3NK0X

Complex of 6-hydroxy-l-nicotine oxidase with inhibitor bound at active site and turnover product at exit cavity
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 149
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk0X02
3NKSA 4UDQA 1JOAA 2WPEA 1Q9IA 3AE3A 4C3XA 3GD3A 3AECA 3K30A 4FX9A 3CGBA 5FS8A 4EM3A 1L0VA 1CJ2A 5BVAA 3LZXA 2WU2A 4K5SA 3AD7B 3ADAB 1ZMCA 3URHA 4BK1A 4NTDA 1PBEA 4YSZA 4WX1A 2X99A 3AYLA 1LTXR 1AOGA 4B69A 3ABVA 4J57A 1RYIA 2XFPA 1ZOYA 1BWCA 1GTHA 2Y6RA 4NTCA 4XXGA 5TR3A 3UTGA 1TDOA 2XYOA 3HZLA 3PS9A 4JY3A 4TM3A 4BK3A 4EQWA 2EQ9A 2ZZCA 1LV0A 2RGOA 4JQ9A 2J3NA 1D7YA 3QSMA 4A79A 1KDGA 1DODA 1TDEA 1Y56A 1ZKQA 5BRTA 3ICTA 2GVCA 3ITJA 1B8SA 3DJGX 3KD9A 3P4QA 2YLRA 1MOKA 3F8DA 4U8PA 4U2TA 2WP9A 2GR2A 1ZP0A 4EQXA 1ELIA 2NPXA 4IA6A 4OPDA 2BC0A 4Z24A 4AP3A 5KRQA 3K7MX 4H50A 4HA6A 1MXTA 1NHQA 1Y0PA 1E1NA 3EAOA 2DKHA 4EM4A 4PAAA 3K7TA 1XDIA 4J33A 3AEBA 1QLBA 3LOVA 4UDRA 1PXCA 1K0LA 1D4EA 1KF6A 3UKAA 3UTHA 3AE9A 4BJYA 4Z25A 5KWFA 3AEGA 5J60A 1CJ4A 5KVHA 2C66A 2WOIA 3DGZA 3F8RA 2WDQA 4YKFA 2GF3A 2JBVA 3AE8A 3LJPA 3ZYXA 3LADA 1CJCA 1ONFA 3CNTA 3EPTA 3Q9TA 2R0CA 1IUTA 2YLXA 4CCRA 4Y4LA 3FIMB 5JCLA 1LVLA 1IUVA 4ADWA 5HYMA 4Z26A 4X9NA 5BUKA 5C2TA 2YG3A 3DMEA 3F8PA 3OZ2A 4XWZA 2BYBA 1NHPA 4A6NB 1O94A 4GR1A 5BULA 1L9EA 2CFYA 2R4EA 2R46A 3D8XA 4EQRA 2EQ8A 3FPZA 3NT6A 3P4PA 1KSSA 3NRNA 5JCIA 2FJAA 3QSSA 3RP8A 3DGHA 4FDCB 1N1PA 4TM1A 5CQFA 4H4TA 2V61A 3NH3X 3PO7A 4H7UA 2A89A 3C96A 5EB4A 2Y6QA 2VQBA 3QJ4A 3NK1X 3RP7A 3AEAA 4K22A 4M52A 4B63A 4OPLA 5CKUA 3NGCX 2EQ7A 3ALMA 4H4PA 2QA2A 1REOA 3NN6X 2B9WA 1PJ6A 3C4NA 3DJJA 5M0ZA 2RGHA 2VRLA 4H4RA 3GDPA 4CNJA 2YLSA 4EIQA 3EF6A 2XVJA 1N4UA 5JCKA 1PBBA 1OJDA 1QJDA 3UCLA 3NYEA 3UOZA 1JNZA 4H2RA 3NG7X 2YG7A 4MJWA 3AYJA 1YY5A 2BCGG 2Q7VA 4NEWA 3GWDA 2XLUA 2YLTA 4ZN0A 2WOWA 3SFEA 1GETA 3RHAA 1N4VA 1PJ7A 3H8IA 4YKGA 2UZZA 2ZZ0A 2Z5YA 4IA5A 3SFDA 3QFBA 3QSEA 5KVIA 4A6NA 2WQYA 3CGCA 3E1TA 4B67A 2VVLA 2GAHB 1CBOA 3Q6JA 2VVMA 3DK9A 1VG0A 3DA1A 3ICSA 3I3LA 1D4CA 1NHRA 5KXJA 2YG5A 4OCGA 2BK5A 2OALA 1TYPA 3NK2X 3C4AA 3UKLA 1BZLA 1BGNA 2BACA 2CULA 2RABA 1EL7A 2HQMA 2YQUA 3VRBA 2XVFA 1LQUA 1IUSA 2XVIA 2YG4A 2GMHA 1DOBA 3CGDA 4J56A 4LA1A 3BHFA 2Q0KA 3IC9A 4U8MA 4UP3A 2XFQA 2WBAA 1PHHA 1F8SA 3R9UA 4H4XA 1PBDA 1KNPA 3DK8A 3VRAA 5L46A 2R0PA 1JEHA 4O5UA 4B1BA 4B64A 1O95A 1FCDA 2C70A 3CPHG 4OPTA 3REDA 1IUUA 1PJ5A 3L1RA 2GR0A 3L8KA 4YWOA 2WPFA 1W4XA 3VR9A 4LIIA 2WPCA 3ISHA 2JB1A 4H4VA 4XWRA 5J7XA 1XHCA 4WCTA 4AT0A 2XFNA 2E4GA 4C74A 4OPGA 2BC1A 3ALLA 3II4A 3NTDA 1GNDA 2YR6A 1N4WA 3G5SA 3H8LA 4BJZA 1Q1WA 3BHKA 2JB3A 4ZCDA 1H7WA 2GMJA 3UP4A 4H4YA 3AE7A 1YQZA 4AT2A 1CJ3A 1YKJA 2VOUA 1JRZA 2YAUA 1P2HA 2VVLG 4DNAA 1JRXA 3ATQA 3M0OA 2WOVA 3ZDNA 2XLPA 4GDPA 2YWLA 2DKIA 3OC4A 4CRTA 4Z2TA 2WP5A 3AEEA 3AE1A 2QCUA 1GRHA 1KFYA 1D5TA 2XCGA 3DK4A 2H89A 4YXDA 1XANA 2B76A 4C5OA 3NNEA 2B9XA 3GDNA 5U25A 3VRDB 3CN8A 3UKKA 3UP5A 2GQFA 2W0HA 4ZCCA 4BV6A 1B37A 2GR1A 1TRBA 4OPIA 5EB5A 5FMHA 3IHGA 4IVMB 3EANA 4EQSA 4J36A 2C67A 3CNDA 4Z2UA 4H4WA 4K8DA 4USQA 1GRFA 1K0JA 3AD8B 5EBKA 4YTMA 4RSLA 3V3OA 2A8XA 1L9DA 1Z6LA 3GRSA 5U1OA 4A9WA 4D03A 4Z44A 1B4VA 1E1KA 2PYXA 3ATRA 1YQ3A 2C76A 1S2QA 5EOWA 2APGA 1GT8A 2GV8A 2A87A 2BS3A 1F8WA 2BXRA 2X50A 2B7SA 4K5RA 3VQRA 3LXDA 1P2EA 3IHMA 3S61A 4TM0A 3CNSA 2TMDA 2FJDA 2PHHA 1K0IA 1PXAA 1DXLA 2V3BA 2XDOA 1GREA 1GOSA 4EMJA 3M12A 2GAGB 4B65A 2R4JA 1H83A 1BF3A 3CTYA 1FOHA 3BNMA 5DBJA 2WETA 5HY5A 2QA1A 4NTEA 4H2NA 2X3NA 3GMCA 1NPXA 4CY6A 1EL9A 1NG3A 3KKJA 2C64A 1X31B 2XLTA 1O5WA 1H86A 3M13A 3SQPA 2RGJA 3KU9A 4U8LA 3BNUA 4JDRA 2C7GA 3SGLA 3UOYA 2BK3A 3AEDA 3K7QX 3RP6A 3CGEA 2IVEA 2Q0LA 2ACZA 1E1LA 2YVFA 1DJNA 4H4QA 4NZHA 3UKHA 1GPEA 2VQ7A 2E1MA 5HHFA 1H82A 1L9CA 2O9ZA 3ALJA 3CPJG 3UOVA 3BI5A 2C3DA 3COXA 5IQ1A 1ZK7A 1Q1RA 2V6OA 2FJBA 3GWFA 1ZMDA 1Y56B 1GERA 2IIDA 3IF9A 1K4QA 3KA7A 2WDRA 3P4SA 4OPCA 4H4SA 3CNJA 1CC6A 1LQTA 1ZOVA 2GB0A 3RNMA 3GRTA 3PVCA 2WESA 2CDUA 4I58A 4U8JA 3P9UA 4JN9A 3FBSA 5FS6A 4CCQA 1FECA 1LPFA 2CVJA 2JAEA 3CNPA 3T37A 4UDPA 3LB8A 3V3NA 3P4RA 3IWAA 2V3AA 3AWIA 4O5QA 4AOXA 4EMIA 5M10A 1LJ1A 4FK1C 4JNAA 1IUXA 1HYUA 2F5ZA 3DH9A 2QAEA 1XPQA 1E6EA 1KNRA 4IVOB 1CC4A 4X4JA 5C3JA 1BGJA 2YR5A 3NK0X 4U8OA 1COYA 1E39A 4YSXA 3G5RA 2OAMA 1VQWA 3GMBA 2GEWA 1IUWA 3AEFA 1YQ4A 3AE2A 4A99A 5IPYA 3O0HA 4H2PA 3AE6A 3B3RA 4NEVA 3UOXA 5FS9A 1S2YA 1ZDLA 2YVGA 3UTEA 2YLZA 2AAQA 2WP6A 2XFOA 4EMWA 1JRYA 1F6MA 5FS7A 1H6VA 5JCNA 4N9XA 2JB2A 4TLXA 1M64A 1B5QA 1ZY8A 1H7XA 1V59A 4H4ZA 1H84A 4ECHA 3AE4A 4GRTA 1GXFA 4U2SA 3UKQA 2WU5A 1RP0A 3JSKA 1OJAA 2R0GA 3NN0X 4DSGA 3CIRA 3ICRA 1EL8A 1GSNA 3V76A 3D1CA 3VR8A 1ZX9A 2C72A 1RSGA 4B68A 4LU6A 4AP1A 4C77A 4YSYA 4E0VA 3NYCA 1VDCA 4IV9A 1PBFA 1GALA 4Z43A 1S3EA 4TLZA 1M6IA 2XVEA 3QFAA 4K2XA 1DJQA 1TDKA 2FJEA 2XLSA 2H88A 4KPRA 1D4DA 1TDNA 3GYJA 4KX6A 2XFUA 2Q6UA 1NHSA 1F3PA 2XLRA 4DGKA 2X8HA 4Z2RA 2BS4A 3BI4A 2OLOA 1TDFA 4B66A 2B7RA 2GH5A 3SM8A 2V60A 2BA9A 1OJ9A 4A7AA 2ZZBA 4JY2A 2JKCA 4U2LA 1UKVG 4A5LA 1NEKA 1GEUA 2YM1A 3GYIA 4TM4A 2AQJA 4YTNA 2B9YA 4DSHA 5ER0A 5U63A 4YSHA 1GESA 2C73A 1FL2A 2R45A 4I59A 2R9ZA 1DOCA 4J31A 2YM2A 5HXIA 4C3YA 1MO9A 3AXBA 5GSNA 2OLNA 1GRBA 2XVHA 1PDHA 4BURA 1OJCA 2BS2A 1GRAA 3KVEA 2ZBWA 5KOWA 3NLCA 2VZ2A 4JNQA 3H4KA 3FG2P 2TPRA 2WEUA 3QVRA 2YR4A 3DJEA 3KLJA 4GDEA 1GRGA 1DNCA 3AYIA 3UTFA 2X8CA 3UKFA 4APNA 4YT0A 4GCMA 4USRA 1E1MA 1NDAA 4X9MA 1TYTA 4H2QA 1PBCA 3AE5A 2ARDA 3AD9B 1BKWA 1CF3A 1VRQB 1SEZA 1GV4A 2GQWA 3CPIG 4U8NA 2GRTA 1F8RA 3P1WA 2I0ZA 4EIPA 1GTEA 5KOXA 2JK6A 2YG6A 1CL0A 1EL5A 1PN0A 3KPFA 4ICYA 4CY8A 2FBWA 2GR3A 1PXBA 2YVJA 3BI2A 2NVKX 1QO8A 4CNKA 4YTPA 3NHOX 2WHDA 3DJDA 2BCPA 3FMWA 4REKA 5GRTA 2BK4A 2YLWA 1H81A 4CBQA 5LV9A 1D7LA 2C75A 4D04A 4U8IA 1OJTA 1KSUA 2WDVA 5JCMA 1CHUA 4RG4A 2AR8A 4Y4MA 2IVDA 4A65A 1FEAA 2BXSA 1PS9A 2C3CA 2WS3A 4OPUA 4PABA 4OVIA 1DOEA 1NENA 3B6DA 1IJHA 3UKPA 3LZWA 4H4UA 3S5WA 3WE0A 2C65A 3GD4A 3I6DA 4U8KA 1FEBA 1S3BA 2BABA 1VG9A 1NG4A 2OA1A 5IQ4A 4HB9A 4J34A 1NAAA 1JU2A 2E5VA 4J2WA 1E7PA 3NTAA 4GUVA 1EBDA 3G5QA 4BK2A 4AOSA 2EQ6A 2V5ZA 3NYFA 3QVPA 4RG3A 1GRTA 3NIXA 4GF7A 1CC2A 2VRMA 4FK1A 4K7ZA 2Z5XA 4P9SA 3GSIA 1JNRA 3AB1A 4Y4NA 2X8GA
chains in the Genus database with same CATH superfamily
3NKSA 4UDQA 1JOAA 2WPEA 1Q9IA 3AE3A 4C3XA 3GD3A 3AECA 3K30A 4FX9A 3CGBA 5FS8A 4EM3A 1L0VA 1CJ2A 5BVAA 3LZXA 2WU2A 4K5SA 3AD7B 3ADAB 1ZMCA 3URHA 4BK1A 4NTDA 1PBEA 3SZCA 4YSZA 4WX1A 2X99A 3AYLA 1LTXR 1AOGA 4B69A 3ABVA 4J57A 1RYIA 2XFPA 4G73A 1ZOYA 1BWCA 1GTHA 2Y6RA 4NTCA 4XXGA 5TR3A 3UTGA 1TDOA 2XYOA 3HZLA 3PS9A 4JY3A 4TM3A 4BK3A 4EQWA 2EQ9A 2ZZCA 1LV0A 2RGOA 4JQ9A 2J3NA 1D7YA 3QSMA 4A79A 1KDGA 1DODA 1TDEA 1Y56A 1ZKQA 5BRTA 3ICTA 2GVCA 3ITJA 1B8SA 3DJGX 3KD9A 3P4QA 2YLRA 1MOKA 3F8DA 4U8PA 4U2TA 2WP9A 2GR2A 1ZP0A 4EQXA 1ELIA 2NPXA 4IA6A 4OPDA 2BC0A 4Z24A 3SXIA 4AP3A 5KRQA 3K7MX 4H50A 4HA6A 1MXTA 1NHQA 1Y0PA 1E1NA 3EAOA 2DKHA 4EM4A 4PAAA 3K7TA 1XDIA 4J33A 3AEBA 1QLBA 3LOVA 4UDRA 1PXCA 1K0LA 1D4EA 1KF6A 3UKAA 3UTHA 3AE9A 4BJYA 4Z25A 5KWFA 3AEGA 4G9KA 1CJ4A 5J60A 5KVHA 4II2A 2C66A 2WOIA 3DGZA 4G6HA 3F8RA 2WDQA 4YKFA 2GF3A 2JBVA 3AE8A 3LJPA 3ZYXA 3LADA 1CJCA 1ONFA 3CNTA 3EPTA 3Q9TA 2R0CA 1IUTA 2YLXA 4CCRA 4Y4LA 3FIMB 5JCLA 1LVLA 1IUVA 4ADWA 5HYMA 4Z26A 4X9NA 5BUKA 5C2TA 2YG3A 3DMEA 3F8PA 3OZ2A 4XWZA 2BYBA 1NHPA 4A6NB 1O94A 4GR1A 5BULA 1L9EA 2CFYA 2R4EA 2R46A 3D8XA 4EQRA 2EQ8A 3FPZA 3NT6A 3P4PA 1KSSA 3NRNA 5JCIA 2FJAA 3QSSA 3RP8A 3DGHA 4FDCB 1N1PA 4TM1A 4II3A 4H4TA 2V61A 3GYXA 3NH3X 3PO7A 4H7UA 2A89A 5CQFA 3C96A 5EB4A 2Y6QA 2VQBA 3QJ4A 3NK1X 3RP7A 3AEAA 4K22A 4GAPA 4M52A 4B63A 4OPLA 5CKUA 3NGCX 2EQ7A 3ALMA 4H4PA 2QA2A 1REOA 3NN6X 2B9WA 1PJ6A 3C4NA 3DJJA 5M0ZA 2RGHA 2VRLA 4H4RA 3SYIA 3GDPA 4CNJA 2YLSA 4EIQA 3EF6A 2XVJA 1N4UA 5JCKA 1PBBA 1OJDA 1QJDA 3UCLA 3NYEA 3UOZA 1JNZA 4H2RA 3NG7X 5KNLA 2YG7A 3HYWA 4MJWA 3AYJA 1YY5A 2BCGG 2Q7VA 4NEWA 3GWDA 2XLUA 2YLTA 4ZN0A 2WOWA 3SFEA 1GETA 3RHAA 1N4VA 1PJ7A 3H8IA 4YKGA 2UZZA 2ZZ0A 2Z5YA 3HYVA 4IA5A 3SFDA 3QFBA 3QSEA 5KVIA 4A6NA 2WQYA 3CGCA 3E1TA 4B67A 2VVLA 2GAHB 1CBOA 3SY4A 3Q6JA 2VVMA 3DK9A 3T0KA 1VG0A 3DA1A 3ICSA 3I3LA 1D4CA 1NHRA 5KXJA 2YG5A 4OCGA 2BK5A 2OALA 1TYPA 3NK2X 3C4AA 3UKLA 1BZLA 1BGNA 2BACA 2CULA 2RABA 1EL7A 2HQMA 2YQUA 3VRBA 2XVFA 1LQUA 1IUSA 2XVIA 2YG4A 2GMHA 1DOBA 3CGDA 4J56A 4LA1A 3BHFA 2Q0KA 3IC9A 4U8MA 4UP3A 2XFQA 2WBAA 1PHHA 1F8SA 3R9UA 4H4XA 1PBDA 1KNPA 3DK8A 3VRAA 5L46A 2R0PA 1JEHA 4O5UA 4B1BA 4B64A 1O95A 1FCDA 2C70A 3SZ0A 3CPHG 4OPTA 3REDA 1IUUA 1PJ5A 3L1RA 2GR0A 3L8KA 4YWOA 2WPFA 1W4XA 3VR9A 4LIIA 2WPCA 3ISHA 2JB1A 4H4VA 4XWRA 5J7XA 1XHCA 4WCTA 4AT0A 2XFNA 2E4GA 4C74A 4OPGA 2BC1A 3ALLA 3II4A 3NTDA 1GNDA 2YR6A 1N4WA 3G5SA 3H8LA 4BJZA 1Q1WA 3BHKA 2JB3A 4ZCDA 1H7WA 2GMJA 3UP4A 4H4YA 3AE7A 1YQZA 4AT2A 1CJ3A 1YKJA 2VOUA 1JRZA 2YAUA 1P2HA 2VVLG 4DNAA 1JRXA 3ATQA 3M0OA 2WOVA 3ZDNA 2XLPA 4GDPA 2YWLA 2DKIA 3OC4A 4CRTA 4Z2TA 2WP5A 3AEEA 3AE1A 2QCUA 1GRHA 1KFYA 1D5TA 2XCGA 3DK4A 2H89A 4YXDA 1XANA 2B76A 4NNJA 4C5OA 3NNEA 2B9XA 3GDNA 5U25A 3VRDB 3CN8A 3UKKA 3UP5A 2GQFA 2W0HA 4ZCCA 3SZWA 4BV6A 3KPKA 1B37A 2GR1A 1TRBA 4OPIA 5EB5A 5FMHA 3IHGA 4IVMB 3EANA 4EQSA 4J36A 2C67A 3CNDA 4Z2UA 4H4WA 4K8DA 4USQA 1GRFA 1K0JA 3AD8B 5EBKA 4YTMA 4RSLA 3V3OA 2A8XA 1L9DA 1Z6LA 3GRSA 5U1OA 4A9WA 4D03A 4Z44A 1B4VA 1E1KA 2PYXA 3ATRA 1YQ3A 2C76A 1S2QA 5EOWA 2APGA 1GT8A 2GV8A 2A87A 2BS3A 1F8WA 2BXRA 2X50A 2B7SA 4K5RA 4GAVA 3LXDA 3VQRA 1P2EA 3IHMA 3S61A 4TM0A 3CNSA 4G74A 2TMDA 2FJDA 2PHHA 1K0IA 1PXAA 1DXLA 2V3BA 2XDOA 3T2KA 1GREA 1GOSA 4EMJA 3M12A 2GAGB 5KMQA 4B65A 2R4JA 1H83A 1BF3A 3CTYA 1FOHA 3BNMA 5DBJA 2WETA 5HY5A 2QA1A 4NTEA 4H2NA 2X3NA 3GMCA 1NPXA 4CY6A 4G6GA 1EL9A 1NG3A 3KKJA 2C64A 1X31B 2XLTA 1O5WA 1H86A 3M13A 3SQPA 2RGJA 3KU9A 4U8LA 3BNUA 2BRYA 2C7GA 4JDRA 3SGLA 3UOYA 2BK3A 3AEDA 3K7QX 3RP6A 3CGEA 2IVEA 2Q0LA 2ACZA 1E1LA 2YVFA 1DJNA 4H4QA 4NZHA 3UKHA 1GPEA 2VQ7A 2E1MA 5HHFA 1H82A 1L9CA 2O9ZA 3ALJA 3CPJG 3UOVA 3BI5A 2C3DA 3COXA 5IQ1A 1ZK7A 1Q1RA 2V6OA 3T14A 2FJBA 3GWFA 1ZMDA 1Y56B 1GERA 2IIDA 3IF9A 1K4QA 3KA7A 2WDRA 3P4SA 4OPCA 4H4SA 3CNJA 1CC6A 1LQTA 1ZOVA 5KMSA 2GB0A 3RNMA 3GRTA 3PVCA 2WESA 2CDUA 4I58A 4U8JA 3P9UA 4JN9A 3FBSA 5FS6A 4CCQA 1FECA 3SX6A 1LPFA 2CVJA 2JAEA 3CNPA 3T37A 4UDPA 3LB8A 3V3NA 3P4RA 3IWAA 2V3AA 5KMRA 3AWIA 4O5QA 4AOXA 4EMIA 5M10A 1LJ1A 4FK1C 4JNAA 1IUXA 1HYUA 2F5ZA 3DH9A 2QAEA 1XPQA 1E6EA 1KNRA 4IVOB 1CC4A 4X4JA 5C3JA 1BGJA 2YR5A 3NK0X 4U8OA 1COYA 1E39A 3T2ZA 3G5RA 4YSXA 2OAMA 1VQWA 3GMBA 2GEWA 1IUWA 3AEFA 1YQ4A 3AE2A 4A99A 5IPYA 3O0HA 4H2PA 3AE6A 3B3RA 4NEVA 3UOXA 5FS9A 1S2YA 1ZDLA 2YVGA 3UTEA 2YLZA 2AAQA 2WP6A 2XFOA 4EMWA 1JRYA 1F6MA 5FS7A 1H6VA 5JCNA 4N9XA 2JB2A 4TLXA 1M64A 1B5QA 1ZY8A 1H7XA 1V59A 4H4ZA 1H84A 4ECHA 3AE4A 4GRTA 1GXFA 4U2SA 3UKQA 2WU5A 1RP0A 3JSKA 1OJAA 2R0GA 3NN0X 4DSGA 3CIRA 3ICRA 1EL8A 1GSNA 3V76A 3D1CA 3VR8A 1ZX9A 2C72A 1RSGA 4B68A 4LU6A 4AP1A 4C77A 4YSYA 4E0VA 2BRAA 1VDCA 3NYCA 1PBFA 1GALA 4IV9A 1S3EA 4Z43A 4TLZA 1M6IA 2XVEA 3QFAA 4K2XA 1DJQA 5KMPA 1TDKA 2FJEA 2XLSA 2H88A 4KPRA 1D4DA 1TDNA 3GYJA 4KX6A 2XFUA 2Q6UA 1NHSA 4NWZA 1F3PA 2XLRA 3T31A 2X8HA 4DGKA 4Z2RA 2BS4A 3HYXA 3BI4A 2OLOA 1TDFA 4B66A 2B7RA 2GH5A 3SM8A 2V60A 2BA9A 1OJ9A 4A7AA 2ZZBA 4JY2A 2JKCA 4U2LA 1UKVG 4A5LA 1NEKA 1GEUA 2YM1A 3GYIA 4TM4A 2AQJA 4YTNA 2B9YA 4DSHA 5ER0A 5U63A 4YSHA 1GESA 2C73A 1FL2A 2R45A 4I59A 3T2YA 2R9ZA 1DOCA 4J31A 2YM2A 5HXIA 4C3YA 1MO9A 3AXBA 5GSNA 2OLNA 1GRBA 2XVHA 1PDHA 4BURA 1OJCA 2BS2A 1GRAA 3KVEA 2C4CA 2ZBWA 5KOWA 3NLCA 2VZ2A 4JNQA 3H4KA 3FG2P 2TPRA 2WEUA 3QVRA 2YR4A 3DJEA 3KLJA 4GDEA 1GRGA 1DNCA 3AYIA 3UTFA 2X8CA 3UKFA 4APNA 4YT0A 4GCMA 4USRA 1E1MA 1NDAA 4X9MA 1TYTA 4H2QA 1PBCA 3AE5A 2ARDA 3AD9B 1BKWA 1CF3A 1VRQB 1SEZA 1GV4A 2GQWA 3CPIG 4U8NA 2GRTA 1F8RA 3P1WA 2I0ZA 4EIPA 1GTEA 5KOXA 2JK6A 2YG6A 1CL0A 1EL5A 1PN0A 3KPFA 4ICYA 4CY8A 2FBWA 2GR3A 1PXBA 2YVJA 3BI2A 2NVKX 1QO8A 4CNKA 4YTPA 3NHOX 2WHDA 3DJDA 2BCPA 3FMWA 4REKA 5GRTA 2BK4A 2YLWA 1H81A 4CBQA 5LV9A 1D7LA 2C75A 4D04A 4U8IA 1OJTA 1KSUA 2WDVA 5JCMA 1CHUA 4RG4A 2AR8A 4Y4MA 2IVDA 4A65A 1FEAA 3CMMA 2BXSA 1PS9A 2C3CA 2WS3A 4OPUA 4PABA 4OVIA 1DOEA 1NENA 3B6DA 1IJHA 3SZFA 3UKPA 3LZWA 4H4UA 3S5WA 3WE0A 2C65A 3GD4A 3I6DA 4U8KA 1FEBA 1S3BA 2BABA 1VG9A 1NG4A 2OA1A 5IQ4A 4HB9A 4J34A 1NAAA 1JU2A 2E5VA 4J2WA 1E7PA 3NTAA 4GUVA 1EBDA 3G5QA 4BK2A 4AOSA 2EQ6A 2V5ZA 3NYFA 3QVPA 4RG3A 1GRTA 3NIXA 4GF7A 1CC2A 2VRMA 4FK1A 4K7ZA 2Z5XA 4P9SA 3GSIA 1JNRA 3AB1A 4Y4NA 2X8GA
chains in the Genus database with same CATH topology
3NKSA 4UDQA 1JOAA 2WPEA 1Q9IA 3AE3A 4C3XA 3GD3A 3AECA 3K30A 4FX9A 3CGBA 5FS8A 4EM3A 1L0VA 1CJ2A 5BVAA 3LZXA 2WU2A 4K5SA 3AD7B 3ADAB 1ZMCA 3URHA 4BK1A 4NTDA 1PBEA 3SZCA 4YSZA 4WX1A 2X99A 3AYLA 1LTXR 1AOGA 4B69A 3ABVA 4J57A 1RYIA 2XFPA 4G73A 1ZOYA 1BWCA 1GTHA 2Y6RA 4NTCA 4XXGA 5TR3A 3UTGA 1TDOA 2XYOA 3HZLA 3PS9A 4JY3A 4TM3A 4BK3A 4EQWA 2EQ9A 2ZZCA 1LV0A 2RGOA 4JQ9A 2J3NA 1D7YA 3QSMA 4A79A 1KDGA 1DODA 1TDEA 1Y56A 1ZKQA 5BRTA 3ICTA 2GVCA 3ITJA 1B8SA 3DJGX 3KD9A 3P4QA 2YLRA 1MOKA 3F8DA 4U8PA 4U2TA 2WP9A 2GR2A 1ZP0A 4EQXA 1ELIA 2NPXA 4IA6A 4OPDA 2BC0A 4Z24A 3SXIA 4AP3A 5KRQA 3K7MX 4H50A 4HA6A 1MXTA 1NHQA 1Y0PA 1E1NA 3EAOA 2DKHA 4EM4A 4PAAA 3K7TA 1XDIA 4J33A 3AEBA 1QLBA 3LOVA 4UDRA 1PXCA 1K0LA 1D4EA 1KF6A 3UKAA 3UTHA 3AE9A 4BJYA 4Z25A 5KWFA 3AEGA 4G9KA 1CJ4A 5J60A 5KVHA 4II2A 2C66A 2WOIA 3DGZA 4G6HA 3F8RA 2WDQA 4YKFA 2GF3A 2JBVA 3AE8A 3LJPA 3ZYXA 3LADA 1CJCA 1ONFA 3CNTA 3EPTA 3Q9TA 2R0CA 1IUTA 2YLXA 4CCRA 4Y4LA 3FIMB 5JCLA 1LVLA 1IUVA 4ADWA 5HYMA 4Z26A 4X9NA 5BUKA 5C2TA 2YG3A 3DMEA 3F8PA 3OZ2A 4XWZA 2BYBA 1NHPA 4A6NB 1O94A 4GR1A 5BULA 1L9EA 2CFYA 2R4EA 2R46A 3D8XA 4EQRA 2EQ8A 3FPZA 3NT6A 3P4PA 1KSSA 3NRNA 5JCIA 2FJAA 3QSSA 3RP8A 3DGHA 4FDCB 1N1PA 4TM1A 4II3A 4H4TA 2V61A 3GYXA 3NH3X 3PO7A 4H7UA 2A89A 5CQFA 3C96A 5EB4A 2Y6QA 2VQBA 3QJ4A 3NK1X 3RP7A 3AEAA 4K22A 4GAPA 4M52A 4B63A 4OPLA 5CKUA 3NGCX 2EQ7A 3ALMA 4H4PA 2QA2A 1REOA 3NN6X 2B9WA 1PJ6A 3C4NA 3DJJA 5M0ZA 2RGHA 2VRLA 4H4RA 3SYIA 3GDPA 4CNJA 2YLSA 4EIQA 3EF6A 2XVJA 1N4UA 5JCKA 1PBBA 1OJDA 1QJDA 3UCLA 3NYEA 3UOZA 1JNZA 4H2RA 3NG7X 5KNLA 2YG7A 3HYWA 4MJWA 3AYJA 1YY5A 2BCGG 2Q7VA 4NEWA 3GWDA 2XLUA 2YLTA 4ZN0A 2WOWA 3SFEA 1GETA 3RHAA 1N4VA 1PJ7A 3H8IA 4YKGA 2UZZA 2ZZ0A 2Z5YA 3HYVA 4IA5A 3SFDA 3QFBA 3QSEA 5KVIA 4A6NA 2WQYA 3CGCA 3E1TA 4B67A 2VVLA 2GAHB 1CBOA 3SY4A 3Q6JA 2VVMA 3DK9A 3T0KA 1VG0A 3DA1A 3ICSA 3I3LA 1D4CA 1NHRA 5KXJA 2YG5A 4OCGA 2BK5A 2OALA 1TYPA 3NK2X 3C4AA 3UKLA 1BZLA 1BGNA 2BACA 2CULA 2RABA 1EL7A 2HQMA 2YQUA 3VRBA 2XVFA 1LQUA 1IUSA 2XVIA 2YG4A 2GMHA 1DOBA 3CGDA 4J56A 4LA1A 3BHFA 2Q0KA 3IC9A 4U8MA 4UP3A 2XFQA 2WBAA 1PHHA 1F8SA 3R9UA 4H4XA 1PBDA 1KNPA 3DK8A 3VRAA 5L46A 2R0PA 1JEHA 4O5UA 4B1BA 4B64A 1O95A 1FCDA 2C70A 3SZ0A 3CPHG 4OPTA 3REDA 1IUUA 1PJ5A 3L1RA 2GR0A 3L8KA 4YWOA 2WPFA 1W4XA 3VR9A 4LIIA 2WPCA 3ISHA 2JB1A 4H4VA 4XWRA 5J7XA 1XHCA 4WCTA 4AT0A 2XFNA 2E4GA 4C74A 4OPGA 2BC1A 3ALLA 3II4A 3NTDA 1GNDA 2YR6A 1N4WA 3G5SA 3H8LA 4BJZA 1Q1WA 3BHKA 2JB3A 4ZCDA 1H7WA 2GMJA 3UP4A 4H4YA 3AE7A 1YQZA 4AT2A 1CJ3A 1YKJA 2VOUA 1JRZA 2YAUA 1P2HA 2VVLG 4DNAA 1JRXA 3ATQA 3M0OA 2WOVA 3ZDNA 2XLPA 4GDPA 2YWLA 2DKIA 3OC4A 4CRTA 4Z2TA 2WP5A 3AEEA 3AE1A 2QCUA 1GRHA 1KFYA 1D5TA 2XCGA 3DK4A 2H89A 4YXDA 1XANA 2B76A 4NNJA 4C5OA 3NNEA 2B9XA 3GDNA 5U25A 3VRDB 3CN8A 3UKKA 3UP5A 2GQFA 2W0HA 4ZCCA 3SZWA 4BV6A 3KPKA 1B37A 2GR1A 1TRBA 4OPIA 5EB5A 5FMHA 3IHGA 4IVMB 3EANA 4EQSA 4J36A 2C67A 3CNDA 4Z2UA 4H4WA 4K8DA 4USQA 1GRFA 1K0JA 3AD8B 5EBKA 4YTMA 4RSLA 3V3OA 2A8XA 1L9DA 1Z6LA 3GRSA 5U1OA 4A9WA 4D03A 4Z44A 1B4VA 1E1KA 2PYXA 3ATRA 1YQ3A 2C76A 1S2QA 5EOWA 2APGA 1GT8A 2GV8A 2A87A 2BS3A 1F8WA 2BXRA 2X50A 2B7SA 4K5RA 4GAVA 3LXDA 3VQRA 1P2EA 3IHMA 3S61A 4TM0A 3CNSA 4G74A 2TMDA 2FJDA 2PHHA 1K0IA 1PXAA 1DXLA 2V3BA 2XDOA 3T2KA 1GREA 1GOSA 4EMJA 3M12A 2GAGB 5KMQA 4B65A 2R4JA 1H83A 1BF3A 3CTYA 1FOHA 3BNMA 5DBJA 2WETA 5HY5A 2QA1A 4NTEA 4H2NA 2X3NA 3GMCA 1NPXA 4CY6A 4G6GA 1EL9A 1NG3A 3KKJA 2C64A 1X31B 2XLTA 1O5WA 1H86A 3M13A 3SQPA 2RGJA 3KU9A 4U8LA 3BNUA 2BRYA 2C7GA 4JDRA 3SGLA 3UOYA 2BK3A 3AEDA 3K7QX 3RP6A 3CGEA 2IVEA 2Q0LA 2ACZA 1E1LA 2YVFA 1DJNA 4H4QA 4NZHA 3UKHA 1GPEA 2VQ7A 2E1MA 5HHFA 1H82A 1L9CA 2O9ZA 3ALJA 3CPJG 3UOVA 3BI5A 2C3DA 3COXA 5IQ1A 1ZK7A 1Q1RA 2V6OA 3T14A 2FJBA 3GWFA 1ZMDA 1Y56B 1GERA 2IIDA 3IF9A 1K4QA 3KA7A 2WDRA 3P4SA 4OPCA 4H4SA 3CNJA 1CC6A 1LQTA 1ZOVA 5KMSA 2GB0A 3RNMA 3GRTA 3PVCA 2WESA 2CDUA 4I58A 4U8JA 3P9UA 4JN9A 3FBSA 5FS6A 4CCQA 1FECA 3SX6A 1LPFA 2CVJA 2JAEA 3CNPA 3T37A 4UDPA 3LB8A 3V3NA 3P4RA 3IWAA 2V3AA 5KMRA 3AWIA 4O5QA 4AOXA 4EMIA 5M10A 1LJ1A 4FK1C 4JNAA 1IUXA 1HYUA 2F5ZA 3DH9A 2QAEA 1XPQA 1E6EA 1KNRA 4IVOB 1CC4A 4X4JA 5C3JA 1BGJA 2YR5A 3NK0X 4U8OA 1COYA 1E39A 3T2ZA 3G5RA 4YSXA 2OAMA 1VQWA 3GMBA 2GEWA 1IUWA 3AEFA 1YQ4A 3AE2A 4A99A 5IPYA 3O0HA 4H2PA 3AE6A 3B3RA 4NEVA 3UOXA 5FS9A 1S2YA 1ZDLA 2YVGA 3UTEA 2YLZA 2AAQA 2WP6A 2XFOA 4EMWA 1JRYA 1F6MA 5FS7A 1H6VA 5JCNA 4N9XA 2JB2A 4TLXA 1M64A 1B5QA 1ZY8A 1H7XA 1V59A 4H4ZA 1H84A 4ECHA 3AE4A 4GRTA 1GXFA 4U2SA 3UKQA 2WU5A 1RP0A 3JSKA 1OJAA 2R0GA 3NN0X 4DSGA 3CIRA 3ICRA 1EL8A 1GSNA 3V76A 3D1CA 3VR8A 1ZX9A 2C72A 1RSGA 4B68A 4LU6A 4AP1A 4C77A 4YSYA 4E0VA 2BRAA 1VDCA 3NYCA 1PBFA 1GALA 4IV9A 1S3EA 4Z43A 4TLZA 1M6IA 2XVEA 3QFAA 4K2XA 1DJQA 5KMPA 1TDKA 2FJEA 2XLSA 2H88A 4KPRA 1D4DA 1TDNA 3GYJA 4KX6A 2XFUA 2Q6UA 1NHSA 4NWZA 1F3PA 2XLRA 3T31A 2X8HA 4DGKA 4Z2RA 2BS4A 3HYXA 3BI4A 2OLOA 1TDFA 4B66A 2B7RA 2GH5A 3SM8A 2V60A 2BA9A 1OJ9A 4A7AA 2ZZBA 4JY2A 2JKCA 4U2LA 1UKVG 4A5LA 1NEKA 1GEUA 2YM1A 3GYIA 4TM4A 2AQJA 4YTNA 2B9YA 4DSHA 5ER0A 5U63A 4YSHA 1GESA 2C73A 1FL2A 2R45A 4I59A 3T2YA 2R9ZA 1DOCA 4J31A 2YM2A 5HXIA 4C3YA 1MO9A 3AXBA 5GSNA 2OLNA 1GRBA 2XVHA 1PDHA 4BURA 1OJCA 2BS2A 1GRAA 3KVEA 2C4CA 2ZBWA 5KOWA 3NLCA 2VZ2A 4JNQA 3H4KA 3FG2P 2TPRA 2WEUA 3QVRA 2YR4A 3DJEA 3KLJA 4GDEA 1GRGA 1DNCA 3AYIA 3UTFA 2X8CA 3UKFA 4APNA 4YT0A 4GCMA 4USRA 1E1MA 1NDAA 4X9MA 1TYTA 4H2QA 1PBCA 3AE5A 2ARDA 3AD9B 1BKWA 1CF3A 1VRQB 1SEZA 1GV4A 2GQWA 3CPIG 4U8NA 2GRTA 1F8RA 3P1WA 2I0ZA 4EIPA 1GTEA 5KOXA 2JK6A 2YG6A 1CL0A 1EL5A 1PN0A 3KPFA 4ICYA 4CY8A 2FBWA 2GR3A 1PXBA 2YVJA 3BI2A 2NVKX 1QO8A 4CNKA 4YTPA 3NHOX 2WHDA 3DJDA 2BCPA 3FMWA 4REKA 5GRTA 2BK4A 2YLWA 1H81A 4CBQA 5LV9A 1D7LA 2C75A 4D04A 4U8IA 1OJTA 1KSUA 2WDVA 5JCMA 1CHUA 4RG4A 2AR8A 4Y4MA 2IVDA 4A65A 1FEAA 3CMMA 2BXSA 1PS9A 2C3CA 2WS3A 4OPUA 4PABA 4OVIA 1DOEA 1NENA 3B6DA 1IJHA 3SZFA 3UKPA 3LZWA 4H4UA 3S5WA 3WE0A 2C65A 3GD4A 3I6DA 4U8KA 1FEBA 1S3BA 2BABA 1VG9A 1NG4A 2OA1A 5IQ4A 4HB9A 4J34A 1NAAA 1JU2A 2E5VA 4J2WA 1E7PA 3NTAA 4GUVA 1EBDA 3G5QA 4BK2A 4AOSA 2EQ6A 2V5ZA 3NYFA 3QVPA 4RG3A 1GRTA 3NIXA 4GF7A 1CC2A 2VRMA 4FK1A 4K7ZA 2Z5XA 4P9SA 3GSIA 1JNRA 3AB1A 4Y4NA 2X8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NKS A;  4UDQ A;  1JOA A;  2WPE A;  1Q9I A;  3AE3 A;  4C3X A;  3GD3 A;  3AEC A;  3K30 A;  4FX9 A;  3CGB A;  5FS8 A;  4EM3 A;  1L0V A;  1CJ2 A;  5BVA A;  3LZX A;  2WU2 A;  4K5S A;  3AD7 B;  3ADA B;  1ZMC A;  3URH A;  4BK1 A;  4NTD A;  1PBE A;  4YSZ A;  4WX1 A;  2X99 A;  3AYL A;  1LTX R;  1AOG A;  4B69 A;  3ABV A;  4J57 A;  1RYI A;  2XFP A;  1ZOY A;  1BWC A;  1GTH A;  2Y6R A;  4NTC A;  4XXG A;  5TR3 A;  3UTG A;  1TDO A;  2XYO A;  3HZL A;  3PS9 A;  4JY3 A;  4TM3 A;  4BK3 A;  4EQW A;  2EQ9 A;  2ZZC A;  1LV0 A;  2RGO A;  4JQ9 A;  2J3N A;  1D7Y A;  3QSM A;  4A79 A;  1KDG A;  1DOD A;  1TDE A;  1Y56 A;  1ZKQ A;  5BRT A;  3ICT A;  2GVC A;  3ITJ A;  1B8S A;  3DJG X;  3KD9 A;  3P4Q A;  2YLR A;  1MOK A;  3F8D A;  4U8P A;  4U2T A;  2WP9 A;  2GR2 A;  1ZP0 A;  4EQX A;  1ELI A;  2NPX A;  4IA6 A;  4OPD A;  2BC0 A;  4Z24 A;  4AP3 A;  5KRQ A;  3K7M X;  4H50 A;  4HA6 A;  1MXT A;  1NHQ A;  1Y0P A;  1E1N A;  3EAO A;  2DKH A;  4EM4 A;  4PAA A;  3K7T A;  1XDI A;  4J33 A;  3AEB A;  1QLB A;  3LOV A;  4UDR A;  1PXC A;  1K0L A;  1D4E A;  1KF6 A;  3UKA A;  3UTH A;  3AE9 A;  4BJY A;  4Z25 A;  5KWF A;  3AEG A;  5J60 A;  1CJ4 A;  5KVH A;  2C66 A;  2WOI A;  3DGZ A;  3F8R A;  2WDQ A;  4YKF A;  2GF3 A;  2JBV A;  3AE8 A;  3LJP A;  3ZYX A;  3LAD A;  1CJC A;  1ONF A;  3CNT A;  3EPT A;  3Q9T A;  2R0C A;  1IUT A;  2YLX A;  4CCR A;  4Y4L A;  3FIM B;  5JCL A;  1LVL A;  1IUV A;  4ADW A;  5HYM A;  4Z26 A;  4X9N A;  5BUK A;  5C2T A;  2YG3 A;  3DME A;  3F8P A;  3OZ2 A;  4XWZ A;  2BYB A;  1NHP A;  4A6N B;  1O94 A;  4GR1 A;  5BUL A;  1L9E A;  2CFY A;  2R4E A;  2R46 A;  3D8X A;  4EQR A;  2EQ8 A;  3FPZ A;  3NT6 A;  3P4P A;  1KSS A;  3NRN A;  5JCI A;  2FJA A;  3QSS A;  3RP8 A;  3DGH A;  4FDC B;  1N1P A;  4TM1 A;  5CQF A;  4H4T A;  2V61 A;  3NH3 X;  3PO7 A;  4H7U A;  2A89 A;  3C96 A;  5EB4 A;  2Y6Q A;  2VQB A;  3QJ4 A;  3NK1 X;  3RP7 A;  3AEA A;  4K22 A;  4M52 A;  4B63 A;  4OPL A;  5CKU A;  3NGC X;  2EQ7 A;  3ALM A;  4H4P A;  2QA2 A;  1REO A;  3NN6 X;  2B9W A;  1PJ6 A;  3C4N A;  3DJJ A;  5M0Z A;  2RGH A;  2VRL A;  4H4R A;  3GDP A;  4CNJ A;  2YLS A;  4EIQ A;  3EF6 A;  2XVJ A;  1N4U A;  5JCK A;  1PBB A;  1OJD A;  1QJD A;  3UCL A;  3NYE A;  3UOZ A;  1JNZ A;  4H2R A;  3NG7 X;  2YG7 A;  4MJW A;  3AYJ A;  1YY5 A;  2BCG G;  2Q7V A;  4NEW A;  3GWD A;  2XLU A;  2YLT A;  4ZN0 A;  2WOW A;  3SFE A;  1GET A;  3RHA A;  1N4V A;  1PJ7 A;  3H8I A;  4YKG A;  2UZZ A;  2ZZ0 A;  2Z5Y A;  4IA5 A;  3SFD A;  3QFB A;  3QSE A;  5KVI A;  4A6N A;  2WQY A;  3CGC A;  3E1T A;  4B67 A;  2VVL A;  2GAH B;  1CBO A;  3Q6J A;  2VVM A;  3DK9 A;  1VG0 A;  3DA1 A;  3ICS A;  3I3L A;  1D4C A;  1NHR A;  5KXJ A;  2YG5 A;  4OCG A;  2BK5 A;  2OAL A;  1TYP A;  3NK2 X;  3C4A A;  3UKL A;  1BZL A;  1BGN A;  2BAC A;  2CUL A;  2RAB A;  1EL7 A;  2HQM A;  2YQU A;  3VRB A;  2XVF A;  1LQU A;  1IUS A;  2XVI A;  2YG4 A;  2GMH A;  1DOB A;  3CGD A;  4J56 A;  4LA1 A;  3BHF A;  2Q0K A;  3IC9 A;  4U8M A;  4UP3 A;  2XFQ A;  2WBA A;  1PHH A;  1F8S A;  3R9U A;  4H4X A;  1PBD A;  1KNP A;  3DK8 A;  3VRA A;  5L46 A;  2R0P A;  1JEH A;  4O5U A;  4B1B A;  4B64 A;  1O95 A;  1FCD A;  2C70 A;  3CPH G;  4OPT A;  3RED A;  1IUU A;  1PJ5 A;  3L1R A;  2GR0 A;  3L8K A;  4YWO A;  2WPF A;  1W4X A;  3VR9 A;  4LII A;  2WPC A;  3ISH A;  2JB1 A;  4H4V A;  4XWR A;  5J7X A;  1XHC A;  4WCT A;  4AT0 A;  2XFN A;  2E4G A;  4C74 A;  4OPG A;  2BC1 A;  3ALL A;  3II4 A;  3NTD A;  1GND A;  2YR6 A;  1N4W A;  3G5S A;  3H8L A;  4BJZ A;  1Q1W A;  3BHK A;  2JB3 A;  4ZCD A;  1H7W A;  2GMJ A;  3UP4 A;  4H4Y A;  3AE7 A;  1YQZ A;  4AT2 A;  1CJ3 A;  1YKJ A;  2VOU A;  1JRZ A;  2YAU A;  1P2H A;  2VVL G;  4DNA A;  1JRX A;  3ATQ A;  3M0O A;  2WOV A;  3ZDN A;  2XLP A;  4GDP A;  2YWL A;  2DKI A;  3OC4 A;  4CRT A;  4Z2T A;  2WP5 A;  3AEE A;  3AE1 A;  2QCU A;  1GRH A;  1KFY A;  1D5T A;  2XCG A;  3DK4 A;  2H89 A;  4YXD A;  1XAN A;  2B76 A;  4C5O A;  3NNE A;  2B9X A;  3GDN A;  5U25 A;  3VRD B;  3CN8 A;  3UKK A;  3UP5 A;  2GQF A;  2W0H A;  4ZCC A;  4BV6 A;  1B37 A;  2GR1 A;  1TRB A;  4OPI A;  5EB5 A;  5FMH A;  3IHG A;  4IVM B;  3EAN A;  4EQS A;  4J36 A;  2C67 A;  3CND A;  4Z2U A;  4H4W A;  4K8D A;  4USQ A;  1GRF A;  1K0J A;  3AD8 B;  5EBK A;  4YTM A;  4RSL A;  3V3O A;  2A8X A;  1L9D A;  1Z6L A;  3GRS A;  5U1O A;  4A9W A;  4D03 A;  4Z44 A;  1B4V A;  1E1K A;  2PYX A;  3ATR A;  1YQ3 A;  2C76 A;  1S2Q A;  5EOW A;  2APG A;  1GT8 A;  2GV8 A;  2A87 A;  2BS3 A;  1F8W A;  2BXR A;  2X50 A;  2B7S A;  4K5R A;  3VQR A;  3LXD A;  1P2E A;  3IHM A;  3S61 A;  4TM0 A;  3CNS A;  2TMD A;  2FJD A;  2PHH A;  1K0I A;  1PXA A;  1DXL A;  2V3B A;  2XDO A;  1GRE A;  1GOS A;  4EMJ A;  3M12 A;  2GAG B;  4B65 A;  2R4J A;  1H83 A;  1BF3 A;  3CTY A;  1FOH A;  3BNM A;  5DBJ A;  2WET A;  5HY5 A;  2QA1 A;  4NTE A;  4H2N A;  2X3N A;  3GMC A;  1NPX A;  4CY6 A;  1EL9 A;  1NG3 A;  3KKJ A;  2C64 A;  1X31 B;  2XLT A;  1O5W A;  1H86 A;  3M13 A;  3SQP A;  2RGJ A;  3KU9 A;  4U8L A;  3BNU A;  4JDR A;  2C7G A;  3SGL A;  3UOY A;  2BK3 A;  3AED A;  3K7Q X;  3RP6 A;  3CGE A;  2IVE A;  2Q0L A;  2ACZ A;  1E1L A;  2YVF A;  1DJN A;  4H4Q A;  4NZH A;  3UKH A;  1GPE A;  2VQ7 A;  2E1M A;  5HHF A;  1H82 A;  1L9C A;  2O9Z A;  3ALJ A;  3CPJ G;  3UOV A;  3BI5 A;  2C3D A;  3COX A;  5IQ1 A;  1ZK7 A;  1Q1R A;  2V6O A;  2FJB A;  3GWF A;  1ZMD A;  1Y56 B;  1GER A;  2IID A;  3IF9 A;  1K4Q A;  3KA7 A;  2WDR A;  3P4S A;  4OPC A;  4H4S A;  3CNJ A;  1CC6 A;  1LQT A;  1ZOV A;  2GB0 A;  3RNM A;  3GRT A;  3PVC A;  2WES A;  2CDU A;  4I58 A;  4U8J A;  3P9U A;  4JN9 A;  3FBS A;  5FS6 A;  4CCQ A;  1FEC A;  1LPF A;  2CVJ A;  2JAE A;  3CNP A;  3T37 A;  4UDP A;  3LB8 A;  3V3N A;  3P4R A;  3IWA A;  2V3A A;  3AWI A;  4O5Q A;  4AOX A;  4EMI A;  5M10 A;  1LJ1 A;  4FK1 C;  4JNA A;  1IUX A;  1HYU A;  2F5Z A;  3DH9 A;  2QAE A;  1XPQ A;  1E6E A;  1KNR A;  4IVO B;  1CC4 A;  4X4J A;  5C3J A;  1BGJ A;  2YR5 A;  3NK0 X;  4U8O A;  1COY A;  1E39 A;  4YSX A;  3G5R A;  2OAM A;  1VQW A;  3GMB A;  2GEW A;  1IUW A;  3AEF A;  1YQ4 A;  3AE2 A;  4A99 A;  5IPY A;  3O0H A;  4H2P A;  3AE6 A;  3B3R A;  4NEV A;  3UOX A;  5FS9 A;  1S2Y A;  1ZDL A;  2YVG A;  3UTE A;  2YLZ A;  2AAQ A;  2WP6 A;  2XFO A;  4EMW A;  1JRY A;  1F6M A;  5FS7 A;  1H6V A;  5JCN A;  4N9X A;  2JB2 A;  4TLX A;  1M64 A;  1B5Q A;  1ZY8 A;  1H7X A;  1V59 A;  4H4Z A;  1H84 A;  4ECH A;  3AE4 A;  4GRT A;  1GXF A;  4U2S A;  3UKQ A;  2WU5 A;  1RP0 A;  3JSK A;  1OJA A;  2R0G A;  3NN0 X;  4DSG A;  3CIR A;  3ICR A;  1EL8 A;  1GSN A;  3V76 A;  3D1C A;  3VR8 A;  1ZX9 A;  2C72 A;  1RSG A;  4B68 A;  4LU6 A;  4AP1 A;  4C77 A;  4YSY A;  4E0V A;  3NYC A;  1VDC A;  4IV9 A;  1PBF A;  1GAL A;  4Z43 A;  1S3E A;  4TLZ A;  1M6I A;  2XVE A;  3QFA A;  4K2X A;  1DJQ A;  1TDK A;  2FJE A;  2XLS A;  2H88 A;  4KPR A;  1D4D A;  1TDN A;  3GYJ A;  4KX6 A;  2XFU A;  2Q6U A;  1NHS A;  1F3P A;  2XLR A;  4DGK A;  2X8H A;  4Z2R A;  2BS4 A;  3BI4 A;  2OLO A;  1TDF A;  4B66 A;  2B7R A;  2GH5 A;  3SM8 A;  2V60 A;  2BA9 A;  1OJ9 A;  4A7A A;  2ZZB A;  4JY2 A;  2JKC A;  4U2L A;  1UKV G;  4A5L A;  1NEK A;  1GEU A;  2YM1 A;  3GYI A;  4TM4 A;  2AQJ A;  4YTN A;  2B9Y A;  4DSH A;  5ER0 A;  5U63 A;  4YSH A;  1GES A;  2C73 A;  1FL2 A;  2R45 A;  4I59 A;  2R9Z A;  1DOC A;  4J31 A;  2YM2 A;  5HXI A;  4C3Y A;  1MO9 A;  3AXB A;  5GSN A;  2OLN A;  1GRB A;  2XVH A;  1PDH A;  4BUR A;  1OJC A;  2BS2 A;  1GRA A;  3KVE A;  2ZBW A;  5KOW A;  3NLC A;  2VZ2 A;  4JNQ A;  3H4K A;  3FG2 P;  2TPR A;  2WEU A;  3QVR A;  2YR4 A;  3DJE A;  3KLJ A;  4GDE A;  1GRG A;  1DNC A;  3AYI A;  3UTF A;  2X8C A;  3UKF A;  4APN A;  4YT0 A;  4GCM A;  4USR A;  1E1M A;  1NDA A;  4X9M A;  1TYT A;  4H2Q A;  1PBC A;  3AE5 A;  2ARD A;  3AD9 B;  1BKW A;  1CF3 A;  1VRQ B;  1SEZ A;  1GV4 A;  2GQW A;  3CPI G;  4U8N A;  2GRT A;  1F8R A;  3P1W A;  2I0Z A;  4EIP A;  1GTE A;  5KOX A;  2JK6 A;  2YG6 A;  1CL0 A;  1EL5 A;  1PN0 A;  3KPF A;  4ICY A;  4CY8 A;  2FBW A;  2GR3 A;  1PXB A;  2YVJ A;  3BI2 A;  2NVK X;  1QO8 A;  4CNK A;  4YTP A;  3NHO X;  2WHD A;  3DJD A;  2BCP A;  3FMW A;  4REK A;  5GRT A;  2BK4 A;  2YLW A;  1H81 A;  4CBQ A;  5LV9 A;  1D7L A;  2C75 A;  4D04 A;  4U8I A;  1OJT A;  1KSU A;  2WDV A;  5JCM A;  1CHU A;  4RG4 A;  2AR8 A;  4Y4M A;  2IVD A;  4A65 A;  1FEA A;  2BXS A;  1PS9 A;  2C3C A;  2WS3 A;  4OPU A;  4PAB A;  4OVI A;  1DOE A;  1NEN A;  3B6D A;  1IJH A;  3UKP A;  3LZW A;  4H4U A;  3S5W A;  3WE0 A;  2C65 A;  3GD4 A;  3I6D A;  4U8K A;  1FEB A;  1S3B A;  2BAB A;  1VG9 A;  1NG4 A;  2OA1 A;  5IQ4 A;  4HB9 A;  4J34 A;  1NAA A;  1JU2 A;  2E5V A;  4J2W A;  1E7P A;  3NTA A;  4GUV A;  1EBD A;  3G5Q A;  4BK2 A;  4AOS A;  2EQ6 A;  2V5Z A;  3NYF A;  3QVP A;  4RG3 A;  1GRT A;  3NIX A;  4GF7 A;  1CC2 A;  2VRM A;  4FK1 A;  4K7Z A;  2Z5X A;  4P9S A;  3GSI A;  1JNR A;  3AB1 A;  4Y4N A;  2X8G A; 
#chains in the Genus database with same CATH topology
 3NKS A;  4UDQ A;  1JOA A;  2WPE A;  1Q9I A;  3AE3 A;  4C3X A;  3GD3 A;  3AEC A;  3K30 A;  4FX9 A;  3CGB A;  5FS8 A;  4EM3 A;  1L0V A;  1CJ2 A;  5BVA A;  3LZX A;  2WU2 A;  4K5S A;  3AD7 B;  3ADA B;  1ZMC A;  3URH A;  4BK1 A;  4NTD A;  1PBE A;  3SZC A;  4YSZ A;  4WX1 A;  2X99 A;  3AYL A;  1LTX R;  1AOG A;  4B69 A;  3ABV A;  4J57 A;  1RYI A;  2XFP A;  4G73 A;  1ZOY A;  1BWC A;  1GTH A;  2Y6R A;  4NTC A;  4XXG A;  5TR3 A;  3UTG A;  1TDO A;  2XYO A;  3HZL A;  3PS9 A;  4JY3 A;  4TM3 A;  4BK3 A;  4EQW A;  2EQ9 A;  2ZZC A;  1LV0 A;  2RGO A;  4JQ9 A;  2J3N A;  1D7Y A;  3QSM A;  4A79 A;  1KDG A;  1DOD A;  1TDE A;  1Y56 A;  1ZKQ A;  5BRT A;  3ICT A;  2GVC A;  3ITJ A;  1B8S A;  3DJG X;  3KD9 A;  3P4Q A;  2YLR A;  1MOK A;  3F8D A;  4U8P A;  4U2T A;  2WP9 A;  2GR2 A;  1ZP0 A;  4EQX A;  1ELI A;  2NPX A;  4IA6 A;  4OPD A;  2BC0 A;  4Z24 A;  3SXI A;  4AP3 A;  5KRQ A;  3K7M X;  4H50 A;  4HA6 A;  1MXT A;  1NHQ A;  1Y0P A;  1E1N A;  3EAO A;  2DKH A;  4EM4 A;  4PAA A;  3K7T A;  1XDI A;  4J33 A;  3AEB A;  1QLB A;  3LOV A;  4UDR A;  1PXC A;  1K0L A;  1D4E A;  1KF6 A;  3UKA A;  3UTH A;  3AE9 A;  4BJY A;  4Z25 A;  5KWF A;  3AEG A;  4G9K A;  1CJ4 A;  5J60 A;  5KVH A;  4II2 A;  2C66 A;  2WOI A;  3DGZ A;  4G6H A;  3F8R A;  2WDQ A;  4YKF A;  2GF3 A;  2JBV A;  3AE8 A;  3LJP A;  3ZYX A;  3LAD A;  1CJC A;  1ONF A;  3CNT A;  3EPT A;  3Q9T A;  2R0C A;  1IUT A;  2YLX A;  4CCR A;  4Y4L A;  3FIM B;  5JCL A;  1LVL A;  1IUV A;  4ADW A;  5HYM A;  4Z26 A;  4X9N A;  5BUK A;  5C2T A;  2YG3 A;  3DME A;  3F8P A;  3OZ2 A;  4XWZ A;  2BYB A;  1NHP A;  4A6N B;  1O94 A;  4GR1 A;  5BUL A;  1L9E A;  2CFY A;  2R4E A;  2R46 A;  3D8X A;  4EQR A;  2EQ8 A;  3FPZ A;  3NT6 A;  3P4P A;  1KSS A;  3NRN A;  5JCI A;  2FJA A;  3QSS A;  3RP8 A;  3DGH A;  4FDC B;  1N1P A;  4TM1 A;  4II3 A;  4H4T A;  2V61 A;  3GYX A;  3NH3 X;  3PO7 A;  4H7U A;  2A89 A;  5CQF A;  3C96 A;  5EB4 A;  2Y6Q A;  2VQB A;  3QJ4 A;  3NK1 X;  3RP7 A;  3AEA A;  4K22 A;  4GAP A;  4M52 A;  4B63 A;  4OPL A;  5CKU A;  3NGC X;  2EQ7 A;  3ALM A;  4H4P A;  2QA2 A;  1REO A;  3NN6 X;  2B9W A;  1PJ6 A;  3C4N A;  3DJJ A;  5M0Z A;  2RGH A;  2VRL A;  4H4R A;  3SYI A;  3GDP A;  4CNJ A;  2YLS A;  4EIQ A;  3EF6 A;  2XVJ A;  1N4U A;  5JCK A;  1PBB A;  1OJD A;  1QJD A;  3UCL A;  3NYE A;  3UOZ A;  1JNZ A;  4H2R A;  3NG7 X;  5KNL A;  2YG7 A;  3HYW A;  4MJW A;  3AYJ A;  1YY5 A;  2BCG G;  2Q7V A;  4NEW A;  3GWD A;  2XLU A;  2YLT A;  4ZN0 A;  2WOW A;  3SFE A;  1GET A;  3RHA A;  1N4V A;  1PJ7 A;  3H8I A;  4YKG A;  2UZZ A;  2ZZ0 A;  2Z5Y A;  3HYV A;  4IA5 A;  3SFD A;  3QFB A;  3QSE A;  5KVI A;  4A6N A;  2WQY A;  3CGC A;  3E1T A;  4B67 A;  2VVL A;  2GAH B;  1CBO A;  3SY4 A;  3Q6J A;  2VVM A;  3DK9 A;  3T0K A;  1VG0 A;  3DA1 A;  3ICS A;  3I3L A;  1D4C A;  1NHR A;  5KXJ A;  2YG5 A;  4OCG A;  2BK5 A;  2OAL A;  1TYP A;  3NK2 X;  3C4A A;  3UKL A;  1BZL A;  1BGN A;  2BAC A;  2CUL A;  2RAB A;  1EL7 A;  2HQM A;  2YQU A;  3VRB A;  2XVF A;  1LQU A;  1IUS A;  2XVI A;  2YG4 A;  2GMH A;  1DOB A;  3CGD A;  4J56 A;  4LA1 A;  3BHF A;  2Q0K A;  3IC9 A;  4U8M A;  4UP3 A;  2XFQ A;  2WBA A;  1PHH A;  1F8S A;  3R9U A;  4H4X A;  1PBD A;  1KNP A;  3DK8 A;  3VRA A;  5L46 A;  2R0P A;  1JEH A;  4O5U A;  4B1B A;  4B64 A;  1O95 A;  1FCD A;  2C70 A;  3SZ0 A;  3CPH G;  4OPT A;  3RED A;  1IUU A;  1PJ5 A;  3L1R A;  2GR0 A;  3L8K A;  4YWO A;  2WPF A;  1W4X A;  3VR9 A;  4LII A;  2WPC A;  3ISH A;  2JB1 A;  4H4V A;  4XWR A;  5J7X A;  1XHC A;  4WCT A;  4AT0 A;  2XFN A;  2E4G A;  4C74 A;  4OPG A;  2BC1 A;  3ALL A;  3II4 A;  3NTD A;  1GND A;  2YR6 A;  1N4W A;  3G5S A;  3H8L A;  4BJZ A;  1Q1W A;  3BHK A;  2JB3 A;  4ZCD A;  1H7W A;  2GMJ A;  3UP4 A;  4H4Y A;  3AE7 A;  1YQZ A;  4AT2 A;  1CJ3 A;  1YKJ A;  2VOU A;  1JRZ A;  2YAU A;  1P2H A;  2VVL G;  4DNA A;  1JRX A;  3ATQ A;  3M0O A;  2WOV A;  3ZDN A;  2XLP A;  4GDP A;  2YWL A;  2DKI A;  3OC4 A;  4CRT A;  4Z2T A;  2WP5 A;  3AEE A;  3AE1 A;  2QCU A;  1GRH A;  1KFY A;  1D5T A;  2XCG A;  3DK4 A;  2H89 A;  4YXD A;  1XAN A;  2B76 A;  4NNJ A;  4C5O A;  3NNE A;  2B9X A;  3GDN A;  5U25 A;  3VRD B;  3CN8 A;  3UKK A;  3UP5 A;  2GQF A;  2W0H A;  4ZCC A;  3SZW A;  4BV6 A;  3KPK A;  1B37 A;  2GR1 A;  1TRB A;  4OPI A;  5EB5 A;  5FMH A;  3IHG A;  4IVM B;  3EAN A;  4EQS A;  4J36 A;  2C67 A;  3CND A;  4Z2U A;  4H4W A;  4K8D A;  4USQ A;  1GRF A;  1K0J A;  3AD8 B;  5EBK A;  4YTM A;  4RSL A;  3V3O A;  2A8X A;  1L9D A;  1Z6L A;  3GRS A;  5U1O A;  4A9W A;  4D03 A;  4Z44 A;  1B4V A;  1E1K A;  2PYX A;  3ATR A;  1YQ3 A;  2C76 A;  1S2Q A;  5EOW A;  2APG A;  1GT8 A;  2GV8 A;  2A87 A;  2BS3 A;  1F8W A;  2BXR A;  2X50 A;  2B7S A;  4K5R A;  4GAV A;  3LXD A;  3VQR A;  1P2E A;  3IHM A;  3S61 A;  4TM0 A;  3CNS A;  4G74 A;  2TMD A;  2FJD A;  2PHH A;  1K0I A;  1PXA A;  1DXL A;  2V3B A;  2XDO A;  3T2K A;  1GRE A;  1GOS A;  4EMJ A;  3M12 A;  2GAG B;  5KMQ A;  4B65 A;  2R4J A;  1H83 A;  1BF3 A;  3CTY A;  1FOH A;  3BNM A;  5DBJ A;  2WET A;  5HY5 A;  2QA1 A;  4NTE A;  4H2N A;  2X3N A;  3GMC A;  1NPX A;  4CY6 A;  4G6G A;  1EL9 A;  1NG3 A;  3KKJ A;  2C64 A;  1X31 B;  2XLT A;  1O5W A;  1H86 A;  3M13 A;  3SQP A;  2RGJ A;  3KU9 A;  4U8L A;  3BNU A;  2BRY A;  2C7G A;  4JDR A;  3SGL A;  3UOY A;  2BK3 A;  3AED A;  3K7Q X;  3RP6 A;  3CGE A;  2IVE A;  2Q0L A;  2ACZ A;  1E1L A;  2YVF A;  1DJN A;  4H4Q A;  4NZH A;  3UKH A;  1GPE A;  2VQ7 A;  2E1M A;  5HHF A;  1H82 A;  1L9C A;  2O9Z A;  3ALJ A;  3CPJ G;  3UOV A;  3BI5 A;  2C3D A;  3COX A;  5IQ1 A;  1ZK7 A;  1Q1R A;  2V6O A;  3T14 A;  2FJB A;  3GWF A;  1ZMD A;  1Y56 B;  1GER A;  2IID A;  3IF9 A;  1K4Q A;  3KA7 A;  2WDR A;  3P4S A;  4OPC A;  4H4S A;  3CNJ A;  1CC6 A;  1LQT A;  1ZOV A;  5KMS A;  2GB0 A;  3RNM A;  3GRT A;  3PVC A;  2WES A;  2CDU A;  4I58 A;  4U8J A;  3P9U A;  4JN9 A;  3FBS A;  5FS6 A;  4CCQ A;  1FEC A;  3SX6 A;  1LPF A;  2CVJ A;  2JAE A;  3CNP A;  3T37 A;  4UDP A;  3LB8 A;  3V3N A;  3P4R A;  3IWA A;  2V3A A;  5KMR A;  3AWI A;  4O5Q A;  4AOX A;  4EMI A;  5M10 A;  1LJ1 A;  4FK1 C;  4JNA A;  1IUX A;  1HYU A;  2F5Z A;  3DH9 A;  2QAE A;  1XPQ A;  1E6E A;  1KNR A;  4IVO B;  1CC4 A;  4X4J A;  5C3J A;  1BGJ A;  2YR5 A;  3NK0 X;  4U8O A;  1COY A;  1E39 A;  3T2Z A;  3G5R A;  4YSX A;  2OAM A;  1VQW A;  3GMB A;  2GEW A;  1IUW A;  3AEF A;  1YQ4 A;  3AE2 A;  4A99 A;  5IPY A;  3O0H A;  4H2P A;  3AE6 A;  3B3R A;  4NEV A;  3UOX A;  5FS9 A;  1S2Y A;  1ZDL A;  2YVG A;  3UTE A;  2YLZ A;  2AAQ A;  2WP6 A;  2XFO A;  4EMW A;  1JRY A;  1F6M A;  5FS7 A;  1H6V A;  5JCN A;  4N9X A;  2JB2 A;  4TLX A;  1M64 A;  1B5Q A;  1ZY8 A;  1H7X A;  1V59 A;  4H4Z A;  1H84 A;  4ECH A;  3AE4 A;  4GRT A;  1GXF A;  4U2S A;  3UKQ A;  2WU5 A;  1RP0 A;  3JSK A;  1OJA A;  2R0G A;  3NN0 X;  4DSG A;  3CIR A;  3ICR A;  1EL8 A;  1GSN A;  3V76 A;  3D1C A;  3VR8 A;  1ZX9 A;  2C72 A;  1RSG A;  4B68 A;  4LU6 A;  4AP1 A;  4C77 A;  4YSY A;  4E0V A;  2BRA A;  1VDC A;  3NYC A;  1PBF A;  1GAL A;  4IV9 A;  1S3E A;  4Z43 A;  4TLZ A;  1M6I A;  2XVE A;  3QFA A;  4K2X A;  1DJQ A;  5KMP A;  1TDK A;  2FJE A;  2XLS A;  2H88 A;  4KPR A;  1D4D A;  1TDN A;  3GYJ A;  4KX6 A;  2XFU A;  2Q6U A;  1NHS A;  4NWZ A;  1F3P A;  2XLR A;  3T31 A;  2X8H A;  4DGK A;  4Z2R A;  2BS4 A;  3HYX A;  3BI4 A;  2OLO A;  1TDF A;  4B66 A;  2B7R A;  2GH5 A;  3SM8 A;  2V60 A;  2BA9 A;  1OJ9 A;  4A7A A;  2ZZB A;  4JY2 A;  2JKC A;  4U2L A;  1UKV G;  4A5L A;  1NEK A;  1GEU A;  2YM1 A;  3GYI A;  4TM4 A;  2AQJ A;  4YTN A;  2B9Y A;  4DSH A;  5ER0 A;  5U63 A;  4YSH A;  1GES A;  2C73 A;  1FL2 A;  2R45 A;  4I59 A;  3T2Y A;  2R9Z A;  1DOC A;  4J31 A;  2YM2 A;  5HXI A;  4C3Y A;  1MO9 A;  3AXB A;  5GSN A;  2OLN A;  1GRB A;  2XVH A;  1PDH A;  4BUR A;  1OJC A;  2BS2 A;  1GRA A;  3KVE A;  2C4C A;  2ZBW A;  5KOW A;  3NLC A;  2VZ2 A;  4JNQ A;  3H4K A;  3FG2 P;  2TPR A;  2WEU A;  3QVR A;  2YR4 A;  3DJE A;  3KLJ A;  4GDE A;  1GRG A;  1DNC A;  3AYI A;  3UTF A;  2X8C A;  3UKF A;  4APN A;  4YT0 A;  4GCM A;  4USR A;  1E1M A;  1NDA A;  4X9M A;  1TYT A;  4H2Q A;  1PBC A;  3AE5 A;  2ARD A;  3AD9 B;  1BKW A;  1CF3 A;  1VRQ B;  1SEZ A;  1GV4 A;  2GQW A;  3CPI G;  4U8N A;  2GRT A;  1F8R A;  3P1W A;  2I0Z A;  4EIP A;  1GTE A;  5KOX A;  2JK6 A;  2YG6 A;  1CL0 A;  1EL5 A;  1PN0 A;  3KPF A;  4ICY A;  4CY8 A;  2FBW A;  2GR3 A;  1PXB A;  2YVJ A;  3BI2 A;  2NVK X;  1QO8 A;  4CNK A;  4YTP A;  3NHO X;  2WHD A;  3DJD A;  2BCP A;  3FMW A;  4REK A;  5GRT A;  2BK4 A;  2YLW A;  1H81 A;  4CBQ A;  5LV9 A;  1D7L A;  2C75 A;  4D04 A;  4U8I A;  1OJT A;  1KSU A;  2WDV A;  5JCM A;  1CHU A;  4RG4 A;  2AR8 A;  4Y4M A;  2IVD A;  4A65 A;  1FEA A;  3CMM A;  2BXS A;  1PS9 A;  2C3C A;  2WS3 A;  4OPU A;  4PAB A;  4OVI A;  1DOE A;  1NEN A;  3B6D A;  1IJH A;  3SZF A;  3UKP A;  3LZW A;  4H4U A;  3S5W A;  3WE0 A;  2C65 A;  3GD4 A;  3I6D A;  4U8K A;  1FEB A;  1S3B A;  2BAB A;  1VG9 A;  1NG4 A;  2OA1 A;  5IQ4 A;  4HB9 A;  4J34 A;  1NAA A;  1JU2 A;  2E5V A;  4J2W A;  1E7P A;  3NTA A;  4GUV A;  1EBD A;  3G5Q A;  4BK2 A;  4AOS A;  2EQ6 A;  2V5Z A;  3NYF A;  3QVP A;  4RG3 A;  1GRT A;  3NIX A;  4GF7 A;  1CC2 A;  2VRM A;  4FK1 A;  4K7Z A;  2Z5X A;  4P9S A;  3GSI A;  1JNR A;  3AB1 A;  4Y4N A;  2X8G A; 
#chains in the Genus database with same CATH homology
 3NKS A;  4UDQ A;  1JOA A;  2WPE A;  1Q9I A;  3AE3 A;  4C3X A;  3GD3 A;  3AEC A;  3K30 A;  4FX9 A;  3CGB A;  5FS8 A;  4EM3 A;  1L0V A;  1CJ2 A;  5BVA A;  3LZX A;  2WU2 A;  4K5S A;  3AD7 B;  3ADA B;  1ZMC A;  3URH A;  4BK1 A;  4NTD A;  1PBE A;  3SZC A;  4YSZ A;  4WX1 A;  2X99 A;  3AYL A;  1LTX R;  1AOG A;  4B69 A;  3ABV A;  4J57 A;  1RYI A;  2XFP A;  4G73 A;  1ZOY A;  1BWC A;  1GTH A;  2Y6R A;  4NTC A;  4XXG A;  5TR3 A;  3UTG A;  1TDO A;  2XYO A;  3HZL A;  3PS9 A;  4JY3 A;  4TM3 A;  4BK3 A;  4EQW A;  2EQ9 A;  2ZZC A;  1LV0 A;  2RGO A;  4JQ9 A;  2J3N A;  1D7Y A;  3QSM A;  4A79 A;  1KDG A;  1DOD A;  1TDE A;  1Y56 A;  1ZKQ A;  5BRT A;  3ICT A;  2GVC A;  3ITJ A;  1B8S A;  3DJG X;  3KD9 A;  3P4Q A;  2YLR A;  1MOK A;  3F8D A;  4U8P A;  4U2T A;  2WP9 A;  2GR2 A;  1ZP0 A;  4EQX A;  1ELI A;  2NPX A;  4IA6 A;  4OPD A;  2BC0 A;  4Z24 A;  3SXI A;  4AP3 A;  5KRQ A;  3K7M X;  4H50 A;  4HA6 A;  1MXT A;  1NHQ A;  1Y0P A;  1E1N A;  3EAO A;  2DKH A;  4EM4 A;  4PAA A;  3K7T A;  1XDI A;  4J33 A;  3AEB A;  1QLB A;  3LOV A;  4UDR A;  1PXC A;  1K0L A;  1D4E A;  1KF6 A;  3UKA A;  3UTH A;  3AE9 A;  4BJY A;  4Z25 A;  5KWF A;  3AEG A;  4G9K A;  1CJ4 A;  5J60 A;  5KVH A;  4II2 A;  2C66 A;  2WOI A;  3DGZ A;  4G6H A;  3F8R A;  2WDQ A;  4YKF A;  2GF3 A;  2JBV A;  3AE8 A;  3LJP A;  3ZYX A;  3LAD A;  1CJC A;  1ONF A;  3CNT A;  3EPT A;  3Q9T A;  2R0C A;  1IUT A;  2YLX A;  4CCR A;  4Y4L A;  3FIM B;  5JCL A;  1LVL A;  1IUV A;  4ADW A;  5HYM A;  4Z26 A;  4X9N A;  5BUK A;  5C2T A;  2YG3 A;  3DME A;  3F8P A;  3OZ2 A;  4XWZ A;  2BYB A;  1NHP A;  4A6N B;  1O94 A;  4GR1 A;  5BUL A;  1L9E A;  2CFY A;  2R4E A;  2R46 A;  3D8X A;  4EQR A;  2EQ8 A;  3FPZ A;  3NT6 A;  3P4P A;  1KSS A;  3NRN A;  5JCI A;  2FJA A;  3QSS A;  3RP8 A;  3DGH A;  4FDC B;  1N1P A;  4TM1 A;  4II3 A;  4H4T A;  2V61 A;  3GYX A;  3NH3 X;  3PO7 A;  4H7U A;  2A89 A;  5CQF A;  3C96 A;  5EB4 A;  2Y6Q A;  2VQB A;  3QJ4 A;  3NK1 X;  3RP7 A;  3AEA A;  4K22 A;  4GAP A;  4M52 A;  4B63 A;  4OPL A;  5CKU A;  3NGC X;  2EQ7 A;  3ALM A;  4H4P A;  2QA2 A;  1REO A;  3NN6 X;  2B9W A;  1PJ6 A;  3C4N A;  3DJJ A;  5M0Z A;  2RGH A;  2VRL A;  4H4R A;  3SYI A;  3GDP A;  4CNJ A;  2YLS A;  4EIQ A;  3EF6 A;  2XVJ A;  1N4U A;  5JCK A;  1PBB A;  1OJD A;  1QJD A;  3UCL A;  3NYE A;  3UOZ A;  1JNZ A;  4H2R A;  3NG7 X;  5KNL A;  2YG7 A;  3HYW A;  4MJW A;  3AYJ A;  1YY5 A;  2BCG G;  2Q7V A;  4NEW A;  3GWD A;  2XLU A;  2YLT A;  4ZN0 A;  2WOW A;  3SFE A;  1GET A;  3RHA A;  1N4V A;  1PJ7 A;  3H8I A;  4YKG A;  2UZZ A;  2ZZ0 A;  2Z5Y A;  3HYV A;  4IA5 A;  3SFD A;  3QFB A;  3QSE A;  5KVI A;  4A6N A;  2WQY A;  3CGC A;  3E1T A;  4B67 A;  2VVL A;  2GAH B;  1CBO A;  3SY4 A;  3Q6J A;  2VVM A;  3DK9 A;  3T0K A;  1VG0 A;  3DA1 A;  3ICS A;  3I3L A;  1D4C A;  1NHR A;  5KXJ A;  2YG5 A;  4OCG A;  2BK5 A;  2OAL A;  1TYP A;  3NK2 X;  3C4A A;  3UKL A;  1BZL A;  1BGN A;  2BAC A;  2CUL A;  2RAB A;  1EL7 A;  2HQM A;  2YQU A;  3VRB A;  2XVF A;  1LQU A;  1IUS A;  2XVI A;  2YG4 A;  2GMH A;  1DOB A;  3CGD A;  4J56 A;  4LA1 A;  3BHF A;  2Q0K A;  3IC9 A;  4U8M A;  4UP3 A;  2XFQ A;  2WBA A;  1PHH A;  1F8S A;  3R9U A;  4H4X A;  1PBD A;  1KNP A;  3DK8 A;  3VRA A;  5L46 A;  2R0P A;  1JEH A;  4O5U A;  4B1B A;  4B64 A;  1O95 A;  1FCD A;  2C70 A;  3SZ0 A;  3CPH G;  4OPT A;  3RED A;  1IUU A;  1PJ5 A;  3L1R A;  2GR0 A;  3L8K A;  4YWO A;  2WPF A;  1W4X A;  3VR9 A;  4LII A;  2WPC A;  3ISH A;  2JB1 A;  4H4V A;  4XWR A;  5J7X A;  1XHC A;  4WCT A;  4AT0 A;  2XFN A;  2E4G A;  4C74 A;  4OPG A;  2BC1 A;  3ALL A;  3II4 A;  3NTD A;  1GND A;  2YR6 A;  1N4W A;  3G5S A;  3H8L A;  4BJZ A;  1Q1W A;  3BHK A;  2JB3 A;  4ZCD A;  1H7W A;  2GMJ A;  3UP4 A;  4H4Y A;  3AE7 A;  1YQZ A;  4AT2 A;  1CJ3 A;  1YKJ A;  2VOU A;  1JRZ A;  2YAU A;  1P2H A;  2VVL G;  4DNA A;  1JRX A;  3ATQ A;  3M0O A;  2WOV A;  3ZDN A;  2XLP A;  4GDP A;  2YWL A;  2DKI A;  3OC4 A;  4CRT A;  4Z2T A;  2WP5 A;  3AEE A;  3AE1 A;  2QCU A;  1GRH A;  1KFY A;  1D5T A;  2XCG A;  3DK4 A;  2H89 A;  4YXD A;  1XAN A;  2B76 A;  4NNJ A;  4C5O A;  3NNE A;  2B9X A;  3GDN A;  5U25 A;  3VRD B;  3CN8 A;  3UKK A;  3UP5 A;  2GQF A;  2W0H A;  4ZCC A;  3SZW A;  4BV6 A;  3KPK A;  1B37 A;  2GR1 A;  1TRB A;  4OPI A;  5EB5 A;  5FMH A;  3IHG A;  4IVM B;  3EAN A;  4EQS A;  4J36 A;  2C67 A;  3CND A;  4Z2U A;  4H4W A;  4K8D A;  4USQ A;  1GRF A;  1K0J A;  3AD8 B;  5EBK A;  4YTM A;  4RSL A;  3V3O A;  2A8X A;  1L9D A;  1Z6L A;  3GRS A;  5U1O A;  4A9W A;  4D03 A;  4Z44 A;  1B4V A;  1E1K A;  2PYX A;  3ATR A;  1YQ3 A;  2C76 A;  1S2Q A;  5EOW A;  2APG A;  1GT8 A;  2GV8 A;  2A87 A;  2BS3 A;  1F8W A;  2BXR A;  2X50 A;  2B7S A;  4K5R A;  4GAV A;  3LXD A;  3VQR A;  1P2E A;  3IHM A;  3S61 A;  4TM0 A;  3CNS A;  4G74 A;  2TMD A;  2FJD A;  2PHH A;  1K0I A;  1PXA A;  1DXL A;  2V3B A;  2XDO A;  3T2K A;  1GRE A;  1GOS A;  4EMJ A;  3M12 A;  2GAG B;  5KMQ A;  4B65 A;  2R4J A;  1H83 A;  1BF3 A;  3CTY A;  1FOH A;  3BNM A;  5DBJ A;  2WET A;  5HY5 A;  2QA1 A;  4NTE A;  4H2N A;  2X3N A;  3GMC A;  1NPX A;  4CY6 A;  4G6G A;  1EL9 A;  1NG3 A;  3KKJ A;  2C64 A;  1X31 B;  2XLT A;  1O5W A;  1H86 A;  3M13 A;  3SQP A;  2RGJ A;  3KU9 A;  4U8L A;  3BNU A;  2BRY A;  2C7G A;  4JDR A;  3SGL A;  3UOY A;  2BK3 A;  3AED A;  3K7Q X;  3RP6 A;  3CGE A;  2IVE A;  2Q0L A;  2ACZ A;  1E1L A;  2YVF A;  1DJN A;  4H4Q A;  4NZH A;  3UKH A;  1GPE A;  2VQ7 A;  2E1M A;  5HHF A;  1H82 A;  1L9C A;  2O9Z A;  3ALJ A;  3CPJ G;  3UOV A;  3BI5 A;  2C3D A;  3COX A;  5IQ1 A;  1ZK7 A;  1Q1R A;  2V6O A;  3T14 A;  2FJB A;  3GWF A;  1ZMD A;  1Y56 B;  1GER A;  2IID A;  3IF9 A;  1K4Q A;  3KA7 A;  2WDR A;  3P4S A;  4OPC A;  4H4S A;  3CNJ A;  1CC6 A;  1LQT A;  1ZOV A;  5KMS A;  2GB0 A;  3RNM A;  3GRT A;  3PVC A;  2WES A;  2CDU A;  4I58 A;  4U8J A;  3P9U A;  4JN9 A;  3FBS A;  5FS6 A;  4CCQ A;  1FEC A;  3SX6 A;  1LPF A;  2CVJ A;  2JAE A;  3CNP A;  3T37 A;  4UDP A;  3LB8 A;  3V3N A;  3P4R A;  3IWA A;  2V3A A;  5KMR A;  3AWI A;  4O5Q A;  4AOX A;  4EMI A;  5M10 A;  1LJ1 A;  4FK1 C;  4JNA A;  1IUX A;  1HYU A;  2F5Z A;  3DH9 A;  2QAE A;  1XPQ A;  1E6E A;  1KNR A;  4IVO B;  1CC4 A;  4X4J A;  5C3J A;  1BGJ A;  2YR5 A;  3NK0 X;  4U8O A;  1COY A;  1E39 A;  3T2Z A;  3G5R A;  4YSX A;  2OAM A;  1VQW A;  3GMB A;  2GEW A;  1IUW A;  3AEF A;  1YQ4 A;  3AE2 A;  4A99 A;  5IPY A;  3O0H A;  4H2P A;  3AE6 A;  3B3R A;  4NEV A;  3UOX A;  5FS9 A;  1S2Y A;  1ZDL A;  2YVG A;  3UTE A;  2YLZ A;  2AAQ A;  2WP6 A;  2XFO A;  4EMW A;  1JRY A;  1F6M A;  5FS7 A;  1H6V A;  5JCN A;  4N9X A;  2JB2 A;  4TLX A;  1M64 A;  1B5Q A;  1ZY8 A;  1H7X A;  1V59 A;  4H4Z A;  1H84 A;  4ECH A;  3AE4 A;  4GRT A;  1GXF A;  4U2S A;  3UKQ A;  2WU5 A;  1RP0 A;  3JSK A;  1OJA A;  2R0G A;  3NN0 X;  4DSG A;  3CIR A;  3ICR A;  1EL8 A;  1GSN A;  3V76 A;  3D1C A;  3VR8 A;  1ZX9 A;  2C72 A;  1RSG A;  4B68 A;  4LU6 A;  4AP1 A;  4C77 A;  4YSY A;  4E0V A;  2BRA A;  1VDC A;  3NYC A;  1PBF A;  1GAL A;  4IV9 A;  1S3E A;  4Z43 A;  4TLZ A;  1M6I A;  2XVE A;  3QFA A;  4K2X A;  1DJQ A;  5KMP A;  1TDK A;  2FJE A;  2XLS A;  2H88 A;  4KPR A;  1D4D A;  1TDN A;  3GYJ A;  4KX6 A;  2XFU A;  2Q6U A;  1NHS A;  4NWZ A;  1F3P A;  2XLR A;  3T31 A;  2X8H A;  4DGK A;  4Z2R A;  2BS4 A;  3HYX A;  3BI4 A;  2OLO A;  1TDF A;  4B66 A;  2B7R A;  2GH5 A;  3SM8 A;  2V60 A;  2BA9 A;  1OJ9 A;  4A7A A;  2ZZB A;  4JY2 A;  2JKC A;  4U2L A;  1UKV G;  4A5L A;  1NEK A;  1GEU A;  2YM1 A;  3GYI A;  4TM4 A;  2AQJ A;  4YTN A;  2B9Y A;  4DSH A;  5ER0 A;  5U63 A;  4YSH A;  1GES A;  2C73 A;  1FL2 A;  2R45 A;  4I59 A;  3T2Y A;  2R9Z A;  1DOC A;  4J31 A;  2YM2 A;  5HXI A;  4C3Y A;  1MO9 A;  3AXB A;  5GSN A;  2OLN A;  1GRB A;  2XVH A;  1PDH A;  4BUR A;  1OJC A;  2BS2 A;  1GRA A;  3KVE A;  2C4C A;  2ZBW A;  5KOW A;  3NLC A;  2VZ2 A;  4JNQ A;  3H4K A;  3FG2 P;  2TPR A;  2WEU A;  3QVR A;  2YR4 A;  3DJE A;  3KLJ A;  4GDE A;  1GRG A;  1DNC A;  3AYI A;  3UTF A;  2X8C A;  3UKF A;  4APN A;  4YT0 A;  4GCM A;  4USR A;  1E1M A;  1NDA A;  4X9M A;  1TYT A;  4H2Q A;  1PBC A;  3AE5 A;  2ARD A;  3AD9 B;  1BKW A;  1CF3 A;  1VRQ B;  1SEZ A;  1GV4 A;  2GQW A;  3CPI G;  4U8N A;  2GRT A;  1F8R A;  3P1W A;  2I0Z A;  4EIP A;  1GTE A;  5KOX A;  2JK6 A;  2YG6 A;  1CL0 A;  1EL5 A;  1PN0 A;  3KPF A;  4ICY A;  4CY8 A;  2FBW A;  2GR3 A;  1PXB A;  2YVJ A;  3BI2 A;  2NVK X;  1QO8 A;  4CNK A;  4YTP A;  3NHO X;  2WHD A;  3DJD A;  2BCP A;  3FMW A;  4REK A;  5GRT A;  2BK4 A;  2YLW A;  1H81 A;  4CBQ A;  5LV9 A;  1D7L A;  2C75 A;  4D04 A;  4U8I A;  1OJT A;  1KSU A;  2WDV A;  5JCM A;  1CHU A;  4RG4 A;  2AR8 A;  4Y4M A;  2IVD A;  4A65 A;  1FEA A;  3CMM A;  2BXS A;  1PS9 A;  2C3C A;  2WS3 A;  4OPU A;  4PAB A;  4OVI A;  1DOE A;  1NEN A;  3B6D A;  1IJH A;  3SZF A;  3UKP A;  3LZW A;  4H4U A;  3S5W A;  3WE0 A;  2C65 A;  3GD4 A;  3I6D A;  4U8K A;  1FEB A;  1S3B A;  2BAB A;  1VG9 A;  1NG4 A;  2OA1 A;  5IQ4 A;  4HB9 A;  4J34 A;  1NAA A;  1JU2 A;  2E5V A;  4J2W A;  1E7P A;  3NTA A;  4GUV A;  1EBD A;  3G5Q A;  4BK2 A;  4AOS A;  2EQ6 A;  2V5Z A;  3NYF A;  3QVP A;  4RG3 A;  1GRT A;  3NIX A;  4GF7 A;  1CC2 A;  2VRM A;  4FK1 A;  4K7Z A;  2Z5X A;  4P9S A;  3GSI A;  1JNR A;  3AB1 A;  4Y4N A;  2X8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...