4G6GA

Crystal structure of ndh with trt
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
478
structure length
470
Chain Sequence
GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
total genus 151
structure length 470
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6gA00
3T0KA 4G73A 3SZFA 4NWZA 5KMQA 3SX6A 3HYXA 3SZ0A 3T2KA 3T31A 3HYVA 3SXIA 4G6HA 4GAPA 3T14A 3SZCA 3SY4A 3T2ZA 4GAVA 5KMSA 4G6GA 4G9KA 4G74A 3T2YA 5KMPA 3HYWA 3KPKA 5KMRA 3SZWA 3SYIA
chains in the Genus database with same CATH superfamily
2C75A 2VRMA 4U8IA 2GV8A 3NHOX 2V3AA 3RP6A 3EANA 1CF3A 3CMMA 4H4QA 2GAGB 4B68A 4NEVA 3GD3A 4HB9A 1PDHA 2GR2A 4CNJA 3NLCA 3H4KA 2I0ZA 2YG7A 1BWCA 3OZ2A 4GAPA 3LADA 3D8XA 3K7MX 2WOIA 2WETA 4H4SA 1B8SA 3NG7X 3GD4A 4UDPA 2ZBWA 4YTMA 1F3PA 3URHA 1K0JA 1RYIA 2XLPA 1GETA 3GWFA 1W4XA 4X4JA 1YQ3A 1QJDA 1TDFA 1OJAA 2XVJA 3NK1X 3QSMA 1TDEA 3KVEA 1PJ5A 2C3DA 3T0KA 1XDIA 1PXCA 4A6NB 2ARDA 3GRSA 4B63A 5IQ4A 3ADAB 1EL5A 1CJ2A 4J57A 4DSHA 2OLNA 2BXRA 3BI4A 3NK2X 1NAAA 3GYJA 2JB2A 3QVRA 3SM8A 5KXJA 1ZMDA 1E7PA 4H7UA 2GF3A 1ZDLA 4FK1A 3RP8A 2E4GA 3Q9TA 1JEHA 3AD9B 3GYXA 5HYMA 3BI5A 2ZZBA 4C3XA 5KVIA 2WU5A 1ZOYA 2WDQA 2VVLG 1TYTA 3AE1A 3COXA 4K5SA 2TMDA 3UKKA 2H89A 2EQ6A 3DA1A 3IHGA 4U8OA 3SX6A 1CC6A 3UKAA 3AECA 3GMBA 1GRAA 2B7SA 2WS3A 3CGCA 4RG3A 2HQMA 3B6DA 5TR3A 2BK3A 4EMJA 2WP5A 4RSLA 5JCNA 1AOGA 4EQXA 4TM4A 1OJTA 2AR8A 2C76A 1RSGA 3AYLA 3KLJA 4K8DA 3O0HA 3QSSA 2XFQA 1D5TA 1L9CA 1MOKA 2E5VA 4II3A 3SQPA 3V3OA 5BRTA 1P2HA 3BNUA 3ICSA 4D03A 2BK4A 3GYIA 2A8XA 5JCIA 2A89A 1QLBA 4J34A 4O5QA 1IJHA 2VRLA 1M6IA 2XLUA 2YVGA 3CGBA 4A79A 3FPZA 4YT0A 1PBEA 2C72A 2WHDA 4DGKA 4GF7A 4CCRA 1NHPA 2X8GA 2EQ8A 1DXLA 1KNPA 3UKQA 3NYCA 3BHKA 4OPUA 2JK6A 1Q9IA 2GB0A 2BC1A 4Z44A 1H82A 1B4VA 4MJWA 1E1NA 4A65A 1Y0PA 2AAQA 3FG2P 1COYA 1TYPA 2R0CA 4UP3A 1M64A 3KD9A 2WP6A 1D7LA 2OLOA 3QVPA 4IA6A 2B9XA 4U2LA 4ZN0A 1IUWA 4ECHA 3UTGA 2VZ2A 3CNDA 4NTEA 2CVJA 3VRBA 1FOHA 4OPDA 1F8WA 2Q6UA 1MO9A 4APNA 1Z6LA 5JCKA 3KPKA 2VVLA 3ALJA 3IC9A 1L0VA 2WESA 1IUVA 4Z2TA 3CPIG 1YQZA 4GRTA 4GUVA 1S2YA 4USQA 4O5UA 4CRTA 2GEWA 5J60A 5JCLA 2PHHA 5U25A 1K0LA 1LVLA 3AD8B 4H4XA 5J7XA 3T31A 1JNZA 3AEDA 1EBDA 4Z2UA 5KVHA 2BS3A 2WDVA 4TLXA 4II2A 2Z5YA 3P4RA 4Y4NA 4H4UA 3VQRA 3T2ZA 1O94A 3UTHA 4U8MA 4BJZA 1GALA 3GWDA 4YSYA 1TRBA 4X9NA 1GEUA 1NHRA 3KKJA 3ATRA 3DK4A 1H84A 5M0ZA 1XANA 3DJDA 3VRDB 1ZK7A 3C4NA 2AQJA 2H88A 1MXTA 2Y6QA 2BA9A 2RGOA 1K4QA 2CULA 4CBQA 5IPYA 4K2XA 2VOUA 3LJPA 1GRBA 1GSNA 2W0HA 2APGA 2RGHA 3DGHA 3EAOA 3ISHA 4K22A 2JB1A 3F8DA 4OPTA 3CNSA 1GPEA 1X31B 1S3BA 2BACA 2GRTA 4M52A 3UTEA 4USRA 3FBSA 4JNAA 3VR9A 3NTAA 3VR8A 4EIQA 2BXSA 3QSEA 4H4ZA 4BK2A 3GDNA 4C3YA 2YLWA 4XXGA 1JRXA 1VQWA 4GAVA 2TPRA 5KWFA 1BGJA 5BULA 3RHAA 2FBWA 1Y56A 3DJEA 2R46A 1NDAA 1PHHA 1N4WA 1KDGA 4HA6A 4N9XA 1H81A 1GERA 2XFNA 4J56A 1N1PA 1H86A 1PBBA 4FDCB 1LJ1A 3AEBA 4OPIA 3OC4A 5GRTA 2YG5A 3CIRA 2IIDA 4YSHA 3T2KA 1H83A 1HYUA 1CC4A 2QA2A 3KU9A 3VRAA 4TM3A 2JBVA 4EQRA 1NENA 1PXBA 2BRYA 2CFYA 2XVEA 2WPFA 2YR4A 3P1WA 4JNQA 1EL9A 4KPRA 2FJDA 4AOSA 2YR6A 2X50A 2VVMA 4P9SA 2R45A 4NTDA 3CNTA 2ACZA 3AE2A 3P4QA 2GMJA 3AEAA 2JKCA 1JRYA 2BYBA 2RGJA 1VG9A 1O5WA 3SYIA 5M10A 1GRHA 5KOXA 2F5ZA 4G73A 1NHSA 3CGDA 4U8KA 3F8RA 3NT6A 1GV4A 3LB8A 3NGCX 3LZXA 2XFPA 5BUKA 3UCLA 4CNKA 1PBCA 2YQUA 2O9ZA 1H6VA 3G5SA 3GDPA 3QFBA 4B65A 3RNMA 2JB3A 1PXAA 2YWLA 3AE8A 1FEAA 3T14A 4K5RA 3RP7A 3SZCA 1CHUA 5KMSA 4A99A 4H4PA 2R9ZA 4BK3A 4GDPA 1VRQB 5EB5A 2VQBA 3H8IA 3NYFA 4ZCDA 1GRGA 1IUUA 2FJEA 4AOXA 4IA5A 5LV9A 4YXDA 3Q6JA 2JAEA 4RG4A 1YQ4A 2X8CA 3ATQA 4PAAA 3UOXA 3AE5A 3NYEA 2WPCA 3SZ0A 4A9WA 2OALA 3DH9A 3V3NA 4UDRA 3AD7B 2IVEA 3NN6X 1F8SA 4TM0A 5U1OA 4I58A 1N4VA 2WU2A 1D4EA 3KA7A 1CC2A 3EF6A 2OA1A 2YG4A 1LQUA 1ONFA 3LZWA 1EL8A 3ZDNA 4FK1C 1OJCA 3K30A 3UOZA 1DOCA 3G5RA 1KSSA 2E1MA 3G5QA 3C4AA 2BK5A 3SFEA 4OPGA 4B69A 3FMWA 5GSNA 2XVFA 3K7TA 4EMIA 5KMPA 4J36A 4ADWA 4BK1A 2C65A 1RP0A 4JN9A 4BJYA 4NZHA 2V5ZA 3GRTA 1ZY8A 3E1TA 4H50A 1JNRA 1E39A 1QO8A 2YG3A 3NRNA 1KF6A 2GR1A 1GESA 3EPTA 4LIIA 4EM4A 2WP9A 2XFOA 1NHQA 2C3CA 3K7QX 1GRTA 1VG0A 2FJAA 3GMCA 4YSXA 2EQ9A 3NK0X 2C70A 4GR1A 4TLZA 3T37A 4AT2A 4NEWA 2NVKX 1ZKQA 4H4WA 4WX1A 2XLSA 1DOBA 4H4VA 1LQTA 1NG4A 2C67A 4IV9A 4C77A 4YKGA 2YVJA 2YG6A 4YTNA 1GT8A 2BRAA 5HHFA 3P4PA 3IWAA 1PN0A 3CGEA 4A5LA 3AEFA 5KOWA 1DNCA 3DJGX 5HXIA 4LA1A 4JQ9A 1IUXA 2BCPA 2QAEA 3SZFA 1PBDA 2YLZA 5L46A 1LV0A 3NH3X 3QFAA 4B64A 4WCTA 3UKPA 3UP4A 2B9WA 1BZLA 4YKFA 3I6DA 1KFYA 4H2NA 1ZMCA 1F8RA 5C3JA 2V61A 3B3RA 4YWOA 3AEGA 2WBAA 1CJ4A 4Z2RA 1FEBA 2GR0A 2GVCA 4D04A 2XYOA 2XLRA 3BI2A 3CTYA 5BVAA 1E1MA 1NEKA 3CN8A 2GH5A 2V60A 5FMHA 2R0PA 2WOWA 2IVDA 3QJ4A 2C64A 4G74A 4U8NA 3NIXA 4UDQA 2C7GA 2GAHB 1ZP0A 1FL2A 1L9DA 3AB1A 3NN0X 3AE9A 5C2TA 5FS6A 5FS7A 3PS9A 2J3NA 3AXBA 5U63A 2XCGA 3GSIA 3ITJA 4U8LA 5CQFA 3S5WA 4OPCA 4C74A 2Q0LA 1GNDA 2BS4A 2A87A 2PYXA 4H4YA 4LU6A 3ICTA 3NNEA 4J2WA 4BV6A 1F6MA 1YKJA 2NPXA 3ICRA 5EBKA 1N4UA 3ALMA 4ZCCA 1B37A 1DJNA 2Z5XA 4AP1A 3SY4A 3UKFA 1GTHA 2BS2A 4U8JA 4G9KA 3LOVA 4NNJA 2GMHA 1B5QA 1CL0A 5DBJA 3L1RA 4Z43A 3PO7A 3CNJA 4GCMA 1ELIA 5KMRA 3AYIA 3IF9A 3BNMA 1DOEA 3CPHG 4EM3A 1K0IA 2ZZ0A 3C96A 2WEUA 3M0OA 1BKWA 4Z25A 2GQFA 2X3NA 1D4DA 4Z24A 3R9UA 4EMWA 1PBFA 2CDUA 3CPJG 4DNAA 4B66A 5KMQA 1JU2A 3F8PA 3JSKA 1GREA 2YM1A 5CKUA 4Z26A 5EB4A 3HYVA 1FECA 4GDEA 3UKLA 4B1BA 3SXIA 4TM1A 1P2EA 1LPFA 1YY5A 1OJ9A 2YLXA 2GR3A 3NTDA 3AE3A 4YTPA 4Y4LA 1L9EA 2UZZA 3V76A 1H7XA 1O95A 2X99A 1REOA 3CNPA 3I3LA 4FX9A 4YSZA 2Q0KA 2BC0A 3REDA 3UOVA 2YLTA 5EOWA 3SZWA 1SEZA 1Y56B 3S61A 4U2SA 4CCQA 4OCGA 2R0GA 1CJCA 2RABA 4U8PA 1KNRA 2Q7VA 4J33A 3P4SA 4JY2A 4NWZA 2XVIA 2YLSA 4H2RA 1DJQA 4CY8A 1TDNA 1BGNA 2EQ7A 4DSGA 4NTCA 1NG3A 4AP3A 3WE0A 1E1LA 1E1KA 2B7RA 3AEEA 3NKSA 4G6HA 4X9MA 4XWRA 1PJ6A 3IHMA 4EIPA 2XFUA 4PABA 2WPEA 1EL7A 3AE6A 4XWZA 1S2QA 3UP5A 3DMEA 2YVFA 4G6GA 4REKA 5KRQA 2WDRA 4IVOB 1FCDA 4A7AA 2WOVA 3DGZA 2ZZCA 2YM2A 3HYWA 4I59A 4JY3A 2B9YA 1UKVG 1XPQA 3ZYXA 1OJDA 5JCMA 3BHFA 2C66A 3P9UA 5FS9A 4BURA 4AT0A 5IQ1A 4ICYA 3L8KA 4Y4MA 2X8HA 4B67A 3HYXA 3II4A 4K7ZA 1D7YA 3UKHA 2FJBA 2C4CA 3ABVA 1TDOA 4CY6A 4IVMB 1TDKA 1ZOVA 1DODA 1VDCA 1CJ3A 3ALLA 3HZLA 3AYJA 1S3EA 3AE7A 4OVIA 3SGLA 2QCUA 5ER0A 1JOAA 5FS8A 1ZX9A 4A6NA 5KNLA 1H7WA 1JRZA 3FIMB 4JDRA 1GTEA 3D1CA 4OPLA 4U2TA 1GRFA 2XLTA 3AWIA 1CBOA 4EQWA 1Q1WA 2BCGG 3KPFA 3SFDA 2C73A 1BF3A 2DKIA 3PVCA 1KSUA 2VQ7A 2OAMA 1GXFA 3M12A 3UTFA 3M13A 2V3BA 3H8LA 4J31A 2V6OA 3DK9A 5HY5A 2YAUA 2QA1A 4C5OA 3UOYA 1E6EA 4H2PA 1GOSA 4E0VA 1IUTA 4H4RA 3DJJA 2DKHA 4H4TA 2R4JA 2WQYA 1D4CA 2XDOA 2YR5A 2XVHA 1V59A 1IUSA 1PJ7A 2GQWA 4EQSA 4H2QA 2B76A 1PS9A 2BABA 3T2YA 2R4EA 3AE4A 1LTXR 1NPXA 2YLRA 1XHCA 1Q1RA 3DK8A 3LXDA 2Y6RA 4KX6A
chains in the Genus database with same CATH topology
2C75A 2VRMA 4U8IA 2GV8A 3NHOX 2V3AA 3RP6A 3EANA 1CF3A 3CMMA 4H4QA 2GAGB 4B68A 4NEVA 3GD3A 4HB9A 1PDHA 2GR2A 4CNJA 3NLCA 3H4KA 2I0ZA 2YG7A 1BWCA 3OZ2A 4GAPA 3LADA 3D8XA 3K7MX 2WOIA 2WETA 4H4SA 1B8SA 3NG7X 3GD4A 4UDPA 2ZBWA 4YTMA 1F3PA 3URHA 1K0JA 1RYIA 2XLPA 1GETA 3GWFA 1W4XA 4X4JA 1YQ3A 1QJDA 1TDFA 1OJAA 2XVJA 3NK1X 3QSMA 1TDEA 3KVEA 1PJ5A 2C3DA 3T0KA 1XDIA 1PXCA 4A6NB 2ARDA 3GRSA 4B63A 5IQ4A 3ADAB 1EL5A 1CJ2A 4J57A 4DSHA 2OLNA 2BXRA 3BI4A 3NK2X 1NAAA 3GYJA 2JB2A 3QVRA 3SM8A 5KXJA 1ZMDA 1E7PA 4H7UA 2GF3A 1ZDLA 4FK1A 3RP8A 2E4GA 3Q9TA 1JEHA 3AD9B 3GYXA 5HYMA 3BI5A 2ZZBA 4C3XA 5KVIA 2WU5A 1ZOYA 2WDQA 2VVLG 1TYTA 3AE1A 3COXA 4K5SA 2TMDA 3UKKA 2H89A 2EQ6A 3DA1A 3IHGA 4U8OA 3SX6A 1CC6A 3UKAA 3AECA 3GMBA 1GRAA 2B7SA 2WS3A 3CGCA 4RG3A 2HQMA 3B6DA 5TR3A 2BK3A 4EMJA 2WP5A 4RSLA 5JCNA 1AOGA 4EQXA 4TM4A 1OJTA 2AR8A 2C76A 1RSGA 3AYLA 3KLJA 4K8DA 3O0HA 3QSSA 2XFQA 1D5TA 1L9CA 1MOKA 2E5VA 4II3A 3SQPA 3V3OA 5BRTA 1P2HA 3BNUA 3ICSA 4D03A 2BK4A 3GYIA 2A8XA 5JCIA 2A89A 1QLBA 4J34A 4O5QA 1IJHA 2VRLA 1M6IA 2XLUA 2YVGA 3CGBA 4A79A 3FPZA 4YT0A 1PBEA 2C72A 2WHDA 4DGKA 4GF7A 4CCRA 1NHPA 2X8GA 2EQ8A 1DXLA 1KNPA 3UKQA 3NYCA 3BHKA 4OPUA 2JK6A 1Q9IA 2GB0A 2BC1A 4Z44A 1H82A 1B4VA 4MJWA 1E1NA 4A65A 1Y0PA 2AAQA 3FG2P 1COYA 1TYPA 2R0CA 4UP3A 1M64A 3KD9A 2WP6A 1D7LA 2OLOA 3QVPA 4IA6A 2B9XA 4U2LA 4ZN0A 1IUWA 4ECHA 3UTGA 2VZ2A 3CNDA 4NTEA 2CVJA 3VRBA 1FOHA 4OPDA 1F8WA 2Q6UA 1MO9A 4APNA 1Z6LA 5JCKA 3KPKA 2VVLA 3ALJA 3IC9A 1L0VA 2WESA 1IUVA 4Z2TA 3CPIG 1YQZA 4GRTA 4GUVA 1S2YA 4USQA 4O5UA 4CRTA 2GEWA 5J60A 5JCLA 2PHHA 5U25A 1K0LA 1LVLA 3AD8B 4H4XA 5J7XA 3T31A 1JNZA 3AEDA 1EBDA 4Z2UA 5KVHA 2BS3A 2WDVA 4TLXA 4II2A 2Z5YA 3P4RA 4Y4NA 4H4UA 3VQRA 3T2ZA 1O94A 3UTHA 4U8MA 4BJZA 1GALA 3GWDA 4YSYA 1TRBA 4X9NA 1GEUA 1NHRA 3KKJA 3ATRA 3DK4A 1H84A 5M0ZA 1XANA 3DJDA 3VRDB 1ZK7A 3C4NA 2AQJA 2H88A 1MXTA 2Y6QA 2BA9A 2RGOA 1K4QA 2CULA 4CBQA 5IPYA 4K2XA 2VOUA 3LJPA 1GRBA 1GSNA 2W0HA 2APGA 2RGHA 3DGHA 3EAOA 3ISHA 4K22A 2JB1A 3F8DA 4OPTA 3CNSA 1GPEA 1X31B 1S3BA 2BACA 2GRTA 4M52A 3UTEA 4USRA 3FBSA 4JNAA 3VR9A 3NTAA 3VR8A 4EIQA 2BXSA 3QSEA 4H4ZA 4BK2A 3GDNA 4C3YA 2YLWA 4XXGA 1JRXA 1VQWA 4GAVA 2TPRA 5KWFA 1BGJA 5BULA 3RHAA 2FBWA 1Y56A 3DJEA 2R46A 1NDAA 1PHHA 1N4WA 1KDGA 4HA6A 4N9XA 1H81A 1GERA 2XFNA 4J56A 1N1PA 1H86A 1PBBA 4FDCB 1LJ1A 3AEBA 4OPIA 3OC4A 5GRTA 2YG5A 3CIRA 2IIDA 4YSHA 3T2KA 1H83A 1HYUA 1CC4A 2QA2A 3KU9A 3VRAA 4TM3A 2JBVA 4EQRA 1NENA 1PXBA 2BRYA 2CFYA 2XVEA 2WPFA 2YR4A 3P1WA 4JNQA 1EL9A 4KPRA 2FJDA 4AOSA 2YR6A 2X50A 2VVMA 4P9SA 2R45A 4NTDA 3CNTA 2ACZA 3AE2A 3P4QA 2GMJA 3AEAA 2JKCA 1JRYA 2BYBA 2RGJA 1VG9A 1O5WA 3SYIA 5M10A 1GRHA 5KOXA 2F5ZA 4G73A 1NHSA 3CGDA 4U8KA 3F8RA 3NT6A 1GV4A 3LB8A 3NGCX 3LZXA 2XFPA 5BUKA 3UCLA 4CNKA 1PBCA 2YQUA 2O9ZA 1H6VA 3G5SA 3GDPA 3QFBA 4B65A 3RNMA 2JB3A 1PXAA 2YWLA 3AE8A 1FEAA 3T14A 4K5RA 3RP7A 3SZCA 1CHUA 5KMSA 4A99A 4H4PA 2R9ZA 4BK3A 4GDPA 1VRQB 5EB5A 2VQBA 3H8IA 3NYFA 4ZCDA 1GRGA 1IUUA 2FJEA 4AOXA 4IA5A 5LV9A 4YXDA 3Q6JA 2JAEA 4RG4A 1YQ4A 2X8CA 3ATQA 4PAAA 3UOXA 3AE5A 3NYEA 2WPCA 3SZ0A 4A9WA 2OALA 3DH9A 3V3NA 4UDRA 3AD7B 2IVEA 3NN6X 1F8SA 4TM0A 5U1OA 4I58A 1N4VA 2WU2A 1D4EA 3KA7A 1CC2A 3EF6A 2OA1A 2YG4A 1LQUA 1ONFA 3LZWA 1EL8A 3ZDNA 4FK1C 1OJCA 3K30A 3UOZA 1DOCA 3G5RA 1KSSA 2E1MA 3G5QA 3C4AA 2BK5A 3SFEA 4OPGA 4B69A 3FMWA 5GSNA 2XVFA 3K7TA 4EMIA 5KMPA 4J36A 4ADWA 4BK1A 2C65A 1RP0A 4JN9A 4BJYA 4NZHA 2V5ZA 3GRTA 1ZY8A 3E1TA 4H50A 1JNRA 1E39A 1QO8A 2YG3A 3NRNA 1KF6A 2GR1A 1GESA 3EPTA 4LIIA 4EM4A 2WP9A 2XFOA 1NHQA 2C3CA 3K7QX 1GRTA 1VG0A 2FJAA 3GMCA 4YSXA 2EQ9A 3NK0X 2C70A 4GR1A 4TLZA 3T37A 4AT2A 4NEWA 2NVKX 1ZKQA 4H4WA 4WX1A 2XLSA 1DOBA 4H4VA 1LQTA 1NG4A 2C67A 4IV9A 4C77A 4YKGA 2YVJA 2YG6A 4YTNA 1GT8A 2BRAA 5HHFA 3P4PA 3IWAA 1PN0A 3CGEA 4A5LA 3AEFA 5KOWA 1DNCA 3DJGX 5HXIA 4LA1A 4JQ9A 1IUXA 2BCPA 2QAEA 3SZFA 1PBDA 2YLZA 5L46A 1LV0A 3NH3X 3QFAA 4B64A 4WCTA 3UKPA 3UP4A 2B9WA 1BZLA 4YKFA 3I6DA 1KFYA 4H2NA 1ZMCA 1F8RA 5C3JA 2V61A 3B3RA 4YWOA 3AEGA 2WBAA 1CJ4A 4Z2RA 1FEBA 2GR0A 2GVCA 4D04A 2XYOA 2XLRA 3BI2A 3CTYA 5BVAA 1E1MA 1NEKA 3CN8A 2GH5A 2V60A 5FMHA 2R0PA 2WOWA 2IVDA 3QJ4A 2C64A 4G74A 4U8NA 3NIXA 4UDQA 2C7GA 2GAHB 1ZP0A 1FL2A 1L9DA 3AB1A 3NN0X 3AE9A 5C2TA 5FS6A 5FS7A 3PS9A 2J3NA 3AXBA 5U63A 2XCGA 3GSIA 3ITJA 4U8LA 5CQFA 3S5WA 4OPCA 4C74A 2Q0LA 1GNDA 2BS4A 2A87A 2PYXA 4H4YA 4LU6A 3ICTA 3NNEA 4J2WA 4BV6A 1F6MA 1YKJA 2NPXA 3ICRA 5EBKA 1N4UA 3ALMA 4ZCCA 1B37A 1DJNA 2Z5XA 4AP1A 3SY4A 3UKFA 1GTHA 2BS2A 4U8JA 4G9KA 3LOVA 4NNJA 2GMHA 1B5QA 1CL0A 5DBJA 3L1RA 4Z43A 3PO7A 3CNJA 4GCMA 1ELIA 5KMRA 3AYIA 3IF9A 3BNMA 1DOEA 3CPHG 4EM3A 1K0IA 2ZZ0A 3C96A 2WEUA 3M0OA 1BKWA 4Z25A 2GQFA 2X3NA 1D4DA 4Z24A 3R9UA 4EMWA 1PBFA 2CDUA 3CPJG 4DNAA 4B66A 5KMQA 1JU2A 3F8PA 3JSKA 1GREA 2YM1A 5CKUA 4Z26A 5EB4A 3HYVA 1FECA 4GDEA 3UKLA 4B1BA 3SXIA 4TM1A 1P2EA 1LPFA 1YY5A 1OJ9A 2YLXA 2GR3A 3NTDA 3AE3A 4YTPA 4Y4LA 1L9EA 2UZZA 3V76A 1H7XA 1O95A 2X99A 1REOA 3CNPA 3I3LA 4FX9A 4YSZA 2Q0KA 2BC0A 3REDA 3UOVA 2YLTA 5EOWA 3SZWA 1SEZA 1Y56B 3S61A 4U2SA 4CCQA 4OCGA 2R0GA 1CJCA 2RABA 4U8PA 1KNRA 2Q7VA 4J33A 3P4SA 4JY2A 4NWZA 2XVIA 2YLSA 4H2RA 1DJQA 4CY8A 1TDNA 1BGNA 2EQ7A 4DSGA 4NTCA 1NG3A 4AP3A 3WE0A 1E1LA 1E1KA 2B7RA 3AEEA 3NKSA 4G6HA 4X9MA 4XWRA 1PJ6A 3IHMA 4EIPA 2XFUA 4PABA 2WPEA 1EL7A 3AE6A 4XWZA 1S2QA 3UP5A 3DMEA 2YVFA 4G6GA 4REKA 5KRQA 2WDRA 4IVOB 1FCDA 4A7AA 2WOVA 3DGZA 2ZZCA 2YM2A 3HYWA 4I59A 4JY3A 2B9YA 1UKVG 1XPQA 3ZYXA 1OJDA 5JCMA 3BHFA 2C66A 3P9UA 5FS9A 4BURA 4AT0A 5IQ1A 4ICYA 3L8KA 4Y4MA 2X8HA 4B67A 3HYXA 3II4A 4K7ZA 1D7YA 3UKHA 2FJBA 2C4CA 3ABVA 1TDOA 4CY6A 4IVMB 1TDKA 1ZOVA 1DODA 1VDCA 1CJ3A 3ALLA 3HZLA 3AYJA 1S3EA 3AE7A 4OVIA 3SGLA 2QCUA 5ER0A 1JOAA 5FS8A 1ZX9A 4A6NA 5KNLA 1H7WA 1JRZA 3FIMB 4JDRA 1GTEA 3D1CA 4OPLA 4U2TA 1GRFA 2XLTA 3AWIA 1CBOA 4EQWA 1Q1WA 2BCGG 3KPFA 3SFDA 2C73A 1BF3A 2DKIA 3PVCA 1KSUA 2VQ7A 2OAMA 1GXFA 3M12A 3UTFA 3M13A 2V3BA 3H8LA 4J31A 2V6OA 3DK9A 5HY5A 2YAUA 2QA1A 4C5OA 3UOYA 1E6EA 4H2PA 1GOSA 4E0VA 1IUTA 4H4RA 3DJJA 2DKHA 4H4TA 2R4JA 2WQYA 1D4CA 2XDOA 2YR5A 2XVHA 1V59A 1IUSA 1PJ7A 2GQWA 4EQSA 4H2QA 2B76A 1PS9A 2BABA 3T2YA 2R4EA 3AE4A 1LTXR 1NPXA 2YLRA 1XHCA 1Q1RA 3DK8A 3LXDA 2Y6RA 4KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0K A;  4G73 A;  3SZF A;  4NWZ A;  5KMQ A;  3SX6 A;  3HYX A;  3SZ0 A;  3T2K A;  3T31 A;  3HYV A;  3SXI A;  4G6H A;  4GAP A;  3T14 A;  3SZC A;  3SY4 A;  3T2Z A;  4GAV A;  5KMS A;  4G6G A;  4G9K A;  4G74 A;  3T2Y A;  5KMP A;  3HYW A;  3KPK A;  5KMR A;  3SZW A;  3SYI A; 
#chains in the Genus database with same CATH topology
 2C75 A;  2VRM A;  4U8I A;  2GV8 A;  3NHO X;  2V3A A;  3RP6 A;  3EAN A;  1CF3 A;  3CMM A;  4H4Q A;  2GAG B;  4B68 A;  4NEV A;  3GD3 A;  4HB9 A;  1PDH A;  2GR2 A;  4CNJ A;  3NLC A;  3H4K A;  2I0Z A;  2YG7 A;  1BWC A;  3OZ2 A;  4GAP A;  3LAD A;  3D8X A;  3K7M X;  2WOI A;  2WET A;  4H4S A;  1B8S A;  3NG7 X;  3GD4 A;  4UDP A;  2ZBW A;  4YTM A;  1F3P A;  3URH A;  1K0J A;  1RYI A;  2XLP A;  1GET A;  3GWF A;  1W4X A;  4X4J A;  1YQ3 A;  1QJD A;  1TDF A;  1OJA A;  2XVJ A;  3NK1 X;  3QSM A;  1TDE A;  3KVE A;  1PJ5 A;  2C3D A;  3T0K A;  1XDI A;  1PXC A;  4A6N B;  2ARD A;  3GRS A;  4B63 A;  5IQ4 A;  3ADA B;  1EL5 A;  1CJ2 A;  4J57 A;  4DSH A;  2OLN A;  2BXR A;  3BI4 A;  3NK2 X;  1NAA A;  3GYJ A;  2JB2 A;  3QVR A;  3SM8 A;  5KXJ A;  1ZMD A;  1E7P A;  4H7U A;  2GF3 A;  1ZDL A;  4FK1 A;  3RP8 A;  2E4G A;  3Q9T A;  1JEH A;  3AD9 B;  3GYX A;  5HYM A;  3BI5 A;  2ZZB A;  4C3X A;  5KVI A;  2WU5 A;  1ZOY A;  2WDQ A;  2VVL G;  1TYT A;  3AE1 A;  3COX A;  4K5S A;  2TMD A;  3UKK A;  2H89 A;  2EQ6 A;  3DA1 A;  3IHG A;  4U8O A;  3SX6 A;  1CC6 A;  3UKA A;  3AEC A;  3GMB A;  1GRA A;  2B7S A;  2WS3 A;  3CGC A;  4RG3 A;  2HQM A;  3B6D A;  5TR3 A;  2BK3 A;  4EMJ A;  2WP5 A;  4RSL A;  5JCN A;  1AOG A;  4EQX A;  4TM4 A;  1OJT A;  2AR8 A;  2C76 A;  1RSG A;  3AYL A;  3KLJ A;  4K8D A;  3O0H A;  3QSS A;  2XFQ A;  1D5T A;  1L9C A;  1MOK A;  2E5V A;  4II3 A;  3SQP A;  3V3O A;  5BRT A;  1P2H A;  3BNU A;  3ICS A;  4D03 A;  2BK4 A;  3GYI A;  2A8X A;  5JCI A;  2A89 A;  1QLB A;  4J34 A;  4O5Q A;  1IJH A;  2VRL A;  1M6I A;  2XLU A;  2YVG A;  3CGB A;  4A79 A;  3FPZ A;  4YT0 A;  1PBE A;  2C72 A;  2WHD A;  4DGK A;  4GF7 A;  4CCR A;  1NHP A;  2X8G A;  2EQ8 A;  1DXL A;  1KNP A;  3UKQ A;  3NYC A;  3BHK A;  4OPU A;  2JK6 A;  1Q9I A;  2GB0 A;  2BC1 A;  4Z44 A;  1H82 A;  1B4V A;  4MJW A;  1E1N A;  4A65 A;  1Y0P A;  2AAQ A;  3FG2 P;  1COY A;  1TYP A;  2R0C A;  4UP3 A;  1M64 A;  3KD9 A;  2WP6 A;  1D7L A;  2OLO A;  3QVP A;  4IA6 A;  2B9X A;  4U2L A;  4ZN0 A;  1IUW A;  4ECH A;  3UTG A;  2VZ2 A;  3CND A;  4NTE A;  2CVJ A;  3VRB A;  1FOH A;  4OPD A;  1F8W A;  2Q6U A;  1MO9 A;  4APN A;  1Z6L A;  5JCK A;  3KPK A;  2VVL A;  3ALJ A;  3IC9 A;  1L0V A;  2WES A;  1IUV A;  4Z2T A;  3CPI G;  1YQZ A;  4GRT A;  4GUV A;  1S2Y A;  4USQ A;  4O5U A;  4CRT A;  2GEW A;  5J60 A;  5JCL A;  2PHH A;  5U25 A;  1K0L A;  1LVL A;  3AD8 B;  4H4X A;  5J7X A;  3T31 A;  1JNZ A;  3AED A;  1EBD A;  4Z2U A;  5KVH A;  2BS3 A;  2WDV A;  4TLX A;  4II2 A;  2Z5Y A;  3P4R A;  4Y4N A;  4H4U A;  3VQR A;  3T2Z A;  1O94 A;  3UTH A;  4U8M A;  4BJZ A;  1GAL A;  3GWD A;  4YSY A;  1TRB A;  4X9N A;  1GEU A;  1NHR A;  3KKJ A;  3ATR A;  3DK4 A;  1H84 A;  5M0Z A;  1XAN A;  3DJD A;  3VRD B;  1ZK7 A;  3C4N A;  2AQJ A;  2H88 A;  1MXT A;  2Y6Q A;  2BA9 A;  2RGO A;  1K4Q A;  2CUL A;  4CBQ A;  5IPY A;  4K2X A;  2VOU A;  3LJP A;  1GRB A;  1GSN A;  2W0H A;  2APG A;  2RGH A;  3DGH A;  3EAO A;  3ISH A;  4K22 A;  2JB1 A;  3F8D A;  4OPT A;  3CNS A;  1GPE A;  1X31 B;  1S3B A;  2BAC A;  2GRT A;  4M52 A;  3UTE A;  4USR A;  3FBS A;  4JNA A;  3VR9 A;  3NTA A;  3VR8 A;  4EIQ A;  2BXS A;  3QSE A;  4H4Z A;  4BK2 A;  3GDN A;  4C3Y A;  2YLW A;  4XXG A;  1JRX A;  1VQW A;  4GAV A;  2TPR A;  5KWF A;  1BGJ A;  5BUL A;  3RHA A;  2FBW A;  1Y56 A;  3DJE A;  2R46 A;  1NDA A;  1PHH A;  1N4W A;  1KDG A;  4HA6 A;  4N9X A;  1H81 A;  1GER A;  2XFN A;  4J56 A;  1N1P A;  1H86 A;  1PBB A;  4FDC B;  1LJ1 A;  3AEB A;  4OPI A;  3OC4 A;  5GRT A;  2YG5 A;  3CIR A;  2IID A;  4YSH A;  3T2K A;  1H83 A;  1HYU A;  1CC4 A;  2QA2 A;  3KU9 A;  3VRA A;  4TM3 A;  2JBV A;  4EQR A;  1NEN A;  1PXB A;  2BRY A;  2CFY A;  2XVE A;  2WPF A;  2YR4 A;  3P1W A;  4JNQ A;  1EL9 A;  4KPR A;  2FJD A;  4AOS A;  2YR6 A;  2X50 A;  2VVM A;  4P9S A;  2R45 A;  4NTD A;  3CNT A;  2ACZ A;  3AE2 A;  3P4Q A;  2GMJ A;  3AEA A;  2JKC A;  1JRY A;  2BYB A;  2RGJ A;  1VG9 A;  1O5W A;  3SYI A;  5M10 A;  1GRH A;  5KOX A;  2F5Z A;  4G73 A;  1NHS A;  3CGD A;  4U8K A;  3F8R A;  3NT6 A;  1GV4 A;  3LB8 A;  3NGC X;  3LZX A;  2XFP A;  5BUK A;  3UCL A;  4CNK A;  1PBC A;  2YQU A;  2O9Z A;  1H6V A;  3G5S A;  3GDP A;  3QFB A;  4B65 A;  3RNM A;  2JB3 A;  1PXA A;  2YWL A;  3AE8 A;  1FEA A;  3T14 A;  4K5R A;  3RP7 A;  3SZC A;  1CHU A;  5KMS A;  4A99 A;  4H4P A;  2R9Z A;  4BK3 A;  4GDP A;  1VRQ B;  5EB5 A;  2VQB A;  3H8I A;  3NYF A;  4ZCD A;  1GRG A;  1IUU A;  2FJE A;  4AOX A;  4IA5 A;  5LV9 A;  4YXD A;  3Q6J A;  2JAE A;  4RG4 A;  1YQ4 A;  2X8C A;  3ATQ A;  4PAA A;  3UOX A;  3AE5 A;  3NYE A;  2WPC A;  3SZ0 A;  4A9W A;  2OAL A;  3DH9 A;  3V3N A;  4UDR A;  3AD7 B;  2IVE A;  3NN6 X;  1F8S A;  4TM0 A;  5U1O A;  4I58 A;  1N4V A;  2WU2 A;  1D4E A;  3KA7 A;  1CC2 A;  3EF6 A;  2OA1 A;  2YG4 A;  1LQU A;  1ONF A;  3LZW A;  1EL8 A;  3ZDN A;  4FK1 C;  1OJC A;  3K30 A;  3UOZ A;  1DOC A;  3G5R A;  1KSS A;  2E1M A;  3G5Q A;  3C4A A;  2BK5 A;  3SFE A;  4OPG A;  4B69 A;  3FMW A;  5GSN A;  2XVF A;  3K7T A;  4EMI A;  5KMP A;  4J36 A;  4ADW A;  4BK1 A;  2C65 A;  1RP0 A;  4JN9 A;  4BJY A;  4NZH A;  2V5Z A;  3GRT A;  1ZY8 A;  3E1T A;  4H50 A;  1JNR A;  1E39 A;  1QO8 A;  2YG3 A;  3NRN A;  1KF6 A;  2GR1 A;  1GES A;  3EPT A;  4LII A;  4EM4 A;  2WP9 A;  2XFO A;  1NHQ A;  2C3C A;  3K7Q X;  1GRT A;  1VG0 A;  2FJA A;  3GMC A;  4YSX A;  2EQ9 A;  3NK0 X;  2C70 A;  4GR1 A;  4TLZ A;  3T37 A;  4AT2 A;  4NEW A;  2NVK X;  1ZKQ A;  4H4W A;  4WX1 A;  2XLS A;  1DOB A;  4H4V A;  1LQT A;  1NG4 A;  2C67 A;  4IV9 A;  4C77 A;  4YKG A;  2YVJ A;  2YG6 A;  4YTN A;  1GT8 A;  2BRA A;  5HHF A;  3P4P A;  3IWA A;  1PN0 A;  3CGE A;  4A5L A;  3AEF A;  5KOW A;  1DNC A;  3DJG X;  5HXI A;  4LA1 A;  4JQ9 A;  1IUX A;  2BCP A;  2QAE A;  3SZF A;  1PBD A;  2YLZ A;  5L46 A;  1LV0 A;  3NH3 X;  3QFA A;  4B64 A;  4WCT A;  3UKP A;  3UP4 A;  2B9W A;  1BZL A;  4YKF A;  3I6D A;  1KFY A;  4H2N A;  1ZMC A;  1F8R A;  5C3J A;  2V61 A;  3B3R A;  4YWO A;  3AEG A;  2WBA A;  1CJ4 A;  4Z2R A;  1FEB A;  2GR0 A;  2GVC A;  4D04 A;  2XYO A;  2XLR A;  3BI2 A;  3CTY A;  5BVA A;  1E1M A;  1NEK A;  3CN8 A;  2GH5 A;  2V60 A;  5FMH A;  2R0P A;  2WOW A;  2IVD A;  3QJ4 A;  2C64 A;  4G74 A;  4U8N A;  3NIX A;  4UDQ A;  2C7G A;  2GAH B;  1ZP0 A;  1FL2 A;  1L9D A;  3AB1 A;  3NN0 X;  3AE9 A;  5C2T A;  5FS6 A;  5FS7 A;  3PS9 A;  2J3N A;  3AXB A;  5U63 A;  2XCG A;  3GSI A;  3ITJ A;  4U8L A;  5CQF A;  3S5W A;  4OPC A;  4C74 A;  2Q0L A;  1GND A;  2BS4 A;  2A87 A;  2PYX A;  4H4Y A;  4LU6 A;  3ICT A;  3NNE A;  4J2W A;  4BV6 A;  1F6M A;  1YKJ A;  2NPX A;  3ICR A;  5EBK A;  1N4U A;  3ALM A;  4ZCC A;  1B37 A;  1DJN A;  2Z5X A;  4AP1 A;  3SY4 A;  3UKF A;  1GTH A;  2BS2 A;  4U8J A;  4G9K A;  3LOV A;  4NNJ A;  2GMH A;  1B5Q A;  1CL0 A;  5DBJ A;  3L1R A;  4Z43 A;  3PO7 A;  3CNJ A;  4GCM A;  1ELI A;  5KMR A;  3AYI A;  3IF9 A;  3BNM A;  1DOE A;  3CPH G;  4EM3 A;  1K0I A;  2ZZ0 A;  3C96 A;  2WEU A;  3M0O A;  1BKW A;  4Z25 A;  2GQF A;  2X3N A;  1D4D A;  4Z24 A;  3R9U A;  4EMW A;  1PBF A;  2CDU A;  3CPJ G;  4DNA A;  4B66 A;  5KMQ A;  1JU2 A;  3F8P A;  3JSK A;  1GRE A;  2YM1 A;  5CKU A;  4Z26 A;  5EB4 A;  3HYV A;  1FEC A;  4GDE A;  3UKL A;  4B1B A;  3SXI A;  4TM1 A;  1P2E A;  1LPF A;  1YY5 A;  1OJ9 A;  2YLX A;  2GR3 A;  3NTD A;  3AE3 A;  4YTP A;  4Y4L A;  1L9E A;  2UZZ A;  3V76 A;  1H7X A;  1O95 A;  2X99 A;  1REO A;  3CNP A;  3I3L A;  4FX9 A;  4YSZ A;  2Q0K A;  2BC0 A;  3RED A;  3UOV A;  2YLT A;  5EOW A;  3SZW A;  1SEZ A;  1Y56 B;  3S61 A;  4U2S A;  4CCQ A;  4OCG A;  2R0G A;  1CJC A;  2RAB A;  4U8P A;  1KNR A;  2Q7V A;  4J33 A;  3P4S A;  4JY2 A;  4NWZ A;  2XVI A;  2YLS A;  4H2R A;  1DJQ A;  4CY8 A;  1TDN A;  1BGN A;  2EQ7 A;  4DSG A;  4NTC A;  1NG3 A;  4AP3 A;  3WE0 A;  1E1L A;  1E1K A;  2B7R A;  3AEE A;  3NKS A;  4G6H A;  4X9M A;  4XWR A;  1PJ6 A;  3IHM A;  4EIP A;  2XFU A;  4PAB A;  2WPE A;  1EL7 A;  3AE6 A;  4XWZ A;  1S2Q A;  3UP5 A;  3DME A;  2YVF A;  4G6G A;  4REK A;  5KRQ A;  2WDR A;  4IVO B;  1FCD A;  4A7A A;  2WOV A;  3DGZ A;  2ZZC A;  2YM2 A;  3HYW A;  4I59 A;  4JY3 A;  2B9Y A;  1UKV G;  1XPQ A;  3ZYX A;  1OJD A;  5JCM A;  3BHF A;  2C66 A;  3P9U A;  5FS9 A;  4BUR A;  4AT0 A;  5IQ1 A;  4ICY A;  3L8K A;  4Y4M A;  2X8H A;  4B67 A;  3HYX A;  3II4 A;  4K7Z A;  1D7Y A;  3UKH A;  2FJB A;  2C4C A;  3ABV A;  1TDO A;  4CY6 A;  4IVM B;  1TDK A;  1ZOV A;  1DOD A;  1VDC A;  1CJ3 A;  3ALL A;  3HZL A;  3AYJ A;  1S3E A;  3AE7 A;  4OVI A;  3SGL A;  2QCU A;  5ER0 A;  1JOA A;  5FS8 A;  1ZX9 A;  4A6N A;  5KNL A;  1H7W A;  1JRZ A;  3FIM B;  4JDR A;  1GTE A;  3D1C A;  4OPL A;  4U2T A;  1GRF A;  2XLT A;  3AWI A;  1CBO A;  4EQW A;  1Q1W A;  2BCG G;  3KPF A;  3SFD A;  2C73 A;  1BF3 A;  2DKI A;  3PVC A;  1KSU A;  2VQ7 A;  2OAM A;  1GXF A;  3M12 A;  3UTF A;  3M13 A;  2V3B A;  3H8L A;  4J31 A;  2V6O A;  3DK9 A;  5HY5 A;  2YAU A;  2QA1 A;  4C5O A;  3UOY A;  1E6E A;  4H2P A;  1GOS A;  4E0V A;  1IUT A;  4H4R A;  3DJJ A;  2DKH A;  4H4T A;  2R4J A;  2WQY A;  1D4C A;  2XDO A;  2YR5 A;  2XVH A;  1V59 A;  1IUS A;  1PJ7 A;  2GQW A;  4EQS A;  4H2Q A;  2B76 A;  1PS9 A;  2BAB A;  3T2Y A;  2R4E A;  3AE4 A;  1LTX R;  1NPX A;  2YLR A;  1XHC A;  1Q1R A;  3DK8 A;  3LXD A;  2Y6R A;  4KX6 A; 
#chains in the Genus database with same CATH homology
 2C75 A;  2VRM A;  4U8I A;  2GV8 A;  3NHO X;  2V3A A;  3RP6 A;  3EAN A;  1CF3 A;  3CMM A;  4H4Q A;  2GAG B;  4B68 A;  4NEV A;  3GD3 A;  4HB9 A;  1PDH A;  2GR2 A;  4CNJ A;  3NLC A;  3H4K A;  2I0Z A;  2YG7 A;  1BWC A;  3OZ2 A;  4GAP A;  3LAD A;  3D8X A;  3K7M X;  2WOI A;  2WET A;  4H4S A;  1B8S A;  3NG7 X;  3GD4 A;  4UDP A;  2ZBW A;  4YTM A;  1F3P A;  3URH A;  1K0J A;  1RYI A;  2XLP A;  1GET A;  3GWF A;  1W4X A;  4X4J A;  1YQ3 A;  1QJD A;  1TDF A;  1OJA A;  2XVJ A;  3NK1 X;  3QSM A;  1TDE A;  3KVE A;  1PJ5 A;  2C3D A;  3T0K A;  1XDI A;  1PXC A;  4A6N B;  2ARD A;  3GRS A;  4B63 A;  5IQ4 A;  3ADA B;  1EL5 A;  1CJ2 A;  4J57 A;  4DSH A;  2OLN A;  2BXR A;  3BI4 A;  3NK2 X;  1NAA A;  3GYJ A;  2JB2 A;  3QVR A;  3SM8 A;  5KXJ A;  1ZMD A;  1E7P A;  4H7U A;  2GF3 A;  1ZDL A;  4FK1 A;  3RP8 A;  2E4G A;  3Q9T A;  1JEH A;  3AD9 B;  3GYX A;  5HYM A;  3BI5 A;  2ZZB A;  4C3X A;  5KVI A;  2WU5 A;  1ZOY A;  2WDQ A;  2VVL G;  1TYT A;  3AE1 A;  3COX A;  4K5S A;  2TMD A;  3UKK A;  2H89 A;  2EQ6 A;  3DA1 A;  3IHG A;  4U8O A;  3SX6 A;  1CC6 A;  3UKA A;  3AEC A;  3GMB A;  1GRA A;  2B7S A;  2WS3 A;  3CGC A;  4RG3 A;  2HQM A;  3B6D A;  5TR3 A;  2BK3 A;  4EMJ A;  2WP5 A;  4RSL A;  5JCN A;  1AOG A;  4EQX A;  4TM4 A;  1OJT A;  2AR8 A;  2C76 A;  1RSG A;  3AYL A;  3KLJ A;  4K8D A;  3O0H A;  3QSS A;  2XFQ A;  1D5T A;  1L9C A;  1MOK A;  2E5V A;  4II3 A;  3SQP A;  3V3O A;  5BRT A;  1P2H A;  3BNU A;  3ICS A;  4D03 A;  2BK4 A;  3GYI A;  2A8X A;  5JCI A;  2A89 A;  1QLB A;  4J34 A;  4O5Q A;  1IJH A;  2VRL A;  1M6I A;  2XLU A;  2YVG A;  3CGB A;  4A79 A;  3FPZ A;  4YT0 A;  1PBE A;  2C72 A;  2WHD A;  4DGK A;  4GF7 A;  4CCR A;  1NHP A;  2X8G A;  2EQ8 A;  1DXL A;  1KNP A;  3UKQ A;  3NYC A;  3BHK A;  4OPU A;  2JK6 A;  1Q9I A;  2GB0 A;  2BC1 A;  4Z44 A;  1H82 A;  1B4V A;  4MJW A;  1E1N A;  4A65 A;  1Y0P A;  2AAQ A;  3FG2 P;  1COY A;  1TYP A;  2R0C A;  4UP3 A;  1M64 A;  3KD9 A;  2WP6 A;  1D7L A;  2OLO A;  3QVP A;  4IA6 A;  2B9X A;  4U2L A;  4ZN0 A;  1IUW A;  4ECH A;  3UTG A;  2VZ2 A;  3CND A;  4NTE A;  2CVJ A;  3VRB A;  1FOH A;  4OPD A;  1F8W A;  2Q6U A;  1MO9 A;  4APN A;  1Z6L A;  5JCK A;  3KPK A;  2VVL A;  3ALJ A;  3IC9 A;  1L0V A;  2WES A;  1IUV A;  4Z2T A;  3CPI G;  1YQZ A;  4GRT A;  4GUV A;  1S2Y A;  4USQ A;  4O5U A;  4CRT A;  2GEW A;  5J60 A;  5JCL A;  2PHH A;  5U25 A;  1K0L A;  1LVL A;  3AD8 B;  4H4X A;  5J7X A;  3T31 A;  1JNZ A;  3AED A;  1EBD A;  4Z2U A;  5KVH A;  2BS3 A;  2WDV A;  4TLX A;  4II2 A;  2Z5Y A;  3P4R A;  4Y4N A;  4H4U A;  3VQR A;  3T2Z A;  1O94 A;  3UTH A;  4U8M A;  4BJZ A;  1GAL A;  3GWD A;  4YSY A;  1TRB A;  4X9N A;  1GEU A;  1NHR A;  3KKJ A;  3ATR A;  3DK4 A;  1H84 A;  5M0Z A;  1XAN A;  3DJD A;  3VRD B;  1ZK7 A;  3C4N A;  2AQJ A;  2H88 A;  1MXT A;  2Y6Q A;  2BA9 A;  2RGO A;  1K4Q A;  2CUL A;  4CBQ A;  5IPY A;  4K2X A;  2VOU A;  3LJP A;  1GRB A;  1GSN A;  2W0H A;  2APG A;  2RGH A;  3DGH A;  3EAO A;  3ISH A;  4K22 A;  2JB1 A;  3F8D A;  4OPT A;  3CNS A;  1GPE A;  1X31 B;  1S3B A;  2BAC A;  2GRT A;  4M52 A;  3UTE A;  4USR A;  3FBS A;  4JNA A;  3VR9 A;  3NTA A;  3VR8 A;  4EIQ A;  2BXS A;  3QSE A;  4H4Z A;  4BK2 A;  3GDN A;  4C3Y A;  2YLW A;  4XXG A;  1JRX A;  1VQW A;  4GAV A;  2TPR A;  5KWF A;  1BGJ A;  5BUL A;  3RHA A;  2FBW A;  1Y56 A;  3DJE A;  2R46 A;  1NDA A;  1PHH A;  1N4W A;  1KDG A;  4HA6 A;  4N9X A;  1H81 A;  1GER A;  2XFN A;  4J56 A;  1N1P A;  1H86 A;  1PBB A;  4FDC B;  1LJ1 A;  3AEB A;  4OPI A;  3OC4 A;  5GRT A;  2YG5 A;  3CIR A;  2IID A;  4YSH A;  3T2K A;  1H83 A;  1HYU A;  1CC4 A;  2QA2 A;  3KU9 A;  3VRA A;  4TM3 A;  2JBV A;  4EQR A;  1NEN A;  1PXB A;  2BRY A;  2CFY A;  2XVE A;  2WPF A;  2YR4 A;  3P1W A;  4JNQ A;  1EL9 A;  4KPR A;  2FJD A;  4AOS A;  2YR6 A;  2X50 A;  2VVM A;  4P9S A;  2R45 A;  4NTD A;  3CNT A;  2ACZ A;  3AE2 A;  3P4Q A;  2GMJ A;  3AEA A;  2JKC A;  1JRY A;  2BYB A;  2RGJ A;  1VG9 A;  1O5W A;  3SYI A;  5M10 A;  1GRH A;  5KOX A;  2F5Z A;  4G73 A;  1NHS A;  3CGD A;  4U8K A;  3F8R A;  3NT6 A;  1GV4 A;  3LB8 A;  3NGC X;  3LZX A;  2XFP A;  5BUK A;  3UCL A;  4CNK A;  1PBC A;  2YQU A;  2O9Z A;  1H6V A;  3G5S A;  3GDP A;  3QFB A;  4B65 A;  3RNM A;  2JB3 A;  1PXA A;  2YWL A;  3AE8 A;  1FEA A;  3T14 A;  4K5R A;  3RP7 A;  3SZC A;  1CHU A;  5KMS A;  4A99 A;  4H4P A;  2R9Z A;  4BK3 A;  4GDP A;  1VRQ B;  5EB5 A;  2VQB A;  3H8I A;  3NYF A;  4ZCD A;  1GRG A;  1IUU A;  2FJE A;  4AOX A;  4IA5 A;  5LV9 A;  4YXD A;  3Q6J A;  2JAE A;  4RG4 A;  1YQ4 A;  2X8C A;  3ATQ A;  4PAA A;  3UOX A;  3AE5 A;  3NYE A;  2WPC A;  3SZ0 A;  4A9W A;  2OAL A;  3DH9 A;  3V3N A;  4UDR A;  3AD7 B;  2IVE A;  3NN6 X;  1F8S A;  4TM0 A;  5U1O A;  4I58 A;  1N4V A;  2WU2 A;  1D4E A;  3KA7 A;  1CC2 A;  3EF6 A;  2OA1 A;  2YG4 A;  1LQU A;  1ONF A;  3LZW A;  1EL8 A;  3ZDN A;  4FK1 C;  1OJC A;  3K30 A;  3UOZ A;  1DOC A;  3G5R A;  1KSS A;  2E1M A;  3G5Q A;  3C4A A;  2BK5 A;  3SFE A;  4OPG A;  4B69 A;  3FMW A;  5GSN A;  2XVF A;  3K7T A;  4EMI A;  5KMP A;  4J36 A;  4ADW A;  4BK1 A;  2C65 A;  1RP0 A;  4JN9 A;  4BJY A;  4NZH A;  2V5Z A;  3GRT A;  1ZY8 A;  3E1T A;  4H50 A;  1JNR A;  1E39 A;  1QO8 A;  2YG3 A;  3NRN A;  1KF6 A;  2GR1 A;  1GES A;  3EPT A;  4LII A;  4EM4 A;  2WP9 A;  2XFO A;  1NHQ A;  2C3C A;  3K7Q X;  1GRT A;  1VG0 A;  2FJA A;  3GMC A;  4YSX A;  2EQ9 A;  3NK0 X;  2C70 A;  4GR1 A;  4TLZ A;  3T37 A;  4AT2 A;  4NEW A;  2NVK X;  1ZKQ A;  4H4W A;  4WX1 A;  2XLS A;  1DOB A;  4H4V A;  1LQT A;  1NG4 A;  2C67 A;  4IV9 A;  4C77 A;  4YKG A;  2YVJ A;  2YG6 A;  4YTN A;  1GT8 A;  2BRA A;  5HHF A;  3P4P A;  3IWA A;  1PN0 A;  3CGE A;  4A5L A;  3AEF A;  5KOW A;  1DNC A;  3DJG X;  5HXI A;  4LA1 A;  4JQ9 A;  1IUX A;  2BCP A;  2QAE A;  3SZF A;  1PBD A;  2YLZ A;  5L46 A;  1LV0 A;  3NH3 X;  3QFA A;  4B64 A;  4WCT A;  3UKP A;  3UP4 A;  2B9W A;  1BZL A;  4YKF A;  3I6D A;  1KFY A;  4H2N A;  1ZMC A;  1F8R A;  5C3J A;  2V61 A;  3B3R A;  4YWO A;  3AEG A;  2WBA A;  1CJ4 A;  4Z2R A;  1FEB A;  2GR0 A;  2GVC A;  4D04 A;  2XYO A;  2XLR A;  3BI2 A;  3CTY A;  5BVA A;  1E1M A;  1NEK A;  3CN8 A;  2GH5 A;  2V60 A;  5FMH A;  2R0P A;  2WOW A;  2IVD A;  3QJ4 A;  2C64 A;  4G74 A;  4U8N A;  3NIX A;  4UDQ A;  2C7G A;  2GAH B;  1ZP0 A;  1FL2 A;  1L9D A;  3AB1 A;  3NN0 X;  3AE9 A;  5C2T A;  5FS6 A;  5FS7 A;  3PS9 A;  2J3N A;  3AXB A;  5U63 A;  2XCG A;  3GSI A;  3ITJ A;  4U8L A;  5CQF A;  3S5W A;  4OPC A;  4C74 A;  2Q0L A;  1GND A;  2BS4 A;  2A87 A;  2PYX A;  4H4Y A;  4LU6 A;  3ICT A;  3NNE A;  4J2W A;  4BV6 A;  1F6M A;  1YKJ A;  2NPX A;  3ICR A;  5EBK A;  1N4U A;  3ALM A;  4ZCC A;  1B37 A;  1DJN A;  2Z5X A;  4AP1 A;  3SY4 A;  3UKF A;  1GTH A;  2BS2 A;  4U8J A;  4G9K A;  3LOV A;  4NNJ A;  2GMH A;  1B5Q A;  1CL0 A;  5DBJ A;  3L1R A;  4Z43 A;  3PO7 A;  3CNJ A;  4GCM A;  1ELI A;  5KMR A;  3AYI A;  3IF9 A;  3BNM A;  1DOE A;  3CPH G;  4EM3 A;  1K0I A;  2ZZ0 A;  3C96 A;  2WEU A;  3M0O A;  1BKW A;  4Z25 A;  2GQF A;  2X3N A;  1D4D A;  4Z24 A;  3R9U A;  4EMW A;  1PBF A;  2CDU A;  3CPJ G;  4DNA A;  4B66 A;  5KMQ A;  1JU2 A;  3F8P A;  3JSK A;  1GRE A;  2YM1 A;  5CKU A;  4Z26 A;  5EB4 A;  3HYV A;  1FEC A;  4GDE A;  3UKL A;  4B1B A;  3SXI A;  4TM1 A;  1P2E A;  1LPF A;  1YY5 A;  1OJ9 A;  2YLX A;  2GR3 A;  3NTD A;  3AE3 A;  4YTP A;  4Y4L A;  1L9E A;  2UZZ A;  3V76 A;  1H7X A;  1O95 A;  2X99 A;  1REO A;  3CNP A;  3I3L A;  4FX9 A;  4YSZ A;  2Q0K A;  2BC0 A;  3RED A;  3UOV A;  2YLT A;  5EOW A;  3SZW A;  1SEZ A;  1Y56 B;  3S61 A;  4U2S A;  4CCQ A;  4OCG A;  2R0G A;  1CJC A;  2RAB A;  4U8P A;  1KNR A;  2Q7V A;  4J33 A;  3P4S A;  4JY2 A;  4NWZ A;  2XVI A;  2YLS A;  4H2R A;  1DJQ A;  4CY8 A;  1TDN A;  1BGN A;  2EQ7 A;  4DSG A;  4NTC A;  1NG3 A;  4AP3 A;  3WE0 A;  1E1L A;  1E1K A;  2B7R A;  3AEE A;  3NKS A;  4G6H A;  4X9M A;  4XWR A;  1PJ6 A;  3IHM A;  4EIP A;  2XFU A;  4PAB A;  2WPE A;  1EL7 A;  3AE6 A;  4XWZ A;  1S2Q A;  3UP5 A;  3DME A;  2YVF A;  4G6G A;  4REK A;  5KRQ A;  2WDR A;  4IVO B;  1FCD A;  4A7A A;  2WOV A;  3DGZ A;  2ZZC A;  2YM2 A;  3HYW A;  4I59 A;  4JY3 A;  2B9Y A;  1UKV G;  1XPQ A;  3ZYX A;  1OJD A;  5JCM A;  3BHF A;  2C66 A;  3P9U A;  5FS9 A;  4BUR A;  4AT0 A;  5IQ1 A;  4ICY A;  3L8K A;  4Y4M A;  2X8H A;  4B67 A;  3HYX A;  3II4 A;  4K7Z A;  1D7Y A;  3UKH A;  2FJB A;  2C4C A;  3ABV A;  1TDO A;  4CY6 A;  4IVM B;  1TDK A;  1ZOV A;  1DOD A;  1VDC A;  1CJ3 A;  3ALL A;  3HZL A;  3AYJ A;  1S3E A;  3AE7 A;  4OVI A;  3SGL A;  2QCU A;  5ER0 A;  1JOA A;  5FS8 A;  1ZX9 A;  4A6N A;  5KNL A;  1H7W A;  1JRZ A;  3FIM B;  4JDR A;  1GTE A;  3D1C A;  4OPL A;  4U2T A;  1GRF A;  2XLT A;  3AWI A;  1CBO A;  4EQW A;  1Q1W A;  2BCG G;  3KPF A;  3SFD A;  2C73 A;  1BF3 A;  2DKI A;  3PVC A;  1KSU A;  2VQ7 A;  2OAM A;  1GXF A;  3M12 A;  3UTF A;  3M13 A;  2V3B A;  3H8L A;  4J31 A;  2V6O A;  3DK9 A;  5HY5 A;  2YAU A;  2QA1 A;  4C5O A;  3UOY A;  1E6E A;  4H2P A;  1GOS A;  4E0V A;  1IUT A;  4H4R A;  3DJJ A;  2DKH A;  4H4T A;  2R4J A;  2WQY A;  1D4C A;  2XDO A;  2YR5 A;  2XVH A;  1V59 A;  1IUS A;  1PJ7 A;  2GQW A;  4EQS A;  4H2Q A;  2B76 A;  1PS9 A;  2BAB A;  3T2Y A;  2R4E A;  3AE4 A;  1LTX R;  1NPX A;  2YLR A;  1XHC A;  1Q1R A;  3DK8 A;  3LXD A;  2Y6R A;  4KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...