3NK0X

Complex of 6-hydroxy-l-nicotine oxidase with inhibitor bound at active site and turnover product at exit cavity
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
b'MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 149
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk0X02
3G5RA 3P4QA 1KSSA 3V3NA 3QFAA 1DOEA 2GR1A 3CNDA 2BCGG 2ZZ0A 4U8JA 1RYIA 1PHHA 3FPZA 3ADAB 4U2SA 2XLSA 4EQWA 3K30A 4Y4LA 2Q6UA 1L9DA 2X99A 2FBWA 1PBBA 1PBCA 1NG4A 4A6NA 1FEAA 1X31B 2C66A 1ZMDA 2E4GA 4EIPA 2C76A 2GRTA 1ZKQA 3P4SA 1QO8A 4JNQA 3SQPA 2BK5A 2YLWA 4JNAA 2FJAA 3S5WA 1GXFA 4RG3A 1GRAA 2VRLA 1JEHA 2YLXA 4A5LA 4DSGA 1GERA 2JBVA 3AEAA 3V76A 3K7QX 4IA5A 3NIXA 4KPRA 4CCQA 1H86A 1IUWA 3DJGX 4U2LA 4EM3A 2R0CA 1DJQA 5C3JA 1F8SA 3CGBA 5C2TA 2WHDA 1P2HA 1IJHA 1LVLA 1CJCA 1YQ3A 3HZLA 4OVIA 2WOVA 3NK0X 4NTEA 3EPTA 3AE4A 2GMJA 5U63A 3VRAA 2GAHB 2V3BA 3NK1X 2H89A 2WU2A 1VG0A 3SFEA 4CNKA 1ZOVA 5LV9A 1LJ1A 4J57A 4ZCDA 3GMBA 5U1OA 3AE5A 4D03A 4YSHA 2XDOA 1EBDA 5EOWA 4EQSA 1Y56A 1IUXA 1ZX9A 2YLZA 2V60A 3AEEA 5FS9A 4TM4A 2X8HA 3ATQA 1ELIA 1TDFA 3ICSA 5IQ1A 3GD4A 5U25A 2YG6A 3ALMA 3AEBA 3AE3A 4REKA 3ATRA 3FMWA 3UKHA 3NTDA 2B7RA 2JB2A 2C3CA 3GWDA 3K7MX 1BZLA 4ICYA 3VQRA 1ZY8A 1AOGA 1NHPA 2WOWA 5FS7A 3NYFA 1ZMCA 5M10A 4HA6A 3BHKA 4TM1A 3UOZA 4B69A 2QA2A 1BGNA 2YR5A 4CNJA 2ACZA 2DKHA 4WCTA 4YWOA 2GVCA 3GMCA 2WETA 2QCUA 4H2PA 1OJCA 2YWLA 4CRTA 4DSHA 2BC1A 4NTCA 4YSXA 4H7UA 1FECA 3FIMB 2YLTA 2R9ZA 3IWAA 1EL8A 1GRHA 4H4XA 3UKFA 1GRTA 1EL9A 4H2NA 3F8PA 4X9MA 3I3LA 4U2TA 1TDKA 4EIQA 1H7XA 1ZOYA 2BACA 4YT0A 3AYLA 5BUKA 4AP1A 3EF6A 2CVJA 2BYBA 2X8CA 3UKPA 4Z2RA 4J56A 1PJ6A 5KWFA 3C4AA 2WDRA 3CPJG 1S2QA 3DH9A 5GSNA 3UTGA 5KRQA 3UOXA 3UKAA 1PDHA 3LXDA 4WX1A 1OJ9A 4ADWA 4EMWA 1DXLA 1B5QA 3OZ2A 2JKCA 3GWFA 1H82A 1YQZA 4YTNA 1KFYA 4OPTA 4B1BA 1PJ5A 4IA6A 3JSKA 5EBKA 1ZDLA 1FCDA 2YR4A 1GEUA 2GQFA 1CJ4A 4LU6A 3NKSA 4A9WA 1GALA 2BXRA 4M52A 1GETA 4B67A 4JDRA 2IIDA 3QSMA 3NTAA 4J33A 4A7AA 1NENA 1GV4A 2E5VA 3II4A 4RG4A 3NLCA 3RNMA 2FJEA 1K4QA 4YSZA 3IF9A 3ALLA 4Z26A 3KU9A 4H4QA 1GRBA 4YKFA 3M0OA 3GDNA 1JRYA 3Q9TA 3LOVA 2RGOA 2WESA 3PVCA 4LA1A 3GDPA 1E6EA 4CY8A 1IUUA 1F6MA 3QFBA 4KX6A 4TLXA 2O9ZA 2Q0LA 3ITJA 3RP6A 3CPHG 1K0JA 1N4WA 4I59A 3VR8A 2R4JA 3NRNA 3QVRA 3PS9A 3CTYA 2C73A 3E1TA 5CKUA 1KDGA 3AXBA 5ER0A 4K2XA 5DBJA 5FS8A 5JCMA 3IHGA 4C77A 3KD9A 4U8PA 4K22A 2GR0A 3UOVA 4A79A 4H4SA 4U8KA 3ICTA 2YVGA 5BVAA 3DK4A 1B4VA 1Y0PA 2YAUA 4K7ZA 4A99A 1NHQA 1Q1WA 4OPCA 3AE8A 1Q1RA 2YG4A 4EM4A 1W4XA 3D8XA 3D1CA 5EB4A 4DNAA 3CNSA 2FJDA 3UKQA 3AWIA 2BS4A 1H83A 4FX9A 4H4WA 5HY5A 3CGDA 2XVFA 2GEWA 4JY3A 1D5TA 2YR6A 1DOCA 3DGZA 1D4EA 2BK3A 3RP8A 3UKKA 1S3BA 3DMEA 2EQ8A 1IUTA 4Z24A 1LTXR 4B63A 4I58A 5M0ZA 5KOWA 1B8SA 1IUSA 3UCLA 2WP5A 3QSSA 2B7SA 2C64A 2BCPA 4BK3A 3SM8A 3DK8A 5FMHA 1TRBA 1JRZA 1L9CA 3F8DA 4CCRA 5KOXA 2C67A 2CDUA 3BNUA 4B66A 4C3YA 4N9XA 2JB3A 2WPCA 2V5ZA 4JY2A 3AD9B 4IVMB 4Z43A 1GESA 2TMDA 3H8IA 3H4KA 4TM3A 2Z5YA 3NYEA 3CN8A 4GRTA 2WU5A 3FBSA 2WOIA 4OPGA 4CY6A 3CIRA 4USQA 1BWCA 3AD7B 2ZBWA 3CNTA 3CNPA 4H4YA 1TDNA 2QAEA 4H4PA 1MXTA 2DKIA 4OPLA 2B9YA 3ZDNA 1CL0A 2OLNA 4U8LA 2AAQA 1D4CA 1F3PA 4B65A 1TYTA 2BS3A 2BK4A 3RHAA 2YLSA 1MO9A 3QSEA 4K8DA 1KNRA 1M6IA 4AT2A 1YKJA 3AYIA 3DK9A 1XDIA 1ZP0A 1Z6LA 1YY5A 3DJDA 3I6DA 3AB1A 2WDVA 2XVJA 4H4VA 4DGKA 1EL7A 1OJAA 3UTHA 4Z2UA 3NK2X 4GUVA 1E1KA 4TLZA 5HXIA 1P2EA 1LV0A 1RSGA 3AE1A 2WBAA 3AD8B 1N1PA 1E7PA 3UP4A 4APNA 1PXCA 3OC4A 3KLJA 2A8XA 2NPXA 2H88A 3SGLA 1DODA 3AE2A 4U8OA 1F8WA 2XLTA 2VQBA 3ABVA 2YM1A 4Z25A 4H4UA 4XXGA 4PABA 3GYJA 1CBOA 1PN0A 2W0HA 2C3DA 4NZHA 1OJDA 4H50A 1PJ7A 3QJ4A 4HB9A 3VRBA 1S2YA 4J2WA 4C3XA 2XVIA 3NHOX 3T37A 4Y4MA 2WP6A 4J31A 4YXDA 3L8KA 1S3EA 3FG2P 5JCKA 4E0VA 4EMJA 2R0GA 1GRGA 2Y6QA 5IPYA 1XHCA 2B76A 2R0PA 2Y6RA 3NH3X 1KNPA 2XFNA 4UDQA 5J60A 3H8LA 3ICRA 4UDRA 2XFOA 3GSIA 2CULA 1MOKA 2XLPA 5BULA 4AP3A 5J7XA 4GR1A 2JAEA 4H4ZA 2XLUA 1D4DA 1F8RA 1PS9A 1GT8A 2PHHA 3M12A 1VDCA 3AE6A 1H84A 3G5SA 5HHFA 2X50A 3G5QA 3AE7A 4NTDA 1GRFA 1JNRA 2NVKX 4GF7A 1M64A 2AQJA 2YVFA 1IUVA 3DA1A 4UDPA 4BJZA 3ALJA 4U8NA 2C70A 3UP5A 2GH5A 3ISHA 4XWZA 1Y56B 2VOUA 4IV9A 1D7YA 3S61A 1EL5A 4A65A 1VG9A 4K5RA 3AEGA 3QVPA 3AYJA 3NGCX 4J36A 4YSYA 2YQUA 2JK6A 3M13A 3NT6A 4X4JA 1JNZA 3L1RA 1NPXA 5JCIA 3SFDA 3NG7X 2VVMA 4D04A 4CBQA 2GF3A 3GRTA 2X3NA 4YTMA 4P9SA 3RP7A 1XANA 3WE0A 2EQ6A 3LADA 3UTEA 1NDAA 3BI4A 3UTFA 2XVHA 1XPQA 2YG3A 2OAMA 5FS6A 3NN6X 5BRTA 4RSLA 5KVIA 2BABA 1QLBA 1OJTA 4O5QA 3KVEA 3AE9A 1JOAA 4YTPA 5JCLA 1FOHA 3GD3A 1B37A 2VZ2A 2F5ZA 2VQ7A 2VVLA 3BI5A 4AOXA 4MJWA 3B6DA 1V59A 2WPFA 3C96A 3IHMA 2IVEA 1PXBA 4GDEA 4NEVA 3R9UA 1L0VA 1CC4A 3PO7A 5JCNA 2V6OA 3CGCA 2E1MA 3CNJA 3GRSA 3AEDA 4U8MA 3F8RA 1PBDA 2GAGB 1QJDA 2RABA 3NNEA 1PBEA 1NG3A 1JU2A 2J3NA 1H6VA 5GRTA 2ZZBA 3KA7A 2GV8A 3DGHA 4IVOB 2VVLG 5TR3A 1DOBA 2R45A 4AOSA 4ZN0A 3P4PA 3EAOA 4XWRA 3V3OA 2XVEA 1NAAA 1NHSA 2APGA 5L46A 2TPRA 1DJNA 2QA1A 5CQFA 1SEZA 2XFQA 4B64A 4LIIA 4JQ9A 2YLRA 2A89A 3B3RA 4UP3A 1GPEA 2BC0A 2BS2A 2I0ZA 2Q7VA 1O95A 3COXA 3LJPA 4BK2A 1REOA 2XFUA 1NEKA 2XLRA 3GYIA 3BNMA 3P9UA 1CJ3A 3P1WA 3NN0X 1H81A 1O94A 2YVJA 1CC2A 1GSNA 2X8GA 3IC9A 3LZWA 4J34A 5HYMA 1FL2A 1VQWA 2Z5XA 1E39A 4X9NA 5EB5A 2WDQA 2XCGA 1N4UA 2A87A 1E1LA 4AT0A 4Z44A 4EQRA 1E1NA 2XYOA 3LB8A 4EMIA 2B9XA 1PXAA 4BURA 2JB1A 2WQYA 1CHUA 4K5SA 1BF3A 3AECA 3REDA 2GB0A 1BKWA 2GR3A 4FDCB 4JN9A 3O0HA 1HYUA 1ZK7A 3KKJA 3KPFA 1D7LA 1LQTA 1NHRA 4USRA 1K0IA 4B68A 5IQ4A 2PYXA 4OPUA 1PBFA 2IVDA 4A6NB 2FJBA 1DNCA 2XFPA 4C5OA 4EQXA 4H2QA 1CF3A 1UKVG 2VRMA 1CJ2A 1GTEA 2GMHA 4GDPA 4OCGA 1E1MA 1JRXA 1RP0A 4ECHA 5KVHA 2OLOA 2WEUA 4BV6A 1L9EA 4H4TA 2R4EA 4OPDA 2UZZA 2V3AA 1ONFA 2YM2A 2WP9A 3CPIG 1YQ4A 1TDEA 1TDOA 3C4NA 2RGHA 3CGEA 3URHA 2WPEA 3BHFA 1GTHA 3UOYA 1CC6A 4H2RA 1GNDA 2CFYA 1LPFA 4FK1A 4O5UA 4BJYA 1GOSA 2GQWA 1O5WA 2B9WA 3VR9A 4Z2TA 2C7GA 1N4VA 2C65A 2GR2A 1KSUA 2YG7A 4GCMA 2R46A 4U8IA 3DJEA 2YG5A 4Y4NA 4H4RA 1BGJA 5KXJA 3ZYXA 1H7WA 4BK1A 2Q0KA 4ZCCA 4C74A 3BI2A 3VRDB 1FEBA 1K0LA 1VRQB 2ARDA 1LQUA 2EQ7A 3K7TA 4NEWA 4YKGA 1Q9IA 4FK1C 4OPIA 3Q6JA 2BXSA 3UKLA 2RGJA 1GREA 3AEFA 2C72A 2ZZCA 2EQ9A 2OA1A 4TM0A 2OALA 2WS3A 3P4RA 2AR8A 2BA9A 3LZXA 4PAAA 1KF6A 2V61A 2HQMA 1TYPA 1COYA 3NYCA 3EANA 2C75A 3DJJA
chains in the Genus database with same CATH superfamily
3G5RA 3P4QA 1KSSA 3V3NA 3QFAA 1DOEA 2GR1A 3CNDA 2BCGG 2ZZ0A 4U8JA 1RYIA 1PHHA 3FPZA 3ADAB 4U2SA 2XLSA 4EQWA 3K30A 4Y4LA 2Q6UA 1L9DA 2X99A 2FBWA 1PBBA 1PBCA 1NG4A 4A6NA 1FEAA 1X31B 2C66A 1ZMDA 2E4GA 4EIPA 2C76A 2GRTA 1ZKQA 3P4SA 1QO8A 4JNQA 3SQPA 2BK5A 2YLWA 4JNAA 2FJAA 3S5WA 1GXFA 4RG3A 1GRAA 2VRLA 1JEHA 2YLXA 4A5LA 4DSGA 1GERA 2JBVA 3AEAA 3V76A 3K7QX 4IA5A 3NIXA 4KPRA 4CCQA 1H86A 1IUWA 3DJGX 4U2LA 4EM3A 2R0CA 1DJQA 5C3JA 1F8SA 3CGBA 5C2TA 2WHDA 1P2HA 1IJHA 1LVLA 1CJCA 1YQ3A 3HZLA 4OVIA 2WOVA 3NK0X 4NTEA 3EPTA 3AE4A 2GMJA 5U63A 3VRAA 2GAHB 2V3BA 3NK1X 2BRAA 2H89A 2WU2A 1VG0A 3SFEA 4CNKA 1ZOVA 5LV9A 1LJ1A 4J57A 4ZCDA 3GMBA 5U1OA 3AE5A 4D03A 4YSHA 2XDOA 1EBDA 5EOWA 4EQSA 1Y56A 1IUXA 1ZX9A 2YLZA 2V60A 3AEEA 5FS9A 4TM4A 2X8HA 3ATQA 1ELIA 1TDFA 3ICSA 5IQ1A 3GD4A 5U25A 2YG6A 3ALMA 3AEBA 3AE3A 4REKA 3ATRA 3FMWA 3T14A 3UKHA 3NTDA 2B7RA 2JB2A 2C3CA 3GWDA 3K7MX 1BZLA 3KPKA 4ICYA 1ZY8A 3VQRA 1NHPA 2WOWA 5FS7A 1AOGA 3NYFA 1ZMCA 5M10A 4HA6A 4CY6A 3BHKA 4TM1A 3UOZA 4B69A 2QA2A 1BGNA 2YR5A 4G6HA 4CNJA 2ACZA 2DKHA 4WCTA 4YWOA 2GVCA 3GMCA 2WETA 2QCUA 4H2PA 1OJCA 2YWLA 4CRTA 4DSHA 2BC1A 4NTCA 4YSXA 4H7UA 1FECA 3FIMB 2YLTA 3SZFA 2R9ZA 3IWAA 1EL8A 1GRHA 4H4XA 3T2KA 3UKFA 1GRTA 1EL9A 4H2NA 3F8PA 4X9MA 3I3LA 4U2TA 1TDKA 4EIQA 1H7XA 1ZOYA 2BACA 4YT0A 3AYLA 5BUKA 4AP1A 3EF6A 2CVJA 2BYBA 2X8CA 4II2A 3UKPA 4Z2RA 4J56A 1PJ6A 5KWFA 3C4AA 2WDRA 3CPJG 3HYVA 1S2QA 3DH9A 5GSNA 3UTGA 5KRQA 3UOXA 3UKAA 1PDHA 3LXDA 4WX1A 1OJ9A 3SXIA 4ADWA 1DXLA 1B5QA 4EMWA 3OZ2A 2JKCA 3GWFA 1H82A 1YQZA 4YTNA 1KFYA 5KMSA 4OPTA 4B1BA 1PJ5A 4IA6A 3JSKA 5EBKA 3CMMA 1ZDLA 1FCDA 2YR4A 2GQFA 1GEUA 1CJ4A 4LU6A 3NKSA 4A9WA 1GALA 2BXRA 4M52A 1GETA 4B67A 4JDRA 2IIDA 3QSMA 3NTAA 4J33A 4A7AA 1NENA 1GV4A 2E5VA 3II4A 4RG4A 3NLCA 3RNMA 2FJEA 1K4QA 4YSZA 3IF9A 3ALLA 4Z26A 3KU9A 4H4QA 1GRBA 4YKFA 3M0OA 3GDNA 1JRYA 3Q9TA 3LOVA 2RGOA 2WESA 3PVCA 4LA1A 3GDPA 1E6EA 4CY8A 1IUUA 1F6MA 3QFBA 4KX6A 4TLXA 2O9ZA 2Q0LA 3ITJA 3RP6A 3CPHG 1K0JA 1N4WA 4I59A 3VR8A 2R4JA 3NRNA 3QVRA 3PS9A 3CTYA 3HYXA 2C73A 3E1TA 5CKUA 1KDGA 3AXBA 5ER0A 4K2XA 5DBJA 5FS8A 5JCMA 3IHGA 4C77A 3KD9A 4U8PA 4K22A 2GR0A 3UOVA 4A79A 4H4SA 4U8KA 3ICTA 2YVGA 5BVAA 3DK4A 1B4VA 1Y0PA 2YAUA 4K7ZA 4A99A 1NHQA 1Q1WA 4OPCA 3AE8A 1Q1RA 2YG4A 4EM4A 1W4XA 3D8XA 3D1CA 5EB4A 4DNAA 3CNSA 2FJDA 3UKQA 3AWIA 2BS4A 1H83A 4FX9A 4H4WA 5HY5A 3CGDA 2XVFA 2GEWA 4JY3A 1D5TA 2YR6A 1DOCA 3DGZA 1D4EA 2BK3A 3RP8A 3UKKA 1S3BA 3DMEA 2EQ8A 1IUTA 4Z24A 1LTXR 4B63A 4I58A 5M0ZA 5KOWA 1B8SA 1IUSA 3UCLA 2WP5A 3QSSA 2B7SA 2C64A 2BCPA 4BK3A 3SM8A 3DK8A 5FMHA 1TRBA 1JRZA 1L9CA 3F8DA 4CCRA 5KOXA 3T31A 2C67A 5KMRA 2CDUA 3BNUA 4B66A 4C3YA 4N9XA 2JB3A 2WPCA 2V5ZA 4JY2A 3AD9B 4IVMB 4Z43A 1GESA 2TMDA 3H8IA 3H4KA 4TM3A 2Z5YA 3NYEA 3CN8A 4GRTA 2WU5A 3FBSA 2WOIA 4OPGA 3HYWA 3SY4A 3CIRA 4USQA 1BWCA 3AD7B 2ZBWA 3CNTA 3CNPA 4H4YA 1TDNA 2QAEA 4H4PA 1MXTA 2DKIA 4OPLA 2B9YA 3ZDNA 1CL0A 2OLNA 4U8LA 2AAQA 1D4CA 1F3PA 4B65A 1TYTA 2BS3A 2BK4A 3RHAA 2YLSA 1MO9A 3QSEA 4K8DA 1KNRA 1M6IA 4AT2A 1YKJA 3AYIA 3DK9A 1XDIA 1ZP0A 1Z6LA 1YY5A 3DJDA 3I6DA 3AB1A 2WDVA 2XVJA 4H4VA 4DGKA 1EL7A 1OJAA 3UTHA 3SZWA 4Z2UA 3NK2X 4GUVA 1E1KA 4TLZA 5HXIA 1P2EA 1LV0A 1RSGA 3AE1A 2WBAA 3AD8B 1N1PA 1E7PA 3UP4A 4APNA 1PXCA 3OC4A 3KLJA 2A8XA 2NPXA 2H88A 3SGLA 1DODA 3AE2A 4U8OA 1F8WA 2XLTA 2VQBA 3ABVA 2YM1A 4Z25A 4H4UA 4XXGA 4PABA 3GYJA 1CBOA 1PN0A 2W0HA 4GAVA 2C3DA 4NZHA 2C4CA 1OJDA 4H50A 1PJ7A 3QJ4A 4HB9A 3VRBA 1S2YA 4J2WA 4C3XA 2XVIA 3NHOX 3T37A 4Y4MA 2WP6A 4J31A 4YXDA 3L8KA 1S3EA 3FG2P 5JCKA 4E0VA 4EMJA 2R0GA 1GRGA 2Y6QA 5IPYA 1XHCA 2B76A 2R0PA 2Y6RA 3NH3X 1KNPA 2XFNA 4UDQA 5J60A 3H8LA 3ICRA 4UDRA 2XFOA 3GSIA 2CULA 1MOKA 2XLPA 5BULA 4AP3A 5J7XA 4GR1A 2JAEA 4H4ZA 2XLUA 3SZCA 1D4DA 1F8RA 1PS9A 1GT8A 2PHHA 3M12A 1VDCA 3AE6A 1H84A 3G5SA 5HHFA 2X50A 3G5QA 3AE7A 4NTDA 1GRFA 1JNRA 2NVKX 4GF7A 1M64A 2AQJA 2YVFA 1IUVA 3DA1A 4UDPA 4BJZA 3ALJA 4U8NA 2C70A 3UP5A 2GH5A 3ISHA 4XWZA 1Y56B 2VOUA 4IV9A 1D7YA 3S61A 1EL5A 4A65A 1VG9A 4K5RA 3AEGA 3QVPA 3AYJA 3NGCX 4J36A 4YSYA 2YQUA 2JK6A 3M13A 3NT6A 4NNJA 4X4JA 1JNZA 3L1RA 1NPXA 5JCIA 3SFDA 3NG7X 2VVMA 4D04A 4CBQA 2GF3A 3GRTA 2X3NA 4YTMA 4P9SA 3RP7A 1XANA 4NWZA 3WE0A 2EQ6A 3SZ0A 3LADA 3UTEA 1NDAA 3BI4A 3UTFA 2XVHA 1XPQA 2YG3A 2OAMA 5FS6A 3NN6X 5BRTA 4RSLA 5KVIA 2BABA 1QLBA 1OJTA 4O5QA 3KVEA 3AE9A 1JOAA 4G6GA 4YTPA 5JCLA 1FOHA 3GD3A 1B37A 2VZ2A 2F5ZA 2VQ7A 2VVLA 3BI5A 4AOXA 4MJWA 3B6DA 1V59A 2WPFA 3C96A 3IHMA 2IVEA 3SYIA 1PXBA 4GDEA 4NEVA 3R9UA 1L0VA 1CC4A 3PO7A 5JCNA 2V6OA 3CGCA 2E1MA 3CNJA 3GRSA 3AEDA 4U8MA 3F8RA 1PBDA 2GAGB 1QJDA 2RABA 3NNEA 1PBEA 1NG3A 2BRYA 1JU2A 2J3NA 1H6VA 5GRTA 2ZZBA 3KA7A 2GV8A 3DGHA 4IVOB 2VVLG 5TR3A 1DOBA 2R45A 4AOSA 4ZN0A 3P4PA 3EAOA 4XWRA 3V3OA 2XVEA 1NAAA 1NHSA 2APGA 5L46A 2TPRA 1DJNA 2QA1A 5CQFA 1SEZA 2XFQA 4B64A 4LIIA 4JQ9A 2YLRA 2A89A 3B3RA 4UP3A 1GPEA 2BC0A 2BS2A 2I0ZA 2Q7VA 1O95A 3COXA 3LJPA 4BK2A 1REOA 2XFUA 1NEKA 2XLRA 3GYIA 3BNMA 3P9UA 1CJ3A 3P1WA 3NN0X 1H81A 1O94A 2YVJA 5KMPA 1CC2A 1GSNA 2X8GA 3IC9A 3LZWA 4J34A 5HYMA 1FL2A 1VQWA 2Z5XA 1E39A 4X9NA 5EB5A 2WDQA 2XCGA 1N4UA 2A87A 1E1LA 4AT0A 4Z44A 4EQRA 1E1NA 2XYOA 3LB8A 4EMIA 2B9XA 1PXAA 4BURA 2JB1A 2WQYA 1CHUA 4K5SA 3GYXA 1BF3A 3AECA 3REDA 2GB0A 1BKWA 4G9KA 2GR3A 4FDCB 4JN9A 3O0HA 1HYUA 1ZK7A 3KKJA 3KPFA 3SX6A 1D7LA 1LQTA 1NHRA 4USRA 1K0IA 4B68A 5IQ4A 2PYXA 4OPUA 5KNLA 1PBFA 2IVDA 4A6NB 2FJBA 1DNCA 2XFPA 4C5OA 4EQXA 4H2QA 1CF3A 1UKVG 2VRMA 1CJ2A 1GTEA 2GMHA 4GDPA 4OCGA 1E1MA 1JRXA 1RP0A 4ECHA 5KVHA 2OLOA 2WEUA 4BV6A 1L9EA 4H4TA 2R4EA 4OPDA 2UZZA 2V3AA 1ONFA 2YM2A 2WP9A 3CPIG 1YQ4A 4II3A 1TDEA 1TDOA 3C4NA 2RGHA 3CGEA 3URHA 2WPEA 3BHFA 1GTHA 3UOYA 4G74A 1CC6A 4H2RA 1GNDA 2CFYA 1LPFA 4FK1A 4O5UA 4BJYA 1GOSA 2GQWA 1O5WA 2B9WA 3VR9A 4Z2TA 5KMQA 2C7GA 1N4VA 2C65A 2GR2A 3T0KA 1KSUA 2YG7A 4GCMA 2R46A 4U8IA 3DJEA 2YG5A 4Y4NA 4H4RA 1BGJA 5KXJA 3ZYXA 1H7WA 4BK1A 4GAPA 2Q0KA 4ZCCA 4C74A 3BI2A 3VRDB 1FEBA 1K0LA 1VRQB 2ARDA 1LQUA 2EQ7A 3K7TA 4NEWA 4YKGA 1Q9IA 4FK1C 4G73A 4OPIA 3Q6JA 2BXSA 3UKLA 2RGJA 1GREA 3AEFA 2C72A 2ZZCA 2EQ9A 2OA1A 4TM0A 2OALA 2WS3A 3P4RA 3T2ZA 2AR8A 2BA9A 3LZXA 4PAAA 1KF6A 2V61A 2HQMA 3T2YA 1TYPA 1COYA 3NYCA 3EANA 2C75A 3DJJA
chains in the Genus database with same CATH topology
3G5RA 3P4QA 1KSSA 3V3NA 3QFAA 1DOEA 2GR1A 3CNDA 2BCGG 2ZZ0A 4U8JA 1RYIA 1PHHA 3FPZA 3ADAB 4U2SA 2XLSA 4EQWA 3K30A 4Y4LA 2Q6UA 1L9DA 2X99A 2FBWA 1PBBA 1PBCA 1NG4A 4A6NA 1FEAA 1X31B 2C66A 1ZMDA 2E4GA 4EIPA 2C76A 2GRTA 1ZKQA 3P4SA 1QO8A 4JNQA 3SQPA 2BK5A 2YLWA 4JNAA 2FJAA 3S5WA 1GXFA 4RG3A 1GRAA 2VRLA 1JEHA 2YLXA 4A5LA 4DSGA 1GERA 2JBVA 3AEAA 3V76A 3K7QX 4IA5A 3NIXA 4KPRA 4CCQA 1H86A 1IUWA 3DJGX 4U2LA 4EM3A 2R0CA 1DJQA 5C3JA 1F8SA 3CGBA 5C2TA 2WHDA 1P2HA 1IJHA 1LVLA 1CJCA 1YQ3A 3HZLA 4OVIA 2WOVA 3NK0X 4NTEA 3EPTA 3AE4A 2GMJA 5U63A 3VRAA 2GAHB 2V3BA 3NK1X 2BRAA 2H89A 2WU2A 1VG0A 3SFEA 4CNKA 1ZOVA 5LV9A 1LJ1A 4J57A 4ZCDA 3GMBA 5U1OA 3AE5A 4D03A 4YSHA 2XDOA 1EBDA 5EOWA 4EQSA 1Y56A 1IUXA 1ZX9A 2YLZA 2V60A 3AEEA 5FS9A 4TM4A 2X8HA 3ATQA 1ELIA 1TDFA 3ICSA 5IQ1A 3GD4A 5U25A 2YG6A 3ALMA 3AEBA 3AE3A 4REKA 3ATRA 3FMWA 3T14A 3UKHA 3NTDA 2B7RA 2JB2A 2C3CA 3GWDA 3K7MX 1BZLA 3KPKA 4ICYA 1ZY8A 3VQRA 1NHPA 2WOWA 5FS7A 1AOGA 3NYFA 1ZMCA 5M10A 4HA6A 4CY6A 3BHKA 4TM1A 3UOZA 4B69A 2QA2A 1BGNA 2YR5A 4G6HA 4CNJA 2ACZA 2DKHA 4WCTA 4YWOA 2GVCA 3GMCA 2WETA 2QCUA 4H2PA 1OJCA 2YWLA 4CRTA 4DSHA 2BC1A 4NTCA 4YSXA 4H7UA 1FECA 3FIMB 2YLTA 3SZFA 2R9ZA 3IWAA 1EL8A 1GRHA 4H4XA 3T2KA 3UKFA 1GRTA 1EL9A 4H2NA 3F8PA 4X9MA 3I3LA 4U2TA 1TDKA 4EIQA 1H7XA 1ZOYA 2BACA 4YT0A 3AYLA 5BUKA 4AP1A 3EF6A 2CVJA 2BYBA 2X8CA 4II2A 3UKPA 4Z2RA 4J56A 1PJ6A 5KWFA 3C4AA 2WDRA 3CPJG 3HYVA 1S2QA 3DH9A 5GSNA 3UTGA 5KRQA 3UOXA 3UKAA 1PDHA 3LXDA 4WX1A 1OJ9A 3SXIA 4ADWA 1DXLA 1B5QA 4EMWA 3OZ2A 2JKCA 3GWFA 1H82A 1YQZA 4YTNA 1KFYA 5KMSA 4OPTA 4B1BA 1PJ5A 4IA6A 3JSKA 5EBKA 3CMMA 1ZDLA 1FCDA 2YR4A 2GQFA 1GEUA 1CJ4A 4LU6A 3NKSA 4A9WA 1GALA 2BXRA 4M52A 1GETA 4B67A 4JDRA 2IIDA 3QSMA 3NTAA 4J33A 4A7AA 1NENA 1GV4A 2E5VA 3II4A 4RG4A 3NLCA 3RNMA 2FJEA 1K4QA 4YSZA 3IF9A 3ALLA 4Z26A 3KU9A 4H4QA 1GRBA 4YKFA 3M0OA 3GDNA 1JRYA 3Q9TA 3LOVA 2RGOA 2WESA 3PVCA 4LA1A 3GDPA 1E6EA 4CY8A 1IUUA 1F6MA 3QFBA 4KX6A 4TLXA 2O9ZA 2Q0LA 3ITJA 3RP6A 3CPHG 1K0JA 1N4WA 4I59A 3VR8A 2R4JA 3NRNA 3QVRA 3PS9A 3CTYA 3HYXA 2C73A 3E1TA 5CKUA 1KDGA 3AXBA 5ER0A 4K2XA 5DBJA 5FS8A 5JCMA 3IHGA 4C77A 3KD9A 4U8PA 4K22A 2GR0A 3UOVA 4A79A 4H4SA 4U8KA 3ICTA 2YVGA 5BVAA 3DK4A 1B4VA 1Y0PA 2YAUA 4K7ZA 4A99A 1NHQA 1Q1WA 4OPCA 3AE8A 1Q1RA 2YG4A 4EM4A 1W4XA 3D8XA 3D1CA 5EB4A 4DNAA 3CNSA 2FJDA 3UKQA 3AWIA 2BS4A 1H83A 4FX9A 4H4WA 5HY5A 3CGDA 2XVFA 2GEWA 4JY3A 1D5TA 2YR6A 1DOCA 3DGZA 1D4EA 2BK3A 3RP8A 3UKKA 1S3BA 3DMEA 2EQ8A 1IUTA 4Z24A 1LTXR 4B63A 4I58A 5M0ZA 5KOWA 1B8SA 1IUSA 3UCLA 2WP5A 3QSSA 2B7SA 2C64A 2BCPA 4BK3A 3SM8A 3DK8A 5FMHA 1TRBA 1JRZA 1L9CA 3F8DA 4CCRA 5KOXA 3T31A 2C67A 5KMRA 2CDUA 3BNUA 4B66A 4C3YA 4N9XA 2JB3A 2WPCA 2V5ZA 4JY2A 3AD9B 4IVMB 4Z43A 1GESA 2TMDA 3H8IA 3H4KA 4TM3A 2Z5YA 3NYEA 3CN8A 4GRTA 2WU5A 3FBSA 2WOIA 4OPGA 3HYWA 3SY4A 3CIRA 4USQA 1BWCA 3AD7B 2ZBWA 3CNTA 3CNPA 4H4YA 1TDNA 2QAEA 4H4PA 1MXTA 2DKIA 4OPLA 2B9YA 3ZDNA 1CL0A 2OLNA 4U8LA 2AAQA 1D4CA 1F3PA 4B65A 1TYTA 2BS3A 2BK4A 3RHAA 2YLSA 1MO9A 3QSEA 4K8DA 1KNRA 1M6IA 4AT2A 1YKJA 3AYIA 3DK9A 1XDIA 1ZP0A 1Z6LA 1YY5A 3DJDA 3I6DA 3AB1A 2WDVA 2XVJA 4H4VA 4DGKA 1EL7A 1OJAA 3UTHA 3SZWA 4Z2UA 3NK2X 4GUVA 1E1KA 4TLZA 5HXIA 1P2EA 1LV0A 1RSGA 3AE1A 2WBAA 3AD8B 1N1PA 1E7PA 3UP4A 4APNA 1PXCA 3OC4A 3KLJA 2A8XA 2NPXA 2H88A 3SGLA 1DODA 3AE2A 4U8OA 1F8WA 2XLTA 2VQBA 3ABVA 2YM1A 4Z25A 4H4UA 4XXGA 4PABA 3GYJA 1CBOA 1PN0A 2W0HA 4GAVA 2C3DA 4NZHA 2C4CA 1OJDA 4H50A 1PJ7A 3QJ4A 4HB9A 3VRBA 1S2YA 4J2WA 4C3XA 2XVIA 3NHOX 3T37A 4Y4MA 2WP6A 4J31A 4YXDA 3L8KA 1S3EA 3FG2P 5JCKA 4E0VA 4EMJA 2R0GA 1GRGA 2Y6QA 5IPYA 1XHCA 2B76A 2R0PA 2Y6RA 3NH3X 1KNPA 2XFNA 4UDQA 5J60A 3H8LA 3ICRA 4UDRA 2XFOA 3GSIA 2CULA 1MOKA 2XLPA 5BULA 4AP3A 5J7XA 4GR1A 2JAEA 4H4ZA 2XLUA 3SZCA 1D4DA 1F8RA 1PS9A 1GT8A 2PHHA 3M12A 1VDCA 3AE6A 1H84A 3G5SA 5HHFA 2X50A 3G5QA 3AE7A 4NTDA 1GRFA 1JNRA 2NVKX 4GF7A 1M64A 2AQJA 2YVFA 1IUVA 3DA1A 4UDPA 4BJZA 3ALJA 4U8NA 2C70A 3UP5A 2GH5A 3ISHA 4XWZA 1Y56B 2VOUA 4IV9A 1D7YA 3S61A 1EL5A 4A65A 1VG9A 4K5RA 3AEGA 3QVPA 3AYJA 3NGCX 4J36A 4YSYA 2YQUA 2JK6A 3M13A 3NT6A 4NNJA 4X4JA 1JNZA 3L1RA 1NPXA 5JCIA 3SFDA 3NG7X 2VVMA 4D04A 4CBQA 2GF3A 3GRTA 2X3NA 4YTMA 4P9SA 3RP7A 1XANA 4NWZA 3WE0A 2EQ6A 3SZ0A 3LADA 3UTEA 1NDAA 3BI4A 3UTFA 2XVHA 1XPQA 2YG3A 2OAMA 5FS6A 3NN6X 5BRTA 4RSLA 5KVIA 2BABA 1QLBA 1OJTA 4O5QA 3KVEA 3AE9A 1JOAA 4G6GA 4YTPA 5JCLA 1FOHA 3GD3A 1B37A 2VZ2A 2F5ZA 2VQ7A 2VVLA 3BI5A 4AOXA 4MJWA 3B6DA 1V59A 2WPFA 3C96A 3IHMA 2IVEA 3SYIA 1PXBA 4GDEA 4NEVA 3R9UA 1L0VA 1CC4A 3PO7A 5JCNA 2V6OA 3CGCA 2E1MA 3CNJA 3GRSA 3AEDA 4U8MA 3F8RA 1PBDA 2GAGB 1QJDA 2RABA 3NNEA 1PBEA 1NG3A 2BRYA 1JU2A 2J3NA 1H6VA 5GRTA 2ZZBA 3KA7A 2GV8A 3DGHA 4IVOB 2VVLG 5TR3A 1DOBA 2R45A 4AOSA 4ZN0A 3P4PA 3EAOA 4XWRA 3V3OA 2XVEA 1NAAA 1NHSA 2APGA 5L46A 2TPRA 1DJNA 2QA1A 5CQFA 1SEZA 2XFQA 4B64A 4LIIA 4JQ9A 2YLRA 2A89A 3B3RA 4UP3A 1GPEA 2BC0A 2BS2A 2I0ZA 2Q7VA 1O95A 3COXA 3LJPA 4BK2A 1REOA 2XFUA 1NEKA 2XLRA 3GYIA 3BNMA 3P9UA 1CJ3A 3P1WA 3NN0X 1H81A 1O94A 2YVJA 5KMPA 1CC2A 1GSNA 2X8GA 3IC9A 3LZWA 4J34A 5HYMA 1FL2A 1VQWA 2Z5XA 1E39A 4X9NA 5EB5A 2WDQA 2XCGA 1N4UA 2A87A 1E1LA 4AT0A 4Z44A 4EQRA 1E1NA 2XYOA 3LB8A 4EMIA 2B9XA 1PXAA 4BURA 2JB1A 2WQYA 1CHUA 4K5SA 3GYXA 1BF3A 3AECA 3REDA 2GB0A 1BKWA 4G9KA 2GR3A 4FDCB 4JN9A 3O0HA 1HYUA 1ZK7A 3KKJA 3KPFA 3SX6A 1D7LA 1LQTA 1NHRA 4USRA 1K0IA 4B68A 5IQ4A 2PYXA 4OPUA 5KNLA 1PBFA 2IVDA 4A6NB 2FJBA 1DNCA 2XFPA 4C5OA 4EQXA 4H2QA 1CF3A 1UKVG 2VRMA 1CJ2A 1GTEA 2GMHA 4GDPA 4OCGA 1E1MA 1JRXA 1RP0A 4ECHA 5KVHA 2OLOA 2WEUA 4BV6A 1L9EA 4H4TA 2R4EA 4OPDA 2UZZA 2V3AA 1ONFA 2YM2A 2WP9A 3CPIG 1YQ4A 4II3A 1TDEA 1TDOA 3C4NA 2RGHA 3CGEA 3URHA 2WPEA 3BHFA 1GTHA 3UOYA 4G74A 1CC6A 4H2RA 1GNDA 2CFYA 1LPFA 4FK1A 4O5UA 4BJYA 1GOSA 2GQWA 1O5WA 2B9WA 3VR9A 4Z2TA 5KMQA 2C7GA 1N4VA 2C65A 2GR2A 3T0KA 1KSUA 2YG7A 4GCMA 2R46A 4U8IA 3DJEA 2YG5A 4Y4NA 4H4RA 1BGJA 5KXJA 3ZYXA 1H7WA 4BK1A 4GAPA 2Q0KA 4ZCCA 4C74A 3BI2A 3VRDB 1FEBA 1K0LA 1VRQB 2ARDA 1LQUA 2EQ7A 3K7TA 4NEWA 4YKGA 1Q9IA 4FK1C 4G73A 4OPIA 3Q6JA 2BXSA 3UKLA 2RGJA 1GREA 3AEFA 2C72A 2ZZCA 2EQ9A 2OA1A 4TM0A 2OALA 2WS3A 3P4RA 3T2ZA 2AR8A 2BA9A 3LZXA 4PAAA 1KF6A 2V61A 2HQMA 3T2YA 1TYPA 1COYA 3NYCA 3EANA 2C75A 3DJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G5R A;  3P4Q A;  1KSS A;  3V3N A;  3QFA A;  1DOE A;  2GR1 A;  3CND A;  2BCG G;  2ZZ0 A;  4U8J A;  1RYI A;  1PHH A;  3FPZ A;  3ADA B;  4U2S A;  2XLS A;  4EQW A;  3K30 A;  4Y4L A;  2Q6U A;  1L9D A;  2X99 A;  2FBW A;  1PBB A;  1PBC A;  1NG4 A;  4A6N A;  1FEA A;  1X31 B;  2C66 A;  1ZMD A;  2E4G A;  4EIP A;  2C76 A;  2GRT A;  1ZKQ A;  3P4S A;  1QO8 A;  4JNQ A;  3SQP A;  2BK5 A;  2YLW A;  4JNA A;  2FJA A;  3S5W A;  1GXF A;  4RG3 A;  1GRA A;  2VRL A;  1JEH A;  2YLX A;  4A5L A;  4DSG A;  1GER A;  2JBV A;  3AEA A;  3V76 A;  3K7Q X;  4IA5 A;  3NIX A;  4KPR A;  4CCQ A;  1H86 A;  1IUW A;  3DJG X;  4U2L A;  4EM3 A;  2R0C A;  1DJQ A;  5C3J A;  1F8S A;  3CGB A;  5C2T A;  2WHD A;  1P2H A;  1IJH A;  1LVL A;  1CJC A;  1YQ3 A;  3HZL A;  4OVI A;  2WOV A;  3NK0 X;  4NTE A;  3EPT A;  3AE4 A;  2GMJ A;  5U63 A;  3VRA A;  2GAH B;  2V3B A;  3NK1 X;  2H89 A;  2WU2 A;  1VG0 A;  3SFE A;  4CNK A;  1ZOV A;  5LV9 A;  1LJ1 A;  4J57 A;  4ZCD A;  3GMB A;  5U1O A;  3AE5 A;  4D03 A;  4YSH A;  2XDO A;  1EBD A;  5EOW A;  4EQS A;  1Y56 A;  1IUX A;  1ZX9 A;  2YLZ A;  2V60 A;  3AEE A;  5FS9 A;  4TM4 A;  2X8H A;  3ATQ A;  1ELI A;  1TDF A;  3ICS A;  5IQ1 A;  3GD4 A;  5U25 A;  2YG6 A;  3ALM A;  3AEB A;  3AE3 A;  4REK A;  3ATR A;  3FMW A;  3UKH A;  3NTD A;  2B7R A;  2JB2 A;  2C3C A;  3GWD A;  3K7M X;  1BZL A;  4ICY A;  3VQR A;  1ZY8 A;  1AOG A;  1NHP A;  2WOW A;  5FS7 A;  3NYF A;  1ZMC A;  5M10 A;  4HA6 A;  3BHK A;  4TM1 A;  3UOZ A;  4B69 A;  2QA2 A;  1BGN A;  2YR5 A;  4CNJ A;  2ACZ A;  2DKH A;  4WCT A;  4YWO A;  2GVC A;  3GMC A;  2WET A;  2QCU A;  4H2P A;  1OJC A;  2YWL A;  4CRT A;  4DSH A;  2BC1 A;  4NTC A;  4YSX A;  4H7U A;  1FEC A;  3FIM B;  2YLT A;  2R9Z A;  3IWA A;  1EL8 A;  1GRH A;  4H4X A;  3UKF A;  1GRT A;  1EL9 A;  4H2N A;  3F8P A;  4X9M A;  3I3L A;  4U2T A;  1TDK A;  4EIQ A;  1H7X A;  1ZOY A;  2BAC A;  4YT0 A;  3AYL A;  5BUK A;  4AP1 A;  3EF6 A;  2CVJ A;  2BYB A;  2X8C A;  3UKP A;  4Z2R A;  4J56 A;  1PJ6 A;  5KWF A;  3C4A A;  2WDR A;  3CPJ G;  1S2Q A;  3DH9 A;  5GSN A;  3UTG A;  5KRQ A;  3UOX A;  3UKA A;  1PDH A;  3LXD A;  4WX1 A;  1OJ9 A;  4ADW A;  4EMW A;  1DXL A;  1B5Q A;  3OZ2 A;  2JKC A;  3GWF A;  1H82 A;  1YQZ A;  4YTN A;  1KFY A;  4OPT A;  4B1B A;  1PJ5 A;  4IA6 A;  3JSK A;  5EBK A;  1ZDL A;  1FCD A;  2YR4 A;  1GEU A;  2GQF A;  1CJ4 A;  4LU6 A;  3NKS A;  4A9W A;  1GAL A;  2BXR A;  4M52 A;  1GET A;  4B67 A;  4JDR A;  2IID A;  3QSM A;  3NTA A;  4J33 A;  4A7A A;  1NEN A;  1GV4 A;  2E5V A;  3II4 A;  4RG4 A;  3NLC A;  3RNM A;  2FJE A;  1K4Q A;  4YSZ A;  3IF9 A;  3ALL A;  4Z26 A;  3KU9 A;  4H4Q A;  1GRB A;  4YKF A;  3M0O A;  3GDN A;  1JRY A;  3Q9T A;  3LOV A;  2RGO A;  2WES A;  3PVC A;  4LA1 A;  3GDP A;  1E6E A;  4CY8 A;  1IUU A;  1F6M A;  3QFB A;  4KX6 A;  4TLX A;  2O9Z A;  2Q0L A;  3ITJ A;  3RP6 A;  3CPH G;  1K0J A;  1N4W A;  4I59 A;  3VR8 A;  2R4J A;  3NRN A;  3QVR A;  3PS9 A;  3CTY A;  2C73 A;  3E1T A;  5CKU A;  1KDG A;  3AXB A;  5ER0 A;  4K2X A;  5DBJ A;  5FS8 A;  5JCM A;  3IHG A;  4C77 A;  3KD9 A;  4U8P A;  4K22 A;  2GR0 A;  3UOV A;  4A79 A;  4H4S A;  4U8K A;  3ICT A;  2YVG A;  5BVA A;  3DK4 A;  1B4V A;  1Y0P A;  2YAU A;  4K7Z A;  4A99 A;  1NHQ A;  1Q1W A;  4OPC A;  3AE8 A;  1Q1R A;  2YG4 A;  4EM4 A;  1W4X A;  3D8X A;  3D1C A;  5EB4 A;  4DNA A;  3CNS A;  2FJD A;  3UKQ A;  3AWI A;  2BS4 A;  1H83 A;  4FX9 A;  4H4W A;  5HY5 A;  3CGD A;  2XVF A;  2GEW A;  4JY3 A;  1D5T A;  2YR6 A;  1DOC A;  3DGZ A;  1D4E A;  2BK3 A;  3RP8 A;  3UKK A;  1S3B A;  3DME A;  2EQ8 A;  1IUT A;  4Z24 A;  1LTX R;  4B63 A;  4I58 A;  5M0Z A;  5KOW A;  1B8S A;  1IUS A;  3UCL A;  2WP5 A;  3QSS A;  2B7S A;  2C64 A;  2BCP A;  4BK3 A;  3SM8 A;  3DK8 A;  5FMH A;  1TRB A;  1JRZ A;  1L9C A;  3F8D A;  4CCR A;  5KOX A;  2C67 A;  2CDU A;  3BNU A;  4B66 A;  4C3Y A;  4N9X A;  2JB3 A;  2WPC A;  2V5Z A;  4JY2 A;  3AD9 B;  4IVM B;  4Z43 A;  1GES A;  2TMD A;  3H8I A;  3H4K A;  4TM3 A;  2Z5Y A;  3NYE A;  3CN8 A;  4GRT A;  2WU5 A;  3FBS A;  2WOI A;  4OPG A;  4CY6 A;  3CIR A;  4USQ A;  1BWC A;  3AD7 B;  2ZBW A;  3CNT A;  3CNP A;  4H4Y A;  1TDN A;  2QAE A;  4H4P A;  1MXT A;  2DKI A;  4OPL A;  2B9Y A;  3ZDN A;  1CL0 A;  2OLN A;  4U8L A;  2AAQ A;  1D4C A;  1F3P A;  4B65 A;  1TYT A;  2BS3 A;  2BK4 A;  3RHA A;  2YLS A;  1MO9 A;  3QSE A;  4K8D A;  1KNR A;  1M6I A;  4AT2 A;  1YKJ A;  3AYI A;  3DK9 A;  1XDI A;  1ZP0 A;  1Z6L A;  1YY5 A;  3DJD A;  3I6D A;  3AB1 A;  2WDV A;  2XVJ A;  4H4V A;  4DGK A;  1EL7 A;  1OJA A;  3UTH A;  4Z2U A;  3NK2 X;  4GUV A;  1E1K A;  4TLZ A;  5HXI A;  1P2E A;  1LV0 A;  1RSG A;  3AE1 A;  2WBA A;  3AD8 B;  1N1P A;  1E7P A;  3UP4 A;  4APN A;  1PXC A;  3OC4 A;  3KLJ A;  2A8X A;  2NPX A;  2H88 A;  3SGL A;  1DOD A;  3AE2 A;  4U8O A;  1F8W A;  2XLT A;  2VQB A;  3ABV A;  2YM1 A;  4Z25 A;  4H4U A;  4XXG A;  4PAB A;  3GYJ A;  1CBO A;  1PN0 A;  2W0H A;  2C3D A;  4NZH A;  1OJD A;  4H50 A;  1PJ7 A;  3QJ4 A;  4HB9 A;  3VRB A;  1S2Y A;  4J2W A;  4C3X A;  2XVI A;  3NHO X;  3T37 A;  4Y4M A;  2WP6 A;  4J31 A;  4YXD A;  3L8K A;  1S3E A;  3FG2 P;  5JCK A;  4E0V A;  4EMJ A;  2R0G A;  1GRG A;  2Y6Q A;  5IPY A;  1XHC A;  2B76 A;  2R0P A;  2Y6R A;  3NH3 X;  1KNP A;  2XFN A;  4UDQ A;  5J60 A;  3H8L A;  3ICR A;  4UDR A;  2XFO A;  3GSI A;  2CUL A;  1MOK A;  2XLP A;  5BUL A;  4AP3 A;  5J7X A;  4GR1 A;  2JAE A;  4H4Z A;  2XLU A;  1D4D A;  1F8R A;  1PS9 A;  1GT8 A;  2PHH A;  3M12 A;  1VDC A;  3AE6 A;  1H84 A;  3G5S A;  5HHF A;  2X50 A;  3G5Q A;  3AE7 A;  4NTD A;  1GRF A;  1JNR A;  2NVK X;  4GF7 A;  1M64 A;  2AQJ A;  2YVF A;  1IUV A;  3DA1 A;  4UDP A;  4BJZ A;  3ALJ A;  4U8N A;  2C70 A;  3UP5 A;  2GH5 A;  3ISH A;  4XWZ A;  1Y56 B;  2VOU A;  4IV9 A;  1D7Y A;  3S61 A;  1EL5 A;  4A65 A;  1VG9 A;  4K5R A;  3AEG A;  3QVP A;  3AYJ A;  3NGC X;  4J36 A;  4YSY A;  2YQU A;  2JK6 A;  3M13 A;  3NT6 A;  4X4J A;  1JNZ A;  3L1R A;  1NPX A;  5JCI A;  3SFD A;  3NG7 X;  2VVM A;  4D04 A;  4CBQ A;  2GF3 A;  3GRT A;  2X3N A;  4YTM A;  4P9S A;  3RP7 A;  1XAN A;  3WE0 A;  2EQ6 A;  3LAD A;  3UTE A;  1NDA A;  3BI4 A;  3UTF A;  2XVH A;  1XPQ A;  2YG3 A;  2OAM A;  5FS6 A;  3NN6 X;  5BRT A;  4RSL A;  5KVI A;  2BAB A;  1QLB A;  1OJT A;  4O5Q A;  3KVE A;  3AE9 A;  1JOA A;  4YTP A;  5JCL A;  1FOH A;  3GD3 A;  1B37 A;  2VZ2 A;  2F5Z A;  2VQ7 A;  2VVL A;  3BI5 A;  4AOX A;  4MJW A;  3B6D A;  1V59 A;  2WPF A;  3C96 A;  3IHM A;  2IVE A;  1PXB A;  4GDE A;  4NEV A;  3R9U A;  1L0V A;  1CC4 A;  3PO7 A;  5JCN A;  2V6O A;  3CGC A;  2E1M A;  3CNJ A;  3GRS A;  3AED A;  4U8M A;  3F8R A;  1PBD A;  2GAG B;  1QJD A;  2RAB A;  3NNE A;  1PBE A;  1NG3 A;  1JU2 A;  2J3N A;  1H6V A;  5GRT A;  2ZZB A;  3KA7 A;  2GV8 A;  3DGH A;  4IVO B;  2VVL G;  5TR3 A;  1DOB A;  2R45 A;  4AOS A;  4ZN0 A;  3P4P A;  3EAO A;  4XWR A;  3V3O A;  2XVE A;  1NAA A;  1NHS A;  2APG A;  5L46 A;  2TPR A;  1DJN A;  2QA1 A;  5CQF A;  1SEZ A;  2XFQ A;  4B64 A;  4LII A;  4JQ9 A;  2YLR A;  2A89 A;  3B3R A;  4UP3 A;  1GPE A;  2BC0 A;  2BS2 A;  2I0Z A;  2Q7V A;  1O95 A;  3COX A;  3LJP A;  4BK2 A;  1REO A;  2XFU A;  1NEK A;  2XLR A;  3GYI A;  3BNM A;  3P9U A;  1CJ3 A;  3P1W A;  3NN0 X;  1H81 A;  1O94 A;  2YVJ A;  1CC2 A;  1GSN A;  2X8G A;  3IC9 A;  3LZW A;  4J34 A;  5HYM A;  1FL2 A;  1VQW A;  2Z5X A;  1E39 A;  4X9N A;  5EB5 A;  2WDQ A;  2XCG A;  1N4U A;  2A87 A;  1E1L A;  4AT0 A;  4Z44 A;  4EQR A;  1E1N A;  2XYO A;  3LB8 A;  4EMI A;  2B9X A;  1PXA A;  4BUR A;  2JB1 A;  2WQY A;  1CHU A;  4K5S A;  1BF3 A;  3AEC A;  3RED A;  2GB0 A;  1BKW A;  2GR3 A;  4FDC B;  4JN9 A;  3O0H A;  1HYU A;  1ZK7 A;  3KKJ A;  3KPF A;  1D7L A;  1LQT A;  1NHR A;  4USR A;  1K0I A;  4B68 A;  5IQ4 A;  2PYX A;  4OPU A;  1PBF A;  2IVD A;  4A6N B;  2FJB A;  1DNC A;  2XFP A;  4C5O A;  4EQX A;  4H2Q A;  1CF3 A;  1UKV G;  2VRM A;  1CJ2 A;  1GTE A;  2GMH A;  4GDP A;  4OCG A;  1E1M A;  1JRX A;  1RP0 A;  4ECH A;  5KVH A;  2OLO A;  2WEU A;  4BV6 A;  1L9E A;  4H4T A;  2R4E A;  4OPD A;  2UZZ A;  2V3A A;  1ONF A;  2YM2 A;  2WP9 A;  3CPI G;  1YQ4 A;  1TDE A;  1TDO A;  3C4N A;  2RGH A;  3CGE A;  3URH A;  2WPE A;  3BHF A;  1GTH A;  3UOY A;  1CC6 A;  4H2R A;  1GND A;  2CFY A;  1LPF A;  4FK1 A;  4O5U A;  4BJY A;  1GOS A;  2GQW A;  1O5W A;  2B9W A;  3VR9 A;  4Z2T A;  2C7G A;  1N4V A;  2C65 A;  2GR2 A;  1KSU A;  2YG7 A;  4GCM A;  2R46 A;  4U8I A;  3DJE A;  2YG5 A;  4Y4N A;  4H4R A;  1BGJ A;  5KXJ A;  3ZYX A;  1H7W A;  4BK1 A;  2Q0K A;  4ZCC A;  4C74 A;  3BI2 A;  3VRD B;  1FEB A;  1K0L A;  1VRQ B;  2ARD A;  1LQU A;  2EQ7 A;  3K7T A;  4NEW A;  4YKG A;  1Q9I A;  4FK1 C;  4OPI A;  3Q6J A;  2BXS A;  3UKL A;  2RGJ A;  1GRE A;  3AEF A;  2C72 A;  2ZZC A;  2EQ9 A;  2OA1 A;  4TM0 A;  2OAL A;  2WS3 A;  3P4R A;  2AR8 A;  2BA9 A;  3LZX A;  4PAA A;  1KF6 A;  2V61 A;  2HQM A;  1TYP A;  1COY A;  3NYC A;  3EAN A;  2C75 A;  3DJJ A; 
#chains in the Genus database with same CATH topology
 3G5R A;  3P4Q A;  1KSS A;  3V3N A;  3QFA A;  1DOE A;  2GR1 A;  3CND A;  2BCG G;  2ZZ0 A;  4U8J A;  1RYI A;  1PHH A;  3FPZ A;  3ADA B;  4U2S A;  2XLS A;  4EQW A;  3K30 A;  4Y4L A;  2Q6U A;  1L9D A;  2X99 A;  2FBW A;  1PBB A;  1PBC A;  1NG4 A;  4A6N A;  1FEA A;  1X31 B;  2C66 A;  1ZMD A;  2E4G A;  4EIP A;  2C76 A;  2GRT A;  1ZKQ A;  3P4S A;  1QO8 A;  4JNQ A;  3SQP A;  2BK5 A;  2YLW A;  4JNA A;  2FJA A;  3S5W A;  1GXF A;  4RG3 A;  1GRA A;  2VRL A;  1JEH A;  2YLX A;  4A5L A;  4DSG A;  1GER A;  2JBV A;  3AEA A;  3V76 A;  3K7Q X;  4IA5 A;  3NIX A;  4KPR A;  4CCQ A;  1H86 A;  1IUW A;  3DJG X;  4U2L A;  4EM3 A;  2R0C A;  1DJQ A;  5C3J A;  1F8S A;  3CGB A;  5C2T A;  2WHD A;  1P2H A;  1IJH A;  1LVL A;  1CJC A;  1YQ3 A;  3HZL A;  4OVI A;  2WOV A;  3NK0 X;  4NTE A;  3EPT A;  3AE4 A;  2GMJ A;  5U63 A;  3VRA A;  2GAH B;  2V3B A;  3NK1 X;  2BRA A;  2H89 A;  2WU2 A;  1VG0 A;  3SFE A;  4CNK A;  1ZOV A;  5LV9 A;  1LJ1 A;  4J57 A;  4ZCD A;  3GMB A;  5U1O A;  3AE5 A;  4D03 A;  4YSH A;  2XDO A;  1EBD A;  5EOW A;  4EQS A;  1Y56 A;  1IUX A;  1ZX9 A;  2YLZ A;  2V60 A;  3AEE A;  5FS9 A;  4TM4 A;  2X8H A;  3ATQ A;  1ELI A;  1TDF A;  3ICS A;  5IQ1 A;  3GD4 A;  5U25 A;  2YG6 A;  3ALM A;  3AEB A;  3AE3 A;  4REK A;  3ATR A;  3FMW A;  3T14 A;  3UKH A;  3NTD A;  2B7R A;  2JB2 A;  2C3C A;  3GWD A;  3K7M X;  1BZL A;  3KPK A;  4ICY A;  1ZY8 A;  3VQR A;  1NHP A;  2WOW A;  5FS7 A;  1AOG A;  3NYF A;  1ZMC A;  5M10 A;  4HA6 A;  4CY6 A;  3BHK A;  4TM1 A;  3UOZ A;  4B69 A;  2QA2 A;  1BGN A;  2YR5 A;  4G6H A;  4CNJ A;  2ACZ A;  2DKH A;  4WCT A;  4YWO A;  2GVC A;  3GMC A;  2WET A;  2QCU A;  4H2P A;  1OJC A;  2YWL A;  4CRT A;  4DSH A;  2BC1 A;  4NTC A;  4YSX A;  4H7U A;  1FEC A;  3FIM B;  2YLT A;  3SZF A;  2R9Z A;  3IWA A;  1EL8 A;  1GRH A;  4H4X A;  3T2K A;  3UKF A;  1GRT A;  1EL9 A;  4H2N A;  3F8P A;  4X9M A;  3I3L A;  4U2T A;  1TDK A;  4EIQ A;  1H7X A;  1ZOY A;  2BAC A;  4YT0 A;  3AYL A;  5BUK A;  4AP1 A;  3EF6 A;  2CVJ A;  2BYB A;  2X8C A;  4II2 A;  3UKP A;  4Z2R A;  4J56 A;  1PJ6 A;  5KWF A;  3C4A A;  2WDR A;  3CPJ G;  3HYV A;  1S2Q A;  3DH9 A;  5GSN A;  3UTG A;  5KRQ A;  3UOX A;  3UKA A;  1PDH A;  3LXD A;  4WX1 A;  1OJ9 A;  3SXI A;  4ADW A;  1DXL A;  1B5Q A;  4EMW A;  3OZ2 A;  2JKC A;  3GWF A;  1H82 A;  1YQZ A;  4YTN A;  1KFY A;  5KMS A;  4OPT A;  4B1B A;  1PJ5 A;  4IA6 A;  3JSK A;  5EBK A;  3CMM A;  1ZDL A;  1FCD A;  2YR4 A;  2GQF A;  1GEU A;  1CJ4 A;  4LU6 A;  3NKS A;  4A9W A;  1GAL A;  2BXR A;  4M52 A;  1GET A;  4B67 A;  4JDR A;  2IID A;  3QSM A;  3NTA A;  4J33 A;  4A7A A;  1NEN A;  1GV4 A;  2E5V A;  3II4 A;  4RG4 A;  3NLC A;  3RNM A;  2FJE A;  1K4Q A;  4YSZ A;  3IF9 A;  3ALL A;  4Z26 A;  3KU9 A;  4H4Q A;  1GRB A;  4YKF A;  3M0O A;  3GDN A;  1JRY A;  3Q9T A;  3LOV A;  2RGO A;  2WES A;  3PVC A;  4LA1 A;  3GDP A;  1E6E A;  4CY8 A;  1IUU A;  1F6M A;  3QFB A;  4KX6 A;  4TLX A;  2O9Z A;  2Q0L A;  3ITJ A;  3RP6 A;  3CPH G;  1K0J A;  1N4W A;  4I59 A;  3VR8 A;  2R4J A;  3NRN A;  3QVR A;  3PS9 A;  3CTY A;  3HYX A;  2C73 A;  3E1T A;  5CKU A;  1KDG A;  3AXB A;  5ER0 A;  4K2X A;  5DBJ A;  5FS8 A;  5JCM A;  3IHG A;  4C77 A;  3KD9 A;  4U8P A;  4K22 A;  2GR0 A;  3UOV A;  4A79 A;  4H4S A;  4U8K A;  3ICT A;  2YVG A;  5BVA A;  3DK4 A;  1B4V A;  1Y0P A;  2YAU A;  4K7Z A;  4A99 A;  1NHQ A;  1Q1W A;  4OPC A;  3AE8 A;  1Q1R A;  2YG4 A;  4EM4 A;  1W4X A;  3D8X A;  3D1C A;  5EB4 A;  4DNA A;  3CNS A;  2FJD A;  3UKQ A;  3AWI A;  2BS4 A;  1H83 A;  4FX9 A;  4H4W A;  5HY5 A;  3CGD A;  2XVF A;  2GEW A;  4JY3 A;  1D5T A;  2YR6 A;  1DOC A;  3DGZ A;  1D4E A;  2BK3 A;  3RP8 A;  3UKK A;  1S3B A;  3DME A;  2EQ8 A;  1IUT A;  4Z24 A;  1LTX R;  4B63 A;  4I58 A;  5M0Z A;  5KOW A;  1B8S A;  1IUS A;  3UCL A;  2WP5 A;  3QSS A;  2B7S A;  2C64 A;  2BCP A;  4BK3 A;  3SM8 A;  3DK8 A;  5FMH A;  1TRB A;  1JRZ A;  1L9C A;  3F8D A;  4CCR A;  5KOX A;  3T31 A;  2C67 A;  5KMR A;  2CDU A;  3BNU A;  4B66 A;  4C3Y A;  4N9X A;  2JB3 A;  2WPC A;  2V5Z A;  4JY2 A;  3AD9 B;  4IVM B;  4Z43 A;  1GES A;  2TMD A;  3H8I A;  3H4K A;  4TM3 A;  2Z5Y A;  3NYE A;  3CN8 A;  4GRT A;  2WU5 A;  3FBS A;  2WOI A;  4OPG A;  3HYW A;  3SY4 A;  3CIR A;  4USQ A;  1BWC A;  3AD7 B;  2ZBW A;  3CNT A;  3CNP A;  4H4Y A;  1TDN A;  2QAE A;  4H4P A;  1MXT A;  2DKI A;  4OPL A;  2B9Y A;  3ZDN A;  1CL0 A;  2OLN A;  4U8L A;  2AAQ A;  1D4C A;  1F3P A;  4B65 A;  1TYT A;  2BS3 A;  2BK4 A;  3RHA A;  2YLS A;  1MO9 A;  3QSE A;  4K8D A;  1KNR A;  1M6I A;  4AT2 A;  1YKJ A;  3AYI A;  3DK9 A;  1XDI A;  1ZP0 A;  1Z6L A;  1YY5 A;  3DJD A;  3I6D A;  3AB1 A;  2WDV A;  2XVJ A;  4H4V A;  4DGK A;  1EL7 A;  1OJA A;  3UTH A;  3SZW A;  4Z2U A;  3NK2 X;  4GUV A;  1E1K A;  4TLZ A;  5HXI A;  1P2E A;  1LV0 A;  1RSG A;  3AE1 A;  2WBA A;  3AD8 B;  1N1P A;  1E7P A;  3UP4 A;  4APN A;  1PXC A;  3OC4 A;  3KLJ A;  2A8X A;  2NPX A;  2H88 A;  3SGL A;  1DOD A;  3AE2 A;  4U8O A;  1F8W A;  2XLT A;  2VQB A;  3ABV A;  2YM1 A;  4Z25 A;  4H4U A;  4XXG A;  4PAB A;  3GYJ A;  1CBO A;  1PN0 A;  2W0H A;  4GAV A;  2C3D A;  4NZH A;  2C4C A;  1OJD A;  4H50 A;  1PJ7 A;  3QJ4 A;  4HB9 A;  3VRB A;  1S2Y A;  4J2W A;  4C3X A;  2XVI A;  3NHO X;  3T37 A;  4Y4M A;  2WP6 A;  4J31 A;  4YXD A;  3L8K A;  1S3E A;  3FG2 P;  5JCK A;  4E0V A;  4EMJ A;  2R0G A;  1GRG A;  2Y6Q A;  5IPY A;  1XHC A;  2B76 A;  2R0P A;  2Y6R A;  3NH3 X;  1KNP A;  2XFN A;  4UDQ A;  5J60 A;  3H8L A;  3ICR A;  4UDR A;  2XFO A;  3GSI A;  2CUL A;  1MOK A;  2XLP A;  5BUL A;  4AP3 A;  5J7X A;  4GR1 A;  2JAE A;  4H4Z A;  2XLU A;  3SZC A;  1D4D A;  1F8R A;  1PS9 A;  1GT8 A;  2PHH A;  3M12 A;  1VDC A;  3AE6 A;  1H84 A;  3G5S A;  5HHF A;  2X50 A;  3G5Q A;  3AE7 A;  4NTD A;  1GRF A;  1JNR A;  2NVK X;  4GF7 A;  1M64 A;  2AQJ A;  2YVF A;  1IUV A;  3DA1 A;  4UDP A;  4BJZ A;  3ALJ A;  4U8N A;  2C70 A;  3UP5 A;  2GH5 A;  3ISH A;  4XWZ A;  1Y56 B;  2VOU A;  4IV9 A;  1D7Y A;  3S61 A;  1EL5 A;  4A65 A;  1VG9 A;  4K5R A;  3AEG A;  3QVP A;  3AYJ A;  3NGC X;  4J36 A;  4YSY A;  2YQU A;  2JK6 A;  3M13 A;  3NT6 A;  4NNJ A;  4X4J A;  1JNZ A;  3L1R A;  1NPX A;  5JCI A;  3SFD A;  3NG7 X;  2VVM A;  4D04 A;  4CBQ A;  2GF3 A;  3GRT A;  2X3N A;  4YTM A;  4P9S A;  3RP7 A;  1XAN A;  4NWZ A;  3WE0 A;  2EQ6 A;  3SZ0 A;  3LAD A;  3UTE A;  1NDA A;  3BI4 A;  3UTF A;  2XVH A;  1XPQ A;  2YG3 A;  2OAM A;  5FS6 A;  3NN6 X;  5BRT A;  4RSL A;  5KVI A;  2BAB A;  1QLB A;  1OJT A;  4O5Q A;  3KVE A;  3AE9 A;  1JOA A;  4G6G A;  4YTP A;  5JCL A;  1FOH A;  3GD3 A;  1B37 A;  2VZ2 A;  2F5Z A;  2VQ7 A;  2VVL A;  3BI5 A;  4AOX A;  4MJW A;  3B6D A;  1V59 A;  2WPF A;  3C96 A;  3IHM A;  2IVE A;  3SYI A;  1PXB A;  4GDE A;  4NEV A;  3R9U A;  1L0V A;  1CC4 A;  3PO7 A;  5JCN A;  2V6O A;  3CGC A;  2E1M A;  3CNJ A;  3GRS A;  3AED A;  4U8M A;  3F8R A;  1PBD A;  2GAG B;  1QJD A;  2RAB A;  3NNE A;  1PBE A;  1NG3 A;  2BRY A;  1JU2 A;  2J3N A;  1H6V A;  5GRT A;  2ZZB A;  3KA7 A;  2GV8 A;  3DGH A;  4IVO B;  2VVL G;  5TR3 A;  1DOB A;  2R45 A;  4AOS A;  4ZN0 A;  3P4P A;  3EAO A;  4XWR A;  3V3O A;  2XVE A;  1NAA A;  1NHS A;  2APG A;  5L46 A;  2TPR A;  1DJN A;  2QA1 A;  5CQF A;  1SEZ A;  2XFQ A;  4B64 A;  4LII A;  4JQ9 A;  2YLR A;  2A89 A;  3B3R A;  4UP3 A;  1GPE A;  2BC0 A;  2BS2 A;  2I0Z A;  2Q7V A;  1O95 A;  3COX A;  3LJP A;  4BK2 A;  1REO A;  2XFU A;  1NEK A;  2XLR A;  3GYI A;  3BNM A;  3P9U A;  1CJ3 A;  3P1W A;  3NN0 X;  1H81 A;  1O94 A;  2YVJ A;  5KMP A;  1CC2 A;  1GSN A;  2X8G A;  3IC9 A;  3LZW A;  4J34 A;  5HYM A;  1FL2 A;  1VQW A;  2Z5X A;  1E39 A;  4X9N A;  5EB5 A;  2WDQ A;  2XCG A;  1N4U A;  2A87 A;  1E1L A;  4AT0 A;  4Z44 A;  4EQR A;  1E1N A;  2XYO A;  3LB8 A;  4EMI A;  2B9X A;  1PXA A;  4BUR A;  2JB1 A;  2WQY A;  1CHU A;  4K5S A;  3GYX A;  1BF3 A;  3AEC A;  3RED A;  2GB0 A;  1BKW A;  4G9K A;  2GR3 A;  4FDC B;  4JN9 A;  3O0H A;  1HYU A;  1ZK7 A;  3KKJ A;  3KPF A;  3SX6 A;  1D7L A;  1LQT A;  1NHR A;  4USR A;  1K0I A;  4B68 A;  5IQ4 A;  2PYX A;  4OPU A;  5KNL A;  1PBF A;  2IVD A;  4A6N B;  2FJB A;  1DNC A;  2XFP A;  4C5O A;  4EQX A;  4H2Q A;  1CF3 A;  1UKV G;  2VRM A;  1CJ2 A;  1GTE A;  2GMH A;  4GDP A;  4OCG A;  1E1M A;  1JRX A;  1RP0 A;  4ECH A;  5KVH A;  2OLO A;  2WEU A;  4BV6 A;  1L9E A;  4H4T A;  2R4E A;  4OPD A;  2UZZ A;  2V3A A;  1ONF A;  2YM2 A;  2WP9 A;  3CPI G;  1YQ4 A;  4II3 A;  1TDE A;  1TDO A;  3C4N A;  2RGH A;  3CGE A;  3URH A;  2WPE A;  3BHF A;  1GTH A;  3UOY A;  4G74 A;  1CC6 A;  4H2R A;  1GND A;  2CFY A;  1LPF A;  4FK1 A;  4O5U A;  4BJY A;  1GOS A;  2GQW A;  1O5W A;  2B9W A;  3VR9 A;  4Z2T A;  5KMQ A;  2C7G A;  1N4V A;  2C65 A;  2GR2 A;  3T0K A;  1KSU A;  2YG7 A;  4GCM A;  2R46 A;  4U8I A;  3DJE A;  2YG5 A;  4Y4N A;  4H4R A;  1BGJ A;  5KXJ A;  3ZYX A;  1H7W A;  4BK1 A;  4GAP A;  2Q0K A;  4ZCC A;  4C74 A;  3BI2 A;  3VRD B;  1FEB A;  1K0L A;  1VRQ B;  2ARD A;  1LQU A;  2EQ7 A;  3K7T A;  4NEW A;  4YKG A;  1Q9I A;  4FK1 C;  4G73 A;  4OPI A;  3Q6J A;  2BXS A;  3UKL A;  2RGJ A;  1GRE A;  3AEF A;  2C72 A;  2ZZC A;  2EQ9 A;  2OA1 A;  4TM0 A;  2OAL A;  2WS3 A;  3P4R A;  3T2Z A;  2AR8 A;  2BA9 A;  3LZX A;  4PAA A;  1KF6 A;  2V61 A;  2HQM A;  3T2Y A;  1TYP A;  1COY A;  3NYC A;  3EAN A;  2C75 A;  3DJJ A; 
#chains in the Genus database with same CATH homology
 3G5R A;  3P4Q A;  1KSS A;  3V3N A;  3QFA A;  1DOE A;  2GR1 A;  3CND A;  2BCG G;  2ZZ0 A;  4U8J A;  1RYI A;  1PHH A;  3FPZ A;  3ADA B;  4U2S A;  2XLS A;  4EQW A;  3K30 A;  4Y4L A;  2Q6U A;  1L9D A;  2X99 A;  2FBW A;  1PBB A;  1PBC A;  1NG4 A;  4A6N A;  1FEA A;  1X31 B;  2C66 A;  1ZMD A;  2E4G A;  4EIP A;  2C76 A;  2GRT A;  1ZKQ A;  3P4S A;  1QO8 A;  4JNQ A;  3SQP A;  2BK5 A;  2YLW A;  4JNA A;  2FJA A;  3S5W A;  1GXF A;  4RG3 A;  1GRA A;  2VRL A;  1JEH A;  2YLX A;  4A5L A;  4DSG A;  1GER A;  2JBV A;  3AEA A;  3V76 A;  3K7Q X;  4IA5 A;  3NIX A;  4KPR A;  4CCQ A;  1H86 A;  1IUW A;  3DJG X;  4U2L A;  4EM3 A;  2R0C A;  1DJQ A;  5C3J A;  1F8S A;  3CGB A;  5C2T A;  2WHD A;  1P2H A;  1IJH A;  1LVL A;  1CJC A;  1YQ3 A;  3HZL A;  4OVI A;  2WOV A;  3NK0 X;  4NTE A;  3EPT A;  3AE4 A;  2GMJ A;  5U63 A;  3VRA A;  2GAH B;  2V3B A;  3NK1 X;  2BRA A;  2H89 A;  2WU2 A;  1VG0 A;  3SFE A;  4CNK A;  1ZOV A;  5LV9 A;  1LJ1 A;  4J57 A;  4ZCD A;  3GMB A;  5U1O A;  3AE5 A;  4D03 A;  4YSH A;  2XDO A;  1EBD A;  5EOW A;  4EQS A;  1Y56 A;  1IUX A;  1ZX9 A;  2YLZ A;  2V60 A;  3AEE A;  5FS9 A;  4TM4 A;  2X8H A;  3ATQ A;  1ELI A;  1TDF A;  3ICS A;  5IQ1 A;  3GD4 A;  5U25 A;  2YG6 A;  3ALM A;  3AEB A;  3AE3 A;  4REK A;  3ATR A;  3FMW A;  3T14 A;  3UKH A;  3NTD A;  2B7R A;  2JB2 A;  2C3C A;  3GWD A;  3K7M X;  1BZL A;  3KPK A;  4ICY A;  1ZY8 A;  3VQR A;  1NHP A;  2WOW A;  5FS7 A;  1AOG A;  3NYF A;  1ZMC A;  5M10 A;  4HA6 A;  4CY6 A;  3BHK A;  4TM1 A;  3UOZ A;  4B69 A;  2QA2 A;  1BGN A;  2YR5 A;  4G6H A;  4CNJ A;  2ACZ A;  2DKH A;  4WCT A;  4YWO A;  2GVC A;  3GMC A;  2WET A;  2QCU A;  4H2P A;  1OJC A;  2YWL A;  4CRT A;  4DSH A;  2BC1 A;  4NTC A;  4YSX A;  4H7U A;  1FEC A;  3FIM B;  2YLT A;  3SZF A;  2R9Z A;  3IWA A;  1EL8 A;  1GRH A;  4H4X A;  3T2K A;  3UKF A;  1GRT A;  1EL9 A;  4H2N A;  3F8P A;  4X9M A;  3I3L A;  4U2T A;  1TDK A;  4EIQ A;  1H7X A;  1ZOY A;  2BAC A;  4YT0 A;  3AYL A;  5BUK A;  4AP1 A;  3EF6 A;  2CVJ A;  2BYB A;  2X8C A;  4II2 A;  3UKP A;  4Z2R A;  4J56 A;  1PJ6 A;  5KWF A;  3C4A A;  2WDR A;  3CPJ G;  3HYV A;  1S2Q A;  3DH9 A;  5GSN A;  3UTG A;  5KRQ A;  3UOX A;  3UKA A;  1PDH A;  3LXD A;  4WX1 A;  1OJ9 A;  3SXI A;  4ADW A;  1DXL A;  1B5Q A;  4EMW A;  3OZ2 A;  2JKC A;  3GWF A;  1H82 A;  1YQZ A;  4YTN A;  1KFY A;  5KMS A;  4OPT A;  4B1B A;  1PJ5 A;  4IA6 A;  3JSK A;  5EBK A;  3CMM A;  1ZDL A;  1FCD A;  2YR4 A;  2GQF A;  1GEU A;  1CJ4 A;  4LU6 A;  3NKS A;  4A9W A;  1GAL A;  2BXR A;  4M52 A;  1GET A;  4B67 A;  4JDR A;  2IID A;  3QSM A;  3NTA A;  4J33 A;  4A7A A;  1NEN A;  1GV4 A;  2E5V A;  3II4 A;  4RG4 A;  3NLC A;  3RNM A;  2FJE A;  1K4Q A;  4YSZ A;  3IF9 A;  3ALL A;  4Z26 A;  3KU9 A;  4H4Q A;  1GRB A;  4YKF A;  3M0O A;  3GDN A;  1JRY A;  3Q9T A;  3LOV A;  2RGO A;  2WES A;  3PVC A;  4LA1 A;  3GDP A;  1E6E A;  4CY8 A;  1IUU A;  1F6M A;  3QFB A;  4KX6 A;  4TLX A;  2O9Z A;  2Q0L A;  3ITJ A;  3RP6 A;  3CPH G;  1K0J A;  1N4W A;  4I59 A;  3VR8 A;  2R4J A;  3NRN A;  3QVR A;  3PS9 A;  3CTY A;  3HYX A;  2C73 A;  3E1T A;  5CKU A;  1KDG A;  3AXB A;  5ER0 A;  4K2X A;  5DBJ A;  5FS8 A;  5JCM A;  3IHG A;  4C77 A;  3KD9 A;  4U8P A;  4K22 A;  2GR0 A;  3UOV A;  4A79 A;  4H4S A;  4U8K A;  3ICT A;  2YVG A;  5BVA A;  3DK4 A;  1B4V A;  1Y0P A;  2YAU A;  4K7Z A;  4A99 A;  1NHQ A;  1Q1W A;  4OPC A;  3AE8 A;  1Q1R A;  2YG4 A;  4EM4 A;  1W4X A;  3D8X A;  3D1C A;  5EB4 A;  4DNA A;  3CNS A;  2FJD A;  3UKQ A;  3AWI A;  2BS4 A;  1H83 A;  4FX9 A;  4H4W A;  5HY5 A;  3CGD A;  2XVF A;  2GEW A;  4JY3 A;  1D5T A;  2YR6 A;  1DOC A;  3DGZ A;  1D4E A;  2BK3 A;  3RP8 A;  3UKK A;  1S3B A;  3DME A;  2EQ8 A;  1IUT A;  4Z24 A;  1LTX R;  4B63 A;  4I58 A;  5M0Z A;  5KOW A;  1B8S A;  1IUS A;  3UCL A;  2WP5 A;  3QSS A;  2B7S A;  2C64 A;  2BCP A;  4BK3 A;  3SM8 A;  3DK8 A;  5FMH A;  1TRB A;  1JRZ A;  1L9C A;  3F8D A;  4CCR A;  5KOX A;  3T31 A;  2C67 A;  5KMR A;  2CDU A;  3BNU A;  4B66 A;  4C3Y A;  4N9X A;  2JB3 A;  2WPC A;  2V5Z A;  4JY2 A;  3AD9 B;  4IVM B;  4Z43 A;  1GES A;  2TMD A;  3H8I A;  3H4K A;  4TM3 A;  2Z5Y A;  3NYE A;  3CN8 A;  4GRT A;  2WU5 A;  3FBS A;  2WOI A;  4OPG A;  3HYW A;  3SY4 A;  3CIR A;  4USQ A;  1BWC A;  3AD7 B;  2ZBW A;  3CNT A;  3CNP A;  4H4Y A;  1TDN A;  2QAE A;  4H4P A;  1MXT A;  2DKI A;  4OPL A;  2B9Y A;  3ZDN A;  1CL0 A;  2OLN A;  4U8L A;  2AAQ A;  1D4C A;  1F3P A;  4B65 A;  1TYT A;  2BS3 A;  2BK4 A;  3RHA A;  2YLS A;  1MO9 A;  3QSE A;  4K8D A;  1KNR A;  1M6I A;  4AT2 A;  1YKJ A;  3AYI A;  3DK9 A;  1XDI A;  1ZP0 A;  1Z6L A;  1YY5 A;  3DJD A;  3I6D A;  3AB1 A;  2WDV A;  2XVJ A;  4H4V A;  4DGK A;  1EL7 A;  1OJA A;  3UTH A;  3SZW A;  4Z2U A;  3NK2 X;  4GUV A;  1E1K A;  4TLZ A;  5HXI A;  1P2E A;  1LV0 A;  1RSG A;  3AE1 A;  2WBA A;  3AD8 B;  1N1P A;  1E7P A;  3UP4 A;  4APN A;  1PXC A;  3OC4 A;  3KLJ A;  2A8X A;  2NPX A;  2H88 A;  3SGL A;  1DOD A;  3AE2 A;  4U8O A;  1F8W A;  2XLT A;  2VQB A;  3ABV A;  2YM1 A;  4Z25 A;  4H4U A;  4XXG A;  4PAB A;  3GYJ A;  1CBO A;  1PN0 A;  2W0H A;  4GAV A;  2C3D A;  4NZH A;  2C4C A;  1OJD A;  4H50 A;  1PJ7 A;  3QJ4 A;  4HB9 A;  3VRB A;  1S2Y A;  4J2W A;  4C3X A;  2XVI A;  3NHO X;  3T37 A;  4Y4M A;  2WP6 A;  4J31 A;  4YXD A;  3L8K A;  1S3E A;  3FG2 P;  5JCK A;  4E0V A;  4EMJ A;  2R0G A;  1GRG A;  2Y6Q A;  5IPY A;  1XHC A;  2B76 A;  2R0P A;  2Y6R A;  3NH3 X;  1KNP A;  2XFN A;  4UDQ A;  5J60 A;  3H8L A;  3ICR A;  4UDR A;  2XFO A;  3GSI A;  2CUL A;  1MOK A;  2XLP A;  5BUL A;  4AP3 A;  5J7X A;  4GR1 A;  2JAE A;  4H4Z A;  2XLU A;  3SZC A;  1D4D A;  1F8R A;  1PS9 A;  1GT8 A;  2PHH A;  3M12 A;  1VDC A;  3AE6 A;  1H84 A;  3G5S A;  5HHF A;  2X50 A;  3G5Q A;  3AE7 A;  4NTD A;  1GRF A;  1JNR A;  2NVK X;  4GF7 A;  1M64 A;  2AQJ A;  2YVF A;  1IUV A;  3DA1 A;  4UDP A;  4BJZ A;  3ALJ A;  4U8N A;  2C70 A;  3UP5 A;  2GH5 A;  3ISH A;  4XWZ A;  1Y56 B;  2VOU A;  4IV9 A;  1D7Y A;  3S61 A;  1EL5 A;  4A65 A;  1VG9 A;  4K5R A;  3AEG A;  3QVP A;  3AYJ A;  3NGC X;  4J36 A;  4YSY A;  2YQU A;  2JK6 A;  3M13 A;  3NT6 A;  4NNJ A;  4X4J A;  1JNZ A;  3L1R A;  1NPX A;  5JCI A;  3SFD A;  3NG7 X;  2VVM A;  4D04 A;  4CBQ A;  2GF3 A;  3GRT A;  2X3N A;  4YTM A;  4P9S A;  3RP7 A;  1XAN A;  4NWZ A;  3WE0 A;  2EQ6 A;  3SZ0 A;  3LAD A;  3UTE A;  1NDA A;  3BI4 A;  3UTF A;  2XVH A;  1XPQ A;  2YG3 A;  2OAM A;  5FS6 A;  3NN6 X;  5BRT A;  4RSL A;  5KVI A;  2BAB A;  1QLB A;  1OJT A;  4O5Q A;  3KVE A;  3AE9 A;  1JOA A;  4G6G A;  4YTP A;  5JCL A;  1FOH A;  3GD3 A;  1B37 A;  2VZ2 A;  2F5Z A;  2VQ7 A;  2VVL A;  3BI5 A;  4AOX A;  4MJW A;  3B6D A;  1V59 A;  2WPF A;  3C96 A;  3IHM A;  2IVE A;  3SYI A;  1PXB A;  4GDE A;  4NEV A;  3R9U A;  1L0V A;  1CC4 A;  3PO7 A;  5JCN A;  2V6O A;  3CGC A;  2E1M A;  3CNJ A;  3GRS A;  3AED A;  4U8M A;  3F8R A;  1PBD A;  2GAG B;  1QJD A;  2RAB A;  3NNE A;  1PBE A;  1NG3 A;  2BRY A;  1JU2 A;  2J3N A;  1H6V A;  5GRT A;  2ZZB A;  3KA7 A;  2GV8 A;  3DGH A;  4IVO B;  2VVL G;  5TR3 A;  1DOB A;  2R45 A;  4AOS A;  4ZN0 A;  3P4P A;  3EAO A;  4XWR A;  3V3O A;  2XVE A;  1NAA A;  1NHS A;  2APG A;  5L46 A;  2TPR A;  1DJN A;  2QA1 A;  5CQF A;  1SEZ A;  2XFQ A;  4B64 A;  4LII A;  4JQ9 A;  2YLR A;  2A89 A;  3B3R A;  4UP3 A;  1GPE A;  2BC0 A;  2BS2 A;  2I0Z A;  2Q7V A;  1O95 A;  3COX A;  3LJP A;  4BK2 A;  1REO A;  2XFU A;  1NEK A;  2XLR A;  3GYI A;  3BNM A;  3P9U A;  1CJ3 A;  3P1W A;  3NN0 X;  1H81 A;  1O94 A;  2YVJ A;  5KMP A;  1CC2 A;  1GSN A;  2X8G A;  3IC9 A;  3LZW A;  4J34 A;  5HYM A;  1FL2 A;  1VQW A;  2Z5X A;  1E39 A;  4X9N A;  5EB5 A;  2WDQ A;  2XCG A;  1N4U A;  2A87 A;  1E1L A;  4AT0 A;  4Z44 A;  4EQR A;  1E1N A;  2XYO A;  3LB8 A;  4EMI A;  2B9X A;  1PXA A;  4BUR A;  2JB1 A;  2WQY A;  1CHU A;  4K5S A;  3GYX A;  1BF3 A;  3AEC A;  3RED A;  2GB0 A;  1BKW A;  4G9K A;  2GR3 A;  4FDC B;  4JN9 A;  3O0H A;  1HYU A;  1ZK7 A;  3KKJ A;  3KPF A;  3SX6 A;  1D7L A;  1LQT A;  1NHR A;  4USR A;  1K0I A;  4B68 A;  5IQ4 A;  2PYX A;  4OPU A;  5KNL A;  1PBF A;  2IVD A;  4A6N B;  2FJB A;  1DNC A;  2XFP A;  4C5O A;  4EQX A;  4H2Q A;  1CF3 A;  1UKV G;  2VRM A;  1CJ2 A;  1GTE A;  2GMH A;  4GDP A;  4OCG A;  1E1M A;  1JRX A;  1RP0 A;  4ECH A;  5KVH A;  2OLO A;  2WEU A;  4BV6 A;  1L9E A;  4H4T A;  2R4E A;  4OPD A;  2UZZ A;  2V3A A;  1ONF A;  2YM2 A;  2WP9 A;  3CPI G;  1YQ4 A;  4II3 A;  1TDE A;  1TDO A;  3C4N A;  2RGH A;  3CGE A;  3URH A;  2WPE A;  3BHF A;  1GTH A;  3UOY A;  4G74 A;  1CC6 A;  4H2R A;  1GND A;  2CFY A;  1LPF A;  4FK1 A;  4O5U A;  4BJY A;  1GOS A;  2GQW A;  1O5W A;  2B9W A;  3VR9 A;  4Z2T A;  5KMQ A;  2C7G A;  1N4V A;  2C65 A;  2GR2 A;  3T0K A;  1KSU A;  2YG7 A;  4GCM A;  2R46 A;  4U8I A;  3DJE A;  2YG5 A;  4Y4N A;  4H4R A;  1BGJ A;  5KXJ A;  3ZYX A;  1H7W A;  4BK1 A;  4GAP A;  2Q0K A;  4ZCC A;  4C74 A;  3BI2 A;  3VRD B;  1FEB A;  1K0L A;  1VRQ B;  2ARD A;  1LQU A;  2EQ7 A;  3K7T A;  4NEW A;  4YKG A;  1Q9I A;  4FK1 C;  4G73 A;  4OPI A;  3Q6J A;  2BXS A;  3UKL A;  2RGJ A;  1GRE A;  3AEF A;  2C72 A;  2ZZC A;  2EQ9 A;  2OA1 A;  4TM0 A;  2OAL A;  2WS3 A;  3P4R A;  3T2Z A;  2AR8 A;  2BA9 A;  3LZX A;  4PAA A;  1KF6 A;  2V61 A;  2HQM A;  3T2Y A;  1TYP A;  1COY A;  3NYC A;  3EAN A;  2C75 A;  3DJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...