3NK1X

Complex of 6-hydroxy-l-nicotine oxidase with serotonin
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 144
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk1X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk1X02
1CL0A 2XFOA 3L1RA 2XLUA 2BC0A 2RGHA 3K7QX 3UKHA 3GDPA 1FEAA 3KU9A 2YLRA 4OPLA 1K4QA 1IJHA 4TLXA 1IUWA 1EL8A 4Z2TA 4X9MA 3SQPA 3K30A 1E1MA 2B7SA 2BXRA 4YSYA 1DOCA 4AT0A 1GETA 2GAHB 4J2WA 1F8RA 4U8NA 4Z44A 2BS4A 3LZWA 5FS7A 5U1OA 1GALA 4OPCA 5JCKA 2BCPA 2X8CA 1AOGA 3D8XA 4D03A 3ICSA 3ICRA 5BULA 3DK9A 4H4YA 1PHHA 1ZY8A 4NEVA 1H86A 3GYJA 2JAEA 1BGNA 4FK1C 1ONFA 3DJGX 1QLBA 2XVFA 2V5ZA 3AE9A 1YKJA 1S2YA 2OA1A 2E4GA 2JKCA 3RP7A 3BI2A 1JRXA 1Q9IA 4CCRA 4XWZA 3CNPA 2XVHA 5HHFA 1BGJA 3RP6A 4XWRA 4CNJA 1D4DA 3CPJG 4H4UA 3PO7A 4H2PA 4NZHA 2NVKX 4B69A 2XYOA 1Q1WA 3SGLA 3GD4A 3BHFA 3P1WA 2YWLA 1LQUA 4A9WA 1N4VA 4JDRA 2EQ9A 1LQTA 1Q1RA 4ZCDA 1O5WA 3NN6X 1B4VA 4GUVA 4HB9A 1DODA 1ELIA 1H82A 3NIXA 4EIPA 3AEEA 3KVEA 3CGBA 4Z2RA 3Q9TA 4U2TA 3VR9A 3CTYA 1NEKA 1VQWA 2BC1A 4APNA 3CPHG 3RHAA 2X8GA 4USQA 3NK2X 2WU2A 4Z25A 2GH5A 4ZN0A 3K7MX 4N9XA 2JB3A 2FJBA 4J56A 4U8OA 3NNEA 3V3NA 3VRAA 4ECHA 1NHSA 4EIQA 1GRFA 2GV8A 1JU2A 1F8WA 3C4NA 2YLXA 4J57A 4JY3A 2WP9A 2GB0A 2TPRA 5BRTA 2V61A 2YG7A 1PXAA 5M10A 4ADWA 4LIIA 2VVLG 1K0IA 1REOA 4TM0A 3ZYXA 2ZZCA 3I3LA 1TYPA 3ITJA 3UOVA 5JCIA 5C3JA 4IA5A 4Y4LA 5GSNA 2BA9A 1VG9A 3AD8B 1GRTA 4K7ZA 3GD3A 2VRLA 4IVMB 3CNSA 3URHA 3UTFA 4AP1A 4BV6A 1KFYA 1FECA 1TDEA 2GQWA 3UKKA 3VRBA 2V6OA 5KVIA 3S5WA 5U63A 3CNDA 4U2LA 1YQZA 1MXTA 4BURA 4BK2A 3AEFA 3LOVA 4UDPA 1CC6A 1JRYA 2WPCA 2H88A 2R9ZA 3KKJA 2WDQA 3M12A 4JNQA 1QO8A 5FMHA 5KVHA 2TMDA 1VRQB 1EL7A 3L8KA 2ACZA 3QSEA 3AD9B 2GQFA 2W0HA 1CC2A 1YQ4A 3BI5A 4HA6A 1CJCA 1BWCA 3JSKA 3UOZA 2YVFA 1ZP0A 2XLTA 3BHKA 4AOXA 5TR3A 1P2EA 4H4ZA 3DGHA 1K0JA 2XFNA 1GOSA 1PJ5A 4YWOA 3NK1X 4IVOB 5IQ4A 2NPXA 1JNRA 3C96A 4EM3A 5U25A 3C4AA 1E1KA 1LV0A 2RGJA 4EQWA 3QJ4A 3ICTA 1PDHA 3OC4A 2APGA 2VOUA 4YTMA 4NTCA 1E6EA 3CIRA 3CGCA 4A7AA 4Z43A 2ARDA 3IHMA 1KDGA 1E39A 3FG2P 1CJ2A 2XFPA 4M52A 2WEUA 5KOWA 2B9WA 3UKLA 2R4EA 2OAMA 3AE8A 3NYFA 4J34A 4E0VA 3QSSA 5KWFA 4AOSA 4MJWA 1XDIA 5KRQA 3FPZA 2X3NA 3AECA 1BF3A 1DOEA 2IVEA 3T37A 3ALMA 2FJAA 5EB5A 1GT8A 2YM2A 2B7RA 2CDUA 1IUSA 4Z26A 3EPTA 3HZLA 3KD9A 3LJPA 1B5QA 3CGEA 1PJ7A 1GV4A 4YKGA 2AQJA 3VRDB 2WPEA 5FS6A 4YTNA 4B65A 2WOWA 4JNAA 4XXGA 4A79A 2X99A 2VQ7A 4OPGA 4B66A 3VQRA 4GCMA 1LTXR 2YR4A 4H2NA 4NEWA 4YSXA 2WP6A 4RG4A 4C3YA 2C66A 3QVPA 3NG7X 4JY2A 3EANA 2WU5A 1L9DA 2R0PA 4FDCB 5BUKA 2YR6A 2A87A 4IV9A 4OPUA 3GWDA 1KSSA 4U8JA 4EMIA 3NN0X 1S3BA 4YSZA 1M64A 3DH9A 1W4XA 2IIDA 1Z6LA 2OALA 3AD7B 3NGCX 4H2RA 2XVIA 4AT2A 4U8PA 2YLSA 4YTPA 3FMWA 4U2SA 1TYTA 1XPQA 3NYEA 2GRTA 3KLJA 1OJDA 4J33A 4TLZA 5L46A 1EL9A 5M0ZA 2VZ2A 3UOYA 3QFAA 3R9UA 3GRSA 3NKSA 1IUUA 2AAQA 1CHUA 1GRAA 1PS9A 2C3DA 2A8XA 1MO9A 2WDVA 2C67A 3DA1A 3F8DA 2EQ7A 3AE2A 4LA1A 2OLOA 2YLZA 4U8KA 1CJ3A 2H89A 2Q0LA 3AYLA 3GRTA 4I59A 4CRTA 4J31A 4H4RA 5C2TA 3ABVA 4B67A 4I58A 3Q6JA 4NTDA 2ZZ0A 1B37A 5FS8A 3RNMA 4GDPA 3M0OA 2EQ8A 5KOXA 1NHRA 2C70A 4OPIA 4PAAA 4BK1A 2O9ZA 1NHQA 4C3XA 3WE0A 4C5OA 2JK6A 1V59A 1ZMCA 1LPFA 2F5ZA 2C76A 3UP5A 5LV9A 1ZDLA 1N1PA 2BS2A 4UDQA 4UP3A 3SFDA 1ZOVA 1IUVA 1EBDA 4U8MA 1YY5A 1O94A 5FS9A 2XLSA 1KSUA 4A6NA 1PBCA 2CULA 4KX6A 2YG6A 2YR5A 3E1TA 1CC4A 1LJ1A 3KPFA 4B63A 1DXLA 3H8LA 3NRNA 1TDFA 2QCUA 2WBAA 1L9EA 3CN8A 1COYA 4Y4NA 3I6DA 1JOAA 2Z5XA 2R0CA 3AE1A 5CQFA 1NENA 1ZMDA 3H4KA 4Z24A 1TDKA 1XHCA 2BCGG 2GR3A 2QAEA 2JB1A 4UDRA 3V3OA 2DKHA 3RP8A 2R4JA 3PVCA 1TRBA 3K7TA 2WDRA 3CPIG 2GR1A 3DJDA 3NTAA 3ZDNA 2Q6UA 2RABA 3H8IA 4H2QA 3O0HA 4WX1A 2JBVA 1OJCA 3AYJA 1KF6A 1FL2A 3PS9A 4NTEA 2GAGB 1GTHA 2YG4A 4RG3A 1QJDA 1GERA 1MOKA 2JB2A 1H81A 1ZX9A 1GRGA 4EMWA 1JNZA 2WP5A 1PBBA 4K8DA 4O5QA 3F8RA 3P4RA 4A65A 3GMCA 4YSHA 1OJTA 1NAAA 1DJQA 3KA7A 4H4VA 1GRHA 4J36A 4JQ9A 2IVDA 4B68A 1ZK7A 3DK4A 4X9NA 1F3PA 1GREA 1Y0PA 1VDCA 3ALLA 3IWAA 4AP3A 1TDOA 4GF7A 3NK0X 4H4XA 3BNMA 2FJEA 3NTDA 5HY5A 2WQYA 2C73A 3QFBA 1S3EA 5EBKA 3FIMB 4B1BA 4YT0A 1DNCA 2XLPA 4RSLA 3F8PA 4U8IA 1B8SA 3LADA 5ER0A 3REDA 2WESA 2FJDA 2YG3A 4H4SA 1DJNA 1H7WA 3VR8A 1E1LA 1GTEA 1PN0A 1Y56A 2VVMA 1D7LA 4TM1A 1GXFA 2C75A 1D4EA 2WOIA 3AE3A 4Y4MA 2XCGA 4C77A 3M13A 4O5UA 1H84A 1FCDA 2VRMA 4U8LA 1P2HA 1D5TA 2XFUA 2WS3A 5EOWA 2ZBWA 1TDNA 2Y6RA 3UP4A 1RP0A 3QVRA 2CVJA 2C7GA 3GDNA 3NT6A 1SEZA 2R46A 3ISHA 3NH3X 3G5SA 1L0VA 1E1NA 3AEGA 3NHOX 3AWIA 3AE5A 5JCMA 1E7PA 3D1CA 3LZXA 1PBDA 4H4PA 3AB1A 1F8SA 5IPYA 5GRTA 3AYIA 2EQ6A 3LXDA 3UCLA 2V60A 4GR1A 2XVJA 1UKVG 4A99A 3BI4A 4CBQA 2I0ZA 1N4WA 1D7YA 1PBFA 4H50A 5HYMA 2Z5YA 3LB8A 2AR8A 2DKIA 1ZKQA 5EB4A 4DSGA 4WCTA 3UTEA 2E5VA 2GMHA 2J3NA 3CNTA 2R0GA 1DOBA 1GSNA 1GESA 2UZZA 2XVEA 3DJJA 2YQUA 3G5RA 3P4SA 4FX9A 4K2XA 2PYXA 3UTHA 4PABA 3P4PA 4EQRA 2GEWA 3NLCA 1NDAA 3SFEA 4OPDA 1PJ6A 4P9SA 2WHDA 2HQMA 5J7XA 4CCQA 1JEHA 5J60A 4K5RA 4D04A 2B9XA 4A5LA 4EMJA 4H7UA 2YLWA 2YLTA 1RYIA 1YQ3A 5CKUA 1PBEA 2PHHA 3UKQA 4CY8A 1CBOA 4GDEA 4CY6A 2BK5A 4DSHA 4EQXA 3GMBA 2Q0KA 1KNRA 3AXBA 4OCGA 2Y6QA 1NG3A 1BZLA 3ADAB 2YVGA 3ATRA 3AEAA 2GF3A 2E1MA 3ALJA 4YXDA 2BACA 2XFQA 1Y56B 4BJYA 1N4UA 2CFYA 2C72A 5JCNA 4H4TA 1GPEA 2FBWA 4DGKA 3AE7A 3CNJA 2VQBA 3ATQA 1PXBA 1PXCA 3QSMA 1NPXA 3UTGA 3P4QA 5IQ1A 1LVLA 1OJAA 1VG0A 1GRBA 2BYBA 4Z2UA 4REKA 3GYIA 3P9UA 4DNAA 1O95A 2WOVA 2ZZBA 4ZCCA 1NHPA 4ICYA 2BK3A 1CF3A 5BVAA 4B64A 3II4A 4H4QA 3FBSA 2A89A 3SM8A 4GRTA 2GVCA 4K5SA 4TM4A 4USRA 3UKPA 2BXSA 2YVJA 4JN9A 4YKFA 4A6NB 4CNKA 3UOXA 5DBJA 1EL5A 5KXJA 2BS3A 2V3AA 1IUXA 1GNDA 1GEUA 3B6DA 4OPTA 3COXA 4FK1A 2B76A 4TM3A 2XLRA 4C74A 3AEBA 2QA1A 1HYUA 3BNUA 5HXIA 4BJZA 1CJ4A 1X31B 3DMEA 3DGZA 3AEDA 1H6VA 2X8HA 3B3RA 3OZ2A 1JRZA 3GWFA 1H7XA 4EQSA 1IUTA 2GMJA 2YAUA 4K22A 3V76A 2R45A 3IHGA 1ZOYA 3UKFA 4EM4A 1K0LA 1S2QA 2OLNA 1OJ9A 2GR2A 3AE4A 3IF9A 1NG4A 1BKWA 2V3BA 2VVLA 1RSGA 3GSIA 4KPRA 2B9YA 2C64A 2WETA 3G5QA 1FEBA 3S61A 5JCLA 2C3CA 4LU6A 4IA6A 1D4CA 1M6IA 3EAOA 4BK3A 4OVIA 1L9CA 1F6MA 2BK4A 1FOHA 2WPFA 3DJEA 2RGOA 2YG5A 2Q7VA 2QA2A 4H4WA 2XDOA 3EF6A 2C65A 1KNPA 2X50A 2YM1A 3DK8A 3UKAA 2BABA 4X4JA 3CGDA 3AE6A 3NYCA 3IC9A 1H83A 2GR0A 1XANA
chains in the Genus database with same CATH superfamily
1CL0A 2XFOA 3L1RA 2XLUA 2BC0A 2RGHA 3K7QX 4G73A 3UKHA 3GDPA 1FEAA 3KU9A 2YLRA 4OPLA 1K4QA 1IJHA 4TLXA 1IUWA 1EL8A 4Z2TA 4X9MA 3SQPA 3K30A 1E1MA 2B7SA 2BXRA 4YSYA 1DOCA 4AT0A 1GETA 4II3A 2GAHB 4J2WA 1F8RA 4U8NA 4Z44A 2BS4A 3LZWA 5FS7A 5U1OA 1GALA 4OPCA 5JCKA 2BCPA 2X8CA 1AOGA 3D8XA 4D03A 3ICSA 3ICRA 5BULA 3DK9A 4H4YA 1PHHA 1ZY8A 4NEVA 1H86A 3GYJA 2JAEA 1BGNA 4FK1C 1ONFA 3DJGX 1QLBA 2XVFA 2V5ZA 3AE9A 1YKJA 1S2YA 2OA1A 2E4GA 2JKCA 3RP7A 3SX6A 3BI2A 1JRXA 1Q9IA 4CCRA 4XWZA 3CNPA 2XVHA 5HHFA 1BGJA 3RP6A 4XWRA 4CNJA 1D4DA 3CPJG 4H4UA 3PO7A 4H2PA 4NZHA 2NVKX 4B69A 2XYOA 1Q1WA 3SGLA 3SZFA 3GD4A 3BHFA 3P1WA 2YWLA 1LQUA 4A9WA 1N4VA 4JDRA 2EQ9A 1LQTA 1Q1RA 4ZCDA 1O5WA 3NN6X 1B4VA 4GUVA 4HB9A 1DODA 1ELIA 1H82A 3NIXA 4EIPA 3AEEA 3KVEA 3CGBA 4Z2RA 3Q9TA 4U2TA 3VR9A 3CTYA 1NEKA 1VQWA 2BC1A 4APNA 3CPHG 3RHAA 2X8GA 4USQA 3NK2X 2WU2A 4Z25A 2GH5A 4ZN0A 3K7MX 4N9XA 2JB3A 2FJBA 4J56A 4U8OA 3T2YA 3NNEA 3SZ0A 3V3NA 3VRAA 4ECHA 1NHSA 4EIQA 1GRFA 2GV8A 1JU2A 1F8WA 3C4NA 2YLXA 4J57A 4JY3A 2WP9A 2GB0A 2TPRA 5BRTA 2V61A 2YG7A 1PXAA 5M10A 4ADWA 4LIIA 2VVLG 1K0IA 1REOA 3GYXA 4TM0A 3ZYXA 2ZZCA 3I3LA 3KPKA 1TYPA 3ITJA 3UOVA 5JCIA 5C3JA 4IA5A 4Y4LA 5GSNA 2BA9A 1VG9A 3AD8B 1GRTA 4K7ZA 3GD3A 2VRLA 4IVMB 3CNSA 3URHA 3UTFA 4AP1A 4BV6A 1KFYA 1FECA 1TDEA 2GQWA 3UKKA 3VRBA 2V6OA 5KVIA 3S5WA 5U63A 3CNDA 4U2LA 1YQZA 1MXTA 4BURA 4BK2A 3AEFA 3LOVA 4UDPA 1CC6A 1JRYA 2WPCA 2H88A 2R9ZA 3KKJA 2WDQA 3M12A 4JNQA 1QO8A 5FMHA 5KVHA 2TMDA 1VRQB 1EL7A 3L8KA 2ACZA 3QSEA 3AD9B 2GQFA 2W0HA 1CC2A 1YQ4A 3BI5A 4HA6A 1CJCA 1BWCA 3JSKA 3UOZA 5KNLA 2YVFA 1ZP0A 2XLTA 3BHKA 4AOXA 5TR3A 1P2EA 4H4ZA 3DGHA 1K0JA 2XFNA 1GOSA 1PJ5A 4YWOA 3NK1X 4IVOB 5IQ4A 2NPXA 1JNRA 3C96A 3T31A 4EM3A 5U25A 3C4AA 1E1KA 1LV0A 2RGJA 4EQWA 3QJ4A 3ICTA 1PDHA 3CMMA 3OC4A 2APGA 2VOUA 4YTMA 4NTCA 1E6EA 3CIRA 3CGCA 4A7AA 2BRYA 4Z43A 4II2A 2ARDA 3IHMA 1KDGA 1E39A 3FG2P 1CJ2A 2XFPA 4M52A 2WEUA 5KOWA 2B9WA 3UKLA 2R4EA 2OAMA 3AE8A 3NYFA 4J34A 4E0VA 3QSSA 3SZWA 5KWFA 4AOSA 4MJWA 1XDIA 5KRQA 3FPZA 2X3NA 3AECA 1BF3A 1DOEA 2IVEA 3T37A 3ALMA 2FJAA 5EB5A 1GT8A 2YM2A 2B7RA 2CDUA 1IUSA 4Z26A 3EPTA 3HZLA 3KD9A 3LJPA 1B5QA 3CGEA 1PJ7A 1GV4A 4YKGA 2AQJA 3VRDB 2WPEA 5FS6A 4YTNA 4B65A 2WOWA 4JNAA 4XXGA 4A79A 2X99A 2VQ7A 4OPGA 4B66A 3VQRA 4GCMA 1LTXR 2YR4A 4H2NA 4NEWA 5KMPA 4YSXA 2WP6A 4RG4A 4C3YA 2C66A 3QVPA 3NG7X 4JY2A 3EANA 2WU5A 1L9DA 2R0PA 4FDCB 3T14A 5BUKA 2YR6A 2A87A 4IV9A 4OPUA 3GWDA 3SZCA 1KSSA 4U8JA 4EMIA 3NN0X 1S3BA 4YSZA 1M64A 3DH9A 1W4XA 2IIDA 1Z6LA 2OALA 3AD7B 3NGCX 4H2RA 2XVIA 4AT2A 4U8PA 2YLSA 4YTPA 3FMWA 4U2SA 1TYTA 1XPQA 3NYEA 2GRTA 3KLJA 1OJDA 4J33A 4TLZA 5L46A 1EL9A 5M0ZA 3T2KA 2VZ2A 3UOYA 3QFAA 3R9UA 3GRSA 3NKSA 1IUUA 2AAQA 1CHUA 1GRAA 1PS9A 2C3DA 2A8XA 1MO9A 2WDVA 2C67A 3DA1A 3F8DA 2EQ7A 3AE2A 4G6HA 4LA1A 2OLOA 2YLZA 4U8KA 1CJ3A 2H89A 2Q0LA 3AYLA 3GRTA 4I59A 4CRTA 4J31A 4H4RA 5C2TA 3ABVA 5KMQA 4I58A 4B67A 3Q6JA 4NTDA 2ZZ0A 1B37A 5FS8A 3RNMA 4GDPA 3M0OA 2EQ8A 5KOXA 1NHRA 2C70A 4OPIA 4PAAA 4BK1A 2O9ZA 1NHQA 4C3XA 3WE0A 4C5OA 2JK6A 1V59A 1ZMCA 1LPFA 2F5ZA 2C76A 3UP5A 5LV9A 1ZDLA 1N1PA 4NNJA 2BS2A 4UDQA 4UP3A 3SFDA 1ZOVA 1IUVA 1EBDA 4U8MA 1YY5A 1O94A 5FS9A 2XLSA 1KSUA 4A6NA 1PBCA 2CULA 4KX6A 2YG6A 2YR5A 3E1TA 1CC4A 1LJ1A 3KPFA 4B63A 1DXLA 3H8LA 3NRNA 1TDFA 2QCUA 2WBAA 1L9EA 3CN8A 1COYA 4Y4NA 4G6GA 3I6DA 1JOAA 2Z5XA 2R0CA 3AE1A 5CQFA 1NENA 1ZMDA 3H4KA 4Z24A 1TDKA 1XHCA 2BCGG 3SY4A 2GR3A 2QAEA 2JB1A 4UDRA 3V3OA 2DKHA 4GAVA 2R4JA 3PVCA 3RP8A 1TRBA 3K7TA 2WDRA 3CPIG 2GR1A 3DJDA 3NTAA 3ZDNA 2Q6UA 2RABA 3H8IA 4H2QA 3O0HA 4WX1A 2JBVA 1OJCA 3AYJA 1KF6A 1FL2A 3PS9A 4NTEA 2GAGB 1GTHA 2YG4A 4RG3A 1QJDA 1GERA 1MOKA 2JB2A 1H81A 1ZX9A 1GRGA 4EMWA 1JNZA 2WP5A 1PBBA 4K8DA 4O5QA 3F8RA 3P4RA 4A65A 3GMCA 4YSHA 1OJTA 1NAAA 1DJQA 3KA7A 4H4VA 1GRHA 4J36A 4JQ9A 2IVDA 4B68A 1ZK7A 3DK4A 4X9NA 1F3PA 1GREA 1Y0PA 1VDCA 3ALLA 3IWAA 4AP3A 1TDOA 4GF7A 3NK0X 4H4XA 3BNMA 2FJEA 3NTDA 5HY5A 2WQYA 2C73A 3QFBA 1S3EA 5EBKA 3FIMB 4B1BA 4YT0A 1DNCA 2XLPA 4RSLA 3F8PA 4U8IA 1B8SA 3LADA 5ER0A 3REDA 2WESA 2FJDA 2YG3A 4H4SA 1DJNA 1H7WA 3SXIA 3VR8A 1E1LA 1GTEA 1PN0A 1Y56A 2VVMA 1D7LA 4TM1A 1GXFA 2C75A 1D4EA 2WOIA 3AE3A 4Y4MA 2XCGA 4C77A 3M13A 4O5UA 4G74A 1H84A 1FCDA 2VRMA 3HYXA 1P2HA 4U8LA 1D5TA 2XFUA 2WS3A 5EOWA 2ZBWA 1TDNA 2Y6RA 3T0KA 2C4CA 3UP4A 1RP0A 3QVRA 2CVJA 2C7GA 3GDNA 3NT6A 1SEZA 2R46A 3ISHA 3NH3X 3G5SA 1L0VA 1E1NA 3AEGA 3NHOX 3AWIA 3AE5A 5JCMA 1E7PA 3D1CA 3LZXA 1PBDA 4H4PA 3AB1A 1F8SA 5IPYA 5GRTA 3AYIA 2EQ6A 3LXDA 3UCLA 2V60A 4GR1A 2XVJA 1UKVG 4A99A 3BI4A 4CBQA 2I0ZA 1N4WA 1D7YA 1PBFA 4H50A 5HYMA 2Z5YA 3LB8A 2AR8A 2DKIA 1ZKQA 5EB4A 4DSGA 4WCTA 3UTEA 2E5VA 2GMHA 2J3NA 3CNTA 2R0GA 1DOBA 1GSNA 1GESA 2UZZA 2XVEA 3DJJA 2YQUA 3G5RA 3P4SA 4FX9A 4K2XA 2PYXA 3UTHA 4PABA 3P4PA 4EQRA 2GEWA 3NLCA 1NDAA 3SFEA 4OPDA 1PJ6A 4P9SA 2WHDA 2HQMA 5J7XA 4CCQA 5KMRA 1JEHA 5J60A 4K5RA 4D04A 2B9XA 4A5LA 4EMJA 4H7UA 2YLWA 2YLTA 1RYIA 1YQ3A 5CKUA 1PBEA 2PHHA 3UKQA 4CY8A 1CBOA 4GDEA 4CY6A 2BK5A 4DSHA 4EQXA 3GMBA 2Q0KA 1KNRA 3AXBA 4OCGA 2Y6QA 1NG3A 2BRAA 1BZLA 3ADAB 2YVGA 3ATRA 4NWZA 3AEAA 2GF3A 2E1MA 3ALJA 4YXDA 2BACA 2XFQA 1Y56B 4BJYA 1N4UA 2CFYA 2C72A 5JCNA 4G9KA 4H4TA 1GPEA 2FBWA 4DGKA 3AE7A 3CNJA 2VQBA 3ATQA 1PXBA 1PXCA 3HYVA 1NPXA 3QSMA 3UTGA 3P4QA 5IQ1A 5KMSA 1LVLA 1OJAA 1VG0A 1GRBA 2BYBA 4Z2UA 4REKA 3GYIA 3P9UA 4DNAA 1O95A 2WOVA 2ZZBA 4ZCCA 1NHPA 4ICYA 2BK3A 1CF3A 5BVAA 4B64A 3II4A 4H4QA 3FBSA 2A89A 3SM8A 4GRTA 2GVCA 4K5SA 4TM4A 4USRA 3UKPA 2BXSA 2YVJA 4JN9A 4YKFA 4A6NB 4CNKA 3UOXA 5DBJA 1EL5A 5KXJA 2BS3A 2V3AA 1IUXA 1GNDA 1GEUA 3B6DA 4OPTA 3COXA 4FK1A 2B76A 4TM3A 2XLRA 4C74A 3AEBA 2QA1A 1HYUA 3BNUA 5HXIA 3T2ZA 4BJZA 1CJ4A 1X31B 3DMEA 3DGZA 3AEDA 1H6VA 3HYWA 2X8HA 3B3RA 3OZ2A 1JRZA 3GWFA 1H7XA 4EQSA 1IUTA 2GMJA 2YAUA 4K22A 3V76A 2R45A 3IHGA 1ZOYA 3UKFA 4EM4A 4GAPA 1K0LA 1S2QA 2OLNA 1OJ9A 2GR2A 3AE4A 3IF9A 1NG4A 1BKWA 3SYIA 2V3BA 2VVLA 1RSGA 3GSIA 4KPRA 2B9YA 2C64A 2WETA 3G5QA 1FEBA 3S61A 5JCLA 2C3CA 4LU6A 4IA6A 1D4CA 1M6IA 3EAOA 4BK3A 4OVIA 1L9CA 1F6MA 2BK4A 1FOHA 2WPFA 3DJEA 2RGOA 2YG5A 2Q7VA 2QA2A 4H4WA 2XDOA 3EF6A 2C65A 1KNPA 2X50A 2YM1A 3DK8A 3UKAA 2BABA 4X4JA 3CGDA 3AE6A 3NYCA 3IC9A 1H83A 2GR0A 1XANA
chains in the Genus database with same CATH topology
1CL0A 2XFOA 3L1RA 2XLUA 2BC0A 2RGHA 3K7QX 4G73A 3UKHA 3GDPA 1FEAA 3KU9A 2YLRA 4OPLA 1K4QA 1IJHA 4TLXA 1IUWA 1EL8A 4Z2TA 4X9MA 3SQPA 3K30A 1E1MA 2B7SA 2BXRA 4YSYA 1DOCA 4AT0A 1GETA 4II3A 2GAHB 4J2WA 1F8RA 4U8NA 4Z44A 2BS4A 3LZWA 5FS7A 5U1OA 1GALA 4OPCA 5JCKA 2BCPA 2X8CA 1AOGA 3D8XA 4D03A 3ICSA 3ICRA 5BULA 3DK9A 4H4YA 1PHHA 1ZY8A 4NEVA 1H86A 3GYJA 2JAEA 1BGNA 4FK1C 1ONFA 3DJGX 1QLBA 2XVFA 2V5ZA 3AE9A 1YKJA 1S2YA 2OA1A 2E4GA 2JKCA 3RP7A 3SX6A 3BI2A 1JRXA 1Q9IA 4CCRA 4XWZA 3CNPA 2XVHA 5HHFA 1BGJA 3RP6A 4XWRA 4CNJA 1D4DA 3CPJG 4H4UA 3PO7A 4H2PA 4NZHA 2NVKX 4B69A 2XYOA 1Q1WA 3SGLA 3SZFA 3GD4A 3BHFA 3P1WA 2YWLA 1LQUA 4A9WA 1N4VA 4JDRA 2EQ9A 1LQTA 1Q1RA 4ZCDA 1O5WA 3NN6X 1B4VA 4GUVA 4HB9A 1DODA 1ELIA 1H82A 3NIXA 4EIPA 3AEEA 3KVEA 3CGBA 4Z2RA 3Q9TA 4U2TA 3VR9A 3CTYA 1NEKA 1VQWA 2BC1A 4APNA 3CPHG 3RHAA 2X8GA 4USQA 3NK2X 2WU2A 4Z25A 2GH5A 4ZN0A 3K7MX 4N9XA 2JB3A 2FJBA 4J56A 4U8OA 3T2YA 3NNEA 3SZ0A 3V3NA 3VRAA 4ECHA 1NHSA 4EIQA 1GRFA 2GV8A 1JU2A 1F8WA 3C4NA 2YLXA 4J57A 4JY3A 2WP9A 2GB0A 2TPRA 5BRTA 2V61A 2YG7A 1PXAA 5M10A 4ADWA 4LIIA 2VVLG 1K0IA 1REOA 3GYXA 4TM0A 3ZYXA 2ZZCA 3I3LA 3KPKA 1TYPA 3ITJA 3UOVA 5JCIA 5C3JA 4IA5A 4Y4LA 5GSNA 2BA9A 1VG9A 3AD8B 1GRTA 4K7ZA 3GD3A 2VRLA 4IVMB 3CNSA 3URHA 3UTFA 4AP1A 4BV6A 1KFYA 1FECA 1TDEA 2GQWA 3UKKA 3VRBA 2V6OA 5KVIA 3S5WA 5U63A 3CNDA 4U2LA 1YQZA 1MXTA 4BURA 4BK2A 3AEFA 3LOVA 4UDPA 1CC6A 1JRYA 2WPCA 2H88A 2R9ZA 3KKJA 2WDQA 3M12A 4JNQA 1QO8A 5FMHA 5KVHA 2TMDA 1VRQB 1EL7A 3L8KA 2ACZA 3QSEA 3AD9B 2GQFA 2W0HA 1CC2A 1YQ4A 3BI5A 4HA6A 1CJCA 1BWCA 3JSKA 3UOZA 5KNLA 2YVFA 1ZP0A 2XLTA 3BHKA 4AOXA 5TR3A 1P2EA 4H4ZA 3DGHA 1K0JA 2XFNA 1GOSA 1PJ5A 4YWOA 3NK1X 4IVOB 5IQ4A 2NPXA 1JNRA 3C96A 3T31A 4EM3A 5U25A 3C4AA 1E1KA 1LV0A 2RGJA 4EQWA 3QJ4A 3ICTA 1PDHA 3CMMA 3OC4A 2APGA 2VOUA 4YTMA 4NTCA 1E6EA 3CIRA 3CGCA 4A7AA 2BRYA 4Z43A 4II2A 2ARDA 3IHMA 1KDGA 1E39A 3FG2P 1CJ2A 2XFPA 4M52A 2WEUA 5KOWA 2B9WA 3UKLA 2R4EA 2OAMA 3AE8A 3NYFA 4J34A 4E0VA 3QSSA 3SZWA 5KWFA 4AOSA 4MJWA 1XDIA 5KRQA 3FPZA 2X3NA 3AECA 1BF3A 1DOEA 2IVEA 3T37A 3ALMA 2FJAA 5EB5A 1GT8A 2YM2A 2B7RA 2CDUA 1IUSA 4Z26A 3EPTA 3HZLA 3KD9A 3LJPA 1B5QA 3CGEA 1PJ7A 1GV4A 4YKGA 2AQJA 3VRDB 2WPEA 5FS6A 4YTNA 4B65A 2WOWA 4JNAA 4XXGA 4A79A 2X99A 2VQ7A 4OPGA 4B66A 3VQRA 4GCMA 1LTXR 2YR4A 4H2NA 4NEWA 5KMPA 4YSXA 2WP6A 4RG4A 4C3YA 2C66A 3QVPA 3NG7X 4JY2A 3EANA 2WU5A 1L9DA 2R0PA 4FDCB 3T14A 5BUKA 2YR6A 2A87A 4IV9A 4OPUA 3GWDA 3SZCA 1KSSA 4U8JA 4EMIA 3NN0X 1S3BA 4YSZA 1M64A 3DH9A 1W4XA 2IIDA 1Z6LA 2OALA 3AD7B 3NGCX 4H2RA 2XVIA 4AT2A 4U8PA 2YLSA 4YTPA 3FMWA 4U2SA 1TYTA 1XPQA 3NYEA 2GRTA 3KLJA 1OJDA 4J33A 4TLZA 5L46A 1EL9A 5M0ZA 3T2KA 2VZ2A 3UOYA 3QFAA 3R9UA 3GRSA 3NKSA 1IUUA 2AAQA 1CHUA 1GRAA 1PS9A 2C3DA 2A8XA 1MO9A 2WDVA 2C67A 3DA1A 3F8DA 2EQ7A 3AE2A 4G6HA 4LA1A 2OLOA 2YLZA 4U8KA 1CJ3A 2H89A 2Q0LA 3AYLA 3GRTA 4I59A 4CRTA 4J31A 4H4RA 5C2TA 3ABVA 5KMQA 4I58A 4B67A 3Q6JA 4NTDA 2ZZ0A 1B37A 5FS8A 3RNMA 4GDPA 3M0OA 2EQ8A 5KOXA 1NHRA 2C70A 4OPIA 4PAAA 4BK1A 2O9ZA 1NHQA 4C3XA 3WE0A 4C5OA 2JK6A 1V59A 1ZMCA 1LPFA 2F5ZA 2C76A 3UP5A 5LV9A 1ZDLA 1N1PA 4NNJA 2BS2A 4UDQA 4UP3A 3SFDA 1ZOVA 1IUVA 1EBDA 4U8MA 1YY5A 1O94A 5FS9A 2XLSA 1KSUA 4A6NA 1PBCA 2CULA 4KX6A 2YG6A 2YR5A 3E1TA 1CC4A 1LJ1A 3KPFA 4B63A 1DXLA 3H8LA 3NRNA 1TDFA 2QCUA 2WBAA 1L9EA 3CN8A 1COYA 4Y4NA 4G6GA 3I6DA 1JOAA 2Z5XA 2R0CA 3AE1A 5CQFA 1NENA 1ZMDA 3H4KA 4Z24A 1TDKA 1XHCA 2BCGG 3SY4A 2GR3A 2QAEA 2JB1A 4UDRA 3V3OA 2DKHA 4GAVA 2R4JA 3PVCA 3RP8A 1TRBA 3K7TA 2WDRA 3CPIG 2GR1A 3DJDA 3NTAA 3ZDNA 2Q6UA 2RABA 3H8IA 4H2QA 3O0HA 4WX1A 2JBVA 1OJCA 3AYJA 1KF6A 1FL2A 3PS9A 4NTEA 2GAGB 1GTHA 2YG4A 4RG3A 1QJDA 1GERA 1MOKA 2JB2A 1H81A 1ZX9A 1GRGA 4EMWA 1JNZA 2WP5A 1PBBA 4K8DA 4O5QA 3F8RA 3P4RA 4A65A 3GMCA 4YSHA 1OJTA 1NAAA 1DJQA 3KA7A 4H4VA 1GRHA 4J36A 4JQ9A 2IVDA 4B68A 1ZK7A 3DK4A 4X9NA 1F3PA 1GREA 1Y0PA 1VDCA 3ALLA 3IWAA 4AP3A 1TDOA 4GF7A 3NK0X 4H4XA 3BNMA 2FJEA 3NTDA 5HY5A 2WQYA 2C73A 3QFBA 1S3EA 5EBKA 3FIMB 4B1BA 4YT0A 1DNCA 2XLPA 4RSLA 3F8PA 4U8IA 1B8SA 3LADA 5ER0A 3REDA 2WESA 2FJDA 2YG3A 4H4SA 1DJNA 1H7WA 3SXIA 3VR8A 1E1LA 1GTEA 1PN0A 1Y56A 2VVMA 1D7LA 4TM1A 1GXFA 2C75A 1D4EA 2WOIA 3AE3A 4Y4MA 2XCGA 4C77A 3M13A 4O5UA 4G74A 1H84A 1FCDA 2VRMA 3HYXA 1P2HA 4U8LA 1D5TA 2XFUA 2WS3A 5EOWA 2ZBWA 1TDNA 2Y6RA 3T0KA 2C4CA 3UP4A 1RP0A 3QVRA 2CVJA 2C7GA 3GDNA 3NT6A 1SEZA 2R46A 3ISHA 3NH3X 3G5SA 1L0VA 1E1NA 3AEGA 3NHOX 3AWIA 3AE5A 5JCMA 1E7PA 3D1CA 3LZXA 1PBDA 4H4PA 3AB1A 1F8SA 5IPYA 5GRTA 3AYIA 2EQ6A 3LXDA 3UCLA 2V60A 4GR1A 2XVJA 1UKVG 4A99A 3BI4A 4CBQA 2I0ZA 1N4WA 1D7YA 1PBFA 4H50A 5HYMA 2Z5YA 3LB8A 2AR8A 2DKIA 1ZKQA 5EB4A 4DSGA 4WCTA 3UTEA 2E5VA 2GMHA 2J3NA 3CNTA 2R0GA 1DOBA 1GSNA 1GESA 2UZZA 2XVEA 3DJJA 2YQUA 3G5RA 3P4SA 4FX9A 4K2XA 2PYXA 3UTHA 4PABA 3P4PA 4EQRA 2GEWA 3NLCA 1NDAA 3SFEA 4OPDA 1PJ6A 4P9SA 2WHDA 2HQMA 5J7XA 4CCQA 5KMRA 1JEHA 5J60A 4K5RA 4D04A 2B9XA 4A5LA 4EMJA 4H7UA 2YLWA 2YLTA 1RYIA 1YQ3A 5CKUA 1PBEA 2PHHA 3UKQA 4CY8A 1CBOA 4GDEA 4CY6A 2BK5A 4DSHA 4EQXA 3GMBA 2Q0KA 1KNRA 3AXBA 4OCGA 2Y6QA 1NG3A 2BRAA 1BZLA 3ADAB 2YVGA 3ATRA 4NWZA 3AEAA 2GF3A 2E1MA 3ALJA 4YXDA 2BACA 2XFQA 1Y56B 4BJYA 1N4UA 2CFYA 2C72A 5JCNA 4G9KA 4H4TA 1GPEA 2FBWA 4DGKA 3AE7A 3CNJA 2VQBA 3ATQA 1PXBA 1PXCA 3HYVA 1NPXA 3QSMA 3UTGA 3P4QA 5IQ1A 5KMSA 1LVLA 1OJAA 1VG0A 1GRBA 2BYBA 4Z2UA 4REKA 3GYIA 3P9UA 4DNAA 1O95A 2WOVA 2ZZBA 4ZCCA 1NHPA 4ICYA 2BK3A 1CF3A 5BVAA 4B64A 3II4A 4H4QA 3FBSA 2A89A 3SM8A 4GRTA 2GVCA 4K5SA 4TM4A 4USRA 3UKPA 2BXSA 2YVJA 4JN9A 4YKFA 4A6NB 4CNKA 3UOXA 5DBJA 1EL5A 5KXJA 2BS3A 2V3AA 1IUXA 1GNDA 1GEUA 3B6DA 4OPTA 3COXA 4FK1A 2B76A 4TM3A 2XLRA 4C74A 3AEBA 2QA1A 1HYUA 3BNUA 5HXIA 3T2ZA 4BJZA 1CJ4A 1X31B 3DMEA 3DGZA 3AEDA 1H6VA 3HYWA 2X8HA 3B3RA 3OZ2A 1JRZA 3GWFA 1H7XA 4EQSA 1IUTA 2GMJA 2YAUA 4K22A 3V76A 2R45A 3IHGA 1ZOYA 3UKFA 4EM4A 4GAPA 1K0LA 1S2QA 2OLNA 1OJ9A 2GR2A 3AE4A 3IF9A 1NG4A 1BKWA 3SYIA 2V3BA 2VVLA 1RSGA 3GSIA 4KPRA 2B9YA 2C64A 2WETA 3G5QA 1FEBA 3S61A 5JCLA 2C3CA 4LU6A 4IA6A 1D4CA 1M6IA 3EAOA 4BK3A 4OVIA 1L9CA 1F6MA 2BK4A 1FOHA 2WPFA 3DJEA 2RGOA 2YG5A 2Q7VA 2QA2A 4H4WA 2XDOA 3EF6A 2C65A 1KNPA 2X50A 2YM1A 3DK8A 3UKAA 2BABA 4X4JA 3CGDA 3AE6A 3NYCA 3IC9A 1H83A 2GR0A 1XANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CL0 A;  2XFO A;  3L1R A;  2XLU A;  2BC0 A;  2RGH A;  3K7Q X;  3UKH A;  3GDP A;  1FEA A;  3KU9 A;  2YLR A;  4OPL A;  1K4Q A;  1IJH A;  4TLX A;  1IUW A;  1EL8 A;  4Z2T A;  4X9M A;  3SQP A;  3K30 A;  1E1M A;  2B7S A;  2BXR A;  4YSY A;  1DOC A;  4AT0 A;  1GET A;  2GAH B;  4J2W A;  1F8R A;  4U8N A;  4Z44 A;  2BS4 A;  3LZW A;  5FS7 A;  5U1O A;  1GAL A;  4OPC A;  5JCK A;  2BCP A;  2X8C A;  1AOG A;  3D8X A;  4D03 A;  3ICS A;  3ICR A;  5BUL A;  3DK9 A;  4H4Y A;  1PHH A;  1ZY8 A;  4NEV A;  1H86 A;  3GYJ A;  2JAE A;  1BGN A;  4FK1 C;  1ONF A;  3DJG X;  1QLB A;  2XVF A;  2V5Z A;  3AE9 A;  1YKJ A;  1S2Y A;  2OA1 A;  2E4G A;  2JKC A;  3RP7 A;  3BI2 A;  1JRX A;  1Q9I A;  4CCR A;  4XWZ A;  3CNP A;  2XVH A;  5HHF A;  1BGJ A;  3RP6 A;  4XWR A;  4CNJ A;  1D4D A;  3CPJ G;  4H4U A;  3PO7 A;  4H2P A;  4NZH A;  2NVK X;  4B69 A;  2XYO A;  1Q1W A;  3SGL A;  3GD4 A;  3BHF A;  3P1W A;  2YWL A;  1LQU A;  4A9W A;  1N4V A;  4JDR A;  2EQ9 A;  1LQT A;  1Q1R A;  4ZCD A;  1O5W A;  3NN6 X;  1B4V A;  4GUV A;  4HB9 A;  1DOD A;  1ELI A;  1H82 A;  3NIX A;  4EIP A;  3AEE A;  3KVE A;  3CGB A;  4Z2R A;  3Q9T A;  4U2T A;  3VR9 A;  3CTY A;  1NEK A;  1VQW A;  2BC1 A;  4APN A;  3CPH G;  3RHA A;  2X8G A;  4USQ A;  3NK2 X;  2WU2 A;  4Z25 A;  2GH5 A;  4ZN0 A;  3K7M X;  4N9X A;  2JB3 A;  2FJB A;  4J56 A;  4U8O A;  3NNE A;  3V3N A;  3VRA A;  4ECH A;  1NHS A;  4EIQ A;  1GRF A;  2GV8 A;  1JU2 A;  1F8W A;  3C4N A;  2YLX A;  4J57 A;  4JY3 A;  2WP9 A;  2GB0 A;  2TPR A;  5BRT A;  2V61 A;  2YG7 A;  1PXA A;  5M10 A;  4ADW A;  4LII A;  2VVL G;  1K0I A;  1REO A;  4TM0 A;  3ZYX A;  2ZZC A;  3I3L A;  1TYP A;  3ITJ A;  3UOV A;  5JCI A;  5C3J A;  4IA5 A;  4Y4L A;  5GSN A;  2BA9 A;  1VG9 A;  3AD8 B;  1GRT A;  4K7Z A;  3GD3 A;  2VRL A;  4IVM B;  3CNS A;  3URH A;  3UTF A;  4AP1 A;  4BV6 A;  1KFY A;  1FEC A;  1TDE A;  2GQW A;  3UKK A;  3VRB A;  2V6O A;  5KVI A;  3S5W A;  5U63 A;  3CND A;  4U2L A;  1YQZ A;  1MXT A;  4BUR A;  4BK2 A;  3AEF A;  3LOV A;  4UDP A;  1CC6 A;  1JRY A;  2WPC A;  2H88 A;  2R9Z A;  3KKJ A;  2WDQ A;  3M12 A;  4JNQ A;  1QO8 A;  5FMH A;  5KVH A;  2TMD A;  1VRQ B;  1EL7 A;  3L8K A;  2ACZ A;  3QSE A;  3AD9 B;  2GQF A;  2W0H A;  1CC2 A;  1YQ4 A;  3BI5 A;  4HA6 A;  1CJC A;  1BWC A;  3JSK A;  3UOZ A;  2YVF A;  1ZP0 A;  2XLT A;  3BHK A;  4AOX A;  5TR3 A;  1P2E A;  4H4Z A;  3DGH A;  1K0J A;  2XFN A;  1GOS A;  1PJ5 A;  4YWO A;  3NK1 X;  4IVO B;  5IQ4 A;  2NPX A;  1JNR A;  3C96 A;  4EM3 A;  5U25 A;  3C4A A;  1E1K A;  1LV0 A;  2RGJ A;  4EQW A;  3QJ4 A;  3ICT A;  1PDH A;  3OC4 A;  2APG A;  2VOU A;  4YTM A;  4NTC A;  1E6E A;  3CIR A;  3CGC A;  4A7A A;  4Z43 A;  2ARD A;  3IHM A;  1KDG A;  1E39 A;  3FG2 P;  1CJ2 A;  2XFP A;  4M52 A;  2WEU A;  5KOW A;  2B9W A;  3UKL A;  2R4E A;  2OAM A;  3AE8 A;  3NYF A;  4J34 A;  4E0V A;  3QSS A;  5KWF A;  4AOS A;  4MJW A;  1XDI A;  5KRQ A;  3FPZ A;  2X3N A;  3AEC A;  1BF3 A;  1DOE A;  2IVE A;  3T37 A;  3ALM A;  2FJA A;  5EB5 A;  1GT8 A;  2YM2 A;  2B7R A;  2CDU A;  1IUS A;  4Z26 A;  3EPT A;  3HZL A;  3KD9 A;  3LJP A;  1B5Q A;  3CGE A;  1PJ7 A;  1GV4 A;  4YKG A;  2AQJ A;  3VRD B;  2WPE A;  5FS6 A;  4YTN A;  4B65 A;  2WOW A;  4JNA A;  4XXG A;  4A79 A;  2X99 A;  2VQ7 A;  4OPG A;  4B66 A;  3VQR A;  4GCM A;  1LTX R;  2YR4 A;  4H2N A;  4NEW A;  4YSX A;  2WP6 A;  4RG4 A;  4C3Y A;  2C66 A;  3QVP A;  3NG7 X;  4JY2 A;  3EAN A;  2WU5 A;  1L9D A;  2R0P A;  4FDC B;  5BUK A;  2YR6 A;  2A87 A;  4IV9 A;  4OPU A;  3GWD A;  1KSS A;  4U8J A;  4EMI A;  3NN0 X;  1S3B A;  4YSZ A;  1M64 A;  3DH9 A;  1W4X A;  2IID A;  1Z6L A;  2OAL A;  3AD7 B;  3NGC X;  4H2R A;  2XVI A;  4AT2 A;  4U8P A;  2YLS A;  4YTP A;  3FMW A;  4U2S A;  1TYT A;  1XPQ A;  3NYE A;  2GRT A;  3KLJ A;  1OJD A;  4J33 A;  4TLZ A;  5L46 A;  1EL9 A;  5M0Z A;  2VZ2 A;  3UOY A;  3QFA A;  3R9U A;  3GRS A;  3NKS A;  1IUU A;  2AAQ A;  1CHU A;  1GRA A;  1PS9 A;  2C3D A;  2A8X A;  1MO9 A;  2WDV A;  2C67 A;  3DA1 A;  3F8D A;  2EQ7 A;  3AE2 A;  4LA1 A;  2OLO A;  2YLZ A;  4U8K A;  1CJ3 A;  2H89 A;  2Q0L A;  3AYL A;  3GRT A;  4I59 A;  4CRT A;  4J31 A;  4H4R A;  5C2T A;  3ABV A;  4B67 A;  4I58 A;  3Q6J A;  4NTD A;  2ZZ0 A;  1B37 A;  5FS8 A;  3RNM A;  4GDP A;  3M0O A;  2EQ8 A;  5KOX A;  1NHR A;  2C70 A;  4OPI A;  4PAA A;  4BK1 A;  2O9Z A;  1NHQ A;  4C3X A;  3WE0 A;  4C5O A;  2JK6 A;  1V59 A;  1ZMC A;  1LPF A;  2F5Z A;  2C76 A;  3UP5 A;  5LV9 A;  1ZDL A;  1N1P A;  2BS2 A;  4UDQ A;  4UP3 A;  3SFD A;  1ZOV A;  1IUV A;  1EBD A;  4U8M A;  1YY5 A;  1O94 A;  5FS9 A;  2XLS A;  1KSU A;  4A6N A;  1PBC A;  2CUL A;  4KX6 A;  2YG6 A;  2YR5 A;  3E1T A;  1CC4 A;  1LJ1 A;  3KPF A;  4B63 A;  1DXL A;  3H8L A;  3NRN A;  1TDF A;  2QCU A;  2WBA A;  1L9E A;  3CN8 A;  1COY A;  4Y4N A;  3I6D A;  1JOA A;  2Z5X A;  2R0C A;  3AE1 A;  5CQF A;  1NEN A;  1ZMD A;  3H4K A;  4Z24 A;  1TDK A;  1XHC A;  2BCG G;  2GR3 A;  2QAE A;  2JB1 A;  4UDR A;  3V3O A;  2DKH A;  3RP8 A;  2R4J A;  3PVC A;  1TRB A;  3K7T A;  2WDR A;  3CPI G;  2GR1 A;  3DJD A;  3NTA A;  3ZDN A;  2Q6U A;  2RAB A;  3H8I A;  4H2Q A;  3O0H A;  4WX1 A;  2JBV A;  1OJC A;  3AYJ A;  1KF6 A;  1FL2 A;  3PS9 A;  4NTE A;  2GAG B;  1GTH A;  2YG4 A;  4RG3 A;  1QJD A;  1GER A;  1MOK A;  2JB2 A;  1H81 A;  1ZX9 A;  1GRG A;  4EMW A;  1JNZ A;  2WP5 A;  1PBB A;  4K8D A;  4O5Q A;  3F8R A;  3P4R A;  4A65 A;  3GMC A;  4YSH A;  1OJT A;  1NAA A;  1DJQ A;  3KA7 A;  4H4V A;  1GRH A;  4J36 A;  4JQ9 A;  2IVD A;  4B68 A;  1ZK7 A;  3DK4 A;  4X9N A;  1F3P A;  1GRE A;  1Y0P A;  1VDC A;  3ALL A;  3IWA A;  4AP3 A;  1TDO A;  4GF7 A;  3NK0 X;  4H4X A;  3BNM A;  2FJE A;  3NTD A;  5HY5 A;  2WQY A;  2C73 A;  3QFB A;  1S3E A;  5EBK A;  3FIM B;  4B1B A;  4YT0 A;  1DNC A;  2XLP A;  4RSL A;  3F8P A;  4U8I A;  1B8S A;  3LAD A;  5ER0 A;  3RED A;  2WES A;  2FJD A;  2YG3 A;  4H4S A;  1DJN A;  1H7W A;  3VR8 A;  1E1L A;  1GTE A;  1PN0 A;  1Y56 A;  2VVM A;  1D7L A;  4TM1 A;  1GXF A;  2C75 A;  1D4E A;  2WOI A;  3AE3 A;  4Y4M A;  2XCG A;  4C77 A;  3M13 A;  4O5U A;  1H84 A;  1FCD A;  2VRM A;  4U8L A;  1P2H A;  1D5T A;  2XFU A;  2WS3 A;  5EOW A;  2ZBW A;  1TDN A;  2Y6R A;  3UP4 A;  1RP0 A;  3QVR A;  2CVJ A;  2C7G A;  3GDN A;  3NT6 A;  1SEZ A;  2R46 A;  3ISH A;  3NH3 X;  3G5S A;  1L0V A;  1E1N A;  3AEG A;  3NHO X;  3AWI A;  3AE5 A;  5JCM A;  1E7P A;  3D1C A;  3LZX A;  1PBD A;  4H4P A;  3AB1 A;  1F8S A;  5IPY A;  5GRT A;  3AYI A;  2EQ6 A;  3LXD A;  3UCL A;  2V60 A;  4GR1 A;  2XVJ A;  1UKV G;  4A99 A;  3BI4 A;  4CBQ A;  2I0Z A;  1N4W A;  1D7Y A;  1PBF A;  4H50 A;  5HYM A;  2Z5Y A;  3LB8 A;  2AR8 A;  2DKI A;  1ZKQ A;  5EB4 A;  4DSG A;  4WCT A;  3UTE A;  2E5V A;  2GMH A;  2J3N A;  3CNT A;  2R0G A;  1DOB A;  1GSN A;  1GES A;  2UZZ A;  2XVE A;  3DJJ A;  2YQU A;  3G5R A;  3P4S A;  4FX9 A;  4K2X A;  2PYX A;  3UTH A;  4PAB A;  3P4P A;  4EQR A;  2GEW A;  3NLC A;  1NDA A;  3SFE A;  4OPD A;  1PJ6 A;  4P9S A;  2WHD A;  2HQM A;  5J7X A;  4CCQ A;  1JEH A;  5J60 A;  4K5R A;  4D04 A;  2B9X A;  4A5L A;  4EMJ A;  4H7U A;  2YLW A;  2YLT A;  1RYI A;  1YQ3 A;  5CKU A;  1PBE A;  2PHH A;  3UKQ A;  4CY8 A;  1CBO A;  4GDE A;  4CY6 A;  2BK5 A;  4DSH A;  4EQX A;  3GMB A;  2Q0K A;  1KNR A;  3AXB A;  4OCG A;  2Y6Q A;  1NG3 A;  1BZL A;  3ADA B;  2YVG A;  3ATR A;  3AEA A;  2GF3 A;  2E1M A;  3ALJ A;  4YXD A;  2BAC A;  2XFQ A;  1Y56 B;  4BJY A;  1N4U A;  2CFY A;  2C72 A;  5JCN A;  4H4T A;  1GPE A;  2FBW A;  4DGK A;  3AE7 A;  3CNJ A;  2VQB A;  3ATQ A;  1PXB A;  1PXC A;  3QSM A;  1NPX A;  3UTG A;  3P4Q A;  5IQ1 A;  1LVL A;  1OJA A;  1VG0 A;  1GRB A;  2BYB A;  4Z2U A;  4REK A;  3GYI A;  3P9U A;  4DNA A;  1O95 A;  2WOV A;  2ZZB A;  4ZCC A;  1NHP A;  4ICY A;  2BK3 A;  1CF3 A;  5BVA A;  4B64 A;  3II4 A;  4H4Q A;  3FBS A;  2A89 A;  3SM8 A;  4GRT A;  2GVC A;  4K5S A;  4TM4 A;  4USR A;  3UKP A;  2BXS A;  2YVJ A;  4JN9 A;  4YKF A;  4A6N B;  4CNK A;  3UOX A;  5DBJ A;  1EL5 A;  5KXJ A;  2BS3 A;  2V3A A;  1IUX A;  1GND A;  1GEU A;  3B6D A;  4OPT A;  3COX A;  4FK1 A;  2B76 A;  4TM3 A;  2XLR A;  4C74 A;  3AEB A;  2QA1 A;  1HYU A;  3BNU A;  5HXI A;  4BJZ A;  1CJ4 A;  1X31 B;  3DME A;  3DGZ A;  3AED A;  1H6V A;  2X8H A;  3B3R A;  3OZ2 A;  1JRZ A;  3GWF A;  1H7X A;  4EQS A;  1IUT A;  2GMJ A;  2YAU A;  4K22 A;  3V76 A;  2R45 A;  3IHG A;  1ZOY A;  3UKF A;  4EM4 A;  1K0L A;  1S2Q A;  2OLN A;  1OJ9 A;  2GR2 A;  3AE4 A;  3IF9 A;  1NG4 A;  1BKW A;  2V3B A;  2VVL A;  1RSG A;  3GSI A;  4KPR A;  2B9Y A;  2C64 A;  2WET A;  3G5Q A;  1FEB A;  3S61 A;  5JCL A;  2C3C A;  4LU6 A;  4IA6 A;  1D4C A;  1M6I A;  3EAO A;  4BK3 A;  4OVI A;  1L9C A;  1F6M A;  2BK4 A;  1FOH A;  2WPF A;  3DJE A;  2RGO A;  2YG5 A;  2Q7V A;  2QA2 A;  4H4W A;  2XDO A;  3EF6 A;  2C65 A;  1KNP A;  2X50 A;  2YM1 A;  3DK8 A;  3UKA A;  2BAB A;  4X4J A;  3CGD A;  3AE6 A;  3NYC A;  3IC9 A;  1H83 A;  2GR0 A;  1XAN A; 
#chains in the Genus database with same CATH topology
 1CL0 A;  2XFO A;  3L1R A;  2XLU A;  2BC0 A;  2RGH A;  3K7Q X;  4G73 A;  3UKH A;  3GDP A;  1FEA A;  3KU9 A;  2YLR A;  4OPL A;  1K4Q A;  1IJH A;  4TLX A;  1IUW A;  1EL8 A;  4Z2T A;  4X9M A;  3SQP A;  3K30 A;  1E1M A;  2B7S A;  2BXR A;  4YSY A;  1DOC A;  4AT0 A;  1GET A;  4II3 A;  2GAH B;  4J2W A;  1F8R A;  4U8N A;  4Z44 A;  2BS4 A;  3LZW A;  5FS7 A;  5U1O A;  1GAL A;  4OPC A;  5JCK A;  2BCP A;  2X8C A;  1AOG A;  3D8X A;  4D03 A;  3ICS A;  3ICR A;  5BUL A;  3DK9 A;  4H4Y A;  1PHH A;  1ZY8 A;  4NEV A;  1H86 A;  3GYJ A;  2JAE A;  1BGN A;  4FK1 C;  1ONF A;  3DJG X;  1QLB A;  2XVF A;  2V5Z A;  3AE9 A;  1YKJ A;  1S2Y A;  2OA1 A;  2E4G A;  2JKC A;  3RP7 A;  3SX6 A;  3BI2 A;  1JRX A;  1Q9I A;  4CCR A;  4XWZ A;  3CNP A;  2XVH A;  5HHF A;  1BGJ A;  3RP6 A;  4XWR A;  4CNJ A;  1D4D A;  3CPJ G;  4H4U A;  3PO7 A;  4H2P A;  4NZH A;  2NVK X;  4B69 A;  2XYO A;  1Q1W A;  3SGL A;  3SZF A;  3GD4 A;  3BHF A;  3P1W A;  2YWL A;  1LQU A;  4A9W A;  1N4V A;  4JDR A;  2EQ9 A;  1LQT A;  1Q1R A;  4ZCD A;  1O5W A;  3NN6 X;  1B4V A;  4GUV A;  4HB9 A;  1DOD A;  1ELI A;  1H82 A;  3NIX A;  4EIP A;  3AEE A;  3KVE A;  3CGB A;  4Z2R A;  3Q9T A;  4U2T A;  3VR9 A;  3CTY A;  1NEK A;  1VQW A;  2BC1 A;  4APN A;  3CPH G;  3RHA A;  2X8G A;  4USQ A;  3NK2 X;  2WU2 A;  4Z25 A;  2GH5 A;  4ZN0 A;  3K7M X;  4N9X A;  2JB3 A;  2FJB A;  4J56 A;  4U8O A;  3T2Y A;  3NNE A;  3SZ0 A;  3V3N A;  3VRA A;  4ECH A;  1NHS A;  4EIQ A;  1GRF A;  2GV8 A;  1JU2 A;  1F8W A;  3C4N A;  2YLX A;  4J57 A;  4JY3 A;  2WP9 A;  2GB0 A;  2TPR A;  5BRT A;  2V61 A;  2YG7 A;  1PXA A;  5M10 A;  4ADW A;  4LII A;  2VVL G;  1K0I A;  1REO A;  3GYX A;  4TM0 A;  3ZYX A;  2ZZC A;  3I3L A;  3KPK A;  1TYP A;  3ITJ A;  3UOV A;  5JCI A;  5C3J A;  4IA5 A;  4Y4L A;  5GSN A;  2BA9 A;  1VG9 A;  3AD8 B;  1GRT A;  4K7Z A;  3GD3 A;  2VRL A;  4IVM B;  3CNS A;  3URH A;  3UTF A;  4AP1 A;  4BV6 A;  1KFY A;  1FEC A;  1TDE A;  2GQW A;  3UKK A;  3VRB A;  2V6O A;  5KVI A;  3S5W A;  5U63 A;  3CND A;  4U2L A;  1YQZ A;  1MXT A;  4BUR A;  4BK2 A;  3AEF A;  3LOV A;  4UDP A;  1CC6 A;  1JRY A;  2WPC A;  2H88 A;  2R9Z A;  3KKJ A;  2WDQ A;  3M12 A;  4JNQ A;  1QO8 A;  5FMH A;  5KVH A;  2TMD A;  1VRQ B;  1EL7 A;  3L8K A;  2ACZ A;  3QSE A;  3AD9 B;  2GQF A;  2W0H A;  1CC2 A;  1YQ4 A;  3BI5 A;  4HA6 A;  1CJC A;  1BWC A;  3JSK A;  3UOZ A;  5KNL A;  2YVF A;  1ZP0 A;  2XLT A;  3BHK A;  4AOX A;  5TR3 A;  1P2E A;  4H4Z A;  3DGH A;  1K0J A;  2XFN A;  1GOS A;  1PJ5 A;  4YWO A;  3NK1 X;  4IVO B;  5IQ4 A;  2NPX A;  1JNR A;  3C96 A;  3T31 A;  4EM3 A;  5U25 A;  3C4A A;  1E1K A;  1LV0 A;  2RGJ A;  4EQW A;  3QJ4 A;  3ICT A;  1PDH A;  3CMM A;  3OC4 A;  2APG A;  2VOU A;  4YTM A;  4NTC A;  1E6E A;  3CIR A;  3CGC A;  4A7A A;  2BRY A;  4Z43 A;  4II2 A;  2ARD A;  3IHM A;  1KDG A;  1E39 A;  3FG2 P;  1CJ2 A;  2XFP A;  4M52 A;  2WEU A;  5KOW A;  2B9W A;  3UKL A;  2R4E A;  2OAM A;  3AE8 A;  3NYF A;  4J34 A;  4E0V A;  3QSS A;  3SZW A;  5KWF A;  4AOS A;  4MJW A;  1XDI A;  5KRQ A;  3FPZ A;  2X3N A;  3AEC A;  1BF3 A;  1DOE A;  2IVE A;  3T37 A;  3ALM A;  2FJA A;  5EB5 A;  1GT8 A;  2YM2 A;  2B7R A;  2CDU A;  1IUS A;  4Z26 A;  3EPT A;  3HZL A;  3KD9 A;  3LJP A;  1B5Q A;  3CGE A;  1PJ7 A;  1GV4 A;  4YKG A;  2AQJ A;  3VRD B;  2WPE A;  5FS6 A;  4YTN A;  4B65 A;  2WOW A;  4JNA A;  4XXG A;  4A79 A;  2X99 A;  2VQ7 A;  4OPG A;  4B66 A;  3VQR A;  4GCM A;  1LTX R;  2YR4 A;  4H2N A;  4NEW A;  5KMP A;  4YSX A;  2WP6 A;  4RG4 A;  4C3Y A;  2C66 A;  3QVP A;  3NG7 X;  4JY2 A;  3EAN A;  2WU5 A;  1L9D A;  2R0P A;  4FDC B;  3T14 A;  5BUK A;  2YR6 A;  2A87 A;  4IV9 A;  4OPU A;  3GWD A;  3SZC A;  1KSS A;  4U8J A;  4EMI A;  3NN0 X;  1S3B A;  4YSZ A;  1M64 A;  3DH9 A;  1W4X A;  2IID A;  1Z6L A;  2OAL A;  3AD7 B;  3NGC X;  4H2R A;  2XVI A;  4AT2 A;  4U8P A;  2YLS A;  4YTP A;  3FMW A;  4U2S A;  1TYT A;  1XPQ A;  3NYE A;  2GRT A;  3KLJ A;  1OJD A;  4J33 A;  4TLZ A;  5L46 A;  1EL9 A;  5M0Z A;  3T2K A;  2VZ2 A;  3UOY A;  3QFA A;  3R9U A;  3GRS A;  3NKS A;  1IUU A;  2AAQ A;  1CHU A;  1GRA A;  1PS9 A;  2C3D A;  2A8X A;  1MO9 A;  2WDV A;  2C67 A;  3DA1 A;  3F8D A;  2EQ7 A;  3AE2 A;  4G6H A;  4LA1 A;  2OLO A;  2YLZ A;  4U8K A;  1CJ3 A;  2H89 A;  2Q0L A;  3AYL A;  3GRT A;  4I59 A;  4CRT A;  4J31 A;  4H4R A;  5C2T A;  3ABV A;  5KMQ A;  4I58 A;  4B67 A;  3Q6J A;  4NTD A;  2ZZ0 A;  1B37 A;  5FS8 A;  3RNM A;  4GDP A;  3M0O A;  2EQ8 A;  5KOX A;  1NHR A;  2C70 A;  4OPI A;  4PAA A;  4BK1 A;  2O9Z A;  1NHQ A;  4C3X A;  3WE0 A;  4C5O A;  2JK6 A;  1V59 A;  1ZMC A;  1LPF A;  2F5Z A;  2C76 A;  3UP5 A;  5LV9 A;  1ZDL A;  1N1P A;  4NNJ A;  2BS2 A;  4UDQ A;  4UP3 A;  3SFD A;  1ZOV A;  1IUV A;  1EBD A;  4U8M A;  1YY5 A;  1O94 A;  5FS9 A;  2XLS A;  1KSU A;  4A6N A;  1PBC A;  2CUL A;  4KX6 A;  2YG6 A;  2YR5 A;  3E1T A;  1CC4 A;  1LJ1 A;  3KPF A;  4B63 A;  1DXL A;  3H8L A;  3NRN A;  1TDF A;  2QCU A;  2WBA A;  1L9E A;  3CN8 A;  1COY A;  4Y4N A;  4G6G A;  3I6D A;  1JOA A;  2Z5X A;  2R0C A;  3AE1 A;  5CQF A;  1NEN A;  1ZMD A;  3H4K A;  4Z24 A;  1TDK A;  1XHC A;  2BCG G;  3SY4 A;  2GR3 A;  2QAE A;  2JB1 A;  4UDR A;  3V3O A;  2DKH A;  4GAV A;  2R4J A;  3PVC A;  3RP8 A;  1TRB A;  3K7T A;  2WDR A;  3CPI G;  2GR1 A;  3DJD A;  3NTA A;  3ZDN A;  2Q6U A;  2RAB A;  3H8I A;  4H2Q A;  3O0H A;  4WX1 A;  2JBV A;  1OJC A;  3AYJ A;  1KF6 A;  1FL2 A;  3PS9 A;  4NTE A;  2GAG B;  1GTH A;  2YG4 A;  4RG3 A;  1QJD A;  1GER A;  1MOK A;  2JB2 A;  1H81 A;  1ZX9 A;  1GRG A;  4EMW A;  1JNZ A;  2WP5 A;  1PBB A;  4K8D A;  4O5Q A;  3F8R A;  3P4R A;  4A65 A;  3GMC A;  4YSH A;  1OJT A;  1NAA A;  1DJQ A;  3KA7 A;  4H4V A;  1GRH A;  4J36 A;  4JQ9 A;  2IVD A;  4B68 A;  1ZK7 A;  3DK4 A;  4X9N A;  1F3P A;  1GRE A;  1Y0P A;  1VDC A;  3ALL A;  3IWA A;  4AP3 A;  1TDO A;  4GF7 A;  3NK0 X;  4H4X A;  3BNM A;  2FJE A;  3NTD A;  5HY5 A;  2WQY A;  2C73 A;  3QFB A;  1S3E A;  5EBK A;  3FIM B;  4B1B A;  4YT0 A;  1DNC A;  2XLP A;  4RSL A;  3F8P A;  4U8I A;  1B8S A;  3LAD A;  5ER0 A;  3RED A;  2WES A;  2FJD A;  2YG3 A;  4H4S A;  1DJN A;  1H7W A;  3SXI A;  3VR8 A;  1E1L A;  1GTE A;  1PN0 A;  1Y56 A;  2VVM A;  1D7L A;  4TM1 A;  1GXF A;  2C75 A;  1D4E A;  2WOI A;  3AE3 A;  4Y4M A;  2XCG A;  4C77 A;  3M13 A;  4O5U A;  4G74 A;  1H84 A;  1FCD A;  2VRM A;  3HYX A;  1P2H A;  4U8L A;  1D5T A;  2XFU A;  2WS3 A;  5EOW A;  2ZBW A;  1TDN A;  2Y6R A;  3T0K A;  2C4C A;  3UP4 A;  1RP0 A;  3QVR A;  2CVJ A;  2C7G A;  3GDN A;  3NT6 A;  1SEZ A;  2R46 A;  3ISH A;  3NH3 X;  3G5S A;  1L0V A;  1E1N A;  3AEG A;  3NHO X;  3AWI A;  3AE5 A;  5JCM A;  1E7P A;  3D1C A;  3LZX A;  1PBD A;  4H4P A;  3AB1 A;  1F8S A;  5IPY A;  5GRT A;  3AYI A;  2EQ6 A;  3LXD A;  3UCL A;  2V60 A;  4GR1 A;  2XVJ A;  1UKV G;  4A99 A;  3BI4 A;  4CBQ A;  2I0Z A;  1N4W A;  1D7Y A;  1PBF A;  4H50 A;  5HYM A;  2Z5Y A;  3LB8 A;  2AR8 A;  2DKI A;  1ZKQ A;  5EB4 A;  4DSG A;  4WCT A;  3UTE A;  2E5V A;  2GMH A;  2J3N A;  3CNT A;  2R0G A;  1DOB A;  1GSN A;  1GES A;  2UZZ A;  2XVE A;  3DJJ A;  2YQU A;  3G5R A;  3P4S A;  4FX9 A;  4K2X A;  2PYX A;  3UTH A;  4PAB A;  3P4P A;  4EQR A;  2GEW A;  3NLC A;  1NDA A;  3SFE A;  4OPD A;  1PJ6 A;  4P9S A;  2WHD A;  2HQM A;  5J7X A;  4CCQ A;  5KMR A;  1JEH A;  5J60 A;  4K5R A;  4D04 A;  2B9X A;  4A5L A;  4EMJ A;  4H7U A;  2YLW A;  2YLT A;  1RYI A;  1YQ3 A;  5CKU A;  1PBE A;  2PHH A;  3UKQ A;  4CY8 A;  1CBO A;  4GDE A;  4CY6 A;  2BK5 A;  4DSH A;  4EQX A;  3GMB A;  2Q0K A;  1KNR A;  3AXB A;  4OCG A;  2Y6Q A;  1NG3 A;  2BRA A;  1BZL A;  3ADA B;  2YVG A;  3ATR A;  4NWZ A;  3AEA A;  2GF3 A;  2E1M A;  3ALJ A;  4YXD A;  2BAC A;  2XFQ A;  1Y56 B;  4BJY A;  1N4U A;  2CFY A;  2C72 A;  5JCN A;  4G9K A;  4H4T A;  1GPE A;  2FBW A;  4DGK A;  3AE7 A;  3CNJ A;  2VQB A;  3ATQ A;  1PXB A;  1PXC A;  3HYV A;  1NPX A;  3QSM A;  3UTG A;  3P4Q A;  5IQ1 A;  5KMS A;  1LVL A;  1OJA A;  1VG0 A;  1GRB A;  2BYB A;  4Z2U A;  4REK A;  3GYI A;  3P9U A;  4DNA A;  1O95 A;  2WOV A;  2ZZB A;  4ZCC A;  1NHP A;  4ICY A;  2BK3 A;  1CF3 A;  5BVA A;  4B64 A;  3II4 A;  4H4Q A;  3FBS A;  2A89 A;  3SM8 A;  4GRT A;  2GVC A;  4K5S A;  4TM4 A;  4USR A;  3UKP A;  2BXS A;  2YVJ A;  4JN9 A;  4YKF A;  4A6N B;  4CNK A;  3UOX A;  5DBJ A;  1EL5 A;  5KXJ A;  2BS3 A;  2V3A A;  1IUX A;  1GND A;  1GEU A;  3B6D A;  4OPT A;  3COX A;  4FK1 A;  2B76 A;  4TM3 A;  2XLR A;  4C74 A;  3AEB A;  2QA1 A;  1HYU A;  3BNU A;  5HXI A;  3T2Z A;  4BJZ A;  1CJ4 A;  1X31 B;  3DME A;  3DGZ A;  3AED A;  1H6V A;  3HYW A;  2X8H A;  3B3R A;  3OZ2 A;  1JRZ A;  3GWF A;  1H7X A;  4EQS A;  1IUT A;  2GMJ A;  2YAU A;  4K22 A;  3V76 A;  2R45 A;  3IHG A;  1ZOY A;  3UKF A;  4EM4 A;  4GAP A;  1K0L A;  1S2Q A;  2OLN A;  1OJ9 A;  2GR2 A;  3AE4 A;  3IF9 A;  1NG4 A;  1BKW A;  3SYI A;  2V3B A;  2VVL A;  1RSG A;  3GSI A;  4KPR A;  2B9Y A;  2C64 A;  2WET A;  3G5Q A;  1FEB A;  3S61 A;  5JCL A;  2C3C A;  4LU6 A;  4IA6 A;  1D4C A;  1M6I A;  3EAO A;  4BK3 A;  4OVI A;  1L9C A;  1F6M A;  2BK4 A;  1FOH A;  2WPF A;  3DJE A;  2RGO A;  2YG5 A;  2Q7V A;  2QA2 A;  4H4W A;  2XDO A;  3EF6 A;  2C65 A;  1KNP A;  2X50 A;  2YM1 A;  3DK8 A;  3UKA A;  2BAB A;  4X4J A;  3CGD A;  3AE6 A;  3NYC A;  3IC9 A;  1H83 A;  2GR0 A;  1XAN A; 
#chains in the Genus database with same CATH homology
 1CL0 A;  2XFO A;  3L1R A;  2XLU A;  2BC0 A;  2RGH A;  3K7Q X;  4G73 A;  3UKH A;  3GDP A;  1FEA A;  3KU9 A;  2YLR A;  4OPL A;  1K4Q A;  1IJH A;  4TLX A;  1IUW A;  1EL8 A;  4Z2T A;  4X9M A;  3SQP A;  3K30 A;  1E1M A;  2B7S A;  2BXR A;  4YSY A;  1DOC A;  4AT0 A;  1GET A;  4II3 A;  2GAH B;  4J2W A;  1F8R A;  4U8N A;  4Z44 A;  2BS4 A;  3LZW A;  5FS7 A;  5U1O A;  1GAL A;  4OPC A;  5JCK A;  2BCP A;  2X8C A;  1AOG A;  3D8X A;  4D03 A;  3ICS A;  3ICR A;  5BUL A;  3DK9 A;  4H4Y A;  1PHH A;  1ZY8 A;  4NEV A;  1H86 A;  3GYJ A;  2JAE A;  1BGN A;  4FK1 C;  1ONF A;  3DJG X;  1QLB A;  2XVF A;  2V5Z A;  3AE9 A;  1YKJ A;  1S2Y A;  2OA1 A;  2E4G A;  2JKC A;  3RP7 A;  3SX6 A;  3BI2 A;  1JRX A;  1Q9I A;  4CCR A;  4XWZ A;  3CNP A;  2XVH A;  5HHF A;  1BGJ A;  3RP6 A;  4XWR A;  4CNJ A;  1D4D A;  3CPJ G;  4H4U A;  3PO7 A;  4H2P A;  4NZH A;  2NVK X;  4B69 A;  2XYO A;  1Q1W A;  3SGL A;  3SZF A;  3GD4 A;  3BHF A;  3P1W A;  2YWL A;  1LQU A;  4A9W A;  1N4V A;  4JDR A;  2EQ9 A;  1LQT A;  1Q1R A;  4ZCD A;  1O5W A;  3NN6 X;  1B4V A;  4GUV A;  4HB9 A;  1DOD A;  1ELI A;  1H82 A;  3NIX A;  4EIP A;  3AEE A;  3KVE A;  3CGB A;  4Z2R A;  3Q9T A;  4U2T A;  3VR9 A;  3CTY A;  1NEK A;  1VQW A;  2BC1 A;  4APN A;  3CPH G;  3RHA A;  2X8G A;  4USQ A;  3NK2 X;  2WU2 A;  4Z25 A;  2GH5 A;  4ZN0 A;  3K7M X;  4N9X A;  2JB3 A;  2FJB A;  4J56 A;  4U8O A;  3T2Y A;  3NNE A;  3SZ0 A;  3V3N A;  3VRA A;  4ECH A;  1NHS A;  4EIQ A;  1GRF A;  2GV8 A;  1JU2 A;  1F8W A;  3C4N A;  2YLX A;  4J57 A;  4JY3 A;  2WP9 A;  2GB0 A;  2TPR A;  5BRT A;  2V61 A;  2YG7 A;  1PXA A;  5M10 A;  4ADW A;  4LII A;  2VVL G;  1K0I A;  1REO A;  3GYX A;  4TM0 A;  3ZYX A;  2ZZC A;  3I3L A;  3KPK A;  1TYP A;  3ITJ A;  3UOV A;  5JCI A;  5C3J A;  4IA5 A;  4Y4L A;  5GSN A;  2BA9 A;  1VG9 A;  3AD8 B;  1GRT A;  4K7Z A;  3GD3 A;  2VRL A;  4IVM B;  3CNS A;  3URH A;  3UTF A;  4AP1 A;  4BV6 A;  1KFY A;  1FEC A;  1TDE A;  2GQW A;  3UKK A;  3VRB A;  2V6O A;  5KVI A;  3S5W A;  5U63 A;  3CND A;  4U2L A;  1YQZ A;  1MXT A;  4BUR A;  4BK2 A;  3AEF A;  3LOV A;  4UDP A;  1CC6 A;  1JRY A;  2WPC A;  2H88 A;  2R9Z A;  3KKJ A;  2WDQ A;  3M12 A;  4JNQ A;  1QO8 A;  5FMH A;  5KVH A;  2TMD A;  1VRQ B;  1EL7 A;  3L8K A;  2ACZ A;  3QSE A;  3AD9 B;  2GQF A;  2W0H A;  1CC2 A;  1YQ4 A;  3BI5 A;  4HA6 A;  1CJC A;  1BWC A;  3JSK A;  3UOZ A;  5KNL A;  2YVF A;  1ZP0 A;  2XLT A;  3BHK A;  4AOX A;  5TR3 A;  1P2E A;  4H4Z A;  3DGH A;  1K0J A;  2XFN A;  1GOS A;  1PJ5 A;  4YWO A;  3NK1 X;  4IVO B;  5IQ4 A;  2NPX A;  1JNR A;  3C96 A;  3T31 A;  4EM3 A;  5U25 A;  3C4A A;  1E1K A;  1LV0 A;  2RGJ A;  4EQW A;  3QJ4 A;  3ICT A;  1PDH A;  3CMM A;  3OC4 A;  2APG A;  2VOU A;  4YTM A;  4NTC A;  1E6E A;  3CIR A;  3CGC A;  4A7A A;  2BRY A;  4Z43 A;  4II2 A;  2ARD A;  3IHM A;  1KDG A;  1E39 A;  3FG2 P;  1CJ2 A;  2XFP A;  4M52 A;  2WEU A;  5KOW A;  2B9W A;  3UKL A;  2R4E A;  2OAM A;  3AE8 A;  3NYF A;  4J34 A;  4E0V A;  3QSS A;  3SZW A;  5KWF A;  4AOS A;  4MJW A;  1XDI A;  5KRQ A;  3FPZ A;  2X3N A;  3AEC A;  1BF3 A;  1DOE A;  2IVE A;  3T37 A;  3ALM A;  2FJA A;  5EB5 A;  1GT8 A;  2YM2 A;  2B7R A;  2CDU A;  1IUS A;  4Z26 A;  3EPT A;  3HZL A;  3KD9 A;  3LJP A;  1B5Q A;  3CGE A;  1PJ7 A;  1GV4 A;  4YKG A;  2AQJ A;  3VRD B;  2WPE A;  5FS6 A;  4YTN A;  4B65 A;  2WOW A;  4JNA A;  4XXG A;  4A79 A;  2X99 A;  2VQ7 A;  4OPG A;  4B66 A;  3VQR A;  4GCM A;  1LTX R;  2YR4 A;  4H2N A;  4NEW A;  5KMP A;  4YSX A;  2WP6 A;  4RG4 A;  4C3Y A;  2C66 A;  3QVP A;  3NG7 X;  4JY2 A;  3EAN A;  2WU5 A;  1L9D A;  2R0P A;  4FDC B;  3T14 A;  5BUK A;  2YR6 A;  2A87 A;  4IV9 A;  4OPU A;  3GWD A;  3SZC A;  1KSS A;  4U8J A;  4EMI A;  3NN0 X;  1S3B A;  4YSZ A;  1M64 A;  3DH9 A;  1W4X A;  2IID A;  1Z6L A;  2OAL A;  3AD7 B;  3NGC X;  4H2R A;  2XVI A;  4AT2 A;  4U8P A;  2YLS A;  4YTP A;  3FMW A;  4U2S A;  1TYT A;  1XPQ A;  3NYE A;  2GRT A;  3KLJ A;  1OJD A;  4J33 A;  4TLZ A;  5L46 A;  1EL9 A;  5M0Z A;  3T2K A;  2VZ2 A;  3UOY A;  3QFA A;  3R9U A;  3GRS A;  3NKS A;  1IUU A;  2AAQ A;  1CHU A;  1GRA A;  1PS9 A;  2C3D A;  2A8X A;  1MO9 A;  2WDV A;  2C67 A;  3DA1 A;  3F8D A;  2EQ7 A;  3AE2 A;  4G6H A;  4LA1 A;  2OLO A;  2YLZ A;  4U8K A;  1CJ3 A;  2H89 A;  2Q0L A;  3AYL A;  3GRT A;  4I59 A;  4CRT A;  4J31 A;  4H4R A;  5C2T A;  3ABV A;  5KMQ A;  4I58 A;  4B67 A;  3Q6J A;  4NTD A;  2ZZ0 A;  1B37 A;  5FS8 A;  3RNM A;  4GDP A;  3M0O A;  2EQ8 A;  5KOX A;  1NHR A;  2C70 A;  4OPI A;  4PAA A;  4BK1 A;  2O9Z A;  1NHQ A;  4C3X A;  3WE0 A;  4C5O A;  2JK6 A;  1V59 A;  1ZMC A;  1LPF A;  2F5Z A;  2C76 A;  3UP5 A;  5LV9 A;  1ZDL A;  1N1P A;  4NNJ A;  2BS2 A;  4UDQ A;  4UP3 A;  3SFD A;  1ZOV A;  1IUV A;  1EBD A;  4U8M A;  1YY5 A;  1O94 A;  5FS9 A;  2XLS A;  1KSU A;  4A6N A;  1PBC A;  2CUL A;  4KX6 A;  2YG6 A;  2YR5 A;  3E1T A;  1CC4 A;  1LJ1 A;  3KPF A;  4B63 A;  1DXL A;  3H8L A;  3NRN A;  1TDF A;  2QCU A;  2WBA A;  1L9E A;  3CN8 A;  1COY A;  4Y4N A;  4G6G A;  3I6D A;  1JOA A;  2Z5X A;  2R0C A;  3AE1 A;  5CQF A;  1NEN A;  1ZMD A;  3H4K A;  4Z24 A;  1TDK A;  1XHC A;  2BCG G;  3SY4 A;  2GR3 A;  2QAE A;  2JB1 A;  4UDR A;  3V3O A;  2DKH A;  4GAV A;  2R4J A;  3PVC A;  3RP8 A;  1TRB A;  3K7T A;  2WDR A;  3CPI G;  2GR1 A;  3DJD A;  3NTA A;  3ZDN A;  2Q6U A;  2RAB A;  3H8I A;  4H2Q A;  3O0H A;  4WX1 A;  2JBV A;  1OJC A;  3AYJ A;  1KF6 A;  1FL2 A;  3PS9 A;  4NTE A;  2GAG B;  1GTH A;  2YG4 A;  4RG3 A;  1QJD A;  1GER A;  1MOK A;  2JB2 A;  1H81 A;  1ZX9 A;  1GRG A;  4EMW A;  1JNZ A;  2WP5 A;  1PBB A;  4K8D A;  4O5Q A;  3F8R A;  3P4R A;  4A65 A;  3GMC A;  4YSH A;  1OJT A;  1NAA A;  1DJQ A;  3KA7 A;  4H4V A;  1GRH A;  4J36 A;  4JQ9 A;  2IVD A;  4B68 A;  1ZK7 A;  3DK4 A;  4X9N A;  1F3P A;  1GRE A;  1Y0P A;  1VDC A;  3ALL A;  3IWA A;  4AP3 A;  1TDO A;  4GF7 A;  3NK0 X;  4H4X A;  3BNM A;  2FJE A;  3NTD A;  5HY5 A;  2WQY A;  2C73 A;  3QFB A;  1S3E A;  5EBK A;  3FIM B;  4B1B A;  4YT0 A;  1DNC A;  2XLP A;  4RSL A;  3F8P A;  4U8I A;  1B8S A;  3LAD A;  5ER0 A;  3RED A;  2WES A;  2FJD A;  2YG3 A;  4H4S A;  1DJN A;  1H7W A;  3SXI A;  3VR8 A;  1E1L A;  1GTE A;  1PN0 A;  1Y56 A;  2VVM A;  1D7L A;  4TM1 A;  1GXF A;  2C75 A;  1D4E A;  2WOI A;  3AE3 A;  4Y4M A;  2XCG A;  4C77 A;  3M13 A;  4O5U A;  4G74 A;  1H84 A;  1FCD A;  2VRM A;  3HYX A;  1P2H A;  4U8L A;  1D5T A;  2XFU A;  2WS3 A;  5EOW A;  2ZBW A;  1TDN A;  2Y6R A;  3T0K A;  2C4C A;  3UP4 A;  1RP0 A;  3QVR A;  2CVJ A;  2C7G A;  3GDN A;  3NT6 A;  1SEZ A;  2R46 A;  3ISH A;  3NH3 X;  3G5S A;  1L0V A;  1E1N A;  3AEG A;  3NHO X;  3AWI A;  3AE5 A;  5JCM A;  1E7P A;  3D1C A;  3LZX A;  1PBD A;  4H4P A;  3AB1 A;  1F8S A;  5IPY A;  5GRT A;  3AYI A;  2EQ6 A;  3LXD A;  3UCL A;  2V60 A;  4GR1 A;  2XVJ A;  1UKV G;  4A99 A;  3BI4 A;  4CBQ A;  2I0Z A;  1N4W A;  1D7Y A;  1PBF A;  4H50 A;  5HYM A;  2Z5Y A;  3LB8 A;  2AR8 A;  2DKI A;  1ZKQ A;  5EB4 A;  4DSG A;  4WCT A;  3UTE A;  2E5V A;  2GMH A;  2J3N A;  3CNT A;  2R0G A;  1DOB A;  1GSN A;  1GES A;  2UZZ A;  2XVE A;  3DJJ A;  2YQU A;  3G5R A;  3P4S A;  4FX9 A;  4K2X A;  2PYX A;  3UTH A;  4PAB A;  3P4P A;  4EQR A;  2GEW A;  3NLC A;  1NDA A;  3SFE A;  4OPD A;  1PJ6 A;  4P9S A;  2WHD A;  2HQM A;  5J7X A;  4CCQ A;  5KMR A;  1JEH A;  5J60 A;  4K5R A;  4D04 A;  2B9X A;  4A5L A;  4EMJ A;  4H7U A;  2YLW A;  2YLT A;  1RYI A;  1YQ3 A;  5CKU A;  1PBE A;  2PHH A;  3UKQ A;  4CY8 A;  1CBO A;  4GDE A;  4CY6 A;  2BK5 A;  4DSH A;  4EQX A;  3GMB A;  2Q0K A;  1KNR A;  3AXB A;  4OCG A;  2Y6Q A;  1NG3 A;  2BRA A;  1BZL A;  3ADA B;  2YVG A;  3ATR A;  4NWZ A;  3AEA A;  2GF3 A;  2E1M A;  3ALJ A;  4YXD A;  2BAC A;  2XFQ A;  1Y56 B;  4BJY A;  1N4U A;  2CFY A;  2C72 A;  5JCN A;  4G9K A;  4H4T A;  1GPE A;  2FBW A;  4DGK A;  3AE7 A;  3CNJ A;  2VQB A;  3ATQ A;  1PXB A;  1PXC A;  3HYV A;  1NPX A;  3QSM A;  3UTG A;  3P4Q A;  5IQ1 A;  5KMS A;  1LVL A;  1OJA A;  1VG0 A;  1GRB A;  2BYB A;  4Z2U A;  4REK A;  3GYI A;  3P9U A;  4DNA A;  1O95 A;  2WOV A;  2ZZB A;  4ZCC A;  1NHP A;  4ICY A;  2BK3 A;  1CF3 A;  5BVA A;  4B64 A;  3II4 A;  4H4Q A;  3FBS A;  2A89 A;  3SM8 A;  4GRT A;  2GVC A;  4K5S A;  4TM4 A;  4USR A;  3UKP A;  2BXS A;  2YVJ A;  4JN9 A;  4YKF A;  4A6N B;  4CNK A;  3UOX A;  5DBJ A;  1EL5 A;  5KXJ A;  2BS3 A;  2V3A A;  1IUX A;  1GND A;  1GEU A;  3B6D A;  4OPT A;  3COX A;  4FK1 A;  2B76 A;  4TM3 A;  2XLR A;  4C74 A;  3AEB A;  2QA1 A;  1HYU A;  3BNU A;  5HXI A;  3T2Z A;  4BJZ A;  1CJ4 A;  1X31 B;  3DME A;  3DGZ A;  3AED A;  1H6V A;  3HYW A;  2X8H A;  3B3R A;  3OZ2 A;  1JRZ A;  3GWF A;  1H7X A;  4EQS A;  1IUT A;  2GMJ A;  2YAU A;  4K22 A;  3V76 A;  2R45 A;  3IHG A;  1ZOY A;  3UKF A;  4EM4 A;  4GAP A;  1K0L A;  1S2Q A;  2OLN A;  1OJ9 A;  2GR2 A;  3AE4 A;  3IF9 A;  1NG4 A;  1BKW A;  3SYI A;  2V3B A;  2VVL A;  1RSG A;  3GSI A;  4KPR A;  2B9Y A;  2C64 A;  2WET A;  3G5Q A;  1FEB A;  3S61 A;  5JCL A;  2C3C A;  4LU6 A;  4IA6 A;  1D4C A;  1M6I A;  3EAO A;  4BK3 A;  4OVI A;  1L9C A;  1F6M A;  2BK4 A;  1FOH A;  2WPF A;  3DJE A;  2RGO A;  2YG5 A;  2Q7V A;  2QA2 A;  4H4W A;  2XDO A;  3EF6 A;  2C65 A;  1KNP A;  2X50 A;  2YM1 A;  3DK8 A;  3UKA A;  2BAB A;  4X4J A;  3CGD A;  3AE6 A;  3NYC A;  3IC9 A;  1H83 A;  2GR0 A;  1XAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...