3LZWA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form i)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA02
2XVJA 4CCQA 1NPXA 4AOXA 4K5RA 1ZK7A 5FMHA 3NLCA 3M0OA 4BK2A 4MJWA 3S5WA 5M10A 4H4XA 5FS8A 4BK1A 3V3OA 3AXBA 1F3PA 3AE2A 4P9SA 2E5VA 1JNRA 4H4RA 2GR3A 2DKHA 2WOIA 3L8KA 3GMBA 1D4CA 2GAHB 1JOAA 2EQ7A 1NENA 1TDFA 2RGOA 1EL9A 1L9CA 3AE7A 3ALLA 3GWFA 5JCLA 2J3NA 3CIRA 1DOCA 1GRGA 2WDQA 2Q6UA 2PYXA 2XFNA 2X8HA 4U8PA 1PXBA 2GQWA 2YLRA 3QFAA 4UDQA 1LTXR 5KVHA 3AYJA 3NIXA 4I59A 2BABA 1DXLA 3UKLA 3GSIA 1P2HA 3CNDA 2C7GA 3K7TA 2XDOA 1RYIA 1CL0A 2JB1A 2B7SA 2R9ZA 3IHMA 1OJAA 1K0JA 1NHQA 1ZDLA 3NTAA 2BYBA 1H86A 2R45A 1GREA 1GOSA 2F5ZA 3P4RA 2XLUA 1TDKA 1GV4A 3GWDA 3H8IA 5DBJA 4GF7A 1SEZA 1QJDA 5JCNA 3OZ2A 3UKFA 1DNCA 2VZ2A 1B4VA 2YVFA 3ICRA 2X50A 3KPFA 3V76A 4B67A 1PXCA 4C5OA 3H8LA 1N4VA 2JK6A 4CNKA 4USRA 4GDPA 1YQZA 3AEBA 4EQWA 3FMWA 4HB9A 2C72A 5EB4A 1H7WA 1LQUA 1NG3A 1EL8A 3AEDA 4YXDA 3PS9A 4YT0A 3CNTA 1JRYA 2NPXA 3GYIA 3AE8A 3Q6JA 3NTDA 3B6DA 4JNQA 4KPRA 2FJEA 3LJPA 3NRNA 1L0VA 4ADWA 3EAOA 4Y4NA 2XVHA 2FJBA 3P4PA 5U1OA 3FIMB 3BI5A 2ARDA 2YR4A 4AT2A 3DH9A 1GRTA 4NTCA 1NEKA 1F8WA 1VRQB 4H4QA 4YSXA 1IUSA 2CULA 2X8GA 2BS2A 4EQRA 1CC2A 2JAEA 3GYJA 1FCDA 2RGHA 2YG5A 1IUWA 3M12A 5KWFA 5CKUA 3SFEA 4TLXA 1YQ4A 2Q7VA 1GPEA 2ACZA 2YQUA 1TYPA 1F8SA 2XVEA 4FX9A 4PABA 5HHFA 2AAQA 1H83A 5KOWA 1FECA 1NHPA 1ELIA 3DMEA 4IA6A 3NT6A 1O94A 1OJ9A 1BGNA 3AE3A 5BULA 1FEBA 4FK1A 4B63A 1DOEA 4EIPA 4PAAA 3KLJA 2RABA 1O5WA 2GV8A 3E1TA 2WPCA 2BK4A 2YG3A 1E6EA 2B9WA 1CC4A 4YKFA 2UZZA 2IIDA 2GEWA 2A8XA 2X99A 3ABVA 5GRTA 3EPTA 4D03A 1IUUA 1REOA 1KDGA 1XHCA 2E1MA 2V3BA 2WP6A 4U2SA 3UKHA 2GH5A 5KVIA 1ZX9A 1IUTA 1VQWA 3URHA 1DJNA 3NHOX 3UOZA 1P2EA 4TM1A 4APNA 3AEAA 4C3XA 2ZZBA 4U8MA 2R0CA 1Q1WA 3ZDNA 4A5LA 3GDNA 1GESA 5L46A 3NKSA 1CF3A 1LVLA 4BJYA 1S3BA 2BXSA 5BRTA 2R0GA 3WE0A 1GTEA 1DJQA 3CPIG 4YTMA 1KSUA 4Z26A 4GDEA 5HYMA 4RSLA 1CJ3A 1TDOA 2YAUA 3KD9A 4X9MA 4H4ZA 1PBDA 1JEHA 3NK0X 2R4JA 4TM3A 3VR8A 1ZKQA 1D7LA 3DGZA 3LZXA 4REKA 3AD7B 1V59A 1VDCA 4AP3A 1O95A 2XCGA 2YLTA 3RNMA 4OPDA 4CRTA 1D4DA 1BZLA 2PHHA 3II4A 1TYTA 4LU6A 2HQMA 1KFYA 4ECHA 3P1WA 3T37A 1IUXA 1DODA 4YSHA 3GRTA 4OVIA 2TMDA 3UOYA 1MOKA 1VG9A 2YM2A 1FOHA 2YLSA 3ZYXA 3IWAA 1N4UA 3BI4A 3DK4A 4JY2A 5EOWA 3OC4A 4NZHA 4BK3A 4Z2UA 2C75A 1ZY8A 2C76A 2X8CA 5U25A 4NEVA 1LJ1A 2R0PA 1KF6A 2XFUA 4H4TA 2C66A 1ONFA 1PBCA 2GMJA 2V6OA 2WU5A 3FBSA 1LV0A 3KA7A 4CY6A 1CJ4A 1FL2A 2B7RA 1M64A 3C4AA 1MO9A 1NHRA 2VOUA 1OJCA 2WPFA 2C73A 1GRAA 1NDAA 1TRBA 3AE9A 4TLZA 1Z6LA 2OALA 3ATQA 3QFBA 3BI2A 4EMWA 1EBDA 1H84A 3H4KA 5TR3A 3RP7A 5IPYA 4LA1A 4JDRA 3C4NA 4BJZA 2WESA 1E39A 2C64A 3DJEA 4Z24A 2VVLG 4OPCA 4B66A 1XPQA 1F8RA 1ZOYA 1PBEA 3SQPA 2BCPA 2H89A 3CNPA 3M13A 2A89A 4AOSA 3ALJA 1FEAA 2V3AA 4IVMB 4YTPA 1KSSA 2C67A 1E1MA 2O9ZA 2XFOA 1S3EA 1ZMDA 2V5ZA 3NNEA 2IVDA 5LV9A 1XDIA 1Y0PA 2GR0A 5JCIA 3UP4A 3AWIA 3G5QA 4O5UA 2EQ9A 1GT8A 2VQBA 1EL5A 4H4SA 4A99A 4C3YA 4U8KA 4Z44A 1COYA 2BCGG 2B9XA 2C70A 1YKJA 4DSGA 3AEGA 1GNDA 3VRDB 2XFQA 2YM1A 2QA1A 3CGEA 5FS7A 3F8DA 2WEUA 1F6MA 3UOVA 4H2RA 3UKPA 2Y6QA 3LB8A 3NN6X 5EBKA 3ALMA 5CQFA 4X4JA 2A87A 2EQ6A 1PBFA 1IUVA 1GERA 2H88A 3G5SA 3QSMA 4U8IA 2Z5YA 1GALA 2CVJA 2JB3A 2Z5XA 5JCKA 1ZMCA 2YWLA 1Q1RA 2YVJA 4GUVA 1ZP0A 1LQTA 3QVPA 2BXRA 2GRTA 3K7QX 4J2WA 1HYUA 3CGCA 2JB2A 3PVCA 1L9EA 4FK1C 2YG6A 3AE1A 3CGBA 4J56A 4IVOB 3UKKA 4CY8A 2C3DA 4U2LA 3GRSA 4H2QA 1OJDA 1N4WA 4YWOA 5GSNA 2JKCA 3GDPA 3K30A 4IA5A 2QA2A 2OLOA 2VVLA 2Q0KA 3PO7A 1JU2A 2YLXA 3QJ4A 4OPIA 4EIQA 3NGCX 1S2QA 2Q0LA 3Q9TA 2BS4A 4A9WA 5J7XA 1DOBA 4BV6A 2VQ7A 3F8PA 4YTNA 5IQ4A 3F8RA 4H2PA 1YQ3A 3KVEA 4U8NA 5IQ1A 1ZOVA 1MXTA 1XANA 4K5SA 3SM8A 2BK3A 3GD4A 4JQ9A 2GF3A 3LOVA 4Z43A 1L9DA 1LPFA 3FG2P 4USQA 2C3CA 2BC1A 4UP3A 1CBOA 1GEUA 2WDVA 2BK5A 4LIIA 3DGHA 4TM4A 3R9UA 2B9YA 3NYCA 3QVRA 2I0ZA 1D5TA 4UDRA 4JY3A 2NVKX 3HZLA 2BA9A 3AE5A 3VRBA 2YLZA 3LADA 3KKJA 3COXA 5M0ZA 2B76A 4EM3A 3NYEA 1K0LA 4U8JA 4ZCDA 5FS9A 4AT0A 1S2YA 1TDNA 1NHSA 2XYOA 5FS6A 3CPJG 2BS3A 2GVCA 1GRHA 4YKGA 4J33A 4XWRA 1AOGA 1UKVG 5HY5A 1BWCA 3UOXA 3DJGX 3CN8A 1QLBA 2V60A 5KXJA 3B3RA 1Q9IA 3NK1X 4K22A 4GRTA 3VRAA 2W0HA 2ZZ0A 3IC9A 3ISHA 1GRFA 3UTGA 4JN9A 1H82A 4O5QA 1BGJA 3LXDA 3D8XA 3NK2X 1W4XA 4H4UA 4AP1A 4B1BA 3RP6A 1JNZA 3DA1A 3V3NA 4K7ZA 5BUKA 3JSKA 4K8DA 3KU9A 5J60A 4DSHA 4H2NA 3I3LA 4NEWA 3QSSA 1E7PA 3RHAA 2WU2A 1TDEA 1CJCA 3AD8B 3UCLA 3SGLA 3UTEA 3S61A 4CNJA 4N9XA 4EMIA 1PS9A 4KX6A 3NYFA 4J31A 1BF3A 1E1KA 2WQYA 3REDA 4U8LA 2YLWA 2WOWA 2OAMA 2BC0A 1PXAA 3AD9B 3P9UA 4FDCB 3LZWA 3CNJA 4XWZA 5HXIA 1IJHA 2IVEA 3CTYA 4EM4A 4Z2TA 2E4GA 3DK9A 5BVAA 2TPRA 1NG4A 1N1PA 2WS3A 1PHHA 1YY5A 3ATRA 1EL7A 1CJ2A 1K4QA 3AYIA 4ICYA 3L1RA 3VR9A 3AE4A 4A65A 5JCMA 3DJDA 2XVIA 3AEEA 3CPHG 4M52A 2WDRA 4WCTA 4Z2RA 3SFDA 2WP5A 3K7MX 4UDPA 1PDHA 1GRBA 1M6IA 2OLNA 3P4SA 1B37A 3GMCA 4RG4A 2BACA 1OJTA 2QAEA 4B68A 4BURA 4EMJA 1D4EA 1KNPA 4E0VA 1H81A 3AB1A 3UKAA 3IF9A 4ZN0A 2GQFA 2R4EA 4B65A 4H4VA 1KNRA 4J36A 2AQJA 3C96A 4H4YA 5ER0A 4EQXA 2R46A 2WOVA 2VVMA 3BNUA 2XVFA 3QSEA 3G5RA 4Y4LA 3RP8A 4A7AA 4YSZA 4Y4MA 2Y6RA 4DNAA 2ZZCA 1H6VA 2APGA 3EF6A 3EANA 1PJ5A 3AEFA 1GSNA 2YR6A 1QO8A 4IV9A 4CBQA 2YG4A 4I58A 4NTEA 2RGJA 4JNAA 2FBWA 4A79A 2WPEA 4GR1A 5U63A 4J57A 2AR8A 2YR5A 2GR2A 3DJJA 3ICTA 2CDUA 3D1CA 1PBBA 3DK8A 4U2TA 2GR1A 2XFPA 1H7XA 3P4QA 1PJ7A 3NH3X 5KOXA 3AECA 4OCGA 4U8OA 4CCRA 2GMHA 4HA6A 4H4PA 1PJ6A 4C77A 4EQSA 4H4WA 4OPGA 3UKQA 2GB0A 4B69A 3ITJA 2XLSA 3BHFA 3I6DA 4OPTA 3UTHA 5KRQA 4NTDA 4X9NA 4B64A 4DGKA 1X31B 2XLTA 3NG7X 3O0HA 2C65A 3CNSA 5C3JA 3FPZA 2FJAA 2JBVA 1BKWA 4J34A 2XLRA 4H50A 2FJDA 4GCMA 1Y56A 4D04A 2YVGA 4A6NA 1GETA 1E1NA 1K0IA 2VRMA 4RG3A 3UTFA 2WETA 3UP5A 1RSGA 4Z25A 2XLPA 4XXGA 1B8SA 3ADAB 1CC6A 3BHKA 3CGDA 3IHGA 1Y56B 3NN0X 1JRXA 4OPLA 2X3NA 4A6NB 4YSYA 1PN0A 2WP9A 4H7UA 2VRLA 3AYLA 1B5QA 1RP0A 2V61A 2EQ8A 1NAAA 3ICSA 4OPUA 3AE6A 4K2XA 1VG0A 3BNMA 5EB5A 1JRZA 2WHDA 1E1LA 2ZBWA 4TM0A 4ZCCA 2YG7A 3VQRA 5C2TA 2QCUA 2CFYA 4C74A 2WBAA 1GXFA 2DKIA 4WX1A 2GAGB 3GD3A 2OA1A 1D7YA 1CHUA 1GTHA
chains in the Genus database with same CATH superfamily
2XVJA 3T2ZA 4CCQA 1NPXA 4AOXA 4K5RA 1ZK7A 5KMQA 5FMHA 3NLCA 3M0OA 4BK2A 4MJWA 3S5WA 5M10A 4H4XA 5FS8A 4BK1A 3V3OA 3AXBA 1F3PA 3AE2A 4P9SA 2E5VA 1JNRA 4H4RA 5KMPA 2GR3A 2DKHA 2WOIA 3L8KA 3GMBA 1D4CA 2GAHB 1JOAA 2EQ7A 1NENA 1TDFA 2RGOA 1EL9A 1L9CA 3AE7A 3ALLA 3GWFA 5JCLA 2J3NA 3CIRA 1DOCA 1GRGA 2WDQA 2Q6UA 2PYXA 2XFNA 2X8HA 4U8PA 1PXBA 2GQWA 2YLRA 3QFAA 4UDQA 1LTXR 5KVHA 3AYJA 3NIXA 4I59A 2BABA 1DXLA 3UKLA 3GSIA 1P2HA 3CNDA 2C7GA 3K7TA 2XDOA 4G6GA 1RYIA 1CL0A 2JB1A 2B7SA 2R9ZA 3IHMA 1OJAA 1K0JA 1NHQA 5KMRA 1ZDLA 3NTAA 2BYBA 1H86A 2R45A 1GREA 1GOSA 2F5ZA 3P4RA 2XLUA 1TDKA 1GV4A 3GWDA 3H8IA 5DBJA 4GF7A 1SEZA 1QJDA 5JCNA 3OZ2A 3UKFA 1DNCA 2VZ2A 1B4VA 2YVFA 3ICRA 2X50A 3KPFA 3V76A 4B67A 1PXCA 4C5OA 3H8LA 1N4VA 2JK6A 4CNKA 4USRA 4GDPA 1YQZA 3AEBA 4EQWA 3FMWA 4HB9A 2C72A 5EB4A 3CMMA 1H7WA 1LQUA 1NG3A 1EL8A 3AEDA 4YXDA 3PS9A 4YT0A 3CNTA 1JRYA 2NPXA 3GYIA 3AE8A 3Q6JA 4D03A 3NTDA 3B6DA 4JNQA 4KPRA 2FJEA 3LJPA 3NRNA 1L0VA 4ADWA 3EAOA 4Y4NA 2XVHA 2FJBA 3P4PA 3KPKA 5U1OA 3FIMB 3BI5A 2ARDA 2YR4A 4AT2A 3DH9A 1GRTA 4NTCA 1NEKA 1F8WA 1VRQB 4H4QA 4YSXA 1IUSA 2CULA 2X8GA 3T2YA 2BS2A 2C4CA 4EQRA 1CC2A 2JAEA 3GYJA 1FCDA 2RGHA 2YG5A 1IUWA 3M12A 5KWFA 5CKUA 3SFEA 4TLXA 1YQ4A 3GYXA 2Q7VA 1GPEA 2ACZA 2YQUA 1TYPA 1F8SA 2XVEA 4FX9A 4PABA 5HHFA 3SYIA 2AAQA 1H83A 5KOWA 1FECA 1NHPA 1ELIA 3DMEA 4IA6A 3NT6A 1O94A 1OJ9A 1BGNA 3AE3A 5BULA 1FEBA 4FK1A 4B63A 1DOEA 4EIPA 4PAAA 2BRYA 2RABA 1O5WA 3KLJA 2GV8A 3E1TA 2WPCA 2BK4A 2YG3A 1E6EA 2B9WA 1CC4A 4YKFA 2UZZA 2IIDA 2GEWA 2A8XA 2X99A 3ABVA 5GRTA 3EPTA 4G73A 1IUUA 1REOA 1KDGA 1XHCA 2E1MA 2V3BA 2WP6A 4U2SA 3UKHA 2GH5A 5KVIA 1ZX9A 1IUTA 1VQWA 3URHA 1DJNA 3NHOX 3UOZA 3HYXA 1P2EA 4TM1A 4APNA 3AEAA 4C3XA 2ZZBA 4U8MA 2R0CA 1Q1WA 3ZDNA 4A5LA 3GDNA 1GESA 5L46A 3NKSA 1CF3A 1LVLA 4BJYA 1S3BA 2BXSA 5BRTA 2R0GA 3WE0A 1GTEA 1DJQA 3CPIG 4YTMA 1KSUA 4Z26A 4GDEA 5HYMA 4RSLA 1CJ3A 1TDOA 2YAUA 3KD9A 4X9MA 4H4ZA 1PBDA 1JEHA 3NK0X 2R4JA 4TM3A 3VR8A 1ZKQA 1D7LA 3DGZA 3LZXA 4REKA 3AD7B 1V59A 1VDCA 4AP3A 4GAVA 1O95A 2XCGA 2YLTA 3RNMA 4OPDA 4CRTA 1D4DA 1BZLA 2PHHA 3II4A 1TYTA 4LU6A 2HQMA 1KFYA 4ECHA 3P1WA 3T37A 1IUXA 1DODA 4YSHA 3GRTA 4OVIA 2TMDA 3UOYA 1MOKA 1VG9A 2YM2A 1FOHA 2YLSA 3ZYXA 3IWAA 1N4UA 3BI4A 3DK4A 4JY2A 5EOWA 3OC4A 4NZHA 4BK3A 4NWZA 2C75A 4Z2UA 1ZY8A 2C76A 2X8CA 5U25A 4NEVA 1LJ1A 2R0PA 1KF6A 2XFUA 4H4TA 2C66A 1ONFA 1PBCA 2GMJA 2V6OA 2WU5A 3FBSA 1LV0A 3KA7A 4CY6A 1CJ4A 1FL2A 2B7RA 1M64A 3C4AA 3HYVA 3SZWA 1MO9A 1NHRA 2VOUA 1OJCA 2WPFA 2C73A 1GRAA 1NDAA 1TRBA 3AE9A 3HYWA 4TLZA 1Z6LA 2OALA 3ATQA 3QFBA 3BI2A 4EMWA 1EBDA 1H84A 3H4KA 5TR3A 3RP7A 5IPYA 4LA1A 4JDRA 3C4NA 4BJZA 2WESA 1E39A 2C64A 3DJEA 4Z24A 2VVLG 4OPCA 4B66A 1XPQA 1F8RA 1ZOYA 1PBEA 3SZCA 3SQPA 2BCPA 2H89A 3CNPA 3M13A 2A89A 4AOSA 3ALJA 1FEAA 2V3AA 4IVMB 4YTPA 1KSSA 2C67A 1E1MA 2O9ZA 2XFOA 1S3EA 1ZMDA 2V5ZA 3NNEA 2IVDA 5LV9A 1XDIA 1Y0PA 2GR0A 5JCIA 3UP4A 3AWIA 3G5QA 4O5UA 2EQ9A 1GT8A 2VQBA 1EL5A 4H4SA 4A99A 4C3YA 4U8KA 4Z44A 1COYA 2BCGG 3SXIA 2B9XA 2C70A 1YKJA 4DSGA 3AEGA 1GNDA 4G9KA 3VRDB 2XFQA 2YM1A 2QA1A 3CGEA 5FS7A 3F8DA 2WEUA 1F6MA 3UOVA 4H2RA 3UKPA 2Y6QA 3LB8A 5KMSA 3NN6X 5EBKA 3ALMA 5CQFA 4X4JA 2A87A 2EQ6A 1PBFA 1IUVA 1GERA 2H88A 3G5SA 3QSMA 4U8IA 2Z5YA 1GALA 2CVJA 2JB3A 2Z5XA 5JCKA 1ZMCA 2YWLA 1Q1RA 2YVJA 4GUVA 1ZP0A 1LQTA 3QVPA 2BXRA 2GRTA 3K7QX 4J2WA 1HYUA 3CGCA 2JB2A 3PVCA 1L9EA 4FK1C 2YG6A 3AE1A 3CGBA 4J56A 4IVOB 3UKKA 4CY8A 2C3DA 4U2LA 3GRSA 4H2QA 1OJDA 1N4WA 4YWOA 5GSNA 2JKCA 3GDPA 3K30A 4IA5A 2QA2A 2OLOA 2VVLA 2Q0KA 3PO7A 1JU2A 2YLXA 3QJ4A 4OPIA 4EIQA 3NGCX 1S2QA 2Q0LA 3Q9TA 2BS4A 4A9WA 2BRAA 5J7XA 1DOBA 4BV6A 2VQ7A 3F8PA 4YTNA 5IQ4A 3F8RA 4H2PA 1YQ3A 3KVEA 4U8NA 5IQ1A 1ZOVA 1MXTA 1XANA 4K5SA 3SM8A 2BK3A 3GD4A 4JQ9A 2GF3A 3LOVA 4Z43A 1L9DA 1LPFA 3FG2P 4USQA 2C3CA 2BC1A 4UP3A 1CBOA 1GEUA 2WDVA 2BK5A 4LIIA 3DGHA 4TM4A 3R9UA 2B9YA 3NYCA 3QVRA 2I0ZA 1D5TA 4UDRA 4JY3A 2NVKX 3HZLA 2BA9A 3AE5A 3VRBA 2YLZA 3LADA 3KKJA 3COXA 5M0ZA 2B76A 4EM3A 3NYEA 1K0LA 4U8JA 4ZCDA 5FS9A 4AT0A 1S2YA 1TDNA 1NHSA 2XYOA 5FS6A 3CPJG 2BS3A 2GVCA 1GRHA 4YKGA 4J33A 4XWRA 1AOGA 1UKVG 5HY5A 1BWCA 3UOXA 3DJGX 3CN8A 1QLBA 2V60A 5KXJA 3B3RA 1Q9IA 3NK1X 4NNJA 3SZFA 4K22A 4GRTA 3VRAA 2W0HA 2ZZ0A 3IC9A 3ISHA 1GRFA 3UTGA 4JN9A 1H82A 4O5QA 1BGJA 3LXDA 3D8XA 3NK2X 1W4XA 4H4UA 4AP1A 4II2A 4B1BA 3RP6A 1JNZA 3DA1A 3V3NA 4K7ZA 5BUKA 3JSKA 4K8DA 3KU9A 5J60A 4DSHA 4H2NA 3I3LA 4NEWA 3QSSA 1E7PA 3RHAA 2WU2A 1TDEA 1CJCA 3AD8B 3UCLA 3SGLA 3UTEA 3S61A 4CNJA 4N9XA 3T14A 1PS9A 4EMIA 4KX6A 3NYFA 4J31A 1BF3A 1E1KA 2WQYA 3REDA 4U8LA 3SZ0A 2YLWA 2WOWA 2OAMA 2BC0A 1PXAA 3AD9B 3P9UA 4FDCB 3LZWA 3CNJA 4XWZA 5HXIA 1IJHA 2IVEA 3CTYA 4EM4A 4Z2TA 2E4GA 3DK9A 5BVAA 2TPRA 1NG4A 1N1PA 2WS3A 1PHHA 1YY5A 3ATRA 1EL7A 1CJ2A 1K4QA 3AYIA 4ICYA 3L1RA 3VR9A 3AE4A 4A65A 5JCMA 3DJDA 2XVIA 3AEEA 3CPHG 4M52A 2WDRA 4WCTA 4Z2RA 4G6HA 3SFDA 2WP5A 3K7MX 4UDPA 1PDHA 1GRBA 1M6IA 2OLNA 3P4SA 1B37A 3GMCA 4II3A 4RG4A 2BACA 1OJTA 2QAEA 4B68A 4BURA 4EMJA 3T31A 1D4EA 1KNPA 4E0VA 1H81A 3AB1A 3UKAA 3IF9A 4ZN0A 2GQFA 2R4EA 4B65A 4H4VA 1KNRA 4J36A 2AQJA 3C96A 4H4YA 5ER0A 4EQXA 2R46A 2WOVA 2VVMA 3BNUA 2XVFA 3QSEA 3G5RA 4Y4LA 3RP8A 4A7AA 4YSZA 4Y4MA 2Y6RA 4DNAA 2ZZCA 1H6VA 2APGA 3EF6A 3EANA 1PJ5A 3AEFA 1GSNA 2YR6A 1QO8A 4IV9A 4CBQA 2YG4A 4I58A 4NTEA 2RGJA 4JNAA 2FBWA 4A79A 2WPEA 4GR1A 5U63A 4J57A 2AR8A 2YR5A 2GR2A 3DJJA 3ICTA 2CDUA 3D1CA 1PBBA 3DK8A 4GAPA 4U2TA 2GR1A 2XFPA 1H7XA 3P4QA 1PJ7A 3NH3X 5KOXA 3AECA 4OCGA 4U8OA 4CCRA 3T0KA 2GMHA 4HA6A 4H4PA 1PJ6A 4C77A 4EQSA 4H4WA 4OPGA 3UKQA 2GB0A 4B69A 3ITJA 2XLSA 3BHFA 3I6DA 4OPTA 3UTHA 5KRQA 4NTDA 4X9NA 4B64A 4DGKA 1X31B 2XLTA 3NG7X 3O0HA 5KNLA 2C65A 3CNSA 5C3JA 3FPZA 2FJAA 2JBVA 1BKWA 4J34A 2XLRA 4H50A 2FJDA 4GCMA 1Y56A 4D04A 2YVGA 4A6NA 1GETA 1E1NA 1K0IA 2VRMA 3T2KA 4RG3A 3UTFA 2WETA 3UP5A 1RSGA 4Z25A 2XLPA 4XXGA 1B8SA 3ADAB 1CC6A 3BHKA 3CGDA 3IHGA 1Y56B 3NN0X 1JRXA 4OPLA 2X3NA 4A6NB 4YSYA 1PN0A 2WP9A 4H7UA 2VRLA 3AYLA 1B5QA 1RP0A 2V61A 2EQ8A 1NAAA 3ICSA 4OPUA 3AE6A 4K2XA 1VG0A 3BNMA 5EB5A 3SY4A 3SX6A 1JRZA 2WHDA 1E1LA 2ZBWA 4TM0A 4ZCCA 2YG7A 3VQRA 5C2TA 2QCUA 2CFYA 4C74A 2WBAA 1GXFA 4G74A 2DKIA 4WX1A 2GAGB 3GD3A 2OA1A 1D7YA 1CHUA 1GTHA
chains in the Genus database with same CATH topology
2XVJA 3T2ZA 4CCQA 1NPXA 4AOXA 4K5RA 1ZK7A 5KMQA 5FMHA 3NLCA 3M0OA 4BK2A 4MJWA 3S5WA 5M10A 4H4XA 5FS8A 4BK1A 3V3OA 3AXBA 1F3PA 3AE2A 4P9SA 2E5VA 1JNRA 4H4RA 5KMPA 2GR3A 2DKHA 2WOIA 3L8KA 3GMBA 1D4CA 2GAHB 1JOAA 2EQ7A 1NENA 1TDFA 2RGOA 1EL9A 1L9CA 3AE7A 3ALLA 3GWFA 5JCLA 2J3NA 3CIRA 1DOCA 1GRGA 2WDQA 2Q6UA 2PYXA 2XFNA 2X8HA 4U8PA 1PXBA 2GQWA 2YLRA 3QFAA 4UDQA 1LTXR 5KVHA 3AYJA 3NIXA 4I59A 2BABA 1DXLA 3UKLA 3GSIA 1P2HA 3CNDA 2C7GA 3K7TA 2XDOA 4G6GA 1RYIA 1CL0A 2JB1A 2B7SA 2R9ZA 3IHMA 1OJAA 1K0JA 1NHQA 5KMRA 1ZDLA 3NTAA 2BYBA 1H86A 2R45A 1GREA 1GOSA 2F5ZA 3P4RA 2XLUA 1TDKA 1GV4A 3GWDA 3H8IA 5DBJA 4GF7A 1SEZA 1QJDA 5JCNA 3OZ2A 3UKFA 1DNCA 2VZ2A 1B4VA 2YVFA 3ICRA 2X50A 3KPFA 3V76A 4B67A 1PXCA 4C5OA 3H8LA 1N4VA 2JK6A 4CNKA 4USRA 4GDPA 1YQZA 3AEBA 4EQWA 3FMWA 4HB9A 2C72A 5EB4A 3CMMA 1H7WA 1LQUA 1NG3A 1EL8A 3AEDA 4YXDA 3PS9A 4YT0A 3CNTA 1JRYA 2NPXA 3GYIA 3AE8A 3Q6JA 4D03A 3NTDA 3B6DA 4JNQA 4KPRA 2FJEA 3LJPA 3NRNA 1L0VA 4ADWA 3EAOA 4Y4NA 2XVHA 2FJBA 3P4PA 3KPKA 5U1OA 3FIMB 3BI5A 2ARDA 2YR4A 4AT2A 3DH9A 1GRTA 4NTCA 1NEKA 1F8WA 1VRQB 4H4QA 4YSXA 1IUSA 2CULA 2X8GA 3T2YA 2BS2A 2C4CA 4EQRA 1CC2A 2JAEA 3GYJA 1FCDA 2RGHA 2YG5A 1IUWA 3M12A 5KWFA 5CKUA 3SFEA 4TLXA 1YQ4A 3GYXA 2Q7VA 1GPEA 2ACZA 2YQUA 1TYPA 1F8SA 2XVEA 4FX9A 4PABA 5HHFA 3SYIA 2AAQA 1H83A 5KOWA 1FECA 1NHPA 1ELIA 3DMEA 4IA6A 3NT6A 1O94A 1OJ9A 1BGNA 3AE3A 5BULA 1FEBA 4FK1A 4B63A 1DOEA 4EIPA 4PAAA 2BRYA 2RABA 1O5WA 3KLJA 2GV8A 3E1TA 2WPCA 2BK4A 2YG3A 1E6EA 2B9WA 1CC4A 4YKFA 2UZZA 2IIDA 2GEWA 2A8XA 2X99A 3ABVA 5GRTA 3EPTA 4G73A 1IUUA 1REOA 1KDGA 1XHCA 2E1MA 2V3BA 2WP6A 4U2SA 3UKHA 2GH5A 5KVIA 1ZX9A 1IUTA 1VQWA 3URHA 1DJNA 3NHOX 3UOZA 3HYXA 1P2EA 4TM1A 4APNA 3AEAA 4C3XA 2ZZBA 4U8MA 2R0CA 1Q1WA 3ZDNA 4A5LA 3GDNA 1GESA 5L46A 3NKSA 1CF3A 1LVLA 4BJYA 1S3BA 2BXSA 5BRTA 2R0GA 3WE0A 1GTEA 1DJQA 3CPIG 4YTMA 1KSUA 4Z26A 4GDEA 5HYMA 4RSLA 1CJ3A 1TDOA 2YAUA 3KD9A 4X9MA 4H4ZA 1PBDA 1JEHA 3NK0X 2R4JA 4TM3A 3VR8A 1ZKQA 1D7LA 3DGZA 3LZXA 4REKA 3AD7B 1V59A 1VDCA 4AP3A 4GAVA 1O95A 2XCGA 2YLTA 3RNMA 4OPDA 4CRTA 1D4DA 1BZLA 2PHHA 3II4A 1TYTA 4LU6A 2HQMA 1KFYA 4ECHA 3P1WA 3T37A 1IUXA 1DODA 4YSHA 3GRTA 4OVIA 2TMDA 3UOYA 1MOKA 1VG9A 2YM2A 1FOHA 2YLSA 3ZYXA 3IWAA 1N4UA 3BI4A 3DK4A 4JY2A 5EOWA 3OC4A 4NZHA 4BK3A 4NWZA 2C75A 4Z2UA 1ZY8A 2C76A 2X8CA 5U25A 4NEVA 1LJ1A 2R0PA 1KF6A 2XFUA 4H4TA 2C66A 1ONFA 1PBCA 2GMJA 2V6OA 2WU5A 3FBSA 1LV0A 3KA7A 4CY6A 1CJ4A 1FL2A 2B7RA 1M64A 3C4AA 3HYVA 3SZWA 1MO9A 1NHRA 2VOUA 1OJCA 2WPFA 2C73A 1GRAA 1NDAA 1TRBA 3AE9A 3HYWA 4TLZA 1Z6LA 2OALA 3ATQA 3QFBA 3BI2A 4EMWA 1EBDA 1H84A 3H4KA 5TR3A 3RP7A 5IPYA 4LA1A 4JDRA 3C4NA 4BJZA 2WESA 1E39A 2C64A 3DJEA 4Z24A 2VVLG 4OPCA 4B66A 1XPQA 1F8RA 1ZOYA 1PBEA 3SZCA 3SQPA 2BCPA 2H89A 3CNPA 3M13A 2A89A 4AOSA 3ALJA 1FEAA 2V3AA 4IVMB 4YTPA 1KSSA 2C67A 1E1MA 2O9ZA 2XFOA 1S3EA 1ZMDA 2V5ZA 3NNEA 2IVDA 5LV9A 1XDIA 1Y0PA 2GR0A 5JCIA 3UP4A 3AWIA 3G5QA 4O5UA 2EQ9A 1GT8A 2VQBA 1EL5A 4H4SA 4A99A 4C3YA 4U8KA 4Z44A 1COYA 2BCGG 3SXIA 2B9XA 2C70A 1YKJA 4DSGA 3AEGA 1GNDA 4G9KA 3VRDB 2XFQA 2YM1A 2QA1A 3CGEA 5FS7A 3F8DA 2WEUA 1F6MA 3UOVA 4H2RA 3UKPA 2Y6QA 3LB8A 5KMSA 3NN6X 5EBKA 3ALMA 5CQFA 4X4JA 2A87A 2EQ6A 1PBFA 1IUVA 1GERA 2H88A 3G5SA 3QSMA 4U8IA 2Z5YA 1GALA 2CVJA 2JB3A 2Z5XA 5JCKA 1ZMCA 2YWLA 1Q1RA 2YVJA 4GUVA 1ZP0A 1LQTA 3QVPA 2BXRA 2GRTA 3K7QX 4J2WA 1HYUA 3CGCA 2JB2A 3PVCA 1L9EA 4FK1C 2YG6A 3AE1A 3CGBA 4J56A 4IVOB 3UKKA 4CY8A 2C3DA 4U2LA 3GRSA 4H2QA 1OJDA 1N4WA 4YWOA 5GSNA 2JKCA 3GDPA 3K30A 4IA5A 2QA2A 2OLOA 2VVLA 2Q0KA 3PO7A 1JU2A 2YLXA 3QJ4A 4OPIA 4EIQA 3NGCX 1S2QA 2Q0LA 3Q9TA 2BS4A 4A9WA 2BRAA 5J7XA 1DOBA 4BV6A 2VQ7A 3F8PA 4YTNA 5IQ4A 3F8RA 4H2PA 1YQ3A 3KVEA 4U8NA 5IQ1A 1ZOVA 1MXTA 1XANA 4K5SA 3SM8A 2BK3A 3GD4A 4JQ9A 2GF3A 3LOVA 4Z43A 1L9DA 1LPFA 3FG2P 4USQA 2C3CA 2BC1A 4UP3A 1CBOA 1GEUA 2WDVA 2BK5A 4LIIA 3DGHA 4TM4A 3R9UA 2B9YA 3NYCA 3QVRA 2I0ZA 1D5TA 4UDRA 4JY3A 2NVKX 3HZLA 2BA9A 3AE5A 3VRBA 2YLZA 3LADA 3KKJA 3COXA 5M0ZA 2B76A 4EM3A 3NYEA 1K0LA 4U8JA 4ZCDA 5FS9A 4AT0A 1S2YA 1TDNA 1NHSA 2XYOA 5FS6A 3CPJG 2BS3A 2GVCA 1GRHA 4YKGA 4J33A 4XWRA 1AOGA 1UKVG 5HY5A 1BWCA 3UOXA 3DJGX 3CN8A 1QLBA 2V60A 5KXJA 3B3RA 1Q9IA 3NK1X 4NNJA 3SZFA 4K22A 4GRTA 3VRAA 2W0HA 2ZZ0A 3IC9A 3ISHA 1GRFA 3UTGA 4JN9A 1H82A 4O5QA 1BGJA 3LXDA 3D8XA 3NK2X 1W4XA 4H4UA 4AP1A 4II2A 4B1BA 3RP6A 1JNZA 3DA1A 3V3NA 4K7ZA 5BUKA 3JSKA 4K8DA 3KU9A 5J60A 4DSHA 4H2NA 3I3LA 4NEWA 3QSSA 1E7PA 3RHAA 2WU2A 1TDEA 1CJCA 3AD8B 3UCLA 3SGLA 3UTEA 3S61A 4CNJA 4N9XA 3T14A 1PS9A 4EMIA 4KX6A 3NYFA 4J31A 1BF3A 1E1KA 2WQYA 3REDA 4U8LA 3SZ0A 2YLWA 2WOWA 2OAMA 2BC0A 1PXAA 3AD9B 3P9UA 4FDCB 3LZWA 3CNJA 4XWZA 5HXIA 1IJHA 2IVEA 3CTYA 4EM4A 4Z2TA 2E4GA 3DK9A 5BVAA 2TPRA 1NG4A 1N1PA 2WS3A 1PHHA 1YY5A 3ATRA 1EL7A 1CJ2A 1K4QA 3AYIA 4ICYA 3L1RA 3VR9A 3AE4A 4A65A 5JCMA 3DJDA 2XVIA 3AEEA 3CPHG 4M52A 2WDRA 4WCTA 4Z2RA 4G6HA 3SFDA 2WP5A 3K7MX 4UDPA 1PDHA 1GRBA 1M6IA 2OLNA 3P4SA 1B37A 3GMCA 4II3A 4RG4A 2BACA 1OJTA 2QAEA 4B68A 4BURA 4EMJA 3T31A 1D4EA 1KNPA 4E0VA 1H81A 3AB1A 3UKAA 3IF9A 4ZN0A 2GQFA 2R4EA 4B65A 4H4VA 1KNRA 4J36A 2AQJA 3C96A 4H4YA 5ER0A 4EQXA 2R46A 2WOVA 2VVMA 3BNUA 2XVFA 3QSEA 3G5RA 4Y4LA 3RP8A 4A7AA 4YSZA 4Y4MA 2Y6RA 4DNAA 2ZZCA 1H6VA 2APGA 3EF6A 3EANA 1PJ5A 3AEFA 1GSNA 2YR6A 1QO8A 4IV9A 4CBQA 2YG4A 4I58A 4NTEA 2RGJA 4JNAA 2FBWA 4A79A 2WPEA 4GR1A 5U63A 4J57A 2AR8A 2YR5A 2GR2A 3DJJA 3ICTA 2CDUA 3D1CA 1PBBA 3DK8A 4GAPA 4U2TA 2GR1A 2XFPA 1H7XA 3P4QA 1PJ7A 3NH3X 5KOXA 3AECA 4OCGA 4U8OA 4CCRA 3T0KA 2GMHA 4HA6A 4H4PA 1PJ6A 4C77A 4EQSA 4H4WA 4OPGA 3UKQA 2GB0A 4B69A 3ITJA 2XLSA 3BHFA 3I6DA 4OPTA 3UTHA 5KRQA 4NTDA 4X9NA 4B64A 4DGKA 1X31B 2XLTA 3NG7X 3O0HA 5KNLA 2C65A 3CNSA 5C3JA 3FPZA 2FJAA 2JBVA 1BKWA 4J34A 2XLRA 4H50A 2FJDA 4GCMA 1Y56A 4D04A 2YVGA 4A6NA 1GETA 1E1NA 1K0IA 2VRMA 3T2KA 4RG3A 3UTFA 2WETA 3UP5A 1RSGA 4Z25A 2XLPA 4XXGA 1B8SA 3ADAB 1CC6A 3BHKA 3CGDA 3IHGA 1Y56B 3NN0X 1JRXA 4OPLA 2X3NA 4A6NB 4YSYA 1PN0A 2WP9A 4H7UA 2VRLA 3AYLA 1B5QA 1RP0A 2V61A 2EQ8A 1NAAA 3ICSA 4OPUA 3AE6A 4K2XA 1VG0A 3BNMA 5EB5A 3SY4A 3SX6A 1JRZA 2WHDA 1E1LA 2ZBWA 4TM0A 4ZCCA 2YG7A 3VQRA 5C2TA 2QCUA 2CFYA 4C74A 2WBAA 1GXFA 4G74A 2DKIA 4WX1A 2GAGB 3GD3A 2OA1A 1D7YA 1CHUA 1GTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVJ A;  4CCQ A;  1NPX A;  4AOX A;  4K5R A;  1ZK7 A;  5FMH A;  3NLC A;  3M0O A;  4BK2 A;  4MJW A;  3S5W A;  5M10 A;  4H4X A;  5FS8 A;  4BK1 A;  3V3O A;  3AXB A;  1F3P A;  3AE2 A;  4P9S A;  2E5V A;  1JNR A;  4H4R A;  2GR3 A;  2DKH A;  2WOI A;  3L8K A;  3GMB A;  1D4C A;  2GAH B;  1JOA A;  2EQ7 A;  1NEN A;  1TDF A;  2RGO A;  1EL9 A;  1L9C A;  3AE7 A;  3ALL A;  3GWF A;  5JCL A;  2J3N A;  3CIR A;  1DOC A;  1GRG A;  2WDQ A;  2Q6U A;  2PYX A;  2XFN A;  2X8H A;  4U8P A;  1PXB A;  2GQW A;  2YLR A;  3QFA A;  4UDQ A;  1LTX R;  5KVH A;  3AYJ A;  3NIX A;  4I59 A;  2BAB A;  1DXL A;  3UKL A;  3GSI A;  1P2H A;  3CND A;  2C7G A;  3K7T A;  2XDO A;  1RYI A;  1CL0 A;  2JB1 A;  2B7S A;  2R9Z A;  3IHM A;  1OJA A;  1K0J A;  1NHQ A;  1ZDL A;  3NTA A;  2BYB A;  1H86 A;  2R45 A;  1GRE A;  1GOS A;  2F5Z A;  3P4R A;  2XLU A;  1TDK A;  1GV4 A;  3GWD A;  3H8I A;  5DBJ A;  4GF7 A;  1SEZ A;  1QJD A;  5JCN A;  3OZ2 A;  3UKF A;  1DNC A;  2VZ2 A;  1B4V A;  2YVF A;  3ICR A;  2X50 A;  3KPF A;  3V76 A;  4B67 A;  1PXC A;  4C5O A;  3H8L A;  1N4V A;  2JK6 A;  4CNK A;  4USR A;  4GDP A;  1YQZ A;  3AEB A;  4EQW A;  3FMW A;  4HB9 A;  2C72 A;  5EB4 A;  1H7W A;  1LQU A;  1NG3 A;  1EL8 A;  3AED A;  4YXD A;  3PS9 A;  4YT0 A;  3CNT A;  1JRY A;  2NPX A;  3GYI A;  3AE8 A;  3Q6J A;  3NTD A;  3B6D A;  4JNQ A;  4KPR A;  2FJE A;  3LJP A;  3NRN A;  1L0V A;  4ADW A;  3EAO A;  4Y4N A;  2XVH A;  2FJB A;  3P4P A;  5U1O A;  3FIM B;  3BI5 A;  2ARD A;  2YR4 A;  4AT2 A;  3DH9 A;  1GRT A;  4NTC A;  1NEK A;  1F8W A;  1VRQ B;  4H4Q A;  4YSX A;  1IUS A;  2CUL A;  2X8G A;  2BS2 A;  4EQR A;  1CC2 A;  2JAE A;  3GYJ A;  1FCD A;  2RGH A;  2YG5 A;  1IUW A;  3M12 A;  5KWF A;  5CKU A;  3SFE A;  4TLX A;  1YQ4 A;  2Q7V A;  1GPE A;  2ACZ A;  2YQU A;  1TYP A;  1F8S A;  2XVE A;  4FX9 A;  4PAB A;  5HHF A;  2AAQ A;  1H83 A;  5KOW A;  1FEC A;  1NHP A;  1ELI A;  3DME A;  4IA6 A;  3NT6 A;  1O94 A;  1OJ9 A;  1BGN A;  3AE3 A;  5BUL A;  1FEB A;  4FK1 A;  4B63 A;  1DOE A;  4EIP A;  4PAA A;  3KLJ A;  2RAB A;  1O5W A;  2GV8 A;  3E1T A;  2WPC A;  2BK4 A;  2YG3 A;  1E6E A;  2B9W A;  1CC4 A;  4YKF A;  2UZZ A;  2IID A;  2GEW A;  2A8X A;  2X99 A;  3ABV A;  5GRT A;  3EPT A;  4D03 A;  1IUU A;  1REO A;  1KDG A;  1XHC A;  2E1M A;  2V3B A;  2WP6 A;  4U2S A;  3UKH A;  2GH5 A;  5KVI A;  1ZX9 A;  1IUT A;  1VQW A;  3URH A;  1DJN A;  3NHO X;  3UOZ A;  1P2E A;  4TM1 A;  4APN A;  3AEA A;  4C3X A;  2ZZB A;  4U8M A;  2R0C A;  1Q1W A;  3ZDN A;  4A5L A;  3GDN A;  1GES A;  5L46 A;  3NKS A;  1CF3 A;  1LVL A;  4BJY A;  1S3B A;  2BXS A;  5BRT A;  2R0G A;  3WE0 A;  1GTE A;  1DJQ A;  3CPI G;  4YTM A;  1KSU A;  4Z26 A;  4GDE A;  5HYM A;  4RSL A;  1CJ3 A;  1TDO A;  2YAU A;  3KD9 A;  4X9M A;  4H4Z A;  1PBD A;  1JEH A;  3NK0 X;  2R4J A;  4TM3 A;  3VR8 A;  1ZKQ A;  1D7L A;  3DGZ A;  3LZX A;  4REK A;  3AD7 B;  1V59 A;  1VDC A;  4AP3 A;  1O95 A;  2XCG A;  2YLT A;  3RNM A;  4OPD A;  4CRT A;  1D4D A;  1BZL A;  2PHH A;  3II4 A;  1TYT A;  4LU6 A;  2HQM A;  1KFY A;  4ECH A;  3P1W A;  3T37 A;  1IUX A;  1DOD A;  4YSH A;  3GRT A;  4OVI A;  2TMD A;  3UOY A;  1MOK A;  1VG9 A;  2YM2 A;  1FOH A;  2YLS A;  3ZYX A;  3IWA A;  1N4U A;  3BI4 A;  3DK4 A;  4JY2 A;  5EOW A;  3OC4 A;  4NZH A;  4BK3 A;  4Z2U A;  2C75 A;  1ZY8 A;  2C76 A;  2X8C A;  5U25 A;  4NEV A;  1LJ1 A;  2R0P A;  1KF6 A;  2XFU A;  4H4T A;  2C66 A;  1ONF A;  1PBC A;  2GMJ A;  2V6O A;  2WU5 A;  3FBS A;  1LV0 A;  3KA7 A;  4CY6 A;  1CJ4 A;  1FL2 A;  2B7R A;  1M64 A;  3C4A A;  1MO9 A;  1NHR A;  2VOU A;  1OJC A;  2WPF A;  2C73 A;  1GRA A;  1NDA A;  1TRB A;  3AE9 A;  4TLZ A;  1Z6L A;  2OAL A;  3ATQ A;  3QFB A;  3BI2 A;  4EMW A;  1EBD A;  1H84 A;  3H4K A;  5TR3 A;  3RP7 A;  5IPY A;  4LA1 A;  4JDR A;  3C4N A;  4BJZ A;  2WES A;  1E39 A;  2C64 A;  3DJE A;  4Z24 A;  2VVL G;  4OPC A;  4B66 A;  1XPQ A;  1F8R A;  1ZOY A;  1PBE A;  3SQP A;  2BCP A;  2H89 A;  3CNP A;  3M13 A;  2A89 A;  4AOS A;  3ALJ A;  1FEA A;  2V3A A;  4IVM B;  4YTP A;  1KSS A;  2C67 A;  1E1M A;  2O9Z A;  2XFO A;  1S3E A;  1ZMD A;  2V5Z A;  3NNE A;  2IVD A;  5LV9 A;  1XDI A;  1Y0P A;  2GR0 A;  5JCI A;  3UP4 A;  3AWI A;  3G5Q A;  4O5U A;  2EQ9 A;  1GT8 A;  2VQB A;  1EL5 A;  4H4S A;  4A99 A;  4C3Y A;  4U8K A;  4Z44 A;  1COY A;  2BCG G;  2B9X A;  2C70 A;  1YKJ A;  4DSG A;  3AEG A;  1GND A;  3VRD B;  2XFQ A;  2YM1 A;  2QA1 A;  3CGE A;  5FS7 A;  3F8D A;  2WEU A;  1F6M A;  3UOV A;  4H2R A;  3UKP A;  2Y6Q A;  3LB8 A;  3NN6 X;  5EBK A;  3ALM A;  5CQF A;  4X4J A;  2A87 A;  2EQ6 A;  1PBF A;  1IUV A;  1GER A;  2H88 A;  3G5S A;  3QSM A;  4U8I A;  2Z5Y A;  1GAL A;  2CVJ A;  2JB3 A;  2Z5X A;  5JCK A;  1ZMC A;  2YWL A;  1Q1R A;  2YVJ A;  4GUV A;  1ZP0 A;  1LQT A;  3QVP A;  2BXR A;  2GRT A;  3K7Q X;  4J2W A;  1HYU A;  3CGC A;  2JB2 A;  3PVC A;  1L9E A;  4FK1 C;  2YG6 A;  3AE1 A;  3CGB A;  4J56 A;  4IVO B;  3UKK A;  4CY8 A;  2C3D A;  4U2L A;  3GRS A;  4H2Q A;  1OJD A;  1N4W A;  4YWO A;  5GSN A;  2JKC A;  3GDP A;  3K30 A;  4IA5 A;  2QA2 A;  2OLO A;  2VVL A;  2Q0K A;  3PO7 A;  1JU2 A;  2YLX A;  3QJ4 A;  4OPI A;  4EIQ A;  3NGC X;  1S2Q A;  2Q0L A;  3Q9T A;  2BS4 A;  4A9W A;  5J7X A;  1DOB A;  4BV6 A;  2VQ7 A;  3F8P A;  4YTN A;  5IQ4 A;  3F8R A;  4H2P A;  1YQ3 A;  3KVE A;  4U8N A;  5IQ1 A;  1ZOV A;  1MXT A;  1XAN A;  4K5S A;  3SM8 A;  2BK3 A;  3GD4 A;  4JQ9 A;  2GF3 A;  3LOV A;  4Z43 A;  1L9D A;  1LPF A;  3FG2 P;  4USQ A;  2C3C A;  2BC1 A;  4UP3 A;  1CBO A;  1GEU A;  2WDV A;  2BK5 A;  4LII A;  3DGH A;  4TM4 A;  3R9U A;  2B9Y A;  3NYC A;  3QVR A;  2I0Z A;  1D5T A;  4UDR A;  4JY3 A;  2NVK X;  3HZL A;  2BA9 A;  3AE5 A;  3VRB A;  2YLZ A;  3LAD A;  3KKJ A;  3COX A;  5M0Z A;  2B76 A;  4EM3 A;  3NYE A;  1K0L A;  4U8J A;  4ZCD A;  5FS9 A;  4AT0 A;  1S2Y A;  1TDN A;  1NHS A;  2XYO A;  5FS6 A;  3CPJ G;  2BS3 A;  2GVC A;  1GRH A;  4YKG A;  4J33 A;  4XWR A;  1AOG A;  1UKV G;  5HY5 A;  1BWC A;  3UOX A;  3DJG X;  3CN8 A;  1QLB A;  2V60 A;  5KXJ A;  3B3R A;  1Q9I A;  3NK1 X;  4K22 A;  4GRT A;  3VRA A;  2W0H A;  2ZZ0 A;  3IC9 A;  3ISH A;  1GRF A;  3UTG A;  4JN9 A;  1H82 A;  4O5Q A;  1BGJ A;  3LXD A;  3D8X A;  3NK2 X;  1W4X A;  4H4U A;  4AP1 A;  4B1B A;  3RP6 A;  1JNZ A;  3DA1 A;  3V3N A;  4K7Z A;  5BUK A;  3JSK A;  4K8D A;  3KU9 A;  5J60 A;  4DSH A;  4H2N A;  3I3L A;  4NEW A;  3QSS A;  1E7P A;  3RHA A;  2WU2 A;  1TDE A;  1CJC A;  3AD8 B;  3UCL A;  3SGL A;  3UTE A;  3S61 A;  4CNJ A;  4N9X A;  4EMI A;  1PS9 A;  4KX6 A;  3NYF A;  4J31 A;  1BF3 A;  1E1K A;  2WQY A;  3RED A;  4U8L A;  2YLW A;  2WOW A;  2OAM A;  2BC0 A;  1PXA A;  3AD9 B;  3P9U A;  4FDC B;  3LZW A;  3CNJ A;  4XWZ A;  5HXI A;  1IJH A;  2IVE A;  3CTY A;  4EM4 A;  4Z2T A;  2E4G A;  3DK9 A;  5BVA A;  2TPR A;  1NG4 A;  1N1P A;  2WS3 A;  1PHH A;  1YY5 A;  3ATR A;  1EL7 A;  1CJ2 A;  1K4Q A;  3AYI A;  4ICY A;  3L1R A;  3VR9 A;  3AE4 A;  4A65 A;  5JCM A;  3DJD A;  2XVI A;  3AEE A;  3CPH G;  4M52 A;  2WDR A;  4WCT A;  4Z2R A;  3SFD A;  2WP5 A;  3K7M X;  4UDP A;  1PDH A;  1GRB A;  1M6I A;  2OLN A;  3P4S A;  1B37 A;  3GMC A;  4RG4 A;  2BAC A;  1OJT A;  2QAE A;  4B68 A;  4BUR A;  4EMJ A;  1D4E A;  1KNP A;  4E0V A;  1H81 A;  3AB1 A;  3UKA A;  3IF9 A;  4ZN0 A;  2GQF A;  2R4E A;  4B65 A;  4H4V A;  1KNR A;  4J36 A;  2AQJ A;  3C96 A;  4H4Y A;  5ER0 A;  4EQX A;  2R46 A;  2WOV A;  2VVM A;  3BNU A;  2XVF A;  3QSE A;  3G5R A;  4Y4L A;  3RP8 A;  4A7A A;  4YSZ A;  4Y4M A;  2Y6R A;  4DNA A;  2ZZC A;  1H6V A;  2APG A;  3EF6 A;  3EAN A;  1PJ5 A;  3AEF A;  1GSN A;  2YR6 A;  1QO8 A;  4IV9 A;  4CBQ A;  2YG4 A;  4I58 A;  4NTE A;  2RGJ A;  4JNA A;  2FBW A;  4A79 A;  2WPE A;  4GR1 A;  5U63 A;  4J57 A;  2AR8 A;  2YR5 A;  2GR2 A;  3DJJ A;  3ICT A;  2CDU A;  3D1C A;  1PBB A;  3DK8 A;  4U2T A;  2GR1 A;  2XFP A;  1H7X A;  3P4Q A;  1PJ7 A;  3NH3 X;  5KOX A;  3AEC A;  4OCG A;  4U8O A;  4CCR A;  2GMH A;  4HA6 A;  4H4P A;  1PJ6 A;  4C77 A;  4EQS A;  4H4W A;  4OPG A;  3UKQ A;  2GB0 A;  4B69 A;  3ITJ A;  2XLS A;  3BHF A;  3I6D A;  4OPT A;  3UTH A;  5KRQ A;  4NTD A;  4X9N A;  4B64 A;  4DGK A;  1X31 B;  2XLT A;  3NG7 X;  3O0H A;  2C65 A;  3CNS A;  5C3J A;  3FPZ A;  2FJA A;  2JBV A;  1BKW A;  4J34 A;  2XLR A;  4H50 A;  2FJD A;  4GCM A;  1Y56 A;  4D04 A;  2YVG A;  4A6N A;  1GET A;  1E1N A;  1K0I A;  2VRM A;  4RG3 A;  3UTF A;  2WET A;  3UP5 A;  1RSG A;  4Z25 A;  2XLP A;  4XXG A;  1B8S A;  3ADA B;  1CC6 A;  3BHK A;  3CGD A;  3IHG A;  1Y56 B;  3NN0 X;  1JRX A;  4OPL A;  2X3N A;  4A6N B;  4YSY A;  1PN0 A;  2WP9 A;  4H7U A;  2VRL A;  3AYL A;  1B5Q A;  1RP0 A;  2V61 A;  2EQ8 A;  1NAA A;  3ICS A;  4OPU A;  3AE6 A;  4K2X A;  1VG0 A;  3BNM A;  5EB5 A;  1JRZ A;  2WHD A;  1E1L A;  2ZBW A;  4TM0 A;  4ZCC A;  2YG7 A;  3VQR A;  5C2T A;  2QCU A;  2CFY A;  4C74 A;  2WBA A;  1GXF A;  2DKI A;  4WX1 A;  2GAG B;  3GD3 A;  2OA1 A;  1D7Y A;  1CHU A;  1GTH A; 
#chains in the Genus database with same CATH topology
 2XVJ A;  3T2Z A;  4CCQ A;  1NPX A;  4AOX A;  4K5R A;  1ZK7 A;  5KMQ A;  5FMH A;  3NLC A;  3M0O A;  4BK2 A;  4MJW A;  3S5W A;  5M10 A;  4H4X A;  5FS8 A;  4BK1 A;  3V3O A;  3AXB A;  1F3P A;  3AE2 A;  4P9S A;  2E5V A;  1JNR A;  4H4R A;  5KMP A;  2GR3 A;  2DKH A;  2WOI A;  3L8K A;  3GMB A;  1D4C A;  2GAH B;  1JOA A;  2EQ7 A;  1NEN A;  1TDF A;  2RGO A;  1EL9 A;  1L9C A;  3AE7 A;  3ALL A;  3GWF A;  5JCL A;  2J3N A;  3CIR A;  1DOC A;  1GRG A;  2WDQ A;  2Q6U A;  2PYX A;  2XFN A;  2X8H A;  4U8P A;  1PXB A;  2GQW A;  2YLR A;  3QFA A;  4UDQ A;  1LTX R;  5KVH A;  3AYJ A;  3NIX A;  4I59 A;  2BAB A;  1DXL A;  3UKL A;  3GSI A;  1P2H A;  3CND A;  2C7G A;  3K7T A;  2XDO A;  4G6G A;  1RYI A;  1CL0 A;  2JB1 A;  2B7S A;  2R9Z A;  3IHM A;  1OJA A;  1K0J A;  1NHQ A;  5KMR A;  1ZDL A;  3NTA A;  2BYB A;  1H86 A;  2R45 A;  1GRE A;  1GOS A;  2F5Z A;  3P4R A;  2XLU A;  1TDK A;  1GV4 A;  3GWD A;  3H8I A;  5DBJ A;  4GF7 A;  1SEZ A;  1QJD A;  5JCN A;  3OZ2 A;  3UKF A;  1DNC A;  2VZ2 A;  1B4V A;  2YVF A;  3ICR A;  2X50 A;  3KPF A;  3V76 A;  4B67 A;  1PXC A;  4C5O A;  3H8L A;  1N4V A;  2JK6 A;  4CNK A;  4USR A;  4GDP A;  1YQZ A;  3AEB A;  4EQW A;  3FMW A;  4HB9 A;  2C72 A;  5EB4 A;  3CMM A;  1H7W A;  1LQU A;  1NG3 A;  1EL8 A;  3AED A;  4YXD A;  3PS9 A;  4YT0 A;  3CNT A;  1JRY A;  2NPX A;  3GYI A;  3AE8 A;  3Q6J A;  4D03 A;  3NTD A;  3B6D A;  4JNQ A;  4KPR A;  2FJE A;  3LJP A;  3NRN A;  1L0V A;  4ADW A;  3EAO A;  4Y4N A;  2XVH A;  2FJB A;  3P4P A;  3KPK A;  5U1O A;  3FIM B;  3BI5 A;  2ARD A;  2YR4 A;  4AT2 A;  3DH9 A;  1GRT A;  4NTC A;  1NEK A;  1F8W A;  1VRQ B;  4H4Q A;  4YSX A;  1IUS A;  2CUL A;  2X8G A;  3T2Y A;  2BS2 A;  2C4C A;  4EQR A;  1CC2 A;  2JAE A;  3GYJ A;  1FCD A;  2RGH A;  2YG5 A;  1IUW A;  3M12 A;  5KWF A;  5CKU A;  3SFE A;  4TLX A;  1YQ4 A;  3GYX A;  2Q7V A;  1GPE A;  2ACZ A;  2YQU A;  1TYP A;  1F8S A;  2XVE A;  4FX9 A;  4PAB A;  5HHF A;  3SYI A;  2AAQ A;  1H83 A;  5KOW A;  1FEC A;  1NHP A;  1ELI A;  3DME A;  4IA6 A;  3NT6 A;  1O94 A;  1OJ9 A;  1BGN A;  3AE3 A;  5BUL A;  1FEB A;  4FK1 A;  4B63 A;  1DOE A;  4EIP A;  4PAA A;  2BRY A;  2RAB A;  1O5W A;  3KLJ A;  2GV8 A;  3E1T A;  2WPC A;  2BK4 A;  2YG3 A;  1E6E A;  2B9W A;  1CC4 A;  4YKF A;  2UZZ A;  2IID A;  2GEW A;  2A8X A;  2X99 A;  3ABV A;  5GRT A;  3EPT A;  4G73 A;  1IUU A;  1REO A;  1KDG A;  1XHC A;  2E1M A;  2V3B A;  2WP6 A;  4U2S A;  3UKH A;  2GH5 A;  5KVI A;  1ZX9 A;  1IUT A;  1VQW A;  3URH A;  1DJN A;  3NHO X;  3UOZ A;  3HYX A;  1P2E A;  4TM1 A;  4APN A;  3AEA A;  4C3X A;  2ZZB A;  4U8M A;  2R0C A;  1Q1W A;  3ZDN A;  4A5L A;  3GDN A;  1GES A;  5L46 A;  3NKS A;  1CF3 A;  1LVL A;  4BJY A;  1S3B A;  2BXS A;  5BRT A;  2R0G A;  3WE0 A;  1GTE A;  1DJQ A;  3CPI G;  4YTM A;  1KSU A;  4Z26 A;  4GDE A;  5HYM A;  4RSL A;  1CJ3 A;  1TDO A;  2YAU A;  3KD9 A;  4X9M A;  4H4Z A;  1PBD A;  1JEH A;  3NK0 X;  2R4J A;  4TM3 A;  3VR8 A;  1ZKQ A;  1D7L A;  3DGZ A;  3LZX A;  4REK A;  3AD7 B;  1V59 A;  1VDC A;  4AP3 A;  4GAV A;  1O95 A;  2XCG A;  2YLT A;  3RNM A;  4OPD A;  4CRT A;  1D4D A;  1BZL A;  2PHH A;  3II4 A;  1TYT A;  4LU6 A;  2HQM A;  1KFY A;  4ECH A;  3P1W A;  3T37 A;  1IUX A;  1DOD A;  4YSH A;  3GRT A;  4OVI A;  2TMD A;  3UOY A;  1MOK A;  1VG9 A;  2YM2 A;  1FOH A;  2YLS A;  3ZYX A;  3IWA A;  1N4U A;  3BI4 A;  3DK4 A;  4JY2 A;  5EOW A;  3OC4 A;  4NZH A;  4BK3 A;  4NWZ A;  2C75 A;  4Z2U A;  1ZY8 A;  2C76 A;  2X8C A;  5U25 A;  4NEV A;  1LJ1 A;  2R0P A;  1KF6 A;  2XFU A;  4H4T A;  2C66 A;  1ONF A;  1PBC A;  2GMJ A;  2V6O A;  2WU5 A;  3FBS A;  1LV0 A;  3KA7 A;  4CY6 A;  1CJ4 A;  1FL2 A;  2B7R A;  1M64 A;  3C4A A;  3HYV A;  3SZW A;  1MO9 A;  1NHR A;  2VOU A;  1OJC A;  2WPF A;  2C73 A;  1GRA A;  1NDA A;  1TRB A;  3AE9 A;  3HYW A;  4TLZ A;  1Z6L A;  2OAL A;  3ATQ A;  3QFB A;  3BI2 A;  4EMW A;  1EBD A;  1H84 A;  3H4K A;  5TR3 A;  3RP7 A;  5IPY A;  4LA1 A;  4JDR A;  3C4N A;  4BJZ A;  2WES A;  1E39 A;  2C64 A;  3DJE A;  4Z24 A;  2VVL G;  4OPC A;  4B66 A;  1XPQ A;  1F8R A;  1ZOY A;  1PBE A;  3SZC A;  3SQP A;  2BCP A;  2H89 A;  3CNP A;  3M13 A;  2A89 A;  4AOS A;  3ALJ A;  1FEA A;  2V3A A;  4IVM B;  4YTP A;  1KSS A;  2C67 A;  1E1M A;  2O9Z A;  2XFO A;  1S3E A;  1ZMD A;  2V5Z A;  3NNE A;  2IVD A;  5LV9 A;  1XDI A;  1Y0P A;  2GR0 A;  5JCI A;  3UP4 A;  3AWI A;  3G5Q A;  4O5U A;  2EQ9 A;  1GT8 A;  2VQB A;  1EL5 A;  4H4S A;  4A99 A;  4C3Y A;  4U8K A;  4Z44 A;  1COY A;  2BCG G;  3SXI A;  2B9X A;  2C70 A;  1YKJ A;  4DSG A;  3AEG A;  1GND A;  4G9K A;  3VRD B;  2XFQ A;  2YM1 A;  2QA1 A;  3CGE A;  5FS7 A;  3F8D A;  2WEU A;  1F6M A;  3UOV A;  4H2R A;  3UKP A;  2Y6Q A;  3LB8 A;  5KMS A;  3NN6 X;  5EBK A;  3ALM A;  5CQF A;  4X4J A;  2A87 A;  2EQ6 A;  1PBF A;  1IUV A;  1GER A;  2H88 A;  3G5S A;  3QSM A;  4U8I A;  2Z5Y A;  1GAL A;  2CVJ A;  2JB3 A;  2Z5X A;  5JCK A;  1ZMC A;  2YWL A;  1Q1R A;  2YVJ A;  4GUV A;  1ZP0 A;  1LQT A;  3QVP A;  2BXR A;  2GRT A;  3K7Q X;  4J2W A;  1HYU A;  3CGC A;  2JB2 A;  3PVC A;  1L9E A;  4FK1 C;  2YG6 A;  3AE1 A;  3CGB A;  4J56 A;  4IVO B;  3UKK A;  4CY8 A;  2C3D A;  4U2L A;  3GRS A;  4H2Q A;  1OJD A;  1N4W A;  4YWO A;  5GSN A;  2JKC A;  3GDP A;  3K30 A;  4IA5 A;  2QA2 A;  2OLO A;  2VVL A;  2Q0K A;  3PO7 A;  1JU2 A;  2YLX A;  3QJ4 A;  4OPI A;  4EIQ A;  3NGC X;  1S2Q A;  2Q0L A;  3Q9T A;  2BS4 A;  4A9W A;  2BRA A;  5J7X A;  1DOB A;  4BV6 A;  2VQ7 A;  3F8P A;  4YTN A;  5IQ4 A;  3F8R A;  4H2P A;  1YQ3 A;  3KVE A;  4U8N A;  5IQ1 A;  1ZOV A;  1MXT A;  1XAN A;  4K5S A;  3SM8 A;  2BK3 A;  3GD4 A;  4JQ9 A;  2GF3 A;  3LOV A;  4Z43 A;  1L9D A;  1LPF A;  3FG2 P;  4USQ A;  2C3C A;  2BC1 A;  4UP3 A;  1CBO A;  1GEU A;  2WDV A;  2BK5 A;  4LII A;  3DGH A;  4TM4 A;  3R9U A;  2B9Y A;  3NYC A;  3QVR A;  2I0Z A;  1D5T A;  4UDR A;  4JY3 A;  2NVK X;  3HZL A;  2BA9 A;  3AE5 A;  3VRB A;  2YLZ A;  3LAD A;  3KKJ A;  3COX A;  5M0Z A;  2B76 A;  4EM3 A;  3NYE A;  1K0L A;  4U8J A;  4ZCD A;  5FS9 A;  4AT0 A;  1S2Y A;  1TDN A;  1NHS A;  2XYO A;  5FS6 A;  3CPJ G;  2BS3 A;  2GVC A;  1GRH A;  4YKG A;  4J33 A;  4XWR A;  1AOG A;  1UKV G;  5HY5 A;  1BWC A;  3UOX A;  3DJG X;  3CN8 A;  1QLB A;  2V60 A;  5KXJ A;  3B3R A;  1Q9I A;  3NK1 X;  4NNJ A;  3SZF A;  4K22 A;  4GRT A;  3VRA A;  2W0H A;  2ZZ0 A;  3IC9 A;  3ISH A;  1GRF A;  3UTG A;  4JN9 A;  1H82 A;  4O5Q A;  1BGJ A;  3LXD A;  3D8X A;  3NK2 X;  1W4X A;  4H4U A;  4AP1 A;  4II2 A;  4B1B A;  3RP6 A;  1JNZ A;  3DA1 A;  3V3N A;  4K7Z A;  5BUK A;  3JSK A;  4K8D A;  3KU9 A;  5J60 A;  4DSH A;  4H2N A;  3I3L A;  4NEW A;  3QSS A;  1E7P A;  3RHA A;  2WU2 A;  1TDE A;  1CJC A;  3AD8 B;  3UCL A;  3SGL A;  3UTE A;  3S61 A;  4CNJ A;  4N9X A;  3T14 A;  1PS9 A;  4EMI A;  4KX6 A;  3NYF A;  4J31 A;  1BF3 A;  1E1K A;  2WQY A;  3RED A;  4U8L A;  3SZ0 A;  2YLW A;  2WOW A;  2OAM A;  2BC0 A;  1PXA A;  3AD9 B;  3P9U A;  4FDC B;  3LZW A;  3CNJ A;  4XWZ A;  5HXI A;  1IJH A;  2IVE A;  3CTY A;  4EM4 A;  4Z2T A;  2E4G A;  3DK9 A;  5BVA A;  2TPR A;  1NG4 A;  1N1P A;  2WS3 A;  1PHH A;  1YY5 A;  3ATR A;  1EL7 A;  1CJ2 A;  1K4Q A;  3AYI A;  4ICY A;  3L1R A;  3VR9 A;  3AE4 A;  4A65 A;  5JCM A;  3DJD A;  2XVI A;  3AEE A;  3CPH G;  4M52 A;  2WDR A;  4WCT A;  4Z2R A;  4G6H A;  3SFD A;  2WP5 A;  3K7M X;  4UDP A;  1PDH A;  1GRB A;  1M6I A;  2OLN A;  3P4S A;  1B37 A;  3GMC A;  4II3 A;  4RG4 A;  2BAC A;  1OJT A;  2QAE A;  4B68 A;  4BUR A;  4EMJ A;  3T31 A;  1D4E A;  1KNP A;  4E0V A;  1H81 A;  3AB1 A;  3UKA A;  3IF9 A;  4ZN0 A;  2GQF A;  2R4E A;  4B65 A;  4H4V A;  1KNR A;  4J36 A;  2AQJ A;  3C96 A;  4H4Y A;  5ER0 A;  4EQX A;  2R46 A;  2WOV A;  2VVM A;  3BNU A;  2XVF A;  3QSE A;  3G5R A;  4Y4L A;  3RP8 A;  4A7A A;  4YSZ A;  4Y4M A;  2Y6R A;  4DNA A;  2ZZC A;  1H6V A;  2APG A;  3EF6 A;  3EAN A;  1PJ5 A;  3AEF A;  1GSN A;  2YR6 A;  1QO8 A;  4IV9 A;  4CBQ A;  2YG4 A;  4I58 A;  4NTE A;  2RGJ A;  4JNA A;  2FBW A;  4A79 A;  2WPE A;  4GR1 A;  5U63 A;  4J57 A;  2AR8 A;  2YR5 A;  2GR2 A;  3DJJ A;  3ICT A;  2CDU A;  3D1C A;  1PBB A;  3DK8 A;  4GAP A;  4U2T A;  2GR1 A;  2XFP A;  1H7X A;  3P4Q A;  1PJ7 A;  3NH3 X;  5KOX A;  3AEC A;  4OCG A;  4U8O A;  4CCR A;  3T0K A;  2GMH A;  4HA6 A;  4H4P A;  1PJ6 A;  4C77 A;  4EQS A;  4H4W A;  4OPG A;  3UKQ A;  2GB0 A;  4B69 A;  3ITJ A;  2XLS A;  3BHF A;  3I6D A;  4OPT A;  3UTH A;  5KRQ A;  4NTD A;  4X9N A;  4B64 A;  4DGK A;  1X31 B;  2XLT A;  3NG7 X;  3O0H A;  5KNL A;  2C65 A;  3CNS A;  5C3J A;  3FPZ A;  2FJA A;  2JBV A;  1BKW A;  4J34 A;  2XLR A;  4H50 A;  2FJD A;  4GCM A;  1Y56 A;  4D04 A;  2YVG A;  4A6N A;  1GET A;  1E1N A;  1K0I A;  2VRM A;  3T2K A;  4RG3 A;  3UTF A;  2WET A;  3UP5 A;  1RSG A;  4Z25 A;  2XLP A;  4XXG A;  1B8S A;  3ADA B;  1CC6 A;  3BHK A;  3CGD A;  3IHG A;  1Y56 B;  3NN0 X;  1JRX A;  4OPL A;  2X3N A;  4A6N B;  4YSY A;  1PN0 A;  2WP9 A;  4H7U A;  2VRL A;  3AYL A;  1B5Q A;  1RP0 A;  2V61 A;  2EQ8 A;  1NAA A;  3ICS A;  4OPU A;  3AE6 A;  4K2X A;  1VG0 A;  3BNM A;  5EB5 A;  3SY4 A;  3SX6 A;  1JRZ A;  2WHD A;  1E1L A;  2ZBW A;  4TM0 A;  4ZCC A;  2YG7 A;  3VQR A;  5C2T A;  2QCU A;  2CFY A;  4C74 A;  2WBA A;  1GXF A;  4G74 A;  2DKI A;  4WX1 A;  2GAG B;  3GD3 A;  2OA1 A;  1D7Y A;  1CHU A;  1GTH A; 
#chains in the Genus database with same CATH homology
 2XVJ A;  3T2Z A;  4CCQ A;  1NPX A;  4AOX A;  4K5R A;  1ZK7 A;  5KMQ A;  5FMH A;  3NLC A;  3M0O A;  4BK2 A;  4MJW A;  3S5W A;  5M10 A;  4H4X A;  5FS8 A;  4BK1 A;  3V3O A;  3AXB A;  1F3P A;  3AE2 A;  4P9S A;  2E5V A;  1JNR A;  4H4R A;  5KMP A;  2GR3 A;  2DKH A;  2WOI A;  3L8K A;  3GMB A;  1D4C A;  2GAH B;  1JOA A;  2EQ7 A;  1NEN A;  1TDF A;  2RGO A;  1EL9 A;  1L9C A;  3AE7 A;  3ALL A;  3GWF A;  5JCL A;  2J3N A;  3CIR A;  1DOC A;  1GRG A;  2WDQ A;  2Q6U A;  2PYX A;  2XFN A;  2X8H A;  4U8P A;  1PXB A;  2GQW A;  2YLR A;  3QFA A;  4UDQ A;  1LTX R;  5KVH A;  3AYJ A;  3NIX A;  4I59 A;  2BAB A;  1DXL A;  3UKL A;  3GSI A;  1P2H A;  3CND A;  2C7G A;  3K7T A;  2XDO A;  4G6G A;  1RYI A;  1CL0 A;  2JB1 A;  2B7S A;  2R9Z A;  3IHM A;  1OJA A;  1K0J A;  1NHQ A;  5KMR A;  1ZDL A;  3NTA A;  2BYB A;  1H86 A;  2R45 A;  1GRE A;  1GOS A;  2F5Z A;  3P4R A;  2XLU A;  1TDK A;  1GV4 A;  3GWD A;  3H8I A;  5DBJ A;  4GF7 A;  1SEZ A;  1QJD A;  5JCN A;  3OZ2 A;  3UKF A;  1DNC A;  2VZ2 A;  1B4V A;  2YVF A;  3ICR A;  2X50 A;  3KPF A;  3V76 A;  4B67 A;  1PXC A;  4C5O A;  3H8L A;  1N4V A;  2JK6 A;  4CNK A;  4USR A;  4GDP A;  1YQZ A;  3AEB A;  4EQW A;  3FMW A;  4HB9 A;  2C72 A;  5EB4 A;  3CMM A;  1H7W A;  1LQU A;  1NG3 A;  1EL8 A;  3AED A;  4YXD A;  3PS9 A;  4YT0 A;  3CNT A;  1JRY A;  2NPX A;  3GYI A;  3AE8 A;  3Q6J A;  4D03 A;  3NTD A;  3B6D A;  4JNQ A;  4KPR A;  2FJE A;  3LJP A;  3NRN A;  1L0V A;  4ADW A;  3EAO A;  4Y4N A;  2XVH A;  2FJB A;  3P4P A;  3KPK A;  5U1O A;  3FIM B;  3BI5 A;  2ARD A;  2YR4 A;  4AT2 A;  3DH9 A;  1GRT A;  4NTC A;  1NEK A;  1F8W A;  1VRQ B;  4H4Q A;  4YSX A;  1IUS A;  2CUL A;  2X8G A;  3T2Y A;  2BS2 A;  2C4C A;  4EQR A;  1CC2 A;  2JAE A;  3GYJ A;  1FCD A;  2RGH A;  2YG5 A;  1IUW A;  3M12 A;  5KWF A;  5CKU A;  3SFE A;  4TLX A;  1YQ4 A;  3GYX A;  2Q7V A;  1GPE A;  2ACZ A;  2YQU A;  1TYP A;  1F8S A;  2XVE A;  4FX9 A;  4PAB A;  5HHF A;  3SYI A;  2AAQ A;  1H83 A;  5KOW A;  1FEC A;  1NHP A;  1ELI A;  3DME A;  4IA6 A;  3NT6 A;  1O94 A;  1OJ9 A;  1BGN A;  3AE3 A;  5BUL A;  1FEB A;  4FK1 A;  4B63 A;  1DOE A;  4EIP A;  4PAA A;  2BRY A;  2RAB A;  1O5W A;  3KLJ A;  2GV8 A;  3E1T A;  2WPC A;  2BK4 A;  2YG3 A;  1E6E A;  2B9W A;  1CC4 A;  4YKF A;  2UZZ A;  2IID A;  2GEW A;  2A8X A;  2X99 A;  3ABV A;  5GRT A;  3EPT A;  4G73 A;  1IUU A;  1REO A;  1KDG A;  1XHC A;  2E1M A;  2V3B A;  2WP6 A;  4U2S A;  3UKH A;  2GH5 A;  5KVI A;  1ZX9 A;  1IUT A;  1VQW A;  3URH A;  1DJN A;  3NHO X;  3UOZ A;  3HYX A;  1P2E A;  4TM1 A;  4APN A;  3AEA A;  4C3X A;  2ZZB A;  4U8M A;  2R0C A;  1Q1W A;  3ZDN A;  4A5L A;  3GDN A;  1GES A;  5L46 A;  3NKS A;  1CF3 A;  1LVL A;  4BJY A;  1S3B A;  2BXS A;  5BRT A;  2R0G A;  3WE0 A;  1GTE A;  1DJQ A;  3CPI G;  4YTM A;  1KSU A;  4Z26 A;  4GDE A;  5HYM A;  4RSL A;  1CJ3 A;  1TDO A;  2YAU A;  3KD9 A;  4X9M A;  4H4Z A;  1PBD A;  1JEH A;  3NK0 X;  2R4J A;  4TM3 A;  3VR8 A;  1ZKQ A;  1D7L A;  3DGZ A;  3LZX A;  4REK A;  3AD7 B;  1V59 A;  1VDC A;  4AP3 A;  4GAV A;  1O95 A;  2XCG A;  2YLT A;  3RNM A;  4OPD A;  4CRT A;  1D4D A;  1BZL A;  2PHH A;  3II4 A;  1TYT A;  4LU6 A;  2HQM A;  1KFY A;  4ECH A;  3P1W A;  3T37 A;  1IUX A;  1DOD A;  4YSH A;  3GRT A;  4OVI A;  2TMD A;  3UOY A;  1MOK A;  1VG9 A;  2YM2 A;  1FOH A;  2YLS A;  3ZYX A;  3IWA A;  1N4U A;  3BI4 A;  3DK4 A;  4JY2 A;  5EOW A;  3OC4 A;  4NZH A;  4BK3 A;  4NWZ A;  2C75 A;  4Z2U A;  1ZY8 A;  2C76 A;  2X8C A;  5U25 A;  4NEV A;  1LJ1 A;  2R0P A;  1KF6 A;  2XFU A;  4H4T A;  2C66 A;  1ONF A;  1PBC A;  2GMJ A;  2V6O A;  2WU5 A;  3FBS A;  1LV0 A;  3KA7 A;  4CY6 A;  1CJ4 A;  1FL2 A;  2B7R A;  1M64 A;  3C4A A;  3HYV A;  3SZW A;  1MO9 A;  1NHR A;  2VOU A;  1OJC A;  2WPF A;  2C73 A;  1GRA A;  1NDA A;  1TRB A;  3AE9 A;  3HYW A;  4TLZ A;  1Z6L A;  2OAL A;  3ATQ A;  3QFB A;  3BI2 A;  4EMW A;  1EBD A;  1H84 A;  3H4K A;  5TR3 A;  3RP7 A;  5IPY A;  4LA1 A;  4JDR A;  3C4N A;  4BJZ A;  2WES A;  1E39 A;  2C64 A;  3DJE A;  4Z24 A;  2VVL G;  4OPC A;  4B66 A;  1XPQ A;  1F8R A;  1ZOY A;  1PBE A;  3SZC A;  3SQP A;  2BCP A;  2H89 A;  3CNP A;  3M13 A;  2A89 A;  4AOS A;  3ALJ A;  1FEA A;  2V3A A;  4IVM B;  4YTP A;  1KSS A;  2C67 A;  1E1M A;  2O9Z A;  2XFO A;  1S3E A;  1ZMD A;  2V5Z A;  3NNE A;  2IVD A;  5LV9 A;  1XDI A;  1Y0P A;  2GR0 A;  5JCI A;  3UP4 A;  3AWI A;  3G5Q A;  4O5U A;  2EQ9 A;  1GT8 A;  2VQB A;  1EL5 A;  4H4S A;  4A99 A;  4C3Y A;  4U8K A;  4Z44 A;  1COY A;  2BCG G;  3SXI A;  2B9X A;  2C70 A;  1YKJ A;  4DSG A;  3AEG A;  1GND A;  4G9K A;  3VRD B;  2XFQ A;  2YM1 A;  2QA1 A;  3CGE A;  5FS7 A;  3F8D A;  2WEU A;  1F6M A;  3UOV A;  4H2R A;  3UKP A;  2Y6Q A;  3LB8 A;  5KMS A;  3NN6 X;  5EBK A;  3ALM A;  5CQF A;  4X4J A;  2A87 A;  2EQ6 A;  1PBF A;  1IUV A;  1GER A;  2H88 A;  3G5S A;  3QSM A;  4U8I A;  2Z5Y A;  1GAL A;  2CVJ A;  2JB3 A;  2Z5X A;  5JCK A;  1ZMC A;  2YWL A;  1Q1R A;  2YVJ A;  4GUV A;  1ZP0 A;  1LQT A;  3QVP A;  2BXR A;  2GRT A;  3K7Q X;  4J2W A;  1HYU A;  3CGC A;  2JB2 A;  3PVC A;  1L9E A;  4FK1 C;  2YG6 A;  3AE1 A;  3CGB A;  4J56 A;  4IVO B;  3UKK A;  4CY8 A;  2C3D A;  4U2L A;  3GRS A;  4H2Q A;  1OJD A;  1N4W A;  4YWO A;  5GSN A;  2JKC A;  3GDP A;  3K30 A;  4IA5 A;  2QA2 A;  2OLO A;  2VVL A;  2Q0K A;  3PO7 A;  1JU2 A;  2YLX A;  3QJ4 A;  4OPI A;  4EIQ A;  3NGC X;  1S2Q A;  2Q0L A;  3Q9T A;  2BS4 A;  4A9W A;  2BRA A;  5J7X A;  1DOB A;  4BV6 A;  2VQ7 A;  3F8P A;  4YTN A;  5IQ4 A;  3F8R A;  4H2P A;  1YQ3 A;  3KVE A;  4U8N A;  5IQ1 A;  1ZOV A;  1MXT A;  1XAN A;  4K5S A;  3SM8 A;  2BK3 A;  3GD4 A;  4JQ9 A;  2GF3 A;  3LOV A;  4Z43 A;  1L9D A;  1LPF A;  3FG2 P;  4USQ A;  2C3C A;  2BC1 A;  4UP3 A;  1CBO A;  1GEU A;  2WDV A;  2BK5 A;  4LII A;  3DGH A;  4TM4 A;  3R9U A;  2B9Y A;  3NYC A;  3QVR A;  2I0Z A;  1D5T A;  4UDR A;  4JY3 A;  2NVK X;  3HZL A;  2BA9 A;  3AE5 A;  3VRB A;  2YLZ A;  3LAD A;  3KKJ A;  3COX A;  5M0Z A;  2B76 A;  4EM3 A;  3NYE A;  1K0L A;  4U8J A;  4ZCD A;  5FS9 A;  4AT0 A;  1S2Y A;  1TDN A;  1NHS A;  2XYO A;  5FS6 A;  3CPJ G;  2BS3 A;  2GVC A;  1GRH A;  4YKG A;  4J33 A;  4XWR A;  1AOG A;  1UKV G;  5HY5 A;  1BWC A;  3UOX A;  3DJG X;  3CN8 A;  1QLB A;  2V60 A;  5KXJ A;  3B3R A;  1Q9I A;  3NK1 X;  4NNJ A;  3SZF A;  4K22 A;  4GRT A;  3VRA A;  2W0H A;  2ZZ0 A;  3IC9 A;  3ISH A;  1GRF A;  3UTG A;  4JN9 A;  1H82 A;  4O5Q A;  1BGJ A;  3LXD A;  3D8X A;  3NK2 X;  1W4X A;  4H4U A;  4AP1 A;  4II2 A;  4B1B A;  3RP6 A;  1JNZ A;  3DA1 A;  3V3N A;  4K7Z A;  5BUK A;  3JSK A;  4K8D A;  3KU9 A;  5J60 A;  4DSH A;  4H2N A;  3I3L A;  4NEW A;  3QSS A;  1E7P A;  3RHA A;  2WU2 A;  1TDE A;  1CJC A;  3AD8 B;  3UCL A;  3SGL A;  3UTE A;  3S61 A;  4CNJ A;  4N9X A;  3T14 A;  1PS9 A;  4EMI A;  4KX6 A;  3NYF A;  4J31 A;  1BF3 A;  1E1K A;  2WQY A;  3RED A;  4U8L A;  3SZ0 A;  2YLW A;  2WOW A;  2OAM A;  2BC0 A;  1PXA A;  3AD9 B;  3P9U A;  4FDC B;  3LZW A;  3CNJ A;  4XWZ A;  5HXI A;  1IJH A;  2IVE A;  3CTY A;  4EM4 A;  4Z2T A;  2E4G A;  3DK9 A;  5BVA A;  2TPR A;  1NG4 A;  1N1P A;  2WS3 A;  1PHH A;  1YY5 A;  3ATR A;  1EL7 A;  1CJ2 A;  1K4Q A;  3AYI A;  4ICY A;  3L1R A;  3VR9 A;  3AE4 A;  4A65 A;  5JCM A;  3DJD A;  2XVI A;  3AEE A;  3CPH G;  4M52 A;  2WDR A;  4WCT A;  4Z2R A;  4G6H A;  3SFD A;  2WP5 A;  3K7M X;  4UDP A;  1PDH A;  1GRB A;  1M6I A;  2OLN A;  3P4S A;  1B37 A;  3GMC A;  4II3 A;  4RG4 A;  2BAC A;  1OJT A;  2QAE A;  4B68 A;  4BUR A;  4EMJ A;  3T31 A;  1D4E A;  1KNP A;  4E0V A;  1H81 A;  3AB1 A;  3UKA A;  3IF9 A;  4ZN0 A;  2GQF A;  2R4E A;  4B65 A;  4H4V A;  1KNR A;  4J36 A;  2AQJ A;  3C96 A;  4H4Y A;  5ER0 A;  4EQX A;  2R46 A;  2WOV A;  2VVM A;  3BNU A;  2XVF A;  3QSE A;  3G5R A;  4Y4L A;  3RP8 A;  4A7A A;  4YSZ A;  4Y4M A;  2Y6R A;  4DNA A;  2ZZC A;  1H6V A;  2APG A;  3EF6 A;  3EAN A;  1PJ5 A;  3AEF A;  1GSN A;  2YR6 A;  1QO8 A;  4IV9 A;  4CBQ A;  2YG4 A;  4I58 A;  4NTE A;  2RGJ A;  4JNA A;  2FBW A;  4A79 A;  2WPE A;  4GR1 A;  5U63 A;  4J57 A;  2AR8 A;  2YR5 A;  2GR2 A;  3DJJ A;  3ICT A;  2CDU A;  3D1C A;  1PBB A;  3DK8 A;  4GAP A;  4U2T A;  2GR1 A;  2XFP A;  1H7X A;  3P4Q A;  1PJ7 A;  3NH3 X;  5KOX A;  3AEC A;  4OCG A;  4U8O A;  4CCR A;  3T0K A;  2GMH A;  4HA6 A;  4H4P A;  1PJ6 A;  4C77 A;  4EQS A;  4H4W A;  4OPG A;  3UKQ A;  2GB0 A;  4B69 A;  3ITJ A;  2XLS A;  3BHF A;  3I6D A;  4OPT A;  3UTH A;  5KRQ A;  4NTD A;  4X9N A;  4B64 A;  4DGK A;  1X31 B;  2XLT A;  3NG7 X;  3O0H A;  5KNL A;  2C65 A;  3CNS A;  5C3J A;  3FPZ A;  2FJA A;  2JBV A;  1BKW A;  4J34 A;  2XLR A;  4H50 A;  2FJD A;  4GCM A;  1Y56 A;  4D04 A;  2YVG A;  4A6N A;  1GET A;  1E1N A;  1K0I A;  2VRM A;  3T2K A;  4RG3 A;  3UTF A;  2WET A;  3UP5 A;  1RSG A;  4Z25 A;  2XLP A;  4XXG A;  1B8S A;  3ADA B;  1CC6 A;  3BHK A;  3CGD A;  3IHG A;  1Y56 B;  3NN0 X;  1JRX A;  4OPL A;  2X3N A;  4A6N B;  4YSY A;  1PN0 A;  2WP9 A;  4H7U A;  2VRL A;  3AYL A;  1B5Q A;  1RP0 A;  2V61 A;  2EQ8 A;  1NAA A;  3ICS A;  4OPU A;  3AE6 A;  4K2X A;  1VG0 A;  3BNM A;  5EB5 A;  3SY4 A;  3SX6 A;  1JRZ A;  2WHD A;  1E1L A;  2ZBW A;  4TM0 A;  4ZCC A;  2YG7 A;  3VQR A;  5C2T A;  2QCU A;  2CFY A;  4C74 A;  2WBA A;  1GXF A;  4G74 A;  2DKI A;  4WX1 A;  2GAG B;  3GD3 A;  2OA1 A;  1D7Y A;  1CHU A;  1GTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...