2XLUA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: complex with thionadp
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
b'MATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint-Functions of Protein Residues and Nadp(H) in Oxygen-Activation by Flavin-Containing Monooxygenase
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xluA02
2C7GA 4USRA 2V5ZA 5M10A 1GRBA 4H50A 1H81A 3KPFA 1V59A 1OJ9A 3DGZA 3DK9A 2EQ6A 4NTDA 1IUXA 5L46A 1Q9IA 3UP5A 1ZX9A 4C3YA 1DNCA 4EQWA 3DK8A 5U63A 1K0JA 1E1MA 1BF3A 1XDIA 3AE3A 1JNZA 3GMBA 3H8LA 1K4QA 4Z25A 3P1WA 4YKGA 4GUVA 3RNMA 2QA2A 3AEGA 4EMIA 3OC4A 2R4EA 4A7AA 1FCDA 1NHQA 4JY2A 5KXJA 3IHGA 4DNAA 1LJ1A 3ALMA 3NTAA 2RABA 2CVJA 1KSUA 2XFPA 3CPIG 1GRHA 2WOVA 1FEAA 1KSSA 1PJ5A 5JCNA 4NTCA 3GWFA 2YG6A 5LV9A 3T37A 4Z2TA 4D04A 2XLSA 2NPXA 3ZDNA 3K30A 4CNKA 1CL0A 4BK3A 3AE7A 4WCTA 3F8DA 1GTHA 1JRZA 3RP8A 1CBOA 3E1TA 4H4TA 4UDRA 3UOZA 2WEUA 3G5RA 4GDPA 1GT8A 2JBVA 1IUSA 4B68A 2C66A 2YG3A 4IV9A 4BURA 4H4UA 4K22A 3AD7B 3PS9A 4Y4MA 1FOHA 4YXDA 3CNPA 4LA1A 1Q1WA 2X50A 4FK1A 4H4WA 3L8KA 3CPJG 5GSNA 1P2EA 3F8PA 2TMDA 4EQSA 1PXAA 1D4DA 1PBDA 2BABA 2GR1A 2B7RA 1GSNA 2WPCA 4ECHA 3DGHA 2X8HA 2XLPA 3R9UA 3SM8A 2DKHA 2B7SA 4JDRA 2XCGA 3D1CA 2YM1A 5KWFA 3EAOA 3BHKA 4U8OA 2E4GA 4AP1A 1TYTA 3AEFA 4U8LA 4X4JA 5CQFA 4DSGA 4I58A 2XLUA 4YT0A 3AE1A 3ICRA 3QSSA 4OCGA 3SGLA 1Y0PA 4A65A 1LV0A 1D4CA 2Q0KA 1E1LA 4Y4LA 5BRTA 2GRTA 3QVRA 1DJQA 5GRTA 3UTHA 1GNDA 2V3BA 4GF7A 4OPTA 4U2SA 4B67A 4WX1A 3AE6A 4BJYA 5BUKA 1ZOYA 1YY5A 2AR8A 2R0CA 3GRSA 3NK0X 3GYIA 1GTEA 1O95A 3DJGX 2GAHB 4MJWA 5U25A 1DOEA 3PO7A 2NVKX 4Z44A 3COXA 4K5RA 3DK4A 4AT2A 1QO8A 5JCKA 3DA1A 2I0ZA 1JU2A 4FX9A 4OPUA 3SFEA 3UKLA 2V60A 4B65A 1S3BA 1NHSA 1VRQB 2FBWA 2ZZCA 2X8GA 4X9MA 1PBFA 3ADAB 2RGJA 4ADWA 3CNDA 3AWIA 4YTNA 3KA7A 2Y6RA 4TM0A 1DOCA 3NKSA 2YVFA 4TM1A 1NDAA 2XDOA 3V3NA 1GETA 1S3EA 2BK4A 2R0PA 3UKFA 2R45A 2C72A 2WOIA 5ER0A 1CC4A 1NEKA 3UKHA 3FIMB 1GERA 2GQWA 4RG3A 4CY6A 1B8SA 3C4AA 3LOVA 3GYJA 5HY5A 3CGDA 5EOWA 2GQFA 3P4SA 3ATQA 4A99A 2CULA 3AEBA 4A9WA 3C96A 4M52A 2V61A 1IUTA 3ZYXA 1E7PA 2YLRA 1NG4A 2C73A 4YTPA 4K8DA 1B5QA 2C64A 2WOWA 4ZN0A 5KRQA 1NAAA 1PJ6A 2EQ9A 4REKA 4A6NA 2X3NA 3AE9A 4U8JA 2GH5A 3DJJA 4B63A 4Z24A 2R9ZA 4EIQA 4B66A 5HXIA 1BZLA 1O5WA 3NN0X 1PHHA 2A87A 1PDHA 2H89A 2JB1A 4ZCCA 3RP6A 1GXFA 3P9UA 4Z43A 1ZMDA 5IQ4A 3GMCA 1VG9A 3BNUA 4OPIA 4J31A 4H4YA 1FECA 4GCMA 5FS9A 3QFBA 3NYCA 4OPLA 1GRAA 4I59A 1JRYA 3AE4A 4NEVA 3EPTA 1F8SA 1TDKA 1K0IA 2GMHA 2ARDA 2OALA 2WS3A 2B9XA 2YM2A 3FPZA 4H2NA 4K7ZA 4U2TA 2IVDA 1JEHA 4NTEA 1CHUA 1GEUA 2WQYA 4LU6A 4H2PA 3CPHG 1H6VA 4RG4A 2ZZBA 2ZBWA 2J3NA 3DH9A 5FS7A 2X8CA 3CGCA 3V76A 4XXGA 2WDQA 3KD9A 1PXBA 1NPXA 4KPRA 2DKIA 3VR9A 4C74A 4XWZA 1BWCA 5U1OA 4DGKA 4H7UA 4LIIA 2YAUA 1PBCA 2YVGA 4J56A 4EM4A 4B69A 4U8NA 2CDUA 3ABVA 3DMEA 3AYIA 4Z26A 1Q1RA 2WDVA 4YKFA 5EBKA 3CTYA 1YQ4A 4K5SA 3UKPA 1CC6A 2FJEA 3UP4A 2A89A 2YLZA 3LJPA 1E39A 1ZDLA 2YR4A 1MXTA 3GWDA 5J7XA 1DODA 4TM4A 1L0VA 4D03A 1D7LA 2V6OA 4H2QA 5KOXA 3NLCA 3UOXA 3V3OA 1XPQA 5EB4A 4O5UA 3JSKA 4CRTA 3S5WA 1ELIA 4YSXA 2YQUA 3G5QA 3NK2X 1F6MA 3UKKA 1RP0A 2FJDA 2OAMA 2YR6A 4KX6A 4AOSA 2XFUA 3BI4A 3ICTA 4H4VA 4ZCDA 1KNRA 2O9ZA 4OPGA 1L9DA 2WP9A 4JNQA 4BJZA 2GV8A 3VRDB 4C5OA 5J60A 2GR0A 1ZY8A 3QSMA 1LQUA 4H4ZA 3DJDA 1NHRA 3NK1X 4U8MA 1F8WA 1GOSA 1HYUA 4UDQA 1PBBA 1KNPA 2XFQA 4J34A 1GRGA 1PS9A 1XHCA 3G5SA 1EL9A 2BYBA 2B9YA 4IVMB 2GB0A 2WPFA 4H2RA 1L9CA 2CFYA 1NG3A 4Z2RA 1M6IA 1N4VA 4J2WA 1ZMCA 4GDEA 1N1PA 3VRAA 3I3LA 3CNTA 1GALA 2VRMA 4U8KA 1JOAA 1EBDA 2C67A 2Q6UA 4U8PA 4J33A 2VVLG 3LB8A 4FK1C 3WE0A 1H86A 5CKUA 3NN6X 4OPDA 2EQ8A 4APNA 4B1BA 3P4PA 3LZXA 1OJDA 1Y56A 4TLXA 2JAEA 2YWLA 1LQTA 3NTDA 2JK6A 1N4UA 3CNSA 3K7MX 2B9WA 4K2XA 1M64A 4IA6A 2X99A 3M12A 1RYIA 1B37A 1FEBA 1ZP0A 4YTMA 1LVLA 4C77A 4A6NB 1AOGA 5KVHA 3UTEA 5TR3A 2XVEA 2WP5A 1IUVA 2YG5A 3CGEA 4BK1A 2QCUA 5M0ZA 2XLRA 3KVEA 2VVLA 1RSGA 2GVCA 3GDPA 3SFDA 3EANA 3NH3X 4PABA 2WHDA 2OLOA 2VQ7A 2VZ2A 3AE5A 1NHPA 4YSZA 3ISHA 3CIRA 3UOVA 2WDRA 1YQ3A 2JKCA 1OJAA 1DOBA 1ONFA 2ACZA 4EIPA 5KOWA 2BK5A 3NYEA 1H7WA 3SQPA 3NNEA 2VQBA 1O94A 3UTFA 4X9NA 3Q6JA 1MO9A 1TDEA 5IPYA 1VG0A 3H8IA 2E1MA 4EQXA 1H84A 3AE8A 4GRTA 1CJ4A 2BACA 2PYXA 1JRXA 2BCGG 2BC1A 1GRTA 3GD4A 4P9SA 1CJ3A 2XVJA 4USQA 2ZZ0A 1H82A 4CCRA 4HA6A 3K7TA 2C3DA 4Z2UA 1IJHA 2C65A 1F3PA 5JCLA 5C2TA 3AEEA 2XVFA 4ICYA 1KF6A 3VQRA 2EQ7A 3GRTA 5HYMA 4YSYA 3LADA 3UOYA 3UKAA 3NT6A 1BGJA 2GMJA 3ALLA 2BK3A 3CGBA 2WU2A 1EL7A 5FS6A 3AYLA 3EF6A 1GESA 3DJEA 4A5LA 1Z6LA 1LPFA 3M13A 3LXDA 1F8RA 3F8RA 4BV6A 1PN0A 5DBJA 3P4QA 3Q9TA 1KFYA 3VR8A 3IF9A 3L1RA 3AECA 1D7YA 3AE2A 1VDCA 2XFNA 2YLSA 3CN8A 3GD3A 4JQ9A 5KVIA 2XVIA 1SEZA 4BK2A 2YLXA 3KU9A 2WESA 4JNAA 2E5VA 3AD8B 4NEWA 2WPEA 3PVCA 4H4RA 2F5ZA 1PXCA 1DXLA 4TM3A 3K7QX 4EQRA 3LZWA 3BHFA 1GV4A 3AB1A 3II4A 2BS2A 4J36A 1EL8A 3B3RA 3QVPA 3ALJA 2H88A 3NG7X 1CC2A 3BI2A 2C70A 5JCMA 2R4JA 1P2HA 1Y56B 4B64A 5JCIA 4H4QA 3RP7A 3URHA 1XANA 1PBEA 3VRBA 3AXBA 1YKJA 3FG2P 3QJ4A 4RSLA 2VOUA 2JB3A 3REDA 1UKVG 2RGOA 1VQWA 2RGHA 2PHHA 3KKJA 4XWRA 3UKQA 1IUUA 2UZZA 2Z5XA 2YG4A 4H4SA 1E6EA 4C3XA 2GR2A 2YLTA 3IHMA 1JNRA 1GRFA 3O0HA 1TRBA 2A8XA 2C76A 3AEDA 1FL2A 4AT0A 3FBSA 2V3AA 2Y6QA 2FJBA 3KLJA 2WBAA 4CCQA 5FS8A 1KDGA 2WU5A 3ATRA 1GPEA 1EL5A 2GAGB 4U2LA 4AP3A 3QFAA 1ZK7A 1E1KA 4A79A 1LTXR 3IC9A 5EB5A 1CF3A 2VVMA 3GDNA 4UP3A 4CY8A 2AQJA 2BS4A 2IVEA 1W4XA 4OPCA 2BXSA 4O5QA 3HZLA 1BKWA 5FMHA 1BGNA 4FDCB 1D5TA 2GEWA 4E0VA 2C3CA 2C75A 4H4XA 3NRNA 2XLTA 3C4NA 2QA1A 4TLZA 2IIDA 3ITJA 1COYA 1DJNA 4IA5A 1H83A 1TDNA 2YG7A 3NHOX 1YQZA 3B6DA 2Q7VA 4OVIA 1MOKA 4N9XA 1QJDA 2HQMA 2YVJA 1GREA 2YR5A 1TDOA 3AD9B 1TYPA 3IWAA 1OJCA 2TPRA 1E1NA 1ZKQA 3QSEA 4U8IA 3NIXA 3AYJA 2JB2A 2QAEA 3GSIA 1IUWA 3S61A 2WETA 4JN9A 1S2YA 3NGCX 1L9EA 4DSHA 1D4EA 3BI5A 3I6DA 2FJAA 4EMWA 2XFOA 2BCPA 2GR3A 1N4WA 1QLBA 1K0LA 4HB9A 3AEAA 2WP6A 2R0GA 4Y4NA 2W0HA 5BULA 3D8XA 2Q0LA 2AAQA 4CBQA 2BS3A 2VRLA 1H7XA 2XVHA 2BXRA 3P4RA 3M0OA 5C3JA 1CJCA 2BA9A 4EM3A 3UCLA 3UTGA 2B76A 1REOA 2Z5YA 1PJ7A 4IVOB 4H4PA 5HHFA 5BVAA 2GF3A 3RHAA 1B4VA 2OA1A 3NYFA 4J57A 4GR1A 3CNJA 4NZHA 2XYOA 3ICSA 3BNMA 4CNJA 1S2QA 2YLWA 1X31B 2OLNA 2BC0A 2APGA 2R46A 3H4KA 3OZ2A 3FMWA 4YSHA 4AOXA 4UDPA 4EMJA 1CJ2A 1OJTA 4PAAA 5IQ1A 1ZOVA 4YWOA 1TDFA 4JY3A 1NENA
chains in the Genus database with same CATH superfamily
2C7GA 4USRA 2V5ZA 5M10A 1GRBA 4H50A 1H81A 3KPFA 1V59A 1OJ9A 3DGZA 3DK9A 2EQ6A 4NTDA 1IUXA 5L46A 1Q9IA 3UP5A 1ZX9A 4C3YA 1DNCA 4EQWA 3DK8A 5U63A 1K0JA 1E1MA 1BF3A 1XDIA 3AE3A 1JNZA 3GMBA 3H8LA 1K4QA 4Z25A 3P1WA 4YKGA 4GUVA 3RNMA 2QA2A 3AEGA 4EMIA 3OC4A 2R4EA 4A7AA 1FCDA 1NHQA 4JY2A 5KXJA 3IHGA 4DNAA 1LJ1A 3ALMA 3NTAA 2RABA 2CVJA 1KSUA 2XFPA 3CPIG 1GRHA 2WOVA 1FEAA 1KSSA 1PJ5A 5JCNA 4NTCA 3GWFA 3SZCA 2YG6A 5LV9A 3T37A 4Z2TA 4D04A 2XLSA 2NPXA 3ZDNA 3K30A 4CNKA 1CL0A 4BK3A 3AE7A 4WCTA 3F8DA 1GTHA 1JRZA 3RP8A 1CBOA 3E1TA 4H4TA 4UDRA 3UOZA 2WEUA 3G5RA 4GDPA 1GT8A 2JBVA 1IUSA 4B68A 2C66A 2YG3A 4IV9A 4BURA 4H4UA 4K22A 3AD7B 3PS9A 4Y4MA 1FOHA 4YXDA 3CNPA 4LA1A 1Q1WA 2X50A 4FK1A 4H4WA 3L8KA 3CPJG 5GSNA 1P2EA 5KRQA 3F8PA 2TMDA 4EQSA 1PXAA 1D4DA 1PBDA 2BABA 2GR1A 4G6HA 2B7RA 1GSNA 2WPCA 4ECHA 3DGHA 2X8HA 2XLPA 3R9UA 3SM8A 2DKHA 2B7SA 4JDRA 2XCGA 3D1CA 2YM1A 5KWFA 3EAOA 3BHKA 4U8OA 2E4GA 4AP1A 1TYTA 3AEFA 4U8LA 4X4JA 5CQFA 4DSGA 4I58A 2XLUA 4YT0A 3AE1A 3ICRA 3QSSA 4OCGA 3SGLA 1Y0PA 4A65A 1LV0A 1D4CA 2Q0KA 1E1LA 4Y4LA 5BRTA 2GRTA 3QVRA 1DJQA 5GRTA 3UTHA 1GNDA 2V3BA 4GF7A 4OPTA 4U2SA 4B67A 4WX1A 3AE6A 3T0KA 4BJYA 5BUKA 1ZOYA 3HYWA 1YY5A 2AR8A 2R0CA 3GRSA 3NK0X 3GYIA 1GTEA 1O95A 3DJGX 2GAHB 4MJWA 5U25A 1DOEA 3PO7A 2NVKX 4Z44A 3COXA 4K5RA 3DK4A 4AT2A 1QO8A 5JCKA 3DA1A 2I0ZA 1JU2A 4FX9A 4OPUA 3SFEA 3UKLA 2V60A 4B65A 1S3BA 1NHSA 1VRQB 2FBWA 2ZZCA 2X8GA 4X9MA 1PBFA 3ADAB 2RGJA 4ADWA 3CNDA 3AWIA 4YTNA 3KA7A 2Y6RA 4TM0A 1DOCA 3NKSA 2YVFA 4TM1A 1NDAA 2XDOA 3V3NA 1GETA 1S3EA 2BK4A 2R0PA 3UKFA 3T2ZA 2R45A 2C72A 2WOIA 5ER0A 1CC4A 1NEKA 3UKHA 3FIMB 1GERA 2GQWA 4RG3A 4CY6A 1B8SA 3C4AA 3LOVA 3GYJA 5HY5A 3CGDA 5EOWA 2GQFA 3P4SA 3ATQA 4A99A 2CULA 3AEBA 4A9WA 3C96A 4M52A 2V61A 1IUTA 3ZYXA 1E7PA 2YLRA 1NG4A 2C73A 3SY4A 4K8DA 1B5QA 2C64A 2WOWA 4YTPA 4ZN0A 1NAAA 1PJ6A 3SZFA 2EQ9A 4REKA 4A6NA 2X3NA 3AE9A 4U8JA 2GH5A 3DJJA 4B63A 4Z24A 2R9ZA 4EIQA 2BRAA 4B66A 1BZLA 1O5WA 3NN0X 5HXIA 1PHHA 2A87A 1PDHA 2H89A 2JB1A 4ZCCA 3RP6A 1GXFA 3P9UA 4Z43A 1ZMDA 5IQ4A 3GMCA 1VG9A 3BNUA 4OPIA 4J31A 4H4YA 1FECA 4GCMA 5FS9A 3QFBA 3NYCA 4OPLA 1GRAA 4I59A 1JRYA 3AE4A 4NEVA 3EPTA 1F8SA 1TDKA 1K0IA 2GMHA 2ARDA 2OALA 2WS3A 2B9XA 2YM2A 3FPZA 4H2NA 4K7ZA 4U2TA 2IVDA 3HYXA 5KMPA 4GAPA 1JEHA 4NTEA 4NWZA 1CHUA 1GEUA 2WQYA 4LU6A 4H2PA 3T2KA 3CPHG 1H6VA 4RG4A 2ZZBA 2ZBWA 2J3NA 3DH9A 5FS7A 2X8CA 3CGCA 3V76A 4XXGA 2WDQA 3KD9A 1PXBA 1NPXA 4KPRA 2DKIA 3VR9A 4C74A 4XWZA 1BWCA 5U1OA 4DGKA 4H7UA 4LIIA 2YAUA 3T2YA 1PBCA 2YVGA 4J56A 4EM4A 4B69A 4U8NA 2CDUA 3ABVA 3DMEA 3AYIA 4Z26A 1Q1RA 2WDVA 4YKFA 5EBKA 3CTYA 1YQ4A 4G73A 4K5SA 3UKPA 1CC6A 2FJEA 3UP4A 2A89A 2YLZA 3LJPA 1E39A 1ZDLA 2YR4A 1MXTA 3GWDA 5J7XA 1DODA 4TM4A 1L0VA 4D03A 1D7LA 2V6OA 4H2QA 5KOXA 3NLCA 3UOXA 3V3OA 1XPQA 5EB4A 4O5UA 3KPKA 3JSKA 4CRTA 3S5WA 1ELIA 3T14A 4YSXA 2YQUA 3G5QA 3NK2X 1F6MA 3UKKA 1RP0A 2FJDA 2OAMA 2YR6A 4KX6A 4AOSA 2XFUA 3BI4A 3ICTA 4H4VA 4ZCDA 1KNRA 2O9ZA 4OPGA 1L9DA 2WP9A 4JNQA 4BJZA 2GV8A 3VRDB 4C5OA 5J60A 2GR0A 1ZY8A 3QSMA 1LQUA 4H4ZA 3DJDA 1NHRA 3NK1X 4U8MA 1F8WA 1GOSA 1HYUA 4UDQA 1PBBA 1KNPA 2XFQA 4J34A 4NNJA 1GRGA 1PS9A 1XHCA 3G5SA 1EL9A 2BYBA 4II2A 2B9YA 4IVMB 2GB0A 2WPFA 4H2RA 1L9CA 2CFYA 1NG3A 4Z2RA 1M6IA 1N4VA 4J2WA 1ZMCA 4GDEA 1N1PA 3VRAA 3I3LA 3CNTA 1GALA 2VRMA 4U8KA 1JOAA 1EBDA 2C67A 2Q6UA 4U8PA 4J33A 2VVLG 3LB8A 4FK1C 3WE0A 1H86A 5CKUA 3NN6X 4OPDA 2EQ8A 4APNA 4B1BA 3P4PA 3LZXA 1OJDA 1Y56A 4TLXA 2JAEA 2YWLA 1LQTA 3NTDA 2JK6A 1N4UA 3CNSA 3K7MX 2B9WA 4K2XA 1M64A 4IA6A 2X99A 3M12A 1RYIA 1B37A 1FEBA 1ZP0A 4YTMA 1LVLA 4C77A 4A6NB 1AOGA 5KVHA 3UTEA 5TR3A 2XVEA 5KMSA 2WP5A 1IUVA 2YG5A 3CGEA 3SZWA 2QCUA 5M0ZA 4BK1A 2XLRA 3KVEA 2VVLA 1RSGA 2GVCA 3GDPA 3SFDA 3EANA 4II3A 3NH3X 4PABA 2WHDA 2OLOA 4GAVA 2VQ7A 2VZ2A 3AE5A 1NHPA 4YSZA 3ISHA 3CIRA 3UOVA 2WDRA 1YQ3A 2JKCA 1OJAA 1DOBA 1ONFA 2ACZA 4EIPA 5KOWA 2BK5A 3NYEA 1H7WA 3SQPA 3NNEA 2VQBA 1O94A 3UTFA 4X9NA 3Q6JA 1MO9A 1TDEA 5IPYA 1VG0A 3H8IA 2E1MA 4EQXA 1H84A 3AE8A 4GRTA 1CJ4A 5KMQA 2BACA 2PYXA 1JRXA 2BCGG 2BC1A 1GRTA 3GD4A 4P9SA 1CJ3A 2XVJA 2C4CA 4USQA 2ZZ0A 1H82A 4CCRA 4HA6A 3K7TA 2C3DA 4Z2UA 1IJHA 2C65A 1F3PA 5JCLA 5C2TA 3AEEA 2XVFA 4ICYA 1KF6A 3VQRA 2EQ7A 3GRTA 5HYMA 4YSYA 3LADA 3UOYA 3UKAA 3NT6A 1BGJA 2GMJA 3ALLA 2BK3A 3CGBA 2WU2A 1EL7A 5FS6A 3AYLA 3EF6A 1GESA 3DJEA 4A5LA 3SYIA 1Z6LA 1LPFA 3M13A 3CMMA 3LXDA 1F8RA 3F8RA 4BV6A 1PN0A 5DBJA 3P4QA 3Q9TA 1KFYA 3VR8A 3IF9A 3L1RA 3AECA 1D7YA 3AE2A 1VDCA 2XFNA 2YLSA 3CN8A 3GD3A 4JQ9A 5KVIA 2XVIA 1SEZA 4G74A 4BK2A 2YLXA 3KU9A 2WESA 4JNAA 2E5VA 3AD8B 4NEWA 2WPEA 3PVCA 4H4RA 2F5ZA 1PXCA 1DXLA 4TM3A 3K7QX 4EQRA 3LZWA 3BHFA 1GV4A 3AB1A 5KMRA 3II4A 2BS2A 4J36A 1EL8A 3B3RA 3QVPA 3ALJA 2H88A 3NG7X 1CC2A 3BI2A 5KNLA 2C70A 5JCMA 2R4JA 1P2HA 1Y56B 4B64A 5JCIA 4H4QA 3RP7A 3URHA 1XANA 1PBEA 3VRBA 3AXBA 1YKJA 3FG2P 3QJ4A 4RSLA 2VOUA 2JB3A 3REDA 1UKVG 2RGOA 1VQWA 2RGHA 2PHHA 3KKJA 3SZ0A 4XWRA 3UKQA 1IUUA 2UZZA 2Z5XA 2YG4A 4H4SA 1E6EA 4C3XA 2GR2A 2YLTA 3IHMA 1JNRA 1GRFA 3O0HA 1TRBA 2A8XA 2C76A 3AEDA 1FL2A 4AT0A 3FBSA 2V3AA 2Y6QA 2FJBA 3KLJA 2WBAA 4CCQA 5FS8A 1KDGA 2WU5A 3ATRA 1GPEA 1EL5A 2GAGB 4U2LA 4AP3A 3GYXA 1ZK7A 3QFAA 1E1KA 4A79A 1LTXR 3IC9A 5EB5A 1CF3A 2VVMA 3GDNA 3T31A 4UP3A 4CY8A 2AQJA 2BS4A 2IVEA 1W4XA 4OPCA 2BXSA 4O5QA 3HZLA 1BKWA 5FMHA 1BGNA 4FDCB 1D5TA 2GEWA 3SXIA 4E0VA 2C3CA 2C75A 4H4XA 3NRNA 2XLTA 3C4NA 2QA1A 4TLZA 2IIDA 3ITJA 1COYA 1DJNA 4IA5A 1H83A 1TDNA 2YG7A 3NHOX 1YQZA 3B6DA 2Q7VA 4OVIA 1MOKA 4N9XA 4G9KA 1QJDA 2HQMA 2YVJA 1GREA 2YR5A 1TDOA 4G6GA 3AD9B 1TYPA 3IWAA 1OJCA 2TPRA 1E1NA 1ZKQA 3QSEA 3SX6A 4U8IA 3NIXA 3AYJA 2JB2A 2QAEA 3GSIA 1IUWA 3S61A 2WETA 4JN9A 1S2YA 3NGCX 3HYVA 1L9EA 4DSHA 1D4EA 3BI5A 3I6DA 2FJAA 4EMWA 2XFOA 2BCPA 2GR3A 1N4WA 1QLBA 1K0LA 4HB9A 3AEAA 2WP6A 2R0GA 4Y4NA 2W0HA 5BULA 3D8XA 2Q0LA 2AAQA 4CBQA 2BS3A 2VRLA 1H7XA 2XVHA 2BXRA 3P4RA 3M0OA 5C3JA 1CJCA 2BA9A 4EM3A 3UCLA 3UTGA 2B76A 1REOA 2Z5YA 1PJ7A 4IVOB 4H4PA 5HHFA 5BVAA 2GF3A 3RHAA 1B4VA 2OA1A 3NYFA 4J57A 4GR1A 3CNJA 4NZHA 2XYOA 3ICSA 3BNMA 4CNJA 1S2QA 2YLWA 1X31B 2OLNA 2BC0A 2APGA 2R46A 3H4KA 3OZ2A 3FMWA 4YSHA 4AOXA 4UDPA 4EMJA 1CJ2A 1OJTA 4PAAA 5IQ1A 1ZOVA 4YWOA 1TDFA 4JY3A 2BRYA 1NENA
chains in the Genus database with same CATH topology
2C7GA 4USRA 2V5ZA 5M10A 1GRBA 4H50A 1H81A 3KPFA 1V59A 1OJ9A 3DGZA 3DK9A 2EQ6A 4NTDA 1IUXA 5L46A 1Q9IA 3UP5A 1ZX9A 4C3YA 1DNCA 4EQWA 3DK8A 5U63A 1K0JA 1E1MA 1BF3A 1XDIA 3AE3A 1JNZA 3GMBA 3H8LA 1K4QA 4Z25A 3P1WA 4YKGA 4GUVA 3RNMA 2QA2A 3AEGA 4EMIA 3OC4A 2R4EA 4A7AA 1FCDA 1NHQA 4JY2A 5KXJA 3IHGA 4DNAA 1LJ1A 3ALMA 3NTAA 2RABA 2CVJA 1KSUA 2XFPA 3CPIG 1GRHA 2WOVA 1FEAA 1KSSA 1PJ5A 5JCNA 4NTCA 3GWFA 3SZCA 2YG6A 5LV9A 3T37A 4Z2TA 4D04A 2XLSA 2NPXA 3ZDNA 3K30A 4CNKA 1CL0A 4BK3A 3AE7A 4WCTA 3F8DA 1GTHA 1JRZA 3RP8A 1CBOA 3E1TA 4H4TA 4UDRA 3UOZA 2WEUA 3G5RA 4GDPA 1GT8A 2JBVA 1IUSA 4B68A 2C66A 2YG3A 4IV9A 4BURA 4H4UA 4K22A 3AD7B 3PS9A 4Y4MA 1FOHA 4YXDA 3CNPA 4LA1A 1Q1WA 2X50A 4FK1A 4H4WA 3L8KA 3CPJG 5GSNA 1P2EA 5KRQA 3F8PA 2TMDA 4EQSA 1PXAA 1D4DA 1PBDA 2BABA 2GR1A 4G6HA 2B7RA 1GSNA 2WPCA 4ECHA 3DGHA 2X8HA 2XLPA 3R9UA 3SM8A 2DKHA 2B7SA 4JDRA 2XCGA 3D1CA 2YM1A 5KWFA 3EAOA 3BHKA 4U8OA 2E4GA 4AP1A 1TYTA 3AEFA 4U8LA 4X4JA 5CQFA 4DSGA 4I58A 2XLUA 4YT0A 3AE1A 3ICRA 3QSSA 4OCGA 3SGLA 1Y0PA 4A65A 1LV0A 1D4CA 2Q0KA 1E1LA 4Y4LA 5BRTA 2GRTA 3QVRA 1DJQA 5GRTA 3UTHA 1GNDA 2V3BA 4GF7A 4OPTA 4U2SA 4B67A 4WX1A 3AE6A 3T0KA 4BJYA 5BUKA 1ZOYA 3HYWA 1YY5A 2AR8A 2R0CA 3GRSA 3NK0X 3GYIA 1GTEA 1O95A 3DJGX 2GAHB 4MJWA 5U25A 1DOEA 3PO7A 2NVKX 4Z44A 3COXA 4K5RA 3DK4A 4AT2A 1QO8A 5JCKA 3DA1A 2I0ZA 1JU2A 4FX9A 4OPUA 3SFEA 3UKLA 2V60A 4B65A 1S3BA 1NHSA 1VRQB 2FBWA 2ZZCA 2X8GA 4X9MA 1PBFA 3ADAB 2RGJA 4ADWA 3CNDA 3AWIA 4YTNA 3KA7A 2Y6RA 4TM0A 1DOCA 3NKSA 2YVFA 4TM1A 1NDAA 2XDOA 3V3NA 1GETA 1S3EA 2BK4A 2R0PA 3UKFA 3T2ZA 2R45A 2C72A 2WOIA 5ER0A 1CC4A 1NEKA 3UKHA 3FIMB 1GERA 2GQWA 4RG3A 4CY6A 1B8SA 3C4AA 3LOVA 3GYJA 5HY5A 3CGDA 5EOWA 2GQFA 3P4SA 3ATQA 4A99A 2CULA 3AEBA 4A9WA 3C96A 4M52A 2V61A 1IUTA 3ZYXA 1E7PA 2YLRA 1NG4A 2C73A 3SY4A 4K8DA 1B5QA 2C64A 2WOWA 4YTPA 4ZN0A 1NAAA 1PJ6A 3SZFA 2EQ9A 4REKA 4A6NA 2X3NA 3AE9A 4U8JA 2GH5A 3DJJA 4B63A 4Z24A 2R9ZA 4EIQA 2BRAA 4B66A 1BZLA 1O5WA 3NN0X 5HXIA 1PHHA 2A87A 1PDHA 2H89A 2JB1A 4ZCCA 3RP6A 1GXFA 3P9UA 4Z43A 1ZMDA 5IQ4A 3GMCA 1VG9A 3BNUA 4OPIA 4J31A 4H4YA 1FECA 4GCMA 5FS9A 3QFBA 3NYCA 4OPLA 1GRAA 4I59A 1JRYA 3AE4A 4NEVA 3EPTA 1F8SA 1TDKA 1K0IA 2GMHA 2ARDA 2OALA 2WS3A 2B9XA 2YM2A 3FPZA 4H2NA 4K7ZA 4U2TA 2IVDA 3HYXA 5KMPA 4GAPA 1JEHA 4NTEA 4NWZA 1CHUA 1GEUA 2WQYA 4LU6A 4H2PA 3T2KA 3CPHG 1H6VA 4RG4A 2ZZBA 2ZBWA 2J3NA 3DH9A 5FS7A 2X8CA 3CGCA 3V76A 4XXGA 2WDQA 3KD9A 1PXBA 1NPXA 4KPRA 2DKIA 3VR9A 4C74A 4XWZA 1BWCA 5U1OA 4DGKA 4H7UA 4LIIA 2YAUA 3T2YA 1PBCA 2YVGA 4J56A 4EM4A 4B69A 4U8NA 2CDUA 3ABVA 3DMEA 3AYIA 4Z26A 1Q1RA 2WDVA 4YKFA 5EBKA 3CTYA 1YQ4A 4G73A 4K5SA 3UKPA 1CC6A 2FJEA 3UP4A 2A89A 2YLZA 3LJPA 1E39A 1ZDLA 2YR4A 1MXTA 3GWDA 5J7XA 1DODA 4TM4A 1L0VA 4D03A 1D7LA 2V6OA 4H2QA 5KOXA 3NLCA 3UOXA 3V3OA 1XPQA 5EB4A 4O5UA 3KPKA 3JSKA 4CRTA 3S5WA 1ELIA 3T14A 4YSXA 2YQUA 3G5QA 3NK2X 1F6MA 3UKKA 1RP0A 2FJDA 2OAMA 2YR6A 4KX6A 4AOSA 2XFUA 3BI4A 3ICTA 4H4VA 4ZCDA 1KNRA 2O9ZA 4OPGA 1L9DA 2WP9A 4JNQA 4BJZA 2GV8A 3VRDB 4C5OA 5J60A 2GR0A 1ZY8A 3QSMA 1LQUA 4H4ZA 3DJDA 1NHRA 3NK1X 4U8MA 1F8WA 1GOSA 1HYUA 4UDQA 1PBBA 1KNPA 2XFQA 4J34A 4NNJA 1GRGA 1PS9A 1XHCA 3G5SA 1EL9A 2BYBA 4II2A 2B9YA 4IVMB 2GB0A 2WPFA 4H2RA 1L9CA 2CFYA 1NG3A 4Z2RA 1M6IA 1N4VA 4J2WA 1ZMCA 4GDEA 1N1PA 3VRAA 3I3LA 3CNTA 1GALA 2VRMA 4U8KA 1JOAA 1EBDA 2C67A 2Q6UA 4U8PA 4J33A 2VVLG 3LB8A 4FK1C 3WE0A 1H86A 5CKUA 3NN6X 4OPDA 2EQ8A 4APNA 4B1BA 3P4PA 3LZXA 1OJDA 1Y56A 4TLXA 2JAEA 2YWLA 1LQTA 3NTDA 2JK6A 1N4UA 3CNSA 3K7MX 2B9WA 4K2XA 1M64A 4IA6A 2X99A 3M12A 1RYIA 1B37A 1FEBA 1ZP0A 4YTMA 1LVLA 4C77A 4A6NB 1AOGA 5KVHA 3UTEA 5TR3A 2XVEA 5KMSA 2WP5A 1IUVA 2YG5A 3CGEA 3SZWA 2QCUA 5M0ZA 4BK1A 2XLRA 3KVEA 2VVLA 1RSGA 2GVCA 3GDPA 3SFDA 3EANA 4II3A 3NH3X 4PABA 2WHDA 2OLOA 4GAVA 2VQ7A 2VZ2A 3AE5A 1NHPA 4YSZA 3ISHA 3CIRA 3UOVA 2WDRA 1YQ3A 2JKCA 1OJAA 1DOBA 1ONFA 2ACZA 4EIPA 5KOWA 2BK5A 3NYEA 1H7WA 3SQPA 3NNEA 2VQBA 1O94A 3UTFA 4X9NA 3Q6JA 1MO9A 1TDEA 5IPYA 1VG0A 3H8IA 2E1MA 4EQXA 1H84A 3AE8A 4GRTA 1CJ4A 5KMQA 2BACA 2PYXA 1JRXA 2BCGG 2BC1A 1GRTA 3GD4A 4P9SA 1CJ3A 2XVJA 2C4CA 4USQA 2ZZ0A 1H82A 4CCRA 4HA6A 3K7TA 2C3DA 4Z2UA 1IJHA 2C65A 1F3PA 5JCLA 5C2TA 3AEEA 2XVFA 4ICYA 1KF6A 3VQRA 2EQ7A 3GRTA 5HYMA 4YSYA 3LADA 3UOYA 3UKAA 3NT6A 1BGJA 2GMJA 3ALLA 2BK3A 3CGBA 2WU2A 1EL7A 5FS6A 3AYLA 3EF6A 1GESA 3DJEA 4A5LA 3SYIA 1Z6LA 1LPFA 3M13A 3CMMA 3LXDA 1F8RA 3F8RA 4BV6A 1PN0A 5DBJA 3P4QA 3Q9TA 1KFYA 3VR8A 3IF9A 3L1RA 3AECA 1D7YA 3AE2A 1VDCA 2XFNA 2YLSA 3CN8A 3GD3A 4JQ9A 5KVIA 2XVIA 1SEZA 4G74A 4BK2A 2YLXA 3KU9A 2WESA 4JNAA 2E5VA 3AD8B 4NEWA 2WPEA 3PVCA 4H4RA 2F5ZA 1PXCA 1DXLA 4TM3A 3K7QX 4EQRA 3LZWA 3BHFA 1GV4A 3AB1A 5KMRA 3II4A 2BS2A 4J36A 1EL8A 3B3RA 3QVPA 3ALJA 2H88A 3NG7X 1CC2A 3BI2A 5KNLA 2C70A 5JCMA 2R4JA 1P2HA 1Y56B 4B64A 5JCIA 4H4QA 3RP7A 3URHA 1XANA 1PBEA 3VRBA 3AXBA 1YKJA 3FG2P 3QJ4A 4RSLA 2VOUA 2JB3A 3REDA 1UKVG 2RGOA 1VQWA 2RGHA 2PHHA 3KKJA 3SZ0A 4XWRA 3UKQA 1IUUA 2UZZA 2Z5XA 2YG4A 4H4SA 1E6EA 4C3XA 2GR2A 2YLTA 3IHMA 1JNRA 1GRFA 3O0HA 1TRBA 2A8XA 2C76A 3AEDA 1FL2A 4AT0A 3FBSA 2V3AA 2Y6QA 2FJBA 3KLJA 2WBAA 4CCQA 5FS8A 1KDGA 2WU5A 3ATRA 1GPEA 1EL5A 2GAGB 4U2LA 4AP3A 3GYXA 1ZK7A 3QFAA 1E1KA 4A79A 1LTXR 3IC9A 5EB5A 1CF3A 2VVMA 3GDNA 3T31A 4UP3A 4CY8A 2AQJA 2BS4A 2IVEA 1W4XA 4OPCA 2BXSA 4O5QA 3HZLA 1BKWA 5FMHA 1BGNA 4FDCB 1D5TA 2GEWA 3SXIA 4E0VA 2C3CA 2C75A 4H4XA 3NRNA 2XLTA 3C4NA 2QA1A 4TLZA 2IIDA 3ITJA 1COYA 1DJNA 4IA5A 1H83A 1TDNA 2YG7A 3NHOX 1YQZA 3B6DA 2Q7VA 4OVIA 1MOKA 4N9XA 4G9KA 1QJDA 2HQMA 2YVJA 1GREA 2YR5A 1TDOA 4G6GA 3AD9B 1TYPA 3IWAA 1OJCA 2TPRA 1E1NA 1ZKQA 3QSEA 3SX6A 4U8IA 3NIXA 3AYJA 2JB2A 2QAEA 3GSIA 1IUWA 3S61A 2WETA 4JN9A 1S2YA 3NGCX 3HYVA 1L9EA 4DSHA 1D4EA 3BI5A 3I6DA 2FJAA 4EMWA 2XFOA 2BCPA 2GR3A 1N4WA 1QLBA 1K0LA 4HB9A 3AEAA 2WP6A 2R0GA 4Y4NA 2W0HA 5BULA 3D8XA 2Q0LA 2AAQA 4CBQA 2BS3A 2VRLA 1H7XA 2XVHA 2BXRA 3P4RA 3M0OA 5C3JA 1CJCA 2BA9A 4EM3A 3UCLA 3UTGA 2B76A 1REOA 2Z5YA 1PJ7A 4IVOB 4H4PA 5HHFA 5BVAA 2GF3A 3RHAA 1B4VA 2OA1A 3NYFA 4J57A 4GR1A 3CNJA 4NZHA 2XYOA 3ICSA 3BNMA 4CNJA 1S2QA 2YLWA 1X31B 2OLNA 2BC0A 2APGA 2R46A 3H4KA 3OZ2A 3FMWA 4YSHA 4AOXA 4UDPA 4EMJA 1CJ2A 1OJTA 4PAAA 5IQ1A 1ZOVA 4YWOA 1TDFA 4JY3A 2BRYA 1NENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C7G A;  4USR A;  2V5Z A;  5M10 A;  1GRB A;  4H50 A;  1H81 A;  3KPF A;  1V59 A;  1OJ9 A;  3DGZ A;  3DK9 A;  2EQ6 A;  4NTD A;  1IUX A;  5L46 A;  1Q9I A;  3UP5 A;  1ZX9 A;  4C3Y A;  1DNC A;  4EQW A;  3DK8 A;  5U63 A;  1K0J A;  1E1M A;  1BF3 A;  1XDI A;  3AE3 A;  1JNZ A;  3GMB A;  3H8L A;  1K4Q A;  4Z25 A;  3P1W A;  4YKG A;  4GUV A;  3RNM A;  2QA2 A;  3AEG A;  4EMI A;  3OC4 A;  2R4E A;  4A7A A;  1FCD A;  1NHQ A;  4JY2 A;  5KXJ A;  3IHG A;  4DNA A;  1LJ1 A;  3ALM A;  3NTA A;  2RAB A;  2CVJ A;  1KSU A;  2XFP A;  3CPI G;  1GRH A;  2WOV A;  1FEA A;  1KSS A;  1PJ5 A;  5JCN A;  4NTC A;  3GWF A;  2YG6 A;  5LV9 A;  3T37 A;  4Z2T A;  4D04 A;  2XLS A;  2NPX A;  3ZDN A;  3K30 A;  4CNK A;  1CL0 A;  4BK3 A;  3AE7 A;  4WCT A;  3F8D A;  1GTH A;  1JRZ A;  3RP8 A;  1CBO A;  3E1T A;  4H4T A;  4UDR A;  3UOZ A;  2WEU A;  3G5R A;  4GDP A;  1GT8 A;  2JBV A;  1IUS A;  4B68 A;  2C66 A;  2YG3 A;  4IV9 A;  4BUR A;  4H4U A;  4K22 A;  3AD7 B;  3PS9 A;  4Y4M A;  1FOH A;  4YXD A;  3CNP A;  4LA1 A;  1Q1W A;  2X50 A;  4FK1 A;  4H4W A;  3L8K A;  3CPJ G;  5GSN A;  1P2E A;  3F8P A;  2TMD A;  4EQS A;  1PXA A;  1D4D A;  1PBD A;  2BAB A;  2GR1 A;  2B7R A;  1GSN A;  2WPC A;  4ECH A;  3DGH A;  2X8H A;  2XLP A;  3R9U A;  3SM8 A;  2DKH A;  2B7S A;  4JDR A;  2XCG A;  3D1C A;  2YM1 A;  5KWF A;  3EAO A;  3BHK A;  4U8O A;  2E4G A;  4AP1 A;  1TYT A;  3AEF A;  4U8L A;  4X4J A;  5CQF A;  4DSG A;  4I58 A;  2XLU A;  4YT0 A;  3AE1 A;  3ICR A;  3QSS A;  4OCG A;  3SGL A;  1Y0P A;  4A65 A;  1LV0 A;  1D4C A;  2Q0K A;  1E1L A;  4Y4L A;  5BRT A;  2GRT A;  3QVR A;  1DJQ A;  5GRT A;  3UTH A;  1GND A;  2V3B A;  4GF7 A;  4OPT A;  4U2S A;  4B67 A;  4WX1 A;  3AE6 A;  4BJY A;  5BUK A;  1ZOY A;  1YY5 A;  2AR8 A;  2R0C A;  3GRS A;  3NK0 X;  3GYI A;  1GTE A;  1O95 A;  3DJG X;  2GAH B;  4MJW A;  5U25 A;  1DOE A;  3PO7 A;  2NVK X;  4Z44 A;  3COX A;  4K5R A;  3DK4 A;  4AT2 A;  1QO8 A;  5JCK A;  3DA1 A;  2I0Z A;  1JU2 A;  4FX9 A;  4OPU A;  3SFE A;  3UKL A;  2V60 A;  4B65 A;  1S3B A;  1NHS A;  1VRQ B;  2FBW A;  2ZZC A;  2X8G A;  4X9M A;  1PBF A;  3ADA B;  2RGJ A;  4ADW A;  3CND A;  3AWI A;  4YTN A;  3KA7 A;  2Y6R A;  4TM0 A;  1DOC A;  3NKS A;  2YVF A;  4TM1 A;  1NDA A;  2XDO A;  3V3N A;  1GET A;  1S3E A;  2BK4 A;  2R0P A;  3UKF A;  2R45 A;  2C72 A;  2WOI A;  5ER0 A;  1CC4 A;  1NEK A;  3UKH A;  3FIM B;  1GER A;  2GQW A;  4RG3 A;  4CY6 A;  1B8S A;  3C4A A;  3LOV A;  3GYJ A;  5HY5 A;  3CGD A;  5EOW A;  2GQF A;  3P4S A;  3ATQ A;  4A99 A;  2CUL A;  3AEB A;  4A9W A;  3C96 A;  4M52 A;  2V61 A;  1IUT A;  3ZYX A;  1E7P A;  2YLR A;  1NG4 A;  2C73 A;  4YTP A;  4K8D A;  1B5Q A;  2C64 A;  2WOW A;  4ZN0 A;  5KRQ A;  1NAA A;  1PJ6 A;  2EQ9 A;  4REK A;  4A6N A;  2X3N A;  3AE9 A;  4U8J A;  2GH5 A;  3DJJ A;  4B63 A;  4Z24 A;  2R9Z A;  4EIQ A;  4B66 A;  5HXI A;  1BZL A;  1O5W A;  3NN0 X;  1PHH A;  2A87 A;  1PDH A;  2H89 A;  2JB1 A;  4ZCC A;  3RP6 A;  1GXF A;  3P9U A;  4Z43 A;  1ZMD A;  5IQ4 A;  3GMC A;  1VG9 A;  3BNU A;  4OPI A;  4J31 A;  4H4Y A;  1FEC A;  4GCM A;  5FS9 A;  3QFB A;  3NYC A;  4OPL A;  1GRA A;  4I59 A;  1JRY A;  3AE4 A;  4NEV A;  3EPT A;  1F8S A;  1TDK A;  1K0I A;  2GMH A;  2ARD A;  2OAL A;  2WS3 A;  2B9X A;  2YM2 A;  3FPZ A;  4H2N A;  4K7Z A;  4U2T A;  2IVD A;  1JEH A;  4NTE A;  1CHU A;  1GEU A;  2WQY A;  4LU6 A;  4H2P A;  3CPH G;  1H6V A;  4RG4 A;  2ZZB A;  2ZBW A;  2J3N A;  3DH9 A;  5FS7 A;  2X8C A;  3CGC A;  3V76 A;  4XXG A;  2WDQ A;  3KD9 A;  1PXB A;  1NPX A;  4KPR A;  2DKI A;  3VR9 A;  4C74 A;  4XWZ A;  1BWC A;  5U1O A;  4DGK A;  4H7U A;  4LII A;  2YAU A;  1PBC A;  2YVG A;  4J56 A;  4EM4 A;  4B69 A;  4U8N A;  2CDU A;  3ABV A;  3DME A;  3AYI A;  4Z26 A;  1Q1R A;  2WDV A;  4YKF A;  5EBK A;  3CTY A;  1YQ4 A;  4K5S A;  3UKP A;  1CC6 A;  2FJE A;  3UP4 A;  2A89 A;  2YLZ A;  3LJP A;  1E39 A;  1ZDL A;  2YR4 A;  1MXT A;  3GWD A;  5J7X A;  1DOD A;  4TM4 A;  1L0V A;  4D03 A;  1D7L A;  2V6O A;  4H2Q A;  5KOX A;  3NLC A;  3UOX A;  3V3O A;  1XPQ A;  5EB4 A;  4O5U A;  3JSK A;  4CRT A;  3S5W A;  1ELI A;  4YSX A;  2YQU A;  3G5Q A;  3NK2 X;  1F6M A;  3UKK A;  1RP0 A;  2FJD A;  2OAM A;  2YR6 A;  4KX6 A;  4AOS A;  2XFU A;  3BI4 A;  3ICT A;  4H4V A;  4ZCD A;  1KNR A;  2O9Z A;  4OPG A;  1L9D A;  2WP9 A;  4JNQ A;  4BJZ A;  2GV8 A;  3VRD B;  4C5O A;  5J60 A;  2GR0 A;  1ZY8 A;  3QSM A;  1LQU A;  4H4Z A;  3DJD A;  1NHR A;  3NK1 X;  4U8M A;  1F8W A;  1GOS A;  1HYU A;  4UDQ A;  1PBB A;  1KNP A;  2XFQ A;  4J34 A;  1GRG A;  1PS9 A;  1XHC A;  3G5S A;  1EL9 A;  2BYB A;  2B9Y A;  4IVM B;  2GB0 A;  2WPF A;  4H2R A;  1L9C A;  2CFY A;  1NG3 A;  4Z2R A;  1M6I A;  1N4V A;  4J2W A;  1ZMC A;  4GDE A;  1N1P A;  3VRA A;  3I3L A;  3CNT A;  1GAL A;  2VRM A;  4U8K A;  1JOA A;  1EBD A;  2C67 A;  2Q6U A;  4U8P A;  4J33 A;  2VVL G;  3LB8 A;  4FK1 C;  3WE0 A;  1H86 A;  5CKU A;  3NN6 X;  4OPD A;  2EQ8 A;  4APN A;  4B1B A;  3P4P A;  3LZX A;  1OJD A;  1Y56 A;  4TLX A;  2JAE A;  2YWL A;  1LQT A;  3NTD A;  2JK6 A;  1N4U A;  3CNS A;  3K7M X;  2B9W A;  4K2X A;  1M64 A;  4IA6 A;  2X99 A;  3M12 A;  1RYI A;  1B37 A;  1FEB A;  1ZP0 A;  4YTM A;  1LVL A;  4C77 A;  4A6N B;  1AOG A;  5KVH A;  3UTE A;  5TR3 A;  2XVE A;  2WP5 A;  1IUV A;  2YG5 A;  3CGE A;  4BK1 A;  2QCU A;  5M0Z A;  2XLR A;  3KVE A;  2VVL A;  1RSG A;  2GVC A;  3GDP A;  3SFD A;  3EAN A;  3NH3 X;  4PAB A;  2WHD A;  2OLO A;  2VQ7 A;  2VZ2 A;  3AE5 A;  1NHP A;  4YSZ A;  3ISH A;  3CIR A;  3UOV A;  2WDR A;  1YQ3 A;  2JKC A;  1OJA A;  1DOB A;  1ONF A;  2ACZ A;  4EIP A;  5KOW A;  2BK5 A;  3NYE A;  1H7W A;  3SQP A;  3NNE A;  2VQB A;  1O94 A;  3UTF A;  4X9N A;  3Q6J A;  1MO9 A;  1TDE A;  5IPY A;  1VG0 A;  3H8I A;  2E1M A;  4EQX A;  1H84 A;  3AE8 A;  4GRT A;  1CJ4 A;  2BAC A;  2PYX A;  1JRX A;  2BCG G;  2BC1 A;  1GRT A;  3GD4 A;  4P9S A;  1CJ3 A;  2XVJ A;  4USQ A;  2ZZ0 A;  1H82 A;  4CCR A;  4HA6 A;  3K7T A;  2C3D A;  4Z2U A;  1IJH A;  2C65 A;  1F3P A;  5JCL A;  5C2T A;  3AEE A;  2XVF A;  4ICY A;  1KF6 A;  3VQR A;  2EQ7 A;  3GRT A;  5HYM A;  4YSY A;  3LAD A;  3UOY A;  3UKA A;  3NT6 A;  1BGJ A;  2GMJ A;  3ALL A;  2BK3 A;  3CGB A;  2WU2 A;  1EL7 A;  5FS6 A;  3AYL A;  3EF6 A;  1GES A;  3DJE A;  4A5L A;  1Z6L A;  1LPF A;  3M13 A;  3LXD A;  1F8R A;  3F8R A;  4BV6 A;  1PN0 A;  5DBJ A;  3P4Q A;  3Q9T A;  1KFY A;  3VR8 A;  3IF9 A;  3L1R A;  3AEC A;  1D7Y A;  3AE2 A;  1VDC A;  2XFN A;  2YLS A;  3CN8 A;  3GD3 A;  4JQ9 A;  5KVI A;  2XVI A;  1SEZ A;  4BK2 A;  2YLX A;  3KU9 A;  2WES A;  4JNA A;  2E5V A;  3AD8 B;  4NEW A;  2WPE A;  3PVC A;  4H4R A;  2F5Z A;  1PXC A;  1DXL A;  4TM3 A;  3K7Q X;  4EQR A;  3LZW A;  3BHF A;  1GV4 A;  3AB1 A;  3II4 A;  2BS2 A;  4J36 A;  1EL8 A;  3B3R A;  3QVP A;  3ALJ A;  2H88 A;  3NG7 X;  1CC2 A;  3BI2 A;  2C70 A;  5JCM A;  2R4J A;  1P2H A;  1Y56 B;  4B64 A;  5JCI A;  4H4Q A;  3RP7 A;  3URH A;  1XAN A;  1PBE A;  3VRB A;  3AXB A;  1YKJ A;  3FG2 P;  3QJ4 A;  4RSL A;  2VOU A;  2JB3 A;  3RED A;  1UKV G;  2RGO A;  1VQW A;  2RGH A;  2PHH A;  3KKJ A;  4XWR A;  3UKQ A;  1IUU A;  2UZZ A;  2Z5X A;  2YG4 A;  4H4S A;  1E6E A;  4C3X A;  2GR2 A;  2YLT A;  3IHM A;  1JNR A;  1GRF A;  3O0H A;  1TRB A;  2A8X A;  2C76 A;  3AED A;  1FL2 A;  4AT0 A;  3FBS A;  2V3A A;  2Y6Q A;  2FJB A;  3KLJ A;  2WBA A;  4CCQ A;  5FS8 A;  1KDG A;  2WU5 A;  3ATR A;  1GPE A;  1EL5 A;  2GAG B;  4U2L A;  4AP3 A;  3QFA A;  1ZK7 A;  1E1K A;  4A79 A;  1LTX R;  3IC9 A;  5EB5 A;  1CF3 A;  2VVM A;  3GDN A;  4UP3 A;  4CY8 A;  2AQJ A;  2BS4 A;  2IVE A;  1W4X A;  4OPC A;  2BXS A;  4O5Q A;  3HZL A;  1BKW A;  5FMH A;  1BGN A;  4FDC B;  1D5T A;  2GEW A;  4E0V A;  2C3C A;  2C75 A;  4H4X A;  3NRN A;  2XLT A;  3C4N A;  2QA1 A;  4TLZ A;  2IID A;  3ITJ A;  1COY A;  1DJN A;  4IA5 A;  1H83 A;  1TDN A;  2YG7 A;  3NHO X;  1YQZ A;  3B6D A;  2Q7V A;  4OVI A;  1MOK A;  4N9X A;  1QJD A;  2HQM A;  2YVJ A;  1GRE A;  2YR5 A;  1TDO A;  3AD9 B;  1TYP A;  3IWA A;  1OJC A;  2TPR A;  1E1N A;  1ZKQ A;  3QSE A;  4U8I A;  3NIX A;  3AYJ A;  2JB2 A;  2QAE A;  3GSI A;  1IUW A;  3S61 A;  2WET A;  4JN9 A;  1S2Y A;  3NGC X;  1L9E A;  4DSH A;  1D4E A;  3BI5 A;  3I6D A;  2FJA A;  4EMW A;  2XFO A;  2BCP A;  2GR3 A;  1N4W A;  1QLB A;  1K0L A;  4HB9 A;  3AEA A;  2WP6 A;  2R0G A;  4Y4N A;  2W0H A;  5BUL A;  3D8X A;  2Q0L A;  2AAQ A;  4CBQ A;  2BS3 A;  2VRL A;  1H7X A;  2XVH A;  2BXR A;  3P4R A;  3M0O A;  5C3J A;  1CJC A;  2BA9 A;  4EM3 A;  3UCL A;  3UTG A;  2B76 A;  1REO A;  2Z5Y A;  1PJ7 A;  4IVO B;  4H4P A;  5HHF A;  5BVA A;  2GF3 A;  3RHA A;  1B4V A;  2OA1 A;  3NYF A;  4J57 A;  4GR1 A;  3CNJ A;  4NZH A;  2XYO A;  3ICS A;  3BNM A;  4CNJ A;  1S2Q A;  2YLW A;  1X31 B;  2OLN A;  2BC0 A;  2APG A;  2R46 A;  3H4K A;  3OZ2 A;  3FMW A;  4YSH A;  4AOX A;  4UDP A;  4EMJ A;  1CJ2 A;  1OJT A;  4PAA A;  5IQ1 A;  1ZOV A;  4YWO A;  1TDF A;  4JY3 A;  1NEN A; 
#chains in the Genus database with same CATH topology
 2C7G A;  4USR A;  2V5Z A;  5M10 A;  1GRB A;  4H50 A;  1H81 A;  3KPF A;  1V59 A;  1OJ9 A;  3DGZ A;  3DK9 A;  2EQ6 A;  4NTD A;  1IUX A;  5L46 A;  1Q9I A;  3UP5 A;  1ZX9 A;  4C3Y A;  1DNC A;  4EQW A;  3DK8 A;  5U63 A;  1K0J A;  1E1M A;  1BF3 A;  1XDI A;  3AE3 A;  1JNZ A;  3GMB A;  3H8L A;  1K4Q A;  4Z25 A;  3P1W A;  4YKG A;  4GUV A;  3RNM A;  2QA2 A;  3AEG A;  4EMI A;  3OC4 A;  2R4E A;  4A7A A;  1FCD A;  1NHQ A;  4JY2 A;  5KXJ A;  3IHG A;  4DNA A;  1LJ1 A;  3ALM A;  3NTA A;  2RAB A;  2CVJ A;  1KSU A;  2XFP A;  3CPI G;  1GRH A;  2WOV A;  1FEA A;  1KSS A;  1PJ5 A;  5JCN A;  4NTC A;  3GWF A;  3SZC A;  2YG6 A;  5LV9 A;  3T37 A;  4Z2T A;  4D04 A;  2XLS A;  2NPX A;  3ZDN A;  3K30 A;  4CNK A;  1CL0 A;  4BK3 A;  3AE7 A;  4WCT A;  3F8D A;  1GTH A;  1JRZ A;  3RP8 A;  1CBO A;  3E1T A;  4H4T A;  4UDR A;  3UOZ A;  2WEU A;  3G5R A;  4GDP A;  1GT8 A;  2JBV A;  1IUS A;  4B68 A;  2C66 A;  2YG3 A;  4IV9 A;  4BUR A;  4H4U A;  4K22 A;  3AD7 B;  3PS9 A;  4Y4M A;  1FOH A;  4YXD A;  3CNP A;  4LA1 A;  1Q1W A;  2X50 A;  4FK1 A;  4H4W A;  3L8K A;  3CPJ G;  5GSN A;  1P2E A;  5KRQ A;  3F8P A;  2TMD A;  4EQS A;  1PXA A;  1D4D A;  1PBD A;  2BAB A;  2GR1 A;  4G6H A;  2B7R A;  1GSN A;  2WPC A;  4ECH A;  3DGH A;  2X8H A;  2XLP A;  3R9U A;  3SM8 A;  2DKH A;  2B7S A;  4JDR A;  2XCG A;  3D1C A;  2YM1 A;  5KWF A;  3EAO A;  3BHK A;  4U8O A;  2E4G A;  4AP1 A;  1TYT A;  3AEF A;  4U8L A;  4X4J A;  5CQF A;  4DSG A;  4I58 A;  2XLU A;  4YT0 A;  3AE1 A;  3ICR A;  3QSS A;  4OCG A;  3SGL A;  1Y0P A;  4A65 A;  1LV0 A;  1D4C A;  2Q0K A;  1E1L A;  4Y4L A;  5BRT A;  2GRT A;  3QVR A;  1DJQ A;  5GRT A;  3UTH A;  1GND A;  2V3B A;  4GF7 A;  4OPT A;  4U2S A;  4B67 A;  4WX1 A;  3AE6 A;  3T0K A;  4BJY A;  5BUK A;  1ZOY A;  3HYW A;  1YY5 A;  2AR8 A;  2R0C A;  3GRS A;  3NK0 X;  3GYI A;  1GTE A;  1O95 A;  3DJG X;  2GAH B;  4MJW A;  5U25 A;  1DOE A;  3PO7 A;  2NVK X;  4Z44 A;  3COX A;  4K5R A;  3DK4 A;  4AT2 A;  1QO8 A;  5JCK A;  3DA1 A;  2I0Z A;  1JU2 A;  4FX9 A;  4OPU A;  3SFE A;  3UKL A;  2V60 A;  4B65 A;  1S3B A;  1NHS A;  1VRQ B;  2FBW A;  2ZZC A;  2X8G A;  4X9M A;  1PBF A;  3ADA B;  2RGJ A;  4ADW A;  3CND A;  3AWI A;  4YTN A;  3KA7 A;  2Y6R A;  4TM0 A;  1DOC A;  3NKS A;  2YVF A;  4TM1 A;  1NDA A;  2XDO A;  3V3N A;  1GET A;  1S3E A;  2BK4 A;  2R0P A;  3UKF A;  3T2Z A;  2R45 A;  2C72 A;  2WOI A;  5ER0 A;  1CC4 A;  1NEK A;  3UKH A;  3FIM B;  1GER A;  2GQW A;  4RG3 A;  4CY6 A;  1B8S A;  3C4A A;  3LOV A;  3GYJ A;  5HY5 A;  3CGD A;  5EOW A;  2GQF A;  3P4S A;  3ATQ A;  4A99 A;  2CUL A;  3AEB A;  4A9W A;  3C96 A;  4M52 A;  2V61 A;  1IUT A;  3ZYX A;  1E7P A;  2YLR A;  1NG4 A;  2C73 A;  3SY4 A;  4K8D A;  1B5Q A;  2C64 A;  2WOW A;  4YTP A;  4ZN0 A;  1NAA A;  1PJ6 A;  3SZF A;  2EQ9 A;  4REK A;  4A6N A;  2X3N A;  3AE9 A;  4U8J A;  2GH5 A;  3DJJ A;  4B63 A;  4Z24 A;  2R9Z A;  4EIQ A;  2BRA A;  4B66 A;  1BZL A;  1O5W A;  3NN0 X;  5HXI A;  1PHH A;  2A87 A;  1PDH A;  2H89 A;  2JB1 A;  4ZCC A;  3RP6 A;  1GXF A;  3P9U A;  4Z43 A;  1ZMD A;  5IQ4 A;  3GMC A;  1VG9 A;  3BNU A;  4OPI A;  4J31 A;  4H4Y A;  1FEC A;  4GCM A;  5FS9 A;  3QFB A;  3NYC A;  4OPL A;  1GRA A;  4I59 A;  1JRY A;  3AE4 A;  4NEV A;  3EPT A;  1F8S A;  1TDK A;  1K0I A;  2GMH A;  2ARD A;  2OAL A;  2WS3 A;  2B9X A;  2YM2 A;  3FPZ A;  4H2N A;  4K7Z A;  4U2T A;  2IVD A;  3HYX A;  5KMP A;  4GAP A;  1JEH A;  4NTE A;  4NWZ A;  1CHU A;  1GEU A;  2WQY A;  4LU6 A;  4H2P A;  3T2K A;  3CPH G;  1H6V A;  4RG4 A;  2ZZB A;  2ZBW A;  2J3N A;  3DH9 A;  5FS7 A;  2X8C A;  3CGC A;  3V76 A;  4XXG A;  2WDQ A;  3KD9 A;  1PXB A;  1NPX A;  4KPR A;  2DKI A;  3VR9 A;  4C74 A;  4XWZ A;  1BWC A;  5U1O A;  4DGK A;  4H7U A;  4LII A;  2YAU A;  3T2Y A;  1PBC A;  2YVG A;  4J56 A;  4EM4 A;  4B69 A;  4U8N A;  2CDU A;  3ABV A;  3DME A;  3AYI A;  4Z26 A;  1Q1R A;  2WDV A;  4YKF A;  5EBK A;  3CTY A;  1YQ4 A;  4G73 A;  4K5S A;  3UKP A;  1CC6 A;  2FJE A;  3UP4 A;  2A89 A;  2YLZ A;  3LJP A;  1E39 A;  1ZDL A;  2YR4 A;  1MXT A;  3GWD A;  5J7X A;  1DOD A;  4TM4 A;  1L0V A;  4D03 A;  1D7L A;  2V6O A;  4H2Q A;  5KOX A;  3NLC A;  3UOX A;  3V3O A;  1XPQ A;  5EB4 A;  4O5U A;  3KPK A;  3JSK A;  4CRT A;  3S5W A;  1ELI A;  3T14 A;  4YSX A;  2YQU A;  3G5Q A;  3NK2 X;  1F6M A;  3UKK A;  1RP0 A;  2FJD A;  2OAM A;  2YR6 A;  4KX6 A;  4AOS A;  2XFU A;  3BI4 A;  3ICT A;  4H4V A;  4ZCD A;  1KNR A;  2O9Z A;  4OPG A;  1L9D A;  2WP9 A;  4JNQ A;  4BJZ A;  2GV8 A;  3VRD B;  4C5O A;  5J60 A;  2GR0 A;  1ZY8 A;  3QSM A;  1LQU A;  4H4Z A;  3DJD A;  1NHR A;  3NK1 X;  4U8M A;  1F8W A;  1GOS A;  1HYU A;  4UDQ A;  1PBB A;  1KNP A;  2XFQ A;  4J34 A;  4NNJ A;  1GRG A;  1PS9 A;  1XHC A;  3G5S A;  1EL9 A;  2BYB A;  4II2 A;  2B9Y A;  4IVM B;  2GB0 A;  2WPF A;  4H2R A;  1L9C A;  2CFY A;  1NG3 A;  4Z2R A;  1M6I A;  1N4V A;  4J2W A;  1ZMC A;  4GDE A;  1N1P A;  3VRA A;  3I3L A;  3CNT A;  1GAL A;  2VRM A;  4U8K A;  1JOA A;  1EBD A;  2C67 A;  2Q6U A;  4U8P A;  4J33 A;  2VVL G;  3LB8 A;  4FK1 C;  3WE0 A;  1H86 A;  5CKU A;  3NN6 X;  4OPD A;  2EQ8 A;  4APN A;  4B1B A;  3P4P A;  3LZX A;  1OJD A;  1Y56 A;  4TLX A;  2JAE A;  2YWL A;  1LQT A;  3NTD A;  2JK6 A;  1N4U A;  3CNS A;  3K7M X;  2B9W A;  4K2X A;  1M64 A;  4IA6 A;  2X99 A;  3M12 A;  1RYI A;  1B37 A;  1FEB A;  1ZP0 A;  4YTM A;  1LVL A;  4C77 A;  4A6N B;  1AOG A;  5KVH A;  3UTE A;  5TR3 A;  2XVE A;  5KMS A;  2WP5 A;  1IUV A;  2YG5 A;  3CGE A;  3SZW A;  2QCU A;  5M0Z A;  4BK1 A;  2XLR A;  3KVE A;  2VVL A;  1RSG A;  2GVC A;  3GDP A;  3SFD A;  3EAN A;  4II3 A;  3NH3 X;  4PAB A;  2WHD A;  2OLO A;  4GAV A;  2VQ7 A;  2VZ2 A;  3AE5 A;  1NHP A;  4YSZ A;  3ISH A;  3CIR A;  3UOV A;  2WDR A;  1YQ3 A;  2JKC A;  1OJA A;  1DOB A;  1ONF A;  2ACZ A;  4EIP A;  5KOW A;  2BK5 A;  3NYE A;  1H7W A;  3SQP A;  3NNE A;  2VQB A;  1O94 A;  3UTF A;  4X9N A;  3Q6J A;  1MO9 A;  1TDE A;  5IPY A;  1VG0 A;  3H8I A;  2E1M A;  4EQX A;  1H84 A;  3AE8 A;  4GRT A;  1CJ4 A;  5KMQ A;  2BAC A;  2PYX A;  1JRX A;  2BCG G;  2BC1 A;  1GRT A;  3GD4 A;  4P9S A;  1CJ3 A;  2XVJ A;  2C4C A;  4USQ A;  2ZZ0 A;  1H82 A;  4CCR A;  4HA6 A;  3K7T A;  2C3D A;  4Z2U A;  1IJH A;  2C65 A;  1F3P A;  5JCL A;  5C2T A;  3AEE A;  2XVF A;  4ICY A;  1KF6 A;  3VQR A;  2EQ7 A;  3GRT A;  5HYM A;  4YSY A;  3LAD A;  3UOY A;  3UKA A;  3NT6 A;  1BGJ A;  2GMJ A;  3ALL A;  2BK3 A;  3CGB A;  2WU2 A;  1EL7 A;  5FS6 A;  3AYL A;  3EF6 A;  1GES A;  3DJE A;  4A5L A;  3SYI A;  1Z6L A;  1LPF A;  3M13 A;  3CMM A;  3LXD A;  1F8R A;  3F8R A;  4BV6 A;  1PN0 A;  5DBJ A;  3P4Q A;  3Q9T A;  1KFY A;  3VR8 A;  3IF9 A;  3L1R A;  3AEC A;  1D7Y A;  3AE2 A;  1VDC A;  2XFN A;  2YLS A;  3CN8 A;  3GD3 A;  4JQ9 A;  5KVI A;  2XVI A;  1SEZ A;  4G74 A;  4BK2 A;  2YLX A;  3KU9 A;  2WES A;  4JNA A;  2E5V A;  3AD8 B;  4NEW A;  2WPE A;  3PVC A;  4H4R A;  2F5Z A;  1PXC A;  1DXL A;  4TM3 A;  3K7Q X;  4EQR A;  3LZW A;  3BHF A;  1GV4 A;  3AB1 A;  5KMR A;  3II4 A;  2BS2 A;  4J36 A;  1EL8 A;  3B3R A;  3QVP A;  3ALJ A;  2H88 A;  3NG7 X;  1CC2 A;  3BI2 A;  5KNL A;  2C70 A;  5JCM A;  2R4J A;  1P2H A;  1Y56 B;  4B64 A;  5JCI A;  4H4Q A;  3RP7 A;  3URH A;  1XAN A;  1PBE A;  3VRB A;  3AXB A;  1YKJ A;  3FG2 P;  3QJ4 A;  4RSL A;  2VOU A;  2JB3 A;  3RED A;  1UKV G;  2RGO A;  1VQW A;  2RGH A;  2PHH A;  3KKJ A;  3SZ0 A;  4XWR A;  3UKQ A;  1IUU A;  2UZZ A;  2Z5X A;  2YG4 A;  4H4S A;  1E6E A;  4C3X A;  2GR2 A;  2YLT A;  3IHM A;  1JNR A;  1GRF A;  3O0H A;  1TRB A;  2A8X A;  2C76 A;  3AED A;  1FL2 A;  4AT0 A;  3FBS A;  2V3A A;  2Y6Q A;  2FJB A;  3KLJ A;  2WBA A;  4CCQ A;  5FS8 A;  1KDG A;  2WU5 A;  3ATR A;  1GPE A;  1EL5 A;  2GAG B;  4U2L A;  4AP3 A;  3GYX A;  1ZK7 A;  3QFA A;  1E1K A;  4A79 A;  1LTX R;  3IC9 A;  5EB5 A;  1CF3 A;  2VVM A;  3GDN A;  3T31 A;  4UP3 A;  4CY8 A;  2AQJ A;  2BS4 A;  2IVE A;  1W4X A;  4OPC A;  2BXS A;  4O5Q A;  3HZL A;  1BKW A;  5FMH A;  1BGN A;  4FDC B;  1D5T A;  2GEW A;  3SXI A;  4E0V A;  2C3C A;  2C75 A;  4H4X A;  3NRN A;  2XLT A;  3C4N A;  2QA1 A;  4TLZ A;  2IID A;  3ITJ A;  1COY A;  1DJN A;  4IA5 A;  1H83 A;  1TDN A;  2YG7 A;  3NHO X;  1YQZ A;  3B6D A;  2Q7V A;  4OVI A;  1MOK A;  4N9X A;  4G9K A;  1QJD A;  2HQM A;  2YVJ A;  1GRE A;  2YR5 A;  1TDO A;  4G6G A;  3AD9 B;  1TYP A;  3IWA A;  1OJC A;  2TPR A;  1E1N A;  1ZKQ A;  3QSE A;  3SX6 A;  4U8I A;  3NIX A;  3AYJ A;  2JB2 A;  2QAE A;  3GSI A;  1IUW A;  3S61 A;  2WET A;  4JN9 A;  1S2Y A;  3NGC X;  3HYV A;  1L9E A;  4DSH A;  1D4E A;  3BI5 A;  3I6D A;  2FJA A;  4EMW A;  2XFO A;  2BCP A;  2GR3 A;  1N4W A;  1QLB A;  1K0L A;  4HB9 A;  3AEA A;  2WP6 A;  2R0G A;  4Y4N A;  2W0H A;  5BUL A;  3D8X A;  2Q0L A;  2AAQ A;  4CBQ A;  2BS3 A;  2VRL A;  1H7X A;  2XVH A;  2BXR A;  3P4R A;  3M0O A;  5C3J A;  1CJC A;  2BA9 A;  4EM3 A;  3UCL A;  3UTG A;  2B76 A;  1REO A;  2Z5Y A;  1PJ7 A;  4IVO B;  4H4P A;  5HHF A;  5BVA A;  2GF3 A;  3RHA A;  1B4V A;  2OA1 A;  3NYF A;  4J57 A;  4GR1 A;  3CNJ A;  4NZH A;  2XYO A;  3ICS A;  3BNM A;  4CNJ A;  1S2Q A;  2YLW A;  1X31 B;  2OLN A;  2BC0 A;  2APG A;  2R46 A;  3H4K A;  3OZ2 A;  3FMW A;  4YSH A;  4AOX A;  4UDP A;  4EMJ A;  1CJ2 A;  1OJT A;  4PAA A;  5IQ1 A;  1ZOV A;  4YWO A;  1TDF A;  4JY3 A;  2BRY A;  1NEN A; 
#chains in the Genus database with same CATH homology
 2C7G A;  4USR A;  2V5Z A;  5M10 A;  1GRB A;  4H50 A;  1H81 A;  3KPF A;  1V59 A;  1OJ9 A;  3DGZ A;  3DK9 A;  2EQ6 A;  4NTD A;  1IUX A;  5L46 A;  1Q9I A;  3UP5 A;  1ZX9 A;  4C3Y A;  1DNC A;  4EQW A;  3DK8 A;  5U63 A;  1K0J A;  1E1M A;  1BF3 A;  1XDI A;  3AE3 A;  1JNZ A;  3GMB A;  3H8L A;  1K4Q A;  4Z25 A;  3P1W A;  4YKG A;  4GUV A;  3RNM A;  2QA2 A;  3AEG A;  4EMI A;  3OC4 A;  2R4E A;  4A7A A;  1FCD A;  1NHQ A;  4JY2 A;  5KXJ A;  3IHG A;  4DNA A;  1LJ1 A;  3ALM A;  3NTA A;  2RAB A;  2CVJ A;  1KSU A;  2XFP A;  3CPI G;  1GRH A;  2WOV A;  1FEA A;  1KSS A;  1PJ5 A;  5JCN A;  4NTC A;  3GWF A;  3SZC A;  2YG6 A;  5LV9 A;  3T37 A;  4Z2T A;  4D04 A;  2XLS A;  2NPX A;  3ZDN A;  3K30 A;  4CNK A;  1CL0 A;  4BK3 A;  3AE7 A;  4WCT A;  3F8D A;  1GTH A;  1JRZ A;  3RP8 A;  1CBO A;  3E1T A;  4H4T A;  4UDR A;  3UOZ A;  2WEU A;  3G5R A;  4GDP A;  1GT8 A;  2JBV A;  1IUS A;  4B68 A;  2C66 A;  2YG3 A;  4IV9 A;  4BUR A;  4H4U A;  4K22 A;  3AD7 B;  3PS9 A;  4Y4M A;  1FOH A;  4YXD A;  3CNP A;  4LA1 A;  1Q1W A;  2X50 A;  4FK1 A;  4H4W A;  3L8K A;  3CPJ G;  5GSN A;  1P2E A;  5KRQ A;  3F8P A;  2TMD A;  4EQS A;  1PXA A;  1D4D A;  1PBD A;  2BAB A;  2GR1 A;  4G6H A;  2B7R A;  1GSN A;  2WPC A;  4ECH A;  3DGH A;  2X8H A;  2XLP A;  3R9U A;  3SM8 A;  2DKH A;  2B7S A;  4JDR A;  2XCG A;  3D1C A;  2YM1 A;  5KWF A;  3EAO A;  3BHK A;  4U8O A;  2E4G A;  4AP1 A;  1TYT A;  3AEF A;  4U8L A;  4X4J A;  5CQF A;  4DSG A;  4I58 A;  2XLU A;  4YT0 A;  3AE1 A;  3ICR A;  3QSS A;  4OCG A;  3SGL A;  1Y0P A;  4A65 A;  1LV0 A;  1D4C A;  2Q0K A;  1E1L A;  4Y4L A;  5BRT A;  2GRT A;  3QVR A;  1DJQ A;  5GRT A;  3UTH A;  1GND A;  2V3B A;  4GF7 A;  4OPT A;  4U2S A;  4B67 A;  4WX1 A;  3AE6 A;  3T0K A;  4BJY A;  5BUK A;  1ZOY A;  3HYW A;  1YY5 A;  2AR8 A;  2R0C A;  3GRS A;  3NK0 X;  3GYI A;  1GTE A;  1O95 A;  3DJG X;  2GAH B;  4MJW A;  5U25 A;  1DOE A;  3PO7 A;  2NVK X;  4Z44 A;  3COX A;  4K5R A;  3DK4 A;  4AT2 A;  1QO8 A;  5JCK A;  3DA1 A;  2I0Z A;  1JU2 A;  4FX9 A;  4OPU A;  3SFE A;  3UKL A;  2V60 A;  4B65 A;  1S3B A;  1NHS A;  1VRQ B;  2FBW A;  2ZZC A;  2X8G A;  4X9M A;  1PBF A;  3ADA B;  2RGJ A;  4ADW A;  3CND A;  3AWI A;  4YTN A;  3KA7 A;  2Y6R A;  4TM0 A;  1DOC A;  3NKS A;  2YVF A;  4TM1 A;  1NDA A;  2XDO A;  3V3N A;  1GET A;  1S3E A;  2BK4 A;  2R0P A;  3UKF A;  3T2Z A;  2R45 A;  2C72 A;  2WOI A;  5ER0 A;  1CC4 A;  1NEK A;  3UKH A;  3FIM B;  1GER A;  2GQW A;  4RG3 A;  4CY6 A;  1B8S A;  3C4A A;  3LOV A;  3GYJ A;  5HY5 A;  3CGD A;  5EOW A;  2GQF A;  3P4S A;  3ATQ A;  4A99 A;  2CUL A;  3AEB A;  4A9W A;  3C96 A;  4M52 A;  2V61 A;  1IUT A;  3ZYX A;  1E7P A;  2YLR A;  1NG4 A;  2C73 A;  3SY4 A;  4K8D A;  1B5Q A;  2C64 A;  2WOW A;  4YTP A;  4ZN0 A;  1NAA A;  1PJ6 A;  3SZF A;  2EQ9 A;  4REK A;  4A6N A;  2X3N A;  3AE9 A;  4U8J A;  2GH5 A;  3DJJ A;  4B63 A;  4Z24 A;  2R9Z A;  4EIQ A;  2BRA A;  4B66 A;  1BZL A;  1O5W A;  3NN0 X;  5HXI A;  1PHH A;  2A87 A;  1PDH A;  2H89 A;  2JB1 A;  4ZCC A;  3RP6 A;  1GXF A;  3P9U A;  4Z43 A;  1ZMD A;  5IQ4 A;  3GMC A;  1VG9 A;  3BNU A;  4OPI A;  4J31 A;  4H4Y A;  1FEC A;  4GCM A;  5FS9 A;  3QFB A;  3NYC A;  4OPL A;  1GRA A;  4I59 A;  1JRY A;  3AE4 A;  4NEV A;  3EPT A;  1F8S A;  1TDK A;  1K0I A;  2GMH A;  2ARD A;  2OAL A;  2WS3 A;  2B9X A;  2YM2 A;  3FPZ A;  4H2N A;  4K7Z A;  4U2T A;  2IVD A;  3HYX A;  5KMP A;  4GAP A;  1JEH A;  4NTE A;  4NWZ A;  1CHU A;  1GEU A;  2WQY A;  4LU6 A;  4H2P A;  3T2K A;  3CPH G;  1H6V A;  4RG4 A;  2ZZB A;  2ZBW A;  2J3N A;  3DH9 A;  5FS7 A;  2X8C A;  3CGC A;  3V76 A;  4XXG A;  2WDQ A;  3KD9 A;  1PXB A;  1NPX A;  4KPR A;  2DKI A;  3VR9 A;  4C74 A;  4XWZ A;  1BWC A;  5U1O A;  4DGK A;  4H7U A;  4LII A;  2YAU A;  3T2Y A;  1PBC A;  2YVG A;  4J56 A;  4EM4 A;  4B69 A;  4U8N A;  2CDU A;  3ABV A;  3DME A;  3AYI A;  4Z26 A;  1Q1R A;  2WDV A;  4YKF A;  5EBK A;  3CTY A;  1YQ4 A;  4G73 A;  4K5S A;  3UKP A;  1CC6 A;  2FJE A;  3UP4 A;  2A89 A;  2YLZ A;  3LJP A;  1E39 A;  1ZDL A;  2YR4 A;  1MXT A;  3GWD A;  5J7X A;  1DOD A;  4TM4 A;  1L0V A;  4D03 A;  1D7L A;  2V6O A;  4H2Q A;  5KOX A;  3NLC A;  3UOX A;  3V3O A;  1XPQ A;  5EB4 A;  4O5U A;  3KPK A;  3JSK A;  4CRT A;  3S5W A;  1ELI A;  3T14 A;  4YSX A;  2YQU A;  3G5Q A;  3NK2 X;  1F6M A;  3UKK A;  1RP0 A;  2FJD A;  2OAM A;  2YR6 A;  4KX6 A;  4AOS A;  2XFU A;  3BI4 A;  3ICT A;  4H4V A;  4ZCD A;  1KNR A;  2O9Z A;  4OPG A;  1L9D A;  2WP9 A;  4JNQ A;  4BJZ A;  2GV8 A;  3VRD B;  4C5O A;  5J60 A;  2GR0 A;  1ZY8 A;  3QSM A;  1LQU A;  4H4Z A;  3DJD A;  1NHR A;  3NK1 X;  4U8M A;  1F8W A;  1GOS A;  1HYU A;  4UDQ A;  1PBB A;  1KNP A;  2XFQ A;  4J34 A;  4NNJ A;  1GRG A;  1PS9 A;  1XHC A;  3G5S A;  1EL9 A;  2BYB A;  4II2 A;  2B9Y A;  4IVM B;  2GB0 A;  2WPF A;  4H2R A;  1L9C A;  2CFY A;  1NG3 A;  4Z2R A;  1M6I A;  1N4V A;  4J2W A;  1ZMC A;  4GDE A;  1N1P A;  3VRA A;  3I3L A;  3CNT A;  1GAL A;  2VRM A;  4U8K A;  1JOA A;  1EBD A;  2C67 A;  2Q6U A;  4U8P A;  4J33 A;  2VVL G;  3LB8 A;  4FK1 C;  3WE0 A;  1H86 A;  5CKU A;  3NN6 X;  4OPD A;  2EQ8 A;  4APN A;  4B1B A;  3P4P A;  3LZX A;  1OJD A;  1Y56 A;  4TLX A;  2JAE A;  2YWL A;  1LQT A;  3NTD A;  2JK6 A;  1N4U A;  3CNS A;  3K7M X;  2B9W A;  4K2X A;  1M64 A;  4IA6 A;  2X99 A;  3M12 A;  1RYI A;  1B37 A;  1FEB A;  1ZP0 A;  4YTM A;  1LVL A;  4C77 A;  4A6N B;  1AOG A;  5KVH A;  3UTE A;  5TR3 A;  2XVE A;  5KMS A;  2WP5 A;  1IUV A;  2YG5 A;  3CGE A;  3SZW A;  2QCU A;  5M0Z A;  4BK1 A;  2XLR A;  3KVE A;  2VVL A;  1RSG A;  2GVC A;  3GDP A;  3SFD A;  3EAN A;  4II3 A;  3NH3 X;  4PAB A;  2WHD A;  2OLO A;  4GAV A;  2VQ7 A;  2VZ2 A;  3AE5 A;  1NHP A;  4YSZ A;  3ISH A;  3CIR A;  3UOV A;  2WDR A;  1YQ3 A;  2JKC A;  1OJA A;  1DOB A;  1ONF A;  2ACZ A;  4EIP A;  5KOW A;  2BK5 A;  3NYE A;  1H7W A;  3SQP A;  3NNE A;  2VQB A;  1O94 A;  3UTF A;  4X9N A;  3Q6J A;  1MO9 A;  1TDE A;  5IPY A;  1VG0 A;  3H8I A;  2E1M A;  4EQX A;  1H84 A;  3AE8 A;  4GRT A;  1CJ4 A;  5KMQ A;  2BAC A;  2PYX A;  1JRX A;  2BCG G;  2BC1 A;  1GRT A;  3GD4 A;  4P9S A;  1CJ3 A;  2XVJ A;  2C4C A;  4USQ A;  2ZZ0 A;  1H82 A;  4CCR A;  4HA6 A;  3K7T A;  2C3D A;  4Z2U A;  1IJH A;  2C65 A;  1F3P A;  5JCL A;  5C2T A;  3AEE A;  2XVF A;  4ICY A;  1KF6 A;  3VQR A;  2EQ7 A;  3GRT A;  5HYM A;  4YSY A;  3LAD A;  3UOY A;  3UKA A;  3NT6 A;  1BGJ A;  2GMJ A;  3ALL A;  2BK3 A;  3CGB A;  2WU2 A;  1EL7 A;  5FS6 A;  3AYL A;  3EF6 A;  1GES A;  3DJE A;  4A5L A;  3SYI A;  1Z6L A;  1LPF A;  3M13 A;  3CMM A;  3LXD A;  1F8R A;  3F8R A;  4BV6 A;  1PN0 A;  5DBJ A;  3P4Q A;  3Q9T A;  1KFY A;  3VR8 A;  3IF9 A;  3L1R A;  3AEC A;  1D7Y A;  3AE2 A;  1VDC A;  2XFN A;  2YLS A;  3CN8 A;  3GD3 A;  4JQ9 A;  5KVI A;  2XVI A;  1SEZ A;  4G74 A;  4BK2 A;  2YLX A;  3KU9 A;  2WES A;  4JNA A;  2E5V A;  3AD8 B;  4NEW A;  2WPE A;  3PVC A;  4H4R A;  2F5Z A;  1PXC A;  1DXL A;  4TM3 A;  3K7Q X;  4EQR A;  3LZW A;  3BHF A;  1GV4 A;  3AB1 A;  5KMR A;  3II4 A;  2BS2 A;  4J36 A;  1EL8 A;  3B3R A;  3QVP A;  3ALJ A;  2H88 A;  3NG7 X;  1CC2 A;  3BI2 A;  5KNL A;  2C70 A;  5JCM A;  2R4J A;  1P2H A;  1Y56 B;  4B64 A;  5JCI A;  4H4Q A;  3RP7 A;  3URH A;  1XAN A;  1PBE A;  3VRB A;  3AXB A;  1YKJ A;  3FG2 P;  3QJ4 A;  4RSL A;  2VOU A;  2JB3 A;  3RED A;  1UKV G;  2RGO A;  1VQW A;  2RGH A;  2PHH A;  3KKJ A;  3SZ0 A;  4XWR A;  3UKQ A;  1IUU A;  2UZZ A;  2Z5X A;  2YG4 A;  4H4S A;  1E6E A;  4C3X A;  2GR2 A;  2YLT A;  3IHM A;  1JNR A;  1GRF A;  3O0H A;  1TRB A;  2A8X A;  2C76 A;  3AED A;  1FL2 A;  4AT0 A;  3FBS A;  2V3A A;  2Y6Q A;  2FJB A;  3KLJ A;  2WBA A;  4CCQ A;  5FS8 A;  1KDG A;  2WU5 A;  3ATR A;  1GPE A;  1EL5 A;  2GAG B;  4U2L A;  4AP3 A;  3GYX A;  1ZK7 A;  3QFA A;  1E1K A;  4A79 A;  1LTX R;  3IC9 A;  5EB5 A;  1CF3 A;  2VVM A;  3GDN A;  3T31 A;  4UP3 A;  4CY8 A;  2AQJ A;  2BS4 A;  2IVE A;  1W4X A;  4OPC A;  2BXS A;  4O5Q A;  3HZL A;  1BKW A;  5FMH A;  1BGN A;  4FDC B;  1D5T A;  2GEW A;  3SXI A;  4E0V A;  2C3C A;  2C75 A;  4H4X A;  3NRN A;  2XLT A;  3C4N A;  2QA1 A;  4TLZ A;  2IID A;  3ITJ A;  1COY A;  1DJN A;  4IA5 A;  1H83 A;  1TDN A;  2YG7 A;  3NHO X;  1YQZ A;  3B6D A;  2Q7V A;  4OVI A;  1MOK A;  4N9X A;  4G9K A;  1QJD A;  2HQM A;  2YVJ A;  1GRE A;  2YR5 A;  1TDO A;  4G6G A;  3AD9 B;  1TYP A;  3IWA A;  1OJC A;  2TPR A;  1E1N A;  1ZKQ A;  3QSE A;  3SX6 A;  4U8I A;  3NIX A;  3AYJ A;  2JB2 A;  2QAE A;  3GSI A;  1IUW A;  3S61 A;  2WET A;  4JN9 A;  1S2Y A;  3NGC X;  3HYV A;  1L9E A;  4DSH A;  1D4E A;  3BI5 A;  3I6D A;  2FJA A;  4EMW A;  2XFO A;  2BCP A;  2GR3 A;  1N4W A;  1QLB A;  1K0L A;  4HB9 A;  3AEA A;  2WP6 A;  2R0G A;  4Y4N A;  2W0H A;  5BUL A;  3D8X A;  2Q0L A;  2AAQ A;  4CBQ A;  2BS3 A;  2VRL A;  1H7X A;  2XVH A;  2BXR A;  3P4R A;  3M0O A;  5C3J A;  1CJC A;  2BA9 A;  4EM3 A;  3UCL A;  3UTG A;  2B76 A;  1REO A;  2Z5Y A;  1PJ7 A;  4IVO B;  4H4P A;  5HHF A;  5BVA A;  2GF3 A;  3RHA A;  1B4V A;  2OA1 A;  3NYF A;  4J57 A;  4GR1 A;  3CNJ A;  4NZH A;  2XYO A;  3ICS A;  3BNM A;  4CNJ A;  1S2Q A;  2YLW A;  1X31 B;  2OLN A;  2BC0 A;  2APG A;  2R46 A;  3H4K A;  3OZ2 A;  3FMW A;  4YSH A;  4AOX A;  4UDP A;  4EMJ A;  1CJ2 A;  1OJT A;  4PAA A;  5IQ1 A;  1ZOV A;  4YWO A;  1TDF A;  4JY3 A;  2BRY A;  1NEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...