3LZWA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form i)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 100
structure length 329
sequence length 329
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzwA02
4TM4A 3WE0A 2XVFA 3VR9A 3GDNA 3KU9A 4H2QA 4B69A 5EB4A 2YR5A 4GUVA 1N4UA 4D03A 1H6VA 3RHAA 3CIRA 1XDIA 3GYIA 1GV4A 5M0ZA 2YVJA 3CPJG 4I58A 1Y0PA 4DSHA 2A87A 2V3BA 3QSSA 4REKA 4IA5A 2YG7A 3PO7A 1GRBA 2V60A 1YQ4A 2BACA 1CBOA 2WS3A 4X9NA 3AEAA 1M64A 3AE1A 2EQ7A 5BULA 3PVCA 4AP3A 1XHCA 5TR3A 4U2LA 5BRTA 2XFNA 2CULA 4H2PA 4H4TA 4XXGA 2GRTA 5IPYA 2XCGA 3L8KA 3HZLA 3G5QA 2YQUA 5EOWA 4NZHA 3EANA 3KA7A 1TDKA 3B3RA 1CHUA 2DKIA 1VQWA 3CTYA 1QO8A 4CRTA 1LPFA 4EQRA 3AB1A 1DOEA 2B9YA 2BA9A 4GCMA 1CJCA 3UTEA 2JK6A 2Q7VA 1D4DA 3VRBA 2C75A 5JCNA 4U8LA 4BK3A 2GR1A 1S3BA 2QCUA 4GDPA 3ZDNA 2XFOA 1ZK7A 3QSEA 1H86A 4A5LA 2IVDA 2HQMA 1GTHA 3SGLA 1V59A 1F8RA 1QJDA 2C65A 4B1BA 1K0LA 4H4ZA 3GWDA 2R4EA 2XYOA 2JBVA 1PHHA 2WP9A 1BF3A 2R9ZA 1CC2A 4Z26A 4RG3A 2BYBA 1LQUA 3AD9B 2NVKX 1Y56A 4U8PA 2VQBA 2BK3A 1FCDA 3OC4A 3DJGX 1B5QA 1X31B 3P4RA 4J33A 4C3XA 3AYJA 5KOWA 4J36A 2GH5A 2IVEA 4JY2A 3B6DA 5LV9A 3UKQA 4CNKA 2JAEA 5FS6A 3CGBA 2YLXA 2BCGG 2GR0A 3LOVA 4OPLA 4OPUA 2H89A 5HXIA 2V3AA 1KNRA 3RNMA 4CCRA 3V3OA 2B7RA 2C3CA 3AE9A 4J31A 3GYJA 1O95A 4EIPA 5JCLA 1LJ1A 1D4CA 3DK8A 1CL0A 3NN6X 3T37A 1LVLA 3IC9A 3LJPA 2YG4A 1FEAA 4DGKA 1ZP0A 2V5ZA 2XFUA 1E7PA 3NK2X 3ADAB 4Z44A 4APNA 1LV0A 5BVAA 2BS4A 2F5ZA 2YR6A 1M6IA 3O0HA 4U8JA 5CKUA 4B67A 4AOSA 2V6OA 2XLSA 4Z43A 2QAEA 4H4YA 1DNCA 3E1TA 5M10A 2XLTA 3AE2A 3G5SA 5IQ1A 1BZLA 2EQ6A 3M0OA 4TM1A 1NENA 3M13A 1IUUA 2OLOA 2BC0A 1NG4A 2R45A 3NKSA 3DJEA 1E39A 2AR8A 3ICSA 4FDCB 4OPTA 1NG3A 4WX1A 1FECA 4HA6A 4B64A 3IF9A 3CN8A 2PHHA 4AP1A 3KPFA 4UDQA 3ALMA 5C3JA 5HHFA 4DSGA 4BK1A 5HY5A 2YVFA 4I59A 3P4SA 4M52A 1JEHA 2GQFA 3DK9A 4U2SA 2VZ2A 3AE3A 4H7UA 1GREA 3AECA 3FBSA 3BI2A 3D8XA 1JRYA 2BK4A 3V76A 4DNAA 1JU2A 1GTEA 3GD4A 3LZXA 2VVMA 3URHA 3UOYA 1YQZA 2B9WA 4ZCCA 4CY6A 2EQ8A 4LU6A 3F8DA 2X50A 2WP5A 5FS7A 5FS9A 4Z25A 2Q0KA 3BI5A 4ICYA 2VOUA 1F6MA 3CNDA 4A7AA 4H2RA 4J34A 1PJ7A 1E1NA 4FK1A 4OVIA 4U2TA 4E0VA 4J56A 4Y4NA 4C77A 1H83A 4YTNA 4K22A 2XLUA 3I3LA 2XVEA 2W0HA 1Y56B 2Q6UA 1TYTA 2YVGA 3NYFA 1DODA 2YM2A 4PABA 3ALLA 1L9CA 5BUKA 2C7GA 3AD8B 1ZOYA 2YM1A 4EQXA 1B4VA 4ZN0A 1TRBA 2XFQA 1PBBA 3UCLA 3UKHA 1S2YA 4Z2UA 4BK2A 3AEFA 1NHQA 1L0VA 3UTFA 2OLNA 1JRXA 2GMHA 1IUVA 2Z5YA 3NK1X 3AE7A 1PJ6A 2C66A 5U25A 4ADWA 1F8SA 1GETA 3NK0X 2PYXA 3C4AA 3C96A 4Y4MA 2NPXA 3NNEA 2FJAA 2JB3A 4PAAA 4TM0A 4A6NA 1MO9A 1GESA 2XVIA 4CBQA 1KDGA 2GEWA 4K5SA 2C64A 1H7WA 3K30A 1PBFA 4NEWA 4NEVA 4A99A 3AYIA 1N1PA 2GR2A 4GDEA 3EAOA 4TM3A 3UKPA 1CC6A 4OPGA 4BJYA 3DJJA 2XLRA 3AEDA 3SFEA 2X8HA 4OCGA 1EL9A 1GRHA 2FJDA 4C74A 1TDOA 2ZBWA 1S3EA 4J57A 3QFAA 2WDRA 2ZZBA 2WOVA 4H4SA 3CNTA 3P1WA 1B8SA 4FK1C 3IHGA 2XLPA 2A8XA 4KX6A 4Z2TA 2WDVA 5GRTA 1ZX9A 1ONFA 1IUXA 2BXRA 3DJDA 3H4KA 4H50A 4JNAA 3ATQA 4H4PA 1VDCA 1OJTA 1H84A 1O94A 2X8GA 3P4QA 3UOZA 3JSKA 3LADA 2WPFA 2C72A 4X4JA 3S5WA 1IUWA 4B68A 5HYMA 3M12A 1Q1RA 3II4A 3ICRA 1FOHA 5EB5A 1ZOVA 2YG6A 2YR4A 2E5VA 3CNPA 3KLJA 4LA1A 3CGCA 1BWCA 2B7SA 3D1CA 1JRZA 3VQRA 1B37A 1IUTA 1N4WA 1KFYA 3C4NA 5L46A 3GD3A 1PBCA 1GALA 1TDNA 3NIXA 3IHMA 3F8PA 4KPRA 2J3NA 3LZWA 4XWZA 2GB0A 1LTXR 1ZMCA 2QA2A 1HYUA 4H4VA 4N9XA 4A9WA 1IUSA 2IIDA 3ZYXA 2RGOA 1D7YA 1VG0A 3K7MX 4JQ9A 2GVCA 2WHDA 2ARDA 1YKJA 3I6DA 1JNRA 3GMCA 2BC1A 4YSYA 2RGJA 5KVHA 2XFPA 2WU2A 1DOBA 1O5WA 3UP5A 3DGZA 1E1LA 1NHRA 1EL7A 1H7XA 3ABVA 1D5TA 3BI4A 4Y4LA 1BGJA 2VRMA 3QVPA 3UP4A 4JNQA 4K7ZA 2C3DA 4H4WA 1ZY8A 2VVLA 1GOSA 4Z2RA 2BS3A 2CDUA 1PBEA 3EF6A 3KVEA 4EM3A 1UKVG 3PS9A 3RP8A 3GMBA 3DMEA 3AXBA 1JNZA 4IV9A 4OPIA 2FBWA 4OPCA 2CFYA 2FJEA 4NTCA 4WCTA 1GRFA 2AQJA 1DJQA 1YQ3A 3CGDA 3GSIA 2EQ9A 3CPHG 4ZCDA 4BV6A 1GXFA 1CJ2A 4A6NB 2GV8A 1AOGA 1NHSA 1CJ3A 2R0GA 3AE4A 1L9DA 2YLZA 4K2XA 4H4XA 4EQWA 1GT8A 1QLBA 3G5RA 2GF3A 1Z6LA 1GEUA 2BXSA 4O5QA 4UDPA 2R46A 3GWFA 4GR1A 4D04A 5KXJA 3QJ4A 4USRA 2X99A 3K7QX 3L1RA 2BABA 3AWIA 4YKGA 2YLRA 1GRGA 1PXAA 5J60A 1RP0A 4AOXA 3AE8A 1VRQB 2APGA 4H4RA 2AAQA 4K8DA 1E6EA 4C5OA 4YTPA 4IVOB 3UKLA 2JB2A 4Z24A 3NTAA 3SFDA 3V3NA 3AE6A 2C70A 3AYLA 4K5RA 5JCKA 1KSUA 2TMDA 1D4EA 1RYIA 2R0CA 4USQA 2WPEA 3VRDB 1P2HA 2I0ZA 3GRSA 3Q6JA 1YY5A 3KKJA 4YWOA 2Y6QA 2R4JA 3ITJA 3SQPA 2WOIA 4YXDA 4EM4A 2V61A 3LB8A 4B63A 4EMJA 4UP3A 4IVMB 2WEUA 4C3YA 2B76A 2WETA 3NN0X 4YSXA 2RGHA 2GQWA 2WESA 3DGHA 1W4XA 1BKWA 2Q0LA 3P9UA 1K0JA 2E4GA 2YLTA 3NLCA 4H2NA 4JY3A 4U8IA 1RSGA 3FPZA 5CQFA 3UKKA 1DJNA 3ISHA 1FEBA 3K7TA 3RP6A 4AT2A 2ZZ0A 3CNSA 4H4UA 1K4QA 3NYEA 3COXA 1ZDLA 2Z5XA 4ECHA 1F3PA 1H81A 1FL2A 1N4VA 1NDAA 3Q9TA 3NH3X 3UKFA 3AD7B 1TYPA 1PDHA 3LXDA 3H8LA 3NG7X 4YSHA 5KVIA 1GSNA 4YT0A 2ACZA 3AEEA 1REOA 5IQ4A 2O9ZA 4JDRA 1OJAA 3FIMB 5FS8A 2ZZCA 3NRNA 3F8RA 1GRTA 1SEZA 4RSLA 3REDA 2UZZA 4U8OA 1LQTA 1GPEA 3QVRA 2WOWA 4YKFA 3CNJA 3FMWA 4FX9A 4U8MA 1NPXA 2FJBA 4LIIA 1JOAA 1OJDA 3S61A 2A89A 2YLSA 2H88A 3CPIG 2OALA 2GMJA 3AEBA 3ALJA 1NEKA 1PBDA 3GDPA 3UTGA 1MXTA 4CY8A 1IJHA 3ICTA 2GR3A 3KD9A 4CNJA 4B66A 4EMIA 4EQSA 2WBAA 2XVHA 4BURA 3BNMA 1XPQA 4OPDA 1NAAA 4EMWA 4HB9A 2XDOA 2QA1A 3NHOX 1COYA 1CF3A 4P9SA 2VRLA 1CJ4A 2Y6RA 3UKAA 3P4PA 5GSNA 5KWFA 1ZMDA 2VQ7A 2YAUA 1ZKQA 1H82A 2YG3A 1PN0A 1PJ5A 2X3NA 4H4QA 5KRQA 4RG4A 2X8CA 3UOXA 4U8NA 4B65A 1PXCA 3QFBA 1F8WA 2BCPA 4J2WA 3NGCX 2C67A 4CCQA 4XWRA 2YLWA 2BK5A 1EL8A 2C73A 1KSSA 3AEGA 3BNUA 5EBKA 2CVJA 3CGEA 4UDRA 5J7XA 2WP6A 5U1OA 2WU5A 1L9EA 2OA1A 1D7LA 4IA6A 2DKHA 2B9XA 5FMHA 1GERA 1OJ9A 4MJWA 2JKCA 4BJZA 3NYCA 4YTMA 1BGNA 2OAMA 1TDEA 3UOVA 2RABA 3RP7A 5C2TA 4X9MA 5KOXA 3VRAA 1K0IA 3SM8A 1S2QA 1OJCA 1VG9A 2GAHB 2C76A 3UTHA 4A65A 4JN9A 1GNDA 3QSMA 4NTDA 1PS9A 1ELIA 3FG2P 2WPCA 4O5UA 1DOCA 3H8IA 1Q1WA 4TLXA 1P2EA 2GAGB 1TDFA 5DBJA 4EIQA 5JCMA 3DH9A 3DK4A 4GF7A 3R9UA 1KF6A 3ATRA 3IWAA 2JB1A 1EBDA 2R0PA 3DA1A 2YWLA 2E1MA 1EL5A 3GRTA 1PXBA 4GRTA 3AE5A 4NTEA 3BHKA 1E1MA 2BS2A 2VVLG 3OZ2A 5JCIA 2TPRA 1KNPA 1CC4A 1DXLA 4U8KA 1MOKA 5U63A 5ER0A 3NTDA 1E1KA 1XANA 4A79A 3VR8A 1GRAA 3BHFA 4TLZA 1Q9IA 4YSZA 2XVJA 3NT6A 2WQYA 1NHPA 2YG5A 2WDQA 3EPTA 4AT0A
chains in the Genus database with same CATH superfamily
4TM4A 3WE0A 2XVFA 3T31A 3GDNA 3KU9A 4H2QA 3VR9A 5EB4A 4B69A 2YR5A 4GUVA 1N4UA 4D03A 1H6VA 3RHAA 3CIRA 1XDIA 3GYIA 4II3A 5KMRA 1GV4A 5M0ZA 2YVJA 3CPJG 4I58A 1Y0PA 4DSHA 2A87A 2V3BA 3QSSA 4REKA 4IA5A 2YG7A 3PO7A 1GRBA 2V60A 1YQ4A 2BACA 1CBOA 2WS3A 4X9NA 3AEAA 1M64A 3AE1A 2EQ7A 5BULA 3PVCA 4AP3A 1XHCA 5TR3A 4U2LA 5BRTA 2BRYA 2XFNA 2CULA 4H2PA 4H4TA 4XXGA 2GRTA 5IPYA 2XCGA 3L8KA 3HZLA 3G5QA 2YQUA 5EOWA 4NZHA 3EANA 3KA7A 1TDKA 3B3RA 1CHUA 2DKIA 1VQWA 3CTYA 1QO8A 4CRTA 1LPFA 4EQRA 3AB1A 1DOEA 2B9YA 2BA9A 4GCMA 1CJCA 3UTEA 2JK6A 2Q7VA 1D4DA 3VRBA 2C75A 5JCNA 4U8LA 4BK3A 2GR1A 1S3BA 2QCUA 4GDPA 3ZDNA 2XFOA 1ZK7A 3QSEA 1H86A 4A5LA 2IVDA 2HQMA 1GTHA 3SGLA 1V59A 1F8RA 1QJDA 2C65A 5KMSA 4B1BA 1K0LA 4H4ZA 3GWDA 2R4EA 2XYOA 2JBVA 1PHHA 2WP9A 1BF3A 2R9ZA 1CC2A 4Z26A 4RG3A 2BYBA 1LQUA 3AD9B 5KNLA 2NVKX 1Y56A 4U8PA 2VQBA 2BK3A 1FCDA 3OC4A 3DJGX 1B5QA 1X31B 3P4RA 4J33A 4C3XA 3AYJA 4NNJA 5KOWA 4J36A 2GH5A 2IVEA 4JY2A 3B6DA 5LV9A 3UKQA 4CNKA 2JAEA 5FS6A 3CGBA 2YLXA 2BCGG 2GR0A 3LOVA 4OPLA 4OPUA 2H89A 5HXIA 2V3AA 1KNRA 3RNMA 4CCRA 3V3OA 2B7RA 2C3CA 3AE9A 4J31A 3GYJA 1O95A 4EIPA 5JCLA 1LJ1A 1D4CA 3DK8A 1CL0A 3NN6X 3T37A 1LVLA 3IC9A 3LJPA 2YG4A 1FEAA 4DGKA 1ZP0A 2V5ZA 2XFUA 1E7PA 3HYXA 3NK2X 3ADAB 4Z44A 4APNA 1LV0A 5BVAA 2BS4A 2F5ZA 2YR6A 3T0KA 1M6IA 3O0HA 4GAVA 4U8JA 5CKUA 4B67A 3KPKA 4AOSA 2V6OA 2XLSA 3SXIA 4Z43A 2QAEA 4H4YA 1DNCA 3E1TA 5M10A 2XLTA 3AE2A 3G5SA 5IQ1A 1BZLA 2EQ6A 3M0OA 4TM1A 1NENA 3M13A 1IUUA 2OLOA 2BC0A 1NG4A 3SZCA 2R45A 3NKSA 3DJEA 1E39A 2AR8A 3ICSA 4FDCB 4OPTA 1NG3A 4WX1A 1FECA 4HA6A 4B64A 3IF9A 3CN8A 2PHHA 4AP1A 3KPFA 4UDQA 3ALMA 5C3JA 5HHFA 4DSGA 4BK1A 5HY5A 2YVFA 4I59A 3P4SA 4M52A 1JEHA 2GQFA 3DK9A 4U2SA 2VZ2A 3AE3A 4H7UA 1GREA 3AECA 3FBSA 3BI2A 3D8XA 1JRYA 2BK4A 3V76A 4DNAA 4GAPA 1JU2A 1GTEA 3GD4A 3LZXA 2VVMA 3URHA 3UOYA 1YQZA 2B9WA 4ZCCA 4CY6A 2EQ8A 4LU6A 3F8DA 2X50A 2WP5A 5FS7A 5FS9A 4Z25A 2Q0KA 3BI5A 4ICYA 2C4CA 1F6MA 2VOUA 3CNDA 4H2RA 4J34A 1PJ7A 1E1NA 4FK1A 4OVIA 4U2TA 4E0VA 4J56A 4Y4NA 4C77A 1H83A 4YTNA 4K22A 2XLUA 3I3LA 2XVEA 2W0HA 1Y56B 2Q6UA 1TYTA 2YVGA 3NYFA 1DODA 2YM2A 4PABA 3ALLA 1L9CA 5BUKA 2C7GA 3AD8B 1ZOYA 2YM1A 4EQXA 1B4VA 4ZN0A 1TRBA 2XFQA 1PBBA 3UCLA 3UKHA 1S2YA 4Z2UA 4BK2A 3T14A 3AEFA 1NHQA 1L0VA 3UTFA 2OLNA 1JRXA 2GMHA 1IUVA 2Z5YA 3NK1X 4G6HA 3AE7A 1PJ6A 2C66A 5U25A 4ADWA 1F8SA 1GETA 3NK0X 2PYXA 3C4AA 3C96A 4Y4MA 2NPXA 3NNEA 2FJAA 2JB3A 4PAAA 4TM0A 4A6NA 1MO9A 1GESA 2XVIA 4CBQA 1KDGA 2GEWA 4K5SA 2C64A 1H7WA 3K30A 1PBFA 4NEWA 4NEVA 4A99A 3AYIA 1N1PA 2GR2A 4GDEA 3EAOA 4TM3A 3UKPA 1CC6A 4OPGA 4BJYA 3DJJA 2XLRA 3AEDA 3SFEA 2X8HA 4OCGA 1EL9A 1GRHA 2FJDA 4C74A 1TDOA 2ZBWA 1S3EA 4J57A 3QFAA 2WDRA 2ZZBA 2WOVA 4H4SA 3CNTA 3P1WA 1B8SA 4FK1C 3IHGA 2XLPA 2A8XA 4KX6A 4Z2TA 2WDVA 5GRTA 1ZX9A 1ONFA 1IUXA 2BXRA 3DJDA 3H4KA 4H50A 4JNAA 3ATQA 4H4PA 1VDCA 1OJTA 1H84A 1O94A 2X8GA 3P4QA 3UOZA 3JSKA 3LADA 2WPFA 2C72A 4X4JA 3S5WA 1IUWA 4B68A 5HYMA 3M12A 1Q1RA 3II4A 3ICRA 1FOHA 5EB5A 1ZOVA 2YG6A 2YR4A 2E5VA 3CNPA 3KLJA 4LA1A 3CGCA 3SZWA 1BWCA 2B7SA 3D1CA 1JRZA 3VQRA 1B37A 1IUTA 1N4WA 1KFYA 3C4NA 5L46A 3GD3A 1PBCA 1GALA 1TDNA 3HYWA 3NIXA 3IHMA 3F8PA 5KMQA 4KPRA 2J3NA 3LZWA 4XWZA 3SX6A 2GB0A 1LTXR 1ZMCA 2QA2A 1HYUA 4H4VA 4N9XA 4A9WA 1IUSA 2IIDA 3ZYXA 2RGOA 1D7YA 1VG0A 3K7MX 4JQ9A 2GVCA 2WHDA 2ARDA 1YKJA 3I6DA 1JNRA 3GMCA 2BC1A 4YSYA 2RGJA 5KVHA 2XFPA 2WU2A 1DOBA 1O5WA 3UP5A 3DGZA 1E1LA 1NHRA 1EL7A 1H7XA 3ABVA 1D5TA 3BI4A 4Y4LA 1BGJA 2VRMA 3QVPA 3UP4A 4JNQA 4K7ZA 4II2A 2C3DA 4H4WA 1ZY8A 2VVLA 1GOSA 4Z2RA 2BS3A 2CDUA 1PBEA 4A7AA 3SY4A 3EF6A 3KVEA 4EM3A 1UKVG 3PS9A 3RP8A 4G73A 3GMBA 3DMEA 3AXBA 1JNZA 4IV9A 4OPIA 2FBWA 4OPCA 2CFYA 2FJEA 4NTCA 4WCTA 1GRFA 2AQJA 3T2KA 1DJQA 1YQ3A 3CGDA 3GSIA 2EQ9A 3CPHG 4ZCDA 4BV6A 1GXFA 1CJ2A 4A6NB 2GV8A 1AOGA 1NHSA 1CJ3A 2R0GA 3AE4A 1L9DA 2YLZA 4K2XA 4H4XA 4EQWA 1GT8A 1QLBA 3G5RA 2GF3A 1Z6LA 1GEUA 2BXSA 4O5QA 4UDPA 2R46A 3GWFA 4GR1A 4D04A 5KXJA 3QJ4A 4USRA 4G9KA 2X99A 3K7QX 3L1RA 2BABA 3AWIA 4YKGA 2YLRA 1GRGA 1PXAA 5J60A 1RP0A 4AOXA 3AE8A 1VRQB 2APGA 4H4RA 2AAQA 4K8DA 1E6EA 4C5OA 4YTPA 4IVOB 3UKLA 2JB2A 4Z24A 3NTAA 3SFDA 3V3NA 3AE6A 2C70A 3AYLA 3HYVA 4K5RA 5JCKA 1KSUA 2TMDA 1D4EA 1RYIA 2R0CA 4USQA 2WPEA 3VRDB 5KMPA 1P2HA 2I0ZA 3GRSA 3Q6JA 1YY5A 3KKJA 4YWOA 2Y6QA 2R4JA 3ITJA 3SQPA 2WOIA 4YXDA 4EM4A 2V61A 3LB8A 4B63A 4EMJA 4UP3A 4IVMB 2WEUA 4C3YA 2B76A 2WETA 3NN0X 4YSXA 2RGHA 2GQWA 2WESA 3DGHA 1W4XA 1BKWA 2Q0LA 3P9UA 1K0JA 2E4GA 2YLTA 3NLCA 4H2NA 4JY3A 4U8IA 1RSGA 3FPZA 5CQFA 3UKKA 1DJNA 3ISHA 1FEBA 3K7TA 3RP6A 4AT2A 2ZZ0A 3CNSA 4H4UA 1K4QA 3NYEA 3COXA 1ZDLA 2Z5XA 4ECHA 1F3PA 1H81A 1FL2A 1N4VA 1NDAA 3SYIA 3Q9TA 3NH3X 3UKFA 3AD7B 1TYPA 1PDHA 3LXDA 3H8LA 3NG7X 4YSHA 3SZFA 5KVIA 1GSNA 4YT0A 2ACZA 3AEEA 1REOA 5IQ4A 2O9ZA 4JDRA 1OJAA 3FIMB 5FS8A 2ZZCA 3NRNA 3F8RA 1GRTA 1SEZA 4RSLA 3REDA 2UZZA 4U8OA 1LQTA 1GPEA 3QVRA 3T2YA 2WOWA 4YKFA 3CNJA 3FMWA 4FX9A 4U8MA 1NPXA 2FJBA 4LIIA 1JOAA 1OJDA 3S61A 2A89A 2YLSA 4NWZA 2H88A 3CPIG 2OALA 2GMJA 3AEBA 3ALJA 1NEKA 1PBDA 3GDPA 3UTGA 1MXTA 4CY8A 1IJHA 3ICTA 2GR3A 3KD9A 4CNJA 4B66A 4EMIA 4EQSA 2WBAA 2XVHA 3SZ0A 4BURA 3BNMA 1XPQA 4OPDA 1NAAA 4EMWA 4HB9A 2XDOA 3CMMA 2QA1A 3NHOX 1COYA 1CF3A 4P9SA 2VRLA 1CJ4A 2Y6RA 3UKAA 3P4PA 5GSNA 5KWFA 1ZMDA 2VQ7A 2YAUA 1ZKQA 1H82A 2YG3A 1PN0A 1PJ5A 2X3NA 4G6GA 4H4QA 5KRQA 4RG4A 2X8CA 3GYXA 3UOXA 4U8NA 4B65A 1PXCA 3QFBA 1F8WA 2BCPA 4J2WA 3NGCX 2C67A 4CCQA 4XWRA 2YLWA 2BK5A 1EL8A 2C73A 1KSSA 3AEGA 3BNUA 5EBKA 2CVJA 3CGEA 4UDRA 5J7XA 2WP6A 5U1OA 2WU5A 1L9EA 2OA1A 1D7LA 4IA6A 2DKHA 2B9XA 5FMHA 1GERA 1OJ9A 4MJWA 3T2ZA 2JKCA 4BJZA 3NYCA 4YTMA 1BGNA 2OAMA 1TDEA 3UOVA 2RABA 3RP7A 5C2TA 4X9MA 5KOXA 3VRAA 1K0IA 3SM8A 1S2QA 1OJCA 1VG9A 2GAHB 2C76A 3UTHA 4A65A 4JN9A 1GNDA 3QSMA 4NTDA 1PS9A 1ELIA 3FG2P 2WPCA 4O5UA 1DOCA 3H8IA 1Q1WA 4TLXA 1P2EA 2GAGB 1TDFA 5DBJA 4EIQA 5JCMA 3DH9A 3DK4A 4GF7A 3R9UA 1KF6A 3ATRA 3IWAA 2JB1A 1EBDA 2R0PA 3DA1A 2YWLA 4G74A 2E1MA 1EL5A 3GRTA 1PXBA 4GRTA 3AE5A 4NTEA 3BHKA 1E1MA 2BS2A 2VVLG 2BRAA 3OZ2A 5JCIA 2TPRA 1KNPA 1CC4A 1DXLA 4U8KA 1MOKA 5U63A 5ER0A 3NTDA 1E1KA 1XANA 4A79A 3VR8A 1GRAA 3BHFA 4TLZA 1Q9IA 4YSZA 2XVJA 3NT6A 2WQYA 1NHPA 2YG5A 2WDQA 3EPTA 4AT0A
chains in the Genus database with same CATH topology
4TM4A 3WE0A 2XVFA 3T31A 3GDNA 3KU9A 4H2QA 3VR9A 5EB4A 4B69A 2YR5A 4GUVA 1N4UA 4D03A 1H6VA 3RHAA 3CIRA 1XDIA 3GYIA 4II3A 5KMRA 1GV4A 5M0ZA 2YVJA 3CPJG 4I58A 1Y0PA 4DSHA 2A87A 2V3BA 3QSSA 4REKA 4IA5A 2YG7A 3PO7A 1GRBA 2V60A 1YQ4A 2BACA 1CBOA 2WS3A 4X9NA 3AEAA 1M64A 3AE1A 2EQ7A 5BULA 3PVCA 4AP3A 1XHCA 5TR3A 4U2LA 5BRTA 2BRYA 2XFNA 2CULA 4H2PA 4H4TA 4XXGA 2GRTA 5IPYA 2XCGA 3L8KA 3HZLA 3G5QA 2YQUA 5EOWA 4NZHA 3EANA 3KA7A 1TDKA 3B3RA 1CHUA 2DKIA 1VQWA 3CTYA 1QO8A 4CRTA 1LPFA 4EQRA 3AB1A 1DOEA 2B9YA 2BA9A 4GCMA 1CJCA 3UTEA 2JK6A 2Q7VA 1D4DA 3VRBA 2C75A 5JCNA 4U8LA 4BK3A 2GR1A 1S3BA 2QCUA 4GDPA 3ZDNA 2XFOA 1ZK7A 3QSEA 1H86A 4A5LA 2IVDA 2HQMA 1GTHA 3SGLA 1V59A 1F8RA 1QJDA 2C65A 5KMSA 4B1BA 1K0LA 4H4ZA 3GWDA 2R4EA 2XYOA 2JBVA 1PHHA 2WP9A 1BF3A 2R9ZA 1CC2A 4Z26A 4RG3A 2BYBA 1LQUA 3AD9B 5KNLA 2NVKX 1Y56A 4U8PA 2VQBA 2BK3A 1FCDA 3OC4A 3DJGX 1B5QA 1X31B 3P4RA 4J33A 4C3XA 3AYJA 4NNJA 5KOWA 4J36A 2GH5A 2IVEA 4JY2A 3B6DA 5LV9A 3UKQA 4CNKA 2JAEA 5FS6A 3CGBA 2YLXA 2BCGG 2GR0A 3LOVA 4OPLA 4OPUA 2H89A 5HXIA 2V3AA 1KNRA 3RNMA 4CCRA 3V3OA 2B7RA 2C3CA 3AE9A 4J31A 3GYJA 1O95A 4EIPA 5JCLA 1LJ1A 1D4CA 3DK8A 1CL0A 3NN6X 3T37A 1LVLA 3IC9A 3LJPA 2YG4A 1FEAA 4DGKA 1ZP0A 2V5ZA 2XFUA 1E7PA 3HYXA 3NK2X 3ADAB 4Z44A 4APNA 1LV0A 5BVAA 2BS4A 2F5ZA 2YR6A 3T0KA 1M6IA 3O0HA 4GAVA 4U8JA 5CKUA 4B67A 3KPKA 4AOSA 2V6OA 2XLSA 3SXIA 4Z43A 2QAEA 4H4YA 1DNCA 3E1TA 5M10A 2XLTA 3AE2A 3G5SA 5IQ1A 1BZLA 2EQ6A 3M0OA 4TM1A 1NENA 3M13A 1IUUA 2OLOA 2BC0A 1NG4A 3SZCA 2R45A 3NKSA 3DJEA 1E39A 2AR8A 3ICSA 4FDCB 4OPTA 1NG3A 4WX1A 1FECA 4HA6A 4B64A 3IF9A 3CN8A 2PHHA 4AP1A 3KPFA 4UDQA 3ALMA 5C3JA 5HHFA 4DSGA 4BK1A 5HY5A 2YVFA 4I59A 3P4SA 4M52A 1JEHA 2GQFA 3DK9A 4U2SA 2VZ2A 3AE3A 4H7UA 1GREA 3AECA 3FBSA 3BI2A 3D8XA 1JRYA 2BK4A 3V76A 4DNAA 4GAPA 1JU2A 1GTEA 3GD4A 3LZXA 2VVMA 3URHA 3UOYA 1YQZA 2B9WA 4ZCCA 4CY6A 2EQ8A 4LU6A 3F8DA 2X50A 2WP5A 5FS7A 5FS9A 4Z25A 2Q0KA 3BI5A 4ICYA 2C4CA 1F6MA 2VOUA 3CNDA 4H2RA 4J34A 1PJ7A 1E1NA 4FK1A 4OVIA 4U2TA 4E0VA 4J56A 4Y4NA 4C77A 1H83A 4YTNA 4K22A 2XLUA 3I3LA 2XVEA 2W0HA 1Y56B 2Q6UA 1TYTA 2YVGA 3NYFA 1DODA 2YM2A 4PABA 3ALLA 1L9CA 5BUKA 2C7GA 3AD8B 1ZOYA 2YM1A 4EQXA 1B4VA 4ZN0A 1TRBA 2XFQA 1PBBA 3UCLA 3UKHA 1S2YA 4Z2UA 4BK2A 3T14A 3AEFA 1NHQA 1L0VA 3UTFA 2OLNA 1JRXA 2GMHA 1IUVA 2Z5YA 3NK1X 4G6HA 3AE7A 1PJ6A 2C66A 5U25A 4ADWA 1F8SA 1GETA 3NK0X 2PYXA 3C4AA 3C96A 4Y4MA 2NPXA 3NNEA 2FJAA 2JB3A 4PAAA 4TM0A 4A6NA 1MO9A 1GESA 2XVIA 4CBQA 1KDGA 2GEWA 4K5SA 2C64A 1H7WA 3K30A 1PBFA 4NEWA 4NEVA 4A99A 3AYIA 1N1PA 2GR2A 4GDEA 3EAOA 4TM3A 3UKPA 1CC6A 4OPGA 4BJYA 3DJJA 2XLRA 3AEDA 3SFEA 2X8HA 4OCGA 1EL9A 1GRHA 2FJDA 4C74A 1TDOA 2ZBWA 1S3EA 4J57A 3QFAA 2WDRA 2ZZBA 2WOVA 4H4SA 3CNTA 3P1WA 1B8SA 4FK1C 3IHGA 2XLPA 2A8XA 4KX6A 4Z2TA 2WDVA 5GRTA 1ZX9A 1ONFA 1IUXA 2BXRA 3DJDA 3H4KA 4H50A 4JNAA 3ATQA 4H4PA 1VDCA 1OJTA 1H84A 1O94A 2X8GA 3P4QA 3UOZA 3JSKA 3LADA 2WPFA 2C72A 4X4JA 3S5WA 1IUWA 4B68A 5HYMA 3M12A 1Q1RA 3II4A 3ICRA 1FOHA 5EB5A 1ZOVA 2YG6A 2YR4A 2E5VA 3CNPA 3KLJA 4LA1A 3CGCA 3SZWA 1BWCA 2B7SA 3D1CA 1JRZA 3VQRA 1B37A 1IUTA 1N4WA 1KFYA 3C4NA 5L46A 3GD3A 1PBCA 1GALA 1TDNA 3HYWA 3NIXA 3IHMA 3F8PA 5KMQA 4KPRA 2J3NA 3LZWA 4XWZA 3SX6A 2GB0A 1LTXR 1ZMCA 2QA2A 1HYUA 4H4VA 4N9XA 4A9WA 1IUSA 2IIDA 3ZYXA 2RGOA 1D7YA 1VG0A 3K7MX 4JQ9A 2GVCA 2WHDA 2ARDA 1YKJA 3I6DA 1JNRA 3GMCA 2BC1A 4YSYA 2RGJA 5KVHA 2XFPA 2WU2A 1DOBA 1O5WA 3UP5A 3DGZA 1E1LA 1NHRA 1EL7A 1H7XA 3ABVA 1D5TA 3BI4A 4Y4LA 1BGJA 2VRMA 3QVPA 3UP4A 4JNQA 4K7ZA 4II2A 2C3DA 4H4WA 1ZY8A 2VVLA 1GOSA 4Z2RA 2BS3A 2CDUA 1PBEA 4A7AA 3SY4A 3EF6A 3KVEA 4EM3A 1UKVG 3PS9A 3RP8A 4G73A 3GMBA 3DMEA 3AXBA 1JNZA 4IV9A 4OPIA 2FBWA 4OPCA 2CFYA 2FJEA 4NTCA 4WCTA 1GRFA 2AQJA 3T2KA 1DJQA 1YQ3A 3CGDA 3GSIA 2EQ9A 3CPHG 4ZCDA 4BV6A 1GXFA 1CJ2A 4A6NB 2GV8A 1AOGA 1NHSA 1CJ3A 2R0GA 3AE4A 1L9DA 2YLZA 4K2XA 4H4XA 4EQWA 1GT8A 1QLBA 3G5RA 2GF3A 1Z6LA 1GEUA 2BXSA 4O5QA 4UDPA 2R46A 3GWFA 4GR1A 4D04A 5KXJA 3QJ4A 4USRA 4G9KA 2X99A 3K7QX 3L1RA 2BABA 3AWIA 4YKGA 2YLRA 1GRGA 1PXAA 5J60A 1RP0A 4AOXA 3AE8A 1VRQB 2APGA 4H4RA 2AAQA 4K8DA 1E6EA 4C5OA 4YTPA 4IVOB 3UKLA 2JB2A 4Z24A 3NTAA 3SFDA 3V3NA 3AE6A 2C70A 3AYLA 3HYVA 4K5RA 5JCKA 1KSUA 2TMDA 1D4EA 1RYIA 2R0CA 4USQA 2WPEA 3VRDB 5KMPA 1P2HA 2I0ZA 3GRSA 3Q6JA 1YY5A 3KKJA 4YWOA 2Y6QA 2R4JA 3ITJA 3SQPA 2WOIA 4YXDA 4EM4A 2V61A 3LB8A 4B63A 4EMJA 4UP3A 4IVMB 2WEUA 4C3YA 2B76A 2WETA 3NN0X 4YSXA 2RGHA 2GQWA 2WESA 3DGHA 1W4XA 1BKWA 2Q0LA 3P9UA 1K0JA 2E4GA 2YLTA 3NLCA 4H2NA 4JY3A 4U8IA 1RSGA 3FPZA 5CQFA 3UKKA 1DJNA 3ISHA 1FEBA 3K7TA 3RP6A 4AT2A 2ZZ0A 3CNSA 4H4UA 1K4QA 3NYEA 3COXA 1ZDLA 2Z5XA 4ECHA 1F3PA 1H81A 1FL2A 1N4VA 1NDAA 3SYIA 3Q9TA 3NH3X 3UKFA 3AD7B 1TYPA 1PDHA 3LXDA 3H8LA 3NG7X 4YSHA 3SZFA 5KVIA 1GSNA 4YT0A 2ACZA 3AEEA 1REOA 5IQ4A 2O9ZA 4JDRA 1OJAA 3FIMB 5FS8A 2ZZCA 3NRNA 3F8RA 1GRTA 1SEZA 4RSLA 3REDA 2UZZA 4U8OA 1LQTA 1GPEA 3QVRA 3T2YA 2WOWA 4YKFA 3CNJA 3FMWA 4FX9A 4U8MA 1NPXA 2FJBA 4LIIA 1JOAA 1OJDA 3S61A 2A89A 2YLSA 4NWZA 2H88A 3CPIG 2OALA 2GMJA 3AEBA 3ALJA 1NEKA 1PBDA 3GDPA 3UTGA 1MXTA 4CY8A 1IJHA 3ICTA 2GR3A 3KD9A 4CNJA 4B66A 4EMIA 4EQSA 2WBAA 2XVHA 3SZ0A 4BURA 3BNMA 1XPQA 4OPDA 1NAAA 4EMWA 4HB9A 2XDOA 3CMMA 2QA1A 3NHOX 1COYA 1CF3A 4P9SA 2VRLA 1CJ4A 2Y6RA 3UKAA 3P4PA 5GSNA 5KWFA 1ZMDA 2VQ7A 2YAUA 1ZKQA 1H82A 2YG3A 1PN0A 1PJ5A 2X3NA 4G6GA 4H4QA 5KRQA 4RG4A 2X8CA 3GYXA 3UOXA 4U8NA 4B65A 1PXCA 3QFBA 1F8WA 2BCPA 4J2WA 3NGCX 2C67A 4CCQA 4XWRA 2YLWA 2BK5A 1EL8A 2C73A 1KSSA 3AEGA 3BNUA 5EBKA 2CVJA 3CGEA 4UDRA 5J7XA 2WP6A 5U1OA 2WU5A 1L9EA 2OA1A 1D7LA 4IA6A 2DKHA 2B9XA 5FMHA 1GERA 1OJ9A 4MJWA 3T2ZA 2JKCA 4BJZA 3NYCA 4YTMA 1BGNA 2OAMA 1TDEA 3UOVA 2RABA 3RP7A 5C2TA 4X9MA 5KOXA 3VRAA 1K0IA 3SM8A 1S2QA 1OJCA 1VG9A 2GAHB 2C76A 3UTHA 4A65A 4JN9A 1GNDA 3QSMA 4NTDA 1PS9A 1ELIA 3FG2P 2WPCA 4O5UA 1DOCA 3H8IA 1Q1WA 4TLXA 1P2EA 2GAGB 1TDFA 5DBJA 4EIQA 5JCMA 3DH9A 3DK4A 4GF7A 3R9UA 1KF6A 3ATRA 3IWAA 2JB1A 1EBDA 2R0PA 3DA1A 2YWLA 4G74A 2E1MA 1EL5A 3GRTA 1PXBA 4GRTA 3AE5A 4NTEA 3BHKA 1E1MA 2BS2A 2VVLG 2BRAA 3OZ2A 5JCIA 2TPRA 1KNPA 1CC4A 1DXLA 4U8KA 1MOKA 5U63A 5ER0A 3NTDA 1E1KA 1XANA 4A79A 3VR8A 1GRAA 3BHFA 4TLZA 1Q9IA 4YSZA 2XVJA 3NT6A 2WQYA 1NHPA 2YG5A 2WDQA 3EPTA 4AT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM4 A;  3WE0 A;  2XVF A;  3VR9 A;  3GDN A;  3KU9 A;  4H2Q A;  4B69 A;  5EB4 A;  2YR5 A;  4GUV A;  1N4U A;  4D03 A;  1H6V A;  3RHA A;  3CIR A;  1XDI A;  3GYI A;  1GV4 A;  5M0Z A;  2YVJ A;  3CPJ G;  4I58 A;  1Y0P A;  4DSH A;  2A87 A;  2V3B A;  3QSS A;  4REK A;  4IA5 A;  2YG7 A;  3PO7 A;  1GRB A;  2V60 A;  1YQ4 A;  2BAC A;  1CBO A;  2WS3 A;  4X9N A;  3AEA A;  1M64 A;  3AE1 A;  2EQ7 A;  5BUL A;  3PVC A;  4AP3 A;  1XHC A;  5TR3 A;  4U2L A;  5BRT A;  2XFN A;  2CUL A;  4H2P A;  4H4T A;  4XXG A;  2GRT A;  5IPY A;  2XCG A;  3L8K A;  3HZL A;  3G5Q A;  2YQU A;  5EOW A;  4NZH A;  3EAN A;  3KA7 A;  1TDK A;  3B3R A;  1CHU A;  2DKI A;  1VQW A;  3CTY A;  1QO8 A;  4CRT A;  1LPF A;  4EQR A;  3AB1 A;  1DOE A;  2B9Y A;  2BA9 A;  4GCM A;  1CJC A;  3UTE A;  2JK6 A;  2Q7V A;  1D4D A;  3VRB A;  2C75 A;  5JCN A;  4U8L A;  4BK3 A;  2GR1 A;  1S3B A;  2QCU A;  4GDP A;  3ZDN A;  2XFO A;  1ZK7 A;  3QSE A;  1H86 A;  4A5L A;  2IVD A;  2HQM A;  1GTH A;  3SGL A;  1V59 A;  1F8R A;  1QJD A;  2C65 A;  4B1B A;  1K0L A;  4H4Z A;  3GWD A;  2R4E A;  2XYO A;  2JBV A;  1PHH A;  2WP9 A;  1BF3 A;  2R9Z A;  1CC2 A;  4Z26 A;  4RG3 A;  2BYB A;  1LQU A;  3AD9 B;  2NVK X;  1Y56 A;  4U8P A;  2VQB A;  2BK3 A;  1FCD A;  3OC4 A;  3DJG X;  1B5Q A;  1X31 B;  3P4R A;  4J33 A;  4C3X A;  3AYJ A;  5KOW A;  4J36 A;  2GH5 A;  2IVE A;  4JY2 A;  3B6D A;  5LV9 A;  3UKQ A;  4CNK A;  2JAE A;  5FS6 A;  3CGB A;  2YLX A;  2BCG G;  2GR0 A;  3LOV A;  4OPL A;  4OPU A;  2H89 A;  5HXI A;  2V3A A;  1KNR A;  3RNM A;  4CCR A;  3V3O A;  2B7R A;  2C3C A;  3AE9 A;  4J31 A;  3GYJ A;  1O95 A;  4EIP A;  5JCL A;  1LJ1 A;  1D4C A;  3DK8 A;  1CL0 A;  3NN6 X;  3T37 A;  1LVL A;  3IC9 A;  3LJP A;  2YG4 A;  1FEA A;  4DGK A;  1ZP0 A;  2V5Z A;  2XFU A;  1E7P A;  3NK2 X;  3ADA B;  4Z44 A;  4APN A;  1LV0 A;  5BVA A;  2BS4 A;  2F5Z A;  2YR6 A;  1M6I A;  3O0H A;  4U8J A;  5CKU A;  4B67 A;  4AOS A;  2V6O A;  2XLS A;  4Z43 A;  2QAE A;  4H4Y A;  1DNC A;  3E1T A;  5M10 A;  2XLT A;  3AE2 A;  3G5S A;  5IQ1 A;  1BZL A;  2EQ6 A;  3M0O A;  4TM1 A;  1NEN A;  3M13 A;  1IUU A;  2OLO A;  2BC0 A;  1NG4 A;  2R45 A;  3NKS A;  3DJE A;  1E39 A;  2AR8 A;  3ICS A;  4FDC B;  4OPT A;  1NG3 A;  4WX1 A;  1FEC A;  4HA6 A;  4B64 A;  3IF9 A;  3CN8 A;  2PHH A;  4AP1 A;  3KPF A;  4UDQ A;  3ALM A;  5C3J A;  5HHF A;  4DSG A;  4BK1 A;  5HY5 A;  2YVF A;  4I59 A;  3P4S A;  4M52 A;  1JEH A;  2GQF A;  3DK9 A;  4U2S A;  2VZ2 A;  3AE3 A;  4H7U A;  1GRE A;  3AEC A;  3FBS A;  3BI2 A;  3D8X A;  1JRY A;  2BK4 A;  3V76 A;  4DNA A;  1JU2 A;  1GTE A;  3GD4 A;  3LZX A;  2VVM A;  3URH A;  3UOY A;  1YQZ A;  2B9W A;  4ZCC A;  4CY6 A;  2EQ8 A;  4LU6 A;  3F8D A;  2X50 A;  2WP5 A;  5FS7 A;  5FS9 A;  4Z25 A;  2Q0K A;  3BI5 A;  4ICY A;  2VOU A;  1F6M A;  3CND A;  4A7A A;  4H2R A;  4J34 A;  1PJ7 A;  1E1N A;  4FK1 A;  4OVI A;  4U2T A;  4E0V A;  4J56 A;  4Y4N A;  4C77 A;  1H83 A;  4YTN A;  4K22 A;  2XLU A;  3I3L A;  2XVE A;  2W0H A;  1Y56 B;  2Q6U A;  1TYT A;  2YVG A;  3NYF A;  1DOD A;  2YM2 A;  4PAB A;  3ALL A;  1L9C A;  5BUK A;  2C7G A;  3AD8 B;  1ZOY A;  2YM1 A;  4EQX A;  1B4V A;  4ZN0 A;  1TRB A;  2XFQ A;  1PBB A;  3UCL A;  3UKH A;  1S2Y A;  4Z2U A;  4BK2 A;  3AEF A;  1NHQ A;  1L0V A;  3UTF A;  2OLN A;  1JRX A;  2GMH A;  1IUV A;  2Z5Y A;  3NK1 X;  3AE7 A;  1PJ6 A;  2C66 A;  5U25 A;  4ADW A;  1F8S A;  1GET A;  3NK0 X;  2PYX A;  3C4A A;  3C96 A;  4Y4M A;  2NPX A;  3NNE A;  2FJA A;  2JB3 A;  4PAA A;  4TM0 A;  4A6N A;  1MO9 A;  1GES A;  2XVI A;  4CBQ A;  1KDG A;  2GEW A;  4K5S A;  2C64 A;  1H7W A;  3K30 A;  1PBF A;  4NEW A;  4NEV A;  4A99 A;  3AYI A;  1N1P A;  2GR2 A;  4GDE A;  3EAO A;  4TM3 A;  3UKP A;  1CC6 A;  4OPG A;  4BJY A;  3DJJ A;  2XLR A;  3AED A;  3SFE A;  2X8H A;  4OCG A;  1EL9 A;  1GRH A;  2FJD A;  4C74 A;  1TDO A;  2ZBW A;  1S3E A;  4J57 A;  3QFA A;  2WDR A;  2ZZB A;  2WOV A;  4H4S A;  3CNT A;  3P1W A;  1B8S A;  4FK1 C;  3IHG A;  2XLP A;  2A8X A;  4KX6 A;  4Z2T A;  2WDV A;  5GRT A;  1ZX9 A;  1ONF A;  1IUX A;  2BXR A;  3DJD A;  3H4K A;  4H50 A;  4JNA A;  3ATQ A;  4H4P A;  1VDC A;  1OJT A;  1H84 A;  1O94 A;  2X8G A;  3P4Q A;  3UOZ A;  3JSK A;  3LAD A;  2WPF A;  2C72 A;  4X4J A;  3S5W A;  1IUW A;  4B68 A;  5HYM A;  3M12 A;  1Q1R A;  3II4 A;  3ICR A;  1FOH A;  5EB5 A;  1ZOV A;  2YG6 A;  2YR4 A;  2E5V A;  3CNP A;  3KLJ A;  4LA1 A;  3CGC A;  1BWC A;  2B7S A;  3D1C A;  1JRZ A;  3VQR A;  1B37 A;  1IUT A;  1N4W A;  1KFY A;  3C4N A;  5L46 A;  3GD3 A;  1PBC A;  1GAL A;  1TDN A;  3NIX A;  3IHM A;  3F8P A;  4KPR A;  2J3N A;  3LZW A;  4XWZ A;  2GB0 A;  1LTX R;  1ZMC A;  2QA2 A;  1HYU A;  4H4V A;  4N9X A;  4A9W A;  1IUS A;  2IID A;  3ZYX A;  2RGO A;  1D7Y A;  1VG0 A;  3K7M X;  4JQ9 A;  2GVC A;  2WHD A;  2ARD A;  1YKJ A;  3I6D A;  1JNR A;  3GMC A;  2BC1 A;  4YSY A;  2RGJ A;  5KVH A;  2XFP A;  2WU2 A;  1DOB A;  1O5W A;  3UP5 A;  3DGZ A;  1E1L A;  1NHR A;  1EL7 A;  1H7X A;  3ABV A;  1D5T A;  3BI4 A;  4Y4L A;  1BGJ A;  2VRM A;  3QVP A;  3UP4 A;  4JNQ A;  4K7Z A;  2C3D A;  4H4W A;  1ZY8 A;  2VVL A;  1GOS A;  4Z2R A;  2BS3 A;  2CDU A;  1PBE A;  3EF6 A;  3KVE A;  4EM3 A;  1UKV G;  3PS9 A;  3RP8 A;  3GMB A;  3DME A;  3AXB A;  1JNZ A;  4IV9 A;  4OPI A;  2FBW A;  4OPC A;  2CFY A;  2FJE A;  4NTC A;  4WCT A;  1GRF A;  2AQJ A;  1DJQ A;  1YQ3 A;  3CGD A;  3GSI A;  2EQ9 A;  3CPH G;  4ZCD A;  4BV6 A;  1GXF A;  1CJ2 A;  4A6N B;  2GV8 A;  1AOG A;  1NHS A;  1CJ3 A;  2R0G A;  3AE4 A;  1L9D A;  2YLZ A;  4K2X A;  4H4X A;  4EQW A;  1GT8 A;  1QLB A;  3G5R A;  2GF3 A;  1Z6L A;  1GEU A;  2BXS A;  4O5Q A;  4UDP A;  2R46 A;  3GWF A;  4GR1 A;  4D04 A;  5KXJ A;  3QJ4 A;  4USR A;  2X99 A;  3K7Q X;  3L1R A;  2BAB A;  3AWI A;  4YKG A;  2YLR A;  1GRG A;  1PXA A;  5J60 A;  1RP0 A;  4AOX A;  3AE8 A;  1VRQ B;  2APG A;  4H4R A;  2AAQ A;  4K8D A;  1E6E A;  4C5O A;  4YTP A;  4IVO B;  3UKL A;  2JB2 A;  4Z24 A;  3NTA A;  3SFD A;  3V3N A;  3AE6 A;  2C70 A;  3AYL A;  4K5R A;  5JCK A;  1KSU A;  2TMD A;  1D4E A;  1RYI A;  2R0C A;  4USQ A;  2WPE A;  3VRD B;  1P2H A;  2I0Z A;  3GRS A;  3Q6J A;  1YY5 A;  3KKJ A;  4YWO A;  2Y6Q A;  2R4J A;  3ITJ A;  3SQP A;  2WOI A;  4YXD A;  4EM4 A;  2V61 A;  3LB8 A;  4B63 A;  4EMJ A;  4UP3 A;  4IVM B;  2WEU A;  4C3Y A;  2B76 A;  2WET A;  3NN0 X;  4YSX A;  2RGH A;  2GQW A;  2WES A;  3DGH A;  1W4X A;  1BKW A;  2Q0L A;  3P9U A;  1K0J A;  2E4G A;  2YLT A;  3NLC A;  4H2N A;  4JY3 A;  4U8I A;  1RSG A;  3FPZ A;  5CQF A;  3UKK A;  1DJN A;  3ISH A;  1FEB A;  3K7T A;  3RP6 A;  4AT2 A;  2ZZ0 A;  3CNS A;  4H4U A;  1K4Q A;  3NYE A;  3COX A;  1ZDL A;  2Z5X A;  4ECH A;  1F3P A;  1H81 A;  1FL2 A;  1N4V A;  1NDA A;  3Q9T A;  3NH3 X;  3UKF A;  3AD7 B;  1TYP A;  1PDH A;  3LXD A;  3H8L A;  3NG7 X;  4YSH A;  5KVI A;  1GSN A;  4YT0 A;  2ACZ A;  3AEE A;  1REO A;  5IQ4 A;  2O9Z A;  4JDR A;  1OJA A;  3FIM B;  5FS8 A;  2ZZC A;  3NRN A;  3F8R A;  1GRT A;  1SEZ A;  4RSL A;  3RED A;  2UZZ A;  4U8O A;  1LQT A;  1GPE A;  3QVR A;  2WOW A;  4YKF A;  3CNJ A;  3FMW A;  4FX9 A;  4U8M A;  1NPX A;  2FJB A;  4LII A;  1JOA A;  1OJD A;  3S61 A;  2A89 A;  2YLS A;  2H88 A;  3CPI G;  2OAL A;  2GMJ A;  3AEB A;  3ALJ A;  1NEK A;  1PBD A;  3GDP A;  3UTG A;  1MXT A;  4CY8 A;  1IJH A;  3ICT A;  2GR3 A;  3KD9 A;  4CNJ A;  4B66 A;  4EMI A;  4EQS A;  2WBA A;  2XVH A;  4BUR A;  3BNM A;  1XPQ A;  4OPD A;  1NAA A;  4EMW A;  4HB9 A;  2XDO A;  2QA1 A;  3NHO X;  1COY A;  1CF3 A;  4P9S A;  2VRL A;  1CJ4 A;  2Y6R A;  3UKA A;  3P4P A;  5GSN A;  5KWF A;  1ZMD A;  2VQ7 A;  2YAU A;  1ZKQ A;  1H82 A;  2YG3 A;  1PN0 A;  1PJ5 A;  2X3N A;  4H4Q A;  5KRQ A;  4RG4 A;  2X8C A;  3UOX A;  4U8N A;  4B65 A;  1PXC A;  3QFB A;  1F8W A;  2BCP A;  4J2W A;  3NGC X;  2C67 A;  4CCQ A;  4XWR A;  2YLW A;  2BK5 A;  1EL8 A;  2C73 A;  1KSS A;  3AEG A;  3BNU A;  5EBK A;  2CVJ A;  3CGE A;  4UDR A;  5J7X A;  2WP6 A;  5U1O A;  2WU5 A;  1L9E A;  2OA1 A;  1D7L A;  4IA6 A;  2DKH A;  2B9X A;  5FMH A;  1GER A;  1OJ9 A;  4MJW A;  2JKC A;  4BJZ A;  3NYC A;  4YTM A;  1BGN A;  2OAM A;  1TDE A;  3UOV A;  2RAB A;  3RP7 A;  5C2T A;  4X9M A;  5KOX A;  3VRA A;  1K0I A;  3SM8 A;  1S2Q A;  1OJC A;  1VG9 A;  2GAH B;  2C76 A;  3UTH A;  4A65 A;  4JN9 A;  1GND A;  3QSM A;  4NTD A;  1PS9 A;  1ELI A;  3FG2 P;  2WPC A;  4O5U A;  1DOC A;  3H8I A;  1Q1W A;  4TLX A;  1P2E A;  2GAG B;  1TDF A;  5DBJ A;  4EIQ A;  5JCM A;  3DH9 A;  3DK4 A;  4GF7 A;  3R9U A;  1KF6 A;  3ATR A;  3IWA A;  2JB1 A;  1EBD A;  2R0P A;  3DA1 A;  2YWL A;  2E1M A;  1EL5 A;  3GRT A;  1PXB A;  4GRT A;  3AE5 A;  4NTE A;  3BHK A;  1E1M A;  2BS2 A;  2VVL G;  3OZ2 A;  5JCI A;  2TPR A;  1KNP A;  1CC4 A;  1DXL A;  4U8K A;  1MOK A;  5U63 A;  5ER0 A;  3NTD A;  1E1K A;  1XAN A;  4A79 A;  3VR8 A;  1GRA A;  3BHF A;  4TLZ A;  1Q9I A;  4YSZ A;  2XVJ A;  3NT6 A;  2WQY A;  1NHP A;  2YG5 A;  2WDQ A;  3EPT A;  4AT0 A; 
#chains in the Genus database with same CATH topology
 4TM4 A;  3WE0 A;  2XVF A;  3T31 A;  3GDN A;  3KU9 A;  4H2Q A;  3VR9 A;  5EB4 A;  4B69 A;  2YR5 A;  4GUV A;  1N4U A;  4D03 A;  1H6V A;  3RHA A;  3CIR A;  1XDI A;  3GYI A;  4II3 A;  5KMR A;  1GV4 A;  5M0Z A;  2YVJ A;  3CPJ G;  4I58 A;  1Y0P A;  4DSH A;  2A87 A;  2V3B A;  3QSS A;  4REK A;  4IA5 A;  2YG7 A;  3PO7 A;  1GRB A;  2V60 A;  1YQ4 A;  2BAC A;  1CBO A;  2WS3 A;  4X9N A;  3AEA A;  1M64 A;  3AE1 A;  2EQ7 A;  5BUL A;  3PVC A;  4AP3 A;  1XHC A;  5TR3 A;  4U2L A;  5BRT A;  2BRY A;  2XFN A;  2CUL A;  4H2P A;  4H4T A;  4XXG A;  2GRT A;  5IPY A;  2XCG A;  3L8K A;  3HZL A;  3G5Q A;  2YQU A;  5EOW A;  4NZH A;  3EAN A;  3KA7 A;  1TDK A;  3B3R A;  1CHU A;  2DKI A;  1VQW A;  3CTY A;  1QO8 A;  4CRT A;  1LPF A;  4EQR A;  3AB1 A;  1DOE A;  2B9Y A;  2BA9 A;  4GCM A;  1CJC A;  3UTE A;  2JK6 A;  2Q7V A;  1D4D A;  3VRB A;  2C75 A;  5JCN A;  4U8L A;  4BK3 A;  2GR1 A;  1S3B A;  2QCU A;  4GDP A;  3ZDN A;  2XFO A;  1ZK7 A;  3QSE A;  1H86 A;  4A5L A;  2IVD A;  2HQM A;  1GTH A;  3SGL A;  1V59 A;  1F8R A;  1QJD A;  2C65 A;  5KMS A;  4B1B A;  1K0L A;  4H4Z A;  3GWD A;  2R4E A;  2XYO A;  2JBV A;  1PHH A;  2WP9 A;  1BF3 A;  2R9Z A;  1CC2 A;  4Z26 A;  4RG3 A;  2BYB A;  1LQU A;  3AD9 B;  5KNL A;  2NVK X;  1Y56 A;  4U8P A;  2VQB A;  2BK3 A;  1FCD A;  3OC4 A;  3DJG X;  1B5Q A;  1X31 B;  3P4R A;  4J33 A;  4C3X A;  3AYJ A;  4NNJ A;  5KOW A;  4J36 A;  2GH5 A;  2IVE A;  4JY2 A;  3B6D A;  5LV9 A;  3UKQ A;  4CNK A;  2JAE A;  5FS6 A;  3CGB A;  2YLX A;  2BCG G;  2GR0 A;  3LOV A;  4OPL A;  4OPU A;  2H89 A;  5HXI A;  2V3A A;  1KNR A;  3RNM A;  4CCR A;  3V3O A;  2B7R A;  2C3C A;  3AE9 A;  4J31 A;  3GYJ A;  1O95 A;  4EIP A;  5JCL A;  1LJ1 A;  1D4C A;  3DK8 A;  1CL0 A;  3NN6 X;  3T37 A;  1LVL A;  3IC9 A;  3LJP A;  2YG4 A;  1FEA A;  4DGK A;  1ZP0 A;  2V5Z A;  2XFU A;  1E7P A;  3HYX A;  3NK2 X;  3ADA B;  4Z44 A;  4APN A;  1LV0 A;  5BVA A;  2BS4 A;  2F5Z A;  2YR6 A;  3T0K A;  1M6I A;  3O0H A;  4GAV A;  4U8J A;  5CKU A;  4B67 A;  3KPK A;  4AOS A;  2V6O A;  2XLS A;  3SXI A;  4Z43 A;  2QAE A;  4H4Y A;  1DNC A;  3E1T A;  5M10 A;  2XLT A;  3AE2 A;  3G5S A;  5IQ1 A;  1BZL A;  2EQ6 A;  3M0O A;  4TM1 A;  1NEN A;  3M13 A;  1IUU A;  2OLO A;  2BC0 A;  1NG4 A;  3SZC A;  2R45 A;  3NKS A;  3DJE A;  1E39 A;  2AR8 A;  3ICS A;  4FDC B;  4OPT A;  1NG3 A;  4WX1 A;  1FEC A;  4HA6 A;  4B64 A;  3IF9 A;  3CN8 A;  2PHH A;  4AP1 A;  3KPF A;  4UDQ A;  3ALM A;  5C3J A;  5HHF A;  4DSG A;  4BK1 A;  5HY5 A;  2YVF A;  4I59 A;  3P4S A;  4M52 A;  1JEH A;  2GQF A;  3DK9 A;  4U2S A;  2VZ2 A;  3AE3 A;  4H7U A;  1GRE A;  3AEC A;  3FBS A;  3BI2 A;  3D8X A;  1JRY A;  2BK4 A;  3V76 A;  4DNA A;  4GAP A;  1JU2 A;  1GTE A;  3GD4 A;  3LZX A;  2VVM A;  3URH A;  3UOY A;  1YQZ A;  2B9W A;  4ZCC A;  4CY6 A;  2EQ8 A;  4LU6 A;  3F8D A;  2X50 A;  2WP5 A;  5FS7 A;  5FS9 A;  4Z25 A;  2Q0K A;  3BI5 A;  4ICY A;  2C4C A;  1F6M A;  2VOU A;  3CND A;  4H2R A;  4J34 A;  1PJ7 A;  1E1N A;  4FK1 A;  4OVI A;  4U2T A;  4E0V A;  4J56 A;  4Y4N A;  4C77 A;  1H83 A;  4YTN A;  4K22 A;  2XLU A;  3I3L A;  2XVE A;  2W0H A;  1Y56 B;  2Q6U A;  1TYT A;  2YVG A;  3NYF A;  1DOD A;  2YM2 A;  4PAB A;  3ALL A;  1L9C A;  5BUK A;  2C7G A;  3AD8 B;  1ZOY A;  2YM1 A;  4EQX A;  1B4V A;  4ZN0 A;  1TRB A;  2XFQ A;  1PBB A;  3UCL A;  3UKH A;  1S2Y A;  4Z2U A;  4BK2 A;  3T14 A;  3AEF A;  1NHQ A;  1L0V A;  3UTF A;  2OLN A;  1JRX A;  2GMH A;  1IUV A;  2Z5Y A;  3NK1 X;  4G6H A;  3AE7 A;  1PJ6 A;  2C66 A;  5U25 A;  4ADW A;  1F8S A;  1GET A;  3NK0 X;  2PYX A;  3C4A A;  3C96 A;  4Y4M A;  2NPX A;  3NNE A;  2FJA A;  2JB3 A;  4PAA A;  4TM0 A;  4A6N A;  1MO9 A;  1GES A;  2XVI A;  4CBQ A;  1KDG A;  2GEW A;  4K5S A;  2C64 A;  1H7W A;  3K30 A;  1PBF A;  4NEW A;  4NEV A;  4A99 A;  3AYI A;  1N1P A;  2GR2 A;  4GDE A;  3EAO A;  4TM3 A;  3UKP A;  1CC6 A;  4OPG A;  4BJY A;  3DJJ A;  2XLR A;  3AED A;  3SFE A;  2X8H A;  4OCG A;  1EL9 A;  1GRH A;  2FJD A;  4C74 A;  1TDO A;  2ZBW A;  1S3E A;  4J57 A;  3QFA A;  2WDR A;  2ZZB A;  2WOV A;  4H4S A;  3CNT A;  3P1W A;  1B8S A;  4FK1 C;  3IHG A;  2XLP A;  2A8X A;  4KX6 A;  4Z2T A;  2WDV A;  5GRT A;  1ZX9 A;  1ONF A;  1IUX A;  2BXR A;  3DJD A;  3H4K A;  4H50 A;  4JNA A;  3ATQ A;  4H4P A;  1VDC A;  1OJT A;  1H84 A;  1O94 A;  2X8G A;  3P4Q A;  3UOZ A;  3JSK A;  3LAD A;  2WPF A;  2C72 A;  4X4J A;  3S5W A;  1IUW A;  4B68 A;  5HYM A;  3M12 A;  1Q1R A;  3II4 A;  3ICR A;  1FOH A;  5EB5 A;  1ZOV A;  2YG6 A;  2YR4 A;  2E5V A;  3CNP A;  3KLJ A;  4LA1 A;  3CGC A;  3SZW A;  1BWC A;  2B7S A;  3D1C A;  1JRZ A;  3VQR A;  1B37 A;  1IUT A;  1N4W A;  1KFY A;  3C4N A;  5L46 A;  3GD3 A;  1PBC A;  1GAL A;  1TDN A;  3HYW A;  3NIX A;  3IHM A;  3F8P A;  5KMQ A;  4KPR A;  2J3N A;  3LZW A;  4XWZ A;  3SX6 A;  2GB0 A;  1LTX R;  1ZMC A;  2QA2 A;  1HYU A;  4H4V A;  4N9X A;  4A9W A;  1IUS A;  2IID A;  3ZYX A;  2RGO A;  1D7Y A;  1VG0 A;  3K7M X;  4JQ9 A;  2GVC A;  2WHD A;  2ARD A;  1YKJ A;  3I6D A;  1JNR A;  3GMC A;  2BC1 A;  4YSY A;  2RGJ A;  5KVH A;  2XFP A;  2WU2 A;  1DOB A;  1O5W A;  3UP5 A;  3DGZ A;  1E1L A;  1NHR A;  1EL7 A;  1H7X A;  3ABV A;  1D5T A;  3BI4 A;  4Y4L A;  1BGJ A;  2VRM A;  3QVP A;  3UP4 A;  4JNQ A;  4K7Z A;  4II2 A;  2C3D A;  4H4W A;  1ZY8 A;  2VVL A;  1GOS A;  4Z2R A;  2BS3 A;  2CDU A;  1PBE A;  4A7A A;  3SY4 A;  3EF6 A;  3KVE A;  4EM3 A;  1UKV G;  3PS9 A;  3RP8 A;  4G73 A;  3GMB A;  3DME A;  3AXB A;  1JNZ A;  4IV9 A;  4OPI A;  2FBW A;  4OPC A;  2CFY A;  2FJE A;  4NTC A;  4WCT A;  1GRF A;  2AQJ A;  3T2K A;  1DJQ A;  1YQ3 A;  3CGD A;  3GSI A;  2EQ9 A;  3CPH G;  4ZCD A;  4BV6 A;  1GXF A;  1CJ2 A;  4A6N B;  2GV8 A;  1AOG A;  1NHS A;  1CJ3 A;  2R0G A;  3AE4 A;  1L9D A;  2YLZ A;  4K2X A;  4H4X A;  4EQW A;  1GT8 A;  1QLB A;  3G5R A;  2GF3 A;  1Z6L A;  1GEU A;  2BXS A;  4O5Q A;  4UDP A;  2R46 A;  3GWF A;  4GR1 A;  4D04 A;  5KXJ A;  3QJ4 A;  4USR A;  4G9K A;  2X99 A;  3K7Q X;  3L1R A;  2BAB A;  3AWI A;  4YKG A;  2YLR A;  1GRG A;  1PXA A;  5J60 A;  1RP0 A;  4AOX A;  3AE8 A;  1VRQ B;  2APG A;  4H4R A;  2AAQ A;  4K8D A;  1E6E A;  4C5O A;  4YTP A;  4IVO B;  3UKL A;  2JB2 A;  4Z24 A;  3NTA A;  3SFD A;  3V3N A;  3AE6 A;  2C70 A;  3AYL A;  3HYV A;  4K5R A;  5JCK A;  1KSU A;  2TMD A;  1D4E A;  1RYI A;  2R0C A;  4USQ A;  2WPE A;  3VRD B;  5KMP A;  1P2H A;  2I0Z A;  3GRS A;  3Q6J A;  1YY5 A;  3KKJ A;  4YWO A;  2Y6Q A;  2R4J A;  3ITJ A;  3SQP A;  2WOI A;  4YXD A;  4EM4 A;  2V61 A;  3LB8 A;  4B63 A;  4EMJ A;  4UP3 A;  4IVM B;  2WEU A;  4C3Y A;  2B76 A;  2WET A;  3NN0 X;  4YSX A;  2RGH A;  2GQW A;  2WES A;  3DGH A;  1W4X A;  1BKW A;  2Q0L A;  3P9U A;  1K0J A;  2E4G A;  2YLT A;  3NLC A;  4H2N A;  4JY3 A;  4U8I A;  1RSG A;  3FPZ A;  5CQF A;  3UKK A;  1DJN A;  3ISH A;  1FEB A;  3K7T A;  3RP6 A;  4AT2 A;  2ZZ0 A;  3CNS A;  4H4U A;  1K4Q A;  3NYE A;  3COX A;  1ZDL A;  2Z5X A;  4ECH A;  1F3P A;  1H81 A;  1FL2 A;  1N4V A;  1NDA A;  3SYI A;  3Q9T A;  3NH3 X;  3UKF A;  3AD7 B;  1TYP A;  1PDH A;  3LXD A;  3H8L A;  3NG7 X;  4YSH A;  3SZF A;  5KVI A;  1GSN A;  4YT0 A;  2ACZ A;  3AEE A;  1REO A;  5IQ4 A;  2O9Z A;  4JDR A;  1OJA A;  3FIM B;  5FS8 A;  2ZZC A;  3NRN A;  3F8R A;  1GRT A;  1SEZ A;  4RSL A;  3RED A;  2UZZ A;  4U8O A;  1LQT A;  1GPE A;  3QVR A;  3T2Y A;  2WOW A;  4YKF A;  3CNJ A;  3FMW A;  4FX9 A;  4U8M A;  1NPX A;  2FJB A;  4LII A;  1JOA A;  1OJD A;  3S61 A;  2A89 A;  2YLS A;  4NWZ A;  2H88 A;  3CPI G;  2OAL A;  2GMJ A;  3AEB A;  3ALJ A;  1NEK A;  1PBD A;  3GDP A;  3UTG A;  1MXT A;  4CY8 A;  1IJH A;  3ICT A;  2GR3 A;  3KD9 A;  4CNJ A;  4B66 A;  4EMI A;  4EQS A;  2WBA A;  2XVH A;  3SZ0 A;  4BUR A;  3BNM A;  1XPQ A;  4OPD A;  1NAA A;  4EMW A;  4HB9 A;  2XDO A;  3CMM A;  2QA1 A;  3NHO X;  1COY A;  1CF3 A;  4P9S A;  2VRL A;  1CJ4 A;  2Y6R A;  3UKA A;  3P4P A;  5GSN A;  5KWF A;  1ZMD A;  2VQ7 A;  2YAU A;  1ZKQ A;  1H82 A;  2YG3 A;  1PN0 A;  1PJ5 A;  2X3N A;  4G6G A;  4H4Q A;  5KRQ A;  4RG4 A;  2X8C A;  3GYX A;  3UOX A;  4U8N A;  4B65 A;  1PXC A;  3QFB A;  1F8W A;  2BCP A;  4J2W A;  3NGC X;  2C67 A;  4CCQ A;  4XWR A;  2YLW A;  2BK5 A;  1EL8 A;  2C73 A;  1KSS A;  3AEG A;  3BNU A;  5EBK A;  2CVJ A;  3CGE A;  4UDR A;  5J7X A;  2WP6 A;  5U1O A;  2WU5 A;  1L9E A;  2OA1 A;  1D7L A;  4IA6 A;  2DKH A;  2B9X A;  5FMH A;  1GER A;  1OJ9 A;  4MJW A;  3T2Z A;  2JKC A;  4BJZ A;  3NYC A;  4YTM A;  1BGN A;  2OAM A;  1TDE A;  3UOV A;  2RAB A;  3RP7 A;  5C2T A;  4X9M A;  5KOX A;  3VRA A;  1K0I A;  3SM8 A;  1S2Q A;  1OJC A;  1VG9 A;  2GAH B;  2C76 A;  3UTH A;  4A65 A;  4JN9 A;  1GND A;  3QSM A;  4NTD A;  1PS9 A;  1ELI A;  3FG2 P;  2WPC A;  4O5U A;  1DOC A;  3H8I A;  1Q1W A;  4TLX A;  1P2E A;  2GAG B;  1TDF A;  5DBJ A;  4EIQ A;  5JCM A;  3DH9 A;  3DK4 A;  4GF7 A;  3R9U A;  1KF6 A;  3ATR A;  3IWA A;  2JB1 A;  1EBD A;  2R0P A;  3DA1 A;  2YWL A;  4G74 A;  2E1M A;  1EL5 A;  3GRT A;  1PXB A;  4GRT A;  3AE5 A;  4NTE A;  3BHK A;  1E1M A;  2BS2 A;  2VVL G;  2BRA A;  3OZ2 A;  5JCI A;  2TPR A;  1KNP A;  1CC4 A;  1DXL A;  4U8K A;  1MOK A;  5U63 A;  5ER0 A;  3NTD A;  1E1K A;  1XAN A;  4A79 A;  3VR8 A;  1GRA A;  3BHF A;  4TLZ A;  1Q9I A;  4YSZ A;  2XVJ A;  3NT6 A;  2WQY A;  1NHP A;  2YG5 A;  2WDQ A;  3EPT A;  4AT0 A; 
#chains in the Genus database with same CATH homology
 4TM4 A;  3WE0 A;  2XVF A;  3T31 A;  3GDN A;  3KU9 A;  4H2Q A;  3VR9 A;  5EB4 A;  4B69 A;  2YR5 A;  4GUV A;  1N4U A;  4D03 A;  1H6V A;  3RHA A;  3CIR A;  1XDI A;  3GYI A;  4II3 A;  5KMR A;  1GV4 A;  5M0Z A;  2YVJ A;  3CPJ G;  4I58 A;  1Y0P A;  4DSH A;  2A87 A;  2V3B A;  3QSS A;  4REK A;  4IA5 A;  2YG7 A;  3PO7 A;  1GRB A;  2V60 A;  1YQ4 A;  2BAC A;  1CBO A;  2WS3 A;  4X9N A;  3AEA A;  1M64 A;  3AE1 A;  2EQ7 A;  5BUL A;  3PVC A;  4AP3 A;  1XHC A;  5TR3 A;  4U2L A;  5BRT A;  2BRY A;  2XFN A;  2CUL A;  4H2P A;  4H4T A;  4XXG A;  2GRT A;  5IPY A;  2XCG A;  3L8K A;  3HZL A;  3G5Q A;  2YQU A;  5EOW A;  4NZH A;  3EAN A;  3KA7 A;  1TDK A;  3B3R A;  1CHU A;  2DKI A;  1VQW A;  3CTY A;  1QO8 A;  4CRT A;  1LPF A;  4EQR A;  3AB1 A;  1DOE A;  2B9Y A;  2BA9 A;  4GCM A;  1CJC A;  3UTE A;  2JK6 A;  2Q7V A;  1D4D A;  3VRB A;  2C75 A;  5JCN A;  4U8L A;  4BK3 A;  2GR1 A;  1S3B A;  2QCU A;  4GDP A;  3ZDN A;  2XFO A;  1ZK7 A;  3QSE A;  1H86 A;  4A5L A;  2IVD A;  2HQM A;  1GTH A;  3SGL A;  1V59 A;  1F8R A;  1QJD A;  2C65 A;  5KMS A;  4B1B A;  1K0L A;  4H4Z A;  3GWD A;  2R4E A;  2XYO A;  2JBV A;  1PHH A;  2WP9 A;  1BF3 A;  2R9Z A;  1CC2 A;  4Z26 A;  4RG3 A;  2BYB A;  1LQU A;  3AD9 B;  5KNL A;  2NVK X;  1Y56 A;  4U8P A;  2VQB A;  2BK3 A;  1FCD A;  3OC4 A;  3DJG X;  1B5Q A;  1X31 B;  3P4R A;  4J33 A;  4C3X A;  3AYJ A;  4NNJ A;  5KOW A;  4J36 A;  2GH5 A;  2IVE A;  4JY2 A;  3B6D A;  5LV9 A;  3UKQ A;  4CNK A;  2JAE A;  5FS6 A;  3CGB A;  2YLX A;  2BCG G;  2GR0 A;  3LOV A;  4OPL A;  4OPU A;  2H89 A;  5HXI A;  2V3A A;  1KNR A;  3RNM A;  4CCR A;  3V3O A;  2B7R A;  2C3C A;  3AE9 A;  4J31 A;  3GYJ A;  1O95 A;  4EIP A;  5JCL A;  1LJ1 A;  1D4C A;  3DK8 A;  1CL0 A;  3NN6 X;  3T37 A;  1LVL A;  3IC9 A;  3LJP A;  2YG4 A;  1FEA A;  4DGK A;  1ZP0 A;  2V5Z A;  2XFU A;  1E7P A;  3HYX A;  3NK2 X;  3ADA B;  4Z44 A;  4APN A;  1LV0 A;  5BVA A;  2BS4 A;  2F5Z A;  2YR6 A;  3T0K A;  1M6I A;  3O0H A;  4GAV A;  4U8J A;  5CKU A;  4B67 A;  3KPK A;  4AOS A;  2V6O A;  2XLS A;  3SXI A;  4Z43 A;  2QAE A;  4H4Y A;  1DNC A;  3E1T A;  5M10 A;  2XLT A;  3AE2 A;  3G5S A;  5IQ1 A;  1BZL A;  2EQ6 A;  3M0O A;  4TM1 A;  1NEN A;  3M13 A;  1IUU A;  2OLO A;  2BC0 A;  1NG4 A;  3SZC A;  2R45 A;  3NKS A;  3DJE A;  1E39 A;  2AR8 A;  3ICS A;  4FDC B;  4OPT A;  1NG3 A;  4WX1 A;  1FEC A;  4HA6 A;  4B64 A;  3IF9 A;  3CN8 A;  2PHH A;  4AP1 A;  3KPF A;  4UDQ A;  3ALM A;  5C3J A;  5HHF A;  4DSG A;  4BK1 A;  5HY5 A;  2YVF A;  4I59 A;  3P4S A;  4M52 A;  1JEH A;  2GQF A;  3DK9 A;  4U2S A;  2VZ2 A;  3AE3 A;  4H7U A;  1GRE A;  3AEC A;  3FBS A;  3BI2 A;  3D8X A;  1JRY A;  2BK4 A;  3V76 A;  4DNA A;  4GAP A;  1JU2 A;  1GTE A;  3GD4 A;  3LZX A;  2VVM A;  3URH A;  3UOY A;  1YQZ A;  2B9W A;  4ZCC A;  4CY6 A;  2EQ8 A;  4LU6 A;  3F8D A;  2X50 A;  2WP5 A;  5FS7 A;  5FS9 A;  4Z25 A;  2Q0K A;  3BI5 A;  4ICY A;  2C4C A;  1F6M A;  2VOU A;  3CND A;  4H2R A;  4J34 A;  1PJ7 A;  1E1N A;  4FK1 A;  4OVI A;  4U2T A;  4E0V A;  4J56 A;  4Y4N A;  4C77 A;  1H83 A;  4YTN A;  4K22 A;  2XLU A;  3I3L A;  2XVE A;  2W0H A;  1Y56 B;  2Q6U A;  1TYT A;  2YVG A;  3NYF A;  1DOD A;  2YM2 A;  4PAB A;  3ALL A;  1L9C A;  5BUK A;  2C7G A;  3AD8 B;  1ZOY A;  2YM1 A;  4EQX A;  1B4V A;  4ZN0 A;  1TRB A;  2XFQ A;  1PBB A;  3UCL A;  3UKH A;  1S2Y A;  4Z2U A;  4BK2 A;  3T14 A;  3AEF A;  1NHQ A;  1L0V A;  3UTF A;  2OLN A;  1JRX A;  2GMH A;  1IUV A;  2Z5Y A;  3NK1 X;  4G6H A;  3AE7 A;  1PJ6 A;  2C66 A;  5U25 A;  4ADW A;  1F8S A;  1GET A;  3NK0 X;  2PYX A;  3C4A A;  3C96 A;  4Y4M A;  2NPX A;  3NNE A;  2FJA A;  2JB3 A;  4PAA A;  4TM0 A;  4A6N A;  1MO9 A;  1GES A;  2XVI A;  4CBQ A;  1KDG A;  2GEW A;  4K5S A;  2C64 A;  1H7W A;  3K30 A;  1PBF A;  4NEW A;  4NEV A;  4A99 A;  3AYI A;  1N1P A;  2GR2 A;  4GDE A;  3EAO A;  4TM3 A;  3UKP A;  1CC6 A;  4OPG A;  4BJY A;  3DJJ A;  2XLR A;  3AED A;  3SFE A;  2X8H A;  4OCG A;  1EL9 A;  1GRH A;  2FJD A;  4C74 A;  1TDO A;  2ZBW A;  1S3E A;  4J57 A;  3QFA A;  2WDR A;  2ZZB A;  2WOV A;  4H4S A;  3CNT A;  3P1W A;  1B8S A;  4FK1 C;  3IHG A;  2XLP A;  2A8X A;  4KX6 A;  4Z2T A;  2WDV A;  5GRT A;  1ZX9 A;  1ONF A;  1IUX A;  2BXR A;  3DJD A;  3H4K A;  4H50 A;  4JNA A;  3ATQ A;  4H4P A;  1VDC A;  1OJT A;  1H84 A;  1O94 A;  2X8G A;  3P4Q A;  3UOZ A;  3JSK A;  3LAD A;  2WPF A;  2C72 A;  4X4J A;  3S5W A;  1IUW A;  4B68 A;  5HYM A;  3M12 A;  1Q1R A;  3II4 A;  3ICR A;  1FOH A;  5EB5 A;  1ZOV A;  2YG6 A;  2YR4 A;  2E5V A;  3CNP A;  3KLJ A;  4LA1 A;  3CGC A;  3SZW A;  1BWC A;  2B7S A;  3D1C A;  1JRZ A;  3VQR A;  1B37 A;  1IUT A;  1N4W A;  1KFY A;  3C4N A;  5L46 A;  3GD3 A;  1PBC A;  1GAL A;  1TDN A;  3HYW A;  3NIX A;  3IHM A;  3F8P A;  5KMQ A;  4KPR A;  2J3N A;  3LZW A;  4XWZ A;  3SX6 A;  2GB0 A;  1LTX R;  1ZMC A;  2QA2 A;  1HYU A;  4H4V A;  4N9X A;  4A9W A;  1IUS A;  2IID A;  3ZYX A;  2RGO A;  1D7Y A;  1VG0 A;  3K7M X;  4JQ9 A;  2GVC A;  2WHD A;  2ARD A;  1YKJ A;  3I6D A;  1JNR A;  3GMC A;  2BC1 A;  4YSY A;  2RGJ A;  5KVH A;  2XFP A;  2WU2 A;  1DOB A;  1O5W A;  3UP5 A;  3DGZ A;  1E1L A;  1NHR A;  1EL7 A;  1H7X A;  3ABV A;  1D5T A;  3BI4 A;  4Y4L A;  1BGJ A;  2VRM A;  3QVP A;  3UP4 A;  4JNQ A;  4K7Z A;  4II2 A;  2C3D A;  4H4W A;  1ZY8 A;  2VVL A;  1GOS A;  4Z2R A;  2BS3 A;  2CDU A;  1PBE A;  4A7A A;  3SY4 A;  3EF6 A;  3KVE A;  4EM3 A;  1UKV G;  3PS9 A;  3RP8 A;  4G73 A;  3GMB A;  3DME A;  3AXB A;  1JNZ A;  4IV9 A;  4OPI A;  2FBW A;  4OPC A;  2CFY A;  2FJE A;  4NTC A;  4WCT A;  1GRF A;  2AQJ A;  3T2K A;  1DJQ A;  1YQ3 A;  3CGD A;  3GSI A;  2EQ9 A;  3CPH G;  4ZCD A;  4BV6 A;  1GXF A;  1CJ2 A;  4A6N B;  2GV8 A;  1AOG A;  1NHS A;  1CJ3 A;  2R0G A;  3AE4 A;  1L9D A;  2YLZ A;  4K2X A;  4H4X A;  4EQW A;  1GT8 A;  1QLB A;  3G5R A;  2GF3 A;  1Z6L A;  1GEU A;  2BXS A;  4O5Q A;  4UDP A;  2R46 A;  3GWF A;  4GR1 A;  4D04 A;  5KXJ A;  3QJ4 A;  4USR A;  4G9K A;  2X99 A;  3K7Q X;  3L1R A;  2BAB A;  3AWI A;  4YKG A;  2YLR A;  1GRG A;  1PXA A;  5J60 A;  1RP0 A;  4AOX A;  3AE8 A;  1VRQ B;  2APG A;  4H4R A;  2AAQ A;  4K8D A;  1E6E A;  4C5O A;  4YTP A;  4IVO B;  3UKL A;  2JB2 A;  4Z24 A;  3NTA A;  3SFD A;  3V3N A;  3AE6 A;  2C70 A;  3AYL A;  3HYV A;  4K5R A;  5JCK A;  1KSU A;  2TMD A;  1D4E A;  1RYI A;  2R0C A;  4USQ A;  2WPE A;  3VRD B;  5KMP A;  1P2H A;  2I0Z A;  3GRS A;  3Q6J A;  1YY5 A;  3KKJ A;  4YWO A;  2Y6Q A;  2R4J A;  3ITJ A;  3SQP A;  2WOI A;  4YXD A;  4EM4 A;  2V61 A;  3LB8 A;  4B63 A;  4EMJ A;  4UP3 A;  4IVM B;  2WEU A;  4C3Y A;  2B76 A;  2WET A;  3NN0 X;  4YSX A;  2RGH A;  2GQW A;  2WES A;  3DGH A;  1W4X A;  1BKW A;  2Q0L A;  3P9U A;  1K0J A;  2E4G A;  2YLT A;  3NLC A;  4H2N A;  4JY3 A;  4U8I A;  1RSG A;  3FPZ A;  5CQF A;  3UKK A;  1DJN A;  3ISH A;  1FEB A;  3K7T A;  3RP6 A;  4AT2 A;  2ZZ0 A;  3CNS A;  4H4U A;  1K4Q A;  3NYE A;  3COX A;  1ZDL A;  2Z5X A;  4ECH A;  1F3P A;  1H81 A;  1FL2 A;  1N4V A;  1NDA A;  3SYI A;  3Q9T A;  3NH3 X;  3UKF A;  3AD7 B;  1TYP A;  1PDH A;  3LXD A;  3H8L A;  3NG7 X;  4YSH A;  3SZF A;  5KVI A;  1GSN A;  4YT0 A;  2ACZ A;  3AEE A;  1REO A;  5IQ4 A;  2O9Z A;  4JDR A;  1OJA A;  3FIM B;  5FS8 A;  2ZZC A;  3NRN A;  3F8R A;  1GRT A;  1SEZ A;  4RSL A;  3RED A;  2UZZ A;  4U8O A;  1LQT A;  1GPE A;  3QVR A;  3T2Y A;  2WOW A;  4YKF A;  3CNJ A;  3FMW A;  4FX9 A;  4U8M A;  1NPX A;  2FJB A;  4LII A;  1JOA A;  1OJD A;  3S61 A;  2A89 A;  2YLS A;  4NWZ A;  2H88 A;  3CPI G;  2OAL A;  2GMJ A;  3AEB A;  3ALJ A;  1NEK A;  1PBD A;  3GDP A;  3UTG A;  1MXT A;  4CY8 A;  1IJH A;  3ICT A;  2GR3 A;  3KD9 A;  4CNJ A;  4B66 A;  4EMI A;  4EQS A;  2WBA A;  2XVH A;  3SZ0 A;  4BUR A;  3BNM A;  1XPQ A;  4OPD A;  1NAA A;  4EMW A;  4HB9 A;  2XDO A;  3CMM A;  2QA1 A;  3NHO X;  1COY A;  1CF3 A;  4P9S A;  2VRL A;  1CJ4 A;  2Y6R A;  3UKA A;  3P4P A;  5GSN A;  5KWF A;  1ZMD A;  2VQ7 A;  2YAU A;  1ZKQ A;  1H82 A;  2YG3 A;  1PN0 A;  1PJ5 A;  2X3N A;  4G6G A;  4H4Q A;  5KRQ A;  4RG4 A;  2X8C A;  3GYX A;  3UOX A;  4U8N A;  4B65 A;  1PXC A;  3QFB A;  1F8W A;  2BCP A;  4J2W A;  3NGC X;  2C67 A;  4CCQ A;  4XWR A;  2YLW A;  2BK5 A;  1EL8 A;  2C73 A;  1KSS A;  3AEG A;  3BNU A;  5EBK A;  2CVJ A;  3CGE A;  4UDR A;  5J7X A;  2WP6 A;  5U1O A;  2WU5 A;  1L9E A;  2OA1 A;  1D7L A;  4IA6 A;  2DKH A;  2B9X A;  5FMH A;  1GER A;  1OJ9 A;  4MJW A;  3T2Z A;  2JKC A;  4BJZ A;  3NYC A;  4YTM A;  1BGN A;  2OAM A;  1TDE A;  3UOV A;  2RAB A;  3RP7 A;  5C2T A;  4X9M A;  5KOX A;  3VRA A;  1K0I A;  3SM8 A;  1S2Q A;  1OJC A;  1VG9 A;  2GAH B;  2C76 A;  3UTH A;  4A65 A;  4JN9 A;  1GND A;  3QSM A;  4NTD A;  1PS9 A;  1ELI A;  3FG2 P;  2WPC A;  4O5U A;  1DOC A;  3H8I A;  1Q1W A;  4TLX A;  1P2E A;  2GAG B;  1TDF A;  5DBJ A;  4EIQ A;  5JCM A;  3DH9 A;  3DK4 A;  4GF7 A;  3R9U A;  1KF6 A;  3ATR A;  3IWA A;  2JB1 A;  1EBD A;  2R0P A;  3DA1 A;  2YWL A;  4G74 A;  2E1M A;  1EL5 A;  3GRT A;  1PXB A;  4GRT A;  3AE5 A;  4NTE A;  3BHK A;  1E1M A;  2BS2 A;  2VVL G;  2BRA A;  3OZ2 A;  5JCI A;  2TPR A;  1KNP A;  1CC4 A;  1DXL A;  4U8K A;  1MOK A;  5U63 A;  5ER0 A;  3NTD A;  1E1K A;  1XAN A;  4A79 A;  3VR8 A;  1GRA A;  3BHF A;  4TLZ A;  1Q9I A;  4YSZ A;  2XVJ A;  3NT6 A;  2WQY A;  1NHP A;  2YG5 A;  2WDQ A;  3EPT A;  4AT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...