4G6GA

Crystal structure of ndh with trt
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
478
structure length
470
Chain Sequence
b'GPTSFKTMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
molecule tags Oxidoreductase
source organism Saccharomyces cerevisiae
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
total genus 151
structure length 470
sequence length 478
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6gA00
3SZWA 3SZCA 4G6GA 3T0KA 4G6HA 3HYWA 3T2YA 3SYIA 4G74A 4G9KA 3SX6A 3T2ZA 4GAPA 5KMSA 3HYVA 3SXIA 4G73A 3HYXA 4GAVA 3KPKA 3SZFA 3T14A 3SZ0A 5KMRA 3T2KA 4NWZA 3SY4A 3T31A 5KMQA 5KMPA
chains in the Genus database with same CATH superfamily
2IVDA 1IUWA 3KD9A 2WPCA 2C76A 1GESA 2BS3A 3AE4A 4J33A 1LTXR 1GSNA 1Q1WA 4IA6A 1CJ2A 4DSGA 2NVKX 5JCMA 3AEAA 3GMCA 4TM1A 2C3CA 4OPCA 1K0JA 2XFNA 3NRNA 1V59A 1XPQA 3CPJG 3NKSA 2V3AA 5J60A 1Q1RA 2XCGA 4H4RA 3DJDA 3CGEA 2YWLA 1M64A 3URHA 2E4GA 1DOEA 1M6IA 1F8RA 1ZX9A 2PHHA 2XVHA 1KFYA 1L0VA 3KA7A 4B63A 3JSKA 3QSMA 5KMQA 4OVIA 1PJ7A 3CIRA 4E0VA 3PS9A 5HHFA 3DGZA 3AYJA 4H4TA 2B9YA 3S5WA 3FBSA 3GD4A 5FS7A 2GR2A 2YM2A 4Z2UA 4B1BA 3M12A 1TYPA 3DJGX 3C4NA 2WPFA 1PXAA 1IUXA 4G73A 3GDPA 4NTDA 4U8OA 2DKIA 3FG2P 2WS3A 1EL5A 4K5RA 3V3NA 5KVIA 3CTYA 3CNTA 3UP5A 1HYUA 4FDCB 4DSHA 4RG4A 2Q0LA 1N4WA 1S3BA 2XFOA 4NZHA 4UP3A 4ZCDA 4HA6A 3QVRA 2VVMA 2WU5A 3BHFA 2X50A 2WEUA 5KMPA 2YG3A 1GALA 2WPEA 3ICTA 2WQYA 4YTNA 3UKLA 4P9SA 3M13A 4J2WA 4AT0A 4G9KA 3O0HA 4YSXA 3NK1X 4NEVA 1B5QA 1F8WA 1NDAA 3E1TA 5KRQA 4X4JA 1GTEA 2ARDA 1JRYA 3ICSA 2GB0A 3HYXA 3L8KA 3KLJA 4H7UA 4JY3A 1SEZA 3AE6A 3UKAA 2VRLA 3KVEA 1BWCA 3P1WA 4A99A 2Y6RA 1Q9IA 2RGJA 3GMBA 3COXA 2GV8A 2VVLG 3GWFA 4A6NB 3DMEA 4C3XA 3AD8B 3RHAA 5BULA 3RP8A 3AYIA 3KKJA 4EMWA 5KWFA 2BC0A 4MJWA 1BZLA 2YR4A 2X3NA 3T0KA 1B4VA 2VZ2A 2GEWA 4Z43A 4HB9A 3DK8A 4B67A 1TDFA 2E5VA 4C3YA 1NG4A 1B8SA 5JCKA 2WP9A 3UOXA 2IIDA 2ZZBA 1S3EA 4NNJA 2GRTA 4ZCCA 3NHOX 4EMJA 4IVMB 1P2HA 5IPYA 4APNA 5GSNA 1PBEA 1KSUA 1IUVA 1K0IA 1NENA 1VRQB 4NWZA 2XYOA 4YSYA 4OPUA 4TLXA 4FK1A 4U8LA 2GAGB 2EQ6A 2VVLA 3RP7A 3UP4A 1RYIA 1S2QA 1D7YA 1H84A 1QLBA 2AAQA 3IF9A 2Q7VA 3KPFA 2R46A 4J34A 3NH3X 4CCQA 1PJ6A 3GSIA 1ELIA 4EQSA 1GRAA 2OAMA 4Y4MA 4GCMA 4Z44A 1EBDA 3UTEA 5JCLA 4H4QA 2V5ZA 4BK1A 2TPRA 2XVIA 4U8KA 1GRTA 3DA1A 3GRSA 4EQXA 3NK0X 5BVAA 1ZKQA 1KNPA 1F8SA 1Z6LA 2YVGA 4YTPA 4H4UA 2XLRA 2BACA 3P9UA 3FPZA 4CY6A 5IQ4A 1ZOVA 5M10A 3SZFA 1LJ1A 1ONFA 1QO8A 1K0LA 2AQJA 4FK1C 4BURA 3AEGA 2WDRA 3SM8A 4Y4NA 1IUTA 1OJCA 3SY4A 4A79A 4IA5A 5CQFA 2BK5A 2BXSA 1PN0A 4OPLA 1JOAA 1N4VA 3AE8A 4JY2A 3CNSA 1GEUA 2C65A 3HYWA 3T2YA 3BI5A 3S61A 1CJ3A 1ZDLA 4LA1A 3F8RA 4EIPA 2OA1A 1DXLA 1OJTA 4EM3A 5KOWA 3UKPA 3BI2A 1PBDA 1VG0A 1YQ3A 3B3RA 3EANA 2Z5YA 4OPTA 4YKGA 4U2TA 3IWAA 4XXGA 3CNPA 3UTGA 2FJEA 2IVEA 4EIQA 5CKUA 3NTAA 5HY5A 3NN6X 3P4SA 3P4QA 1NAAA 5J7XA 3EPTA 3LOVA 5M0ZA 1VDCA 1GT8A 2BA9A 4OPGA 2GQFA 4KX6A 3AB1A 2JK6A 3CPHG 1LPFA 4U8JA 2V3BA 3ICRA 4Z25A 4WCTA 4GF7A 1OJAA 1NEKA 2C66A 1CF3A 1QJDA 1N4UA 1PBFA 1E7PA 4J57A 3T37A 1GRFA 3M0OA 3K30A 1KNRA 3IHGA 4UDRA 2V6OA 2GF3A 3HYVA 2O9ZA 5BUKA 2JB1A 4H2NA 3ITJA 3V76A 2RGHA 2WDQA 4JN9A 2V61A 3EAOA 4FX9A 1REOA 4AOXA 1KDGA 2B76A 3GRTA 3AE9A 2GR3A 4GR1A 3VRBA 3ALMA 3BHKA 3ALJA 1COYA 2BK4A 1H83A 4A9WA 3D8XA 1H86A 3CNDA 4X9MA 5L46A 4REKA 1GETA 3CPIG 3NLCA 4D04A 5ER0A 5JCIA 3FMWA 1XHCA 3WE0A 1Y0PA 1DJQA 1LQUA 2XFUA 4II2A 1OJDA 5EB5A 2C72A 4M52A 3NIXA 2EQ8A 3PO7A 4B66A 5KXJA 3AE5A 1PXBA 1GPEA 4A7AA 2JKCA 3CN8A 3VRDB 3LJPA 4K7ZA 4DNAA 2WDVA 1JRZA 3AEFA 2C73A 3DK9A 4GDPA 2QA2A 4XWZA 5HXIA 2AR8A 3LADA 2ZBWA 2E1MA 3QSEA 4I59A 3SZ0A 4C5OA 2YAUA 2XLPA 3NNEA 4TM0A 3VQRA 4AOSA 3UKHA 5U1OA 1NG3A 4I58A 1VG9A 1FECA 2XVJA 4XWRA 4DGKA 5IQ1A 4YT0A 2R0CA 2JB3A 2GR1A 4H4XA 4H4VA 2TMDA 1EL7A 2VRMA 2WESA 2C4CA 2YR5A 3UKKA 4AT2A 2APGA 5BRTA 4NEWA 4WX1A 1AOGA 4CNKA 1RP0A 3AE1A 4BK3A 2ACZA 2JAEA 1S2YA 3IC9A 5JCNA 2BCPA 3CMMA 3C4AA 3KU9A 2FJAA 4EM4A 1FEAA 1BGNA 2BABA 3AD9B 3G5RA 1PBCA 2GVCA 3H4KA 4H2RA 1L9EA 2C75A 3DK4A 1ZP0A 3GD3A 1X31B 4B64A 2OLOA 3P4RA 2VQ7A 2QCUA 4A5LA 3REDA 3T31A 2CVJA 2QAEA 1KF6A 1GV4A 5TR3A 2Y6QA 2XVFA 3H8LA 2X8CA 1O95A 2CFYA 2EQ7A 1TRBA 1CC2A 3K7MX 4YSHA 4A6NA 4H4WA 1E1KA 1E39A 2C64A 1DOBA 1UKVG 2FJBA 1BF3A 1MO9A 2GMHA 1YKJA 2XFQA 2EQ9A 2ZZCA 2YG4A 3I3LA 4OPIA 2R4JA 4CNJA 1JU2A 4C74A 3QSSA 3SXIA 2XDOA 4UDQA 4D03A 2WOWA 4H2PA 4JDRA 4GUVA 3BI4A 2GAHB 3DJJA 2H89A 4K2XA 4H4PA 2GR0A 4USQA 2YM1A 3BNMA 3AYLA 3VRAA 5EOWA 1LV0A 3GWDA 1CJ4A 3NYFA 5GRTA 1IUUA 3ZYXA 1H7WA 1B37A 3RP6A 1PS9A 2CDUA 3Q9TA 1TDNA 4CCRA 2JBVA 4YWOA 3NT6A 1O5WA 1YQ4A 2PYXA 2XLUA 2RGOA 3UTHA 1NHPA 4O5QA 1FOHA 1DODA 2BK3A 5U25A 3BNUA 1E6EA 3VR8A 2BS2A 3ATRA 3G5SA 5EBKA 3SGLA 3AECA 3II4A 1E1NA 1NHQA 4Z26A 3AXBA 1GRBA 1O94A 1PJ5A 3P4PA 1EL8A 1EL9A 4RSLA 4A65A 2R4EA 2B9XA 2DKHA 3H8IA 1VQWA 3IHMA 1XANA 3ADAB 3QJ4A 4J36A 1FCDA 5DBJA 3GYXA 3UKFA 1CC4A 2R0GA 4U8PA 1JNZA 1RSGA 2NPXA 4Y4LA 2W0HA 3NG7X 3GYJA 2XVEA 5FS8A 4H4SA 2WP6A 4RG3A 2BC1A 4TM4A 4YXDA 2JB2A 4YSZA 2BXRA 3CGBA 4U8NA 1NHRA 3UOVA 4II3A 1CC6A 2A8XA 1ZY8A 2C70A 2YVJA 2X8GA 3B6DA 1ZMCA 4ADWA 3HZLA 2YLZA 4LIIA 3ISHA 4K8DA 4K5SA 1GNDA 2A89A 2OALA 2WP5A 1H82A 2R45A 2BS4A 4PAAA 1TDKA 2CULA 2YG6A 4JQ9A 3R9UA 3UOZA 1GREA 3L1RA 1H81A 1CL0A 5U63A 2YQUA 3AD7B 3T14A 1D7LA 4TLZA 2R9ZA 1GRGA 4ECHA 4U8IA 2F5ZA 2XLSA 3QFBA 1W4XA 3SFEA 4J31A 1F3PA 3F8PA 4TM3A 2I0ZA 4CRTA 5KVHA 2X8HA 3DJEA 4G6GA 2HQMA 4KPRA 1GERA 2Q6UA 4G6HA 3C96A 4U2LA 4Z24A 3RNMA 2BRYA 1IJHA 2WOVA 3FIMB 3PVCA 3UOYA 1H6VA 2X99A 3ALLA 3AE3A 3UTFA 1JEHA 4GAVA 3UCLA 3GDNA 5LV9A 5KOXA 2C3DA 1OJ9A 2YG5A 3LZXA 1L9DA 4N9XA 1MXTA 4IV9A 4PABA 2B7RA 1NPXA 1DNCA 3AEBA 2BCGG 1ZMDA 3UKQA 3AE2A 4J56A 5FS6A 2UZZA 4EMIA 4EQWA 2BRAA 2YLXA 1LQTA 2XFPA 4CY8A 4JNQA 3AWIA 1KSSA 4USRA 1GOSA 1BKWA 4H2QA 3SFDA 1D5TA 2BYBA 3T2ZA 3NGCX 2QA1A 1GXFA 4U2SA 2RABA 3CNJA 3NYCA 5HYMA 1GTHA 5C2TA 1PHHA 5EB4A 1D4CA 2C67A 2ZZ0A 3NN0X 3NYEA 4H50A 2GQWA 1DJNA 2J3NA 3AEDA 3NTDA 4GDEA 5C3JA 4UDPA 4NTEA 1CHUA 1GRHA 2R0PA 3EF6A 3KPKA 2OLNA 1Y56B 3ABVA 5KNLA 3Q6JA 1CJCA 3LZWA 1E1MA 3CGDA 4Z2TA 2Q0KA 3V3OA 3SZCA 4EQRA 1IUSA 4U8MA 1H7XA 1D4EA 3SYIA 3F8DA 4G74A 3SX6A 2YVFA 4JNAA 4CBQA 4ZN0A 2YLTA 4GAPA 1PBBA 1D4DA 3LB8A 3QFAA 2C7GA 3DH9A 3DGHA 1CBOA 1TYTA 4BK2A 2GMJA 2WOIA 3LXDA 3QVPA 2WHDA 2B9WA 2WU2A 1N1PA 1BGJA 2VQBA 3ZDNA 1NHSA 1L9CA 1LVLA 1MOKA 2FBWA 2Z5XA 1Y56A 2YG7A 4O5UA 2V60A 1PXCA 4LU6A 4YKFA 2FJDA 2YLRA 5KMRA 1FL2A 1JRXA 1YQZA 4H4YA 1ZOYA 1E1LA 3AEEA 3ATQA 3K7TA 1DOCA 1P2EA 4C77A 2A87A 1JNRA 3SZWA 3SQPA 4Z2RA 4AP3A 2YR6A 3NK2X 2H88A 3OC4A 3VR9A 1YY5A 4B65A 1TDEA 4IVOB 4BJZA 4BV6A 1FEBA 4BJYA 4GRTA 3G5QA 4B69A 3GYIA 4X9NA 3AE7A 1TDOA 2YLWA 3I6DA 2VOUA 3OZ2A 4ICYA 1K4QA 1PDHA 1ZK7A 2GH5A 2WBAA 5FS9A 4OPDA 2YLSA 4NTCA 4YTMA 3CGCA 2B7SA 3K7QX 2XLTA 4H4ZA 4B68A 5FMHA 4OCGA 3T2KA 4AP1A 1XDIA 2WETA 3D1CA 1F6MA 5KMSA 4K22A
chains in the Genus database with same CATH topology
2IVDA 1IUWA 3KD9A 2WPCA 2C76A 1GESA 2BS3A 3AE4A 4J33A 1LTXR 1GSNA 1Q1WA 4IA6A 1CJ2A 4DSGA 2NVKX 5JCMA 3AEAA 3GMCA 4TM1A 2C3CA 4OPCA 1K0JA 2XFNA 3NRNA 1V59A 1XPQA 3CPJG 3NKSA 2V3AA 5J60A 1Q1RA 2XCGA 4H4RA 3DJDA 3CGEA 2YWLA 1M64A 3URHA 2E4GA 1DOEA 1M6IA 1F8RA 1ZX9A 2PHHA 2XVHA 1KFYA 1L0VA 3KA7A 4B63A 3JSKA 3QSMA 5KMQA 4OVIA 1PJ7A 3CIRA 4E0VA 3PS9A 5HHFA 3DGZA 3AYJA 4H4TA 2B9YA 3S5WA 3FBSA 3GD4A 5FS7A 2GR2A 2YM2A 4Z2UA 4B1BA 3M12A 1TYPA 3DJGX 3C4NA 2WPFA 1PXAA 1IUXA 4G73A 3GDPA 4NTDA 4U8OA 2DKIA 3FG2P 2WS3A 1EL5A 4K5RA 3V3NA 5KVIA 3CTYA 3CNTA 3UP5A 1HYUA 4FDCB 4DSHA 4RG4A 2Q0LA 1N4WA 1S3BA 2XFOA 4NZHA 4UP3A 4ZCDA 4HA6A 3QVRA 2VVMA 2WU5A 3BHFA 2X50A 2WEUA 5KMPA 2YG3A 1GALA 2WPEA 3ICTA 2WQYA 4YTNA 3UKLA 4P9SA 3M13A 4J2WA 4AT0A 4G9KA 3O0HA 4YSXA 3NK1X 4NEVA 1B5QA 1F8WA 1NDAA 3E1TA 5KRQA 4X4JA 1GTEA 2ARDA 1JRYA 3ICSA 2GB0A 3HYXA 3L8KA 3KLJA 4H7UA 4JY3A 1SEZA 3AE6A 3UKAA 2VRLA 3KVEA 1BWCA 3P1WA 4A99A 2Y6RA 1Q9IA 2RGJA 3GMBA 3COXA 2GV8A 2VVLG 3GWFA 4A6NB 3DMEA 4C3XA 3AD8B 3RHAA 5BULA 3RP8A 3AYIA 3KKJA 4EMWA 5KWFA 2BC0A 4MJWA 1BZLA 2YR4A 2X3NA 3T0KA 1B4VA 2VZ2A 2GEWA 4Z43A 4HB9A 3DK8A 4B67A 1TDFA 2E5VA 4C3YA 1NG4A 1B8SA 5JCKA 2WP9A 3UOXA 2IIDA 2ZZBA 1S3EA 4NNJA 2GRTA 4ZCCA 3NHOX 4EMJA 4IVMB 1P2HA 5IPYA 4APNA 5GSNA 1PBEA 1KSUA 1IUVA 1K0IA 1NENA 1VRQB 4NWZA 2XYOA 4YSYA 4OPUA 4TLXA 4FK1A 4U8LA 2GAGB 2EQ6A 2VVLA 3RP7A 3UP4A 1RYIA 1S2QA 1D7YA 1H84A 1QLBA 2AAQA 3IF9A 2Q7VA 3KPFA 2R46A 4J34A 3NH3X 4CCQA 1PJ6A 3GSIA 1ELIA 4EQSA 1GRAA 2OAMA 4Y4MA 4GCMA 4Z44A 1EBDA 3UTEA 5JCLA 4H4QA 2V5ZA 4BK1A 2TPRA 2XVIA 4U8KA 1GRTA 3DA1A 3GRSA 4EQXA 3NK0X 5BVAA 1ZKQA 1KNPA 1F8SA 1Z6LA 2YVGA 4YTPA 4H4UA 2XLRA 2BACA 3P9UA 3FPZA 4CY6A 5IQ4A 1ZOVA 5M10A 3SZFA 1LJ1A 1ONFA 1QO8A 1K0LA 2AQJA 4FK1C 4BURA 3AEGA 2WDRA 3SM8A 4Y4NA 1IUTA 1OJCA 3SY4A 4A79A 4IA5A 5CQFA 2BK5A 2BXSA 1PN0A 4OPLA 1JOAA 1N4VA 3AE8A 4JY2A 3CNSA 1GEUA 2C65A 3HYWA 3T2YA 3BI5A 3S61A 1CJ3A 1ZDLA 4LA1A 3F8RA 4EIPA 2OA1A 1DXLA 1OJTA 4EM3A 5KOWA 3UKPA 3BI2A 1PBDA 1VG0A 1YQ3A 3B3RA 3EANA 2Z5YA 4OPTA 4YKGA 4U2TA 3IWAA 4XXGA 3CNPA 3UTGA 2FJEA 2IVEA 4EIQA 5CKUA 3NTAA 5HY5A 3NN6X 3P4SA 3P4QA 1NAAA 5J7XA 3EPTA 3LOVA 5M0ZA 1VDCA 1GT8A 2BA9A 4OPGA 2GQFA 4KX6A 3AB1A 2JK6A 3CPHG 1LPFA 4U8JA 2V3BA 3ICRA 4Z25A 4WCTA 4GF7A 1OJAA 1NEKA 2C66A 1CF3A 1QJDA 1N4UA 1PBFA 1E7PA 4J57A 3T37A 1GRFA 3M0OA 3K30A 1KNRA 3IHGA 4UDRA 2V6OA 2GF3A 3HYVA 2O9ZA 5BUKA 2JB1A 4H2NA 3ITJA 3V76A 2RGHA 2WDQA 4JN9A 2V61A 3EAOA 4FX9A 1REOA 4AOXA 1KDGA 2B76A 3GRTA 3AE9A 2GR3A 4GR1A 3VRBA 3ALMA 3BHKA 3ALJA 1COYA 2BK4A 1H83A 4A9WA 3D8XA 1H86A 3CNDA 4X9MA 5L46A 4REKA 1GETA 3CPIG 3NLCA 4D04A 5ER0A 5JCIA 3FMWA 1XHCA 3WE0A 1Y0PA 1DJQA 1LQUA 2XFUA 4II2A 1OJDA 5EB5A 2C72A 4M52A 3NIXA 2EQ8A 3PO7A 4B66A 5KXJA 3AE5A 1PXBA 1GPEA 4A7AA 2JKCA 3CN8A 3VRDB 3LJPA 4K7ZA 4DNAA 2WDVA 1JRZA 3AEFA 2C73A 3DK9A 4GDPA 2QA2A 4XWZA 5HXIA 2AR8A 3LADA 2ZBWA 2E1MA 3QSEA 4I59A 3SZ0A 4C5OA 2YAUA 2XLPA 3NNEA 4TM0A 3VQRA 4AOSA 3UKHA 5U1OA 1NG3A 4I58A 1VG9A 1FECA 2XVJA 4XWRA 4DGKA 5IQ1A 4YT0A 2R0CA 2JB3A 2GR1A 4H4XA 4H4VA 2TMDA 1EL7A 2VRMA 2WESA 2C4CA 2YR5A 3UKKA 4AT2A 2APGA 5BRTA 4NEWA 4WX1A 1AOGA 4CNKA 1RP0A 3AE1A 4BK3A 2ACZA 2JAEA 1S2YA 3IC9A 5JCNA 2BCPA 3CMMA 3C4AA 3KU9A 2FJAA 4EM4A 1FEAA 1BGNA 2BABA 3AD9B 3G5RA 1PBCA 2GVCA 3H4KA 4H2RA 1L9EA 2C75A 3DK4A 1ZP0A 3GD3A 1X31B 4B64A 2OLOA 3P4RA 2VQ7A 2QCUA 4A5LA 3REDA 3T31A 2CVJA 2QAEA 1KF6A 1GV4A 5TR3A 2Y6QA 2XVFA 3H8LA 2X8CA 1O95A 2CFYA 2EQ7A 1TRBA 1CC2A 3K7MX 4YSHA 4A6NA 4H4WA 1E1KA 1E39A 2C64A 1DOBA 1UKVG 2FJBA 1BF3A 1MO9A 2GMHA 1YKJA 2XFQA 2EQ9A 2ZZCA 2YG4A 3I3LA 4OPIA 2R4JA 4CNJA 1JU2A 4C74A 3QSSA 3SXIA 2XDOA 4UDQA 4D03A 2WOWA 4H2PA 4JDRA 4GUVA 3BI4A 2GAHB 3DJJA 2H89A 4K2XA 4H4PA 2GR0A 4USQA 2YM1A 3BNMA 3AYLA 3VRAA 5EOWA 1LV0A 3GWDA 1CJ4A 3NYFA 5GRTA 1IUUA 3ZYXA 1H7WA 1B37A 3RP6A 1PS9A 2CDUA 3Q9TA 1TDNA 4CCRA 2JBVA 4YWOA 3NT6A 1O5WA 1YQ4A 2PYXA 2XLUA 2RGOA 3UTHA 1NHPA 4O5QA 1FOHA 1DODA 2BK3A 5U25A 3BNUA 1E6EA 3VR8A 2BS2A 3ATRA 3G5SA 5EBKA 3SGLA 3AECA 3II4A 1E1NA 1NHQA 4Z26A 3AXBA 1GRBA 1O94A 1PJ5A 3P4PA 1EL8A 1EL9A 4RSLA 4A65A 2R4EA 2B9XA 2DKHA 3H8IA 1VQWA 3IHMA 1XANA 3ADAB 3QJ4A 4J36A 1FCDA 5DBJA 3GYXA 3UKFA 1CC4A 2R0GA 4U8PA 1JNZA 1RSGA 2NPXA 4Y4LA 2W0HA 3NG7X 3GYJA 2XVEA 5FS8A 4H4SA 2WP6A 4RG3A 2BC1A 4TM4A 4YXDA 2JB2A 4YSZA 2BXRA 3CGBA 4U8NA 1NHRA 3UOVA 4II3A 1CC6A 2A8XA 1ZY8A 2C70A 2YVJA 2X8GA 3B6DA 1ZMCA 4ADWA 3HZLA 2YLZA 4LIIA 3ISHA 4K8DA 4K5SA 1GNDA 2A89A 2OALA 2WP5A 1H82A 2R45A 2BS4A 4PAAA 1TDKA 2CULA 2YG6A 4JQ9A 3R9UA 3UOZA 1GREA 3L1RA 1H81A 1CL0A 5U63A 2YQUA 3AD7B 3T14A 1D7LA 4TLZA 2R9ZA 1GRGA 4ECHA 4U8IA 2F5ZA 2XLSA 3QFBA 1W4XA 3SFEA 4J31A 1F3PA 3F8PA 4TM3A 2I0ZA 4CRTA 5KVHA 2X8HA 3DJEA 4G6GA 2HQMA 4KPRA 1GERA 2Q6UA 4G6HA 3C96A 4U2LA 4Z24A 3RNMA 2BRYA 1IJHA 2WOVA 3FIMB 3PVCA 3UOYA 1H6VA 2X99A 3ALLA 3AE3A 3UTFA 1JEHA 4GAVA 3UCLA 3GDNA 5LV9A 5KOXA 2C3DA 1OJ9A 2YG5A 3LZXA 1L9DA 4N9XA 1MXTA 4IV9A 4PABA 2B7RA 1NPXA 1DNCA 3AEBA 2BCGG 1ZMDA 3UKQA 3AE2A 4J56A 5FS6A 2UZZA 4EMIA 4EQWA 2BRAA 2YLXA 1LQTA 2XFPA 4CY8A 4JNQA 3AWIA 1KSSA 4USRA 1GOSA 1BKWA 4H2QA 3SFDA 1D5TA 2BYBA 3T2ZA 3NGCX 2QA1A 1GXFA 4U2SA 2RABA 3CNJA 3NYCA 5HYMA 1GTHA 5C2TA 1PHHA 5EB4A 1D4CA 2C67A 2ZZ0A 3NN0X 3NYEA 4H50A 2GQWA 1DJNA 2J3NA 3AEDA 3NTDA 4GDEA 5C3JA 4UDPA 4NTEA 1CHUA 1GRHA 2R0PA 3EF6A 3KPKA 2OLNA 1Y56B 3ABVA 5KNLA 3Q6JA 1CJCA 3LZWA 1E1MA 3CGDA 4Z2TA 2Q0KA 3V3OA 3SZCA 4EQRA 1IUSA 4U8MA 1H7XA 1D4EA 3SYIA 3F8DA 4G74A 3SX6A 2YVFA 4JNAA 4CBQA 4ZN0A 2YLTA 4GAPA 1PBBA 1D4DA 3LB8A 3QFAA 2C7GA 3DH9A 3DGHA 1CBOA 1TYTA 4BK2A 2GMJA 2WOIA 3LXDA 3QVPA 2WHDA 2B9WA 2WU2A 1N1PA 1BGJA 2VQBA 3ZDNA 1NHSA 1L9CA 1LVLA 1MOKA 2FBWA 2Z5XA 1Y56A 2YG7A 4O5UA 2V60A 1PXCA 4LU6A 4YKFA 2FJDA 2YLRA 5KMRA 1FL2A 1JRXA 1YQZA 4H4YA 1ZOYA 1E1LA 3AEEA 3ATQA 3K7TA 1DOCA 1P2EA 4C77A 2A87A 1JNRA 3SZWA 3SQPA 4Z2RA 4AP3A 2YR6A 3NK2X 2H88A 3OC4A 3VR9A 1YY5A 4B65A 1TDEA 4IVOB 4BJZA 4BV6A 1FEBA 4BJYA 4GRTA 3G5QA 4B69A 3GYIA 4X9NA 3AE7A 1TDOA 2YLWA 3I6DA 2VOUA 3OZ2A 4ICYA 1K4QA 1PDHA 1ZK7A 2GH5A 2WBAA 5FS9A 4OPDA 2YLSA 4NTCA 4YTMA 3CGCA 2B7SA 3K7QX 2XLTA 4H4ZA 4B68A 5FMHA 4OCGA 3T2KA 4AP1A 1XDIA 2WETA 3D1CA 1F6MA 5KMSA 4K22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZW A;  3SZC A;  4G6G A;  3T0K A;  4G6H A;  3HYW A;  3T2Y A;  3SYI A;  4G74 A;  4G9K A;  3SX6 A;  3T2Z A;  4GAP A;  5KMS A;  3HYV A;  3SXI A;  4G73 A;  3HYX A;  4GAV A;  3KPK A;  3SZF A;  3T14 A;  3SZ0 A;  5KMR A;  3T2K A;  4NWZ A;  3SY4 A;  3T31 A;  5KMQ A;  5KMP A; 
#chains in the Genus database with same CATH topology
 2IVD A;  1IUW A;  3KD9 A;  2WPC A;  2C76 A;  1GES A;  2BS3 A;  3AE4 A;  4J33 A;  1LTX R;  1GSN A;  1Q1W A;  4IA6 A;  1CJ2 A;  4DSG A;  2NVK X;  5JCM A;  3AEA A;  3GMC A;  4TM1 A;  2C3C A;  4OPC A;  1K0J A;  2XFN A;  3NRN A;  1V59 A;  1XPQ A;  3CPJ G;  3NKS A;  2V3A A;  5J60 A;  1Q1R A;  2XCG A;  4H4R A;  3DJD A;  3CGE A;  2YWL A;  1M64 A;  3URH A;  2E4G A;  1DOE A;  1M6I A;  1F8R A;  1ZX9 A;  2PHH A;  2XVH A;  1KFY A;  1L0V A;  3KA7 A;  4B63 A;  3JSK A;  3QSM A;  5KMQ A;  4OVI A;  1PJ7 A;  3CIR A;  4E0V A;  3PS9 A;  5HHF A;  3DGZ A;  3AYJ A;  4H4T A;  2B9Y A;  3S5W A;  3FBS A;  3GD4 A;  5FS7 A;  2GR2 A;  2YM2 A;  4Z2U A;  4B1B A;  3M12 A;  1TYP A;  3DJG X;  3C4N A;  2WPF A;  1PXA A;  1IUX A;  4G73 A;  3GDP A;  4NTD A;  4U8O A;  2DKI A;  3FG2 P;  2WS3 A;  1EL5 A;  4K5R A;  3V3N A;  5KVI A;  3CTY A;  3CNT A;  3UP5 A;  1HYU A;  4FDC B;  4DSH A;  4RG4 A;  2Q0L A;  1N4W A;  1S3B A;  2XFO A;  4NZH A;  4UP3 A;  4ZCD A;  4HA6 A;  3QVR A;  2VVM A;  2WU5 A;  3BHF A;  2X50 A;  2WEU A;  5KMP A;  2YG3 A;  1GAL A;  2WPE A;  3ICT A;  2WQY A;  4YTN A;  3UKL A;  4P9S A;  3M13 A;  4J2W A;  4AT0 A;  4G9K A;  3O0H A;  4YSX A;  3NK1 X;  4NEV A;  1B5Q A;  1F8W A;  1NDA A;  3E1T A;  5KRQ A;  4X4J A;  1GTE A;  2ARD A;  1JRY A;  3ICS A;  2GB0 A;  3HYX A;  3L8K A;  3KLJ A;  4H7U A;  4JY3 A;  1SEZ A;  3AE6 A;  3UKA A;  2VRL A;  3KVE A;  1BWC A;  3P1W A;  4A99 A;  2Y6R A;  1Q9I A;  2RGJ A;  3GMB A;  3COX A;  2GV8 A;  2VVL G;  3GWF A;  4A6N B;  3DME A;  4C3X A;  3AD8 B;  3RHA A;  5BUL A;  3RP8 A;  3AYI A;  3KKJ A;  4EMW A;  5KWF A;  2BC0 A;  4MJW A;  1BZL A;  2YR4 A;  2X3N A;  3T0K A;  1B4V A;  2VZ2 A;  2GEW A;  4Z43 A;  4HB9 A;  3DK8 A;  4B67 A;  1TDF A;  2E5V A;  4C3Y A;  1NG4 A;  1B8S A;  5JCK A;  2WP9 A;  3UOX A;  2IID A;  2ZZB A;  1S3E A;  4NNJ A;  2GRT A;  4ZCC A;  3NHO X;  4EMJ A;  4IVM B;  1P2H A;  5IPY A;  4APN A;  5GSN A;  1PBE A;  1KSU A;  1IUV A;  1K0I A;  1NEN A;  1VRQ B;  4NWZ A;  2XYO A;  4YSY A;  4OPU A;  4TLX A;  4FK1 A;  4U8L A;  2GAG B;  2EQ6 A;  2VVL A;  3RP7 A;  3UP4 A;  1RYI A;  1S2Q A;  1D7Y A;  1H84 A;  1QLB A;  2AAQ A;  3IF9 A;  2Q7V A;  3KPF A;  2R46 A;  4J34 A;  3NH3 X;  4CCQ A;  1PJ6 A;  3GSI A;  1ELI A;  4EQS A;  1GRA A;  2OAM A;  4Y4M A;  4GCM A;  4Z44 A;  1EBD A;  3UTE A;  5JCL A;  4H4Q A;  2V5Z A;  4BK1 A;  2TPR A;  2XVI A;  4U8K A;  1GRT A;  3DA1 A;  3GRS A;  4EQX A;  3NK0 X;  5BVA A;  1ZKQ A;  1KNP A;  1F8S A;  1Z6L A;  2YVG A;  4YTP A;  4H4U A;  2XLR A;  2BAC A;  3P9U A;  3FPZ A;  4CY6 A;  5IQ4 A;  1ZOV A;  5M10 A;  3SZF A;  1LJ1 A;  1ONF A;  1QO8 A;  1K0L A;  2AQJ A;  4FK1 C;  4BUR A;  3AEG A;  2WDR A;  3SM8 A;  4Y4N A;  1IUT A;  1OJC A;  3SY4 A;  4A79 A;  4IA5 A;  5CQF A;  2BK5 A;  2BXS A;  1PN0 A;  4OPL A;  1JOA A;  1N4V A;  3AE8 A;  4JY2 A;  3CNS A;  1GEU A;  2C65 A;  3HYW A;  3T2Y A;  3BI5 A;  3S61 A;  1CJ3 A;  1ZDL A;  4LA1 A;  3F8R A;  4EIP A;  2OA1 A;  1DXL A;  1OJT A;  4EM3 A;  5KOW A;  3UKP A;  3BI2 A;  1PBD A;  1VG0 A;  1YQ3 A;  3B3R A;  3EAN A;  2Z5Y A;  4OPT A;  4YKG A;  4U2T A;  3IWA A;  4XXG A;  3CNP A;  3UTG A;  2FJE A;  2IVE A;  4EIQ A;  5CKU A;  3NTA A;  5HY5 A;  3NN6 X;  3P4S A;  3P4Q A;  1NAA A;  5J7X A;  3EPT A;  3LOV A;  5M0Z A;  1VDC A;  1GT8 A;  2BA9 A;  4OPG A;  2GQF A;  4KX6 A;  3AB1 A;  2JK6 A;  3CPH G;  1LPF A;  4U8J A;  2V3B A;  3ICR A;  4Z25 A;  4WCT A;  4GF7 A;  1OJA A;  1NEK A;  2C66 A;  1CF3 A;  1QJD A;  1N4U A;  1PBF A;  1E7P A;  4J57 A;  3T37 A;  1GRF A;  3M0O A;  3K30 A;  1KNR A;  3IHG A;  4UDR A;  2V6O A;  2GF3 A;  3HYV A;  2O9Z A;  5BUK A;  2JB1 A;  4H2N A;  3ITJ A;  3V76 A;  2RGH A;  2WDQ A;  4JN9 A;  2V61 A;  3EAO A;  4FX9 A;  1REO A;  4AOX A;  1KDG A;  2B76 A;  3GRT A;  3AE9 A;  2GR3 A;  4GR1 A;  3VRB A;  3ALM A;  3BHK A;  3ALJ A;  1COY A;  2BK4 A;  1H83 A;  4A9W A;  3D8X A;  1H86 A;  3CND A;  4X9M A;  5L46 A;  4REK A;  1GET A;  3CPI G;  3NLC A;  4D04 A;  5ER0 A;  5JCI A;  3FMW A;  1XHC A;  3WE0 A;  1Y0P A;  1DJQ A;  1LQU A;  2XFU A;  4II2 A;  1OJD A;  5EB5 A;  2C72 A;  4M52 A;  3NIX A;  2EQ8 A;  3PO7 A;  4B66 A;  5KXJ A;  3AE5 A;  1PXB A;  1GPE A;  4A7A A;  2JKC A;  3CN8 A;  3VRD B;  3LJP A;  4K7Z A;  4DNA A;  2WDV A;  1JRZ A;  3AEF A;  2C73 A;  3DK9 A;  4GDP A;  2QA2 A;  4XWZ A;  5HXI A;  2AR8 A;  3LAD A;  2ZBW A;  2E1M A;  3QSE A;  4I59 A;  3SZ0 A;  4C5O A;  2YAU A;  2XLP A;  3NNE A;  4TM0 A;  3VQR A;  4AOS A;  3UKH A;  5U1O A;  1NG3 A;  4I58 A;  1VG9 A;  1FEC A;  2XVJ A;  4XWR A;  4DGK A;  5IQ1 A;  4YT0 A;  2R0C A;  2JB3 A;  2GR1 A;  4H4X A;  4H4V A;  2TMD A;  1EL7 A;  2VRM A;  2WES A;  2C4C A;  2YR5 A;  3UKK A;  4AT2 A;  2APG A;  5BRT A;  4NEW A;  4WX1 A;  1AOG A;  4CNK A;  1RP0 A;  3AE1 A;  4BK3 A;  2ACZ A;  2JAE A;  1S2Y A;  3IC9 A;  5JCN A;  2BCP A;  3CMM A;  3C4A A;  3KU9 A;  2FJA A;  4EM4 A;  1FEA A;  1BGN A;  2BAB A;  3AD9 B;  3G5R A;  1PBC A;  2GVC A;  3H4K A;  4H2R A;  1L9E A;  2C75 A;  3DK4 A;  1ZP0 A;  3GD3 A;  1X31 B;  4B64 A;  2OLO A;  3P4R A;  2VQ7 A;  2QCU A;  4A5L A;  3RED A;  3T31 A;  2CVJ A;  2QAE A;  1KF6 A;  1GV4 A;  5TR3 A;  2Y6Q A;  2XVF A;  3H8L A;  2X8C A;  1O95 A;  2CFY A;  2EQ7 A;  1TRB A;  1CC2 A;  3K7M X;  4YSH A;  4A6N A;  4H4W A;  1E1K A;  1E39 A;  2C64 A;  1DOB A;  1UKV G;  2FJB A;  1BF3 A;  1MO9 A;  2GMH A;  1YKJ A;  2XFQ A;  2EQ9 A;  2ZZC A;  2YG4 A;  3I3L A;  4OPI A;  2R4J A;  4CNJ A;  1JU2 A;  4C74 A;  3QSS A;  3SXI A;  2XDO A;  4UDQ A;  4D03 A;  2WOW A;  4H2P A;  4JDR A;  4GUV A;  3BI4 A;  2GAH B;  3DJJ A;  2H89 A;  4K2X A;  4H4P A;  2GR0 A;  4USQ A;  2YM1 A;  3BNM A;  3AYL A;  3VRA A;  5EOW A;  1LV0 A;  3GWD A;  1CJ4 A;  3NYF A;  5GRT A;  1IUU A;  3ZYX A;  1H7W A;  1B37 A;  3RP6 A;  1PS9 A;  2CDU A;  3Q9T A;  1TDN A;  4CCR A;  2JBV A;  4YWO A;  3NT6 A;  1O5W A;  1YQ4 A;  2PYX A;  2XLU A;  2RGO A;  3UTH A;  1NHP A;  4O5Q A;  1FOH A;  1DOD A;  2BK3 A;  5U25 A;  3BNU A;  1E6E A;  3VR8 A;  2BS2 A;  3ATR A;  3G5S A;  5EBK A;  3SGL A;  3AEC A;  3II4 A;  1E1N A;  1NHQ A;  4Z26 A;  3AXB A;  1GRB A;  1O94 A;  1PJ5 A;  3P4P A;  1EL8 A;  1EL9 A;  4RSL A;  4A65 A;  2R4E A;  2B9X A;  2DKH A;  3H8I A;  1VQW A;  3IHM A;  1XAN A;  3ADA B;  3QJ4 A;  4J36 A;  1FCD A;  5DBJ A;  3GYX A;  3UKF A;  1CC4 A;  2R0G A;  4U8P A;  1JNZ A;  1RSG A;  2NPX A;  4Y4L A;  2W0H A;  3NG7 X;  3GYJ A;  2XVE A;  5FS8 A;  4H4S A;  2WP6 A;  4RG3 A;  2BC1 A;  4TM4 A;  4YXD A;  2JB2 A;  4YSZ A;  2BXR A;  3CGB A;  4U8N A;  1NHR A;  3UOV A;  4II3 A;  1CC6 A;  2A8X A;  1ZY8 A;  2C70 A;  2YVJ A;  2X8G A;  3B6D A;  1ZMC A;  4ADW A;  3HZL A;  2YLZ A;  4LII A;  3ISH A;  4K8D A;  4K5S A;  1GND A;  2A89 A;  2OAL A;  2WP5 A;  1H82 A;  2R45 A;  2BS4 A;  4PAA A;  1TDK A;  2CUL A;  2YG6 A;  4JQ9 A;  3R9U A;  3UOZ A;  1GRE A;  3L1R A;  1H81 A;  1CL0 A;  5U63 A;  2YQU A;  3AD7 B;  3T14 A;  1D7L A;  4TLZ A;  2R9Z A;  1GRG A;  4ECH A;  4U8I A;  2F5Z A;  2XLS A;  3QFB A;  1W4X A;  3SFE A;  4J31 A;  1F3P A;  3F8P A;  4TM3 A;  2I0Z A;  4CRT A;  5KVH A;  2X8H A;  3DJE A;  4G6G A;  2HQM A;  4KPR A;  1GER A;  2Q6U A;  4G6H A;  3C96 A;  4U2L A;  4Z24 A;  3RNM A;  2BRY A;  1IJH A;  2WOV A;  3FIM B;  3PVC A;  3UOY A;  1H6V A;  2X99 A;  3ALL A;  3AE3 A;  3UTF A;  1JEH A;  4GAV A;  3UCL A;  3GDN A;  5LV9 A;  5KOX A;  2C3D A;  1OJ9 A;  2YG5 A;  3LZX A;  1L9D A;  4N9X A;  1MXT A;  4IV9 A;  4PAB A;  2B7R A;  1NPX A;  1DNC A;  3AEB A;  2BCG G;  1ZMD A;  3UKQ A;  3AE2 A;  4J56 A;  5FS6 A;  2UZZ A;  4EMI A;  4EQW A;  2BRA A;  2YLX A;  1LQT A;  2XFP A;  4CY8 A;  4JNQ A;  3AWI A;  1KSS A;  4USR A;  1GOS A;  1BKW A;  4H2Q A;  3SFD A;  1D5T A;  2BYB A;  3T2Z A;  3NGC X;  2QA1 A;  1GXF A;  4U2S A;  2RAB A;  3CNJ A;  3NYC A;  5HYM A;  1GTH A;  5C2T A;  1PHH A;  5EB4 A;  1D4C A;  2C67 A;  2ZZ0 A;  3NN0 X;  3NYE A;  4H50 A;  2GQW A;  1DJN A;  2J3N A;  3AED A;  3NTD A;  4GDE A;  5C3J A;  4UDP A;  4NTE A;  1CHU A;  1GRH A;  2R0P A;  3EF6 A;  3KPK A;  2OLN A;  1Y56 B;  3ABV A;  5KNL A;  3Q6J A;  1CJC A;  3LZW A;  1E1M A;  3CGD A;  4Z2T A;  2Q0K A;  3V3O A;  3SZC A;  4EQR A;  1IUS A;  4U8M A;  1H7X A;  1D4E A;  3SYI A;  3F8D A;  4G74 A;  3SX6 A;  2YVF A;  4JNA A;  4CBQ A;  4ZN0 A;  2YLT A;  4GAP A;  1PBB A;  1D4D A;  3LB8 A;  3QFA A;  2C7G A;  3DH9 A;  3DGH A;  1CBO A;  1TYT A;  4BK2 A;  2GMJ A;  2WOI A;  3LXD A;  3QVP A;  2WHD A;  2B9W A;  2WU2 A;  1N1P A;  1BGJ A;  2VQB A;  3ZDN A;  1NHS A;  1L9C A;  1LVL A;  1MOK A;  2FBW A;  2Z5X A;  1Y56 A;  2YG7 A;  4O5U A;  2V60 A;  1PXC A;  4LU6 A;  4YKF A;  2FJD A;  2YLR A;  5KMR A;  1FL2 A;  1JRX A;  1YQZ A;  4H4Y A;  1ZOY A;  1E1L A;  3AEE A;  3ATQ A;  3K7T A;  1DOC A;  1P2E A;  4C77 A;  2A87 A;  1JNR A;  3SZW A;  3SQP A;  4Z2R A;  4AP3 A;  2YR6 A;  3NK2 X;  2H88 A;  3OC4 A;  3VR9 A;  1YY5 A;  4B65 A;  1TDE A;  4IVO B;  4BJZ A;  4BV6 A;  1FEB A;  4BJY A;  4GRT A;  3G5Q A;  4B69 A;  3GYI A;  4X9N A;  3AE7 A;  1TDO A;  2YLW A;  3I6D A;  2VOU A;  3OZ2 A;  4ICY A;  1K4Q A;  1PDH A;  1ZK7 A;  2GH5 A;  2WBA A;  5FS9 A;  4OPD A;  2YLS A;  4NTC A;  4YTM A;  3CGC A;  2B7S A;  3K7Q X;  2XLT A;  4H4Z A;  4B68 A;  5FMH A;  4OCG A;  3T2K A;  4AP1 A;  1XDI A;  2WET A;  3D1C A;  1F6M A;  5KMS A;  4K22 A; 
#chains in the Genus database with same CATH homology
 2IVD A;  1IUW A;  3KD9 A;  2WPC A;  2C76 A;  1GES A;  2BS3 A;  3AE4 A;  4J33 A;  1LTX R;  1GSN A;  1Q1W A;  4IA6 A;  1CJ2 A;  4DSG A;  2NVK X;  5JCM A;  3AEA A;  3GMC A;  4TM1 A;  2C3C A;  4OPC A;  1K0J A;  2XFN A;  3NRN A;  1V59 A;  1XPQ A;  3CPJ G;  3NKS A;  2V3A A;  5J60 A;  1Q1R A;  2XCG A;  4H4R A;  3DJD A;  3CGE A;  2YWL A;  1M64 A;  3URH A;  2E4G A;  1DOE A;  1M6I A;  1F8R A;  1ZX9 A;  2PHH A;  2XVH A;  1KFY A;  1L0V A;  3KA7 A;  4B63 A;  3JSK A;  3QSM A;  5KMQ A;  4OVI A;  1PJ7 A;  3CIR A;  4E0V A;  3PS9 A;  5HHF A;  3DGZ A;  3AYJ A;  4H4T A;  2B9Y A;  3S5W A;  3FBS A;  3GD4 A;  5FS7 A;  2GR2 A;  2YM2 A;  4Z2U A;  4B1B A;  3M12 A;  1TYP A;  3DJG X;  3C4N A;  2WPF A;  1PXA A;  1IUX A;  4G73 A;  3GDP A;  4NTD A;  4U8O A;  2DKI A;  3FG2 P;  2WS3 A;  1EL5 A;  4K5R A;  3V3N A;  5KVI A;  3CTY A;  3CNT A;  3UP5 A;  1HYU A;  4FDC B;  4DSH A;  4RG4 A;  2Q0L A;  1N4W A;  1S3B A;  2XFO A;  4NZH A;  4UP3 A;  4ZCD A;  4HA6 A;  3QVR A;  2VVM A;  2WU5 A;  3BHF A;  2X50 A;  2WEU A;  5KMP A;  2YG3 A;  1GAL A;  2WPE A;  3ICT A;  2WQY A;  4YTN A;  3UKL A;  4P9S A;  3M13 A;  4J2W A;  4AT0 A;  4G9K A;  3O0H A;  4YSX A;  3NK1 X;  4NEV A;  1B5Q A;  1F8W A;  1NDA A;  3E1T A;  5KRQ A;  4X4J A;  1GTE A;  2ARD A;  1JRY A;  3ICS A;  2GB0 A;  3HYX A;  3L8K A;  3KLJ A;  4H7U A;  4JY3 A;  1SEZ A;  3AE6 A;  3UKA A;  2VRL A;  3KVE A;  1BWC A;  3P1W A;  4A99 A;  2Y6R A;  1Q9I A;  2RGJ A;  3GMB A;  3COX A;  2GV8 A;  2VVL G;  3GWF A;  4A6N B;  3DME A;  4C3X A;  3AD8 B;  3RHA A;  5BUL A;  3RP8 A;  3AYI A;  3KKJ A;  4EMW A;  5KWF A;  2BC0 A;  4MJW A;  1BZL A;  2YR4 A;  2X3N A;  3T0K A;  1B4V A;  2VZ2 A;  2GEW A;  4Z43 A;  4HB9 A;  3DK8 A;  4B67 A;  1TDF A;  2E5V A;  4C3Y A;  1NG4 A;  1B8S A;  5JCK A;  2WP9 A;  3UOX A;  2IID A;  2ZZB A;  1S3E A;  4NNJ A;  2GRT A;  4ZCC A;  3NHO X;  4EMJ A;  4IVM B;  1P2H A;  5IPY A;  4APN A;  5GSN A;  1PBE A;  1KSU A;  1IUV A;  1K0I A;  1NEN A;  1VRQ B;  4NWZ A;  2XYO A;  4YSY A;  4OPU A;  4TLX A;  4FK1 A;  4U8L A;  2GAG B;  2EQ6 A;  2VVL A;  3RP7 A;  3UP4 A;  1RYI A;  1S2Q A;  1D7Y A;  1H84 A;  1QLB A;  2AAQ A;  3IF9 A;  2Q7V A;  3KPF A;  2R46 A;  4J34 A;  3NH3 X;  4CCQ A;  1PJ6 A;  3GSI A;  1ELI A;  4EQS A;  1GRA A;  2OAM A;  4Y4M A;  4GCM A;  4Z44 A;  1EBD A;  3UTE A;  5JCL A;  4H4Q A;  2V5Z A;  4BK1 A;  2TPR A;  2XVI A;  4U8K A;  1GRT A;  3DA1 A;  3GRS A;  4EQX A;  3NK0 X;  5BVA A;  1ZKQ A;  1KNP A;  1F8S A;  1Z6L A;  2YVG A;  4YTP A;  4H4U A;  2XLR A;  2BAC A;  3P9U A;  3FPZ A;  4CY6 A;  5IQ4 A;  1ZOV A;  5M10 A;  3SZF A;  1LJ1 A;  1ONF A;  1QO8 A;  1K0L A;  2AQJ A;  4FK1 C;  4BUR A;  3AEG A;  2WDR A;  3SM8 A;  4Y4N A;  1IUT A;  1OJC A;  3SY4 A;  4A79 A;  4IA5 A;  5CQF A;  2BK5 A;  2BXS A;  1PN0 A;  4OPL A;  1JOA A;  1N4V A;  3AE8 A;  4JY2 A;  3CNS A;  1GEU A;  2C65 A;  3HYW A;  3T2Y A;  3BI5 A;  3S61 A;  1CJ3 A;  1ZDL A;  4LA1 A;  3F8R A;  4EIP A;  2OA1 A;  1DXL A;  1OJT A;  4EM3 A;  5KOW A;  3UKP A;  3BI2 A;  1PBD A;  1VG0 A;  1YQ3 A;  3B3R A;  3EAN A;  2Z5Y A;  4OPT A;  4YKG A;  4U2T A;  3IWA A;  4XXG A;  3CNP A;  3UTG A;  2FJE A;  2IVE A;  4EIQ A;  5CKU A;  3NTA A;  5HY5 A;  3NN6 X;  3P4S A;  3P4Q A;  1NAA A;  5J7X A;  3EPT A;  3LOV A;  5M0Z A;  1VDC A;  1GT8 A;  2BA9 A;  4OPG A;  2GQF A;  4KX6 A;  3AB1 A;  2JK6 A;  3CPH G;  1LPF A;  4U8J A;  2V3B A;  3ICR A;  4Z25 A;  4WCT A;  4GF7 A;  1OJA A;  1NEK A;  2C66 A;  1CF3 A;  1QJD A;  1N4U A;  1PBF A;  1E7P A;  4J57 A;  3T37 A;  1GRF A;  3M0O A;  3K30 A;  1KNR A;  3IHG A;  4UDR A;  2V6O A;  2GF3 A;  3HYV A;  2O9Z A;  5BUK A;  2JB1 A;  4H2N A;  3ITJ A;  3V76 A;  2RGH A;  2WDQ A;  4JN9 A;  2V61 A;  3EAO A;  4FX9 A;  1REO A;  4AOX A;  1KDG A;  2B76 A;  3GRT A;  3AE9 A;  2GR3 A;  4GR1 A;  3VRB A;  3ALM A;  3BHK A;  3ALJ A;  1COY A;  2BK4 A;  1H83 A;  4A9W A;  3D8X A;  1H86 A;  3CND A;  4X9M A;  5L46 A;  4REK A;  1GET A;  3CPI G;  3NLC A;  4D04 A;  5ER0 A;  5JCI A;  3FMW A;  1XHC A;  3WE0 A;  1Y0P A;  1DJQ A;  1LQU A;  2XFU A;  4II2 A;  1OJD A;  5EB5 A;  2C72 A;  4M52 A;  3NIX A;  2EQ8 A;  3PO7 A;  4B66 A;  5KXJ A;  3AE5 A;  1PXB A;  1GPE A;  4A7A A;  2JKC A;  3CN8 A;  3VRD B;  3LJP A;  4K7Z A;  4DNA A;  2WDV A;  1JRZ A;  3AEF A;  2C73 A;  3DK9 A;  4GDP A;  2QA2 A;  4XWZ A;  5HXI A;  2AR8 A;  3LAD A;  2ZBW A;  2E1M A;  3QSE A;  4I59 A;  3SZ0 A;  4C5O A;  2YAU A;  2XLP A;  3NNE A;  4TM0 A;  3VQR A;  4AOS A;  3UKH A;  5U1O A;  1NG3 A;  4I58 A;  1VG9 A;  1FEC A;  2XVJ A;  4XWR A;  4DGK A;  5IQ1 A;  4YT0 A;  2R0C A;  2JB3 A;  2GR1 A;  4H4X A;  4H4V A;  2TMD A;  1EL7 A;  2VRM A;  2WES A;  2C4C A;  2YR5 A;  3UKK A;  4AT2 A;  2APG A;  5BRT A;  4NEW A;  4WX1 A;  1AOG A;  4CNK A;  1RP0 A;  3AE1 A;  4BK3 A;  2ACZ A;  2JAE A;  1S2Y A;  3IC9 A;  5JCN A;  2BCP A;  3CMM A;  3C4A A;  3KU9 A;  2FJA A;  4EM4 A;  1FEA A;  1BGN A;  2BAB A;  3AD9 B;  3G5R A;  1PBC A;  2GVC A;  3H4K A;  4H2R A;  1L9E A;  2C75 A;  3DK4 A;  1ZP0 A;  3GD3 A;  1X31 B;  4B64 A;  2OLO A;  3P4R A;  2VQ7 A;  2QCU A;  4A5L A;  3RED A;  3T31 A;  2CVJ A;  2QAE A;  1KF6 A;  1GV4 A;  5TR3 A;  2Y6Q A;  2XVF A;  3H8L A;  2X8C A;  1O95 A;  2CFY A;  2EQ7 A;  1TRB A;  1CC2 A;  3K7M X;  4YSH A;  4A6N A;  4H4W A;  1E1K A;  1E39 A;  2C64 A;  1DOB A;  1UKV G;  2FJB A;  1BF3 A;  1MO9 A;  2GMH A;  1YKJ A;  2XFQ A;  2EQ9 A;  2ZZC A;  2YG4 A;  3I3L A;  4OPI A;  2R4J A;  4CNJ A;  1JU2 A;  4C74 A;  3QSS A;  3SXI A;  2XDO A;  4UDQ A;  4D03 A;  2WOW A;  4H2P A;  4JDR A;  4GUV A;  3BI4 A;  2GAH B;  3DJJ A;  2H89 A;  4K2X A;  4H4P A;  2GR0 A;  4USQ A;  2YM1 A;  3BNM A;  3AYL A;  3VRA A;  5EOW A;  1LV0 A;  3GWD A;  1CJ4 A;  3NYF A;  5GRT A;  1IUU A;  3ZYX A;  1H7W A;  1B37 A;  3RP6 A;  1PS9 A;  2CDU A;  3Q9T A;  1TDN A;  4CCR A;  2JBV A;  4YWO A;  3NT6 A;  1O5W A;  1YQ4 A;  2PYX A;  2XLU A;  2RGO A;  3UTH A;  1NHP A;  4O5Q A;  1FOH A;  1DOD A;  2BK3 A;  5U25 A;  3BNU A;  1E6E A;  3VR8 A;  2BS2 A;  3ATR A;  3G5S A;  5EBK A;  3SGL A;  3AEC A;  3II4 A;  1E1N A;  1NHQ A;  4Z26 A;  3AXB A;  1GRB A;  1O94 A;  1PJ5 A;  3P4P A;  1EL8 A;  1EL9 A;  4RSL A;  4A65 A;  2R4E A;  2B9X A;  2DKH A;  3H8I A;  1VQW A;  3IHM A;  1XAN A;  3ADA B;  3QJ4 A;  4J36 A;  1FCD A;  5DBJ A;  3GYX A;  3UKF A;  1CC4 A;  2R0G A;  4U8P A;  1JNZ A;  1RSG A;  2NPX A;  4Y4L A;  2W0H A;  3NG7 X;  3GYJ A;  2XVE A;  5FS8 A;  4H4S A;  2WP6 A;  4RG3 A;  2BC1 A;  4TM4 A;  4YXD A;  2JB2 A;  4YSZ A;  2BXR A;  3CGB A;  4U8N A;  1NHR A;  3UOV A;  4II3 A;  1CC6 A;  2A8X A;  1ZY8 A;  2C70 A;  2YVJ A;  2X8G A;  3B6D A;  1ZMC A;  4ADW A;  3HZL A;  2YLZ A;  4LII A;  3ISH A;  4K8D A;  4K5S A;  1GND A;  2A89 A;  2OAL A;  2WP5 A;  1H82 A;  2R45 A;  2BS4 A;  4PAA A;  1TDK A;  2CUL A;  2YG6 A;  4JQ9 A;  3R9U A;  3UOZ A;  1GRE A;  3L1R A;  1H81 A;  1CL0 A;  5U63 A;  2YQU A;  3AD7 B;  3T14 A;  1D7L A;  4TLZ A;  2R9Z A;  1GRG A;  4ECH A;  4U8I A;  2F5Z A;  2XLS A;  3QFB A;  1W4X A;  3SFE A;  4J31 A;  1F3P A;  3F8P A;  4TM3 A;  2I0Z A;  4CRT A;  5KVH A;  2X8H A;  3DJE A;  4G6G A;  2HQM A;  4KPR A;  1GER A;  2Q6U A;  4G6H A;  3C96 A;  4U2L A;  4Z24 A;  3RNM A;  2BRY A;  1IJH A;  2WOV A;  3FIM B;  3PVC A;  3UOY A;  1H6V A;  2X99 A;  3ALL A;  3AE3 A;  3UTF A;  1JEH A;  4GAV A;  3UCL A;  3GDN A;  5LV9 A;  5KOX A;  2C3D A;  1OJ9 A;  2YG5 A;  3LZX A;  1L9D A;  4N9X A;  1MXT A;  4IV9 A;  4PAB A;  2B7R A;  1NPX A;  1DNC A;  3AEB A;  2BCG G;  1ZMD A;  3UKQ A;  3AE2 A;  4J56 A;  5FS6 A;  2UZZ A;  4EMI A;  4EQW A;  2BRA A;  2YLX A;  1LQT A;  2XFP A;  4CY8 A;  4JNQ A;  3AWI A;  1KSS A;  4USR A;  1GOS A;  1BKW A;  4H2Q A;  3SFD A;  1D5T A;  2BYB A;  3T2Z A;  3NGC X;  2QA1 A;  1GXF A;  4U2S A;  2RAB A;  3CNJ A;  3NYC A;  5HYM A;  1GTH A;  5C2T A;  1PHH A;  5EB4 A;  1D4C A;  2C67 A;  2ZZ0 A;  3NN0 X;  3NYE A;  4H50 A;  2GQW A;  1DJN A;  2J3N A;  3AED A;  3NTD A;  4GDE A;  5C3J A;  4UDP A;  4NTE A;  1CHU A;  1GRH A;  2R0P A;  3EF6 A;  3KPK A;  2OLN A;  1Y56 B;  3ABV A;  5KNL A;  3Q6J A;  1CJC A;  3LZW A;  1E1M A;  3CGD A;  4Z2T A;  2Q0K A;  3V3O A;  3SZC A;  4EQR A;  1IUS A;  4U8M A;  1H7X A;  1D4E A;  3SYI A;  3F8D A;  4G74 A;  3SX6 A;  2YVF A;  4JNA A;  4CBQ A;  4ZN0 A;  2YLT A;  4GAP A;  1PBB A;  1D4D A;  3LB8 A;  3QFA A;  2C7G A;  3DH9 A;  3DGH A;  1CBO A;  1TYT A;  4BK2 A;  2GMJ A;  2WOI A;  3LXD A;  3QVP A;  2WHD A;  2B9W A;  2WU2 A;  1N1P A;  1BGJ A;  2VQB A;  3ZDN A;  1NHS A;  1L9C A;  1LVL A;  1MOK A;  2FBW A;  2Z5X A;  1Y56 A;  2YG7 A;  4O5U A;  2V60 A;  1PXC A;  4LU6 A;  4YKF A;  2FJD A;  2YLR A;  5KMR A;  1FL2 A;  1JRX A;  1YQZ A;  4H4Y A;  1ZOY A;  1E1L A;  3AEE A;  3ATQ A;  3K7T A;  1DOC A;  1P2E A;  4C77 A;  2A87 A;  1JNR A;  3SZW A;  3SQP A;  4Z2R A;  4AP3 A;  2YR6 A;  3NK2 X;  2H88 A;  3OC4 A;  3VR9 A;  1YY5 A;  4B65 A;  1TDE A;  4IVO B;  4BJZ A;  4BV6 A;  1FEB A;  4BJY A;  4GRT A;  3G5Q A;  4B69 A;  3GYI A;  4X9N A;  3AE7 A;  1TDO A;  2YLW A;  3I6D A;  2VOU A;  3OZ2 A;  4ICY A;  1K4Q A;  1PDH A;  1ZK7 A;  2GH5 A;  2WBA A;  5FS9 A;  4OPD A;  2YLS A;  4NTC A;  4YTM A;  3CGC A;  2B7S A;  3K7Q X;  2XLT A;  4H4Z A;  4B68 A;  5FMH A;  4OCG A;  3T2K A;  4AP1 A;  1XDI A;  2WET A;  3D1C A;  1F6M A;  5KMS A;  4K22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...