3LZWA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form i)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase 2
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA02
1DJQA 1CC4A 1B5QA 4K8DA 5U25A 2YLRA 2YG3A 4GDPA 1BGNA 4A6NA 3NN6X 2WBAA 4UDQA 3P4QA 2WOWA 4NEWA 3UCLA 2ARDA 1VG0A 4TM3A 3NIXA 2GAGB 4CY6A 3JSKA 3KU9A 1DOBA 2J3NA 2TMDA 4OPLA 2PYXA 2WU5A 4IV9A 4YTNA 4N9XA 2YG5A 2B76A 1XDIA 1JRZA 5KRQA 1CJ4A 2PHHA 2GH5A 3L8KA 4IVOB 1BGJA 4YSHA 2GQFA 2V61A 2Z5YA 1BKWA 4IA5A 1TDNA 1L9DA 2WQYA 2WOIA 5LV9A 2W0HA 4A6NB 2Y6QA 1GSNA 3BHFA 3UKFA 1F8SA 2XVEA 1H83A 2NVKX 5FS8A 4FK1A 5HYMA 3FBSA 3SM8A 2GRTA 2YLXA 3H4KA 3PO7A 2AR8A 3D8XA 3V3OA 1LQUA 2OA1A 2JKCA 1LPFA 2XYOA 4B68A 4BK3A 1LQTA 4U8PA 4C5OA 2X50A 3ICSA 3CNTA 1NHRA 2GMHA 3CPIG 4AP3A 1P2HA 1QJDA 3M13A 1PJ7A 1GRHA 3CTYA 1TDOA 1Y56A 3CNJA 4USRA 4AT0A 2BS4A 2A8XA 3O0HA 3QSMA 1X31B 3AEBA 4AOSA 4H50A 3CGEA 1D4DA 1Q1RA 2IIDA 1PJ6A 3VRAA 1IUVA 4FX9A 2BXRA 4K5RA 1L0VA 4K2XA 1E7PA 2YVGA 3C4AA 2Q7VA 1VG9A 4Y4NA 5JCKA 2JK6A 3ZDNA 3AEFA 4X9NA 1GALA 1FCDA 3K7TA 4HA6A 4U8OA 3ICRA 3LB8A 3L1RA 3AE9A 2WEUA 2F5ZA 2BCPA 4PAAA 2C72A 1YQ4A 3QFAA 2A87A 2C3DA 3NYFA 5CQFA 1NHPA 1W4XA 4C77A 3BI5A 1YQ3A 3UOZA 2XVJA 3CIRA 3DJGX 2EQ6A 1O95A 1RYIA 2RABA 1MXTA 4GR1A 4YSXA 4JQ9A 2YG7A 1GRTA 4RG3A 3LJPA 5GSNA 3CGDA 1KSSA 4J33A 3PVCA 2GV8A 2VRLA 1JRXA 1K0IA 4A65A 3KPFA 4YKGA 2ACZA 4CY8A 2YG6A 2XLUA 3IF9A 2E4GA 1ZMCA 2VQBA 1K4QA 3P4RA 2BACA 4CCRA 3QVRA 2WP9A 4U8MA 1EL8A 1H84A 4REKA 2E5VA 2BK4A 3H8IA 3G5QA 3NNEA 4MJWA 1NG3A 3GYJA 3NT6A 2B9YA 4H4VA 2XDOA 1NAAA 2XVIA 2XLTA 3ALMA 4Y4LA 3H8LA 3GRSA 4B1BA 2C73A 3UOXA 4A5LA 5EOWA 3QSSA 3UTHA 2CDUA 5C2TA 1OJAA 1FL2A 4JY3A 3VR9A 5HXIA 1ZOVA 1ELIA 2AAQA 5KOWA 1TRBA 3DJJA 4OPIA 2CFYA 2APGA 4NTEA 4FK1C 2YM2A 1GV4A 2Q6UA 1FEBA 3BNUA 3ALJA 3SFEA 4EQSA 3K7QX 2CVJA 3LZXA 3FPZA 1DJNA 1NG4A 4GDEA 1JOAA 4JDRA 1TYTA 4B66A 2XVHA 2DKHA 1NHSA 2V3AA 4LIIA 2E1MA 5EB5A 3NTDA 2Q0KA 3NKSA 1YY5A 3AECA 1B4VA 2BC1A 2C66A 2WESA 3DJEA 4H4UA 4U8NA 2BC0A 1PBDA 5IQ4A 1N4UA 1LJ1A 3AE8A 3GD4A 1YQZA 5JCIA 2TPRA 1N1PA 3F8DA 1D7LA 1VDCA 4GF7A 3RNMA 1PBEA 4CNJA 3AEDA 5FS9A 1XHCA 4C74A 1IUXA 1M64A 3AYIA 5BUKA 2FJAA 1CJ2A 1GTHA 1XANA 1KNRA 2NPXA 3CGCA 3C4NA 1EL5A 1KSUA 2QAEA 4Z2TA 1Z6LA 4USQA 2YG4A 3UOVA 4H2NA 2XFNA 3QFBA 5U63A 1F6MA 4X9MA 4XWZA 1H81A 4TM4A 3GWFA 4JNAA 3REDA 3DMEA 3HZLA 2WPCA 1Y0PA 1Q1WA 2YAUA 4H2RA 1IUSA 2HQMA 1CBOA 3C96A 1H7XA 2ZZCA 4Y4MA 1ZMDA 3F8PA 2GVCA 3GDPA 1S3EA 3GYIA 1D7YA 2GR3A 1KDGA 4JNQA 1CL0A 5KVIA 4Z25A 4EQXA 5ER0A 1XPQA 2B7RA 1CJCA 1OJ9A 1FOHA 1H6VA 1CC2A 3ISHA 2IVDA 1E1NA 1JU2A 2YLSA 3D1CA 1GNDA 4A99A 2GF3A 1PBBA 4RSLA 2BS2A 4BK1A 3GDNA 3S61A 2V3BA 3KA7A 5M0ZA 3ALLA 1YKJA 1GERA 4O5UA 4DGKA 3NK1X 4H4PA 2EQ9A 3CPHG 1PXCA 1O94A 1N4WA 1NEKA 4H2QA 4Z2RA 4APNA 4J31A 1ZY8A 3SFDA 3V3NA 3GRTA 4OPDA 1PJ5A 3VQRA 4U8IA 3QSEA 2EQ7A 4Z24A 1OJDA 1PS9A 1GRBA 4K22A 3DGZA 3KVEA 4Z44A 1PXAA 2C64A 2BCGG 4RG4A 1ZX9A 2EQ8A 3R9UA 1ONFA 3B3RA 5EBKA 4H2PA 2VRMA 4AP1A 4I59A 4ECHA 1E1KA 4U8JA 2FJBA 2R4EA 5C3JA 4A7AA 3DK8A 5FMHA 2XLPA 2RGJA 5M10A 2FBWA 3EAOA 3AYJA 4TLZA 5L46A 4TLXA 4BK2A 4C3YA 3FG2P 4P9SA 2WS3A 2A89A 4TM0A 2YWLA 4H4XA 1PBFA 1TDFA 3FMWA 1DXLA 4GRTA 3AE3A 2R46A 4FDCB 2VZ2A 2GR0A 2GR2A 3UTGA 4IVMB 2B9XA 5BRTA 3UTFA 3F8RA 2YQUA 3NG7X 3AWIA 1IUWA 1CF3A 3CNDA 3GSIA 4YKFA 3NK2X 1GREA 1ZKQA 5EB4A 5JCMA 3CGBA 1CC6A 5HHFA 3VRDB 2WDVA 1KF6A 2WDQA 1O5WA 2C76A 1QO8A 2V6OA 3DJDA 3AD9B 3ATQA 1D5TA 5IPYA 4X4JA 3I6DA 5FS6A 2XFQA 1LTXR 3BI4A 2B9WA 2VOUA 3NYEA 2WHDA 3Q9TA 1JRYA 2XLRA 1S3BA 2R0PA 4K7ZA 4XWRA 3II4A 1BF3A 1PHHA 3LOVA 2YM1A 3CNPA 4EIPA 2BS3A 4H7UA 1PBCA 1E1MA 1F8WA 1ZK7A 3IC9A 4TM1A 3VRBA 1HYUA 4BURA 1K0LA 1MOKA 2QA1A 3AYLA 2BABA 2GMJA 4UDRA 5DBJA 4EQRA 1EL9A 3IHGA 3LADA 4K5SA 4B65A 2AQJA 4YXDA 2BK5A 3P4PA 1B8SA 4OPTA 3UKQA 3RP8A 3UOYA 5J60A 2WDRA 1UKVG 4M52A 2X99A 4H4ZA 4KX6A 3UKPA 2R9ZA 2OAMA 2V60A 1F8RA 4JN9A 2OALA 3AB1A 4ICYA 4OPCA 4YT0A 3DK9A 4YSYA 2XFOA 2QA2A 2RGHA 4YTPA 2H88A 1OJTA 3CN8A 4NTDA 4DSGA 4ZCDA 4B67A 3AE1A 1QLBA 3GWDA 3ADAB 3LXDA 3K7MX 1GESA 4C3XA 4DSHA 2YLZA 3P4SA 4YTMA 3RHAA 5KVHA 3S5WA 3AE4A 3OZ2A 1H7WA 5JCLA 4O5QA 4OPGA 5U1OA 5IQ1A 2OLOA 1VRQB 2GEWA 1GOSA 3GMBA 5CKUA 4YWOA 2ZBWA 4AOXA 2ZZBA 3NRNA 3EANA 3Q6JA 3NLCA 4EIQA 5BVAA 1PDHA 1LV0A 3G5RA 3CPJG 1S2YA 3NH3X 1LVLA 4J56A 3AEEA 2XCGA 2C7GA 4J57A 1GRGA 2JB3A 2XFPA 3OC4A 1GRFA 1DOCA 4E0VA 1KNPA 3IWAA 4H4TA 2C70A 3URHA 4ZN0A 1DNCA 2XFUA 2WETA 4IA6A 3E1TA 1TDEA 3UKHA 1EBDA 4EMWA 1GXFA 4J36A 4GCMA 3AD7B 3UP4A 2XLSA 4A79A 4GUVA 2CULA 3BHKA 3NK0X 2YR5A 1GTEA 3NN0X 1E39A 4CCQA 3KLJA 5TR3A 2YLWA 3PS9A 2FJDA 4J34A 3T37A 5HY5A 3V76A 2YLTA 2GAHB 2WOVA 2YR6A 3ABVA 3SGLA 3AEAA 1IUUA 4PABA 1EL7A 3KD9A 1NENA 5FS7A 1E1LA 1CHUA 1P2EA 4D04A 4U2TA 4EMJA 2GQWA 3UKKA 3M12A 4CNKA 3B6DA 2Q0LA 4U8KA 3AE6A 2GR1A 1REOA 3VR8A 2X8GA 2R0CA 1DODA 2R4JA 1AOGA 4XXGA 2B7SA 2R0GA 4EMIA 4D03A 1L9EA 4BJZA 4Z43A 3CNSA 2C65A 1D4CA 3UKAA 4U2SA 1B37A 2VVLG 2WPFA 2XVFA 4JY2A 4OPUA 4ADWA 5KXJA 3G5SA 3GD3A 3DGHA 4NEVA 2X8CA 2I0ZA 3QVPA 2V5ZA 4EM4A 3ZYXA 2RGOA 2FJEA 4U8LA 3ICTA 3QJ4A 1BZLA 1GRAA 1MO9A 2BYBA 4H4RA 3RP7A 3BI2A 3NHOX 2UZZA 2BA9A 1DOEA 3KKJA 4OCGA 1M6IA 2H89A 1GEUA 2WU2A 4H4WA 4WCTA 1ZP0A 4B64A 4EQWA 5KWFA 5JCNA 5KOXA 3ATRA 1S2QA 3RP6A 2YVJA 3AE7A 3FIMB 1L9CA 3COXA 2IVEA 2WP6A 1JNRA 3AD8B 1OJCA 2Y6RA 3IHMA 2R45A 1SEZA 3NGCX 4UP3A 1FEAA 2BK3A 3WE0A 4UDPA 3K30A 1E6EA 2YR4A 3P1WA 2JB2A 2O9ZA 3ITJA 2JBVA 2GB0A 1ZDLA 3DK4A 3UP5A 2VVMA 1H82A 1Y56B 1GPEA 1D4EA 2ZZ0A 4B69A 1JNZA 2C67A 4H4SA 4AT2A 4Z26A 4H4YA 1FECA 4I58A 4J2WA 1TDKA 1F3PA 2JB1A 3DH9A 2DKIA 2WP5A 2YVFA 4CRTA 1Q9IA 3AE5A 4ZCCA 4OVIA 1NDAA 2QCUA 4YSZA 4Z2UA 1IUTA 1V59A 2JAEA 3M0OA 3EF6A 1RP0A 3NYCA 1COYA 1VQWA 3BNMA 5BULA 3AE2A 3GMCA 1CJ3A 1GETA 4KPRA 3UKLA 3AEGA 2X8HA 1N4VA 3DA1A 4LA1A 4WX1A 3NTAA 3I3LA 3UTEA 1NHQA 3SQPA 2BXSA 2C75A 4BV6A 4DNAA 4A9WA 2Z5XA 4CBQA 1IJHA 3LZWA 1ZOYA 3P9UA 1RSGA 2OLNA 4HB9A 3EPTA 2VQ7A 5GRTA 1H86A 1KFYA 2C3CA 1GT8A 4NZHA 4U2LA 1K0JA 1BWCA 5J7XA 4B63A 1PXBA 4LU6A 1JEHA 4H4QA 4NTCA 1PN0A 1NPXA 2WPEA 4BJYA 2VVLA 2X3NA 4EM3A 1TYPA 3AXBA
chains in the Genus database with same CATH superfamily
1DJQA 1CC4A 4G73A 1B5QA 4K8DA 5U25A 3SZCA 2YLRA 2YG3A 4GDPA 3HYXA 1BGNA 4A6NA 3NN6X 2WBAA 4UDQA 3P4QA 3SZFA 2WOWA 4NEWA 3UCLA 2ARDA 1VG0A 4TM3A 3NIXA 2GAGB 4CY6A 3JSKA 3KU9A 1DOBA 2J3NA 2TMDA 4OPLA 2PYXA 2WU5A 4IV9A 4YTNA 4N9XA 2YG5A 2B76A 1XDIA 1JRZA 5KRQA 1CJ4A 2PHHA 2GH5A 3L8KA 4IVOB 1BGJA 4YSHA 2GQFA 2V61A 2Z5YA 1BKWA 4IA5A 1TDNA 1L9DA 2WQYA 2WOIA 5LV9A 2W0HA 4A6NB 2Y6QA 1GSNA 3BHFA 4II3A 3UKFA 1F8SA 2XVEA 1H83A 2NVKX 5FS8A 4FK1A 5HYMA 3FBSA 3SM8A 2GRTA 2YLXA 3H4KA 3PO7A 2AR8A 3D8XA 3V3OA 1LQUA 2OA1A 2JKCA 1LPFA 2XYOA 4B68A 4BK3A 1LQTA 4U8PA 4C5OA 2X50A 3ICSA 3CNTA 1NHRA 2GMHA 3CPIG 4AP3A 1P2HA 1QJDA 3M13A 1PJ7A 1GRHA 3CTYA 1TDOA 1Y56A 3CNJA 4USRA 4AT0A 2BS4A 2A8XA 3O0HA 3QSMA 1X31B 3AEBA 4AOSA 4H50A 3CGEA 1D4DA 4G6GA 1Q1RA 2IIDA 1PJ6A 3VRAA 1IUVA 4FX9A 2BXRA 4K5RA 1L0VA 4K2XA 1E7PA 2YVGA 3C4AA 2Q7VA 1VG9A 4Y4NA 3SZWA 5JCKA 2JK6A 3ZDNA 3AEFA 4X9NA 1GALA 1FCDA 3K7TA 4HA6A 4U8OA 3ICRA 3LB8A 3L1RA 3AE9A 2WEUA 2F5ZA 2BCPA 4PAAA 2C72A 1YQ4A 3QFAA 2A87A 2C3DA 3NYFA 5CQFA 1NHPA 1W4XA 4C77A 3BI5A 1YQ3A 3UOZA 2XVJA 3CIRA 3DJGX 2EQ6A 1O95A 1RYIA 2RABA 1MXTA 4GR1A 4YSXA 4JQ9A 2YG7A 1GRTA 4RG3A 3LJPA 5GSNA 3CGDA 1KSSA 4J33A 3PVCA 2GV8A 2VRLA 1JRXA 1K0IA 4A65A 3KPFA 4YKGA 2ACZA 4CY8A 3SX6A 2YG6A 2XLUA 3IF9A 2E4GA 1ZMCA 2VQBA 1K4QA 3P4RA 2BACA 4CCRA 3QVRA 3SZ0A 2WP9A 4U8MA 1EL8A 1H84A 4REKA 2E5VA 2BK4A 3H8IA 3G5QA 3NNEA 4MJWA 1NG3A 3GYJA 3NT6A 2B9YA 3GYXA 4H4VA 2XDOA 1NAAA 2XVIA 2XLTA 3ALMA 4Y4LA 3H8LA 3GRSA 4B1BA 2C73A 3UOXA 4A5LA 5EOWA 3QSSA 3UTHA 2CDUA 5C2TA 1OJAA 1FL2A 4JY3A 3VR9A 5HXIA 1ZOVA 1ELIA 2AAQA 5KOWA 1TRBA 3DJJA 4OPIA 2CFYA 2APGA 4NTEA 4FK1C 2YM2A 1GV4A 2Q6UA 1FEBA 3BNUA 3ALJA 3SFEA 4EQSA 3K7QX 2CVJA 3LZXA 3FPZA 1DJNA 1NG4A 4GDEA 1JOAA 4JDRA 1TYTA 4B66A 2XVHA 2DKHA 1NHSA 2V3AA 4LIIA 2E1MA 5EB5A 3NTDA 2Q0KA 3NKSA 1YY5A 3AECA 1B4VA 2BC1A 2C66A 2WESA 3DJEA 4H4UA 4U8NA 2BC0A 1PBDA 4NWZA 5IQ4A 1N4UA 1LJ1A 3AE8A 3GD4A 1YQZA 5JCIA 2TPRA 1N1PA 3F8DA 1D7LA 1VDCA 4GF7A 3RNMA 1PBEA 4CNJA 3AEDA 5FS9A 1XHCA 4C74A 1IUXA 1M64A 3AYIA 5BUKA 2FJAA 1CJ2A 1GTHA 1XANA 1KNRA 2NPXA 3CGCA 3C4NA 1EL5A 1KSUA 2QAEA 4Z2TA 1Z6LA 4USQA 2YG4A 3UOVA 4H2NA 2XFNA 3QFBA 5U63A 1F6MA 4X9MA 4NNJA 4XWZA 1H81A 4TM4A 3GWFA 4JNAA 3REDA 3DMEA 3HZLA 2WPCA 1Y0PA 1Q1WA 2YAUA 4H2RA 1IUSA 2HQMA 1CBOA 3C96A 1H7XA 2ZZCA 4Y4MA 1ZMDA 3SXIA 3F8PA 2GVCA 4GAVA 3GDPA 1S3EA 3GYIA 1D7YA 2GR3A 1KDGA 4JNQA 1CL0A 5KVIA 4Z25A 4EQXA 5ER0A 1XPQA 2B7RA 1CJCA 1OJ9A 1FOHA 1H6VA 1CC2A 3ISHA 2IVDA 1E1NA 1JU2A 2YLSA 3D1CA 1GNDA 4A99A 2GF3A 1PBBA 4RSLA 2BS2A 4BK1A 3GDNA 3S61A 2V3BA 3KA7A 5M0ZA 3ALLA 1YKJA 1GERA 4O5UA 4DGKA 3NK1X 4H4PA 2EQ9A 3CPHG 1PXCA 1O94A 1N4WA 1NEKA 4H2QA 4Z2RA 4APNA 4J31A 1ZY8A 3SFDA 3V3NA 3GRTA 4OPDA 1PJ5A 3VQRA 4U8IA 3QSEA 2EQ7A 4Z24A 1OJDA 1PS9A 1GRBA 4K22A 3DGZA 3KVEA 4Z44A 1PXAA 2C64A 2BCGG 4RG4A 1ZX9A 2EQ8A 3R9UA 1ONFA 3B3RA 5EBKA 4H2PA 2VRMA 4AP1A 4I59A 4ECHA 1E1KA 4U8JA 2FJBA 2R4EA 5C3JA 4A7AA 3DK8A 5FMHA 2XLPA 2RGJA 5M10A 2FBWA 3EAOA 3AYJA 4TLZA 5L46A 4TLXA 4BK2A 4C3YA 3FG2P 4P9SA 2WS3A 3T31A 2A89A 4TM0A 2YWLA 4H4XA 5KMPA 1PBFA 1TDFA 3FMWA 1DXLA 4GRTA 3AE3A 3T2YA 2R46A 4FDCB 4G9KA 2VZ2A 2GR0A 2GR2A 3UTGA 4IVMB 2B9XA 5BRTA 3UTFA 3F8RA 2YQUA 3NG7X 3AWIA 1IUWA 1CF3A 3CNDA 3GSIA 4YKFA 3NK2X 1GREA 1ZKQA 5EB4A 5JCMA 3CGBA 1CC6A 5HHFA 3VRDB 2WDVA 1KF6A 2WDQA 1O5WA 2C76A 1QO8A 2V6OA 3DJDA 3AD9B 3ATQA 1D5TA 5IPYA 4X4JA 3I6DA 5FS6A 2BRAA 2XFQA 1LTXR 3BI4A 2B9WA 2VOUA 3NYEA 2WHDA 3Q9TA 1JRYA 2XLRA 1S3BA 2R0PA 4K7ZA 4XWRA 3II4A 1BF3A 1PHHA 3LOVA 2YM1A 3CNPA 4EIPA 2BS3A 4H7UA 1PBCA 1E1MA 1F8WA 1ZK7A 3IC9A 4TM1A 3VRBA 1HYUA 4BURA 1K0LA 1MOKA 2QA1A 3AYLA 2BABA 2GMJA 4UDRA 5DBJA 4EQRA 1EL9A 3IHGA 3LADA 4K5SA 5KMRA 4B65A 2AQJA 4YXDA 2BK5A 3P4PA 1B8SA 4OPTA 3UKQA 3RP8A 3UOYA 5J60A 2WDRA 1UKVG 4M52A 2X99A 4H4ZA 4KX6A 3UKPA 2R9ZA 2OAMA 2V60A 1F8RA 4JN9A 2OALA 3AB1A 4ICYA 4OPCA 2C4CA 4YT0A 3DK9A 4YSYA 2XFOA 2QA2A 2RGHA 4YTPA 2H88A 1OJTA 3CN8A 4NTDA 4DSGA 4ZCDA 4B67A 3AE1A 1QLBA 3GWDA 3ADAB 3LXDA 3K7MX 1GESA 4C3XA 4DSHA 2YLZA 3P4SA 2BRYA 4YTMA 3RHAA 5KVHA 3S5WA 3AE4A 3T2ZA 3OZ2A 1H7WA 4GAPA 4O5QA 5JCLA 4OPGA 5U1OA 5IQ1A 4G74A 2OLOA 1VRQB 2GEWA 1GOSA 3GMBA 5CKUA 4YWOA 2ZBWA 4AOXA 2ZZBA 3NRNA 3SYIA 3EANA 3Q6JA 3NLCA 4EIQA 5BVAA 1PDHA 1LV0A 3G5RA 3CPJG 1S2YA 3NH3X 1LVLA 4J56A 3AEEA 2XCGA 2C7GA 4J57A 1GRGA 2JB3A 2XFPA 3OC4A 1GRFA 1DOCA 4E0VA 1KNPA 3IWAA 4H4TA 2C70A 3T0KA 3URHA 4ZN0A 1DNCA 2XFUA 2WETA 4IA6A 3E1TA 1TDEA 3UKHA 1EBDA 4EMWA 1GXFA 4J36A 4GCMA 3AD7B 3UP4A 2XLSA 3KPKA 4A79A 4GUVA 2CULA 3BHKA 3NK0X 2YR5A 1GTEA 3NN0X 1E39A 4CCQA 3KLJA 5TR3A 4G6HA 2YLWA 3PS9A 2FJDA 4J34A 3T37A 5HY5A 3V76A 2YLTA 2GAHB 2WOVA 2YR6A 3ABVA 3SGLA 3CMMA 3AEAA 1IUUA 4PABA 1EL7A 3KD9A 1NENA 4II2A 5FS7A 1E1LA 1CHUA 1P2EA 4D04A 4U2TA 4EMJA 2GQWA 3UKKA 3M12A 4CNKA 3B6DA 2Q0LA 4U8KA 3AE6A 5KMQA 2GR1A 1REOA 3VR8A 2X8GA 2R0CA 1DODA 2R4JA 1AOGA 4XXGA 2B7SA 2R0GA 4EMIA 4D03A 1L9EA 4BJZA 4Z43A 3CNSA 2C65A 1D4CA 3UKAA 4U2SA 1B37A 2VVLG 2WPFA 2XVFA 4JY2A 4OPUA 4ADWA 5KXJA 3G5SA 3GD3A 3DGHA 4NEVA 2X8CA 3T2KA 2I0ZA 3QVPA 2V5ZA 4EM4A 3ZYXA 2RGOA 2FJEA 4U8LA 3ICTA 3QJ4A 1BZLA 3SY4A 1GRAA 1MO9A 2BYBA 4H4RA 3RP7A 3BI2A 3NHOX 2UZZA 2BA9A 1DOEA 3KKJA 4OCGA 1M6IA 2H89A 1GEUA 2WU2A 4H4WA 4WCTA 1ZP0A 4B64A 4EQWA 5KWFA 5JCNA 5KOXA 3ATRA 3HYVA 1S2QA 3RP6A 2YVJA 3AE7A 3FIMB 1L9CA 3COXA 2IVEA 2WP6A 1JNRA 3AD8B 1OJCA 2Y6RA 3IHMA 2R45A 1SEZA 3NGCX 4UP3A 1FEAA 2BK3A 3WE0A 4UDPA 3K30A 1E6EA 2YR4A 3P1WA 2JB2A 2O9ZA 3ITJA 2JBVA 2GB0A 1ZDLA 3DK4A 3UP5A 2VVMA 1H82A 1Y56B 1GPEA 1D4EA 2ZZ0A 4B69A 1JNZA 2C67A 4H4SA 4AT2A 4Z26A 4H4YA 1FECA 4I58A 3HYWA 4J2WA 1TDKA 1F3PA 2JB1A 3DH9A 2DKIA 2WP5A 2YVFA 4CRTA 1Q9IA 3AE5A 4ZCCA 4OVIA 1NDAA 2QCUA 4YSZA 4Z2UA 1IUTA 1V59A 2JAEA 3M0OA 3EF6A 1RP0A 3NYCA 1COYA 1VQWA 3BNMA 5BULA 3AE2A 3GMCA 1CJ3A 1GETA 4KPRA 3UKLA 3AEGA 2X8HA 1N4VA 3DA1A 4LA1A 4WX1A 3NTAA 3I3LA 3UTEA 5KMSA 5KNLA 1NHQA 3SQPA 2BXSA 2C75A 4BV6A 4DNAA 4A9WA 2Z5XA 4CBQA 1IJHA 3LZWA 1ZOYA 3P9UA 1RSGA 2OLNA 4HB9A 3EPTA 2VQ7A 5GRTA 1H86A 1KFYA 3T14A 2C3CA 1GT8A 4NZHA 4U2LA 1K0JA 1BWCA 5J7XA 4B63A 1PXBA 4LU6A 1JEHA 4H4QA 4NTCA 1PN0A 1NPXA 2WPEA 4BJYA 2VVLA 2X3NA 4EM3A 1TYPA 3AXBA
chains in the Genus database with same CATH topology
1DJQA 1CC4A 4G73A 1B5QA 4K8DA 5U25A 3SZCA 2YLRA 2YG3A 4GDPA 3HYXA 1BGNA 4A6NA 3NN6X 2WBAA 4UDQA 3P4QA 3SZFA 2WOWA 4NEWA 3UCLA 2ARDA 1VG0A 4TM3A 3NIXA 2GAGB 4CY6A 3JSKA 3KU9A 1DOBA 2J3NA 2TMDA 4OPLA 2PYXA 2WU5A 4IV9A 4YTNA 4N9XA 2YG5A 2B76A 1XDIA 1JRZA 5KRQA 1CJ4A 2PHHA 2GH5A 3L8KA 4IVOB 1BGJA 4YSHA 2GQFA 2V61A 2Z5YA 1BKWA 4IA5A 1TDNA 1L9DA 2WQYA 2WOIA 5LV9A 2W0HA 4A6NB 2Y6QA 1GSNA 3BHFA 4II3A 3UKFA 1F8SA 2XVEA 1H83A 2NVKX 5FS8A 4FK1A 5HYMA 3FBSA 3SM8A 2GRTA 2YLXA 3H4KA 3PO7A 2AR8A 3D8XA 3V3OA 1LQUA 2OA1A 2JKCA 1LPFA 2XYOA 4B68A 4BK3A 1LQTA 4U8PA 4C5OA 2X50A 3ICSA 3CNTA 1NHRA 2GMHA 3CPIG 4AP3A 1P2HA 1QJDA 3M13A 1PJ7A 1GRHA 3CTYA 1TDOA 1Y56A 3CNJA 4USRA 4AT0A 2BS4A 2A8XA 3O0HA 3QSMA 1X31B 3AEBA 4AOSA 4H50A 3CGEA 1D4DA 4G6GA 1Q1RA 2IIDA 1PJ6A 3VRAA 1IUVA 4FX9A 2BXRA 4K5RA 1L0VA 4K2XA 1E7PA 2YVGA 3C4AA 2Q7VA 1VG9A 4Y4NA 3SZWA 5JCKA 2JK6A 3ZDNA 3AEFA 4X9NA 1GALA 1FCDA 3K7TA 4HA6A 4U8OA 3ICRA 3LB8A 3L1RA 3AE9A 2WEUA 2F5ZA 2BCPA 4PAAA 2C72A 1YQ4A 3QFAA 2A87A 2C3DA 3NYFA 5CQFA 1NHPA 1W4XA 4C77A 3BI5A 1YQ3A 3UOZA 2XVJA 3CIRA 3DJGX 2EQ6A 1O95A 1RYIA 2RABA 1MXTA 4GR1A 4YSXA 4JQ9A 2YG7A 1GRTA 4RG3A 3LJPA 5GSNA 3CGDA 1KSSA 4J33A 3PVCA 2GV8A 2VRLA 1JRXA 1K0IA 4A65A 3KPFA 4YKGA 2ACZA 4CY8A 3SX6A 2YG6A 2XLUA 3IF9A 2E4GA 1ZMCA 2VQBA 1K4QA 3P4RA 2BACA 4CCRA 3QVRA 3SZ0A 2WP9A 4U8MA 1EL8A 1H84A 4REKA 2E5VA 2BK4A 3H8IA 3G5QA 3NNEA 4MJWA 1NG3A 3GYJA 3NT6A 2B9YA 3GYXA 4H4VA 2XDOA 1NAAA 2XVIA 2XLTA 3ALMA 4Y4LA 3H8LA 3GRSA 4B1BA 2C73A 3UOXA 4A5LA 5EOWA 3QSSA 3UTHA 2CDUA 5C2TA 1OJAA 1FL2A 4JY3A 3VR9A 5HXIA 1ZOVA 1ELIA 2AAQA 5KOWA 1TRBA 3DJJA 4OPIA 2CFYA 2APGA 4NTEA 4FK1C 2YM2A 1GV4A 2Q6UA 1FEBA 3BNUA 3ALJA 3SFEA 4EQSA 3K7QX 2CVJA 3LZXA 3FPZA 1DJNA 1NG4A 4GDEA 1JOAA 4JDRA 1TYTA 4B66A 2XVHA 2DKHA 1NHSA 2V3AA 4LIIA 2E1MA 5EB5A 3NTDA 2Q0KA 3NKSA 1YY5A 3AECA 1B4VA 2BC1A 2C66A 2WESA 3DJEA 4H4UA 4U8NA 2BC0A 1PBDA 4NWZA 5IQ4A 1N4UA 1LJ1A 3AE8A 3GD4A 1YQZA 5JCIA 2TPRA 1N1PA 3F8DA 1D7LA 1VDCA 4GF7A 3RNMA 1PBEA 4CNJA 3AEDA 5FS9A 1XHCA 4C74A 1IUXA 1M64A 3AYIA 5BUKA 2FJAA 1CJ2A 1GTHA 1XANA 1KNRA 2NPXA 3CGCA 3C4NA 1EL5A 1KSUA 2QAEA 4Z2TA 1Z6LA 4USQA 2YG4A 3UOVA 4H2NA 2XFNA 3QFBA 5U63A 1F6MA 4X9MA 4NNJA 4XWZA 1H81A 4TM4A 3GWFA 4JNAA 3REDA 3DMEA 3HZLA 2WPCA 1Y0PA 1Q1WA 2YAUA 4H2RA 1IUSA 2HQMA 1CBOA 3C96A 1H7XA 2ZZCA 4Y4MA 1ZMDA 3SXIA 3F8PA 2GVCA 4GAVA 3GDPA 1S3EA 3GYIA 1D7YA 2GR3A 1KDGA 4JNQA 1CL0A 5KVIA 4Z25A 4EQXA 5ER0A 1XPQA 2B7RA 1CJCA 1OJ9A 1FOHA 1H6VA 1CC2A 3ISHA 2IVDA 1E1NA 1JU2A 2YLSA 3D1CA 1GNDA 4A99A 2GF3A 1PBBA 4RSLA 2BS2A 4BK1A 3GDNA 3S61A 2V3BA 3KA7A 5M0ZA 3ALLA 1YKJA 1GERA 4O5UA 4DGKA 3NK1X 4H4PA 2EQ9A 3CPHG 1PXCA 1O94A 1N4WA 1NEKA 4H2QA 4Z2RA 4APNA 4J31A 1ZY8A 3SFDA 3V3NA 3GRTA 4OPDA 1PJ5A 3VQRA 4U8IA 3QSEA 2EQ7A 4Z24A 1OJDA 1PS9A 1GRBA 4K22A 3DGZA 3KVEA 4Z44A 1PXAA 2C64A 2BCGG 4RG4A 1ZX9A 2EQ8A 3R9UA 1ONFA 3B3RA 5EBKA 4H2PA 2VRMA 4AP1A 4I59A 4ECHA 1E1KA 4U8JA 2FJBA 2R4EA 5C3JA 4A7AA 3DK8A 5FMHA 2XLPA 2RGJA 5M10A 2FBWA 3EAOA 3AYJA 4TLZA 5L46A 4TLXA 4BK2A 4C3YA 3FG2P 4P9SA 2WS3A 3T31A 2A89A 4TM0A 2YWLA 4H4XA 5KMPA 1PBFA 1TDFA 3FMWA 1DXLA 4GRTA 3AE3A 3T2YA 2R46A 4FDCB 4G9KA 2VZ2A 2GR0A 2GR2A 3UTGA 4IVMB 2B9XA 5BRTA 3UTFA 3F8RA 2YQUA 3NG7X 3AWIA 1IUWA 1CF3A 3CNDA 3GSIA 4YKFA 3NK2X 1GREA 1ZKQA 5EB4A 5JCMA 3CGBA 1CC6A 5HHFA 3VRDB 2WDVA 1KF6A 2WDQA 1O5WA 2C76A 1QO8A 2V6OA 3DJDA 3AD9B 3ATQA 1D5TA 5IPYA 4X4JA 3I6DA 5FS6A 2BRAA 2XFQA 1LTXR 3BI4A 2B9WA 2VOUA 3NYEA 2WHDA 3Q9TA 1JRYA 2XLRA 1S3BA 2R0PA 4K7ZA 4XWRA 3II4A 1BF3A 1PHHA 3LOVA 2YM1A 3CNPA 4EIPA 2BS3A 4H7UA 1PBCA 1E1MA 1F8WA 1ZK7A 3IC9A 4TM1A 3VRBA 1HYUA 4BURA 1K0LA 1MOKA 2QA1A 3AYLA 2BABA 2GMJA 4UDRA 5DBJA 4EQRA 1EL9A 3IHGA 3LADA 4K5SA 5KMRA 4B65A 2AQJA 4YXDA 2BK5A 3P4PA 1B8SA 4OPTA 3UKQA 3RP8A 3UOYA 5J60A 2WDRA 1UKVG 4M52A 2X99A 4H4ZA 4KX6A 3UKPA 2R9ZA 2OAMA 2V60A 1F8RA 4JN9A 2OALA 3AB1A 4ICYA 4OPCA 2C4CA 4YT0A 3DK9A 4YSYA 2XFOA 2QA2A 2RGHA 4YTPA 2H88A 1OJTA 3CN8A 4NTDA 4DSGA 4ZCDA 4B67A 3AE1A 1QLBA 3GWDA 3ADAB 3LXDA 3K7MX 1GESA 4C3XA 4DSHA 2YLZA 3P4SA 2BRYA 4YTMA 3RHAA 5KVHA 3S5WA 3AE4A 3T2ZA 3OZ2A 1H7WA 4GAPA 4O5QA 5JCLA 4OPGA 5U1OA 5IQ1A 4G74A 2OLOA 1VRQB 2GEWA 1GOSA 3GMBA 5CKUA 4YWOA 2ZBWA 4AOXA 2ZZBA 3NRNA 3SYIA 3EANA 3Q6JA 3NLCA 4EIQA 5BVAA 1PDHA 1LV0A 3G5RA 3CPJG 1S2YA 3NH3X 1LVLA 4J56A 3AEEA 2XCGA 2C7GA 4J57A 1GRGA 2JB3A 2XFPA 3OC4A 1GRFA 1DOCA 4E0VA 1KNPA 3IWAA 4H4TA 2C70A 3T0KA 3URHA 4ZN0A 1DNCA 2XFUA 2WETA 4IA6A 3E1TA 1TDEA 3UKHA 1EBDA 4EMWA 1GXFA 4J36A 4GCMA 3AD7B 3UP4A 2XLSA 3KPKA 4A79A 4GUVA 2CULA 3BHKA 3NK0X 2YR5A 1GTEA 3NN0X 1E39A 4CCQA 3KLJA 5TR3A 4G6HA 2YLWA 3PS9A 2FJDA 4J34A 3T37A 5HY5A 3V76A 2YLTA 2GAHB 2WOVA 2YR6A 3ABVA 3SGLA 3CMMA 3AEAA 1IUUA 4PABA 1EL7A 3KD9A 1NENA 4II2A 5FS7A 1E1LA 1CHUA 1P2EA 4D04A 4U2TA 4EMJA 2GQWA 3UKKA 3M12A 4CNKA 3B6DA 2Q0LA 4U8KA 3AE6A 5KMQA 2GR1A 1REOA 3VR8A 2X8GA 2R0CA 1DODA 2R4JA 1AOGA 4XXGA 2B7SA 2R0GA 4EMIA 4D03A 1L9EA 4BJZA 4Z43A 3CNSA 2C65A 1D4CA 3UKAA 4U2SA 1B37A 2VVLG 2WPFA 2XVFA 4JY2A 4OPUA 4ADWA 5KXJA 3G5SA 3GD3A 3DGHA 4NEVA 2X8CA 3T2KA 2I0ZA 3QVPA 2V5ZA 4EM4A 3ZYXA 2RGOA 2FJEA 4U8LA 3ICTA 3QJ4A 1BZLA 3SY4A 1GRAA 1MO9A 2BYBA 4H4RA 3RP7A 3BI2A 3NHOX 2UZZA 2BA9A 1DOEA 3KKJA 4OCGA 1M6IA 2H89A 1GEUA 2WU2A 4H4WA 4WCTA 1ZP0A 4B64A 4EQWA 5KWFA 5JCNA 5KOXA 3ATRA 3HYVA 1S2QA 3RP6A 2YVJA 3AE7A 3FIMB 1L9CA 3COXA 2IVEA 2WP6A 1JNRA 3AD8B 1OJCA 2Y6RA 3IHMA 2R45A 1SEZA 3NGCX 4UP3A 1FEAA 2BK3A 3WE0A 4UDPA 3K30A 1E6EA 2YR4A 3P1WA 2JB2A 2O9ZA 3ITJA 2JBVA 2GB0A 1ZDLA 3DK4A 3UP5A 2VVMA 1H82A 1Y56B 1GPEA 1D4EA 2ZZ0A 4B69A 1JNZA 2C67A 4H4SA 4AT2A 4Z26A 4H4YA 1FECA 4I58A 3HYWA 4J2WA 1TDKA 1F3PA 2JB1A 3DH9A 2DKIA 2WP5A 2YVFA 4CRTA 1Q9IA 3AE5A 4ZCCA 4OVIA 1NDAA 2QCUA 4YSZA 4Z2UA 1IUTA 1V59A 2JAEA 3M0OA 3EF6A 1RP0A 3NYCA 1COYA 1VQWA 3BNMA 5BULA 3AE2A 3GMCA 1CJ3A 1GETA 4KPRA 3UKLA 3AEGA 2X8HA 1N4VA 3DA1A 4LA1A 4WX1A 3NTAA 3I3LA 3UTEA 5KMSA 5KNLA 1NHQA 3SQPA 2BXSA 2C75A 4BV6A 4DNAA 4A9WA 2Z5XA 4CBQA 1IJHA 3LZWA 1ZOYA 3P9UA 1RSGA 2OLNA 4HB9A 3EPTA 2VQ7A 5GRTA 1H86A 1KFYA 3T14A 2C3CA 1GT8A 4NZHA 4U2LA 1K0JA 1BWCA 5J7XA 4B63A 1PXBA 4LU6A 1JEHA 4H4QA 4NTCA 1PN0A 1NPXA 2WPEA 4BJYA 2VVLA 2X3NA 4EM3A 1TYPA 3AXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJQ A;  1CC4 A;  1B5Q A;  4K8D A;  5U25 A;  2YLR A;  2YG3 A;  4GDP A;  1BGN A;  4A6N A;  3NN6 X;  2WBA A;  4UDQ A;  3P4Q A;  2WOW A;  4NEW A;  3UCL A;  2ARD A;  1VG0 A;  4TM3 A;  3NIX A;  2GAG B;  4CY6 A;  3JSK A;  3KU9 A;  1DOB A;  2J3N A;  2TMD A;  4OPL A;  2PYX A;  2WU5 A;  4IV9 A;  4YTN A;  4N9X A;  2YG5 A;  2B76 A;  1XDI A;  1JRZ A;  5KRQ A;  1CJ4 A;  2PHH A;  2GH5 A;  3L8K A;  4IVO B;  1BGJ A;  4YSH A;  2GQF A;  2V61 A;  2Z5Y A;  1BKW A;  4IA5 A;  1TDN A;  1L9D A;  2WQY A;  2WOI A;  5LV9 A;  2W0H A;  4A6N B;  2Y6Q A;  1GSN A;  3BHF A;  3UKF A;  1F8S A;  2XVE A;  1H83 A;  2NVK X;  5FS8 A;  4FK1 A;  5HYM A;  3FBS A;  3SM8 A;  2GRT A;  2YLX A;  3H4K A;  3PO7 A;  2AR8 A;  3D8X A;  3V3O A;  1LQU A;  2OA1 A;  2JKC A;  1LPF A;  2XYO A;  4B68 A;  4BK3 A;  1LQT A;  4U8P A;  4C5O A;  2X50 A;  3ICS A;  3CNT A;  1NHR A;  2GMH A;  3CPI G;  4AP3 A;  1P2H A;  1QJD A;  3M13 A;  1PJ7 A;  1GRH A;  3CTY A;  1TDO A;  1Y56 A;  3CNJ A;  4USR A;  4AT0 A;  2BS4 A;  2A8X A;  3O0H A;  3QSM A;  1X31 B;  3AEB A;  4AOS A;  4H50 A;  3CGE A;  1D4D A;  1Q1R A;  2IID A;  1PJ6 A;  3VRA A;  1IUV A;  4FX9 A;  2BXR A;  4K5R A;  1L0V A;  4K2X A;  1E7P A;  2YVG A;  3C4A A;  2Q7V A;  1VG9 A;  4Y4N A;  5JCK A;  2JK6 A;  3ZDN A;  3AEF A;  4X9N A;  1GAL A;  1FCD A;  3K7T A;  4HA6 A;  4U8O A;  3ICR A;  3LB8 A;  3L1R A;  3AE9 A;  2WEU A;  2F5Z A;  2BCP A;  4PAA A;  2C72 A;  1YQ4 A;  3QFA A;  2A87 A;  2C3D A;  3NYF A;  5CQF A;  1NHP A;  1W4X A;  4C77 A;  3BI5 A;  1YQ3 A;  3UOZ A;  2XVJ A;  3CIR A;  3DJG X;  2EQ6 A;  1O95 A;  1RYI A;  2RAB A;  1MXT A;  4GR1 A;  4YSX A;  4JQ9 A;  2YG7 A;  1GRT A;  4RG3 A;  3LJP A;  5GSN A;  3CGD A;  1KSS A;  4J33 A;  3PVC A;  2GV8 A;  2VRL A;  1JRX A;  1K0I A;  4A65 A;  3KPF A;  4YKG A;  2ACZ A;  4CY8 A;  2YG6 A;  2XLU A;  3IF9 A;  2E4G A;  1ZMC A;  2VQB A;  1K4Q A;  3P4R A;  2BAC A;  4CCR A;  3QVR A;  2WP9 A;  4U8M A;  1EL8 A;  1H84 A;  4REK A;  2E5V A;  2BK4 A;  3H8I A;  3G5Q A;  3NNE A;  4MJW A;  1NG3 A;  3GYJ A;  3NT6 A;  2B9Y A;  4H4V A;  2XDO A;  1NAA A;  2XVI A;  2XLT A;  3ALM A;  4Y4L A;  3H8L A;  3GRS A;  4B1B A;  2C73 A;  3UOX A;  4A5L A;  5EOW A;  3QSS A;  3UTH A;  2CDU A;  5C2T A;  1OJA A;  1FL2 A;  4JY3 A;  3VR9 A;  5HXI A;  1ZOV A;  1ELI A;  2AAQ A;  5KOW A;  1TRB A;  3DJJ A;  4OPI A;  2CFY A;  2APG A;  4NTE A;  4FK1 C;  2YM2 A;  1GV4 A;  2Q6U A;  1FEB A;  3BNU A;  3ALJ A;  3SFE A;  4EQS A;  3K7Q X;  2CVJ A;  3LZX A;  3FPZ A;  1DJN A;  1NG4 A;  4GDE A;  1JOA A;  4JDR A;  1TYT A;  4B66 A;  2XVH A;  2DKH A;  1NHS A;  2V3A A;  4LII A;  2E1M A;  5EB5 A;  3NTD A;  2Q0K A;  3NKS A;  1YY5 A;  3AEC A;  1B4V A;  2BC1 A;  2C66 A;  2WES A;  3DJE A;  4H4U A;  4U8N A;  2BC0 A;  1PBD A;  5IQ4 A;  1N4U A;  1LJ1 A;  3AE8 A;  3GD4 A;  1YQZ A;  5JCI A;  2TPR A;  1N1P A;  3F8D A;  1D7L A;  1VDC A;  4GF7 A;  3RNM A;  1PBE A;  4CNJ A;  3AED A;  5FS9 A;  1XHC A;  4C74 A;  1IUX A;  1M64 A;  3AYI A;  5BUK A;  2FJA A;  1CJ2 A;  1GTH A;  1XAN A;  1KNR A;  2NPX A;  3CGC A;  3C4N A;  1EL5 A;  1KSU A;  2QAE A;  4Z2T A;  1Z6L A;  4USQ A;  2YG4 A;  3UOV A;  4H2N A;  2XFN A;  3QFB A;  5U63 A;  1F6M A;  4X9M A;  4XWZ A;  1H81 A;  4TM4 A;  3GWF A;  4JNA A;  3RED A;  3DME A;  3HZL A;  2WPC A;  1Y0P A;  1Q1W A;  2YAU A;  4H2R A;  1IUS A;  2HQM A;  1CBO A;  3C96 A;  1H7X A;  2ZZC A;  4Y4M A;  1ZMD A;  3F8P A;  2GVC A;  3GDP A;  1S3E A;  3GYI A;  1D7Y A;  2GR3 A;  1KDG A;  4JNQ A;  1CL0 A;  5KVI A;  4Z25 A;  4EQX A;  5ER0 A;  1XPQ A;  2B7R A;  1CJC A;  1OJ9 A;  1FOH A;  1H6V A;  1CC2 A;  3ISH A;  2IVD A;  1E1N A;  1JU2 A;  2YLS A;  3D1C A;  1GND A;  4A99 A;  2GF3 A;  1PBB A;  4RSL A;  2BS2 A;  4BK1 A;  3GDN A;  3S61 A;  2V3B A;  3KA7 A;  5M0Z A;  3ALL A;  1YKJ A;  1GER A;  4O5U A;  4DGK A;  3NK1 X;  4H4P A;  2EQ9 A;  3CPH G;  1PXC A;  1O94 A;  1N4W A;  1NEK A;  4H2Q A;  4Z2R A;  4APN A;  4J31 A;  1ZY8 A;  3SFD A;  3V3N A;  3GRT A;  4OPD A;  1PJ5 A;  3VQR A;  4U8I A;  3QSE A;  2EQ7 A;  4Z24 A;  1OJD A;  1PS9 A;  1GRB A;  4K22 A;  3DGZ A;  3KVE A;  4Z44 A;  1PXA A;  2C64 A;  2BCG G;  4RG4 A;  1ZX9 A;  2EQ8 A;  3R9U A;  1ONF A;  3B3R A;  5EBK A;  4H2P A;  2VRM A;  4AP1 A;  4I59 A;  4ECH A;  1E1K A;  4U8J A;  2FJB A;  2R4E A;  5C3J A;  4A7A A;  3DK8 A;  5FMH A;  2XLP A;  2RGJ A;  5M10 A;  2FBW A;  3EAO A;  3AYJ A;  4TLZ A;  5L46 A;  4TLX A;  4BK2 A;  4C3Y A;  3FG2 P;  4P9S A;  2WS3 A;  2A89 A;  4TM0 A;  2YWL A;  4H4X A;  1PBF A;  1TDF A;  3FMW A;  1DXL A;  4GRT A;  3AE3 A;  2R46 A;  4FDC B;  2VZ2 A;  2GR0 A;  2GR2 A;  3UTG A;  4IVM B;  2B9X A;  5BRT A;  3UTF A;  3F8R A;  2YQU A;  3NG7 X;  3AWI A;  1IUW A;  1CF3 A;  3CND A;  3GSI A;  4YKF A;  3NK2 X;  1GRE A;  1ZKQ A;  5EB4 A;  5JCM A;  3CGB A;  1CC6 A;  5HHF A;  3VRD B;  2WDV A;  1KF6 A;  2WDQ A;  1O5W A;  2C76 A;  1QO8 A;  2V6O A;  3DJD A;  3AD9 B;  3ATQ A;  1D5T A;  5IPY A;  4X4J A;  3I6D A;  5FS6 A;  2XFQ A;  1LTX R;  3BI4 A;  2B9W A;  2VOU A;  3NYE A;  2WHD A;  3Q9T A;  1JRY A;  2XLR A;  1S3B A;  2R0P A;  4K7Z A;  4XWR A;  3II4 A;  1BF3 A;  1PHH A;  3LOV A;  2YM1 A;  3CNP A;  4EIP A;  2BS3 A;  4H7U A;  1PBC A;  1E1M A;  1F8W A;  1ZK7 A;  3IC9 A;  4TM1 A;  3VRB A;  1HYU A;  4BUR A;  1K0L A;  1MOK A;  2QA1 A;  3AYL A;  2BAB A;  2GMJ A;  4UDR A;  5DBJ A;  4EQR A;  1EL9 A;  3IHG A;  3LAD A;  4K5S A;  4B65 A;  2AQJ A;  4YXD A;  2BK5 A;  3P4P A;  1B8S A;  4OPT A;  3UKQ A;  3RP8 A;  3UOY A;  5J60 A;  2WDR A;  1UKV G;  4M52 A;  2X99 A;  4H4Z A;  4KX6 A;  3UKP A;  2R9Z A;  2OAM A;  2V60 A;  1F8R A;  4JN9 A;  2OAL A;  3AB1 A;  4ICY A;  4OPC A;  4YT0 A;  3DK9 A;  4YSY A;  2XFO A;  2QA2 A;  2RGH A;  4YTP A;  2H88 A;  1OJT A;  3CN8 A;  4NTD A;  4DSG A;  4ZCD A;  4B67 A;  3AE1 A;  1QLB A;  3GWD A;  3ADA B;  3LXD A;  3K7M X;  1GES A;  4C3X A;  4DSH A;  2YLZ A;  3P4S A;  4YTM A;  3RHA A;  5KVH A;  3S5W A;  3AE4 A;  3OZ2 A;  1H7W A;  5JCL A;  4O5Q A;  4OPG A;  5U1O A;  5IQ1 A;  2OLO A;  1VRQ B;  2GEW A;  1GOS A;  3GMB A;  5CKU A;  4YWO A;  2ZBW A;  4AOX A;  2ZZB A;  3NRN A;  3EAN A;  3Q6J A;  3NLC A;  4EIQ A;  5BVA A;  1PDH A;  1LV0 A;  3G5R A;  3CPJ G;  1S2Y A;  3NH3 X;  1LVL A;  4J56 A;  3AEE A;  2XCG A;  2C7G A;  4J57 A;  1GRG A;  2JB3 A;  2XFP A;  3OC4 A;  1GRF A;  1DOC A;  4E0V A;  1KNP A;  3IWA A;  4H4T A;  2C70 A;  3URH A;  4ZN0 A;  1DNC A;  2XFU A;  2WET A;  4IA6 A;  3E1T A;  1TDE A;  3UKH A;  1EBD A;  4EMW A;  1GXF A;  4J36 A;  4GCM A;  3AD7 B;  3UP4 A;  2XLS A;  4A79 A;  4GUV A;  2CUL A;  3BHK A;  3NK0 X;  2YR5 A;  1GTE A;  3NN0 X;  1E39 A;  4CCQ A;  3KLJ A;  5TR3 A;  2YLW A;  3PS9 A;  2FJD A;  4J34 A;  3T37 A;  5HY5 A;  3V76 A;  2YLT A;  2GAH B;  2WOV A;  2YR6 A;  3ABV A;  3SGL A;  3AEA A;  1IUU A;  4PAB A;  1EL7 A;  3KD9 A;  1NEN A;  5FS7 A;  1E1L A;  1CHU A;  1P2E A;  4D04 A;  4U2T A;  4EMJ A;  2GQW A;  3UKK A;  3M12 A;  4CNK A;  3B6D A;  2Q0L A;  4U8K A;  3AE6 A;  2GR1 A;  1REO A;  3VR8 A;  2X8G A;  2R0C A;  1DOD A;  2R4J A;  1AOG A;  4XXG A;  2B7S A;  2R0G A;  4EMI A;  4D03 A;  1L9E A;  4BJZ A;  4Z43 A;  3CNS A;  2C65 A;  1D4C A;  3UKA A;  4U2S A;  1B37 A;  2VVL G;  2WPF A;  2XVF A;  4JY2 A;  4OPU A;  4ADW A;  5KXJ A;  3G5S A;  3GD3 A;  3DGH A;  4NEV A;  2X8C A;  2I0Z A;  3QVP A;  2V5Z A;  4EM4 A;  3ZYX A;  2RGO A;  2FJE A;  4U8L A;  3ICT A;  3QJ4 A;  1BZL A;  1GRA A;  1MO9 A;  2BYB A;  4H4R A;  3RP7 A;  3BI2 A;  3NHO X;  2UZZ A;  2BA9 A;  1DOE A;  3KKJ A;  4OCG A;  1M6I A;  2H89 A;  1GEU A;  2WU2 A;  4H4W A;  4WCT A;  1ZP0 A;  4B64 A;  4EQW A;  5KWF A;  5JCN A;  5KOX A;  3ATR A;  1S2Q A;  3RP6 A;  2YVJ A;  3AE7 A;  3FIM B;  1L9C A;  3COX A;  2IVE A;  2WP6 A;  1JNR A;  3AD8 B;  1OJC A;  2Y6R A;  3IHM A;  2R45 A;  1SEZ A;  3NGC X;  4UP3 A;  1FEA A;  2BK3 A;  3WE0 A;  4UDP A;  3K30 A;  1E6E A;  2YR4 A;  3P1W A;  2JB2 A;  2O9Z A;  3ITJ A;  2JBV A;  2GB0 A;  1ZDL A;  3DK4 A;  3UP5 A;  2VVM A;  1H82 A;  1Y56 B;  1GPE A;  1D4E A;  2ZZ0 A;  4B69 A;  1JNZ A;  2C67 A;  4H4S A;  4AT2 A;  4Z26 A;  4H4Y A;  1FEC A;  4I58 A;  4J2W A;  1TDK A;  1F3P A;  2JB1 A;  3DH9 A;  2DKI A;  2WP5 A;  2YVF A;  4CRT A;  1Q9I A;  3AE5 A;  4ZCC A;  4OVI A;  1NDA A;  2QCU A;  4YSZ A;  4Z2U A;  1IUT A;  1V59 A;  2JAE A;  3M0O A;  3EF6 A;  1RP0 A;  3NYC A;  1COY A;  1VQW A;  3BNM A;  5BUL A;  3AE2 A;  3GMC A;  1CJ3 A;  1GET A;  4KPR A;  3UKL A;  3AEG A;  2X8H A;  1N4V A;  3DA1 A;  4LA1 A;  4WX1 A;  3NTA A;  3I3L A;  3UTE A;  1NHQ A;  3SQP A;  2BXS A;  2C75 A;  4BV6 A;  4DNA A;  4A9W A;  2Z5X A;  4CBQ A;  1IJH A;  3LZW A;  1ZOY A;  3P9U A;  1RSG A;  2OLN A;  4HB9 A;  3EPT A;  2VQ7 A;  5GRT A;  1H86 A;  1KFY A;  2C3C A;  1GT8 A;  4NZH A;  4U2L A;  1K0J A;  1BWC A;  5J7X A;  4B63 A;  1PXB A;  4LU6 A;  1JEH A;  4H4Q A;  4NTC A;  1PN0 A;  1NPX A;  2WPE A;  4BJY A;  2VVL A;  2X3N A;  4EM3 A;  1TYP A;  3AXB A; 
#chains in the Genus database with same CATH topology
 1DJQ A;  1CC4 A;  4G73 A;  1B5Q A;  4K8D A;  5U25 A;  3SZC A;  2YLR A;  2YG3 A;  4GDP A;  3HYX A;  1BGN A;  4A6N A;  3NN6 X;  2WBA A;  4UDQ A;  3P4Q A;  3SZF A;  2WOW A;  4NEW A;  3UCL A;  2ARD A;  1VG0 A;  4TM3 A;  3NIX A;  2GAG B;  4CY6 A;  3JSK A;  3KU9 A;  1DOB A;  2J3N A;  2TMD A;  4OPL A;  2PYX A;  2WU5 A;  4IV9 A;  4YTN A;  4N9X A;  2YG5 A;  2B76 A;  1XDI A;  1JRZ A;  5KRQ A;  1CJ4 A;  2PHH A;  2GH5 A;  3L8K A;  4IVO B;  1BGJ A;  4YSH A;  2GQF A;  2V61 A;  2Z5Y A;  1BKW A;  4IA5 A;  1TDN A;  1L9D A;  2WQY A;  2WOI A;  5LV9 A;  2W0H A;  4A6N B;  2Y6Q A;  1GSN A;  3BHF A;  4II3 A;  3UKF A;  1F8S A;  2XVE A;  1H83 A;  2NVK X;  5FS8 A;  4FK1 A;  5HYM A;  3FBS A;  3SM8 A;  2GRT A;  2YLX A;  3H4K A;  3PO7 A;  2AR8 A;  3D8X A;  3V3O A;  1LQU A;  2OA1 A;  2JKC A;  1LPF A;  2XYO A;  4B68 A;  4BK3 A;  1LQT A;  4U8P A;  4C5O A;  2X50 A;  3ICS A;  3CNT A;  1NHR A;  2GMH A;  3CPI G;  4AP3 A;  1P2H A;  1QJD A;  3M13 A;  1PJ7 A;  1GRH A;  3CTY A;  1TDO A;  1Y56 A;  3CNJ A;  4USR A;  4AT0 A;  2BS4 A;  2A8X A;  3O0H A;  3QSM A;  1X31 B;  3AEB A;  4AOS A;  4H50 A;  3CGE A;  1D4D A;  4G6G A;  1Q1R A;  2IID A;  1PJ6 A;  3VRA A;  1IUV A;  4FX9 A;  2BXR A;  4K5R A;  1L0V A;  4K2X A;  1E7P A;  2YVG A;  3C4A A;  2Q7V A;  1VG9 A;  4Y4N A;  3SZW A;  5JCK A;  2JK6 A;  3ZDN A;  3AEF A;  4X9N A;  1GAL A;  1FCD A;  3K7T A;  4HA6 A;  4U8O A;  3ICR A;  3LB8 A;  3L1R A;  3AE9 A;  2WEU A;  2F5Z A;  2BCP A;  4PAA A;  2C72 A;  1YQ4 A;  3QFA A;  2A87 A;  2C3D A;  3NYF A;  5CQF A;  1NHP A;  1W4X A;  4C77 A;  3BI5 A;  1YQ3 A;  3UOZ A;  2XVJ A;  3CIR A;  3DJG X;  2EQ6 A;  1O95 A;  1RYI A;  2RAB A;  1MXT A;  4GR1 A;  4YSX A;  4JQ9 A;  2YG7 A;  1GRT A;  4RG3 A;  3LJP A;  5GSN A;  3CGD A;  1KSS A;  4J33 A;  3PVC A;  2GV8 A;  2VRL A;  1JRX A;  1K0I A;  4A65 A;  3KPF A;  4YKG A;  2ACZ A;  4CY8 A;  3SX6 A;  2YG6 A;  2XLU A;  3IF9 A;  2E4G A;  1ZMC A;  2VQB A;  1K4Q A;  3P4R A;  2BAC A;  4CCR A;  3QVR A;  3SZ0 A;  2WP9 A;  4U8M A;  1EL8 A;  1H84 A;  4REK A;  2E5V A;  2BK4 A;  3H8I A;  3G5Q A;  3NNE A;  4MJW A;  1NG3 A;  3GYJ A;  3NT6 A;  2B9Y A;  3GYX A;  4H4V A;  2XDO A;  1NAA A;  2XVI A;  2XLT A;  3ALM A;  4Y4L A;  3H8L A;  3GRS A;  4B1B A;  2C73 A;  3UOX A;  4A5L A;  5EOW A;  3QSS A;  3UTH A;  2CDU A;  5C2T A;  1OJA A;  1FL2 A;  4JY3 A;  3VR9 A;  5HXI A;  1ZOV A;  1ELI A;  2AAQ A;  5KOW A;  1TRB A;  3DJJ A;  4OPI A;  2CFY A;  2APG A;  4NTE A;  4FK1 C;  2YM2 A;  1GV4 A;  2Q6U A;  1FEB A;  3BNU A;  3ALJ A;  3SFE A;  4EQS A;  3K7Q X;  2CVJ A;  3LZX A;  3FPZ A;  1DJN A;  1NG4 A;  4GDE A;  1JOA A;  4JDR A;  1TYT A;  4B66 A;  2XVH A;  2DKH A;  1NHS A;  2V3A A;  4LII A;  2E1M A;  5EB5 A;  3NTD A;  2Q0K A;  3NKS A;  1YY5 A;  3AEC A;  1B4V A;  2BC1 A;  2C66 A;  2WES A;  3DJE A;  4H4U A;  4U8N A;  2BC0 A;  1PBD A;  4NWZ A;  5IQ4 A;  1N4U A;  1LJ1 A;  3AE8 A;  3GD4 A;  1YQZ A;  5JCI A;  2TPR A;  1N1P A;  3F8D A;  1D7L A;  1VDC A;  4GF7 A;  3RNM A;  1PBE A;  4CNJ A;  3AED A;  5FS9 A;  1XHC A;  4C74 A;  1IUX A;  1M64 A;  3AYI A;  5BUK A;  2FJA A;  1CJ2 A;  1GTH A;  1XAN A;  1KNR A;  2NPX A;  3CGC A;  3C4N A;  1EL5 A;  1KSU A;  2QAE A;  4Z2T A;  1Z6L A;  4USQ A;  2YG4 A;  3UOV A;  4H2N A;  2XFN A;  3QFB A;  5U63 A;  1F6M A;  4X9M A;  4NNJ A;  4XWZ A;  1H81 A;  4TM4 A;  3GWF A;  4JNA A;  3RED A;  3DME A;  3HZL A;  2WPC A;  1Y0P A;  1Q1W A;  2YAU A;  4H2R A;  1IUS A;  2HQM A;  1CBO A;  3C96 A;  1H7X A;  2ZZC A;  4Y4M A;  1ZMD A;  3SXI A;  3F8P A;  2GVC A;  4GAV A;  3GDP A;  1S3E A;  3GYI A;  1D7Y A;  2GR3 A;  1KDG A;  4JNQ A;  1CL0 A;  5KVI A;  4Z25 A;  4EQX A;  5ER0 A;  1XPQ A;  2B7R A;  1CJC A;  1OJ9 A;  1FOH A;  1H6V A;  1CC2 A;  3ISH A;  2IVD A;  1E1N A;  1JU2 A;  2YLS A;  3D1C A;  1GND A;  4A99 A;  2GF3 A;  1PBB A;  4RSL A;  2BS2 A;  4BK1 A;  3GDN A;  3S61 A;  2V3B A;  3KA7 A;  5M0Z A;  3ALL A;  1YKJ A;  1GER A;  4O5U A;  4DGK A;  3NK1 X;  4H4P A;  2EQ9 A;  3CPH G;  1PXC A;  1O94 A;  1N4W A;  1NEK A;  4H2Q A;  4Z2R A;  4APN A;  4J31 A;  1ZY8 A;  3SFD A;  3V3N A;  3GRT A;  4OPD A;  1PJ5 A;  3VQR A;  4U8I A;  3QSE A;  2EQ7 A;  4Z24 A;  1OJD A;  1PS9 A;  1GRB A;  4K22 A;  3DGZ A;  3KVE A;  4Z44 A;  1PXA A;  2C64 A;  2BCG G;  4RG4 A;  1ZX9 A;  2EQ8 A;  3R9U A;  1ONF A;  3B3R A;  5EBK A;  4H2P A;  2VRM A;  4AP1 A;  4I59 A;  4ECH A;  1E1K A;  4U8J A;  2FJB A;  2R4E A;  5C3J A;  4A7A A;  3DK8 A;  5FMH A;  2XLP A;  2RGJ A;  5M10 A;  2FBW A;  3EAO A;  3AYJ A;  4TLZ A;  5L46 A;  4TLX A;  4BK2 A;  4C3Y A;  3FG2 P;  4P9S A;  2WS3 A;  3T31 A;  2A89 A;  4TM0 A;  2YWL A;  4H4X A;  5KMP A;  1PBF A;  1TDF A;  3FMW A;  1DXL A;  4GRT A;  3AE3 A;  3T2Y A;  2R46 A;  4FDC B;  4G9K A;  2VZ2 A;  2GR0 A;  2GR2 A;  3UTG A;  4IVM B;  2B9X A;  5BRT A;  3UTF A;  3F8R A;  2YQU A;  3NG7 X;  3AWI A;  1IUW A;  1CF3 A;  3CND A;  3GSI A;  4YKF A;  3NK2 X;  1GRE A;  1ZKQ A;  5EB4 A;  5JCM A;  3CGB A;  1CC6 A;  5HHF A;  3VRD B;  2WDV A;  1KF6 A;  2WDQ A;  1O5W A;  2C76 A;  1QO8 A;  2V6O A;  3DJD A;  3AD9 B;  3ATQ A;  1D5T A;  5IPY A;  4X4J A;  3I6D A;  5FS6 A;  2BRA A;  2XFQ A;  1LTX R;  3BI4 A;  2B9W A;  2VOU A;  3NYE A;  2WHD A;  3Q9T A;  1JRY A;  2XLR A;  1S3B A;  2R0P A;  4K7Z A;  4XWR A;  3II4 A;  1BF3 A;  1PHH A;  3LOV A;  2YM1 A;  3CNP A;  4EIP A;  2BS3 A;  4H7U A;  1PBC A;  1E1M A;  1F8W A;  1ZK7 A;  3IC9 A;  4TM1 A;  3VRB A;  1HYU A;  4BUR A;  1K0L A;  1MOK A;  2QA1 A;  3AYL A;  2BAB A;  2GMJ A;  4UDR A;  5DBJ A;  4EQR A;  1EL9 A;  3IHG A;  3LAD A;  4K5S A;  5KMR A;  4B65 A;  2AQJ A;  4YXD A;  2BK5 A;  3P4P A;  1B8S A;  4OPT A;  3UKQ A;  3RP8 A;  3UOY A;  5J60 A;  2WDR A;  1UKV G;  4M52 A;  2X99 A;  4H4Z A;  4KX6 A;  3UKP A;  2R9Z A;  2OAM A;  2V60 A;  1F8R A;  4JN9 A;  2OAL A;  3AB1 A;  4ICY A;  4OPC A;  2C4C A;  4YT0 A;  3DK9 A;  4YSY A;  2XFO A;  2QA2 A;  2RGH A;  4YTP A;  2H88 A;  1OJT A;  3CN8 A;  4NTD A;  4DSG A;  4ZCD A;  4B67 A;  3AE1 A;  1QLB A;  3GWD A;  3ADA B;  3LXD A;  3K7M X;  1GES A;  4C3X A;  4DSH A;  2YLZ A;  3P4S A;  2BRY A;  4YTM A;  3RHA A;  5KVH A;  3S5W A;  3AE4 A;  3T2Z A;  3OZ2 A;  1H7W A;  4GAP A;  4O5Q A;  5JCL A;  4OPG A;  5U1O A;  5IQ1 A;  4G74 A;  2OLO A;  1VRQ B;  2GEW A;  1GOS A;  3GMB A;  5CKU A;  4YWO A;  2ZBW A;  4AOX A;  2ZZB A;  3NRN A;  3SYI A;  3EAN A;  3Q6J A;  3NLC A;  4EIQ A;  5BVA A;  1PDH A;  1LV0 A;  3G5R A;  3CPJ G;  1S2Y A;  3NH3 X;  1LVL A;  4J56 A;  3AEE A;  2XCG A;  2C7G A;  4J57 A;  1GRG A;  2JB3 A;  2XFP A;  3OC4 A;  1GRF A;  1DOC A;  4E0V A;  1KNP A;  3IWA A;  4H4T A;  2C70 A;  3T0K A;  3URH A;  4ZN0 A;  1DNC A;  2XFU A;  2WET A;  4IA6 A;  3E1T A;  1TDE A;  3UKH A;  1EBD A;  4EMW A;  1GXF A;  4J36 A;  4GCM A;  3AD7 B;  3UP4 A;  2XLS A;  3KPK A;  4A79 A;  4GUV A;  2CUL A;  3BHK A;  3NK0 X;  2YR5 A;  1GTE A;  3NN0 X;  1E39 A;  4CCQ A;  3KLJ A;  5TR3 A;  4G6H A;  2YLW A;  3PS9 A;  2FJD A;  4J34 A;  3T37 A;  5HY5 A;  3V76 A;  2YLT A;  2GAH B;  2WOV A;  2YR6 A;  3ABV A;  3SGL A;  3CMM A;  3AEA A;  1IUU A;  4PAB A;  1EL7 A;  3KD9 A;  1NEN A;  4II2 A;  5FS7 A;  1E1L A;  1CHU A;  1P2E A;  4D04 A;  4U2T A;  4EMJ A;  2GQW A;  3UKK A;  3M12 A;  4CNK A;  3B6D A;  2Q0L A;  4U8K A;  3AE6 A;  5KMQ A;  2GR1 A;  1REO A;  3VR8 A;  2X8G A;  2R0C A;  1DOD A;  2R4J A;  1AOG A;  4XXG A;  2B7S A;  2R0G A;  4EMI A;  4D03 A;  1L9E A;  4BJZ A;  4Z43 A;  3CNS A;  2C65 A;  1D4C A;  3UKA A;  4U2S A;  1B37 A;  2VVL G;  2WPF A;  2XVF A;  4JY2 A;  4OPU A;  4ADW A;  5KXJ A;  3G5S A;  3GD3 A;  3DGH A;  4NEV A;  2X8C A;  3T2K A;  2I0Z A;  3QVP A;  2V5Z A;  4EM4 A;  3ZYX A;  2RGO A;  2FJE A;  4U8L A;  3ICT A;  3QJ4 A;  1BZL A;  3SY4 A;  1GRA A;  1MO9 A;  2BYB A;  4H4R A;  3RP7 A;  3BI2 A;  3NHO X;  2UZZ A;  2BA9 A;  1DOE A;  3KKJ A;  4OCG A;  1M6I A;  2H89 A;  1GEU A;  2WU2 A;  4H4W A;  4WCT A;  1ZP0 A;  4B64 A;  4EQW A;  5KWF A;  5JCN A;  5KOX A;  3ATR A;  3HYV A;  1S2Q A;  3RP6 A;  2YVJ A;  3AE7 A;  3FIM B;  1L9C A;  3COX A;  2IVE A;  2WP6 A;  1JNR A;  3AD8 B;  1OJC A;  2Y6R A;  3IHM A;  2R45 A;  1SEZ A;  3NGC X;  4UP3 A;  1FEA A;  2BK3 A;  3WE0 A;  4UDP A;  3K30 A;  1E6E A;  2YR4 A;  3P1W A;  2JB2 A;  2O9Z A;  3ITJ A;  2JBV A;  2GB0 A;  1ZDL A;  3DK4 A;  3UP5 A;  2VVM A;  1H82 A;  1Y56 B;  1GPE A;  1D4E A;  2ZZ0 A;  4B69 A;  1JNZ A;  2C67 A;  4H4S A;  4AT2 A;  4Z26 A;  4H4Y A;  1FEC A;  4I58 A;  3HYW A;  4J2W A;  1TDK A;  1F3P A;  2JB1 A;  3DH9 A;  2DKI A;  2WP5 A;  2YVF A;  4CRT A;  1Q9I A;  3AE5 A;  4ZCC A;  4OVI A;  1NDA A;  2QCU A;  4YSZ A;  4Z2U A;  1IUT A;  1V59 A;  2JAE A;  3M0O A;  3EF6 A;  1RP0 A;  3NYC A;  1COY A;  1VQW A;  3BNM A;  5BUL A;  3AE2 A;  3GMC A;  1CJ3 A;  1GET A;  4KPR A;  3UKL A;  3AEG A;  2X8H A;  1N4V A;  3DA1 A;  4LA1 A;  4WX1 A;  3NTA A;  3I3L A;  3UTE A;  5KMS A;  5KNL A;  1NHQ A;  3SQP A;  2BXS A;  2C75 A;  4BV6 A;  4DNA A;  4A9W A;  2Z5X A;  4CBQ A;  1IJH A;  3LZW A;  1ZOY A;  3P9U A;  1RSG A;  2OLN A;  4HB9 A;  3EPT A;  2VQ7 A;  5GRT A;  1H86 A;  1KFY A;  3T14 A;  2C3C A;  1GT8 A;  4NZH A;  4U2L A;  1K0J A;  1BWC A;  5J7X A;  4B63 A;  1PXB A;  4LU6 A;  1JEH A;  4H4Q A;  4NTC A;  1PN0 A;  1NPX A;  2WPE A;  4BJY A;  2VVL A;  2X3N A;  4EM3 A;  1TYP A;  3AXB A; 
#chains in the Genus database with same CATH homology
 1DJQ A;  1CC4 A;  4G73 A;  1B5Q A;  4K8D A;  5U25 A;  3SZC A;  2YLR A;  2YG3 A;  4GDP A;  3HYX A;  1BGN A;  4A6N A;  3NN6 X;  2WBA A;  4UDQ A;  3P4Q A;  3SZF A;  2WOW A;  4NEW A;  3UCL A;  2ARD A;  1VG0 A;  4TM3 A;  3NIX A;  2GAG B;  4CY6 A;  3JSK A;  3KU9 A;  1DOB A;  2J3N A;  2TMD A;  4OPL A;  2PYX A;  2WU5 A;  4IV9 A;  4YTN A;  4N9X A;  2YG5 A;  2B76 A;  1XDI A;  1JRZ A;  5KRQ A;  1CJ4 A;  2PHH A;  2GH5 A;  3L8K A;  4IVO B;  1BGJ A;  4YSH A;  2GQF A;  2V61 A;  2Z5Y A;  1BKW A;  4IA5 A;  1TDN A;  1L9D A;  2WQY A;  2WOI A;  5LV9 A;  2W0H A;  4A6N B;  2Y6Q A;  1GSN A;  3BHF A;  4II3 A;  3UKF A;  1F8S A;  2XVE A;  1H83 A;  2NVK X;  5FS8 A;  4FK1 A;  5HYM A;  3FBS A;  3SM8 A;  2GRT A;  2YLX A;  3H4K A;  3PO7 A;  2AR8 A;  3D8X A;  3V3O A;  1LQU A;  2OA1 A;  2JKC A;  1LPF A;  2XYO A;  4B68 A;  4BK3 A;  1LQT A;  4U8P A;  4C5O A;  2X50 A;  3ICS A;  3CNT A;  1NHR A;  2GMH A;  3CPI G;  4AP3 A;  1P2H A;  1QJD A;  3M13 A;  1PJ7 A;  1GRH A;  3CTY A;  1TDO A;  1Y56 A;  3CNJ A;  4USR A;  4AT0 A;  2BS4 A;  2A8X A;  3O0H A;  3QSM A;  1X31 B;  3AEB A;  4AOS A;  4H50 A;  3CGE A;  1D4D A;  4G6G A;  1Q1R A;  2IID A;  1PJ6 A;  3VRA A;  1IUV A;  4FX9 A;  2BXR A;  4K5R A;  1L0V A;  4K2X A;  1E7P A;  2YVG A;  3C4A A;  2Q7V A;  1VG9 A;  4Y4N A;  3SZW A;  5JCK A;  2JK6 A;  3ZDN A;  3AEF A;  4X9N A;  1GAL A;  1FCD A;  3K7T A;  4HA6 A;  4U8O A;  3ICR A;  3LB8 A;  3L1R A;  3AE9 A;  2WEU A;  2F5Z A;  2BCP A;  4PAA A;  2C72 A;  1YQ4 A;  3QFA A;  2A87 A;  2C3D A;  3NYF A;  5CQF A;  1NHP A;  1W4X A;  4C77 A;  3BI5 A;  1YQ3 A;  3UOZ A;  2XVJ A;  3CIR A;  3DJG X;  2EQ6 A;  1O95 A;  1RYI A;  2RAB A;  1MXT A;  4GR1 A;  4YSX A;  4JQ9 A;  2YG7 A;  1GRT A;  4RG3 A;  3LJP A;  5GSN A;  3CGD A;  1KSS A;  4J33 A;  3PVC A;  2GV8 A;  2VRL A;  1JRX A;  1K0I A;  4A65 A;  3KPF A;  4YKG A;  2ACZ A;  4CY8 A;  3SX6 A;  2YG6 A;  2XLU A;  3IF9 A;  2E4G A;  1ZMC A;  2VQB A;  1K4Q A;  3P4R A;  2BAC A;  4CCR A;  3QVR A;  3SZ0 A;  2WP9 A;  4U8M A;  1EL8 A;  1H84 A;  4REK A;  2E5V A;  2BK4 A;  3H8I A;  3G5Q A;  3NNE A;  4MJW A;  1NG3 A;  3GYJ A;  3NT6 A;  2B9Y A;  3GYX A;  4H4V A;  2XDO A;  1NAA A;  2XVI A;  2XLT A;  3ALM A;  4Y4L A;  3H8L A;  3GRS A;  4B1B A;  2C73 A;  3UOX A;  4A5L A;  5EOW A;  3QSS A;  3UTH A;  2CDU A;  5C2T A;  1OJA A;  1FL2 A;  4JY3 A;  3VR9 A;  5HXI A;  1ZOV A;  1ELI A;  2AAQ A;  5KOW A;  1TRB A;  3DJJ A;  4OPI A;  2CFY A;  2APG A;  4NTE A;  4FK1 C;  2YM2 A;  1GV4 A;  2Q6U A;  1FEB A;  3BNU A;  3ALJ A;  3SFE A;  4EQS A;  3K7Q X;  2CVJ A;  3LZX A;  3FPZ A;  1DJN A;  1NG4 A;  4GDE A;  1JOA A;  4JDR A;  1TYT A;  4B66 A;  2XVH A;  2DKH A;  1NHS A;  2V3A A;  4LII A;  2E1M A;  5EB5 A;  3NTD A;  2Q0K A;  3NKS A;  1YY5 A;  3AEC A;  1B4V A;  2BC1 A;  2C66 A;  2WES A;  3DJE A;  4H4U A;  4U8N A;  2BC0 A;  1PBD A;  4NWZ A;  5IQ4 A;  1N4U A;  1LJ1 A;  3AE8 A;  3GD4 A;  1YQZ A;  5JCI A;  2TPR A;  1N1P A;  3F8D A;  1D7L A;  1VDC A;  4GF7 A;  3RNM A;  1PBE A;  4CNJ A;  3AED A;  5FS9 A;  1XHC A;  4C74 A;  1IUX A;  1M64 A;  3AYI A;  5BUK A;  2FJA A;  1CJ2 A;  1GTH A;  1XAN A;  1KNR A;  2NPX A;  3CGC A;  3C4N A;  1EL5 A;  1KSU A;  2QAE A;  4Z2T A;  1Z6L A;  4USQ A;  2YG4 A;  3UOV A;  4H2N A;  2XFN A;  3QFB A;  5U63 A;  1F6M A;  4X9M A;  4NNJ A;  4XWZ A;  1H81 A;  4TM4 A;  3GWF A;  4JNA A;  3RED A;  3DME A;  3HZL A;  2WPC A;  1Y0P A;  1Q1W A;  2YAU A;  4H2R A;  1IUS A;  2HQM A;  1CBO A;  3C96 A;  1H7X A;  2ZZC A;  4Y4M A;  1ZMD A;  3SXI A;  3F8P A;  2GVC A;  4GAV A;  3GDP A;  1S3E A;  3GYI A;  1D7Y A;  2GR3 A;  1KDG A;  4JNQ A;  1CL0 A;  5KVI A;  4Z25 A;  4EQX A;  5ER0 A;  1XPQ A;  2B7R A;  1CJC A;  1OJ9 A;  1FOH A;  1H6V A;  1CC2 A;  3ISH A;  2IVD A;  1E1N A;  1JU2 A;  2YLS A;  3D1C A;  1GND A;  4A99 A;  2GF3 A;  1PBB A;  4RSL A;  2BS2 A;  4BK1 A;  3GDN A;  3S61 A;  2V3B A;  3KA7 A;  5M0Z A;  3ALL A;  1YKJ A;  1GER A;  4O5U A;  4DGK A;  3NK1 X;  4H4P A;  2EQ9 A;  3CPH G;  1PXC A;  1O94 A;  1N4W A;  1NEK A;  4H2Q A;  4Z2R A;  4APN A;  4J31 A;  1ZY8 A;  3SFD A;  3V3N A;  3GRT A;  4OPD A;  1PJ5 A;  3VQR A;  4U8I A;  3QSE A;  2EQ7 A;  4Z24 A;  1OJD A;  1PS9 A;  1GRB A;  4K22 A;  3DGZ A;  3KVE A;  4Z44 A;  1PXA A;  2C64 A;  2BCG G;  4RG4 A;  1ZX9 A;  2EQ8 A;  3R9U A;  1ONF A;  3B3R A;  5EBK A;  4H2P A;  2VRM A;  4AP1 A;  4I59 A;  4ECH A;  1E1K A;  4U8J A;  2FJB A;  2R4E A;  5C3J A;  4A7A A;  3DK8 A;  5FMH A;  2XLP A;  2RGJ A;  5M10 A;  2FBW A;  3EAO A;  3AYJ A;  4TLZ A;  5L46 A;  4TLX A;  4BK2 A;  4C3Y A;  3FG2 P;  4P9S A;  2WS3 A;  3T31 A;  2A89 A;  4TM0 A;  2YWL A;  4H4X A;  5KMP A;  1PBF A;  1TDF A;  3FMW A;  1DXL A;  4GRT A;  3AE3 A;  3T2Y A;  2R46 A;  4FDC B;  4G9K A;  2VZ2 A;  2GR0 A;  2GR2 A;  3UTG A;  4IVM B;  2B9X A;  5BRT A;  3UTF A;  3F8R A;  2YQU A;  3NG7 X;  3AWI A;  1IUW A;  1CF3 A;  3CND A;  3GSI A;  4YKF A;  3NK2 X;  1GRE A;  1ZKQ A;  5EB4 A;  5JCM A;  3CGB A;  1CC6 A;  5HHF A;  3VRD B;  2WDV A;  1KF6 A;  2WDQ A;  1O5W A;  2C76 A;  1QO8 A;  2V6O A;  3DJD A;  3AD9 B;  3ATQ A;  1D5T A;  5IPY A;  4X4J A;  3I6D A;  5FS6 A;  2BRA A;  2XFQ A;  1LTX R;  3BI4 A;  2B9W A;  2VOU A;  3NYE A;  2WHD A;  3Q9T A;  1JRY A;  2XLR A;  1S3B A;  2R0P A;  4K7Z A;  4XWR A;  3II4 A;  1BF3 A;  1PHH A;  3LOV A;  2YM1 A;  3CNP A;  4EIP A;  2BS3 A;  4H7U A;  1PBC A;  1E1M A;  1F8W A;  1ZK7 A;  3IC9 A;  4TM1 A;  3VRB A;  1HYU A;  4BUR A;  1K0L A;  1MOK A;  2QA1 A;  3AYL A;  2BAB A;  2GMJ A;  4UDR A;  5DBJ A;  4EQR A;  1EL9 A;  3IHG A;  3LAD A;  4K5S A;  5KMR A;  4B65 A;  2AQJ A;  4YXD A;  2BK5 A;  3P4P A;  1B8S A;  4OPT A;  3UKQ A;  3RP8 A;  3UOY A;  5J60 A;  2WDR A;  1UKV G;  4M52 A;  2X99 A;  4H4Z A;  4KX6 A;  3UKP A;  2R9Z A;  2OAM A;  2V60 A;  1F8R A;  4JN9 A;  2OAL A;  3AB1 A;  4ICY A;  4OPC A;  2C4C A;  4YT0 A;  3DK9 A;  4YSY A;  2XFO A;  2QA2 A;  2RGH A;  4YTP A;  2H88 A;  1OJT A;  3CN8 A;  4NTD A;  4DSG A;  4ZCD A;  4B67 A;  3AE1 A;  1QLB A;  3GWD A;  3ADA B;  3LXD A;  3K7M X;  1GES A;  4C3X A;  4DSH A;  2YLZ A;  3P4S A;  2BRY A;  4YTM A;  3RHA A;  5KVH A;  3S5W A;  3AE4 A;  3T2Z A;  3OZ2 A;  1H7W A;  4GAP A;  4O5Q A;  5JCL A;  4OPG A;  5U1O A;  5IQ1 A;  4G74 A;  2OLO A;  1VRQ B;  2GEW A;  1GOS A;  3GMB A;  5CKU A;  4YWO A;  2ZBW A;  4AOX A;  2ZZB A;  3NRN A;  3SYI A;  3EAN A;  3Q6J A;  3NLC A;  4EIQ A;  5BVA A;  1PDH A;  1LV0 A;  3G5R A;  3CPJ G;  1S2Y A;  3NH3 X;  1LVL A;  4J56 A;  3AEE A;  2XCG A;  2C7G A;  4J57 A;  1GRG A;  2JB3 A;  2XFP A;  3OC4 A;  1GRF A;  1DOC A;  4E0V A;  1KNP A;  3IWA A;  4H4T A;  2C70 A;  3T0K A;  3URH A;  4ZN0 A;  1DNC A;  2XFU A;  2WET A;  4IA6 A;  3E1T A;  1TDE A;  3UKH A;  1EBD A;  4EMW A;  1GXF A;  4J36 A;  4GCM A;  3AD7 B;  3UP4 A;  2XLS A;  3KPK A;  4A79 A;  4GUV A;  2CUL A;  3BHK A;  3NK0 X;  2YR5 A;  1GTE A;  3NN0 X;  1E39 A;  4CCQ A;  3KLJ A;  5TR3 A;  4G6H A;  2YLW A;  3PS9 A;  2FJD A;  4J34 A;  3T37 A;  5HY5 A;  3V76 A;  2YLT A;  2GAH B;  2WOV A;  2YR6 A;  3ABV A;  3SGL A;  3CMM A;  3AEA A;  1IUU A;  4PAB A;  1EL7 A;  3KD9 A;  1NEN A;  4II2 A;  5FS7 A;  1E1L A;  1CHU A;  1P2E A;  4D04 A;  4U2T A;  4EMJ A;  2GQW A;  3UKK A;  3M12 A;  4CNK A;  3B6D A;  2Q0L A;  4U8K A;  3AE6 A;  5KMQ A;  2GR1 A;  1REO A;  3VR8 A;  2X8G A;  2R0C A;  1DOD A;  2R4J A;  1AOG A;  4XXG A;  2B7S A;  2R0G A;  4EMI A;  4D03 A;  1L9E A;  4BJZ A;  4Z43 A;  3CNS A;  2C65 A;  1D4C A;  3UKA A;  4U2S A;  1B37 A;  2VVL G;  2WPF A;  2XVF A;  4JY2 A;  4OPU A;  4ADW A;  5KXJ A;  3G5S A;  3GD3 A;  3DGH A;  4NEV A;  2X8C A;  3T2K A;  2I0Z A;  3QVP A;  2V5Z A;  4EM4 A;  3ZYX A;  2RGO A;  2FJE A;  4U8L A;  3ICT A;  3QJ4 A;  1BZL A;  3SY4 A;  1GRA A;  1MO9 A;  2BYB A;  4H4R A;  3RP7 A;  3BI2 A;  3NHO X;  2UZZ A;  2BA9 A;  1DOE A;  3KKJ A;  4OCG A;  1M6I A;  2H89 A;  1GEU A;  2WU2 A;  4H4W A;  4WCT A;  1ZP0 A;  4B64 A;  4EQW A;  5KWF A;  5JCN A;  5KOX A;  3ATR A;  3HYV A;  1S2Q A;  3RP6 A;  2YVJ A;  3AE7 A;  3FIM B;  1L9C A;  3COX A;  2IVE A;  2WP6 A;  1JNR A;  3AD8 B;  1OJC A;  2Y6R A;  3IHM A;  2R45 A;  1SEZ A;  3NGC X;  4UP3 A;  1FEA A;  2BK3 A;  3WE0 A;  4UDP A;  3K30 A;  1E6E A;  2YR4 A;  3P1W A;  2JB2 A;  2O9Z A;  3ITJ A;  2JBV A;  2GB0 A;  1ZDL A;  3DK4 A;  3UP5 A;  2VVM A;  1H82 A;  1Y56 B;  1GPE A;  1D4E A;  2ZZ0 A;  4B69 A;  1JNZ A;  2C67 A;  4H4S A;  4AT2 A;  4Z26 A;  4H4Y A;  1FEC A;  4I58 A;  3HYW A;  4J2W A;  1TDK A;  1F3P A;  2JB1 A;  3DH9 A;  2DKI A;  2WP5 A;  2YVF A;  4CRT A;  1Q9I A;  3AE5 A;  4ZCC A;  4OVI A;  1NDA A;  2QCU A;  4YSZ A;  4Z2U A;  1IUT A;  1V59 A;  2JAE A;  3M0O A;  3EF6 A;  1RP0 A;  3NYC A;  1COY A;  1VQW A;  3BNM A;  5BUL A;  3AE2 A;  3GMC A;  1CJ3 A;  1GET A;  4KPR A;  3UKL A;  3AEG A;  2X8H A;  1N4V A;  3DA1 A;  4LA1 A;  4WX1 A;  3NTA A;  3I3L A;  3UTE A;  5KMS A;  5KNL A;  1NHQ A;  3SQP A;  2BXS A;  2C75 A;  4BV6 A;  4DNA A;  4A9W A;  2Z5X A;  4CBQ A;  1IJH A;  3LZW A;  1ZOY A;  3P9U A;  1RSG A;  2OLN A;  4HB9 A;  3EPT A;  2VQ7 A;  5GRT A;  1H86 A;  1KFY A;  3T14 A;  2C3C A;  1GT8 A;  4NZH A;  4U2L A;  1K0J A;  1BWC A;  5J7X A;  4B63 A;  1PXB A;  4LU6 A;  1JEH A;  4H4Q A;  4NTC A;  1PN0 A;  1NPX A;  2WPE A;  4BJY A;  2VVL A;  2X3N A;  4EM3 A;  1TYP A;  3AXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...