJB A;  1IUX A;  4GDE A;  4K22 A;  4REK A;  3LJP A;  3B3R A;  1O95 A;  2BK4 A;  3CPH G;  2CUL A;  5BUL A;  3AE1 A;  3QVP A;  2R4E A;  2BCP A;  2Y6R A;  3UKK A;  2EQ7 A;  2WET A;  5KWF A;  5FS8 A;  1NHS A;  1PDH A;  2WS3 A;  3AB1 A;  4O5Q A;  3QSS A;  3NN6 X;  3COX A;  4NEV A;  4J33 A;  4YXD A;  3UKP A;  1S3E A;  3AE3 A;  4YSX A;  3LAD A;  4NZH A;  4RSL A;  3KU9 A;  4XWZ A;  1ZMC A;  1OJ9 A;  3DK8 A;  1YQ3 A;  4UDQ A;  1ZDL A;  2FBW A;  2YVJ A;  1CHU A;  4PAB A;  3HZL A;  2QA2 A;  2TPR A;  4OPT A;  2DKI A;  3VRA A;  4X4J A;  1PJ6 A;  3OC4 A;  3PVC A;  4EQW A;  1GRG A;  4JDR A;  4B69 A;  3NNE A;  4EQS A;  3ITJ A;  1GTE A;  1GRH A;  2BS4 A;  2B7S A;  3DGZ A;  3NH3 X;  2JKC A;  2APG A;  2ZZB A;  1BF3 A;  1MOK A;  2A8X A;  1ZY8 A;  3CTY A;  4FK1 C;  4CBQ A;  4Y4L A;  1IJH A;  2ACZ A;  3AE2 A;  3BHK A;  5M0Z A;  4XXG A;  1PXB A;  3GD3 A;  4OPL A;  4Y4M A;  5BRT A;  1V59 A;  1GAL A;  3EAO A;  4U8J A;  3P4R A;  4ICY A;  1B8S A;  1H7W A;  1GEU A;  3AYL A;  1ZP0 A;  2F5Z A;  1PBB A;  2J3N A;  2C67 A;  2YG3 A;  2E5V A;  4H2N A;  2GH5 A;  2WEU A;  4Z2U A;  1CL0 A;  2YM1 A;  3GYJ A;  2EQ9 A;  4U8L A;  4B66 A;  2YR5 A;  2HQM A;  2GV8 A;  4JNA A;  1IUU A;  5EBK A;  1H81 A;  1E39 A;  3EF6 A;  3GWD A;  4HA6 A;  5J60 A;  1KSU A;  1F3P A;  1Q1R A;  2V6O A;  2ZBW A;  2FJA A;  5FS6 A;  1BGN A;  1LPF A;  1GTH A;  1XHC A;  2QAE A;  4I58 A;  2X3N A;  1QLB A;  1TDN A;  4H4Z A;  3P4S A;  1D5T A;  3SGL A;  2BK3 A;  4OVI A;  1VG9 A;  1XPQ A;  3NYE A;  1H86 A;  4A99 A;  1Q1W A;  1CBO A;  2YWL A;  3L8K A;  1EL9 A;  2ARD A;  4OPU A;  4B67 A;  2GMH A;  3GRT A;  4BJY A;  1CJ3 A;  4WX1 A;  2Z5X A;  4C3X A;  3GDP A;  2XFN A;  2C64 A;  4ZCD A;  4PAA A;  1DOD A;  3DJG X;  2C73 A;  3IWA A;  3DH9 A;  1NAA A;  2C7G A;  2BXS A;  3LB8 A;  4H4R A;  4A9W A;  5IQ1 A;  3NN0 X;  3NLC A;  1TDO A;  4C74 A;  2B7R A;  5IPY A;  4FX9 A;  4D04 A;  4O5U A;  1Y0P A;  2YLR A;  1JEH A;  1EBD A;  3F8P A;  2GMJ A;  1SEZ A;  1H7X A;  3LZW A;  3CND A;  1NPX A;  2A87 A;  4JNQ A;  2H89 A;  1VQW A;  1F6M A;  3C4N A;  1O5W A;  1KNR A;  2YG4 A;  5GSN A;  2R0C A;  4EMJ A;  1PBE A;  3V3O A;  3V3N A;  3AXB A;  4EMW A;  2Z5Y A;  4H4S A;  3DGH A;  4B64 A;  1NG3 A;  2GEW A;  4ADW A;  2YG7 A;  2X99 A;  3KPF A;  4K7Z A;  4OPC A;  1GT8 A;  1HYU A;  4EM3 A;  1LTX R;  1REO A;  4H4Q A;  3ICR A;  3P4P A;  2XCG A;  2FJD A;  3ADA B;  3CGD A;  2V3B A;  1COY A;  3DK9 A;  3I3L A;  1LQT A;  1L9C A;  1LQU A;  4JY2 A;  3UTE A;  4A7A A;  4ZCC A;  1GOS A;  4U8K A;  1KSS A;  2DKH A;  2WOV A;  2WDR A;  3FMW A;  3UOV A;  4J2W A;  3L1R A;  3QFB A;  2YM2 A;  3D8X A;  1PBC A;  3B6D A;  4OPD A;  4MJW A;  3UKL A;  3UTF A;  4TM0 A;  4U2T A;  3Q6J A;  1E1N A;  1NDA A;  3WE0 A;  3RP6 A;  3BI4 A;  3URH A;  3F8D A;  1K0I A;  1ZK7 A;  1ZOV A;  1Z6L A;  1JU2 A;  3H4K A;  3CNP A;  5CQF A;  4EMI A;  3R9U A;  1BZL A;  2YR4 A;  4H2Q A;  2XVJ A;  3AE9 A;  5U25 A;  3G5Q A;  3ATQ A;  4B68 A;  1TYT A;  1H84 A;  5DBJ A;  5JCN A;  1S2Q A;  5JCM A;  4H4X A;  3KD9 A;  4I59 A;  5KOW A;  3ATR A;  4OPI A;  1E1M A;  3C4A A;  1E6E A;  3AEA A;  3DA1 A;  3VRB A;  3ALM A;  1GXF A;  1EL5 A;  5C3J A;  2WPC A;  3AE7 A;  3K30 A;  4B1B A;  1P2E A;  2GAG B;  1TDK A;  2X8H A;  2TMD A;  1DXL A;  2YLW A;  2XYO A;  1RSG A;  3UCL A;  5KRQ A;  3ISH A;  1DJQ A;  2PHH A;  2GQW A;  3UKH A;  3FIM B;  3CN8 A;  4UDR A;  4GDP A;  2OLN A;  1DJN A;  1GRE A;  4BJZ A;  3VR9 A;  5CKU A;  4BK1 A;  4D03 A;  1FCD A;  2C70 A;  2QCU A;  4DSG A;  2VZ2 A;  5JCL A;  3SQP A;  4YKF A;  3AEF A;  1EL7 A;  1YQZ A;  2B9X A;  3GMB A;  3UP5 A;  5LV9 A;  1L9D A;  4H4U A;  4AT0 A;  4LA1 A;  4EM4 A;  2WPF A;  2WHD A;  3AEE A;  3EPT A;  3ZYX A;  4BK2 A;  4LII A;  3AEG A;  5IQ4 A;  3CNT A;  1F8W A;  4TLX A;  1L0V A;  4CY6 A;  1JNR A;  2VQB A;  2X8G A;  3K7M X;  4H4V A;  2E4G A;  2YLX A;  2C3C A;  2C72 A;  3JSK A;  1VG0 A;  5EB5 A;  1E1L A;  3CIR A;  3AED A;  4J57 A;  1FL2 A;  4DNA A;  4U2L A;  3LOV A; 
#chains in the Genus database with same CATH topology
 2XFQ A;  4AOS A;  4BK3 A;  3NKS A;  3K7T A;  4Z43 A;  1LVL A;  2RGJ A;  2GR2 A;  2YG6 A;  1B4V A;  4J56 A;  1N4V A;  4K5S A;  1N1P A;  3ALJ A;  2WP5 A;  2GQF A;  4YTP A;  2FJE A;  3AE4 A;  3EAN A;  4FDC B;  5KOX A;  1UKV G;  3V76 A;  2VVM A;  4K2X A;  4AP3 A;  2GR3 A;  3DJJ A;  4GRT A;  2BA9 A;  4AOX A;  3CNJ A;  3QSM A;  1JOA A;  4DSH A;  3NK2 X;  3CPI G;  2IVE A;  1H83 A;  5HXI A;  2WDV A;  3KKJ A;  5JCI A;  4NTE A;  1DOC A;  2RAB A;  1GV4 A;  3AYI A;  3II4 A;  3RP8 A;  4U8M A;  4YT0 A;  4H2P A;  1GPE A;  1QJD A;  4NWZ A;  3NG7 X;  1ZKQ A;  1EL8 A;  3AE8 A;  3CPJ G;  3UKF A;  3SM8 A;  1ONF A;  1M64 A;  3NTA A;  2BCG G;  3RHA A;  3UKA A;  3UP4 A;  2I0Z A;  1F8R A;  2BC1 A;  4DGK A;  2CVJ A;  4K5R A;  3T2K A;  3H8I A;  4H4P A;  5GRT A;  2R46 A;  2GRT A;  4J34 A;  3UTH A;  3UTG A;  3GRS A;  2YG5 A;  2PYX A;  4B65 A;  1YKJ A;  3KLJ A;  3T31 A;  2A89 A;  2V5Z A;  3E1T A;  1XAN A;  4LU6 A;  3GYX A;  1ZOY A;  2W0H A;  4WCT A;  2B9W A;  4II2 A;  1P2H A;  2C65 A;  2V60 A;  1PJ5 A;  1NEK A;  2Q6U A;  1DOE A;  1GRF A;  2OAM A;  3AEC A;  2Q7V A;  4ZN0 A;  3FG2 P;  1BKW A;  2Q0K A;  2XLR A;  5KVI A;  1CC2 A;  1PBD A;  1IUS A;  3BI2 A;  3UOX A;  4A6N A;  3RP7 A;  2C66 A;  1N4U A;  4YWO A;  2GR1 A;  2BRY A;  4KPR A;  4A6N B;  2WU2 A;  4CRT A;  2GB0 A;  1D4D A;  4OCG A;  5FMH A;  1PS9 A;  1CJ2 A;  2B9Y A;  2JB3 A;  2VOU A;  2XLS A;  5BUK A;  4RG3 A;  2WBA A;  1K4Q A;  4H50 A;  3D1C A;  2YR6 A;  1H82 A;  2WOI A;  1RYI A;  1GRB A;  1OJA A;  3KA7 A;  4YTN A;  4NTC A;  3VQR A;  1JNZ A;  1VDC A;  3NT6 A;  3AD9 B;  1ELI A;  4NEW A;  4U8I A;  1GND A;  3LXD A;  4A5L A;  5HHF A;  1NEN A;  1PXA A;  2WPE A;  2AAQ A;  4CY8 A;  2GVC A;  4BV6 A;  1ZMD A;  2BXR A;  5U63 A;  4U8P A;  5J7X A;  3GDN A;  2CFY A;  5HY5 A;  1KNP A;  2WQY A;  4Y4N A;  2NPX A;  2WP9 A;  2B76 A;  3GMC A;  2XFO A;  3QVR A;  4JY3 A;  2CDU A;  3T37 A;  4EQR A;  4C77 A;  3GD4 A;  3ICT A;  4JN9 A;  2YLT A;  2XLU A;  2Y6Q A;  4M52 A;  2QA1 A;  5TR3 A;  2XVH A;  4CNK A;  1E1K A;  1LJ1 A;  1O94 A;  1PBF A;  1ZX9 A;  2C76 A;  1FEB A;  2VVL A;  3AD8 B;  1E7P A;  4BUR A;  1M6I A;  2IVD A;  3M0O A;  3NHO X;  3SXI A;  3OZ2 A;  3AYJ A;  4A79 A;  3UKQ A;  4C5O A;  1PN0 A;  2XLT A;  3P9U A;  1KF6 A;  3K7Q X;  3AWI A;  1OJT A;  5JCK A;  4A65 A;  3H8L A;  4GR1 A;  1IUT A;  3P4Q A;  3T2Y A;  1GRT A;  3PO7 A;  1NHR A;  4G74 A;  1JRX A;  2C3D A;  4YTM A;  4Z26 A;  3QSE A;  4U8O A;  4CCR A;  2WOW A;  1D7L A;  3C96 A;  2Q0L A;  1K0L A;  4B63 A;  3NTD A;  5C2T A;  3NGC X;  1B5Q A;  2VQ7 A;  2GAH B;  1IUW A;  2VRL A;  3AD7 B;  2OAL A;  4EIQ A;  2C75 A;  1CJC A;  2BAB A;  2WDQ A;  3VR8 A;  4YKG A;  3HYW A;  1TDE A;  3NK0 X;  4TM4 A;  3PS9 A;  5EOW A;  2V3A A;  3O0H A;  5KXJ A;  1YY5 A;  1FEA A;  1Q9I A;  4NTD A;  2RGH A;  2BC0 A;  4Z25 A;  3NRN A;  1N4W A;  2XVI A;  2E1M A;  2EQ8 A;  3BNU A;  3GSI A;  2BAC A;  2NVK X;  3SZ0 A;  1B37 A;  2AR8 A;  4OPG A;  4U2S A;  4YSY A;  2XVE A;  4P9S A;  1MO9 A;  3S5W A;  2O9Z A;  1GER A;  3DJE A;  4ECH A;  1TYP A;  2YVG A;  2VRM A;  2IID A;  4EQX A;  2R4J A;  3IF9 A;  1D4E A;  3S61 A;  3SFD A;  3DK4 A;  1XDI A;  1JRY A;  4H4T A;  4H2R A;  3M12 A;  3IHM A;  2EQ6 A;  3CNS A;  5KVH A;  3G5S A;  4CNJ A;  3IC9 A;  3AE5 A;  2XFU A;  1OJC A;  4H7U A;  1GSN A;  1CC6 A;  3IHG A;  4USQ A;  1Y56 A;  4IA6 A;  2JB1 A;  1S2Y A;  1KFY A;  1TRB A;  2XDO A;  4FK1 A;  4IV9 A;  3NYC A;  1X31 B;  3ABV A;  1NG4 A;  5BVA A;  1Y56 B;  1H6V A;  2H88 A;  2AQJ A;  2JAE A;  4USR A;  3SZC A;  4Z2T A;  5KMR A;  2BS3 A;  5ER0 A;  3UOZ A;  2XVF A;  1TDF A;  2GR0 A;  2JBV A;  2JB2 A;  3Q9T A;  3QJ4 A;  1CC4 A;  4J36 A;  1CJ4 A;  4X9N A;  4GF7 A;  4U8N A;  4APN A;  4CCQ A;  2JK6 A;  3CGB A;  4N9X A;  4AP1 A;  2YQU A;  4TM1 A;  2VVL G;  2YVF A;  3BI5 A;  4TM3 A;  4YSH A;  5M10 A;  2WES A;  3LZX A;  1KDG A;  1MXT A;  3FPZ A;  4Z24 A;  5U1O A;  4TLZ A;  3CGE A;  4AT2 A;  1D4C A;  1NHP A;  3NIX A;  1F8S A;  2X50 A;  3G5R A;  4GCM A;  2YLS A;  1S3B A;  4G6G A;  4J31 A;  3GWF A;  3RED A;  1GET A;  4GUV A;  1OJD A;  3KPK A;  3SZW A;  2BS2 A;  4IVM B;  5EB4 A;  5HYM A;  1CF3 A;  3DJD A;  3UOY A;  1IUV A;  4EIP A;  3M13 A;  1L9E A;  3BHF A;  4GAP A;  2X8C A;  4H4W A;  3F8R A;  1FEC A;  1FOH A;  2XFP A;  3HYX A;  3AE6 A;  3FBS A;  4HB9 A;  1PHH A;  1PJ7 A;  1GRA A;  4GAV A;  3KVE A;  1RP0 A;  4JQ9 A;  2ZZC A;  2R9Z A;  2RGO A;  3ICS A;  2R45 A;  4YSZ A;  1NHQ A;  2R0P A;  3P1W A;  3VRD B;  5FS9 A;  1QO8 A;  3DME A;  4XWR A;  1BWC A;  1K0J A;  4X9M A;  3QFA A;  5FS7 A;  1DOB A;  1PXC A;  1DNC A;  4K8D A;  2GF3 A;  4RG4 A;  2OA1 A;  3SFE A;  1YQ4 A;  2BYB A;  2ZZ0 A;  3BNM A;  3ALL A;  1GES A;  4IVO B;  4E0V A;  2WP6 A;  3CGC A;  4UDP A;  5L46 A;  1BGJ A;  4IA5 A;  4Z44 A;  2V61 A;  1AOG A;  2OLO A;  2R0G A;  4KX6 A;  3GYI A;  5KMS A;  1W4X A;  3ZDN A;  4C3Y A;  1JRZ A;  3RNM A;  3NK1 X;  1LV0 A;  3AEB A;  2XLP A;  2YAU A;  3I6D A;  4Z2R A;  2BK5 A;  2UZZ A;  1D7Y A;  2WU5 A;  4UP3 A;  2YLZ A;  3NYF A;  4H4Y A;  1VRQ B;  2FJB A;  5KNL A;  1IUX A;  4GDE A;  4K22 A;  4REK A;  3LJP A;  3B3R A;  1O95 A;  2BK4 A;  3CPH G;  2CUL A;  5BUL A;  3AE1 A;  3QVP A;  2R4E A;  2BCP A;  2Y6R A;  3UKK A;  2EQ7 A;  2WET A;  5KWF A;  5FS8 A;  2BRA A;  1NHS A;  1PDH A;  2WS3 A;  3AB1 A;  4O5Q A;  3QSS A;  3NN6 X;  3COX A;  4NEV A;  4J33 A;  4YXD A;  3UKP A;  1S3E A;  3AE3 A;  4YSX A;  3LAD A;  4NZH A;  4RSL A;  3KU9 A;  4XWZ A;  1ZMC A;  1OJ9 A;  3DK8 A;  1YQ3 A;  4UDQ A;  1ZDL A;  2FBW A;  2YVJ A;  1CHU A;  4PAB A;  3T0K A;  3HZL A;  2QA2 A;  2TPR A;  4OPT A;  2DKI A;  3VRA A;  4X4J A;  1PJ6 A;  3OC4 A;  3PVC A;  4EQW A;  1GRG A;  4JDR A;  4B69 A;  3NNE A;  4EQS A;  3ITJ A;  4G9K A;  1GTE A;  1GRH A;  2BS4 A;  2B7S A;  3DGZ A;  3NH3 X;  2JKC A;  3SZF A;  2APG A;  2ZZB A;  1BF3 A;  1MOK A;  2A8X A;  1ZY8 A;  3CTY A;  4FK1 C;  4CBQ A;  4Y4L A;  1IJH A;  2ACZ A;  3AE2 A;  3BHK A;  5M0Z A;  4XXG A;  1PXB A;  3GD3 A;  4OPL A;  4Y4M A;  5BRT A;  1V59 A;  1GAL A;  3EAO A;  4U8J A;  3P4R A;  4ICY A;  1B8S A;  1H7W A;  1GEU A;  3AYL A;  1ZP0 A;  2F5Z A;  1PBB A;  2J3N A;  3SYI A;  2C67 A;  2YG3 A;  2E5V A;  4H2N A;  2GH5 A;  2WEU A;  4Z2U A;  1CL0 A;  2YM1 A;  3GYJ A;  2EQ9 A;  4U8L A;  4B66 A;  2YR5 A;  2HQM A;  2GV8 A;  4JNA A;  1IUU A;  5EBK A;  1H81 A;  1E39 A;  3EF6 A;  3GWD A;  4HA6 A;  5J60 A;  1KSU A;  1F3P A;  1Q1R A;  2V6O A;  2ZBW A;  2FJA A;  5FS6 A;  1BGN A;  3T14 A;  1LPF A;  1GTH A;  1XHC A;  2QAE A;  4I58 A;  2X3N A;  1QLB A;  1TDN A;  4G73 A;  3SY4 A;  4H4Z A;  3SX6 A;  3P4S A;  1D5T A;  3SGL A;  2BK3 A;  4OVI A;  1VG9 A;  1XPQ A;  3NYE A;  1H86 A;  4A99 A;  1Q1W A;  1CBO A;  2YWL A;  3L8K A;  1EL9 A;  2ARD A;  4OPU A;  4B67 A;  2GMH A;  3GRT A;  4BJY A;  1CJ3 A;  4WX1 A;  2Z5X A;  4C3X A;  3GDP A;  2XFN A;  2C64 A;  4ZCD A;  4PAA A;  1DOD A;  3DJG X;  2C73 A;  3IWA A;  4NNJ A;  3DH9 A;  1NAA A;  2C7G A;  2BXS A;  3LB8 A;  4H4R A;  4A9W A;  5IQ1 A;  3NN0 X;  3NLC A;  1TDO A;  4C74 A;  2B7R A;  5IPY A;  4FX9 A;  4D04 A;  4O5U A;  1Y0P A;  2YLR A;  1JEH A;  1EBD A;  3F8P A;  2GMJ A;  1SEZ A;  1H7X A;  3LZW A;  3CND A;  1NPX A;  2A87 A;  4JNQ A;  2H89 A;  1VQW A;  1F6M A;  3C4N A;  1O5W A;  1KNR A;  2YG4 A;  5GSN A;  2R0C A;  4EMJ A;  1PBE A;  3V3O A;  3V3N A;  3AXB A;  4EMW A;  2Z5Y A;  4H4S A;  3DGH A;  4B64 A;  1NG3 A;  2GEW A;  4ADW A;  2YG7 A;  2X99 A;  3KPF A;  4K7Z A;  4OPC A;  1GT8 A;  1HYU A;  4EM3 A;  1LTX R;  1REO A;  4H4Q A;  3ICR A;  3P4P A;  2XCG A;  2FJD A;  2C4C A;  3ADA B;  3CGD A;  2V3B A;  1COY A;  3DK9 A;  3I3L A;  1LQT A;  1L9C A;  1LQU A;  4JY2 A;  3T2Z A;  3UTE A;  4A7A A;  4ZCC A;  1GOS A;  4U8K A;  1KSS A;  2DKH A;  2WOV A;  2WDR A;  3FMW A;  3UOV A;  4J2W A;  3L1R A;  3QFB A;  2YM2 A;  3D8X A;  1PBC A;  3B6D A;  4OPD A;  4MJW A;  3UKL A;  3UTF A;  4TM0 A;  4U2T A;  3Q6J A;  1E1N A;  1NDA A;  3WE0 A;  5KMQ A;  3RP6 A;  3BI4 A;  3URH A;  3F8D A;  1K0I A;  1ZK7 A;  1ZOV A;  1Z6L A;  1JU2 A;  3H4K A;  3CNP A;  4G6H A;  5CQF A;  4EMI A;  3R9U A;  1BZL A;  2YR4 A;  4H2Q A;  2XVJ A;  3AE9 A;  5U25 A;  3G5Q A;  3ATQ A;  4B68 A;  1TYT A;  1H84 A;  5DBJ A;  5JCN A;  1S2Q A;  5JCM A;  4H4X A;  3KD9 A;  4I59 A;  5KOW A;  3ATR A;  3HYV A;  1E1M A;  3C4A A;  4OPI A;  1E6E A;  3AEA A;  3DA1 A;  3VRB A;  3ALM A;  1GXF A;  1EL5 A;  5C3J A;  2WPC A;  3AE7 A;  3K30 A;  4B1B A;  1P2E A;  2GAG B;  1TDK A;  2X8H A;  2TMD A;  1DXL A;  2YLW A;  2XYO A;  1RSG A;  3UCL A;  5KRQ A;  3ISH A;  1DJQ A;  4II3 A;  2PHH A;  2GQW A;  3UKH A;  3FIM B;  3CN8 A;  4UDR A;  4GDP A;  2OLN A;  1DJN A;  1GRE A;  4BJZ A;  3VR9 A;  5CKU A;  5KMP A;  4BK1 A;  4D03 A;  1FCD A;  2C70 A;  2QCU A;  4DSG A;  2VZ2 A;  5JCL A;  3SQP A;  4YKF A;  3AEF A;  1EL7 A;  1YQZ A;  2B9X A;  3GMB A;  3UP5 A;  5LV9 A;  1L9D A;  4H4U A;  4AT0 A;  4LA1 A;  4EM4 A;  2WPF A;  2WHD A;  3AEE A;  3EPT A;  3ZYX A;  4BK2 A;  4LII A;  3AEG A;  5IQ4 A;  3CNT A;  1F8W A;  4TLX A;  1L0V A;  4CY6 A;  1JNR A;  2VQB A;  2X8G A;  3K7M X;  4H4V A;  2E4G A;  2YLX A;  2C3C A;  3CMM A;  2C72 A;  3JSK A;  1VG0 A;  5EB5 A;  1E1L A;  3CIR A;  3AED A;  4J57 A;  1FL2 A;  4DNA A;  4U2L A;  3LOV A; 
#chains in the Genus database with same CATH homology
 2XFQ A;  4AOS A;  4BK3 A;  3NKS A;  3K7T A;  4Z43 A;  1LVL A;  2RGJ A;  2GR2 A;  2YG6 A;  1B4V A;  4J56 A;  1N4V A;  4K5S A;  1N1P A;  3ALJ A;  2WP5 A;  2GQF A;  4YTP A;  2FJE A;  3AE4 A;  3EAN A;  4FDC B;  5KOX A;  1UKV G;  3V76 A;  2VVM A;  4K2X A;  4AP3 A;  2GR3 A;  3DJJ A;  4GRT A;  2BA9 A;  4AOX A;  3CNJ A;  3QSM A;  1JOA A;  4DSH A;  3NK2 X;  3CPI G;  2IVE A;  1H83 A;  5HXI A;  2WDV A;  3KKJ A;  5JCI A;  4NTE A;  1DOC A;  2RAB A;  1GV4 A;  3AYI A;  3II4 A;  3RP8 A;  4U8M A;  4YT0 A;  4H2P A;  1GPE A;  1QJD A;  4NWZ A;  3NG7 X;  1ZKQ A;  1EL8 A;  3AE8 A;  3CPJ G;  3UKF A;  3SM8 A;  1ONF A;  1M64 A;  3NTA A;  2BCG G;  3RHA A;  3UKA A;  3UP4 A;  2I0Z A;  1F8R A;  2BC1 A;  4DGK A;  2CVJ A;  4K5R A;  3T2K A;  3H8I A;  4H4P A;  5GRT A;  2R46 A;  2GRT A;  4J34 A;  3UTH A;  3UTG A;  3GRS A;  2YG5 A;  2PYX A;  4B65 A;  1YKJ A;  3KLJ A;  3T31 A;  2A89 A;  2V5Z A;  3E1T A;  1XAN A;  4LU6 A;  3GYX A;  1ZOY A;  2W0H A;  4WCT A;  2B9W A;  4II2 A;  1P2H A;  2C65 A;  2V60 A;  1PJ5 A;  1NEK A;  2Q6U A;  1DOE A;  1GRF A;  2OAM A;  3AEC A;  2Q7V A;  4ZN0 A;  3FG2 P;  1BKW A;  2Q0K A;  2XLR A;  5KVI A;  1CC2 A;  1PBD A;  1IUS A;  3BI2 A;  3UOX A;  4A6N A;  3RP7 A;  2C66 A;  1N4U A;  4YWO A;  2GR1 A;  2BRY A;  4KPR A;  4A6N B;  2WU2 A;  4CRT A;  2GB0 A;  1D4D A;  4OCG A;  5FMH A;  1PS9 A;  1CJ2 A;  2B9Y A;  2JB3 A;  2VOU A;  2XLS A;  5BUK A;  4RG3 A;  2WBA A;  1K4Q A;  4H50 A;  3D1C A;  2YR6 A;  1H82 A;  2WOI A;  1RYI A;  1GRB A;  1OJA A;  3KA7 A;  4YTN A;  4NTC A;  3VQR A;  1JNZ A;  1VDC A;  3NT6 A;  3AD9 B;  1ELI A;  4NEW A;  4U8I A;  1GND A;  3LXD A;  4A5L A;  5HHF A;  1NEN A;  1PXA A;  2WPE A;  2AAQ A;  4CY8 A;  2GVC A;  4BV6 A;  1ZMD A;  2BXR A;  5U63 A;  4U8P A;  5J7X A;  3GDN A;  2CFY A;  5HY5 A;  1KNP A;  2WQY A;  4Y4N A;  2NPX A;  2WP9 A;  2B76 A;  3GMC A;  2XFO A;  3QVR A;  4JY3 A;  2CDU A;  3T37 A;  4EQR A;  4C77 A;  3GD4 A;  3ICT A;  4JN9 A;  2YLT A;  2XLU A;  2Y6Q A;  4M52 A;  2QA1 A;  5TR3 A;  2XVH A;  4CNK A;  1E1K A;  1LJ1 A;  1O94 A;  1PBF A;  1ZX9 A;  2C76 A;  1FEB A;  2VVL A;  3AD8 B;  1E7P A;  4BUR A;  1M6I A;  2IVD A;  3M0O A;  3NHO X;  3SXI A;  3OZ2 A;  3AYJ A;  4A79 A;  3UKQ A;  4C5O A;  1PN0 A;  2XLT A;  3P9U A;  1KF6 A;  3K7Q X;  3AWI A;  1OJT A;  5JCK A;  4A65 A;  3H8L A;  4GR1 A;  1IUT A;  3P4Q A;  3T2Y A;  1GRT A;  3PO7 A;  1NHR A;  4G74 A;  1JRX A;  2C3D A;  4YTM A;  4Z26 A;  3QSE A;  4U8O A;  4CCR A;  2WOW A;  1D7L A;  3C96 A;  2Q0L A;  1K0L A;  4B63 A;  3NTD A;  5C2T A;  3NGC X;  1B5Q A;  2VQ7 A;  2GAH B;  1IUW A;  2VRL A;  3AD7 B;  2OAL A;  4EIQ A;  2C75 A;  1CJC A;  2BAB A;  2WDQ A;  3VR8 A;  4YKG A;  3HYW A;  1TDE A;  3NK0 X;  4TM4 A;  3PS9 A;  5EOW A;  2V3A A;  3O0H A;  5KXJ A;  1YY5 A;  1FEA A;  1Q9I A;  4NTD A;  2RGH A;  2BC0 A;  4Z25 A;  3NRN A;  1N4W A;  2XVI A;  2E1M A;  2EQ8 A;  3BNU A;  3GSI A;  2BAC A;  2NVK X;  3SZ0 A;  1B37 A;  2AR8 A;  4OPG A;  4U2S A;  4YSY A;  2XVE A;  4P9S A;  1MO9 A;  3S5W A;  2O9Z A;  1GER A;  3DJE A;  4ECH A;  1TYP A;  2YVG A;  2VRM A;  2IID A;  4EQX A;  2R4J A;  3IF9 A;  1D4E A;  3S61 A;  3SFD A;  3DK4 A;  1XDI A;  1JRY A;  4H4T A;  4H2R A;  3M12 A;  3IHM A;  2EQ6 A;  3CNS A;  5KVH A;  3G5S A;  4CNJ A;  3IC9 A;  3AE5 A;  2XFU A;  1OJC A;  4H7U A;  1GSN A;  1CC6 A;  3IHG A;  4USQ A;  1Y56 A;  4IA6 A;  2JB1 A;  1S2Y A;  1KFY A;  1TRB A;  2XDO A;  4FK1 A;  4IV9 A;  3NYC A;  1X31 B;  3ABV A;  1NG4 A;  5BVA A;  1Y56 B;  1H6V A;  2H88 A;  2AQJ A;  2JAE A;  4USR A;  3SZC A;  4Z2T A;  5KMR A;  2BS3 A;  5ER0 A;  3UOZ A;  2XVF A;  1TDF A;  2GR0 A;  2JBV A;  2JB2 A;  3Q9T A;  3QJ4 A;  1CC4 A;  4J36 A;  1CJ4 A;  4X9N A;  4GF7 A;  4U8N A;  4APN A;  4CCQ A;  2JK6 A;  3CGB A;  4N9X A;  4AP1 A;  2YQU A;  4TM1 A;  2VVL G;  2YVF A;  3BI5 A;  4TM3 A;  4YSH A;  5M10 A;  2WES A;  3LZX A;  1KDG A;  1MXT A;  3FPZ A;  4Z24 A;  5U1O A;  4TLZ A;  3CGE A;  4AT2 A;  1D4C A;  1NHP A;  3NIX A;  1F8S A;  2X50 A;  3G5R A;  4GCM A;  2YLS A;  1S3B A;  4G6G A;  4J31 A;  3GWF A;  3RED A;  1GET A;  4GUV A;  1OJD A;  3KPK A;  3SZW A;  2BS2 A;  4IVM B;  5EB4 A;  5HYM A;  1CF3 A;  3DJD A;  3UOY A;  1IUV A;  4EIP A;  3M13 A;  1L9E A;  3BHF A;  4GAP A;  2X8C A;  4H4W A;  3F8R A;  1FEC A;  1FOH A;  2XFP A;  3HYX A;  3AE6 A;  3FBS A;  4HB9 A;  1PHH A;  1PJ7 A;  1GRA A;  4GAV A;  3KVE A;  1RP0 A;  4JQ9 A;  2ZZC A;  2R9Z A;  2RGO A;  3ICS A;  2R45 A;  4YSZ A;  1NHQ A;  2R0P A;  3P1W A;  3VRD B;  5FS9 A;  1QO8 A;  3DME A;  4XWR A;  1BWC A;  1K0J A;  4X9M A;  3QFA A;  5FS7 A;  1DOB A;  1PXC A;  1DNC A;  4K8D A;  2GF3 A;  4RG4 A;  2OA1 A;  3SFE A;  1YQ4 A;  2BYB A;  2ZZ0 A;  3BNM A;  3ALL A;  1GES A;  4IVO B;  4E0V A;  2WP6 A;  3CGC A;  4UDP A;  5L46 A;  1BGJ A;  4IA5 A;  4Z44 A;  2V61 A;  1AOG A;  2OLO A;  2R0G A;  4KX6 A;  3GYI A;  5KMS A;  1W4X A;  3ZDN A;  4C3Y A;  1JRZ A;  3RNM A;  3NK1 X;  1LV0 A;  3AEB A;  2XLP A;  2YAU A;  3I6D A;  4Z2R A;  2BK5 A;  2UZZ A;  1D7Y A;  2WU5 A;  4UP3 A;  2YLZ A;  3NYF A;  4H4Y A;  1VRQ B;  2FJB A;  5KNL A;  1IUX A;  4GDE A;  4K22 A;  4REK A;  3LJP A;  3B3R A;  1O95 A;  2BK4 A;  3CPH G;  2CUL A;  5BUL A;  3AE1 A;  3QVP A;  2R4E A;  2BCP A;  2Y6R A;  3UKK A;  2EQ7 A;  2WET A;  5KWF A;  5FS8 A;  2BRA A;  1NHS A;  1PDH A;  2WS3 A;  3AB1 A;  4O5Q A;  3QSS A;  3NN6 X;  3COX A;  4NEV A;  4J33 A;  4YXD A;  3UKP A;  1S3E A;  3AE3 A;  4YSX A;  3LAD A;  4NZH A;  4RSL A;  3KU9 A;  4XWZ A;  1ZMC A;  1OJ9 A;  3DK8 A;  1YQ3 A;  4UDQ A;  1ZDL A;  2FBW A;  2YVJ A;  1CHU A;  4PAB A;  3T0K A;  3HZL A;  2QA2 A;  2TPR A;  4OPT A;  2DKI A;  3VRA A;  4X4J A;  1PJ6 A;  3OC4 A;  3PVC A;  4EQW A;  1GRG A;  4JDR A;  4B69 A;  3NNE A;  4EQS A;  3ITJ A;  4G9K A;  1GTE A;  1GRH A;  2BS4 A;  2B7S A;  3DGZ A;  3NH3 X;  2JKC A;  3SZF A;  2APG A;  2ZZB A;  1BF3 A;  1MOK A;  2A8X A;  1ZY8 A;  3CTY A;  4FK1 C;  4CBQ A;  4Y4L A;  1IJH A;  2ACZ A;  3AE2 A;  3BHK A;  5M0Z A;  4XXG A;  1PXB A;  3GD3 A;  4OPL A;  4Y4M A;  5BRT A;  1V59 A;  1GAL A;  3EAO A;  4U8J A;  3P4R A;  4ICY A;  1B8S A;  1H7W A;  1GEU A;  3AYL A;  1ZP0 A;  2F5Z A;  1PBB A;  2J3N A;  3SYI A;  2C67 A;  2YG3 A;  2E5V A;  4H2N A;  2GH5 A;  2WEU A;  4Z2U A;  1CL0 A;  2YM1 A;  3GYJ A;  2EQ9 A;  4U8L A;  4B66 A;  2YR5 A;  2HQM A;  2GV8 A;  4JNA A;  1IUU A;  5EBK A;  1H81 A;  1E39 A;  3EF6 A;  3GWD A;  4HA6 A;  5J60 A;  1KSU A;  1F3P A;  1Q1R A;  2V6O A;  2ZBW A;  2FJA A;  5FS6 A;  1BGN A;  3T14 A;  1LPF A;  1GTH A;  1XHC A;  2QAE A;  4I58 A;  2X3N A;  1QLB A;  1TDN A;  4G73 A;  3SY4 A;  4H4Z A;  3SX6 A;  3P4S A;  1D5T A;  3SGL A;  2BK3 A;  4OVI A;  1VG9 A;  1XPQ A;  3NYE A;  1H86 A;  4A99 A;  1Q1W A;  1CBO A;  2YWL A;  3L8K A;  1EL9 A;  2ARD A;  4OPU A;  4B67 A;  2GMH A;  3GRT A;  4BJY A;  1CJ3 A;  4WX1 A;  2Z5X A;  4C3X A;  3GDP A;  2XFN A;  2C64 A;  4ZCD A;  4PAA A;  1DOD A;  3DJG X;  2C73 A;  3IWA A;  4NNJ A;  3DH9 A;  1NAA A;  2C7G A;  2BXS A;  3LB8 A;  4H4R A;  4A9W A;  5IQ1 A;  3NN0 X;  3NLC A;  1TDO A;  4C74 A;  2B7R A;  5IPY A;  4FX9 A;  4D04 A;  4O5U A;  1Y0P A;  2YLR A;  1JEH A;  1EBD A;  3F8P A;  2GMJ A;  1SEZ A;  1H7X A;  3LZW A;  3CND A;  1NPX A;  2A87 A;  4JNQ A;  2H89 A;  1VQW A;  1F6M A;  3C4N A;  1O5W A;  1KNR A;  2YG4 A;  5GSN A;  2R0C A;  4EMJ A;  1PBE A;  3V3O A;  3V3N A;  3AXB A;  4EMW A;  2Z5Y A;  4H4S A;  3DGH A;  4B64 A;  1NG3 A;  2GEW A;  4ADW A;  2YG7 A;  2X99 A;  3KPF A;  4K7Z A;  4OPC A;  1GT8 A;  1HYU A;  4EM3 A;  1LTX R;  1REO A;  4H4Q A;  3ICR A;  3P4P A;  2XCG A;  2FJD A;  2C4C A;  3ADA B;  3CGD A;  2V3B A;  1COY A;  3DK9 A;  3I3L A;  1LQT A;  1L9C A;  1LQU A;  4JY2 A;  3T2Z A;  3UTE A;  4A7A A;  4ZCC A;  1GOS A;  4U8K A;  1KSS A;  2DKH A;  2WOV A;  2WDR A;  3FMW A;  3UOV A;  4J2W A;  3L1R A;  3QFB A;  2YM2 A;  3D8X A;  1PBC A;  3B6D A;  4OPD A;  4MJW A;  3UKL A;  3UTF A;  4TM0 A;  4U2T A;  3Q6J A;  1E1N A;  1NDA A;  3WE0 A;  5KMQ A;  3RP6 A;  3BI4 A;  3URH A;  3F8D A;  1K0I A;  1ZK7 A;  1ZOV A;  1Z6L A;  1JU2 A;  3H4K A;  3CNP A;  4G6H A;  5CQF A;  4EMI A;  3R9U A;  1BZL A;  2YR4 A;  4H2Q A;  2XVJ A;  3AE9 A;  5U25 A;  3G5Q A;  3ATQ A;  4B68 A;  1TYT A;  1H84 A;  5DBJ A;  5JCN A;  1S2Q A;  5JCM A;  4H4X A;  3KD9 A;  4I59 A;  5KOW A;  3ATR A;  3HYV A;  1E1M A;  3C4A A;  4OPI A;  1E6E A;  3AEA A;  3DA1 A;  3VRB A;  3ALM A;  1GXF A;  1EL5 A;  5C3J A;  2WPC A;  3AE7 A;  3K30 A;  4B1B A;  1P2E A;  2GAG B;  1TDK A;  2X8H A;  2TMD A;  1DXL A;  2YLW A;  2XYO A;  1RSG A;  3UCL A;  5KRQ A;  3ISH A;  1DJQ A;  4II3 A;  2PHH A;  2GQW A;  3UKH A;  3FIM B;  3CN8 A;  4UDR A;  4GDP A;  2OLN A;  1DJN A;  1GRE A;  4BJZ A;  3VR9 A;  5CKU A;  5KMP A;  4BK1 A;  4D03 A;  1FCD A;  2C70 A;  2QCU A;  4DSG A;  2VZ2 A;  5JCL A;  3SQP A;  4YKF A;  3AEF A;  1EL7 A;  1YQZ A;  2B9X A;  3GMB A;  3UP5 A;  5LV9 A;  1L9D A;  4H4U A;  4AT0 A;  4LA1 A;  4EM4 A;  2WPF A;  2WHD A;  3AEE A;  3EPT A;  3ZYX A;  4BK2 A;  4LII A;  3AEG A;  5IQ4 A;  3CNT A;  1F8W A;  4TLX A;  1L0V A;  4CY6 A;  1JNR A;  2VQB A;  2X8G A;  3K7M X;  4H4V A;  2E4G A;  2YLX A;  2C3C A;  3CMM A;  2C72 A;  3JSK A;  1VG0 A;  5EB5 A;  1E1L A;  3CIR A;  3AED A;  4J57 A;  1FL2 A;  4DNA A;  4U2L A;  3LOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...