4G6GA

Crystal structure of ndh with trt
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
478
structure length
470
Chain Sequence
GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 151
structure length 470
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6gA00
3SYIA 4G9KA 3SZFA 4G73A 4G74A 3HYVA 3T2KA 5KMPA 3KPKA 5KMRA 3HYXA 3SZWA 3T0KA 3T2YA 3SZCA 4GAPA 3SZ0A 5KMSA 3SX6A 3SY4A 4GAVA 4G6GA 3T14A 3T2ZA 4NWZA 3SXIA 3T31A 5KMQA 3HYWA 4G6HA
chains in the Genus database with same CATH superfamily
4H4RA 3DJJA 1E7PA 1H82A 4NTCA 5M0ZA 1D5TA 3NGCX 3GRTA 4LIIA 4GF7A 3V3NA 3G5QA 3P4QA 4GR1A 1E1LA 4H4UA 3DJDA 4ICYA 4JQ9A 3KKJA 4AP1A 3AXBA 4OPLA 3GMBA 3Q6JA 4AT2A 3M12A 1JRXA 2GH5A 3CGCA 3FPZA 1ZK7A 3AD9B 3M0OA 3UOXA 3P1WA 3PS9A 4CBQA 2VRMA 3GWFA 4I59A 3SZ0A 4KX6A 5JCIA 2ZZ0A 4J31A 1IUSA 4GDEA 4Z2TA 2C67A 3NN0X 4NWZA 5GSNA 2C3DA 2DKIA 5KXJA 4LA1A 2XFPA 2R4JA 1JRYA 3SFDA 4BV6A 3COXA 3AE5A 1H7WA 2CVJA 4C3YA 3DGZA 5JCNA 4K7ZA 1JNZA 4H4PA 4H4XA 5BULA 4K22A 3P4SA 5FMHA 5C3JA 3DMEA 2NPXA 3ICSA 3AECA 5IQ4A 1O95A 2ACZA 2Q0KA 1E6EA 1PS9A 2C3CA 2R46A 2V61A 4YSYA 3ALJA 4NEWA 3UKQA 2VQ7A 3HYXA 5FS7A 4B68A 2ARDA 4USQA 1H83A 4JY3A 4A7AA 3CGDA 5ER0A 2XVJA 1NHSA 4EIPA 1NHQA 4K8DA 4U2TA 4A9WA 1VG0A 3AE8A 3EANA 3BI4A 3GYXA 3C96A 3AEFA 3PO7A 4IVOB 3K7QX 1YQ3A 3VRDB 2PYXA 2YLSA 2XFUA 4X9MA 1NHPA 5U1OA 3B3RA 1BWCA 1N1PA 1PDHA 1MOKA 2GB0A 3ATRA 3IC9A 2B9YA 2V3BA 3LOVA 2XYOA 4J36A 4I58A 2F5ZA 1EL5A 2Q7VA 3HYVA 1D4DA 1F8WA 1CC2A 2YR6A 3DJEA 4H4ZA 1SEZA 2E1MA 3IHMA 1ELIA 3EAOA 5KMRA 2YG5A 4H7UA 2GAGB 2WOIA 3AYLA 3NNEA 4J33A 2OALA 1Z6LA 2JAEA 1YKJA 3AE4A 1OJDA 4U8IA 2EQ7A 1BKWA 1PBDA 4KPRA 2X8HA 4Z2UA 1B8SA 5LV9A 3FBSA 2R45A 1GRAA 2BA9A 2XDOA 3SY4A 3H4KA 4U8JA 2WDQA 2WDRA 2XVHA 4YXDA 2WHDA 3NTAA 3T31A 2ZZBA 3FG2P 2XVIA 3I6DA 2GR3A 2WP6A 5FS8A 3FMWA 4CCQA 3C4AA 3ICTA 3ABVA 2JBVA 1K0IA 2AAQA 3NRNA 1FEAA 3CPJG 5J7XA 3RP6A 3QFAA 1W4XA 2FJDA 2WQYA 3II4A 4D04A 3VRBA 2YLWA 4GCMA 2VVLG 4GRTA 4H2PA 3UOZA 1K0JA 2V6OA 3QVPA 4D03A 2CDUA 3K30A 5BRTA 4YWOA 2A89A 3AE3A 4YKFA 2B9XA 3ZDNA 4AT0A 1Q1WA 1PBEA 1GOSA 4J57A 2C76A 2OAMA 3CNSA 3IHGA 4II3A 4B63A 2BK4A 3BHFA 1TDKA 2YLTA 4FK1C 2WU5A 3UP5A 3IF9A 4A79A 4GAVA 2BRYA 3CNDA 1OJ9A 4EQXA 3UTEA 1H84A 5BVAA 1X31B 3GD4A 3P4RA 1N4VA 3NG7X 4TM1A 3KU9A 3Q9TA 2C64A 4PAAA 3SFEA 1Y56A 3UKAA 3AD7B 1GRFA 1F8RA 3ITJA 3PVCA 3SQPA 1N4WA 4B66A 1DODA 5DBJA 1XDIA 2GRTA 4YKGA 2YG4A 2E5VA 3CGEA 4N9XA 4OPGA 4B65A 2X8CA 1OJTA 2EQ9A 1KNRA 2GR1A 2GF3A 2JB3A 2Z5YA 3NK1X 1NPXA 1PXAA 3P9UA 2VVMA 2VRLA 2YVGA 3LZWA 4J34A 3NKSA 2FJBA 4CY8A 1L9DA 4BK3A 3L8KA 4OPCA 2YG6A 2WU2A 4ECHA 3F8DA 1PXBA 3NYEA 3B6DA 3HYWA 2I0ZA 2X50A 4RSLA 3UCLA 1BF3A 4Z26A 3LADA 4EMJA 4Z25A 5U63A 4G74A 4M52A 1CF3A 3AE1A 4ADWA 4EQRA 5IPYA 2YR5A 3DK8A 4A65A 3UKKA 3ICRA 1DXLA 1ZX9A 2JB2A 2QAEA 2E4GA 5EB5A 1H7XA 1FOHA 3G5RA 1YQ4A 4U8LA 1F8SA 3T0KA 4C5OA 2TPRA 1KSUA 4OCGA 1H86A 1FECA 4BJYA 4H2QA 3LXDA 3NH3X 3O0HA 4XWZA 3UP4A 1KFYA 4UP3A 4OVIA 1L9CA 2XLPA 4UDQA 2BRAA 2YR4A 3ALLA 3KD9A 4ZN0A 1F6MA 2PHHA 4NTDA 3ALMA 3NK2X 3G5SA 4YSZA 2WPEA 1KNPA 2XCGA 2BYBA 1ONFA 1NDAA 1ZKQA 2H88A 2R0CA 2VOUA 3L1RA 3I3LA 2YVFA 4UDPA 5JCMA 1CJ3A 1K4QA 4U2LA 1NG3A 2X8GA 1DNCA 3AE7A 4H4VA 2VZ2A 4J2WA 1S3BA 3RP8A 2GR0A 2YG7A 4O5UA 2JK6A 4K2XA 2GQWA 1YY5A 2GVCA 4FDCB 2XFQA 3AE9A 2CULA 4G6GA 1L9EA 2WPCA 2YLRA 4Z44A 2JKCA 1ZY8A 1CC4A 4U8PA 2YM1A 4G6HA 3F8RA 4GUVA 4BURA 3S5WA 4G9KA 1IUVA 3OZ2A 4U8OA 2BS4A 2O9ZA 1S3EA 4NTEA 1PBFA 1DOEA 4B1BA 3D8XA 1VRQB 4EQSA 2B76A 1K0LA 2JB1A 1MO9A 1O5WA 1GALA 4AOSA 2ZBWA 1COYA 1IUXA 2BS2A 3VR8A 1BGJA 3GD3A 1P2HA 2BS3A 3AE6A 5KVIA 2B9WA 1QO8A 2X99A 2NVKX 1LV0A 2RGHA 5KMSA 4HB9A 5KOXA 2XLRA 2WPFA 4WCTA 1TDNA 1M6IA 3NLCA 2AR8A 1LVLA 1CJCA 4OPTA 1NENA 2WBAA 3SYIA 1CHUA 5BUKA 5CQFA 1GRTA 2BACA 3GSIA 3NTDA 4YTPA 1B37A 2QCUA 2C66A 1LQUA 5KOWA 2YAUA 2YQUA 1IJHA 1D4CA 2RABA 3DJGX 1EL7A 1GSNA 2XVFA 4GDPA 3NT6A 3D1CA 4IVMB 3GYJA 4FX9A 2GMJA 4JDRA 3H8LA 1S2QA 4APNA 4B64A 2A8XA 4JNAA 3DK9A 2Y6RA 4K5RA 4TLZA 1GXFA 2GR2A 3AEEA 1GPEA 1PN0A 1FL2A 1GERA 2X3NA 2IVDA 2RGJA 2XFOA 3CPHG 2XLSA 3T2ZA 4H4WA 4EMWA 4YTMA 3AEDA 3CIRA 1LPFA 3SZFA 1PBBA 5J60A 3E1TA 4IA5A 4C77A 4G73A 3ISHA 2OLOA 4DNAA 2RGOA 2WETA 1EL8A 3IWAA 4MJWA 4RG4A 5JCKA 3NN6X 3DGHA 3QSSA 1E1NA 2C75A 4C74A 3QSEA 2B7RA 1PBCA 4H50A 1E1MA 2VVLA 2YG3A 4C3XA 3GDPA 4K5SA 3NHOX 4DSGA 1JEHA 1GETA 1P2EA 4CY6A 2BXSA 1VG9A 2QA1A 4JY2A 1HYUA 2UZZA 1Y0PA 2C73A 5TR3A 4U8MA 1RSGA 4U8KA 2XVEA 4UDRA 4RG3A 5KNLA 4TM3A 1TDFA 3UTGA 2YWLA 4OPUA 1CBOA 2Q6UA 1LJ1A 2YVJA 3AWIA 4OPIA 3K7TA 4BJZA 5IQ1A 4AOXA 1GTHA 5M10A 1D7YA 4II2A 5KMPA 4Z43A 5KWFA 2WS3A 1N4UA 4U8NA 3SM8A 1M64A 1CL0A 1B4VA 2XFNA 1TDOA 2V60A 1H6VA 2XLTA 2VQBA 3AYJA 5EB4A 5HY5A 1PJ7A 1ZMDA 4DSHA 1BGNA 1O94A 5FS9A 3URHA 3LJPA 1TYPA 2AQJA 2H89A 2YLZA 3DK4A 3CGBA 3K7MX 3AEAA 3BNUA 1H81A 1B5QA 3WE0A 4A6NB 3FIMB 3M13A 2IVEA 4IV9A 4LU6A 1GT8A 3UOYA 3H8IA 2Y6QA 3CNTA 2OLNA 4H4YA 3JSKA 1NAAA 3AE2A 1XHCA 5KVHA 3T37A 1IUUA 4Y4MA 3SZCA 4TM0A 4Y4LA 1PJ6A 1S2YA 1ZOYA 3QFBA 2C72A 1CC6A 3KVEA 1GESA 1PXCA 2WDVA 4P9SA 2R9ZA 3LZXA 3SXIA 4YTNA 5C2TA 1DJQA 1GEUA 3REDA 1D4EA 2GV8A 4NZHA 5KRQA 1E1KA 3UKPA 3C4NA 1OJCA 1GRBA 2YM2A 4A5LA 3GMCA 1PHHA 3R9UA 1OJAA 3VRAA 4JN9A 4A99A 3UKHA 3ATQA 4CNJA 1QLBA 2R0PA 3CMMA 1UKVG 3QJ4A 3LB8A 4PABA 3AEBA 3V3OA 3CNJA 1VQWA 2YLXA 1LTXR 2OA1A 3AD8B 3KA7A 4CRTA 4B69A 1Q9IA 2BK3A 3AYIA 4CNKA 3NYFA 2ZZCA 4GAPA 2DKHA 2GMHA 3AB1A 4DGKA 3SX6A 4BK2A 3V76A 4E0VA 5L46A 4EQWA 3CN8A 1KDGA 2FJEA 2GQFA 4ZCDA 2TMDA 2Z5XA 3VR9A 1ZP0A 5KMQA 2BABA 2WP5A 4USRA 3EPTA 2FJAA 2BCPA 4JNQA 2CFYA 4X4JA 4U2SA 4Z2RA 2BC1A 3EF6A 1L0VA 1TRBA 4J56A 1GV4A 1GTEA 5GRTA 3KPKA 1PJ5A 3ADAB 1IUWA 5CKUA 4X9NA 3SGLA 3UTHA 3KLJA 4O5QA 4EIQA 4BK1A 4IA6A 4CCRA 2W0HA 1XPQA 1XANA 2C70A 3OC4A 1REOA 1DOBA 1VDCA 4XWRA 1EL9A 3CPIG 3HZLA 2QA2A 1IUTA 1ZDLA 1FCDA 4H2RA 3KPFA 1TYTA 2A87A 2R0GA 3RHAA 4YSHA 1BZLA 3UKFA 3CTYA 3NK0X 1KF6A 5EBKA 2APGA 2HQMA 1FEBA 1EBDA 1F3PA 4YT0A 5U25A 1YQZA 5HXIA 1JOAA 2WP9A 1NG4A 2WOVA 1GRGA 2XLUA 1MXTA 2GEWA 4WX1A 1CJ4A 2BXRA 1JNRA 1JU2A 4Y4NA 3VQRA 3ZYXA 2C7GA 3RP7A 3T2YA 4AP3A 2BC0A 2EQ6A 3BHKA 3BNMA 3UKLA 1GREA 1RYIA 2Q0LA 5EOWA 3DA1A 5HYMA 1D7LA 2EQ8A 2C65A 1KSSA 3QVRA 4B67A 4YSXA 5JCLA 4EMIA 3BI2A 4NEVA 3S61A 1AOGA 3T14A 1DJNA 1E39A 1V59A 3NIXA 4H4TA 4FK1A 1DOCA 2J3NA 3UTFA 1GNDA 1TDEA 1RP0A 4Z24A 2BK5A 4HA6A 1GRHA 5FS6A 2V5ZA 3BI5A 4REKA 4EM3A 3GWDA 3UOVA 3T2KA 4OPDA 2B7SA 4XXGA 1Q1RA 3P4PA 3QSMA 2WEUA 1JRZA 3GDNA 4H4SA 2WOWA 4TLXA 5HHFA 3SZWA 3NYCA 3CNPA 3GRSA 4NNJA 4TM4A 4A6NA 1NEKA 3GYIA 2WESA 1Y56B 4EM4A 3AEGA 2BCGG 4ZCCA 2FBWA 4H4QA 2GAHB 3DH9A 1QJDA 1LQTA 1CJ2A 1NHRA 1ZMCA 2C4CA 2V3AA 2IIDA 4H2NA 3RNMA 3F8PA 2R4EA 1ZOVA
chains in the Genus database with same CATH topology
4H4RA 3DJJA 1E7PA 1H82A 4NTCA 5M0ZA 1D5TA 3NGCX 3GRTA 4LIIA 4GF7A 3V3NA 3G5QA 3P4QA 4GR1A 1E1LA 4H4UA 3DJDA 4ICYA 4JQ9A 3KKJA 4AP1A 3AXBA 4OPLA 3GMBA 3Q6JA 4AT2A 3M12A 1JRXA 2GH5A 3CGCA 3FPZA 1ZK7A 3AD9B 3M0OA 3UOXA 3P1WA 3PS9A 4CBQA 2VRMA 3GWFA 4I59A 3SZ0A 4KX6A 5JCIA 2ZZ0A 4J31A 1IUSA 4GDEA 4Z2TA 2C67A 3NN0X 4NWZA 5GSNA 2C3DA 2DKIA 5KXJA 4LA1A 2XFPA 2R4JA 1JRYA 3SFDA 4BV6A 3COXA 3AE5A 1H7WA 2CVJA 4C3YA 3DGZA 5JCNA 4K7ZA 1JNZA 4H4PA 4H4XA 5BULA 4K22A 3P4SA 5FMHA 5C3JA 3DMEA 2NPXA 3ICSA 3AECA 5IQ4A 1O95A 2ACZA 2Q0KA 1E6EA 1PS9A 2C3CA 2R46A 2V61A 4YSYA 3ALJA 4NEWA 3UKQA 2VQ7A 3HYXA 5FS7A 4B68A 2ARDA 4USQA 1H83A 4JY3A 4A7AA 3CGDA 5ER0A 2XVJA 1NHSA 4EIPA 1NHQA 4K8DA 4U2TA 4A9WA 1VG0A 3AE8A 3EANA 3BI4A 3GYXA 3C96A 3AEFA 3PO7A 4IVOB 3K7QX 1YQ3A 3VRDB 2PYXA 2YLSA 2XFUA 4X9MA 1NHPA 5U1OA 3B3RA 1BWCA 1N1PA 1PDHA 1MOKA 2GB0A 3ATRA 3IC9A 2B9YA 2V3BA 3LOVA 2XYOA 4J36A 4I58A 2F5ZA 1EL5A 2Q7VA 3HYVA 1D4DA 1F8WA 1CC2A 2YR6A 3DJEA 4H4ZA 1SEZA 2E1MA 3IHMA 1ELIA 3EAOA 5KMRA 2YG5A 4H7UA 2GAGB 2WOIA 3AYLA 3NNEA 4J33A 2OALA 1Z6LA 2JAEA 1YKJA 3AE4A 1OJDA 4U8IA 2EQ7A 1BKWA 1PBDA 4KPRA 2X8HA 4Z2UA 1B8SA 5LV9A 3FBSA 2R45A 1GRAA 2BA9A 2XDOA 3SY4A 3H4KA 4U8JA 2WDQA 2WDRA 2XVHA 4YXDA 2WHDA 3NTAA 3T31A 2ZZBA 3FG2P 2XVIA 3I6DA 2GR3A 2WP6A 5FS8A 3FMWA 4CCQA 3C4AA 3ICTA 3ABVA 2JBVA 1K0IA 2AAQA 3NRNA 1FEAA 3CPJG 5J7XA 3RP6A 3QFAA 1W4XA 2FJDA 2WQYA 3II4A 4D04A 3VRBA 2YLWA 4GCMA 2VVLG 4GRTA 4H2PA 3UOZA 1K0JA 2V6OA 3QVPA 4D03A 2CDUA 3K30A 5BRTA 4YWOA 2A89A 3AE3A 4YKFA 2B9XA 3ZDNA 4AT0A 1Q1WA 1PBEA 1GOSA 4J57A 2C76A 2OAMA 3CNSA 3IHGA 4II3A 4B63A 2BK4A 3BHFA 1TDKA 2YLTA 4FK1C 2WU5A 3UP5A 3IF9A 4A79A 4GAVA 2BRYA 3CNDA 1OJ9A 4EQXA 3UTEA 1H84A 5BVAA 1X31B 3GD4A 3P4RA 1N4VA 3NG7X 4TM1A 3KU9A 3Q9TA 2C64A 4PAAA 3SFEA 1Y56A 3UKAA 3AD7B 1GRFA 1F8RA 3ITJA 3PVCA 3SQPA 1N4WA 4B66A 1DODA 5DBJA 1XDIA 2GRTA 4YKGA 2YG4A 2E5VA 3CGEA 4N9XA 4OPGA 4B65A 2X8CA 1OJTA 2EQ9A 1KNRA 2GR1A 2GF3A 2JB3A 2Z5YA 3NK1X 1NPXA 1PXAA 3P9UA 2VVMA 2VRLA 2YVGA 3LZWA 4J34A 3NKSA 2FJBA 4CY8A 1L9DA 4BK3A 3L8KA 4OPCA 2YG6A 2WU2A 4ECHA 3F8DA 1PXBA 3NYEA 3B6DA 3HYWA 2I0ZA 2X50A 4RSLA 3UCLA 1BF3A 4Z26A 3LADA 4EMJA 4Z25A 5U63A 4G74A 4M52A 1CF3A 3AE1A 4ADWA 4EQRA 5IPYA 2YR5A 3DK8A 4A65A 3UKKA 3ICRA 1DXLA 1ZX9A 2JB2A 2QAEA 2E4GA 5EB5A 1H7XA 1FOHA 3G5RA 1YQ4A 4U8LA 1F8SA 3T0KA 4C5OA 2TPRA 1KSUA 4OCGA 1H86A 1FECA 4BJYA 4H2QA 3LXDA 3NH3X 3O0HA 4XWZA 3UP4A 1KFYA 4UP3A 4OVIA 1L9CA 2XLPA 4UDQA 2BRAA 2YR4A 3ALLA 3KD9A 4ZN0A 1F6MA 2PHHA 4NTDA 3ALMA 3NK2X 3G5SA 4YSZA 2WPEA 1KNPA 2XCGA 2BYBA 1ONFA 1NDAA 1ZKQA 2H88A 2R0CA 2VOUA 3L1RA 3I3LA 2YVFA 4UDPA 5JCMA 1CJ3A 1K4QA 4U2LA 1NG3A 2X8GA 1DNCA 3AE7A 4H4VA 2VZ2A 4J2WA 1S3BA 3RP8A 2GR0A 2YG7A 4O5UA 2JK6A 4K2XA 2GQWA 1YY5A 2GVCA 4FDCB 2XFQA 3AE9A 2CULA 4G6GA 1L9EA 2WPCA 2YLRA 4Z44A 2JKCA 1ZY8A 1CC4A 4U8PA 2YM1A 4G6HA 3F8RA 4GUVA 4BURA 3S5WA 4G9KA 1IUVA 3OZ2A 4U8OA 2BS4A 2O9ZA 1S3EA 4NTEA 1PBFA 1DOEA 4B1BA 3D8XA 1VRQB 4EQSA 2B76A 1K0LA 2JB1A 1MO9A 1O5WA 1GALA 4AOSA 2ZBWA 1COYA 1IUXA 2BS2A 3VR8A 1BGJA 3GD3A 1P2HA 2BS3A 3AE6A 5KVIA 2B9WA 1QO8A 2X99A 2NVKX 1LV0A 2RGHA 5KMSA 4HB9A 5KOXA 2XLRA 2WPFA 4WCTA 1TDNA 1M6IA 3NLCA 2AR8A 1LVLA 1CJCA 4OPTA 1NENA 2WBAA 3SYIA 1CHUA 5BUKA 5CQFA 1GRTA 2BACA 3GSIA 3NTDA 4YTPA 1B37A 2QCUA 2C66A 1LQUA 5KOWA 2YAUA 2YQUA 1IJHA 1D4CA 2RABA 3DJGX 1EL7A 1GSNA 2XVFA 4GDPA 3NT6A 3D1CA 4IVMB 3GYJA 4FX9A 2GMJA 4JDRA 3H8LA 1S2QA 4APNA 4B64A 2A8XA 4JNAA 3DK9A 2Y6RA 4K5RA 4TLZA 1GXFA 2GR2A 3AEEA 1GPEA 1PN0A 1FL2A 1GERA 2X3NA 2IVDA 2RGJA 2XFOA 3CPHG 2XLSA 3T2ZA 4H4WA 4EMWA 4YTMA 3AEDA 3CIRA 1LPFA 3SZFA 1PBBA 5J60A 3E1TA 4IA5A 4C77A 4G73A 3ISHA 2OLOA 4DNAA 2RGOA 2WETA 1EL8A 3IWAA 4MJWA 4RG4A 5JCKA 3NN6X 3DGHA 3QSSA 1E1NA 2C75A 4C74A 3QSEA 2B7RA 1PBCA 4H50A 1E1MA 2VVLA 2YG3A 4C3XA 3GDPA 4K5SA 3NHOX 4DSGA 1JEHA 1GETA 1P2EA 4CY6A 2BXSA 1VG9A 2QA1A 4JY2A 1HYUA 2UZZA 1Y0PA 2C73A 5TR3A 4U8MA 1RSGA 4U8KA 2XVEA 4UDRA 4RG3A 5KNLA 4TM3A 1TDFA 3UTGA 2YWLA 4OPUA 1CBOA 2Q6UA 1LJ1A 2YVJA 3AWIA 4OPIA 3K7TA 4BJZA 5IQ1A 4AOXA 1GTHA 5M10A 1D7YA 4II2A 5KMPA 4Z43A 5KWFA 2WS3A 1N4UA 4U8NA 3SM8A 1M64A 1CL0A 1B4VA 2XFNA 1TDOA 2V60A 1H6VA 2XLTA 2VQBA 3AYJA 5EB4A 5HY5A 1PJ7A 1ZMDA 4DSHA 1BGNA 1O94A 5FS9A 3URHA 3LJPA 1TYPA 2AQJA 2H89A 2YLZA 3DK4A 3CGBA 3K7MX 3AEAA 3BNUA 1H81A 1B5QA 3WE0A 4A6NB 3FIMB 3M13A 2IVEA 4IV9A 4LU6A 1GT8A 3UOYA 3H8IA 2Y6QA 3CNTA 2OLNA 4H4YA 3JSKA 1NAAA 3AE2A 1XHCA 5KVHA 3T37A 1IUUA 4Y4MA 3SZCA 4TM0A 4Y4LA 1PJ6A 1S2YA 1ZOYA 3QFBA 2C72A 1CC6A 3KVEA 1GESA 1PXCA 2WDVA 4P9SA 2R9ZA 3LZXA 3SXIA 4YTNA 5C2TA 1DJQA 1GEUA 3REDA 1D4EA 2GV8A 4NZHA 5KRQA 1E1KA 3UKPA 3C4NA 1OJCA 1GRBA 2YM2A 4A5LA 3GMCA 1PHHA 3R9UA 1OJAA 3VRAA 4JN9A 4A99A 3UKHA 3ATQA 4CNJA 1QLBA 2R0PA 3CMMA 1UKVG 3QJ4A 3LB8A 4PABA 3AEBA 3V3OA 3CNJA 1VQWA 2YLXA 1LTXR 2OA1A 3AD8B 3KA7A 4CRTA 4B69A 1Q9IA 2BK3A 3AYIA 4CNKA 3NYFA 2ZZCA 4GAPA 2DKHA 2GMHA 3AB1A 4DGKA 3SX6A 4BK2A 3V76A 4E0VA 5L46A 4EQWA 3CN8A 1KDGA 2FJEA 2GQFA 4ZCDA 2TMDA 2Z5XA 3VR9A 1ZP0A 5KMQA 2BABA 2WP5A 4USRA 3EPTA 2FJAA 2BCPA 4JNQA 2CFYA 4X4JA 4U2SA 4Z2RA 2BC1A 3EF6A 1L0VA 1TRBA 4J56A 1GV4A 1GTEA 5GRTA 3KPKA 1PJ5A 3ADAB 1IUWA 5CKUA 4X9NA 3SGLA 3UTHA 3KLJA 4O5QA 4EIQA 4BK1A 4IA6A 4CCRA 2W0HA 1XPQA 1XANA 2C70A 3OC4A 1REOA 1DOBA 1VDCA 4XWRA 1EL9A 3CPIG 3HZLA 2QA2A 1IUTA 1ZDLA 1FCDA 4H2RA 3KPFA 1TYTA 2A87A 2R0GA 3RHAA 4YSHA 1BZLA 3UKFA 3CTYA 3NK0X 1KF6A 5EBKA 2APGA 2HQMA 1FEBA 1EBDA 1F3PA 4YT0A 5U25A 1YQZA 5HXIA 1JOAA 2WP9A 1NG4A 2WOVA 1GRGA 2XLUA 1MXTA 2GEWA 4WX1A 1CJ4A 2BXRA 1JNRA 1JU2A 4Y4NA 3VQRA 3ZYXA 2C7GA 3RP7A 3T2YA 4AP3A 2BC0A 2EQ6A 3BHKA 3BNMA 3UKLA 1GREA 1RYIA 2Q0LA 5EOWA 3DA1A 5HYMA 1D7LA 2EQ8A 2C65A 1KSSA 3QVRA 4B67A 4YSXA 5JCLA 4EMIA 3BI2A 4NEVA 3S61A 1AOGA 3T14A 1DJNA 1E39A 1V59A 3NIXA 4H4TA 4FK1A 1DOCA 2J3NA 3UTFA 1GNDA 1TDEA 1RP0A 4Z24A 2BK5A 4HA6A 1GRHA 5FS6A 2V5ZA 3BI5A 4REKA 4EM3A 3GWDA 3UOVA 3T2KA 4OPDA 2B7SA 4XXGA 1Q1RA 3P4PA 3QSMA 2WEUA 1JRZA 3GDNA 4H4SA 2WOWA 4TLXA 5HHFA 3SZWA 3NYCA 3CNPA 3GRSA 4NNJA 4TM4A 4A6NA 1NEKA 3GYIA 2WESA 1Y56B 4EM4A 3AEGA 2BCGG 4ZCCA 2FBWA 4H4QA 2GAHB 3DH9A 1QJDA 1LQTA 1CJ2A 1NHRA 1ZMCA 2C4CA 2V3AA 2IIDA 4H2NA 3RNMA 3F8PA 2R4EA 1ZOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYI A;  4G9K A;  3SZF A;  4G73 A;  4G74 A;  3HYV A;  3T2K A;  5KMP A;  3KPK A;  5KMR A;  3HYX A;  3SZW A;  3T0K A;  3T2Y A;  3SZC A;  4GAP A;  3SZ0 A;  5KMS A;  3SX6 A;  3SY4 A;  4GAV A;  4G6G A;  3T14 A;  3T2Z A;  4NWZ A;  3SXI A;  3T31 A;  5KMQ A;  3HYW A;  4G6H A; 
#chains in the Genus database with same CATH topology
 4H4R A;  3DJJ A;  1E7P A;  1H82 A;  4NTC A;  5M0Z A;  1D5T A;  3NGC X;  3GRT A;  4LII A;  4GF7 A;  3V3N A;  3G5Q A;  3P4Q A;  4GR1 A;  1E1L A;  4H4U A;  3DJD A;  4ICY A;  4JQ9 A;  3KKJ A;  4AP1 A;  3AXB A;  4OPL A;  3GMB A;  3Q6J A;  4AT2 A;  3M12 A;  1JRX A;  2GH5 A;  3CGC A;  3FPZ A;  1ZK7 A;  3AD9 B;  3M0O A;  3UOX A;  3P1W A;  3PS9 A;  4CBQ A;  2VRM A;  3GWF A;  4I59 A;  3SZ0 A;  4KX6 A;  5JCI A;  2ZZ0 A;  4J31 A;  1IUS A;  4GDE A;  4Z2T A;  2C67 A;  3NN0 X;  4NWZ A;  5GSN A;  2C3D A;  2DKI A;  5KXJ A;  4LA1 A;  2XFP A;  2R4J A;  1JRY A;  3SFD A;  4BV6 A;  3COX A;  3AE5 A;  1H7W A;  2CVJ A;  4C3Y A;  3DGZ A;  5JCN A;  4K7Z A;  1JNZ A;  4H4P A;  4H4X A;  5BUL A;  4K22 A;  3P4S A;  5FMH A;  5C3J A;  3DME A;  2NPX A;  3ICS A;  3AEC A;  5IQ4 A;  1O95 A;  2ACZ A;  2Q0K A;  1E6E A;  1PS9 A;  2C3C A;  2R46 A;  2V61 A;  4YSY A;  3ALJ A;  4NEW A;  3UKQ A;  2VQ7 A;  3HYX A;  5FS7 A;  4B68 A;  2ARD A;  4USQ A;  1H83 A;  4JY3 A;  4A7A A;  3CGD A;  5ER0 A;  2XVJ A;  1NHS A;  4EIP A;  1NHQ A;  4K8D A;  4U2T A;  4A9W A;  1VG0 A;  3AE8 A;  3EAN A;  3BI4 A;  3GYX A;  3C96 A;  3AEF A;  3PO7 A;  4IVO B;  3K7Q X;  1YQ3 A;  3VRD B;  2PYX A;  2YLS A;  2XFU A;  4X9M A;  1NHP A;  5U1O A;  3B3R A;  1BWC A;  1N1P A;  1PDH A;  1MOK A;  2GB0 A;  3ATR A;  3IC9 A;  2B9Y A;  2V3B A;  3LOV A;  2XYO A;  4J36 A;  4I58 A;  2F5Z A;  1EL5 A;  2Q7V A;  3HYV A;  1D4D A;  1F8W A;  1CC2 A;  2YR6 A;  3DJE A;  4H4Z A;  1SEZ A;  2E1M A;  3IHM A;  1ELI A;  3EAO A;  5KMR A;  2YG5 A;  4H7U A;  2GAG B;  2WOI A;  3AYL A;  3NNE A;  4J33 A;  2OAL A;  1Z6L A;  2JAE A;  1YKJ A;  3AE4 A;  1OJD A;  4U8I A;  2EQ7 A;  1BKW A;  1PBD A;  4KPR A;  2X8H A;  4Z2U A;  1B8S A;  5LV9 A;  3FBS A;  2R45 A;  1GRA A;  2BA9 A;  2XDO A;  3SY4 A;  3H4K A;  4U8J A;  2WDQ A;  2WDR A;  2XVH A;  4YXD A;  2WHD A;  3NTA A;  3T31 A;  2ZZB A;  3FG2 P;  2XVI A;  3I6D A;  2GR3 A;  2WP6 A;  5FS8 A;  3FMW A;  4CCQ A;  3C4A A;  3ICT A;  3ABV A;  2JBV A;  1K0I A;  2AAQ A;  3NRN A;  1FEA A;  3CPJ G;  5J7X A;  3RP6 A;  3QFA A;  1W4X A;  2FJD A;  2WQY A;  3II4 A;  4D04 A;  3VRB A;  2YLW A;  4GCM A;  2VVL G;  4GRT A;  4H2P A;  3UOZ A;  1K0J A;  2V6O A;  3QVP A;  4D03 A;  2CDU A;  3K30 A;  5BRT A;  4YWO A;  2A89 A;  3AE3 A;  4YKF A;  2B9X A;  3ZDN A;  4AT0 A;  1Q1W A;  1PBE A;  1GOS A;  4J57 A;  2C76 A;  2OAM A;  3CNS A;  3IHG A;  4II3 A;  4B63 A;  2BK4 A;  3BHF A;  1TDK A;  2YLT A;  4FK1 C;  2WU5 A;  3UP5 A;  3IF9 A;  4A79 A;  4GAV A;  2BRY A;  3CND A;  1OJ9 A;  4EQX A;  3UTE A;  1H84 A;  5BVA A;  1X31 B;  3GD4 A;  3P4R A;  1N4V A;  3NG7 X;  4TM1 A;  3KU9 A;  3Q9T A;  2C64 A;  4PAA A;  3SFE A;  1Y56 A;  3UKA A;  3AD7 B;  1GRF A;  1F8R A;  3ITJ A;  3PVC A;  3SQP A;  1N4W A;  4B66 A;  1DOD A;  5DBJ A;  1XDI A;  2GRT A;  4YKG A;  2YG4 A;  2E5V A;  3CGE A;  4N9X A;  4OPG A;  4B65 A;  2X8C A;  1OJT A;  2EQ9 A;  1KNR A;  2GR1 A;  2GF3 A;  2JB3 A;  2Z5Y A;  3NK1 X;  1NPX A;  1PXA A;  3P9U A;  2VVM A;  2VRL A;  2YVG A;  3LZW A;  4J34 A;  3NKS A;  2FJB A;  4CY8 A;  1L9D A;  4BK3 A;  3L8K A;  4OPC A;  2YG6 A;  2WU2 A;  4ECH A;  3F8D A;  1PXB A;  3NYE A;  3B6D A;  3HYW A;  2I0Z A;  2X50 A;  4RSL A;  3UCL A;  1BF3 A;  4Z26 A;  3LAD A;  4EMJ A;  4Z25 A;  5U63 A;  4G74 A;  4M52 A;  1CF3 A;  3AE1 A;  4ADW A;  4EQR A;  5IPY A;  2YR5 A;  3DK8 A;  4A65 A;  3UKK A;  3ICR A;  1DXL A;  1ZX9 A;  2JB2 A;  2QAE A;  2E4G A;  5EB5 A;  1H7X A;  1FOH A;  3G5R A;  1YQ4 A;  4U8L A;  1F8S A;  3T0K A;  4C5O A;  2TPR A;  1KSU A;  4OCG A;  1H86 A;  1FEC A;  4BJY A;  4H2Q A;  3LXD A;  3NH3 X;  3O0H A;  4XWZ A;  3UP4 A;  1KFY A;  4UP3 A;  4OVI A;  1L9C A;  2XLP A;  4UDQ A;  2BRA A;  2YR4 A;  3ALL A;  3KD9 A;  4ZN0 A;  1F6M A;  2PHH A;  4NTD A;  3ALM A;  3NK2 X;  3G5S A;  4YSZ A;  2WPE A;  1KNP A;  2XCG A;  2BYB A;  1ONF A;  1NDA A;  1ZKQ A;  2H88 A;  2R0C A;  2VOU A;  3L1R A;  3I3L A;  2YVF A;  4UDP A;  5JCM A;  1CJ3 A;  1K4Q A;  4U2L A;  1NG3 A;  2X8G A;  1DNC A;  3AE7 A;  4H4V A;  2VZ2 A;  4J2W A;  1S3B A;  3RP8 A;  2GR0 A;  2YG7 A;  4O5U A;  2JK6 A;  4K2X A;  2GQW A;  1YY5 A;  2GVC A;  4FDC B;  2XFQ A;  3AE9 A;  2CUL A;  4G6G A;  1L9E A;  2WPC A;  2YLR A;  4Z44 A;  2JKC A;  1ZY8 A;  1CC4 A;  4U8P A;  2YM1 A;  4G6H A;  3F8R A;  4GUV A;  4BUR A;  3S5W A;  4G9K A;  1IUV A;  3OZ2 A;  4U8O A;  2BS4 A;  2O9Z A;  1S3E A;  4NTE A;  1PBF A;  1DOE A;  4B1B A;  3D8X A;  1VRQ B;  4EQS A;  2B76 A;  1K0L A;  2JB1 A;  1MO9 A;  1O5W A;  1GAL A;  4AOS A;  2ZBW A;  1COY A;  1IUX A;  2BS2 A;  3VR8 A;  1BGJ A;  3GD3 A;  1P2H A;  2BS3 A;  3AE6 A;  5KVI A;  2B9W A;  1QO8 A;  2X99 A;  2NVK X;  1LV0 A;  2RGH A;  5KMS A;  4HB9 A;  5KOX A;  2XLR A;  2WPF A;  4WCT A;  1TDN A;  1M6I A;  3NLC A;  2AR8 A;  1LVL A;  1CJC A;  4OPT A;  1NEN A;  2WBA A;  3SYI A;  1CHU A;  5BUK A;  5CQF A;  1GRT A;  2BAC A;  3GSI A;  3NTD A;  4YTP A;  1B37 A;  2QCU A;  2C66 A;  1LQU A;  5KOW A;  2YAU A;  2YQU A;  1IJH A;  1D4C A;  2RAB A;  3DJG X;  1EL7 A;  1GSN A;  2XVF A;  4GDP A;  3NT6 A;  3D1C A;  4IVM B;  3GYJ A;  4FX9 A;  2GMJ A;  4JDR A;  3H8L A;  1S2Q A;  4APN A;  4B64 A;  2A8X A;  4JNA A;  3DK9 A;  2Y6R A;  4K5R A;  4TLZ A;  1GXF A;  2GR2 A;  3AEE A;  1GPE A;  1PN0 A;  1FL2 A;  1GER A;  2X3N A;  2IVD A;  2RGJ A;  2XFO A;  3CPH G;  2XLS A;  3T2Z A;  4H4W A;  4EMW A;  4YTM A;  3AED A;  3CIR A;  1LPF A;  3SZF A;  1PBB A;  5J60 A;  3E1T A;  4IA5 A;  4C77 A;  4G73 A;  3ISH A;  2OLO A;  4DNA A;  2RGO A;  2WET A;  1EL8 A;  3IWA A;  4MJW A;  4RG4 A;  5JCK A;  3NN6 X;  3DGH A;  3QSS A;  1E1N A;  2C75 A;  4C74 A;  3QSE A;  2B7R A;  1PBC A;  4H50 A;  1E1M A;  2VVL A;  2YG3 A;  4C3X A;  3GDP A;  4K5S A;  3NHO X;  4DSG A;  1JEH A;  1GET A;  1P2E A;  4CY6 A;  2BXS A;  1VG9 A;  2QA1 A;  4JY2 A;  1HYU A;  2UZZ A;  1Y0P A;  2C73 A;  5TR3 A;  4U8M A;  1RSG A;  4U8K A;  2XVE A;  4UDR A;  4RG3 A;  5KNL A;  4TM3 A;  1TDF A;  3UTG A;  2YWL A;  4OPU A;  1CBO A;  2Q6U A;  1LJ1 A;  2YVJ A;  3AWI A;  4OPI A;  3K7T A;  4BJZ A;  5IQ1 A;  4AOX A;  1GTH A;  5M10 A;  1D7Y A;  4II2 A;  5KMP A;  4Z43 A;  5KWF A;  2WS3 A;  1N4U A;  4U8N A;  3SM8 A;  1M64 A;  1CL0 A;  1B4V A;  2XFN A;  1TDO A;  2V60 A;  1H6V A;  2XLT A;  2VQB A;  3AYJ A;  5EB4 A;  5HY5 A;  1PJ7 A;  1ZMD A;  4DSH A;  1BGN A;  1O94 A;  5FS9 A;  3URH A;  3LJP A;  1TYP A;  2AQJ A;  2H89 A;  2YLZ A;  3DK4 A;  3CGB A;  3K7M X;  3AEA A;  3BNU A;  1H81 A;  1B5Q A;  3WE0 A;  4A6N B;  3FIM B;  3M13 A;  2IVE A;  4IV9 A;  4LU6 A;  1GT8 A;  3UOY A;  3H8I A;  2Y6Q A;  3CNT A;  2OLN A;  4H4Y A;  3JSK A;  1NAA A;  3AE2 A;  1XHC A;  5KVH A;  3T37 A;  1IUU A;  4Y4M A;  3SZC A;  4TM0 A;  4Y4L A;  1PJ6 A;  1S2Y A;  1ZOY A;  3QFB A;  2C72 A;  1CC6 A;  3KVE A;  1GES A;  1PXC A;  2WDV A;  4P9S A;  2R9Z A;  3LZX A;  3SXI A;  4YTN A;  5C2T A;  1DJQ A;  1GEU A;  3RED A;  1D4E A;  2GV8 A;  4NZH A;  5KRQ A;  1E1K A;  3UKP A;  3C4N A;  1OJC A;  1GRB A;  2YM2 A;  4A5L A;  3GMC A;  1PHH A;  3R9U A;  1OJA A;  3VRA A;  4JN9 A;  4A99 A;  3UKH A;  3ATQ A;  4CNJ A;  1QLB A;  2R0P A;  3CMM A;  1UKV G;  3QJ4 A;  3LB8 A;  4PAB A;  3AEB A;  3V3O A;  3CNJ A;  1VQW A;  2YLX A;  1LTX R;  2OA1 A;  3AD8 B;  3KA7 A;  4CRT A;  4B69 A;  1Q9I A;  2BK3 A;  3AYI A;  4CNK A;  3NYF A;  2ZZC A;  4GAP A;  2DKH A;  2GMH A;  3AB1 A;  4DGK A;  3SX6 A;  4BK2 A;  3V76 A;  4E0V A;  5L46 A;  4EQW A;  3CN8 A;  1KDG A;  2FJE A;  2GQF A;  4ZCD A;  2TMD A;  2Z5X A;  3VR9 A;  1ZP0 A;  5KMQ A;  2BAB A;  2WP5 A;  4USR A;  3EPT A;  2FJA A;  2BCP A;  4JNQ A;  2CFY A;  4X4J A;  4U2S A;  4Z2R A;  2BC1 A;  3EF6 A;  1L0V A;  1TRB A;  4J56 A;  1GV4 A;  1GTE A;  5GRT A;  3KPK A;  1PJ5 A;  3ADA B;  1IUW A;  5CKU A;  4X9N A;  3SGL A;  3UTH A;  3KLJ A;  4O5Q A;  4EIQ A;  4BK1 A;  4IA6 A;  4CCR A;  2W0H A;  1XPQ A;  1XAN A;  2C70 A;  3OC4 A;  1REO A;  1DOB A;  1VDC A;  4XWR A;  1EL9 A;  3CPI G;  3HZL A;  2QA2 A;  1IUT A;  1ZDL A;  1FCD A;  4H2R A;  3KPF A;  1TYT A;  2A87 A;  2R0G A;  3RHA A;  4YSH A;  1BZL A;  3UKF A;  3CTY A;  3NK0 X;  1KF6 A;  5EBK A;  2APG A;  2HQM A;  1FEB A;  1EBD A;  1F3P A;  4YT0 A;  5U25 A;  1YQZ A;  5HXI A;  1JOA A;  2WP9 A;  1NG4 A;  2WOV A;  1GRG A;  2XLU A;  1MXT A;  2GEW A;  4WX1 A;  1CJ4 A;  2BXR A;  1JNR A;  1JU2 A;  4Y4N A;  3VQR A;  3ZYX A;  2C7G A;  3RP7 A;  3T2Y A;  4AP3 A;  2BC0 A;  2EQ6 A;  3BHK A;  3BNM A;  3UKL A;  1GRE A;  1RYI A;  2Q0L A;  5EOW A;  3DA1 A;  5HYM A;  1D7L A;  2EQ8 A;  2C65 A;  1KSS A;  3QVR A;  4B67 A;  4YSX A;  5JCL A;  4EMI A;  3BI2 A;  4NEV A;  3S61 A;  1AOG A;  3T14 A;  1DJN A;  1E39 A;  1V59 A;  3NIX A;  4H4T A;  4FK1 A;  1DOC A;  2J3N A;  3UTF A;  1GND A;  1TDE A;  1RP0 A;  4Z24 A;  2BK5 A;  4HA6 A;  1GRH A;  5FS6 A;  2V5Z A;  3BI5 A;  4REK A;  4EM3 A;  3GWD A;  3UOV A;  3T2K A;  4OPD A;  2B7S A;  4XXG A;  1Q1R A;  3P4P A;  3QSM A;  2WEU A;  1JRZ A;  3GDN A;  4H4S A;  2WOW A;  4TLX A;  5HHF A;  3SZW A;  3NYC A;  3CNP A;  3GRS A;  4NNJ A;  4TM4 A;  4A6N A;  1NEK A;  3GYI A;  2WES A;  1Y56 B;  4EM4 A;  3AEG A;  2BCG G;  4ZCC A;  2FBW A;  4H4Q A;  2GAH B;  3DH9 A;  1QJD A;  1LQT A;  1CJ2 A;  1NHR A;  1ZMC A;  2C4C A;  2V3A A;  2IID A;  4H2N A;  3RNM A;  3F8P A;  2R4E A;  1ZOV A; 
#chains in the Genus database with same CATH homology
 4H4R A;  3DJJ A;  1E7P A;  1H82 A;  4NTC A;  5M0Z A;  1D5T A;  3NGC X;  3GRT A;  4LII A;  4GF7 A;  3V3N A;  3G5Q A;  3P4Q A;  4GR1 A;  1E1L A;  4H4U A;  3DJD A;  4ICY A;  4JQ9 A;  3KKJ A;  4AP1 A;  3AXB A;  4OPL A;  3GMB A;  3Q6J A;  4AT2 A;  3M12 A;  1JRX A;  2GH5 A;  3CGC A;  3FPZ A;  1ZK7 A;  3AD9 B;  3M0O A;  3UOX A;  3P1W A;  3PS9 A;  4CBQ A;  2VRM A;  3GWF A;  4I59 A;  3SZ0 A;  4KX6 A;  5JCI A;  2ZZ0 A;  4J31 A;  1IUS A;  4GDE A;  4Z2T A;  2C67 A;  3NN0 X;  4NWZ A;  5GSN A;  2C3D A;  2DKI A;  5KXJ A;  4LA1 A;  2XFP A;  2R4J A;  1JRY A;  3SFD A;  4BV6 A;  3COX A;  3AE5 A;  1H7W A;  2CVJ A;  4C3Y A;  3DGZ A;  5JCN A;  4K7Z A;  1JNZ A;  4H4P A;  4H4X A;  5BUL A;  4K22 A;  3P4S A;  5FMH A;  5C3J A;  3DME A;  2NPX A;  3ICS A;  3AEC A;  5IQ4 A;  1O95 A;  2ACZ A;  2Q0K A;  1E6E A;  1PS9 A;  2C3C A;  2R46 A;  2V61 A;  4YSY A;  3ALJ A;  4NEW A;  3UKQ A;  2VQ7 A;  3HYX A;  5FS7 A;  4B68 A;  2ARD A;  4USQ A;  1H83 A;  4JY3 A;  4A7A A;  3CGD A;  5ER0 A;  2XVJ A;  1NHS A;  4EIP A;  1NHQ A;  4K8D A;  4U2T A;  4A9W A;  1VG0 A;  3AE8 A;  3EAN A;  3BI4 A;  3GYX A;  3C96 A;  3AEF A;  3PO7 A;  4IVO B;  3K7Q X;  1YQ3 A;  3VRD B;  2PYX A;  2YLS A;  2XFU A;  4X9M A;  1NHP A;  5U1O A;  3B3R A;  1BWC A;  1N1P A;  1PDH A;  1MOK A;  2GB0 A;  3ATR A;  3IC9 A;  2B9Y A;  2V3B A;  3LOV A;  2XYO A;  4J36 A;  4I58 A;  2F5Z A;  1EL5 A;  2Q7V A;  3HYV A;  1D4D A;  1F8W A;  1CC2 A;  2YR6 A;  3DJE A;  4H4Z A;  1SEZ A;  2E1M A;  3IHM A;  1ELI A;  3EAO A;  5KMR A;  2YG5 A;  4H7U A;  2GAG B;  2WOI A;  3AYL A;  3NNE A;  4J33 A;  2OAL A;  1Z6L A;  2JAE A;  1YKJ A;  3AE4 A;  1OJD A;  4U8I A;  2EQ7 A;  1BKW A;  1PBD A;  4KPR A;  2X8H A;  4Z2U A;  1B8S A;  5LV9 A;  3FBS A;  2R45 A;  1GRA A;  2BA9 A;  2XDO A;  3SY4 A;  3H4K A;  4U8J A;  2WDQ A;  2WDR A;  2XVH A;  4YXD A;  2WHD A;  3NTA A;  3T31 A;  2ZZB A;  3FG2 P;  2XVI A;  3I6D A;  2GR3 A;  2WP6 A;  5FS8 A;  3FMW A;  4CCQ A;  3C4A A;  3ICT A;  3ABV A;  2JBV A;  1K0I A;  2AAQ A;  3NRN A;  1FEA A;  3CPJ G;  5J7X A;  3RP6 A;  3QFA A;  1W4X A;  2FJD A;  2WQY A;  3II4 A;  4D04 A;  3VRB A;  2YLW A;  4GCM A;  2VVL G;  4GRT A;  4H2P A;  3UOZ A;  1K0J A;  2V6O A;  3QVP A;  4D03 A;  2CDU A;  3K30 A;  5BRT A;  4YWO A;  2A89 A;  3AE3 A;  4YKF A;  2B9X A;  3ZDN A;  4AT0 A;  1Q1W A;  1PBE A;  1GOS A;  4J57 A;  2C76 A;  2OAM A;  3CNS A;  3IHG A;  4II3 A;  4B63 A;  2BK4 A;  3BHF A;  1TDK A;  2YLT A;  4FK1 C;  2WU5 A;  3UP5 A;  3IF9 A;  4A79 A;  4GAV A;  2BRY A;  3CND A;  1OJ9 A;  4EQX A;  3UTE A;  1H84 A;  5BVA A;  1X31 B;  3GD4 A;  3P4R A;  1N4V A;  3NG7 X;  4TM1 A;  3KU9 A;  3Q9T A;  2C64 A;  4PAA A;  3SFE A;  1Y56 A;  3UKA A;  3AD7 B;  1GRF A;  1F8R A;  3ITJ A;  3PVC A;  3SQP A;  1N4W A;  4B66 A;  1DOD A;  5DBJ A;  1XDI A;  2GRT A;  4YKG A;  2YG4 A;  2E5V A;  3CGE A;  4N9X A;  4OPG A;  4B65 A;  2X8C A;  1OJT A;  2EQ9 A;  1KNR A;  2GR1 A;  2GF3 A;  2JB3 A;  2Z5Y A;  3NK1 X;  1NPX A;  1PXA A;  3P9U A;  2VVM A;  2VRL A;  2YVG A;  3LZW A;  4J34 A;  3NKS A;  2FJB A;  4CY8 A;  1L9D A;  4BK3 A;  3L8K A;  4OPC A;  2YG6 A;  2WU2 A;  4ECH A;  3F8D A;  1PXB A;  3NYE A;  3B6D A;  3HYW A;  2I0Z A;  2X50 A;  4RSL A;  3UCL A;  1BF3 A;  4Z26 A;  3LAD A;  4EMJ A;  4Z25 A;  5U63 A;  4G74 A;  4M52 A;  1CF3 A;  3AE1 A;  4ADW A;  4EQR A;  5IPY A;  2YR5 A;  3DK8 A;  4A65 A;  3UKK A;  3ICR A;  1DXL A;  1ZX9 A;  2JB2 A;  2QAE A;  2E4G A;  5EB5 A;  1H7X A;  1FOH A;  3G5R A;  1YQ4 A;  4U8L A;  1F8S A;  3T0K A;  4C5O A;  2TPR A;  1KSU A;  4OCG A;  1H86 A;  1FEC A;  4BJY A;  4H2Q A;  3LXD A;  3NH3 X;  3O0H A;  4XWZ A;  3UP4 A;  1KFY A;  4UP3 A;  4OVI A;  1L9C A;  2XLP A;  4UDQ A;  2BRA A;  2YR4 A;  3ALL A;  3KD9 A;  4ZN0 A;  1F6M A;  2PHH A;  4NTD A;  3ALM A;  3NK2 X;  3G5S A;  4YSZ A;  2WPE A;  1KNP A;  2XCG A;  2BYB A;  1ONF A;  1NDA A;  1ZKQ A;  2H88 A;  2R0C A;  2VOU A;  3L1R A;  3I3L A;  2YVF A;  4UDP A;  5JCM A;  1CJ3 A;  1K4Q A;  4U2L A;  1NG3 A;  2X8G A;  1DNC A;  3AE7 A;  4H4V A;  2VZ2 A;  4J2W A;  1S3B A;  3RP8 A;  2GR0 A;  2YG7 A;  4O5U A;  2JK6 A;  4K2X A;  2GQW A;  1YY5 A;  2GVC A;  4FDC B;  2XFQ A;  3AE9 A;  2CUL A;  4G6G A;  1L9E A;  2WPC A;  2YLR A;  4Z44 A;  2JKC A;  1ZY8 A;  1CC4 A;  4U8P A;  2YM1 A;  4G6H A;  3F8R A;  4GUV A;  4BUR A;  3S5W A;  4G9K A;  1IUV A;  3OZ2 A;  4U8O A;  2BS4 A;  2O9Z A;  1S3E A;  4NTE A;  1PBF A;  1DOE A;  4B1B A;  3D8X A;  1VRQ B;  4EQS A;  2B76 A;  1K0L A;  2JB1 A;  1MO9 A;  1O5W A;  1GAL A;  4AOS A;  2ZBW A;  1COY A;  1IUX A;  2BS2 A;  3VR8 A;  1BGJ A;  3GD3 A;  1P2H A;  2BS3 A;  3AE6 A;  5KVI A;  2B9W A;  1QO8 A;  2X99 A;  2NVK X;  1LV0 A;  2RGH A;  5KMS A;  4HB9 A;  5KOX A;  2XLR A;  2WPF A;  4WCT A;  1TDN A;  1M6I A;  3NLC A;  2AR8 A;  1LVL A;  1CJC A;  4OPT A;  1NEN A;  2WBA A;  3SYI A;  1CHU A;  5BUK A;  5CQF A;  1GRT A;  2BAC A;  3GSI A;  3NTD A;  4YTP A;  1B37 A;  2QCU A;  2C66 A;  1LQU A;  5KOW A;  2YAU A;  2YQU A;  1IJH A;  1D4C A;  2RAB A;  3DJG X;  1EL7 A;  1GSN A;  2XVF A;  4GDP A;  3NT6 A;  3D1C A;  4IVM B;  3GYJ A;  4FX9 A;  2GMJ A;  4JDR A;  3H8L A;  1S2Q A;  4APN A;  4B64 A;  2A8X A;  4JNA A;  3DK9 A;  2Y6R A;  4K5R A;  4TLZ A;  1GXF A;  2GR2 A;  3AEE A;  1GPE A;  1PN0 A;  1FL2 A;  1GER A;  2X3N A;  2IVD A;  2RGJ A;  2XFO A;  3CPH G;  2XLS A;  3T2Z A;  4H4W A;  4EMW A;  4YTM A;  3AED A;  3CIR A;  1LPF A;  3SZF A;  1PBB A;  5J60 A;  3E1T A;  4IA5 A;  4C77 A;  4G73 A;  3ISH A;  2OLO A;  4DNA A;  2RGO A;  2WET A;  1EL8 A;  3IWA A;  4MJW A;  4RG4 A;  5JCK A;  3NN6 X;  3DGH A;  3QSS A;  1E1N A;  2C75 A;  4C74 A;  3QSE A;  2B7R A;  1PBC A;  4H50 A;  1E1M A;  2VVL A;  2YG3 A;  4C3X A;  3GDP A;  4K5S A;  3NHO X;  4DSG A;  1JEH A;  1GET A;  1P2E A;  4CY6 A;  2BXS A;  1VG9 A;  2QA1 A;  4JY2 A;  1HYU A;  2UZZ A;  1Y0P A;  2C73 A;  5TR3 A;  4U8M A;  1RSG A;  4U8K A;  2XVE A;  4UDR A;  4RG3 A;  5KNL A;  4TM3 A;  1TDF A;  3UTG A;  2YWL A;  4OPU A;  1CBO A;  2Q6U A;  1LJ1 A;  2YVJ A;  3AWI A;  4OPI A;  3K7T A;  4BJZ A;  5IQ1 A;  4AOX A;  1GTH A;  5M10 A;  1D7Y A;  4II2 A;  5KMP A;  4Z43 A;  5KWF A;  2WS3 A;  1N4U A;  4U8N A;  3SM8 A;  1M64 A;  1CL0 A;  1B4V A;  2XFN A;  1TDO A;  2V60 A;  1H6V A;  2XLT A;  2VQB A;  3AYJ A;  5EB4 A;  5HY5 A;  1PJ7 A;  1ZMD A;  4DSH A;  1BGN A;  1O94 A;  5FS9 A;  3URH A;  3LJP A;  1TYP A;  2AQJ A;  2H89 A;  2YLZ A;  3DK4 A;  3CGB A;  3K7M X;  3AEA A;  3BNU A;  1H81 A;  1B5Q A;  3WE0 A;  4A6N B;  3FIM B;  3M13 A;  2IVE A;  4IV9 A;  4LU6 A;  1GT8 A;  3UOY A;  3H8I A;  2Y6Q A;  3CNT A;  2OLN A;  4H4Y A;  3JSK A;  1NAA A;  3AE2 A;  1XHC A;  5KVH A;  3T37 A;  1IUU A;  4Y4M A;  3SZC A;  4TM0 A;  4Y4L A;  1PJ6 A;  1S2Y A;  1ZOY A;  3QFB A;  2C72 A;  1CC6 A;  3KVE A;  1GES A;  1PXC A;  2WDV A;  4P9S A;  2R9Z A;  3LZX A;  3SXI A;  4YTN A;  5C2T A;  1DJQ A;  1GEU A;  3RED A;  1D4E A;  2GV8 A;  4NZH A;  5KRQ A;  1E1K A;  3UKP A;  3C4N A;  1OJC A;  1GRB A;  2YM2 A;  4A5L A;  3GMC A;  1PHH A;  3R9U A;  1OJA A;  3VRA A;  4JN9 A;  4A99 A;  3UKH A;  3ATQ A;  4CNJ A;  1QLB A;  2R0P A;  3CMM A;  1UKV G;  3QJ4 A;  3LB8 A;  4PAB A;  3AEB A;  3V3O A;  3CNJ A;  1VQW A;  2YLX A;  1LTX R;  2OA1 A;  3AD8 B;  3KA7 A;  4CRT A;  4B69 A;  1Q9I A;  2BK3 A;  3AYI A;  4CNK A;  3NYF A;  2ZZC A;  4GAP A;  2DKH A;  2GMH A;  3AB1 A;  4DGK A;  3SX6 A;  4BK2 A;  3V76 A;  4E0V A;  5L46 A;  4EQW A;  3CN8 A;  1KDG A;  2FJE A;  2GQF A;  4ZCD A;  2TMD A;  2Z5X A;  3VR9 A;  1ZP0 A;  5KMQ A;  2BAB A;  2WP5 A;  4USR A;  3EPT A;  2FJA A;  2BCP A;  4JNQ A;  2CFY A;  4X4J A;  4U2S A;  4Z2R A;  2BC1 A;  3EF6 A;  1L0V A;  1TRB A;  4J56 A;  1GV4 A;  1GTE A;  5GRT A;  3KPK A;  1PJ5 A;  3ADA B;  1IUW A;  5CKU A;  4X9N A;  3SGL A;  3UTH A;  3KLJ A;  4O5Q A;  4EIQ A;  4BK1 A;  4IA6 A;  4CCR A;  2W0H A;  1XPQ A;  1XAN A;  2C70 A;  3OC4 A;  1REO A;  1DOB A;  1VDC A;  4XWR A;  1EL9 A;  3CPI G;  3HZL A;  2QA2 A;  1IUT A;  1ZDL A;  1FCD A;  4H2R A;  3KPF A;  1TYT A;  2A87 A;  2R0G A;  3RHA A;  4YSH A;  1BZL A;  3UKF A;  3CTY A;  3NK0 X;  1KF6 A;  5EBK A;  2APG A;  2HQM A;  1FEB A;  1EBD A;  1F3P A;  4YT0 A;  5U25 A;  1YQZ A;  5HXI A;  1JOA A;  2WP9 A;  1NG4 A;  2WOV A;  1GRG A;  2XLU A;  1MXT A;  2GEW A;  4WX1 A;  1CJ4 A;  2BXR A;  1JNR A;  1JU2 A;  4Y4N A;  3VQR A;  3ZYX A;  2C7G A;  3RP7 A;  3T2Y A;  4AP3 A;  2BC0 A;  2EQ6 A;  3BHK A;  3BNM A;  3UKL A;  1GRE A;  1RYI A;  2Q0L A;  5EOW A;  3DA1 A;  5HYM A;  1D7L A;  2EQ8 A;  2C65 A;  1KSS A;  3QVR A;  4B67 A;  4YSX A;  5JCL A;  4EMI A;  3BI2 A;  4NEV A;  3S61 A;  1AOG A;  3T14 A;  1DJN A;  1E39 A;  1V59 A;  3NIX A;  4H4T A;  4FK1 A;  1DOC A;  2J3N A;  3UTF A;  1GND A;  1TDE A;  1RP0 A;  4Z24 A;  2BK5 A;  4HA6 A;  1GRH A;  5FS6 A;  2V5Z A;  3BI5 A;  4REK A;  4EM3 A;  3GWD A;  3UOV A;  3T2K A;  4OPD A;  2B7S A;  4XXG A;  1Q1R A;  3P4P A;  3QSM A;  2WEU A;  1JRZ A;  3GDN A;  4H4S A;  2WOW A;  4TLX A;  5HHF A;  3SZW A;  3NYC A;  3CNP A;  3GRS A;  4NNJ A;  4TM4 A;  4A6N A;  1NEK A;  3GYI A;  2WES A;  1Y56 B;  4EM4 A;  3AEG A;  2BCG G;  4ZCC A;  2FBW A;  4H4Q A;  2GAH B;  3DH9 A;  1QJD A;  1LQT A;  1CJ2 A;  1NHR A;  1ZMC A;  2C4C A;  2V3A A;  2IID A;  4H2N A;  3RNM A;  3F8P A;  2R4E A;  1ZOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...