3LZWA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form i)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA02
1QJDA 1HYUA 1GRTA 3GYIA 2XLSA 2VRMA 4U8PA 2DKIA 3G5SA 3NNEA 3F8DA 5KOWA 3S61A 3V3OA 2EQ9A 4C74A 3GWDA 4NZHA 1KFYA 4UP3A 2BK3A 1DOCA 1IUTA 3Q6JA 2BABA 2CFYA 2X8CA 3LOVA 4CNKA 2XVFA 4N9XA 4H4RA 4O5QA 4OPTA 2X99A 3AB1A 3B3RA 3QFBA 4UDQA 3VQRA 2V60A 3ATQA 4C3XA 4TM3A 1NG4A 2XYOA 3S5WA 1CHUA 2RGJA 4Z2TA 2Z5YA 4JNQA 1Y56A 1ZOVA 3AEEA 3LADA 4K8DA 5JCLA 1H6VA 4REKA 5KOXA 1PS9A 4XWRA 3CGCA 3AEBA 4H4WA 4EQXA 4Y4LA 4OVIA 1KF6A 1P2HA 2WHDA 4H4YA 3ZYXA 2B9XA 5GSNA 2R46A 2AR8A 4AP3A 4Y4NA 4RSLA 3AEFA 4YTNA 1PN0A 3NN6X 4O5UA 3IC9A 4OPLA 1MOKA 4IV9A 3P4SA 2GVCA 1VRQB 2VQ7A 1ELIA 2VZ2A 1TYPA 1V59A 2WBAA 1TRBA 2X8GA 1LJ1A 3KPFA 4OPGA 4BURA 1D4CA 3EPTA 3P9UA 3E1TA 4M52A 1YQ4A 2OLOA 2WPFA 2QA1A 4CCRA 3DGZA 4H2PA 3CNSA 2YLZA 1BWCA 2NPXA 4K22A 1XANA 4Z25A 3AD9B 1VG0A 1H81A 1N4UA 4HB9A 3GD3A 1CL0A 4TLZA 1GETA 3O0HA 2Y6RA 1FCDA 2B7SA 3DK9A 4GRTA 5DBJA 3ALLA 1PBBA 1SEZA 1XDIA 1LVLA 1NEKA 1BZLA 2VOUA 4X9NA 1PJ7A 3KD9A 1PBCA 3VR8A 5KRQA 4YTPA 1FEAA 1KSUA 4ZCDA 2JB2A 1JNZA 2R0PA 1M6IA 1JU2A 2QCUA 2YG5A 3NG7X 4A65A 1OJTA 4OPIA 1S3BA 5U25A 3SQPA 2C72A 3DK4A 2C73A 3AE3A 4U8KA 2BCGG 1QO8A 2WP9A 2C67A 4YSHA 1K0JA 5JCNA 1DOEA 2XFOA 1GRAA 3L1RA 5J7XA 3ALJA 4NTCA 2IVEA 3PO7A 3AE9A 4ICYA 1L9EA 4YT0A 2C70A 1CC2A 2WPEA 1EL8A 1Y0PA 3QFAA 3LXDA 3M12A 5JCKA 4NEVA 1CJ3A 1NG3A 5FS7A 4APNA 5M0ZA 4U8NA 1PXBA 1ZMDA 3QVRA 3NRNA 4U8JA 4UDPA 3UP4A 4YWOA 1ZKQA 2QAEA 1DXLA 1KNRA 4XXGA 3UKQA 2GR3A 2CULA 3GRTA 3RP6A 2BA9A 1D4EA 4A99A 2XLUA 5CQFA 2XDOA 4GCMA 4B64A 1TDNA 2YVGA 5BULA 2XFNA 1ZY8A 3KA7A 4J56A 4J33A 4OCGA 1K4QA 1KSSA 3BI2A 1PDHA 1XPQA 3AE4A 4U2TA 3VRDB 5HYMA 1F3PA 3C4AA 2YLTA 1LTXR 5BRTA 3NHOX 1KDGA 4OPCA 1GESA 1VG9A 4H2RA 1DOBA 2Q6UA 4U8MA 1H86A 1TDEA 2OLNA 5IPYA 2YVFA 1CJCA 1QLBA 3UTEA 4EQRA 2GF3A 2XFQA 3VR9A 3NYEA 4DNAA 4IVMB 4I58A 5KVIA 3NK0X 2BK5A 2GR1A 3LZWA 4B67A 2ACZA 3FIMB 4EIQA 1NDAA 3GMBA 1E1NA 4RG3A 2J3NA 2R0GA 1E1MA 5JCMA 1RP0A 4YKGA 2JB1A 2XLRA 1TDKA 3GD4A 3NT6A 5HXIA 2ZBWA 3AEAA 5GRTA 3AD8B 2H89A 3AE5A 4FK1A 2X50A 2WEUA 3CPHG 4ZN0A 4USRA 1B37A 1PHHA 4D04A 3IHMA 4B68A 4X4JA 4AT0A 2VVLG 1GNDA 3OC4A 4EMJA 3AXBA 1PJ5A 4I59A 2RGOA 1OJCA 1FEBA 3CN8A 1H83A 1JOAA 1NAAA 3ITJA 4BK2A 5JCIA 2X8HA 4C5OA 3NYCA 3G5QA 3AE7A 1GERA 4GR1A 2YR5A 5C2TA 2GQWA 1FOHA 4Z2RA 2YG6A 1X31B 2WETA 4K2XA 3RNMA 3UOYA 1L9CA 1JRZA 2C3DA 4EIPA 1PBEA 1B4VA 2VQBA 3ALMA 4PABA 1FECA 2PHHA 2JB3A 3UKAA 2R0CA 3SM8A 3B6DA 2C64A 2XVIA 4CRTA 2I0ZA 3FBSA 3REDA 2C7GA 2WU2A 4YKFA 3NTDA 4KX6A 3UOVA 3P1WA 5IQ1A 4U8IA 4NEWA 4CY8A 1BKWA 1GALA 3I6DA 4IA5A 4USQA 2YQUA 3BHKA 4ECHA 1H82A 1S2QA 1GEUA 3C4NA 1NENA 4IA6A 4NTDA 5KWFA 5EBKA 4EMIA 3NTAA 3AE1A 3FG2P 2BXSA 3AE2A 3LB8A 3K7QX 3KVEA 3SFEA 4H4QA 5U1OA 4AOXA 2WESA 3KLJA 3FPZA 1F8SA 1BGJA 4Z26A 4JY2A 3UKKA 4BK3A 2VVLA 3COXA 4XWZA 1EL9A 1L9DA 2C76A 3BHFA 3D8XA 4J57A 3RHAA 1Q9IA 3EAOA 5FS9A 2RGHA 2AAQA 4BK1A 4Z44A 4B69A 2EQ6A 3K30A 1O94A 2TPRA 4ZCCA 2QA2A 3BI4A 2WOVA 2FBWA 2GMJA 2WQYA 4A6NA 4EQSA 3M13A 2BYBA 2XFUA 1GT8A 3EANA 3UKHA 1BGNA 4H4TA 3NLCA 4U8LA 1GRFA 2Q0KA 1S3EA 3UOXA 2JBVA 1CJ4A 2GH5A 2ARDA 1XHCA 2B76A 2WP6A 4C3YA 2APGA 1CC4A 1K0IA 3G5RA 4B66A 1E7PA 1F8RA 3CPIG 4H7UA 2B7RA 3CIRA 3BNUA 3RP8A 4B1BA 4C77A 3FMWA 2BS4A 2TMDA 1MO9A 1LQTA 1Y56B 3GMCA 4J36A 1YQ3A 2UZZA 1LPFA 2YR4A 1FL2A 3CNJA 4K5RA 5HHFA 4YSZA 1YY5A 2JAEA 1RSGA 5HY5A 4IVOB 4OPUA 1ONFA 3H8IA 2YWLA 2E1MA 1DJNA 3CGDA 4X9MA 3C96A 3QSEA 2XCGA 5J60A 3HZLA 1GV4A 1E1KA 2RABA 3V76A 2EQ7A 5FS6A 2BS2A 3H4KA 4A9WA 2AQJA 4E0VA 2OA1A 1RYIA 3IHGA 3QSMA 1LV0A 3QVPA 4OPDA 4TM1A 4H4UA 4YTMA 2GR2A 1D5TA 3WE0A 2OALA 4EM4A 2XLTA 4NTEA 2ZZBA 3CNPA 3NIXA 3GWFA 2GR0A 5EB4A 2YG4A 2WDVA 1Z6LA 4B63A 3GSIA 4Z24A 2CVJA 1H84A 3PS9A 4K7ZA 2GV8A 3II4A 5EB5A 1DODA 3DJEA 4H4PA 3GYJA 1NHPA 2WPCA 2GMHA 1PXCA 1ZDLA 2JK6A 3F8PA 4Y4MA 3K7TA 2A89A 1CBOA 2IVDA 3V3NA 2WOWA 3H8LA 5BVAA 1EL5A 3DMEA 1F6MA 1IJHA 2C66A 4KPRA 2VRLA 3AD7B 3GDPA 4H4SA 2XVHA 1M64A 2F5ZA 4H4ZA 2GRTA 3CGBA 5M10A 2YG3A 3DH9A 3NGCX 3P4QA 4UDRA 3QSSA 1JRXA 1W4XA 3ZDNA 3VRAA 5TR3A 4H2QA 2BC1A 2WU5A 3AYIA 4J31A 5LV9A 1TYTA 3LJPA 4TM4A 1O95A 1E39A 2A87A 1COYA 2GAHB 3UP5A 3CGEA 2B9YA 3JSKA 2FJEA 3NYFA 1S2YA 1H7WA 4AT2A 3UKFA 4A6NB 1O5WA 2WOIA 2A8XA 3NK2X 1D7LA 3PVCA 4H2NA 1CJ2A 1CC6A 2C65A 1ZOYA 3DJGX 1LQUA 3LZXA 3ABVA 4FX9A 1EBDA 3P4PA 1AOGA 3CNTA 3I3LA 1DJQA 4H50A 4P9SA 4EQWA 2V61A 2YG7A 1BF3A 1JEHA 2O9ZA 4ADWA 3ATRA 3SGLA 3UOZA 2YVJA 1GPEA 3L8KA 1D4DA 3T37A 2YR6A 2YLRA 3UTHA 1N4VA 2VVMA 3DA1A 4AOSA 2GAGB 3NN0X 3R9UA 1UKVG 3EF6A 4U8OA 3UKPA 5IQ4A 2BACA 1GTEA 1B5QA 1GREA 2BC0A 2V6OA 2YLXA 2ZZCA 4CCQA 1D7YA 1P2EA 5BUKA 4EMWA 3UTFA 1GSNA 3M0OA 4A5LA 4DSHA 1NPXA 2WS3A 1TDFA 1IUXA 5EOWA 4A7AA 4JN9A 3BNMA 1IUUA 2WDQA 3P4RA 1NHRA 1OJDA 1IUSA 2HQMA 3AWIA 4BJYA 4DSGA 4K5SA 2YLWA 2XLPA 5FMHA 1JNRA 4GF7A 2H88A 4EM3A 2WP5A 2V3BA 2W0HA 1DNCA 1MXTA 1H7XA 3UCLA 2C75A 5KVHA 4MJWA 1PJ6A 3AEGA 4WCTA 1CF3A 5U63A 4GUVA 3NK1X 1TDOA 3AYLA 2XFPA 1YQZA 2Y6QA 1PBFA 3KU9A 1PXAA 2YLSA 4FK1C 1JRYA 1ZX9A 3IF9A 3UKLA 3UTGA 4Z2UA 2GQFA 4FDCB 1IUVA 4AP1A 4YXDA 3ICRA 1N1PA 3QJ4A 1B8SA 2XVEA 4LA1A 4U2LA 1EL7A 1GXFA 2DKHA 2V3AA 2ZZ0A 3DJDA 3ICSA 4BV6A 1ZP0A 2Z5XA 3ADAB 3GDNA 4TLXA 2GB0A 2OAMA 3ISHA 3AECA 4JY3A 3IWAA 4BJZA 5CKUA 2BK4A 1IUWA 1GTHA 1Q1WA 2WDRA 3DGHA 2C3CA 2B9WA 3NH3X 1GOSA 4J2WA 3D1CA 1NHSA 2YAUA 3OZ2A 5FS8A 3RP7A 2FJAA 3VRBA 4CBQA 1E1LA 2BCPA 4LIIA 1VDCA 3Q9TA 3GRSA 3SFDA 4H4VA 2GEWA 2JKCA 2Q7VA 3DJJA 1REOA 2FJDA 4YSXA 2R45A 1PBDA 1VQWA 4LU6A 2BXRA 5C3JA 4B65A 2Q0LA 3AEDA 1Q1RA 4JDRA 1N4WA 4CY6A 3ICTA 2E4GA 2EQ8A 2IIDA 4HA6A 3AE8A 4WX1A 5ER0A 1L0VA 3K7MX 1KNPA 1NHQA 4JNAA 1OJAA 1OJ9A 2V5ZA 2R4JA 3CNDA 4D03A 1GRGA 4JQ9A 3CTYA 4RG4A 3URHA 1ZK7A 4H4XA 3AE6A 4GDEA 1GRBA 3BI5A 1F8WA 2BS3A 4YSYA 4Z43A 2NVKX 4CNJA 4J34A 2E5VA 2PYXA 3KKJA 4PAAA 5KXJA 3NKSA 1E6EA 3DK8A 5L46A 2FJBA 1K0LA 1YKJA 2X3NA 2YM1A 1ZMCA 3F8RA 4DGKA 2R4EA 4A79A 4GDPA 4TM0A 4U2SA 1GRHA 3AYJA 2CDUA 2XVJA 3CPJG 2YM2A 2R9ZA
chains in the Genus database with same CATH superfamily
1QJDA 1HYUA 1GRTA 3GYIA 2XLSA 2VRMA 4U8PA 2DKIA 3G5SA 5KMPA 3NNEA 3F8DA 5KOWA 3S61A 3V3OA 2EQ9A 4C74A 3GWDA 4NZHA 1KFYA 4UP3A 2BK3A 1DOCA 1IUTA 3Q6JA 2BABA 2CFYA 2X8CA 3KPKA 3LOVA 4CNKA 2XVFA 4N9XA 4H4RA 4O5QA 4OPTA 2X99A 3AB1A 3B3RA 3QFBA 4UDQA 3VQRA 2V60A 3HYVA 3ATQA 4C3XA 4TM3A 1NG4A 2XYOA 3S5WA 1CHUA 2RGJA 4Z2TA 2Z5YA 4JNQA 3SX6A 1Y56A 1ZOVA 3AEEA 3LADA 4K8DA 5JCLA 1H6VA 4REKA 5KOXA 1PS9A 4XWRA 3CGCA 3AEBA 4H4WA 4EQXA 4Y4LA 4OVIA 1KF6A 1P2HA 2WHDA 4H4YA 3ZYXA 2B9XA 5GSNA 2R46A 2AR8A 4AP3A 4Y4NA 4RSLA 3AEFA 4YTNA 1PN0A 3NN6X 4O5UA 3IC9A 4OPLA 1MOKA 4IV9A 3P4SA 2GVCA 1VRQB 2VQ7A 1ELIA 2VZ2A 1TYPA 1V59A 2WBAA 1TRBA 2X8GA 1LJ1A 3KPFA 4G74A 4OPGA 4BURA 1D4CA 3EPTA 3P9UA 3E1TA 4M52A 1YQ4A 2OLOA 2WPFA 2QA1A 4CCRA 3DGZA 4H2PA 3CNSA 2YLZA 1BWCA 2NPXA 4K22A 1XANA 4Z25A 3AD9B 1VG0A 1H81A 1N4UA 4HB9A 3GD3A 1CL0A 4TLZA 1GETA 3O0HA 2Y6RA 1FCDA 2B7SA 3DK9A 4GRTA 5DBJA 3ALLA 1PBBA 1SEZA 1XDIA 1LVLA 1NEKA 1BZLA 2VOUA 4X9NA 1PJ7A 3KD9A 1PBCA 3VR8A 5KRQA 4YTPA 1FEAA 1KSUA 4ZCDA 2JB2A 1JNZA 2R0PA 1M6IA 1JU2A 2QCUA 2YG5A 3NG7X 4A65A 1OJTA 4OPIA 1S3BA 5U25A 3SQPA 2C72A 3DK4A 2C73A 3AE3A 4U8KA 2BCGG 1QO8A 2WP9A 2C67A 4YSHA 1K0JA 5JCNA 1DOEA 2XFOA 1GRAA 3L1RA 5J7XA 3ALJA 4NTCA 2IVEA 3PO7A 3AE9A 4ICYA 1L9EA 4YT0A 2C70A 1CC2A 2WPEA 1EL8A 1Y0PA 3QFAA 3LXDA 3M12A 5JCKA 4NEVA 1CJ3A 1NG3A 5FS7A 4APNA 5M0ZA 4U8NA 1PXBA 1ZMDA 3QVRA 3NRNA 4U8JA 4UDPA 3UP4A 4YWOA 1ZKQA 2QAEA 1DXLA 1KNRA 3HYXA 4XXGA 3UKQA 2GR3A 2CULA 3GRTA 3RP6A 2BA9A 1D4EA 4A99A 2XLUA 5CQFA 2XDOA 4GCMA 4B64A 3SZWA 5KMQA 1TDNA 2YVGA 5BULA 2XFNA 1ZY8A 3KA7A 4J56A 4J33A 4OCGA 1K4QA 1KSSA 3BI2A 1PDHA 1XPQA 3AE4A 4U2TA 3VRDB 5HYMA 1F3PA 3C4AA 2YLTA 1LTXR 5BRTA 3NHOX 1KDGA 4OPCA 1GESA 1VG9A 4H2RA 1DOBA 2Q6UA 4U8MA 1H86A 1TDEA 2OLNA 5IPYA 2YVFA 1CJCA 1QLBA 3UTEA 4EQRA 2GF3A 2XFQA 3VR9A 3NYEA 4DNAA 4IVMB 4I58A 5KVIA 3NK0X 2BK5A 2GR1A 3LZWA 4B67A 2ACZA 3FIMB 4EIQA 1NDAA 3GMBA 1E1NA 3HYWA 4RG3A 2J3NA 2R0GA 2BRYA 1E1MA 5JCMA 1RP0A 4YKGA 2JB1A 2XLRA 1TDKA 3GD4A 3NT6A 5HXIA 2ZBWA 3AEAA 5GRTA 3AD8B 2H89A 3AE5A 4FK1A 2X50A 2WEUA 3CPHG 3T14A 4ZN0A 4USRA 1B37A 1PHHA 4D04A 3IHMA 4B68A 4X4JA 4AT0A 2VVLG 1GNDA 3OC4A 4EMJA 3AXBA 3T0KA 1PJ5A 4I59A 2RGOA 1OJCA 1FEBA 3CN8A 1H83A 3SZFA 1JOAA 1NAAA 3ITJA 4BK2A 5JCIA 2X8HA 4C5OA 3NYCA 3G5QA 3AE7A 1GERA 4GR1A 2YR5A 5C2TA 2GQWA 1FOHA 4Z2RA 2YG6A 1X31B 2WETA 4K2XA 4G9KA 3RNMA 3UOYA 1L9CA 1JRZA 2C3DA 4EIPA 1PBEA 4NWZA 1B4VA 2VQBA 3ALMA 4PABA 3SY4A 1FECA 2PHHA 2JB3A 3UKAA 2R0CA 3SM8A 3B6DA 5KNLA 2C64A 2XVIA 4CRTA 2I0ZA 3FBSA 3REDA 4GAPA 2C7GA 2WU2A 4YKFA 3NTDA 4KX6A 3UOVA 3P1WA 5IQ1A 4U8IA 4NEWA 4CY8A 1BKWA 1GALA 3I6DA 4IA5A 4USQA 2YQUA 3BHKA 4ECHA 1H82A 1S2QA 1GEUA 3C4NA 1NENA 4IA6A 4NTDA 5KWFA 5EBKA 4EMIA 3NTAA 3AE1A 3FG2P 2BXSA 3AE2A 3LB8A 3K7QX 3KVEA 3SFEA 4H4QA 5U1OA 4AOXA 2WESA 3KLJA 3FPZA 1F8SA 1BGJA 4Z26A 4JY2A 3UKKA 4BK3A 2VVLA 3COXA 4XWZA 1EL9A 1L9DA 2C76A 3BHFA 3D8XA 4J57A 3RHAA 1Q9IA 3EAOA 5FS9A 2RGHA 2AAQA 4BK1A 4Z44A 4B69A 2EQ6A 3K30A 1O94A 2TPRA 4ZCCA 2QA2A 3BI4A 2WOVA 2FBWA 2GMJA 2WQYA 4A6NA 4EQSA 3M13A 2BYBA 2XFUA 1GT8A 3EANA 3UKHA 1BGNA 4H4TA 3NLCA 4U8LA 1GRFA 2Q0KA 1S3EA 3UOXA 2JBVA 1CJ4A 2GH5A 2ARDA 1XHCA 2B76A 2WP6A 4C3YA 2APGA 1CC4A 1K0IA 3G5RA 4B66A 1E7PA 1F8RA 3CPIG 4H7UA 2B7RA 3CIRA 3BNUA 3RP8A 4B1BA 4C77A 3FMWA 2BS4A 2TMDA 1MO9A 1LQTA 1Y56B 3GMCA 4J36A 1YQ3A 2UZZA 1LPFA 2YR4A 1FL2A 3CNJA 4K5RA 5HHFA 4YSZA 1YY5A 2JAEA 1RSGA 5HY5A 4IVOB 4OPUA 1ONFA 3H8IA 2YWLA 2E1MA 1DJNA 3CGDA 4X9MA 3C96A 3QSEA 2XCGA 5J60A 3HZLA 1GV4A 1E1KA 2RABA 3V76A 2EQ7A 5FS6A 2BS2A 3H4KA 4A9WA 2AQJA 3GYXA 4E0VA 4II3A 2OA1A 1RYIA 3IHGA 3QSMA 1LV0A 3QVPA 4OPDA 4TM1A 4H4UA 4YTMA 2GR2A 1D5TA 3WE0A 2OALA 4EM4A 2XLTA 4NTEA 2ZZBA 3CNPA 3NIXA 3GWFA 2GR0A 5EB4A 2YG4A 2WDVA 1Z6LA 4B63A 3GSIA 4Z24A 2CVJA 1H84A 3PS9A 3CMMA 2GV8A 3II4A 4K7ZA 5EB5A 1DODA 3DJEA 4H4PA 3GYJA 1NHPA 2WPCA 2GMHA 3T2KA 3T2ZA 1PXCA 1ZDLA 2C4CA 2JK6A 3F8PA 4Y4MA 3K7TA 2A89A 1CBOA 2IVDA 3V3NA 2WOWA 3H8LA 5BVAA 1EL5A 3DMEA 1F6MA 1IJHA 2C66A 4KPRA 2VRLA 3AD7B 3GDPA 4H4SA 2XVHA 1M64A 2F5ZA 4H4ZA 2GRTA 3CGBA 5M10A 2YG3A 2BRAA 3DH9A 3NGCX 3P4QA 4G73A 4UDRA 3QSSA 1JRXA 1W4XA 3ZDNA 3VRAA 5TR3A 4G6HA 4H2QA 2BC1A 2WU5A 3AYIA 4J31A 5LV9A 1TYTA 3LJPA 4TM4A 1O95A 1E39A 2A87A 1COYA 2GAHB 3UP5A 3CGEA 2B9YA 3JSKA 3SXIA 2FJEA 3NYFA 1S2YA 1H7WA 4AT2A 3UKFA 4A6NB 1O5WA 2WOIA 2A8XA 3NK2X 1D7LA 3PVCA 4H2NA 1CJ2A 1CC6A 2C65A 1ZOYA 3DJGX 1LQUA 3LZXA 3ABVA 4FX9A 1EBDA 3P4PA 1AOGA 3CNTA 3I3LA 1DJQA 4H50A 4P9SA 4EQWA 2V61A 2YG7A 1BF3A 1JEHA 2O9ZA 4ADWA 3ATRA 3SGLA 3UOZA 2YVJA 1GPEA 3L8KA 1D4DA 3T37A 2YR6A 3T31A 2YLRA 3UTHA 1N4VA 2VVMA 3DA1A 4AOSA 2GAGB 3NN0X 3R9UA 1UKVG 3EF6A 4U8OA 3UKPA 5IQ4A 2BACA 1GTEA 1B5QA 1GREA 2BC0A 2V6OA 2YLXA 2ZZCA 4CCQA 1D7YA 1P2EA 5BUKA 4EMWA 3UTFA 1GSNA 3M0OA 4NNJA 4A5LA 4DSHA 1NPXA 2WS3A 5KMSA 1TDFA 1IUXA 5EOWA 4A7AA 4JN9A 3BNMA 1IUUA 2WDQA 3P4RA 1NHRA 1OJDA 1IUSA 2HQMA 3AWIA 4BJYA 4DSGA 4K5SA 2YLWA 2XLPA 5FMHA 1JNRA 4GF7A 2H88A 3T2YA 4EM3A 2WP5A 2V3BA 2W0HA 1DNCA 1MXTA 1H7XA 3UCLA 2C75A 5KVHA 4MJWA 1PJ6A 3AEGA 4WCTA 1CF3A 5U63A 4GUVA 3NK1X 1TDOA 3AYLA 2XFPA 1YQZA 2Y6QA 1PBFA 3KU9A 1PXAA 2YLSA 4FK1C 1JRYA 1ZX9A 3IF9A 3UKLA 3UTGA 4GAVA 4Z2UA 2GQFA 4FDCB 1IUVA 4G6GA 4AP1A 4YXDA 3ICRA 1N1PA 4II2A 3QJ4A 1B8SA 2XVEA 4LA1A 4U2LA 1EL7A 1GXFA 2DKHA 2V3AA 2ZZ0A 3DJDA 3ICSA 4BV6A 1ZP0A 2Z5XA 3ADAB 3GDNA 4TLXA 2GB0A 2OAMA 3SZCA 3ISHA 3AECA 4JY3A 3IWAA 4BJZA 5CKUA 2BK4A 1IUWA 1GTHA 1Q1WA 2WDRA 3DGHA 2C3CA 2B9WA 3NH3X 1GOSA 4J2WA 3D1CA 1NHSA 2YAUA 3OZ2A 3SZ0A 5FS8A 3RP7A 2FJAA 3VRBA 4CBQA 1E1LA 2BCPA 4LIIA 1VDCA 3Q9TA 3GRSA 3SFDA 4H4VA 2GEWA 2JKCA 2Q7VA 3DJJA 1REOA 2FJDA 4YSXA 2R45A 1PBDA 1VQWA 4LU6A 2BXRA 5C3JA 4B65A 2Q0LA 3AEDA 1Q1RA 4JDRA 1N4WA 4CY6A 3ICTA 2E4GA 2EQ8A 2IIDA 4HA6A 3AE8A 4WX1A 5ER0A 1L0VA 3K7MX 1KNPA 1NHQA 4JNAA 1OJAA 1OJ9A 2V5ZA 2R4JA 3CNDA 4D03A 1GRGA 4JQ9A 3CTYA 4RG4A 3URHA 1ZK7A 4H4XA 3AE6A 4GDEA 5KMRA 1GRBA 3BI5A 1F8WA 2BS3A 4YSYA 4Z43A 2NVKX 4CNJA 4J34A 2E5VA 2PYXA 3KKJA 4PAAA 3SYIA 5KXJA 3NKSA 1E6EA 3DK8A 5L46A 2FJBA 1K0LA 1YKJA 2X3NA 2YM1A 1ZMCA 3F8RA 4DGKA 2R4EA 4A79A 4GDPA 4TM0A 4U2SA 1GRHA 3AYJA 2CDUA 2XVJA 3CPJG 2YM2A 2R9ZA
chains in the Genus database with same CATH topology
1QJDA 1HYUA 1GRTA 3GYIA 2XLSA 2VRMA 4U8PA 2DKIA 3G5SA 5KMPA 3NNEA 3F8DA 5KOWA 3S61A 3V3OA 2EQ9A 4C74A 3GWDA 4NZHA 1KFYA 4UP3A 2BK3A 1DOCA 1IUTA 3Q6JA 2BABA 2CFYA 2X8CA 3KPKA 3LOVA 4CNKA 2XVFA 4N9XA 4H4RA 4O5QA 4OPTA 2X99A 3AB1A 3B3RA 3QFBA 4UDQA 3VQRA 2V60A 3HYVA 3ATQA 4C3XA 4TM3A 1NG4A 2XYOA 3S5WA 1CHUA 2RGJA 4Z2TA 2Z5YA 4JNQA 3SX6A 1Y56A 1ZOVA 3AEEA 3LADA 4K8DA 5JCLA 1H6VA 4REKA 5KOXA 1PS9A 4XWRA 3CGCA 3AEBA 4H4WA 4EQXA 4Y4LA 4OVIA 1KF6A 1P2HA 2WHDA 4H4YA 3ZYXA 2B9XA 5GSNA 2R46A 2AR8A 4AP3A 4Y4NA 4RSLA 3AEFA 4YTNA 1PN0A 3NN6X 4O5UA 3IC9A 4OPLA 1MOKA 4IV9A 3P4SA 2GVCA 1VRQB 2VQ7A 1ELIA 2VZ2A 1TYPA 1V59A 2WBAA 1TRBA 2X8GA 1LJ1A 3KPFA 4G74A 4OPGA 4BURA 1D4CA 3EPTA 3P9UA 3E1TA 4M52A 1YQ4A 2OLOA 2WPFA 2QA1A 4CCRA 3DGZA 4H2PA 3CNSA 2YLZA 1BWCA 2NPXA 4K22A 1XANA 4Z25A 3AD9B 1VG0A 1H81A 1N4UA 4HB9A 3GD3A 1CL0A 4TLZA 1GETA 3O0HA 2Y6RA 1FCDA 2B7SA 3DK9A 4GRTA 5DBJA 3ALLA 1PBBA 1SEZA 1XDIA 1LVLA 1NEKA 1BZLA 2VOUA 4X9NA 1PJ7A 3KD9A 1PBCA 3VR8A 5KRQA 4YTPA 1FEAA 1KSUA 4ZCDA 2JB2A 1JNZA 2R0PA 1M6IA 1JU2A 2QCUA 2YG5A 3NG7X 4A65A 1OJTA 4OPIA 1S3BA 5U25A 3SQPA 2C72A 3DK4A 2C73A 3AE3A 4U8KA 2BCGG 1QO8A 2WP9A 2C67A 4YSHA 1K0JA 5JCNA 1DOEA 2XFOA 1GRAA 3L1RA 5J7XA 3ALJA 4NTCA 2IVEA 3PO7A 3AE9A 4ICYA 1L9EA 4YT0A 2C70A 1CC2A 2WPEA 1EL8A 1Y0PA 3QFAA 3LXDA 3M12A 5JCKA 4NEVA 1CJ3A 1NG3A 5FS7A 4APNA 5M0ZA 4U8NA 1PXBA 1ZMDA 3QVRA 3NRNA 4U8JA 4UDPA 3UP4A 4YWOA 1ZKQA 2QAEA 1DXLA 1KNRA 3HYXA 4XXGA 3UKQA 2GR3A 2CULA 3GRTA 3RP6A 2BA9A 1D4EA 4A99A 2XLUA 5CQFA 2XDOA 4GCMA 4B64A 3SZWA 5KMQA 1TDNA 2YVGA 5BULA 2XFNA 1ZY8A 3KA7A 4J56A 4J33A 4OCGA 1K4QA 1KSSA 3BI2A 1PDHA 1XPQA 3AE4A 4U2TA 3VRDB 5HYMA 1F3PA 3C4AA 2YLTA 1LTXR 5BRTA 3NHOX 1KDGA 4OPCA 1GESA 1VG9A 4H2RA 1DOBA 2Q6UA 4U8MA 1H86A 1TDEA 2OLNA 5IPYA 2YVFA 1CJCA 1QLBA 3UTEA 4EQRA 2GF3A 2XFQA 3VR9A 3NYEA 4DNAA 4IVMB 4I58A 5KVIA 3NK0X 2BK5A 2GR1A 3LZWA 4B67A 2ACZA 3FIMB 4EIQA 1NDAA 3GMBA 1E1NA 3HYWA 4RG3A 2J3NA 2R0GA 2BRYA 1E1MA 5JCMA 1RP0A 4YKGA 2JB1A 2XLRA 1TDKA 3GD4A 3NT6A 5HXIA 2ZBWA 3AEAA 5GRTA 3AD8B 2H89A 3AE5A 4FK1A 2X50A 2WEUA 3CPHG 3T14A 4ZN0A 4USRA 1B37A 1PHHA 4D04A 3IHMA 4B68A 4X4JA 4AT0A 2VVLG 1GNDA 3OC4A 4EMJA 3AXBA 3T0KA 1PJ5A 4I59A 2RGOA 1OJCA 1FEBA 3CN8A 1H83A 3SZFA 1JOAA 1NAAA 3ITJA 4BK2A 5JCIA 2X8HA 4C5OA 3NYCA 3G5QA 3AE7A 1GERA 4GR1A 2YR5A 5C2TA 2GQWA 1FOHA 4Z2RA 2YG6A 1X31B 2WETA 4K2XA 4G9KA 3RNMA 3UOYA 1L9CA 1JRZA 2C3DA 4EIPA 1PBEA 4NWZA 1B4VA 2VQBA 3ALMA 4PABA 3SY4A 1FECA 2PHHA 2JB3A 3UKAA 2R0CA 3SM8A 3B6DA 5KNLA 2C64A 2XVIA 4CRTA 2I0ZA 3FBSA 3REDA 4GAPA 2C7GA 2WU2A 4YKFA 3NTDA 4KX6A 3UOVA 3P1WA 5IQ1A 4U8IA 4NEWA 4CY8A 1BKWA 1GALA 3I6DA 4IA5A 4USQA 2YQUA 3BHKA 4ECHA 1H82A 1S2QA 1GEUA 3C4NA 1NENA 4IA6A 4NTDA 5KWFA 5EBKA 4EMIA 3NTAA 3AE1A 3FG2P 2BXSA 3AE2A 3LB8A 3K7QX 3KVEA 3SFEA 4H4QA 5U1OA 4AOXA 2WESA 3KLJA 3FPZA 1F8SA 1BGJA 4Z26A 4JY2A 3UKKA 4BK3A 2VVLA 3COXA 4XWZA 1EL9A 1L9DA 2C76A 3BHFA 3D8XA 4J57A 3RHAA 1Q9IA 3EAOA 5FS9A 2RGHA 2AAQA 4BK1A 4Z44A 4B69A 2EQ6A 3K30A 1O94A 2TPRA 4ZCCA 2QA2A 3BI4A 2WOVA 2FBWA 2GMJA 2WQYA 4A6NA 4EQSA 3M13A 2BYBA 2XFUA 1GT8A 3EANA 3UKHA 1BGNA 4H4TA 3NLCA 4U8LA 1GRFA 2Q0KA 1S3EA 3UOXA 2JBVA 1CJ4A 2GH5A 2ARDA 1XHCA 2B76A 2WP6A 4C3YA 2APGA 1CC4A 1K0IA 3G5RA 4B66A 1E7PA 1F8RA 3CPIG 4H7UA 2B7RA 3CIRA 3BNUA 3RP8A 4B1BA 4C77A 3FMWA 2BS4A 2TMDA 1MO9A 1LQTA 1Y56B 3GMCA 4J36A 1YQ3A 2UZZA 1LPFA 2YR4A 1FL2A 3CNJA 4K5RA 5HHFA 4YSZA 1YY5A 2JAEA 1RSGA 5HY5A 4IVOB 4OPUA 1ONFA 3H8IA 2YWLA 2E1MA 1DJNA 3CGDA 4X9MA 3C96A 3QSEA 2XCGA 5J60A 3HZLA 1GV4A 1E1KA 2RABA 3V76A 2EQ7A 5FS6A 2BS2A 3H4KA 4A9WA 2AQJA 3GYXA 4E0VA 4II3A 2OA1A 1RYIA 3IHGA 3QSMA 1LV0A 3QVPA 4OPDA 4TM1A 4H4UA 4YTMA 2GR2A 1D5TA 3WE0A 2OALA 4EM4A 2XLTA 4NTEA 2ZZBA 3CNPA 3NIXA 3GWFA 2GR0A 5EB4A 2YG4A 2WDVA 1Z6LA 4B63A 3GSIA 4Z24A 2CVJA 1H84A 3PS9A 3CMMA 2GV8A 3II4A 4K7ZA 5EB5A 1DODA 3DJEA 4H4PA 3GYJA 1NHPA 2WPCA 2GMHA 3T2KA 3T2ZA 1PXCA 1ZDLA 2C4CA 2JK6A 3F8PA 4Y4MA 3K7TA 2A89A 1CBOA 2IVDA 3V3NA 2WOWA 3H8LA 5BVAA 1EL5A 3DMEA 1F6MA 1IJHA 2C66A 4KPRA 2VRLA 3AD7B 3GDPA 4H4SA 2XVHA 1M64A 2F5ZA 4H4ZA 2GRTA 3CGBA 5M10A 2YG3A 2BRAA 3DH9A 3NGCX 3P4QA 4G73A 4UDRA 3QSSA 1JRXA 1W4XA 3ZDNA 3VRAA 5TR3A 4G6HA 4H2QA 2BC1A 2WU5A 3AYIA 4J31A 5LV9A 1TYTA 3LJPA 4TM4A 1O95A 1E39A 2A87A 1COYA 2GAHB 3UP5A 3CGEA 2B9YA 3JSKA 3SXIA 2FJEA 3NYFA 1S2YA 1H7WA 4AT2A 3UKFA 4A6NB 1O5WA 2WOIA 2A8XA 3NK2X 1D7LA 3PVCA 4H2NA 1CJ2A 1CC6A 2C65A 1ZOYA 3DJGX 1LQUA 3LZXA 3ABVA 4FX9A 1EBDA 3P4PA 1AOGA 3CNTA 3I3LA 1DJQA 4H50A 4P9SA 4EQWA 2V61A 2YG7A 1BF3A 1JEHA 2O9ZA 4ADWA 3ATRA 3SGLA 3UOZA 2YVJA 1GPEA 3L8KA 1D4DA 3T37A 2YR6A 3T31A 2YLRA 3UTHA 1N4VA 2VVMA 3DA1A 4AOSA 2GAGB 3NN0X 3R9UA 1UKVG 3EF6A 4U8OA 3UKPA 5IQ4A 2BACA 1GTEA 1B5QA 1GREA 2BC0A 2V6OA 2YLXA 2ZZCA 4CCQA 1D7YA 1P2EA 5BUKA 4EMWA 3UTFA 1GSNA 3M0OA 4NNJA 4A5LA 4DSHA 1NPXA 2WS3A 5KMSA 1TDFA 1IUXA 5EOWA 4A7AA 4JN9A 3BNMA 1IUUA 2WDQA 3P4RA 1NHRA 1OJDA 1IUSA 2HQMA 3AWIA 4BJYA 4DSGA 4K5SA 2YLWA 2XLPA 5FMHA 1JNRA 4GF7A 2H88A 3T2YA 4EM3A 2WP5A 2V3BA 2W0HA 1DNCA 1MXTA 1H7XA 3UCLA 2C75A 5KVHA 4MJWA 1PJ6A 3AEGA 4WCTA 1CF3A 5U63A 4GUVA 3NK1X 1TDOA 3AYLA 2XFPA 1YQZA 2Y6QA 1PBFA 3KU9A 1PXAA 2YLSA 4FK1C 1JRYA 1ZX9A 3IF9A 3UKLA 3UTGA 4GAVA 4Z2UA 2GQFA 4FDCB 1IUVA 4G6GA 4AP1A 4YXDA 3ICRA 1N1PA 4II2A 3QJ4A 1B8SA 2XVEA 4LA1A 4U2LA 1EL7A 1GXFA 2DKHA 2V3AA 2ZZ0A 3DJDA 3ICSA 4BV6A 1ZP0A 2Z5XA 3ADAB 3GDNA 4TLXA 2GB0A 2OAMA 3SZCA 3ISHA 3AECA 4JY3A 3IWAA 4BJZA 5CKUA 2BK4A 1IUWA 1GTHA 1Q1WA 2WDRA 3DGHA 2C3CA 2B9WA 3NH3X 1GOSA 4J2WA 3D1CA 1NHSA 2YAUA 3OZ2A 3SZ0A 5FS8A 3RP7A 2FJAA 3VRBA 4CBQA 1E1LA 2BCPA 4LIIA 1VDCA 3Q9TA 3GRSA 3SFDA 4H4VA 2GEWA 2JKCA 2Q7VA 3DJJA 1REOA 2FJDA 4YSXA 2R45A 1PBDA 1VQWA 4LU6A 2BXRA 5C3JA 4B65A 2Q0LA 3AEDA 1Q1RA 4JDRA 1N4WA 4CY6A 3ICTA 2E4GA 2EQ8A 2IIDA 4HA6A 3AE8A 4WX1A 5ER0A 1L0VA 3K7MX 1KNPA 1NHQA 4JNAA 1OJAA 1OJ9A 2V5ZA 2R4JA 3CNDA 4D03A 1GRGA 4JQ9A 3CTYA 4RG4A 3URHA 1ZK7A 4H4XA 3AE6A 4GDEA 5KMRA 1GRBA 3BI5A 1F8WA 2BS3A 4YSYA 4Z43A 2NVKX 4CNJA 4J34A 2E5VA 2PYXA 3KKJA 4PAAA 3SYIA 5KXJA 3NKSA 1E6EA 3DK8A 5L46A 2FJBA 1K0LA 1YKJA 2X3NA 2YM1A 1ZMCA 3F8RA 4DGKA 2R4EA 4A79A 4GDPA 4TM0A 4U2SA 1GRHA 3AYJA 2CDUA 2XVJA 3CPJG 2YM2A 2R9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJD A;  1HYU A;  1GRT A;  3GYI A;  2XLS A;  2VRM A;  4U8P A;  2DKI A;  3G5S A;  3NNE A;  3F8D A;  5KOW A;  3S61 A;  3V3O A;  2EQ9 A;  4C74 A;  3GWD A;  4NZH A;  1KFY A;  4UP3 A;  2BK3 A;  1DOC A;  1IUT A;  3Q6J A;  2BAB A;  2CFY A;  2X8C A;  3LOV A;  4CNK A;  2XVF A;  4N9X A;  4H4R A;  4O5Q A;  4OPT A;  2X99 A;  3AB1 A;  3B3R A;  3QFB A;  4UDQ A;  3VQR A;  2V60 A;  3ATQ A;  4C3X A;  4TM3 A;  1NG4 A;  2XYO A;  3S5W A;  1CHU A;  2RGJ A;  4Z2T A;  2Z5Y A;  4JNQ A;  1Y56 A;  1ZOV A;  3AEE A;  3LAD A;  4K8D A;  5JCL A;  1H6V A;  4REK A;  5KOX A;  1PS9 A;  4XWR A;  3CGC A;  3AEB A;  4H4W A;  4EQX A;  4Y4L A;  4OVI A;  1KF6 A;  1P2H A;  2WHD A;  4H4Y A;  3ZYX A;  2B9X A;  5GSN A;  2R46 A;  2AR8 A;  4AP3 A;  4Y4N A;  4RSL A;  3AEF A;  4YTN A;  1PN0 A;  3NN6 X;  4O5U A;  3IC9 A;  4OPL A;  1MOK A;  4IV9 A;  3P4S A;  2GVC A;  1VRQ B;  2VQ7 A;  1ELI A;  2VZ2 A;  1TYP A;  1V59 A;  2WBA A;  1TRB A;  2X8G A;  1LJ1 A;  3KPF A;  4OPG A;  4BUR A;  1D4C A;  3EPT A;  3P9U A;  3E1T A;  4M52 A;  1YQ4 A;  2OLO A;  2WPF A;  2QA1 A;  4CCR A;  3DGZ A;  4H2P A;  3CNS A;  2YLZ A;  1BWC A;  2NPX A;  4K22 A;  1XAN A;  4Z25 A;  3AD9 B;  1VG0 A;  1H81 A;  1N4U A;  4HB9 A;  3GD3 A;  1CL0 A;  4TLZ A;  1GET A;  3O0H A;  2Y6R A;  1FCD A;  2B7S A;  3DK9 A;  4GRT A;  5DBJ A;  3ALL A;  1PBB A;  1SEZ A;  1XDI A;  1LVL A;  1NEK A;  1BZL A;  2VOU A;  4X9N A;  1PJ7 A;  3KD9 A;  1PBC A;  3VR8 A;  5KRQ A;  4YTP A;  1FEA A;  1KSU A;  4ZCD A;  2JB2 A;  1JNZ A;  2R0P A;  1M6I A;  1JU2 A;  2QCU A;  2YG5 A;  3NG7 X;  4A65 A;  1OJT A;  4OPI A;  1S3B A;  5U25 A;  3SQP A;  2C72 A;  3DK4 A;  2C73 A;  3AE3 A;  4U8K A;  2BCG G;  1QO8 A;  2WP9 A;  2C67 A;  4YSH A;  1K0J A;  5JCN A;  1DOE A;  2XFO A;  1GRA A;  3L1R A;  5J7X A;  3ALJ A;  4NTC A;  2IVE A;  3PO7 A;  3AE9 A;  4ICY A;  1L9E A;  4YT0 A;  2C70 A;  1CC2 A;  2WPE A;  1EL8 A;  1Y0P A;  3QFA A;  3LXD A;  3M12 A;  5JCK A;  4NEV A;  1CJ3 A;  1NG3 A;  5FS7 A;  4APN A;  5M0Z A;  4U8N A;  1PXB A;  1ZMD A;  3QVR A;  3NRN A;  4U8J A;  4UDP A;  3UP4 A;  4YWO A;  1ZKQ A;  2QAE A;  1DXL A;  1KNR A;  4XXG A;  3UKQ A;  2GR3 A;  2CUL A;  3GRT A;  3RP6 A;  2BA9 A;  1D4E A;  4A99 A;  2XLU A;  5CQF A;  2XDO A;  4GCM A;  4B64 A;  1TDN A;  2YVG A;  5BUL A;  2XFN A;  1ZY8 A;  3KA7 A;  4J56 A;  4J33 A;  4OCG A;  1K4Q A;  1KSS A;  3BI2 A;  1PDH A;  1XPQ A;  3AE4 A;  4U2T A;  3VRD B;  5HYM A;  1F3P A;  3C4A A;  2YLT A;  1LTX R;  5BRT A;  3NHO X;  1KDG A;  4OPC A;  1GES A;  1VG9 A;  4H2R A;  1DOB A;  2Q6U A;  4U8M A;  1H86 A;  1TDE A;  2OLN A;  5IPY A;  2YVF A;  1CJC A;  1QLB A;  3UTE A;  4EQR A;  2GF3 A;  2XFQ A;  3VR9 A;  3NYE A;  4DNA A;  4IVM B;  4I58 A;  5KVI A;  3NK0 X;  2BK5 A;  2GR1 A;  3LZW A;  4B67 A;  2ACZ A;  3FIM B;  4EIQ A;  1NDA A;  3GMB A;  1E1N A;  4RG3 A;  2J3N A;  2R0G A;  1E1M A;  5JCM A;  1RP0 A;  4YKG A;  2JB1 A;  2XLR A;  1TDK A;  3GD4 A;  3NT6 A;  5HXI A;  2ZBW A;  3AEA A;  5GRT A;  3AD8 B;  2H89 A;  3AE5 A;  4FK1 A;  2X50 A;  2WEU A;  3CPH G;  4ZN0 A;  4USR A;  1B37 A;  1PHH A;  4D04 A;  3IHM A;  4B68 A;  4X4J A;  4AT0 A;  2VVL G;  1GND A;  3OC4 A;  4EMJ A;  3AXB A;  1PJ5 A;  4I59 A;  2RGO A;  1OJC A;  1FEB A;  3CN8 A;  1H83 A;  1JOA A;  1NAA A;  3ITJ A;  4BK2 A;  5JCI A;  2X8H A;  4C5O A;  3NYC A;  3G5Q A;  3AE7 A;  1GER A;  4GR1 A;  2YR5 A;  5C2T A;  2GQW A;  1FOH A;  4Z2R A;  2YG6 A;  1X31 B;  2WET A;  4K2X A;  3RNM A;  3UOY A;  1L9C A;  1JRZ A;  2C3D A;  4EIP A;  1PBE A;  1B4V A;  2VQB A;  3ALM A;  4PAB A;  1FEC A;  2PHH A;  2JB3 A;  3UKA A;  2R0C A;  3SM8 A;  3B6D A;  2C64 A;  2XVI A;  4CRT A;  2I0Z A;  3FBS A;  3RED A;  2C7G A;  2WU2 A;  4YKF A;  3NTD A;  4KX6 A;  3UOV A;  3P1W A;  5IQ1 A;  4U8I A;  4NEW A;  4CY8 A;  1BKW A;  1GAL A;  3I6D A;  4IA5 A;  4USQ A;  2YQU A;  3BHK A;  4ECH A;  1H82 A;  1S2Q A;  1GEU A;  3C4N A;  1NEN A;  4IA6 A;  4NTD A;  5KWF A;  5EBK A;  4EMI A;  3NTA A;  3AE1 A;  3FG2 P;  2BXS A;  3AE2 A;  3LB8 A;  3K7Q X;  3KVE A;  3SFE A;  4H4Q A;  5U1O A;  4AOX A;  2WES A;  3KLJ A;  3FPZ A;  1F8S A;  1BGJ A;  4Z26 A;  4JY2 A;  3UKK A;  4BK3 A;  2VVL A;  3COX A;  4XWZ A;  1EL9 A;  1L9D A;  2C76 A;  3BHF A;  3D8X A;  4J57 A;  3RHA A;  1Q9I A;  3EAO A;  5FS9 A;  2RGH A;  2AAQ A;  4BK1 A;  4Z44 A;  4B69 A;  2EQ6 A;  3K30 A;  1O94 A;  2TPR A;  4ZCC A;  2QA2 A;  3BI4 A;  2WOV A;  2FBW A;  2GMJ A;  2WQY A;  4A6N A;  4EQS A;  3M13 A;  2BYB A;  2XFU A;  1GT8 A;  3EAN A;  3UKH A;  1BGN A;  4H4T A;  3NLC A;  4U8L A;  1GRF A;  2Q0K A;  1S3E A;  3UOX A;  2JBV A;  1CJ4 A;  2GH5 A;  2ARD A;  1XHC A;  2B76 A;  2WP6 A;  4C3Y A;  2APG A;  1CC4 A;  1K0I A;  3G5R A;  4B66 A;  1E7P A;  1F8R A;  3CPI G;  4H7U A;  2B7R A;  3CIR A;  3BNU A;  3RP8 A;  4B1B A;  4C77 A;  3FMW A;  2BS4 A;  2TMD A;  1MO9 A;  1LQT A;  1Y56 B;  3GMC A;  4J36 A;  1YQ3 A;  2UZZ A;  1LPF A;  2YR4 A;  1FL2 A;  3CNJ A;  4K5R A;  5HHF A;  4YSZ A;  1YY5 A;  2JAE A;  1RSG A;  5HY5 A;  4IVO B;  4OPU A;  1ONF A;  3H8I A;  2YWL A;  2E1M A;  1DJN A;  3CGD A;  4X9M A;  3C96 A;  3QSE A;  2XCG A;  5J60 A;  3HZL A;  1GV4 A;  1E1K A;  2RAB A;  3V76 A;  2EQ7 A;  5FS6 A;  2BS2 A;  3H4K A;  4A9W A;  2AQJ A;  4E0V A;  2OA1 A;  1RYI A;  3IHG A;  3QSM A;  1LV0 A;  3QVP A;  4OPD A;  4TM1 A;  4H4U A;  4YTM A;  2GR2 A;  1D5T A;  3WE0 A;  2OAL A;  4EM4 A;  2XLT A;  4NTE A;  2ZZB A;  3CNP A;  3NIX A;  3GWF A;  2GR0 A;  5EB4 A;  2YG4 A;  2WDV A;  1Z6L A;  4B63 A;  3GSI A;  4Z24 A;  2CVJ A;  1H84 A;  3PS9 A;  4K7Z A;  2GV8 A;  3II4 A;  5EB5 A;  1DOD A;  3DJE A;  4H4P A;  3GYJ A;  1NHP A;  2WPC A;  2GMH A;  1PXC A;  1ZDL A;  2JK6 A;  3F8P A;  4Y4M A;  3K7T A;  2A89 A;  1CBO A;  2IVD A;  3V3N A;  2WOW A;  3H8L A;  5BVA A;  1EL5 A;  3DME A;  1F6M A;  1IJH A;  2C66 A;  4KPR A;  2VRL A;  3AD7 B;  3GDP A;  4H4S A;  2XVH A;  1M64 A;  2F5Z A;  4H4Z A;  2GRT A;  3CGB A;  5M10 A;  2YG3 A;  3DH9 A;  3NGC X;  3P4Q A;  4UDR A;  3QSS A;  1JRX A;  1W4X A;  3ZDN A;  3VRA A;  5TR3 A;  4H2Q A;  2BC1 A;  2WU5 A;  3AYI A;  4J31 A;  5LV9 A;  1TYT A;  3LJP A;  4TM4 A;  1O95 A;  1E39 A;  2A87 A;  1COY A;  2GAH B;  3UP5 A;  3CGE A;  2B9Y A;  3JSK A;  2FJE A;  3NYF A;  1S2Y A;  1H7W A;  4AT2 A;  3UKF A;  4A6N B;  1O5W A;  2WOI A;  2A8X A;  3NK2 X;  1D7L A;  3PVC A;  4H2N A;  1CJ2 A;  1CC6 A;  2C65 A;  1ZOY A;  3DJG X;  1LQU A;  3LZX A;  3ABV A;  4FX9 A;  1EBD A;  3P4P A;  1AOG A;  3CNT A;  3I3L A;  1DJQ A;  4H50 A;  4P9S A;  4EQW A;  2V61 A;  2YG7 A;  1BF3 A;  1JEH A;  2O9Z A;  4ADW A;  3ATR A;  3SGL A;  3UOZ A;  2YVJ A;  1GPE A;  3L8K A;  1D4D A;  3T37 A;  2YR6 A;  2YLR A;  3UTH A;  1N4V A;  2VVM A;  3DA1 A;  4AOS A;  2GAG B;  3NN0 X;  3R9U A;  1UKV G;  3EF6 A;  4U8O A;  3UKP A;  5IQ4 A;  2BAC A;  1GTE A;  1B5Q A;  1GRE A;  2BC0 A;  2V6O A;  2YLX A;  2ZZC A;  4CCQ A;  1D7Y A;  1P2E A;  5BUK A;  4EMW A;  3UTF A;  1GSN A;  3M0O A;  4A5L A;  4DSH A;  1NPX A;  2WS3 A;  1TDF A;  1IUX A;  5EOW A;  4A7A A;  4JN9 A;  3BNM A;  1IUU A;  2WDQ A;  3P4R A;  1NHR A;  1OJD A;  1IUS A;  2HQM A;  3AWI A;  4BJY A;  4DSG A;  4K5S A;  2YLW A;  2XLP A;  5FMH A;  1JNR A;  4GF7 A;  2H88 A;  4EM3 A;  2WP5 A;  2V3B A;  2W0H A;  1DNC A;  1MXT A;  1H7X A;  3UCL A;  2C75 A;  5KVH A;  4MJW A;  1PJ6 A;  3AEG A;  4WCT A;  1CF3 A;  5U63 A;  4GUV A;  3NK1 X;  1TDO A;  3AYL A;  2XFP A;  1YQZ A;  2Y6Q A;  1PBF A;  3KU9 A;  1PXA A;  2YLS A;  4FK1 C;  1JRY A;  1ZX9 A;  3IF9 A;  3UKL A;  3UTG A;  4Z2U A;  2GQF A;  4FDC B;  1IUV A;  4AP1 A;  4YXD A;  3ICR A;  1N1P A;  3QJ4 A;  1B8S A;  2XVE A;  4LA1 A;  4U2L A;  1EL7 A;  1GXF A;  2DKH A;  2V3A A;  2ZZ0 A;  3DJD A;  3ICS A;  4BV6 A;  1ZP0 A;  2Z5X A;  3ADA B;  3GDN A;  4TLX A;  2GB0 A;  2OAM A;  3ISH A;  3AEC A;  4JY3 A;  3IWA A;  4BJZ A;  5CKU A;  2BK4 A;  1IUW A;  1GTH A;  1Q1W A;  2WDR A;  3DGH A;  2C3C A;  2B9W A;  3NH3 X;  1GOS A;  4J2W A;  3D1C A;  1NHS A;  2YAU A;  3OZ2 A;  5FS8 A;  3RP7 A;  2FJA A;  3VRB A;  4CBQ A;  1E1L A;  2BCP A;  4LII A;  1VDC A;  3Q9T A;  3GRS A;  3SFD A;  4H4V A;  2GEW A;  2JKC A;  2Q7V A;  3DJJ A;  1REO A;  2FJD A;  4YSX A;  2R45 A;  1PBD A;  1VQW A;  4LU6 A;  2BXR A;  5C3J A;  4B65 A;  2Q0L A;  3AED A;  1Q1R A;  4JDR A;  1N4W A;  4CY6 A;  3ICT A;  2E4G A;  2EQ8 A;  2IID A;  4HA6 A;  3AE8 A;  4WX1 A;  5ER0 A;  1L0V A;  3K7M X;  1KNP A;  1NHQ A;  4JNA A;  1OJA A;  1OJ9 A;  2V5Z A;  2R4J A;  3CND A;  4D03 A;  1GRG A;  4JQ9 A;  3CTY A;  4RG4 A;  3URH A;  1ZK7 A;  4H4X A;  3AE6 A;  4GDE A;  1GRB A;  3BI5 A;  1F8W A;  2BS3 A;  4YSY A;  4Z43 A;  2NVK X;  4CNJ A;  4J34 A;  2E5V A;  2PYX A;  3KKJ A;  4PAA A;  5KXJ A;  3NKS A;  1E6E A;  3DK8 A;  5L46 A;  2FJB A;  1K0L A;  1YKJ A;  2X3N A;  2YM1 A;  1ZMC A;  3F8R A;  4DGK A;  2R4E A;  4A79 A;  4GDP A;  4TM0 A;  4U2S A;  1GRH A;  3AYJ A;  2CDU A;  2XVJ A;  3CPJ G;  2YM2 A;  2R9Z A; 
#chains in the Genus database with same CATH topology
 1QJD A;  1HYU A;  1GRT A;  3GYI A;  2XLS A;  2VRM A;  4U8P A;  2DKI A;  3G5S A;  5KMP A;  3NNE A;  3F8D A;  5KOW A;  3S61 A;  3V3O A;  2EQ9 A;  4C74 A;  3GWD A;  4NZH A;  1KFY A;  4UP3 A;  2BK3 A;  1DOC A;  1IUT A;  3Q6J A;  2BAB A;  2CFY A;  2X8C A;  3KPK A;  3LOV A;  4CNK A;  2XVF A;  4N9X A;  4H4R A;  4O5Q A;  4OPT A;  2X99 A;  3AB1 A;  3B3R A;  3QFB A;  4UDQ A;  3VQR A;  2V60 A;  3HYV A;  3ATQ A;  4C3X A;  4TM3 A;  1NG4 A;  2XYO A;  3S5W A;  1CHU A;  2RGJ A;  4Z2T A;  2Z5Y A;  4JNQ A;  3SX6 A;  1Y56 A;  1ZOV A;  3AEE A;  3LAD A;  4K8D A;  5JCL A;  1H6V A;  4REK A;  5KOX A;  1PS9 A;  4XWR A;  3CGC A;  3AEB A;  4H4W A;  4EQX A;  4Y4L A;  4OVI A;  1KF6 A;  1P2H A;  2WHD A;  4H4Y A;  3ZYX A;  2B9X A;  5GSN A;  2R46 A;  2AR8 A;  4AP3 A;  4Y4N A;  4RSL A;  3AEF A;  4YTN A;  1PN0 A;  3NN6 X;  4O5U A;  3IC9 A;  4OPL A;  1MOK A;  4IV9 A;  3P4S A;  2GVC A;  1VRQ B;  2VQ7 A;  1ELI A;  2VZ2 A;  1TYP A;  1V59 A;  2WBA A;  1TRB A;  2X8G A;  1LJ1 A;  3KPF A;  4G74 A;  4OPG A;  4BUR A;  1D4C A;  3EPT A;  3P9U A;  3E1T A;  4M52 A;  1YQ4 A;  2OLO A;  2WPF A;  2QA1 A;  4CCR A;  3DGZ A;  4H2P A;  3CNS A;  2YLZ A;  1BWC A;  2NPX A;  4K22 A;  1XAN A;  4Z25 A;  3AD9 B;  1VG0 A;  1H81 A;  1N4U A;  4HB9 A;  3GD3 A;  1CL0 A;  4TLZ A;  1GET A;  3O0H A;  2Y6R A;  1FCD A;  2B7S A;  3DK9 A;  4GRT A;  5DBJ A;  3ALL A;  1PBB A;  1SEZ A;  1XDI A;  1LVL A;  1NEK A;  1BZL A;  2VOU A;  4X9N A;  1PJ7 A;  3KD9 A;  1PBC A;  3VR8 A;  5KRQ A;  4YTP A;  1FEA A;  1KSU A;  4ZCD A;  2JB2 A;  1JNZ A;  2R0P A;  1M6I A;  1JU2 A;  2QCU A;  2YG5 A;  3NG7 X;  4A65 A;  1OJT A;  4OPI A;  1S3B A;  5U25 A;  3SQP A;  2C72 A;  3DK4 A;  2C73 A;  3AE3 A;  4U8K A;  2BCG G;  1QO8 A;  2WP9 A;  2C67 A;  4YSH A;  1K0J A;  5JCN A;  1DOE A;  2XFO A;  1GRA A;  3L1R A;  5J7X A;  3ALJ A;  4NTC A;  2IVE A;  3PO7 A;  3AE9 A;  4ICY A;  1L9E A;  4YT0 A;  2C70 A;  1CC2 A;  2WPE A;  1EL8 A;  1Y0P A;  3QFA A;  3LXD A;  3M12 A;  5JCK A;  4NEV A;  1CJ3 A;  1NG3 A;  5FS7 A;  4APN A;  5M0Z A;  4U8N A;  1PXB A;  1ZMD A;  3QVR A;  3NRN A;  4U8J A;  4UDP A;  3UP4 A;  4YWO A;  1ZKQ A;  2QAE A;  1DXL A;  1KNR A;  3HYX A;  4XXG A;  3UKQ A;  2GR3 A;  2CUL A;  3GRT A;  3RP6 A;  2BA9 A;  1D4E A;  4A99 A;  2XLU A;  5CQF A;  2XDO A;  4GCM A;  4B64 A;  3SZW A;  5KMQ A;  1TDN A;  2YVG A;  5BUL A;  2XFN A;  1ZY8 A;  3KA7 A;  4J56 A;  4J33 A;  4OCG A;  1K4Q A;  1KSS A;  3BI2 A;  1PDH A;  1XPQ A;  3AE4 A;  4U2T A;  3VRD B;  5HYM A;  1F3P A;  3C4A A;  2YLT A;  1LTX R;  5BRT A;  3NHO X;  1KDG A;  4OPC A;  1GES A;  1VG9 A;  4H2R A;  1DOB A;  2Q6U A;  4U8M A;  1H86 A;  1TDE A;  2OLN A;  5IPY A;  2YVF A;  1CJC A;  1QLB A;  3UTE A;  4EQR A;  2GF3 A;  2XFQ A;  3VR9 A;  3NYE A;  4DNA A;  4IVM B;  4I58 A;  5KVI A;  3NK0 X;  2BK5 A;  2GR1 A;  3LZW A;  4B67 A;  2ACZ A;  3FIM B;  4EIQ A;  1NDA A;  3GMB A;  1E1N A;  3HYW A;  4RG3 A;  2J3N A;  2R0G A;  2BRY A;  1E1M A;  5JCM A;  1RP0 A;  4YKG A;  2JB1 A;  2XLR A;  1TDK A;  3GD4 A;  3NT6 A;  5HXI A;  2ZBW A;  3AEA A;  5GRT A;  3AD8 B;  2H89 A;  3AE5 A;  4FK1 A;  2X50 A;  2WEU A;  3CPH G;  3T14 A;  4ZN0 A;  4USR A;  1B37 A;  1PHH A;  4D04 A;  3IHM A;  4B68 A;  4X4J A;  4AT0 A;  2VVL G;  1GND A;  3OC4 A;  4EMJ A;  3AXB A;  3T0K A;  1PJ5 A;  4I59 A;  2RGO A;  1OJC A;  1FEB A;  3CN8 A;  1H83 A;  3SZF A;  1JOA A;  1NAA A;  3ITJ A;  4BK2 A;  5JCI A;  2X8H A;  4C5O A;  3NYC A;  3G5Q A;  3AE7 A;  1GER A;  4GR1 A;  2YR5 A;  5C2T A;  2GQW A;  1FOH A;  4Z2R A;  2YG6 A;  1X31 B;  2WET A;  4K2X A;  4G9K A;  3RNM A;  3UOY A;  1L9C A;  1JRZ A;  2C3D A;  4EIP A;  1PBE A;  4NWZ A;  1B4V A;  2VQB A;  3ALM A;  4PAB A;  3SY4 A;  1FEC A;  2PHH A;  2JB3 A;  3UKA A;  2R0C A;  3SM8 A;  3B6D A;  5KNL A;  2C64 A;  2XVI A;  4CRT A;  2I0Z A;  3FBS A;  3RED A;  4GAP A;  2C7G A;  2WU2 A;  4YKF A;  3NTD A;  4KX6 A;  3UOV A;  3P1W A;  5IQ1 A;  4U8I A;  4NEW A;  4CY8 A;  1BKW A;  1GAL A;  3I6D A;  4IA5 A;  4USQ A;  2YQU A;  3BHK A;  4ECH A;  1H82 A;  1S2Q A;  1GEU A;  3C4N A;  1NEN A;  4IA6 A;  4NTD A;  5KWF A;  5EBK A;  4EMI A;  3NTA A;  3AE1 A;  3FG2 P;  2BXS A;  3AE2 A;  3LB8 A;  3K7Q X;  3KVE A;  3SFE A;  4H4Q A;  5U1O A;  4AOX A;  2WES A;  3KLJ A;  3FPZ A;  1F8S A;  1BGJ A;  4Z26 A;  4JY2 A;  3UKK A;  4BK3 A;  2VVL A;  3COX A;  4XWZ A;  1EL9 A;  1L9D A;  2C76 A;  3BHF A;  3D8X A;  4J57 A;  3RHA A;  1Q9I A;  3EAO A;  5FS9 A;  2RGH A;  2AAQ A;  4BK1 A;  4Z44 A;  4B69 A;  2EQ6 A;  3K30 A;  1O94 A;  2TPR A;  4ZCC A;  2QA2 A;  3BI4 A;  2WOV A;  2FBW A;  2GMJ A;  2WQY A;  4A6N A;  4EQS A;  3M13 A;  2BYB A;  2XFU A;  1GT8 A;  3EAN A;  3UKH A;  1BGN A;  4H4T A;  3NLC A;  4U8L A;  1GRF A;  2Q0K A;  1S3E A;  3UOX A;  2JBV A;  1CJ4 A;  2GH5 A;  2ARD A;  1XHC A;  2B76 A;  2WP6 A;  4C3Y A;  2APG A;  1CC4 A;  1K0I A;  3G5R A;  4B66 A;  1E7P A;  1F8R A;  3CPI G;  4H7U A;  2B7R A;  3CIR A;  3BNU A;  3RP8 A;  4B1B A;  4C77 A;  3FMW A;  2BS4 A;  2TMD A;  1MO9 A;  1LQT A;  1Y56 B;  3GMC A;  4J36 A;  1YQ3 A;  2UZZ A;  1LPF A;  2YR4 A;  1FL2 A;  3CNJ A;  4K5R A;  5HHF A;  4YSZ A;  1YY5 A;  2JAE A;  1RSG A;  5HY5 A;  4IVO B;  4OPU A;  1ONF A;  3H8I A;  2YWL A;  2E1M A;  1DJN A;  3CGD A;  4X9M A;  3C96 A;  3QSE A;  2XCG A;  5J60 A;  3HZL A;  1GV4 A;  1E1K A;  2RAB A;  3V76 A;  2EQ7 A;  5FS6 A;  2BS2 A;  3H4K A;  4A9W A;  2AQJ A;  3GYX A;  4E0V A;  4II3 A;  2OA1 A;  1RYI A;  3IHG A;  3QSM A;  1LV0 A;  3QVP A;  4OPD A;  4TM1 A;  4H4U A;  4YTM A;  2GR2 A;  1D5T A;  3WE0 A;  2OAL A;  4EM4 A;  2XLT A;  4NTE A;  2ZZB A;  3CNP A;  3NIX A;  3GWF A;  2GR0 A;  5EB4 A;  2YG4 A;  2WDV A;  1Z6L A;  4B63 A;  3GSI A;  4Z24 A;  2CVJ A;  1H84 A;  3PS9 A;  3CMM A;  2GV8 A;  3II4 A;  4K7Z A;  5EB5 A;  1DOD A;  3DJE A;  4H4P A;  3GYJ A;  1NHP A;  2WPC A;  2GMH A;  3T2K A;  3T2Z A;  1PXC A;  1ZDL A;  2C4C A;  2JK6 A;  3F8P A;  4Y4M A;  3K7T A;  2A89 A;  1CBO A;  2IVD A;  3V3N A;  2WOW A;  3H8L A;  5BVA A;  1EL5 A;  3DME A;  1F6M A;  1IJH A;  2C66 A;  4KPR A;  2VRL A;  3AD7 B;  3GDP A;  4H4S A;  2XVH A;  1M64 A;  2F5Z A;  4H4Z A;  2GRT A;  3CGB A;  5M10 A;  2YG3 A;  2BRA A;  3DH9 A;  3NGC X;  3P4Q A;  4G73 A;  4UDR A;  3QSS A;  1JRX A;  1W4X A;  3ZDN A;  3VRA A;  5TR3 A;  4G6H A;  4H2Q A;  2BC1 A;  2WU5 A;  3AYI A;  4J31 A;  5LV9 A;  1TYT A;  3LJP A;  4TM4 A;  1O95 A;  1E39 A;  2A87 A;  1COY A;  2GAH B;  3UP5 A;  3CGE A;  2B9Y A;  3JSK A;  3SXI A;  2FJE A;  3NYF A;  1S2Y A;  1H7W A;  4AT2 A;  3UKF A;  4A6N B;  1O5W A;  2WOI A;  2A8X A;  3NK2 X;  1D7L A;  3PVC A;  4H2N A;  1CJ2 A;  1CC6 A;  2C65 A;  1ZOY A;  3DJG X;  1LQU A;  3LZX A;  3ABV A;  4FX9 A;  1EBD A;  3P4P A;  1AOG A;  3CNT A;  3I3L A;  1DJQ A;  4H50 A;  4P9S A;  4EQW A;  2V61 A;  2YG7 A;  1BF3 A;  1JEH A;  2O9Z A;  4ADW A;  3ATR A;  3SGL A;  3UOZ A;  2YVJ A;  1GPE A;  3L8K A;  1D4D A;  3T37 A;  2YR6 A;  3T31 A;  2YLR A;  3UTH A;  1N4V A;  2VVM A;  3DA1 A;  4AOS A;  2GAG B;  3NN0 X;  3R9U A;  1UKV G;  3EF6 A;  4U8O A;  3UKP A;  5IQ4 A;  2BAC A;  1GTE A;  1B5Q A;  1GRE A;  2BC0 A;  2V6O A;  2YLX A;  2ZZC A;  4CCQ A;  1D7Y A;  1P2E A;  5BUK A;  4EMW A;  3UTF A;  1GSN A;  3M0O A;  4NNJ A;  4A5L A;  4DSH A;  1NPX A;  2WS3 A;  5KMS A;  1TDF A;  1IUX A;  5EOW A;  4A7A A;  4JN9 A;  3BNM A;  1IUU A;  2WDQ A;  3P4R A;  1NHR A;  1OJD A;  1IUS A;  2HQM A;  3AWI A;  4BJY A;  4DSG A;  4K5S A;  2YLW A;  2XLP A;  5FMH A;  1JNR A;  4GF7 A;  2H88 A;  3T2Y A;  4EM3 A;  2WP5 A;  2V3B A;  2W0H A;  1DNC A;  1MXT A;  1H7X A;  3UCL A;  2C75 A;  5KVH A;  4MJW A;  1PJ6 A;  3AEG A;  4WCT A;  1CF3 A;  5U63 A;  4GUV A;  3NK1 X;  1TDO A;  3AYL A;  2XFP A;  1YQZ A;  2Y6Q A;  1PBF A;  3KU9 A;  1PXA A;  2YLS A;  4FK1 C;  1JRY A;  1ZX9 A;  3IF9 A;  3UKL A;  3UTG A;  4GAV A;  4Z2U A;  2GQF A;  4FDC B;  1IUV A;  4G6G A;  4AP1 A;  4YXD A;  3ICR A;  1N1P A;  4II2 A;  3QJ4 A;  1B8S A;  2XVE A;  4LA1 A;  4U2L A;  1EL7 A;  1GXF A;  2DKH A;  2V3A A;  2ZZ0 A;  3DJD A;  3ICS A;  4BV6 A;  1ZP0 A;  2Z5X A;  3ADA B;  3GDN A;  4TLX A;  2GB0 A;  2OAM A;  3SZC A;  3ISH A;  3AEC A;  4JY3 A;  3IWA A;  4BJZ A;  5CKU A;  2BK4 A;  1IUW A;  1GTH A;  1Q1W A;  2WDR A;  3DGH A;  2C3C A;  2B9W A;  3NH3 X;  1GOS A;  4J2W A;  3D1C A;  1NHS A;  2YAU A;  3OZ2 A;  3SZ0 A;  5FS8 A;  3RP7 A;  2FJA A;  3VRB A;  4CBQ A;  1E1L A;  2BCP A;  4LII A;  1VDC A;  3Q9T A;  3GRS A;  3SFD A;  4H4V A;  2GEW A;  2JKC A;  2Q7V A;  3DJJ A;  1REO A;  2FJD A;  4YSX A;  2R45 A;  1PBD A;  1VQW A;  4LU6 A;  2BXR A;  5C3J A;  4B65 A;  2Q0L A;  3AED A;  1Q1R A;  4JDR A;  1N4W A;  4CY6 A;  3ICT A;  2E4G A;  2EQ8 A;  2IID A;  4HA6 A;  3AE8 A;  4WX1 A;  5ER0 A;  1L0V A;  3K7M X;  1KNP A;  1NHQ A;  4JNA A;  1OJA A;  1OJ9 A;  2V5Z A;  2R4J A;  3CND A;  4D03 A;  1GRG A;  4JQ9 A;  3CTY A;  4RG4 A;  3URH A;  1ZK7 A;  4H4X A;  3AE6 A;  4GDE A;  5KMR A;  1GRB A;  3BI5 A;  1F8W A;  2BS3 A;  4YSY A;  4Z43 A;  2NVK X;  4CNJ A;  4J34 A;  2E5V A;  2PYX A;  3KKJ A;  4PAA A;  3SYI A;  5KXJ A;  3NKS A;  1E6E A;  3DK8 A;  5L46 A;  2FJB A;  1K0L A;  1YKJ A;  2X3N A;  2YM1 A;  1ZMC A;  3F8R A;  4DGK A;  2R4E A;  4A79 A;  4GDP A;  4TM0 A;  4U2S A;  1GRH A;  3AYJ A;  2CDU A;  2XVJ A;  3CPJ G;  2YM2 A;  2R9Z A; 
#chains in the Genus database with same CATH homology
 1QJD A;  1HYU A;  1GRT A;  3GYI A;  2XLS A;  2VRM A;  4U8P A;  2DKI A;  3G5S A;  5KMP A;  3NNE A;  3F8D A;  5KOW A;  3S61 A;  3V3O A;  2EQ9 A;  4C74 A;  3GWD A;  4NZH A;  1KFY A;  4UP3 A;  2BK3 A;  1DOC A;  1IUT A;  3Q6J A;  2BAB A;  2CFY A;  2X8C A;  3KPK A;  3LOV A;  4CNK A;  2XVF A;  4N9X A;  4H4R A;  4O5Q A;  4OPT A;  2X99 A;  3AB1 A;  3B3R A;  3QFB A;  4UDQ A;  3VQR A;  2V60 A;  3HYV A;  3ATQ A;  4C3X A;  4TM3 A;  1NG4 A;  2XYO A;  3S5W A;  1CHU A;  2RGJ A;  4Z2T A;  2Z5Y A;  4JNQ A;  3SX6 A;  1Y56 A;  1ZOV A;  3AEE A;  3LAD A;  4K8D A;  5JCL A;  1H6V A;  4REK A;  5KOX A;  1PS9 A;  4XWR A;  3CGC A;  3AEB A;  4H4W A;  4EQX A;  4Y4L A;  4OVI A;  1KF6 A;  1P2H A;  2WHD A;  4H4Y A;  3ZYX A;  2B9X A;  5GSN A;  2R46 A;  2AR8 A;  4AP3 A;  4Y4N A;  4RSL A;  3AEF A;  4YTN A;  1PN0 A;  3NN6 X;  4O5U A;  3IC9 A;  4OPL A;  1MOK A;  4IV9 A;  3P4S A;  2GVC A;  1VRQ B;  2VQ7 A;  1ELI A;  2VZ2 A;  1TYP A;  1V59 A;  2WBA A;  1TRB A;  2X8G A;  1LJ1 A;  3KPF A;  4G74 A;  4OPG A;  4BUR A;  1D4C A;  3EPT A;  3P9U A;  3E1T A;  4M52 A;  1YQ4 A;  2OLO A;  2WPF A;  2QA1 A;  4CCR A;  3DGZ A;  4H2P A;  3CNS A;  2YLZ A;  1BWC A;  2NPX A;  4K22 A;  1XAN A;  4Z25 A;  3AD9 B;  1VG0 A;  1H81 A;  1N4U A;  4HB9 A;  3GD3 A;  1CL0 A;  4TLZ A;  1GET A;  3O0H A;  2Y6R A;  1FCD A;  2B7S A;  3DK9 A;  4GRT A;  5DBJ A;  3ALL A;  1PBB A;  1SEZ A;  1XDI A;  1LVL A;  1NEK A;  1BZL A;  2VOU A;  4X9N A;  1PJ7 A;  3KD9 A;  1PBC A;  3VR8 A;  5KRQ A;  4YTP A;  1FEA A;  1KSU A;  4ZCD A;  2JB2 A;  1JNZ A;  2R0P A;  1M6I A;  1JU2 A;  2QCU A;  2YG5 A;  3NG7 X;  4A65 A;  1OJT A;  4OPI A;  1S3B A;  5U25 A;  3SQP A;  2C72 A;  3DK4 A;  2C73 A;  3AE3 A;  4U8K A;  2BCG G;  1QO8 A;  2WP9 A;  2C67 A;  4YSH A;  1K0J A;  5JCN A;  1DOE A;  2XFO A;  1GRA A;  3L1R A;  5J7X A;  3ALJ A;  4NTC A;  2IVE A;  3PO7 A;  3AE9 A;  4ICY A;  1L9E A;  4YT0 A;  2C70 A;  1CC2 A;  2WPE A;  1EL8 A;  1Y0P A;  3QFA A;  3LXD A;  3M12 A;  5JCK A;  4NEV A;  1CJ3 A;  1NG3 A;  5FS7 A;  4APN A;  5M0Z A;  4U8N A;  1PXB A;  1ZMD A;  3QVR A;  3NRN A;  4U8J A;  4UDP A;  3UP4 A;  4YWO A;  1ZKQ A;  2QAE A;  1DXL A;  1KNR A;  3HYX A;  4XXG A;  3UKQ A;  2GR3 A;  2CUL A;  3GRT A;  3RP6 A;  2BA9 A;  1D4E A;  4A99 A;  2XLU A;  5CQF A;  2XDO A;  4GCM A;  4B64 A;  3SZW A;  5KMQ A;  1TDN A;  2YVG A;  5BUL A;  2XFN A;  1ZY8 A;  3KA7 A;  4J56 A;  4J33 A;  4OCG A;  1K4Q A;  1KSS A;  3BI2 A;  1PDH A;  1XPQ A;  3AE4 A;  4U2T A;  3VRD B;  5HYM A;  1F3P A;  3C4A A;  2YLT A;  1LTX R;  5BRT A;  3NHO X;  1KDG A;  4OPC A;  1GES A;  1VG9 A;  4H2R A;  1DOB A;  2Q6U A;  4U8M A;  1H86 A;  1TDE A;  2OLN A;  5IPY A;  2YVF A;  1CJC A;  1QLB A;  3UTE A;  4EQR A;  2GF3 A;  2XFQ A;  3VR9 A;  3NYE A;  4DNA A;  4IVM B;  4I58 A;  5KVI A;  3NK0 X;  2BK5 A;  2GR1 A;  3LZW A;  4B67 A;  2ACZ A;  3FIM B;  4EIQ A;  1NDA A;  3GMB A;  1E1N A;  3HYW A;  4RG3 A;  2J3N A;  2R0G A;  2BRY A;  1E1M A;  5JCM A;  1RP0 A;  4YKG A;  2JB1 A;  2XLR A;  1TDK A;  3GD4 A;  3NT6 A;  5HXI A;  2ZBW A;  3AEA A;  5GRT A;  3AD8 B;  2H89 A;  3AE5 A;  4FK1 A;  2X50 A;  2WEU A;  3CPH G;  3T14 A;  4ZN0 A;  4USR A;  1B37 A;  1PHH A;  4D04 A;  3IHM A;  4B68 A;  4X4J A;  4AT0 A;  2VVL G;  1GND A;  3OC4 A;  4EMJ A;  3AXB A;  3T0K A;  1PJ5 A;  4I59 A;  2RGO A;  1OJC A;  1FEB A;  3CN8 A;  1H83 A;  3SZF A;  1JOA A;  1NAA A;  3ITJ A;  4BK2 A;  5JCI A;  2X8H A;  4C5O A;  3NYC A;  3G5Q A;  3AE7 A;  1GER A;  4GR1 A;  2YR5 A;  5C2T A;  2GQW A;  1FOH A;  4Z2R A;  2YG6 A;  1X31 B;  2WET A;  4K2X A;  4G9K A;  3RNM A;  3UOY A;  1L9C A;  1JRZ A;  2C3D A;  4EIP A;  1PBE A;  4NWZ A;  1B4V A;  2VQB A;  3ALM A;  4PAB A;  3SY4 A;  1FEC A;  2PHH A;  2JB3 A;  3UKA A;  2R0C A;  3SM8 A;  3B6D A;  5KNL A;  2C64 A;  2XVI A;  4CRT A;  2I0Z A;  3FBS A;  3RED A;  4GAP A;  2C7G A;  2WU2 A;  4YKF A;  3NTD A;  4KX6 A;  3UOV A;  3P1W A;  5IQ1 A;  4U8I A;  4NEW A;  4CY8 A;  1BKW A;  1GAL A;  3I6D A;  4IA5 A;  4USQ A;  2YQU A;  3BHK A;  4ECH A;  1H82 A;  1S2Q A;  1GEU A;  3C4N A;  1NEN A;  4IA6 A;  4NTD A;  5KWF A;  5EBK A;  4EMI A;  3NTA A;  3AE1 A;  3FG2 P;  2BXS A;  3AE2 A;  3LB8 A;  3K7Q X;  3KVE A;  3SFE A;  4H4Q A;  5U1O A;  4AOX A;  2WES A;  3KLJ A;  3FPZ A;  1F8S A;  1BGJ A;  4Z26 A;  4JY2 A;  3UKK A;  4BK3 A;  2VVL A;  3COX A;  4XWZ A;  1EL9 A;  1L9D A;  2C76 A;  3BHF A;  3D8X A;  4J57 A;  3RHA A;  1Q9I A;  3EAO A;  5FS9 A;  2RGH A;  2AAQ A;  4BK1 A;  4Z44 A;  4B69 A;  2EQ6 A;  3K30 A;  1O94 A;  2TPR A;  4ZCC A;  2QA2 A;  3BI4 A;  2WOV A;  2FBW A;  2GMJ A;  2WQY A;  4A6N A;  4EQS A;  3M13 A;  2BYB A;  2XFU A;  1GT8 A;  3EAN A;  3UKH A;  1BGN A;  4H4T A;  3NLC A;  4U8L A;  1GRF A;  2Q0K A;  1S3E A;  3UOX A;  2JBV A;  1CJ4 A;  2GH5 A;  2ARD A;  1XHC A;  2B76 A;  2WP6 A;  4C3Y A;  2APG A;  1CC4 A;  1K0I A;  3G5R A;  4B66 A;  1E7P A;  1F8R A;  3CPI G;  4H7U A;  2B7R A;  3CIR A;  3BNU A;  3RP8 A;  4B1B A;  4C77 A;  3FMW A;  2BS4 A;  2TMD A;  1MO9 A;  1LQT A;  1Y56 B;  3GMC A;  4J36 A;  1YQ3 A;  2UZZ A;  1LPF A;  2YR4 A;  1FL2 A;  3CNJ A;  4K5R A;  5HHF A;  4YSZ A;  1YY5 A;  2JAE A;  1RSG A;  5HY5 A;  4IVO B;  4OPU A;  1ONF A;  3H8I A;  2YWL A;  2E1M A;  1DJN A;  3CGD A;  4X9M A;  3C96 A;  3QSE A;  2XCG A;  5J60 A;  3HZL A;  1GV4 A;  1E1K A;  2RAB A;  3V76 A;  2EQ7 A;  5FS6 A;  2BS2 A;  3H4K A;  4A9W A;  2AQJ A;  3GYX A;  4E0V A;  4II3 A;  2OA1 A;  1RYI A;  3IHG A;  3QSM A;  1LV0 A;  3QVP A;  4OPD A;  4TM1 A;  4H4U A;  4YTM A;  2GR2 A;  1D5T A;  3WE0 A;  2OAL A;  4EM4 A;  2XLT A;  4NTE A;  2ZZB A;  3CNP A;  3NIX A;  3GWF A;  2GR0 A;  5EB4 A;  2YG4 A;  2WDV A;  1Z6L A;  4B63 A;  3GSI A;  4Z24 A;  2CVJ A;  1H84 A;  3PS9 A;  3CMM A;  2GV8 A;  3II4 A;  4K7Z A;  5EB5 A;  1DOD A;  3DJE A;  4H4P A;  3GYJ A;  1NHP A;  2WPC A;  2GMH A;  3T2K A;  3T2Z A;  1PXC A;  1ZDL A;  2C4C A;  2JK6 A;  3F8P A;  4Y4M A;  3K7T A;  2A89 A;  1CBO A;  2IVD A;  3V3N A;  2WOW A;  3H8L A;  5BVA A;  1EL5 A;  3DME A;  1F6M A;  1IJH A;  2C66 A;  4KPR A;  2VRL A;  3AD7 B;  3GDP A;  4H4S A;  2XVH A;  1M64 A;  2F5Z A;  4H4Z A;  2GRT A;  3CGB A;  5M10 A;  2YG3 A;  2BRA A;  3DH9 A;  3NGC X;  3P4Q A;  4G73 A;  4UDR A;  3QSS A;  1JRX A;  1W4X A;  3ZDN A;  3VRA A;  5TR3 A;  4G6H A;  4H2Q A;  2BC1 A;  2WU5 A;  3AYI A;  4J31 A;  5LV9 A;  1TYT A;  3LJP A;  4TM4 A;  1O95 A;  1E39 A;  2A87 A;  1COY A;  2GAH B;  3UP5 A;  3CGE A;  2B9Y A;  3JSK A;  3SXI A;  2FJE A;  3NYF A;  1S2Y A;  1H7W A;  4AT2 A;  3UKF A;  4A6N B;  1O5W A;  2WOI A;  2A8X A;  3NK2 X;  1D7L A;  3PVC A;  4H2N A;  1CJ2 A;  1CC6 A;  2C65 A;  1ZOY A;  3DJG X;  1LQU A;  3LZX A;  3ABV A;  4FX9 A;  1EBD A;  3P4P A;  1AOG A;  3CNT A;  3I3L A;  1DJQ A;  4H50 A;  4P9S A;  4EQW A;  2V61 A;  2YG7 A;  1BF3 A;  1JEH A;  2O9Z A;  4ADW A;  3ATR A;  3SGL A;  3UOZ A;  2YVJ A;  1GPE A;  3L8K A;  1D4D A;  3T37 A;  2YR6 A;  3T31 A;  2YLR A;  3UTH A;  1N4V A;  2VVM A;  3DA1 A;  4AOS A;  2GAG B;  3NN0 X;  3R9U A;  1UKV G;  3EF6 A;  4U8O A;  3UKP A;  5IQ4 A;  2BAC A;  1GTE A;  1B5Q A;  1GRE A;  2BC0 A;  2V6O A;  2YLX A;  2ZZC A;  4CCQ A;  1D7Y A;  1P2E A;  5BUK A;  4EMW A;  3UTF A;  1GSN A;  3M0O A;  4NNJ A;  4A5L A;  4DSH A;  1NPX A;  2WS3 A;  5KMS A;  1TDF A;  1IUX A;  5EOW A;  4A7A A;  4JN9 A;  3BNM A;  1IUU A;  2WDQ A;  3P4R A;  1NHR A;  1OJD A;  1IUS A;  2HQM A;  3AWI A;  4BJY A;  4DSG A;  4K5S A;  2YLW A;  2XLP A;  5FMH A;  1JNR A;  4GF7 A;  2H88 A;  3T2Y A;  4EM3 A;  2WP5 A;  2V3B A;  2W0H A;  1DNC A;  1MXT A;  1H7X A;  3UCL A;  2C75 A;  5KVH A;  4MJW A;  1PJ6 A;  3AEG A;  4WCT A;  1CF3 A;  5U63 A;  4GUV A;  3NK1 X;  1TDO A;  3AYL A;  2XFP A;  1YQZ A;  2Y6Q A;  1PBF A;  3KU9 A;  1PXA A;  2YLS A;  4FK1 C;  1JRY A;  1ZX9 A;  3IF9 A;  3UKL A;  3UTG A;  4GAV A;  4Z2U A;  2GQF A;  4FDC B;  1IUV A;  4G6G A;  4AP1 A;  4YXD A;  3ICR A;  1N1P A;  4II2 A;  3QJ4 A;  1B8S A;  2XVE A;  4LA1 A;  4U2L A;  1EL7 A;  1GXF A;  2DKH A;  2V3A A;  2ZZ0 A;  3DJD A;  3ICS A;  4BV6 A;  1ZP0 A;  2Z5X A;  3ADA B;  3GDN A;  4TLX A;  2GB0 A;  2OAM A;  3SZC A;  3ISH A;  3AEC A;  4JY3 A;  3IWA A;  4BJZ A;  5CKU A;  2BK4 A;  1IUW A;  1GTH A;  1Q1W A;  2WDR A;  3DGH A;  2C3C A;  2B9W A;  3NH3 X;  1GOS A;  4J2W A;  3D1C A;  1NHS A;  2YAU A;  3OZ2 A;  3SZ0 A;  5FS8 A;  3RP7 A;  2FJA A;  3VRB A;  4CBQ A;  1E1L A;  2BCP A;  4LII A;  1VDC A;  3Q9T A;  3GRS A;  3SFD A;  4H4V A;  2GEW A;  2JKC A;  2Q7V A;  3DJJ A;  1REO A;  2FJD A;  4YSX A;  2R45 A;  1PBD A;  1VQW A;  4LU6 A;  2BXR A;  5C3J A;  4B65 A;  2Q0L A;  3AED A;  1Q1R A;  4JDR A;  1N4W A;  4CY6 A;  3ICT A;  2E4G A;  2EQ8 A;  2IID A;  4HA6 A;  3AE8 A;  4WX1 A;  5ER0 A;  1L0V A;  3K7M X;  1KNP A;  1NHQ A;  4JNA A;  1OJA A;  1OJ9 A;  2V5Z A;  2R4J A;  3CND A;  4D03 A;  1GRG A;  4JQ9 A;  3CTY A;  4RG4 A;  3URH A;  1ZK7 A;  4H4X A;  3AE6 A;  4GDE A;  5KMR A;  1GRB A;  3BI5 A;  1F8W A;  2BS3 A;  4YSY A;  4Z43 A;  2NVK X;  4CNJ A;  4J34 A;  2E5V A;  2PYX A;  3KKJ A;  4PAA A;  3SYI A;  5KXJ A;  3NKS A;  1E6E A;  3DK8 A;  5L46 A;  2FJB A;  1K0L A;  1YKJ A;  2X3N A;  2YM1 A;  1ZMC A;  3F8R A;  4DGK A;  2R4E A;  4A79 A;  4GDP A;  4TM0 A;  4U2S A;  1GRH A;  3AYJ A;  2CDU A;  2XVJ A;  3CPJ G;  2YM2 A;  2R9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...