3NK0X

Complex of 6-hydroxy-l-nicotine oxidase with inhibitor bound at active site and turnover product at exit cavity
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 149
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk0X02
1VG9A 3AECA 4EQSA 4MJWA 2YG6A 3VQRA 3CGDA 5C3JA 4OVIA 1W4XA 4A65A 1ZMDA 3KLJA 3AE1A 1JEHA 4H50A 1E6EA 2ACZA 2WU2A 3AYLA 3GWFA 3VRAA 1GXFA 4YSYA 2C72A 1ELIA 3GMCA 1Y0PA 2FJEA 4U2LA 3AEDA 3I3LA 4REKA 2WEUA 4Z2TA 2YLSA 3HZLA 2QAEA 2XCGA 3O0HA 2YR4A 4H4PA 4H4RA 3VR9A 1PJ7A 3AEEA 4B68A 1REOA 2C3CA 3V3NA 4IA6A 4O5QA 1IUTA 1KFYA 3P1WA 4YTMA 3CNDA 3CNJA 3GWDA 3COXA 3UTHA 4TM1A 3UCLA 3PO7A 4K5RA 1DNCA 3NHOX 1YY5A 3QJ4A 1PBFA 2XLPA 2C70A 1CHUA 4YT0A 1QO8A 3ATRA 4H4TA 2A89A 4GDPA 3G5RA 1GRGA 3UKFA 4Z24A 1AOGA 2IIDA 2WPCA 4U8PA 1PXCA 2C75A 3NT6A 4FK1A 2GMHA 3DH9A 1DJQA 3Q6JA 4Y4MA 1GPEA 3NTAA 1ZOVA 3DK4A 3P4PA 4IA5A 1ZKQA 4H2NA 3S61A 1PXBA 4ADWA 1XHCA 2TMDA 3B6DA 4H2PA 3AB1A 4JNAA 2B9XA 5EB4A 4JDRA 3KU9A 2OA1A 3UKHA 3QVPA 2C65A 4A79A 1OJTA 1TDOA 5CQFA 2GVCA 1PJ5A 1K0IA 2B7RA 3NN0X 1S2YA 1S2QA 3L1RA 4H4QA 4X9NA 1GESA 2B76A 1PBDA 1KF6A 2GEWA 4GDEA 4U8JA 1FEAA 2Q0KA 4EIQA 2XVFA 3UTGA 4E0VA 5BULA 1PBCA 2BCGG 4CY6A 3BHFA 1O94A 2RGHA 5BUKA 2WPFA 1DODA 1L9EA 2V60A 4Y4LA 5FMHA 4EQRA 2E4GA 3II4A 3CIRA 4RG3A 4A7AA 2OALA 3DMEA 4U8OA 4YTNA 4BJZA 2C76A 1H82A 1D7LA 2R46A 1H86A 3EF6A 3SFDA 4B63A 3LZXA 2YQUA 1MXTA 2GB0A 3AE3A 3EPTA 2XVJA 3D1CA 4X4JA 4Z2UA 2BXSA 1S3BA 2B9WA 2YR6A 3ZDNA 4B67A 2VRLA 3UTEA 1EL8A 3KA7A 4CRTA 2H88A 1Q9IA 3AE9A 3KD9A 3AD9B 3AE2A 5U25A 2F5ZA 2ARDA 3CPHG 1CC2A 2ZZ0A 3EAOA 4UDRA 3CPIG 1CC6A 4WCTA 2FBWA 1PS9A 2BYBA 3NH3X 4TM4A 2Y6QA 2VVLA 4BK3A 4D03A 3D8XA 4TM0A 2XFQA 3AD8B 3OC4A 3LOVA 1GRHA 3QSMA 4U2TA 2XLRA 1M64A 2QCUA 1V59A 4J31A 1TYPA 5KVIA 2JB3A 2XLSA 4BURA 4IV9A 4N9XA 5KXJA 1CF3A 1BGNA 2WOVA 1Q1RA 4GR1A 4XWZA 1TRBA 2WP5A 4O5UA 1PXAA 3URHA 4FDCB 4J36A 1NAAA 1H83A 2X50A 3REDA 5JCIA 2YLZA 5IPYA 4DSHA 2GQWA 3AXBA 4NEVA 5JCKA 3NTDA 3FIMB 2RABA 1NENA 4JNQA 3AYJA 1NG4A 1E1NA 4U8LA 3AEGA 3AYIA 2WESA 1BZLA 3GD3A 2FJDA 3ICTA 3GDPA 3SM8A 3QSEA 4AOXA 4AT0A 4ZCDA 1F6MA 5U1OA 4H4YA 3ZYXA 3NIXA 1YQ4A 1H6VA 1P2HA 3DK9A 3NN6X 4EQXA 1FL2A 1OJAA 3P9UA 4YTPA 2VVLG 4NTDA 2EQ6A 1H84A 5HY5A 2XFPA 1BKWA 3UKAA 1XANA 4KPRA 1BF3A 2I0ZA 2BXRA 4H2QA 1NHSA 4U8MA 3FG2P 3BNUA 1FECA 1E1LA 3GRTA 3CNSA 2YG4A 2YM1A 3NRNA 3ADAB 1E39A 2DKIA 4OCGA 2NPXA 5EB5A 2WP6A 1D5TA 3PS9A 2BCPA 1TDFA 2JKCA 5CKUA 1LPFA 4YSZA 2R0PA 2CVJA 2WOIA 3UKLA 2BK3A 4CY8A 4YWOA 3RHAA 1KNPA 2YG7A 3H8LA 4JY2A 4U2SA 2APGA 3K7MX 2X8GA 4CNJA 4J33A 2BS2A 3ALLA 1PBEA 3VRBA 3IHMA 5M0ZA 4C74A 2WS3A 3GD4A 4C5OA 4H4ZA 4NEWA 5J7XA 3DJDA 4ICYA 1DOEA 3PVCA 4XXGA 3DK8A 3UTFA 1E1MA 2FJAA 3QFBA 2WHDA 2X99A 2ZBWA 1E7PA 3DGZA 1D4EA 1SEZA 4USQA 4ZCCA 1B5QA 2VVMA 1VQWA 1GT8A 4H4XA 1F3PA 2R0GA 4CCQA 5FS7A 2C7GA 3H8IA 1GERA 2GH5A 3VR8A 3RNMA 1H7WA 1LVLA 4K2XA 2BS3A 2B9YA 1PN0A 4DNAA 4Z26A 2QA1A 1COYA 2XDOA 1FOHA 2Q7VA 4AP3A 4I58A 3ICSA 4LA1A 3E1TA 4TLZA 3C4AA 2E1MA 3G5SA 2W0HA 4UDPA 4A6NA 1RYIA 1NHQA 2A87A 1YKJA 3QVRA 1ZDLA 3NK1X 4H7UA 5HXIA 3CN8A 3RP8A 1XPQA 1IUSA 1E1KA 4GUVA 3F8PA 2JB2A 4K5SA 4A5LA 4EIPA 1OJDA 2C67A 2C3DA 3CGBA 5KWFA 2R4EA 3UOYA 1JU2A 1P2EA 2JB1A 2YLXA 1ZOYA 4A9WA 1TDNA 3LXDA 4NZHA 2AR8A 3C4NA 3F8DA 3GYJA 4H4VA 1Z6LA 1FEBA 1N1PA 1KSSA 1LTXR 3CNTA 3NYEA 1O95A 2ZZCA 3NG7X 4B66A 3JSKA 2BK5A 4FK1C 4H2RA 3LADA 1NHPA 1IUWA 2BK4A 2AAQA 1S3EA 5KRQA 4J34A 3NKSA 1K0LA 1LQUA 3BI4A 1JOAA 4XWRA 3NK0X 2V3BA 4IVOB 2GR0A 2Y6RA 2NVKX 1D4CA 3NYFA 1DXLA 2JAEA 3GMBA 1GALA 4KX6A 3S5WA 1LV0A 4K22A 5IQ1A 3K30A 3UP5A 4AT2A 4DSGA 2WBAA 4PABA 4HB9A 4U8KA 1L9CA 3ABVA 2HQMA 1QLBA 4U8NA 5FS8A 1GEUA 2GR3A 4YSHA 4JQ9A 2X8CA 1KDGA 1CJCA 4Z44A 1GOSA 4A6NB 2FJBA 4P9SA 1HYUA 1Y56A 1F8WA 1H7XA 3C96A 3SGLA 2B7SA 3ISHA 2VOUA 1Q1WA 1NDAA 3NYCA 3F8RA 3QSSA 2YVGA 3UOXA 4EMJA 3DJGX 4BJYA 3R9UA 3LB8A 5C2TA 4C77A 3IHGA 1JNZA 1TDEA 2CDUA 4H4SA 5TR3A 2V3AA 3M0OA 1PDHA 3BI5A 2BC1A 1X31B 4D04A 1B37A 3CGCA 2XFUA 1RP0A 3CPJG 3KPFA 4GRTA 4M52A 2H89A 2OLNA 2WQYA 4YKFA 2WOWA 5IQ4A 3IWAA 2YLTA 2VZ2A 2XYOA 1GSNA 2PHHA 4CBQA 1GRBA 3WE0A 2XFOA 4I59A 3L8KA 1TYTA 5BRTA 3UOVA 2V5ZA 3AE6A 1ZP0A 2X8HA 3AEBA 4X9MA 4GF7A 3GSIA 4ECHA 2J3NA 1ZK7A 3G5QA 5KOXA 1GRAA 3RP7A 2CFYA 3GRSA 1JNRA 1ZMCA 2JBVA 3AE8A 2WDQA 4K8DA 1M6IA 3AE5A 1ZX9A 2ZZBA 1VRQB 2C66A 2X3NA 1NPXA 3AEFA 4BV6A 2YLRA 4J57A 4J56A 1N4UA 2GF3A 1MO9A 4CNKA 4GCMA 1B8SA 2GV8A 3I6DA 4OPTA 1PBBA 4Y4NA 3UKKA 4B1BA 1KSUA 3GYIA 1TDKA 4RSLA 3V3OA 1Y56B 3CNPA 4OPUA 3AE7A 2YAUA 5L46A 1XDIA 4B64A 4J2WA 4WX1A 2GMJA 1BGJA 1JRYA 1K4QA 3DJJA 2JK6A 2EQ8A 5JCMA 2GAHB 2RGOA 4OPGA 2A8XA 1RSGA 2XVIA 3DGHA 4LU6A 5HHFA 4B69A 5M10A 3UKQA 1YQ3A 2GAGB 5EBKA 5LV9A 3CGEA 1EL5A 2YG3A 3M13A 3P4QA 1UKVG 1CJ2A 1D7YA 4H4WA 4TM3A 1PHHA 1ONFA 4B65A 1OJ9A 2XVEA 3NK2X 5DBJA 1DJNA 4EQWA 1GRTA 2YLWA 1MOKA 2QA2A 1VG0A 2AQJA 2VQBA 2WETA 4C3YA 5U63A 3LZWA 5JCNA 1CBOA 1IUUA 2PYXA 3IC9A 4CCRA 2DKHA 4AP1A 2OAMA 4UDQA 3AEAA 1L9DA 4UP3A 2Z5YA 5GSNA 5GRTA 1LQTA 3RP6A 1H81A 2R9ZA 2XLUA 1O5WA 3ICRA 5FS9A 2VQ7A 4ZN0A 3KVEA 2GRTA 1IUVA 3UP4A 1BWCA 2C64A 3CTYA 1EL9A 4DGKA 4H4UA 1EL7A 1D4DA 4RG4A 2IVDA 2XLTA 1K0JA 1GETA 2BC0A 3IF9A 2C73A 4OPLA 5J60A 1FCDA 4Z2RA 2YM2A 3EANA 3DJEA 3H4KA 4Z25A 1IJHA 1N4WA 2GR1A 2WU5A 4APNA 2YWLA 4EMIA 2WDRA 1JRXA 3KKJA 4OPIA 3ALJA 1CJ3A 3UKPA 2RGJA 3ITJA 2BA9A 2TPRA 2V6OA 1DOBA 1GNDA 2EQ9A 5BVAA 4FX9A 3BHKA 4BK1A 2R4JA 1EBDA 2V61A 2BABA 3DA1A 5EOWA 3FPZA 1IUXA 1GTHA 1CC4A 3UOZA 4EM3A 3QFAA 1F8SA 4NTEA 2E5VA 1LJ1A 2YR5A 3FBSA 2O9ZA 3ATQA 1NG3A 3K7QX 3OZ2A 3P4RA 5FS6A 2YVFA 3M12A 3BI2A 3P4SA 3T37A 3NLCA 4OPCA 4JN9A 4JY3A 4C3XA 4LIIA 3SQPA 1GREA 1PJ6A 4K7ZA 4TLXA 1ZY8A 2WDVA 3NGCX 1NHRA 4OPDA 1KNRA 4A99A 4YXDA 1N4VA 5KVHA 3ALMA 3NNEA 2YVJA 4NTCA 3FMWA 5ER0A 4EM4A 3B3RA 1QJDA 1CL0A 2VRMA 4PAAA 1DOCA 4BK2A 3VRDB 1GRFA 2IVEA 2XFNA 1F8RA 4U8IA 2R0CA 3AE4A 2GQFA 1OJCA 2EQ7A 1JRZA 2WPEA 3K7TA 3V76A 2Z5XA 5JCLA 2BS4A 4AOSA 2Q0LA 1GTEA 2GR2A 3GDNA 3Q9TA 2BACA 4YKGA 1GV4A 1NEKA 2XVHA 2UZZA 2OLOA 1B4VA 4IVMB 1CJ4A 4HA6A 4Z43A 4EMWA 4YSXA 2WP9A 3AWIA 2Q6UA 5HYMA 5KOWA 3SFEA 4USRA 2YG5A 1YQZA 3LJPA 3BNMA 3AD7B 2CULA 1VDCA 2R45A 1L0VA
chains in the Genus database with same CATH superfamily
1VG9A 3AECA 3T2ZA 4EQSA 4MJWA 2YG6A 3VQRA 3CGDA 5C3JA 4OVIA 1W4XA 4A65A 1ZMDA 3KLJA 3AE1A 1JEHA 4H50A 1E6EA 2ACZA 2WU2A 3AYLA 3GWFA 3VRAA 1GXFA 4YSYA 2C72A 1ELIA 2BRYA 1Y0PA 2FJEA 3GMCA 4U2LA 3AEDA 3I3LA 4REKA 2WEUA 4Z2TA 2YLSA 3HZLA 2QAEA 2XCGA 3O0HA 2YR4A 4H4PA 4H4RA 3VR9A 1PJ7A 3AEEA 4B68A 1REOA 2C3CA 3V3NA 4IA6A 4O5QA 1IUTA 1KFYA 3P1WA 4YTMA 3CNDA 3CNJA 3GWDA 3COXA 3UTHA 4TM1A 3UCLA 3HYXA 3PO7A 4K5RA 1DNCA 3NHOX 1YY5A 3QJ4A 1PBFA 2XLPA 2C70A 1CHUA 4YT0A 1QO8A 3ATRA 4H4TA 2A89A 4GDPA 3G5RA 1GRGA 3UKFA 4Z24A 1AOGA 2IIDA 2WPCA 4U8PA 1PXCA 2C75A 3NT6A 4FK1A 2GMHA 3DH9A 1DJQA 3Q6JA 4Y4MA 1GPEA 3NTAA 1ZOVA 3DK4A 3P4PA 4IA5A 1ZKQA 4H2NA 3S61A 1PXBA 4ADWA 1XHCA 2TMDA 3B6DA 4H2PA 3AB1A 4JNAA 2B9XA 5EB4A 4JDRA 3KU9A 2OA1A 3UKHA 3QVPA 2C65A 4A79A 1OJTA 1TDOA 4G73A 2GVCA 1PJ5A 1K0IA 2B7RA 4II2A 5CQFA 3NN0X 1S2YA 1S2QA 3L1RA 4H4QA 4X9NA 1GESA 2B76A 1PBDA 1KF6A 2GEWA 4GDEA 4U8JA 1FEAA 2Q0KA 4EIQA 2XVFA 3UTGA 4E0VA 5BULA 1PBCA 2BCGG 4CY6A 3BHFA 1O94A 2RGHA 5BUKA 2WPFA 1DODA 1L9EA 2V60A 4Y4LA 5FMHA 4EQRA 2E4GA 3II4A 3CIRA 4RG3A 4A7AA 2OALA 3DMEA 4U8OA 4YTNA 4BJZA 2C76A 1H82A 5KNLA 1D7LA 2R46A 1H86A 3EF6A 3SFDA 4B63A 3LZXA 2YQUA 1MXTA 2GB0A 3AE3A 3EPTA 2XVJA 3D1CA 4X4JA 4Z2UA 2BXSA 1S3BA 2B9WA 2YR6A 3T0KA 3ZDNA 4B67A 2VRLA 3UTEA 1EL8A 3KA7A 4CRTA 2H88A 1Q9IA 3AE9A 3KD9A 3AD9B 3AE2A 5U25A 2F5ZA 2ARDA 3CPHG 3SX6A 1CC2A 2ZZ0A 3EAOA 4UDRA 3CPIG 1CC6A 4WCTA 2FBWA 1PS9A 2BYBA 3NH3X 4TM4A 2Y6QA 2VVLA 4BK3A 4D03A 3D8XA 4TM0A 2XFQA 3AD8B 3OC4A 3LOVA 1GRHA 3QSMA 4U2TA 2XLRA 1M64A 2QCUA 1V59A 4J31A 1TYPA 5KVIA 2JB3A 2XLSA 4BURA 4IV9A 4N9XA 5KXJA 1CF3A 1BGNA 2WOVA 1Q1RA 4GR1A 4XWZA 1TRBA 2WP5A 4O5UA 2BRAA 1PXAA 3URHA 4FDCB 4J36A 1NAAA 1H83A 2X50A 3REDA 5JCIA 2YLZA 5IPYA 4YSHA 4DSHA 3T14A 2GQWA 3AXBA 4NEVA 5JCKA 3NTDA 3FIMB 2RABA 1NENA 2C4CA 4JNQA 3AYJA 1NG4A 1E1NA 4U8LA 3AEGA 3AYIA 2WESA 1BZLA 3GD3A 2FJDA 3ICTA 3GDPA 3SM8A 3QSEA 4AOXA 4AT0A 4ZCDA 1F6MA 5U1OA 4H4YA 3ZYXA 3NIXA 1YQ4A 3HYVA 1H6VA 1P2HA 3DK9A 3NN6X 4EQXA 1FL2A 1OJAA 3P9UA 4YTPA 2VVLG 4NTDA 2EQ6A 1H84A 5HY5A 2XFPA 1BKWA 3UKAA 1XANA 4KPRA 1BF3A 2I0ZA 2BXRA 4H2QA 1NHSA 4U8MA 3FG2P 3BNUA 1FECA 1E1LA 3GRTA 3CNSA 2YG4A 2YM1A 3NRNA 3ADAB 1E39A 2DKIA 4OCGA 2NPXA 5EB5A 2WP6A 1D5TA 4G6HA 3PS9A 2BCPA 1TDFA 2JKCA 5CKUA 1LPFA 4YSZA 2R0PA 2CVJA 2WOIA 3UKLA 2BK3A 4CY8A 4YWOA 3RHAA 1KNPA 2YG7A 3H8LA 4JY2A 4U2SA 2APGA 3K7MX 2X8GA 4CNJA 4J33A 3T2YA 2BS2A 3ALLA 1PBEA 3VRBA 3IHMA 5M0ZA 4C74A 2WS3A 3GD4A 4C5OA 4H4ZA 4NEWA 5J7XA 3HYWA 3DJDA 4ICYA 1DOEA 3PVCA 4XXGA 3DK8A 3UTFA 1E1MA 2FJAA 3QFBA 2WHDA 2X99A 2ZBWA 1E7PA 3DGZA 1D4EA 1SEZA 4USQA 4ZCCA 1B5QA 2VVMA 1VQWA 1GT8A 4H4XA 1F3PA 3SY4A 2R0GA 4NNJA 5FS7A 4CCQA 2C7GA 3H8IA 1GERA 2GH5A 3VR8A 3RNMA 1H7WA 1LVLA 4K2XA 2BS3A 2B9YA 1PN0A 4DNAA 4Z26A 2QA1A 1COYA 2XDOA 1FOHA 4G9KA 2Q7VA 4AP3A 4I58A 3ICSA 4LA1A 3E1TA 4TLZA 3C4AA 2E1MA 3G5SA 2W0HA 3GYXA 4UDPA 1RYIA 4A6NA 1NHQA 2A87A 1YKJA 3QVRA 1ZDLA 3NK1X 4H7UA 5HXIA 3KPKA 3CN8A 3RP8A 1XPQA 1IUSA 1E1KA 4GUVA 3F8PA 3SZFA 2JB2A 4K5SA 4A5LA 3T2KA 4EIPA 1OJDA 2C67A 2C3DA 3CGBA 5KWFA 2R4EA 3UOYA 1JU2A 1P2EA 2JB1A 2YLXA 1ZOYA 4A9WA 1TDNA 3LXDA 4NZHA 2AR8A 3T31A 3C4NA 3F8DA 3GYJA 4H4VA 1Z6LA 4G6GA 1FEBA 1N1PA 1KSSA 1LTXR 3CNTA 3NYEA 1O95A 2ZZCA 3NG7X 4B66A 3JSKA 2BK5A 4FK1C 4H2RA 3LADA 1NHPA 1IUWA 2BK4A 2AAQA 1S3EA 5KRQA 4J34A 3NKSA 1K0LA 1LQUA 3BI4A 1JOAA 4XWRA 3NK0X 2V3BA 4IVOB 2GR0A 2Y6RA 2NVKX 1D4CA 3NYFA 1DXLA 2JAEA 3GMBA 1GALA 4KX6A 3S5WA 1LV0A 4K22A 5IQ1A 3K30A 3UP5A 4AT2A 4DSGA 2WBAA 4PABA 4HB9A 4U8KA 1L9CA 3ABVA 2HQMA 1QLBA 4NWZA 4U8NA 1GEUA 2GR3A 5FS8A 4JQ9A 2X8CA 1KDGA 1CJCA 4Z44A 1GOSA 4A6NB 2FJBA 4GAPA 4P9SA 3SXIA 1HYUA 1Y56A 1F8WA 1H7XA 3C96A 3SGLA 2B7SA 3ISHA 3SYIA 2VOUA 1Q1WA 1NDAA 3NYCA 5KMQA 3F8RA 3QSSA 2YVGA 3UOXA 4EMJA 3DJGX 4BJYA 3R9UA 5KMRA 3LB8A 5C2TA 4C77A 3CMMA 3IHGA 1JNZA 1TDEA 2CDUA 4H4SA 5TR3A 2V3AA 3M0OA 1PDHA 3BI5A 2BC1A 1X31B 4D04A 1B37A 3CGCA 2XFUA 1RP0A 3CPJG 3KPFA 4GRTA 4M52A 2H89A 2OLNA 2WQYA 4YKFA 2WOWA 3SZ0A 5IQ4A 3IWAA 2YLTA 2VZ2A 2XYOA 1GSNA 2PHHA 4CBQA 1GRBA 3WE0A 2XFOA 4I59A 3L8KA 1TYTA 5BRTA 3UOVA 2V5ZA 3AE6A 1ZP0A 2X8HA 3AEBA 4X9MA 4GF7A 3GSIA 4ECHA 2J3NA 1ZK7A 3G5QA 5KOXA 1GRAA 3RP7A 2CFYA 3GRSA 1JNRA 1ZMCA 2JBVA 3AE8A 2WDQA 4K8DA 1M6IA 3AE5A 1ZX9A 2ZZBA 1VRQB 2C66A 2X3NA 1NPXA 3AEFA 4BV6A 2YLRA 4J57A 4J56A 1N4UA 2GF3A 1MO9A 4CNKA 4GCMA 1B8SA 2GV8A 3I6DA 4OPTA 1PBBA 4Y4NA 3UKKA 4B1BA 1KSUA 3GYIA 1TDKA 4RSLA 3V3OA 1Y56B 3CNPA 4OPUA 3AE7A 2YAUA 5L46A 1XDIA 4B64A 4J2WA 4WX1A 2GMJA 1BGJA 1JRYA 1K4QA 3DJJA 2JK6A 2EQ8A 5JCMA 4G74A 2GAHB 2RGOA 4OPGA 2A8XA 1RSGA 2XVIA 3DGHA 4LU6A 5HHFA 4B69A 4GAVA 5M10A 3UKQA 1YQ3A 2GAGB 5EBKA 5LV9A 3CGEA 1EL5A 2YG3A 3M13A 3P4QA 1UKVG 1CJ2A 1D7YA 4H4WA 4TM3A 1PHHA 1ONFA 4B65A 1OJ9A 2XVEA 3NK2X 5DBJA 1DJNA 4EQWA 1GRTA 2YLWA 1MOKA 2QA2A 1VG0A 2AQJA 2VQBA 2WETA 4C3YA 5U63A 3LZWA 5JCNA 1CBOA 1IUUA 2PYXA 3IC9A 4CCRA 2DKHA 4AP1A 2OAMA 4UDQA 3AEAA 1L9DA 4UP3A 2Z5YA 5GSNA 5GRTA 1LQTA 3RP6A 1H81A 2R9ZA 2XLUA 1O5WA 3ICRA 5FS9A 2VQ7A 4ZN0A 3KVEA 2GRTA 1IUVA 3UP4A 1BWCA 2C64A 3CTYA 1EL9A 4DGKA 4H4UA 1EL7A 1D4DA 4RG4A 2IVDA 2XLTA 1K0JA 1GETA 2BC0A 3IF9A 2C73A 4OPLA 5J60A 1FCDA 4Z2RA 2YM2A 3EANA 3DJEA 3H4KA 4Z25A 1IJHA 1N4WA 2GR1A 2WU5A 4APNA 2YWLA 4EMIA 2WDRA 1JRXA 3KKJA 4OPIA 3ALJA 1CJ3A 3UKPA 2RGJA 3ITJA 2BA9A 2TPRA 2V6OA 1DOBA 1GNDA 2EQ9A 5BVAA 4FX9A 3BHKA 4BK1A 2R4JA 1EBDA 2V61A 4II3A 2BABA 3DA1A 5EOWA 3FPZA 1IUXA 1GTHA 1CC4A 3UOZA 4EM3A 3QFAA 1F8SA 4NTEA 2E5VA 1LJ1A 2YR5A 3SZCA 3FBSA 2O9ZA 3ATQA 1NG3A 3K7QX 3OZ2A 3P4RA 5FS6A 2YVFA 3M12A 3BI2A 3P4SA 3T37A 3NLCA 4OPCA 4JN9A 4JY3A 4C3XA 4LIIA 3SQPA 1GREA 1PJ6A 4K7ZA 4TLXA 1ZY8A 2WDVA 3NGCX 1NHRA 4OPDA 1KNRA 4A99A 4YXDA 1N4VA 5KVHA 3ALMA 3NNEA 2YVJA 4NTCA 3FMWA 5ER0A 4EM4A 3B3RA 1QJDA 1CL0A 2VRMA 4PAAA 1DOCA 5KMPA 4BK2A 3VRDB 1GRFA 2IVEA 2XFNA 1F8RA 4U8IA 2R0CA 3AE4A 2GQFA 1OJCA 2EQ7A 1JRZA 2WPEA 3K7TA 3V76A 5KMSA 2Z5XA 5JCLA 2BS4A 4AOSA 2Q0LA 1GTEA 2GR2A 3GDNA 3Q9TA 3SZWA 2BACA 4YKGA 1GV4A 1NEKA 2XVHA 2UZZA 2OLOA 1B4VA 4IVMB 1CJ4A 4HA6A 4Z43A 4EMWA 4YSXA 2WP9A 3AWIA 2Q6UA 5HYMA 5KOWA 3SFEA 4USRA 2YG5A 1YQZA 3LJPA 3BNMA 3AD7B 2CULA 1VDCA 2R45A 1L0VA
chains in the Genus database with same CATH topology
1VG9A 3AECA 3T2ZA 4EQSA 4MJWA 2YG6A 3VQRA 3CGDA 5C3JA 4OVIA 1W4XA 4A65A 1ZMDA 3KLJA 3AE1A 1JEHA 4H50A 1E6EA 2ACZA 2WU2A 3AYLA 3GWFA 3VRAA 1GXFA 4YSYA 2C72A 1ELIA 2BRYA 1Y0PA 2FJEA 3GMCA 4U2LA 3AEDA 3I3LA 4REKA 2WEUA 4Z2TA 2YLSA 3HZLA 2QAEA 2XCGA 3O0HA 2YR4A 4H4PA 4H4RA 3VR9A 1PJ7A 3AEEA 4B68A 1REOA 2C3CA 3V3NA 4IA6A 4O5QA 1IUTA 1KFYA 3P1WA 4YTMA 3CNDA 3CNJA 3GWDA 3COXA 3UTHA 4TM1A 3UCLA 3HYXA 3PO7A 4K5RA 1DNCA 3NHOX 1YY5A 3QJ4A 1PBFA 2XLPA 2C70A 1CHUA 4YT0A 1QO8A 3ATRA 4H4TA 2A89A 4GDPA 3G5RA 1GRGA 3UKFA 4Z24A 1AOGA 2IIDA 2WPCA 4U8PA 1PXCA 2C75A 3NT6A 4FK1A 2GMHA 3DH9A 1DJQA 3Q6JA 4Y4MA 1GPEA 3NTAA 1ZOVA 3DK4A 3P4PA 4IA5A 1ZKQA 4H2NA 3S61A 1PXBA 4ADWA 1XHCA 2TMDA 3B6DA 4H2PA 3AB1A 4JNAA 2B9XA 5EB4A 4JDRA 3KU9A 2OA1A 3UKHA 3QVPA 2C65A 4A79A 1OJTA 1TDOA 4G73A 2GVCA 1PJ5A 1K0IA 2B7RA 4II2A 5CQFA 3NN0X 1S2YA 1S2QA 3L1RA 4H4QA 4X9NA 1GESA 2B76A 1PBDA 1KF6A 2GEWA 4GDEA 4U8JA 1FEAA 2Q0KA 4EIQA 2XVFA 3UTGA 4E0VA 5BULA 1PBCA 2BCGG 4CY6A 3BHFA 1O94A 2RGHA 5BUKA 2WPFA 1DODA 1L9EA 2V60A 4Y4LA 5FMHA 4EQRA 2E4GA 3II4A 3CIRA 4RG3A 4A7AA 2OALA 3DMEA 4U8OA 4YTNA 4BJZA 2C76A 1H82A 5KNLA 1D7LA 2R46A 1H86A 3EF6A 3SFDA 4B63A 3LZXA 2YQUA 1MXTA 2GB0A 3AE3A 3EPTA 2XVJA 3D1CA 4X4JA 4Z2UA 2BXSA 1S3BA 2B9WA 2YR6A 3T0KA 3ZDNA 4B67A 2VRLA 3UTEA 1EL8A 3KA7A 4CRTA 2H88A 1Q9IA 3AE9A 3KD9A 3AD9B 3AE2A 5U25A 2F5ZA 2ARDA 3CPHG 3SX6A 1CC2A 2ZZ0A 3EAOA 4UDRA 3CPIG 1CC6A 4WCTA 2FBWA 1PS9A 2BYBA 3NH3X 4TM4A 2Y6QA 2VVLA 4BK3A 4D03A 3D8XA 4TM0A 2XFQA 3AD8B 3OC4A 3LOVA 1GRHA 3QSMA 4U2TA 2XLRA 1M64A 2QCUA 1V59A 4J31A 1TYPA 5KVIA 2JB3A 2XLSA 4BURA 4IV9A 4N9XA 5KXJA 1CF3A 1BGNA 2WOVA 1Q1RA 4GR1A 4XWZA 1TRBA 2WP5A 4O5UA 2BRAA 1PXAA 3URHA 4FDCB 4J36A 1NAAA 1H83A 2X50A 3REDA 5JCIA 2YLZA 5IPYA 4YSHA 4DSHA 3T14A 2GQWA 3AXBA 4NEVA 5JCKA 3NTDA 3FIMB 2RABA 1NENA 2C4CA 4JNQA 3AYJA 1NG4A 1E1NA 4U8LA 3AEGA 3AYIA 2WESA 1BZLA 3GD3A 2FJDA 3ICTA 3GDPA 3SM8A 3QSEA 4AOXA 4AT0A 4ZCDA 1F6MA 5U1OA 4H4YA 3ZYXA 3NIXA 1YQ4A 3HYVA 1H6VA 1P2HA 3DK9A 3NN6X 4EQXA 1FL2A 1OJAA 3P9UA 4YTPA 2VVLG 4NTDA 2EQ6A 1H84A 5HY5A 2XFPA 1BKWA 3UKAA 1XANA 4KPRA 1BF3A 2I0ZA 2BXRA 4H2QA 1NHSA 4U8MA 3FG2P 3BNUA 1FECA 1E1LA 3GRTA 3CNSA 2YG4A 2YM1A 3NRNA 3ADAB 1E39A 2DKIA 4OCGA 2NPXA 5EB5A 2WP6A 1D5TA 4G6HA 3PS9A 2BCPA 1TDFA 2JKCA 5CKUA 1LPFA 4YSZA 2R0PA 2CVJA 2WOIA 3UKLA 2BK3A 4CY8A 4YWOA 3RHAA 1KNPA 2YG7A 3H8LA 4JY2A 4U2SA 2APGA 3K7MX 2X8GA 4CNJA 4J33A 3T2YA 2BS2A 3ALLA 1PBEA 3VRBA 3IHMA 5M0ZA 4C74A 2WS3A 3GD4A 4C5OA 4H4ZA 4NEWA 5J7XA 3HYWA 3DJDA 4ICYA 1DOEA 3PVCA 4XXGA 3DK8A 3UTFA 1E1MA 2FJAA 3QFBA 2WHDA 2X99A 2ZBWA 1E7PA 3DGZA 1D4EA 1SEZA 4USQA 4ZCCA 1B5QA 2VVMA 1VQWA 1GT8A 4H4XA 1F3PA 3SY4A 2R0GA 4NNJA 5FS7A 4CCQA 2C7GA 3H8IA 1GERA 2GH5A 3VR8A 3RNMA 1H7WA 1LVLA 4K2XA 2BS3A 2B9YA 1PN0A 4DNAA 4Z26A 2QA1A 1COYA 2XDOA 1FOHA 4G9KA 2Q7VA 4AP3A 4I58A 3ICSA 4LA1A 3E1TA 4TLZA 3C4AA 2E1MA 3G5SA 2W0HA 3GYXA 4UDPA 1RYIA 4A6NA 1NHQA 2A87A 1YKJA 3QVRA 1ZDLA 3NK1X 4H7UA 5HXIA 3KPKA 3CN8A 3RP8A 1XPQA 1IUSA 1E1KA 4GUVA 3F8PA 3SZFA 2JB2A 4K5SA 4A5LA 3T2KA 4EIPA 1OJDA 2C67A 2C3DA 3CGBA 5KWFA 2R4EA 3UOYA 1JU2A 1P2EA 2JB1A 2YLXA 1ZOYA 4A9WA 1TDNA 3LXDA 4NZHA 2AR8A 3T31A 3C4NA 3F8DA 3GYJA 4H4VA 1Z6LA 4G6GA 1FEBA 1N1PA 1KSSA 1LTXR 3CNTA 3NYEA 1O95A 2ZZCA 3NG7X 4B66A 3JSKA 2BK5A 4FK1C 4H2RA 3LADA 1NHPA 1IUWA 2BK4A 2AAQA 1S3EA 5KRQA 4J34A 3NKSA 1K0LA 1LQUA 3BI4A 1JOAA 4XWRA 3NK0X 2V3BA 4IVOB 2GR0A 2Y6RA 2NVKX 1D4CA 3NYFA 1DXLA 2JAEA 3GMBA 1GALA 4KX6A 3S5WA 1LV0A 4K22A 5IQ1A 3K30A 3UP5A 4AT2A 4DSGA 2WBAA 4PABA 4HB9A 4U8KA 1L9CA 3ABVA 2HQMA 1QLBA 4NWZA 4U8NA 1GEUA 2GR3A 5FS8A 4JQ9A 2X8CA 1KDGA 1CJCA 4Z44A 1GOSA 4A6NB 2FJBA 4GAPA 4P9SA 3SXIA 1HYUA 1Y56A 1F8WA 1H7XA 3C96A 3SGLA 2B7SA 3ISHA 3SYIA 2VOUA 1Q1WA 1NDAA 3NYCA 5KMQA 3F8RA 3QSSA 2YVGA 3UOXA 4EMJA 3DJGX 4BJYA 3R9UA 5KMRA 3LB8A 5C2TA 4C77A 3CMMA 3IHGA 1JNZA 1TDEA 2CDUA 4H4SA 5TR3A 2V3AA 3M0OA 1PDHA 3BI5A 2BC1A 1X31B 4D04A 1B37A 3CGCA 2XFUA 1RP0A 3CPJG 3KPFA 4GRTA 4M52A 2H89A 2OLNA 2WQYA 4YKFA 2WOWA 3SZ0A 5IQ4A 3IWAA 2YLTA 2VZ2A 2XYOA 1GSNA 2PHHA 4CBQA 1GRBA 3WE0A 2XFOA 4I59A 3L8KA 1TYTA 5BRTA 3UOVA 2V5ZA 3AE6A 1ZP0A 2X8HA 3AEBA 4X9MA 4GF7A 3GSIA 4ECHA 2J3NA 1ZK7A 3G5QA 5KOXA 1GRAA 3RP7A 2CFYA 3GRSA 1JNRA 1ZMCA 2JBVA 3AE8A 2WDQA 4K8DA 1M6IA 3AE5A 1ZX9A 2ZZBA 1VRQB 2C66A 2X3NA 1NPXA 3AEFA 4BV6A 2YLRA 4J57A 4J56A 1N4UA 2GF3A 1MO9A 4CNKA 4GCMA 1B8SA 2GV8A 3I6DA 4OPTA 1PBBA 4Y4NA 3UKKA 4B1BA 1KSUA 3GYIA 1TDKA 4RSLA 3V3OA 1Y56B 3CNPA 4OPUA 3AE7A 2YAUA 5L46A 1XDIA 4B64A 4J2WA 4WX1A 2GMJA 1BGJA 1JRYA 1K4QA 3DJJA 2JK6A 2EQ8A 5JCMA 4G74A 2GAHB 2RGOA 4OPGA 2A8XA 1RSGA 2XVIA 3DGHA 4LU6A 5HHFA 4B69A 4GAVA 5M10A 3UKQA 1YQ3A 2GAGB 5EBKA 5LV9A 3CGEA 1EL5A 2YG3A 3M13A 3P4QA 1UKVG 1CJ2A 1D7YA 4H4WA 4TM3A 1PHHA 1ONFA 4B65A 1OJ9A 2XVEA 3NK2X 5DBJA 1DJNA 4EQWA 1GRTA 2YLWA 1MOKA 2QA2A 1VG0A 2AQJA 2VQBA 2WETA 4C3YA 5U63A 3LZWA 5JCNA 1CBOA 1IUUA 2PYXA 3IC9A 4CCRA 2DKHA 4AP1A 2OAMA 4UDQA 3AEAA 1L9DA 4UP3A 2Z5YA 5GSNA 5GRTA 1LQTA 3RP6A 1H81A 2R9ZA 2XLUA 1O5WA 3ICRA 5FS9A 2VQ7A 4ZN0A 3KVEA 2GRTA 1IUVA 3UP4A 1BWCA 2C64A 3CTYA 1EL9A 4DGKA 4H4UA 1EL7A 1D4DA 4RG4A 2IVDA 2XLTA 1K0JA 1GETA 2BC0A 3IF9A 2C73A 4OPLA 5J60A 1FCDA 4Z2RA 2YM2A 3EANA 3DJEA 3H4KA 4Z25A 1IJHA 1N4WA 2GR1A 2WU5A 4APNA 2YWLA 4EMIA 2WDRA 1JRXA 3KKJA 4OPIA 3ALJA 1CJ3A 3UKPA 2RGJA 3ITJA 2BA9A 2TPRA 2V6OA 1DOBA 1GNDA 2EQ9A 5BVAA 4FX9A 3BHKA 4BK1A 2R4JA 1EBDA 2V61A 4II3A 2BABA 3DA1A 5EOWA 3FPZA 1IUXA 1GTHA 1CC4A 3UOZA 4EM3A 3QFAA 1F8SA 4NTEA 2E5VA 1LJ1A 2YR5A 3SZCA 3FBSA 2O9ZA 3ATQA 1NG3A 3K7QX 3OZ2A 3P4RA 5FS6A 2YVFA 3M12A 3BI2A 3P4SA 3T37A 3NLCA 4OPCA 4JN9A 4JY3A 4C3XA 4LIIA 3SQPA 1GREA 1PJ6A 4K7ZA 4TLXA 1ZY8A 2WDVA 3NGCX 1NHRA 4OPDA 1KNRA 4A99A 4YXDA 1N4VA 5KVHA 3ALMA 3NNEA 2YVJA 4NTCA 3FMWA 5ER0A 4EM4A 3B3RA 1QJDA 1CL0A 2VRMA 4PAAA 1DOCA 5KMPA 4BK2A 3VRDB 1GRFA 2IVEA 2XFNA 1F8RA 4U8IA 2R0CA 3AE4A 2GQFA 1OJCA 2EQ7A 1JRZA 2WPEA 3K7TA 3V76A 5KMSA 2Z5XA 5JCLA 2BS4A 4AOSA 2Q0LA 1GTEA 2GR2A 3GDNA 3Q9TA 3SZWA 2BACA 4YKGA 1GV4A 1NEKA 2XVHA 2UZZA 2OLOA 1B4VA 4IVMB 1CJ4A 4HA6A 4Z43A 4EMWA 4YSXA 2WP9A 3AWIA 2Q6UA 5HYMA 5KOWA 3SFEA 4USRA 2YG5A 1YQZA 3LJPA 3BNMA 3AD7B 2CULA 1VDCA 2R45A 1L0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG9 A;  3AEC A;  4EQS A;  4MJW A;  2YG6 A;  3VQR A;  3CGD A;  5C3J A;  4OVI A;  1W4X A;  4A65 A;  1ZMD A;  3KLJ A;  3AE1 A;  1JEH A;  4H50 A;  1E6E A;  2ACZ A;  2WU2 A;  3AYL A;  3GWF A;  3VRA A;  1GXF A;  4YSY A;  2C72 A;  1ELI A;  3GMC A;  1Y0P A;  2FJE A;  4U2L A;  3AED A;  3I3L A;  4REK A;  2WEU A;  4Z2T A;  2YLS A;  3HZL A;  2QAE A;  2XCG A;  3O0H A;  2YR4 A;  4H4P A;  4H4R A;  3VR9 A;  1PJ7 A;  3AEE A;  4B68 A;  1REO A;  2C3C A;  3V3N A;  4IA6 A;  4O5Q A;  1IUT A;  1KFY A;  3P1W A;  4YTM A;  3CND A;  3CNJ A;  3GWD A;  3COX A;  3UTH A;  4TM1 A;  3UCL A;  3PO7 A;  4K5R A;  1DNC A;  3NHO X;  1YY5 A;  3QJ4 A;  1PBF A;  2XLP A;  2C70 A;  1CHU A;  4YT0 A;  1QO8 A;  3ATR A;  4H4T A;  2A89 A;  4GDP A;  3G5R A;  1GRG A;  3UKF A;  4Z24 A;  1AOG A;  2IID A;  2WPC A;  4U8P A;  1PXC A;  2C75 A;  3NT6 A;  4FK1 A;  2GMH A;  3DH9 A;  1DJQ A;  3Q6J A;  4Y4M A;  1GPE A;  3NTA A;  1ZOV A;  3DK4 A;  3P4P A;  4IA5 A;  1ZKQ A;  4H2N A;  3S61 A;  1PXB A;  4ADW A;  1XHC A;  2TMD A;  3B6D A;  4H2P A;  3AB1 A;  4JNA A;  2B9X A;  5EB4 A;  4JDR A;  3KU9 A;  2OA1 A;  3UKH A;  3QVP A;  2C65 A;  4A79 A;  1OJT A;  1TDO A;  5CQF A;  2GVC A;  1PJ5 A;  1K0I A;  2B7R A;  3NN0 X;  1S2Y A;  1S2Q A;  3L1R A;  4H4Q A;  4X9N A;  1GES A;  2B76 A;  1PBD A;  1KF6 A;  2GEW A;  4GDE A;  4U8J A;  1FEA A;  2Q0K A;  4EIQ A;  2XVF A;  3UTG A;  4E0V A;  5BUL A;  1PBC A;  2BCG G;  4CY6 A;  3BHF A;  1O94 A;  2RGH A;  5BUK A;  2WPF A;  1DOD A;  1L9E A;  2V60 A;  4Y4L A;  5FMH A;  4EQR A;  2E4G A;  3II4 A;  3CIR A;  4RG3 A;  4A7A A;  2OAL A;  3DME A;  4U8O A;  4YTN A;  4BJZ A;  2C76 A;  1H82 A;  1D7L A;  2R46 A;  1H86 A;  3EF6 A;  3SFD A;  4B63 A;  3LZX A;  2YQU A;  1MXT A;  2GB0 A;  3AE3 A;  3EPT A;  2XVJ A;  3D1C A;  4X4J A;  4Z2U A;  2BXS A;  1S3B A;  2B9W A;  2YR6 A;  3ZDN A;  4B67 A;  2VRL A;  3UTE A;  1EL8 A;  3KA7 A;  4CRT A;  2H88 A;  1Q9I A;  3AE9 A;  3KD9 A;  3AD9 B;  3AE2 A;  5U25 A;  2F5Z A;  2ARD A;  3CPH G;  1CC2 A;  2ZZ0 A;  3EAO A;  4UDR A;  3CPI G;  1CC6 A;  4WCT A;  2FBW A;  1PS9 A;  2BYB A;  3NH3 X;  4TM4 A;  2Y6Q A;  2VVL A;  4BK3 A;  4D03 A;  3D8X A;  4TM0 A;  2XFQ A;  3AD8 B;  3OC4 A;  3LOV A;  1GRH A;  3QSM A;  4U2T A;  2XLR A;  1M64 A;  2QCU A;  1V59 A;  4J31 A;  1TYP A;  5KVI A;  2JB3 A;  2XLS A;  4BUR A;  4IV9 A;  4N9X A;  5KXJ A;  1CF3 A;  1BGN A;  2WOV A;  1Q1R A;  4GR1 A;  4XWZ A;  1TRB A;  2WP5 A;  4O5U A;  1PXA A;  3URH A;  4FDC B;  4J36 A;  1NAA A;  1H83 A;  2X50 A;  3RED A;  5JCI A;  2YLZ A;  5IPY A;  4DSH A;  2GQW A;  3AXB A;  4NEV A;  5JCK A;  3NTD A;  3FIM B;  2RAB A;  1NEN A;  4JNQ A;  3AYJ A;  1NG4 A;  1E1N A;  4U8L A;  3AEG A;  3AYI A;  2WES A;  1BZL A;  3GD3 A;  2FJD A;  3ICT A;  3GDP A;  3SM8 A;  3QSE A;  4AOX A;  4AT0 A;  4ZCD A;  1F6M A;  5U1O A;  4H4Y A;  3ZYX A;  3NIX A;  1YQ4 A;  1H6V A;  1P2H A;  3DK9 A;  3NN6 X;  4EQX A;  1FL2 A;  1OJA A;  3P9U A;  4YTP A;  2VVL G;  4NTD A;  2EQ6 A;  1H84 A;  5HY5 A;  2XFP A;  1BKW A;  3UKA A;  1XAN A;  4KPR A;  1BF3 A;  2I0Z A;  2BXR A;  4H2Q A;  1NHS A;  4U8M A;  3FG2 P;  3BNU A;  1FEC A;  1E1L A;  3GRT A;  3CNS A;  2YG4 A;  2YM1 A;  3NRN A;  3ADA B;  1E39 A;  2DKI A;  4OCG A;  2NPX A;  5EB5 A;  2WP6 A;  1D5T A;  3PS9 A;  2BCP A;  1TDF A;  2JKC A;  5CKU A;  1LPF A;  4YSZ A;  2R0P A;  2CVJ A;  2WOI A;  3UKL A;  2BK3 A;  4CY8 A;  4YWO A;  3RHA A;  1KNP A;  2YG7 A;  3H8L A;  4JY2 A;  4U2S A;  2APG A;  3K7M X;  2X8G A;  4CNJ A;  4J33 A;  2BS2 A;  3ALL A;  1PBE A;  3VRB A;  3IHM A;  5M0Z A;  4C74 A;  2WS3 A;  3GD4 A;  4C5O A;  4H4Z A;  4NEW A;  5J7X A;  3DJD A;  4ICY A;  1DOE A;  3PVC A;  4XXG A;  3DK8 A;  3UTF A;  1E1M A;  2FJA A;  3QFB A;  2WHD A;  2X99 A;  2ZBW A;  1E7P A;  3DGZ A;  1D4E A;  1SEZ A;  4USQ A;  4ZCC A;  1B5Q A;  2VVM A;  1VQW A;  1GT8 A;  4H4X A;  1F3P A;  2R0G A;  4CCQ A;  5FS7 A;  2C7G A;  3H8I A;  1GER A;  2GH5 A;  3VR8 A;  3RNM A;  1H7W A;  1LVL A;  4K2X A;  2BS3 A;  2B9Y A;  1PN0 A;  4DNA A;  4Z26 A;  2QA1 A;  1COY A;  2XDO A;  1FOH A;  2Q7V A;  4AP3 A;  4I58 A;  3ICS A;  4LA1 A;  3E1T A;  4TLZ A;  3C4A A;  2E1M A;  3G5S A;  2W0H A;  4UDP A;  4A6N A;  1RYI A;  1NHQ A;  2A87 A;  1YKJ A;  3QVR A;  1ZDL A;  3NK1 X;  4H7U A;  5HXI A;  3CN8 A;  3RP8 A;  1XPQ A;  1IUS A;  1E1K A;  4GUV A;  3F8P A;  2JB2 A;  4K5S A;  4A5L A;  4EIP A;  1OJD A;  2C67 A;  2C3D A;  3CGB A;  5KWF A;  2R4E A;  3UOY A;  1JU2 A;  1P2E A;  2JB1 A;  2YLX A;  1ZOY A;  4A9W A;  1TDN A;  3LXD A;  4NZH A;  2AR8 A;  3C4N A;  3F8D A;  3GYJ A;  4H4V A;  1Z6L A;  1FEB A;  1N1P A;  1KSS A;  1LTX R;  3CNT A;  3NYE A;  1O95 A;  2ZZC A;  3NG7 X;  4B66 A;  3JSK A;  2BK5 A;  4FK1 C;  4H2R A;  3LAD A;  1NHP A;  1IUW A;  2BK4 A;  2AAQ A;  1S3E A;  5KRQ A;  4J34 A;  3NKS A;  1K0L A;  1LQU A;  3BI4 A;  1JOA A;  4XWR A;  3NK0 X;  2V3B A;  4IVO B;  2GR0 A;  2Y6R A;  2NVK X;  1D4C A;  3NYF A;  1DXL A;  2JAE A;  3GMB A;  1GAL A;  4KX6 A;  3S5W A;  1LV0 A;  4K22 A;  5IQ1 A;  3K30 A;  3UP5 A;  4AT2 A;  4DSG A;  2WBA A;  4PAB A;  4HB9 A;  4U8K A;  1L9C A;  3ABV A;  2HQM A;  1QLB A;  4U8N A;  5FS8 A;  1GEU A;  2GR3 A;  4YSH A;  4JQ9 A;  2X8C A;  1KDG A;  1CJC A;  4Z44 A;  1GOS A;  4A6N B;  2FJB A;  4P9S A;  1HYU A;  1Y56 A;  1F8W A;  1H7X A;  3C96 A;  3SGL A;  2B7S A;  3ISH A;  2VOU A;  1Q1W A;  1NDA A;  3NYC A;  3F8R A;  3QSS A;  2YVG A;  3UOX A;  4EMJ A;  3DJG X;  4BJY A;  3R9U A;  3LB8 A;  5C2T A;  4C77 A;  3IHG A;  1JNZ A;  1TDE A;  2CDU A;  4H4S A;  5TR3 A;  2V3A A;  3M0O A;  1PDH A;  3BI5 A;  2BC1 A;  1X31 B;  4D04 A;  1B37 A;  3CGC A;  2XFU A;  1RP0 A;  3CPJ G;  3KPF A;  4GRT A;  4M52 A;  2H89 A;  2OLN A;  2WQY A;  4YKF A;  2WOW A;  5IQ4 A;  3IWA A;  2YLT A;  2VZ2 A;  2XYO A;  1GSN A;  2PHH A;  4CBQ A;  1GRB A;  3WE0 A;  2XFO A;  4I59 A;  3L8K A;  1TYT A;  5BRT A;  3UOV A;  2V5Z A;  3AE6 A;  1ZP0 A;  2X8H A;  3AEB A;  4X9M A;  4GF7 A;  3GSI A;  4ECH A;  2J3N A;  1ZK7 A;  3G5Q A;  5KOX A;  1GRA A;  3RP7 A;  2CFY A;  3GRS A;  1JNR A;  1ZMC A;  2JBV A;  3AE8 A;  2WDQ A;  4K8D A;  1M6I A;  3AE5 A;  1ZX9 A;  2ZZB A;  1VRQ B;  2C66 A;  2X3N A;  1NPX A;  3AEF A;  4BV6 A;  2YLR A;  4J57 A;  4J56 A;  1N4U A;  2GF3 A;  1MO9 A;  4CNK A;  4GCM A;  1B8S A;  2GV8 A;  3I6D A;  4OPT A;  1PBB A;  4Y4N A;  3UKK A;  4B1B A;  1KSU A;  3GYI A;  1TDK A;  4RSL A;  3V3O A;  1Y56 B;  3CNP A;  4OPU A;  3AE7 A;  2YAU A;  5L46 A;  1XDI A;  4B64 A;  4J2W A;  4WX1 A;  2GMJ A;  1BGJ A;  1JRY A;  1K4Q A;  3DJJ A;  2JK6 A;  2EQ8 A;  5JCM A;  2GAH B;  2RGO A;  4OPG A;  2A8X A;  1RSG A;  2XVI A;  3DGH A;  4LU6 A;  5HHF A;  4B69 A;  5M10 A;  3UKQ A;  1YQ3 A;  2GAG B;  5EBK A;  5LV9 A;  3CGE A;  1EL5 A;  2YG3 A;  3M13 A;  3P4Q A;  1UKV G;  1CJ2 A;  1D7Y A;  4H4W A;  4TM3 A;  1PHH A;  1ONF A;  4B65 A;  1OJ9 A;  2XVE A;  3NK2 X;  5DBJ A;  1DJN A;  4EQW A;  1GRT A;  2YLW A;  1MOK A;  2QA2 A;  1VG0 A;  2AQJ A;  2VQB A;  2WET A;  4C3Y A;  5U63 A;  3LZW A;  5JCN A;  1CBO A;  1IUU A;  2PYX A;  3IC9 A;  4CCR A;  2DKH A;  4AP1 A;  2OAM A;  4UDQ A;  3AEA A;  1L9D A;  4UP3 A;  2Z5Y A;  5GSN A;  5GRT A;  1LQT A;  3RP6 A;  1H81 A;  2R9Z A;  2XLU A;  1O5W A;  3ICR A;  5FS9 A;  2VQ7 A;  4ZN0 A;  3KVE A;  2GRT A;  1IUV A;  3UP4 A;  1BWC A;  2C64 A;  3CTY A;  1EL9 A;  4DGK A;  4H4U A;  1EL7 A;  1D4D A;  4RG4 A;  2IVD A;  2XLT A;  1K0J A;  1GET A;  2BC0 A;  3IF9 A;  2C73 A;  4OPL A;  5J60 A;  1FCD A;  4Z2R A;  2YM2 A;  3EAN A;  3DJE A;  3H4K A;  4Z25 A;  1IJH A;  1N4W A;  2GR1 A;  2WU5 A;  4APN A;  2YWL A;  4EMI A;  2WDR A;  1JRX A;  3KKJ A;  4OPI A;  3ALJ A;  1CJ3 A;  3UKP A;  2RGJ A;  3ITJ A;  2BA9 A;  2TPR A;  2V6O A;  1DOB A;  1GND A;  2EQ9 A;  5BVA A;  4FX9 A;  3BHK A;  4BK1 A;  2R4J A;  1EBD A;  2V61 A;  2BAB A;  3DA1 A;  5EOW A;  3FPZ A;  1IUX A;  1GTH A;  1CC4 A;  3UOZ A;  4EM3 A;  3QFA A;  1F8S A;  4NTE A;  2E5V A;  1LJ1 A;  2YR5 A;  3FBS A;  2O9Z A;  3ATQ A;  1NG3 A;  3K7Q X;  3OZ2 A;  3P4R A;  5FS6 A;  2YVF A;  3M12 A;  3BI2 A;  3P4S A;  3T37 A;  3NLC A;  4OPC A;  4JN9 A;  4JY3 A;  4C3X A;  4LII A;  3SQP A;  1GRE A;  1PJ6 A;  4K7Z A;  4TLX A;  1ZY8 A;  2WDV A;  3NGC X;  1NHR A;  4OPD A;  1KNR A;  4A99 A;  4YXD A;  1N4V A;  5KVH A;  3ALM A;  3NNE A;  2YVJ A;  4NTC A;  3FMW A;  5ER0 A;  4EM4 A;  3B3R A;  1QJD A;  1CL0 A;  2VRM A;  4PAA A;  1DOC A;  4BK2 A;  3VRD B;  1GRF A;  2IVE A;  2XFN A;  1F8R A;  4U8I A;  2R0C A;  3AE4 A;  2GQF A;  1OJC A;  2EQ7 A;  1JRZ A;  2WPE A;  3K7T A;  3V76 A;  2Z5X A;  5JCL A;  2BS4 A;  4AOS A;  2Q0L A;  1GTE A;  2GR2 A;  3GDN A;  3Q9T A;  2BAC A;  4YKG A;  1GV4 A;  1NEK A;  2XVH A;  2UZZ A;  2OLO A;  1B4V A;  4IVM B;  1CJ4 A;  4HA6 A;  4Z43 A;  4EMW A;  4YSX A;  2WP9 A;  3AWI A;  2Q6U A;  5HYM A;  5KOW A;  3SFE A;  4USR A;  2YG5 A;  1YQZ A;  3LJP A;  3BNM A;  3AD7 B;  2CUL A;  1VDC A;  2R45 A;  1L0V A; 
#chains in the Genus database with same CATH topology
 1VG9 A;  3AEC A;  3T2Z A;  4EQS A;  4MJW A;  2YG6 A;  3VQR A;  3CGD A;  5C3J A;  4OVI A;  1W4X A;  4A65 A;  1ZMD A;  3KLJ A;  3AE1 A;  1JEH A;  4H50 A;  1E6E A;  2ACZ A;  2WU2 A;  3AYL A;  3GWF A;  3VRA A;  1GXF A;  4YSY A;  2C72 A;  1ELI A;  2BRY A;  1Y0P A;  2FJE A;  3GMC A;  4U2L A;  3AED A;  3I3L A;  4REK A;  2WEU A;  4Z2T A;  2YLS A;  3HZL A;  2QAE A;  2XCG A;  3O0H A;  2YR4 A;  4H4P A;  4H4R A;  3VR9 A;  1PJ7 A;  3AEE A;  4B68 A;  1REO A;  2C3C A;  3V3N A;  4IA6 A;  4O5Q A;  1IUT A;  1KFY A;  3P1W A;  4YTM A;  3CND A;  3CNJ A;  3GWD A;  3COX A;  3UTH A;  4TM1 A;  3UCL A;  3HYX A;  3PO7 A;  4K5R A;  1DNC A;  3NHO X;  1YY5 A;  3QJ4 A;  1PBF A;  2XLP A;  2C70 A;  1CHU A;  4YT0 A;  1QO8 A;  3ATR A;  4H4T A;  2A89 A;  4GDP A;  3G5R A;  1GRG A;  3UKF A;  4Z24 A;  1AOG A;  2IID A;  2WPC A;  4U8P A;  1PXC A;  2C75 A;  3NT6 A;  4FK1 A;  2GMH A;  3DH9 A;  1DJQ A;  3Q6J A;  4Y4M A;  1GPE A;  3NTA A;  1ZOV A;  3DK4 A;  3P4P A;  4IA5 A;  1ZKQ A;  4H2N A;  3S61 A;  1PXB A;  4ADW A;  1XHC A;  2TMD A;  3B6D A;  4H2P A;  3AB1 A;  4JNA A;  2B9X A;  5EB4 A;  4JDR A;  3KU9 A;  2OA1 A;  3UKH A;  3QVP A;  2C65 A;  4A79 A;  1OJT A;  1TDO A;  4G73 A;  2GVC A;  1PJ5 A;  1K0I A;  2B7R A;  4II2 A;  5CQF A;  3NN0 X;  1S2Y A;  1S2Q A;  3L1R A;  4H4Q A;  4X9N A;  1GES A;  2B76 A;  1PBD A;  1KF6 A;  2GEW A;  4GDE A;  4U8J A;  1FEA A;  2Q0K A;  4EIQ A;  2XVF A;  3UTG A;  4E0V A;  5BUL A;  1PBC A;  2BCG G;  4CY6 A;  3BHF A;  1O94 A;  2RGH A;  5BUK A;  2WPF A;  1DOD A;  1L9E A;  2V60 A;  4Y4L A;  5FMH A;  4EQR A;  2E4G A;  3II4 A;  3CIR A;  4RG3 A;  4A7A A;  2OAL A;  3DME A;  4U8O A;  4YTN A;  4BJZ A;  2C76 A;  1H82 A;  5KNL A;  1D7L A;  2R46 A;  1H86 A;  3EF6 A;  3SFD A;  4B63 A;  3LZX A;  2YQU A;  1MXT A;  2GB0 A;  3AE3 A;  3EPT A;  2XVJ A;  3D1C A;  4X4J A;  4Z2U A;  2BXS A;  1S3B A;  2B9W A;  2YR6 A;  3T0K A;  3ZDN A;  4B67 A;  2VRL A;  3UTE A;  1EL8 A;  3KA7 A;  4CRT A;  2H88 A;  1Q9I A;  3AE9 A;  3KD9 A;  3AD9 B;  3AE2 A;  5U25 A;  2F5Z A;  2ARD A;  3CPH G;  3SX6 A;  1CC2 A;  2ZZ0 A;  3EAO A;  4UDR A;  3CPI G;  1CC6 A;  4WCT A;  2FBW A;  1PS9 A;  2BYB A;  3NH3 X;  4TM4 A;  2Y6Q A;  2VVL A;  4BK3 A;  4D03 A;  3D8X A;  4TM0 A;  2XFQ A;  3AD8 B;  3OC4 A;  3LOV A;  1GRH A;  3QSM A;  4U2T A;  2XLR A;  1M64 A;  2QCU A;  1V59 A;  4J31 A;  1TYP A;  5KVI A;  2JB3 A;  2XLS A;  4BUR A;  4IV9 A;  4N9X A;  5KXJ A;  1CF3 A;  1BGN A;  2WOV A;  1Q1R A;  4GR1 A;  4XWZ A;  1TRB A;  2WP5 A;  4O5U A;  2BRA A;  1PXA A;  3URH A;  4FDC B;  4J36 A;  1NAA A;  1H83 A;  2X50 A;  3RED A;  5JCI A;  2YLZ A;  5IPY A;  4YSH A;  4DSH A;  3T14 A;  2GQW A;  3AXB A;  4NEV A;  5JCK A;  3NTD A;  3FIM B;  2RAB A;  1NEN A;  2C4C A;  4JNQ A;  3AYJ A;  1NG4 A;  1E1N A;  4U8L A;  3AEG A;  3AYI A;  2WES A;  1BZL A;  3GD3 A;  2FJD A;  3ICT A;  3GDP A;  3SM8 A;  3QSE A;  4AOX A;  4AT0 A;  4ZCD A;  1F6M A;  5U1O A;  4H4Y A;  3ZYX A;  3NIX A;  1YQ4 A;  3HYV A;  1H6V A;  1P2H A;  3DK9 A;  3NN6 X;  4EQX A;  1FL2 A;  1OJA A;  3P9U A;  4YTP A;  2VVL G;  4NTD A;  2EQ6 A;  1H84 A;  5HY5 A;  2XFP A;  1BKW A;  3UKA A;  1XAN A;  4KPR A;  1BF3 A;  2I0Z A;  2BXR A;  4H2Q A;  1NHS A;  4U8M A;  3FG2 P;  3BNU A;  1FEC A;  1E1L A;  3GRT A;  3CNS A;  2YG4 A;  2YM1 A;  3NRN A;  3ADA B;  1E39 A;  2DKI A;  4OCG A;  2NPX A;  5EB5 A;  2WP6 A;  1D5T A;  4G6H A;  3PS9 A;  2BCP A;  1TDF A;  2JKC A;  5CKU A;  1LPF A;  4YSZ A;  2R0P A;  2CVJ A;  2WOI A;  3UKL A;  2BK3 A;  4CY8 A;  4YWO A;  3RHA A;  1KNP A;  2YG7 A;  3H8L A;  4JY2 A;  4U2S A;  2APG A;  3K7M X;  2X8G A;  4CNJ A;  4J33 A;  3T2Y A;  2BS2 A;  3ALL A;  1PBE A;  3VRB A;  3IHM A;  5M0Z A;  4C74 A;  2WS3 A;  3GD4 A;  4C5O A;  4H4Z A;  4NEW A;  5J7X A;  3HYW A;  3DJD A;  4ICY A;  1DOE A;  3PVC A;  4XXG A;  3DK8 A;  3UTF A;  1E1M A;  2FJA A;  3QFB A;  2WHD A;  2X99 A;  2ZBW A;  1E7P A;  3DGZ A;  1D4E A;  1SEZ A;  4USQ A;  4ZCC A;  1B5Q A;  2VVM A;  1VQW A;  1GT8 A;  4H4X A;  1F3P A;  3SY4 A;  2R0G A;  4NNJ A;  5FS7 A;  4CCQ A;  2C7G A;  3H8I A;  1GER A;  2GH5 A;  3VR8 A;  3RNM A;  1H7W A;  1LVL A;  4K2X A;  2BS3 A;  2B9Y A;  1PN0 A;  4DNA A;  4Z26 A;  2QA1 A;  1COY A;  2XDO A;  1FOH A;  4G9K A;  2Q7V A;  4AP3 A;  4I58 A;  3ICS A;  4LA1 A;  3E1T A;  4TLZ A;  3C4A A;  2E1M A;  3G5S A;  2W0H A;  3GYX A;  4UDP A;  1RYI A;  4A6N A;  1NHQ A;  2A87 A;  1YKJ A;  3QVR A;  1ZDL A;  3NK1 X;  4H7U A;  5HXI A;  3KPK A;  3CN8 A;  3RP8 A;  1XPQ A;  1IUS A;  1E1K A;  4GUV A;  3F8P A;  3SZF A;  2JB2 A;  4K5S A;  4A5L A;  3T2K A;  4EIP A;  1OJD A;  2C67 A;  2C3D A;  3CGB A;  5KWF A;  2R4E A;  3UOY A;  1JU2 A;  1P2E A;  2JB1 A;  2YLX A;  1ZOY A;  4A9W A;  1TDN A;  3LXD A;  4NZH A;  2AR8 A;  3T31 A;  3C4N A;  3F8D A;  3GYJ A;  4H4V A;  1Z6L A;  4G6G A;  1FEB A;  1N1P A;  1KSS A;  1LTX R;  3CNT A;  3NYE A;  1O95 A;  2ZZC A;  3NG7 X;  4B66 A;  3JSK A;  2BK5 A;  4FK1 C;  4H2R A;  3LAD A;  1NHP A;  1IUW A;  2BK4 A;  2AAQ A;  1S3E A;  5KRQ A;  4J34 A;  3NKS A;  1K0L A;  1LQU A;  3BI4 A;  1JOA A;  4XWR A;  3NK0 X;  2V3B A;  4IVO B;  2GR0 A;  2Y6R A;  2NVK X;  1D4C A;  3NYF A;  1DXL A;  2JAE A;  3GMB A;  1GAL A;  4KX6 A;  3S5W A;  1LV0 A;  4K22 A;  5IQ1 A;  3K30 A;  3UP5 A;  4AT2 A;  4DSG A;  2WBA A;  4PAB A;  4HB9 A;  4U8K A;  1L9C A;  3ABV A;  2HQM A;  1QLB A;  4NWZ A;  4U8N A;  1GEU A;  2GR3 A;  5FS8 A;  4JQ9 A;  2X8C A;  1KDG A;  1CJC A;  4Z44 A;  1GOS A;  4A6N B;  2FJB A;  4GAP A;  4P9S A;  3SXI A;  1HYU A;  1Y56 A;  1F8W A;  1H7X A;  3C96 A;  3SGL A;  2B7S A;  3ISH A;  3SYI A;  2VOU A;  1Q1W A;  1NDA A;  3NYC A;  5KMQ A;  3F8R A;  3QSS A;  2YVG A;  3UOX A;  4EMJ A;  3DJG X;  4BJY A;  3R9U A;  5KMR A;  3LB8 A;  5C2T A;  4C77 A;  3CMM A;  3IHG A;  1JNZ A;  1TDE A;  2CDU A;  4H4S A;  5TR3 A;  2V3A A;  3M0O A;  1PDH A;  3BI5 A;  2BC1 A;  1X31 B;  4D04 A;  1B37 A;  3CGC A;  2XFU A;  1RP0 A;  3CPJ G;  3KPF A;  4GRT A;  4M52 A;  2H89 A;  2OLN A;  2WQY A;  4YKF A;  2WOW A;  3SZ0 A;  5IQ4 A;  3IWA A;  2YLT A;  2VZ2 A;  2XYO A;  1GSN A;  2PHH A;  4CBQ A;  1GRB A;  3WE0 A;  2XFO A;  4I59 A;  3L8K A;  1TYT A;  5BRT A;  3UOV A;  2V5Z A;  3AE6 A;  1ZP0 A;  2X8H A;  3AEB A;  4X9M A;  4GF7 A;  3GSI A;  4ECH A;  2J3N A;  1ZK7 A;  3G5Q A;  5KOX A;  1GRA A;  3RP7 A;  2CFY A;  3GRS A;  1JNR A;  1ZMC A;  2JBV A;  3AE8 A;  2WDQ A;  4K8D A;  1M6I A;  3AE5 A;  1ZX9 A;  2ZZB A;  1VRQ B;  2C66 A;  2X3N A;  1NPX A;  3AEF A;  4BV6 A;  2YLR A;  4J57 A;  4J56 A;  1N4U A;  2GF3 A;  1MO9 A;  4CNK A;  4GCM A;  1B8S A;  2GV8 A;  3I6D A;  4OPT A;  1PBB A;  4Y4N A;  3UKK A;  4B1B A;  1KSU A;  3GYI A;  1TDK A;  4RSL A;  3V3O A;  1Y56 B;  3CNP A;  4OPU A;  3AE7 A;  2YAU A;  5L46 A;  1XDI A;  4B64 A;  4J2W A;  4WX1 A;  2GMJ A;  1BGJ A;  1JRY A;  1K4Q A;  3DJJ A;  2JK6 A;  2EQ8 A;  5JCM A;  4G74 A;  2GAH B;  2RGO A;  4OPG A;  2A8X A;  1RSG A;  2XVI A;  3DGH A;  4LU6 A;  5HHF A;  4B69 A;  4GAV A;  5M10 A;  3UKQ A;  1YQ3 A;  2GAG B;  5EBK A;  5LV9 A;  3CGE A;  1EL5 A;  2YG3 A;  3M13 A;  3P4Q A;  1UKV G;  1CJ2 A;  1D7Y A;  4H4W A;  4TM3 A;  1PHH A;  1ONF A;  4B65 A;  1OJ9 A;  2XVE A;  3NK2 X;  5DBJ A;  1DJN A;  4EQW A;  1GRT A;  2YLW A;  1MOK A;  2QA2 A;  1VG0 A;  2AQJ A;  2VQB A;  2WET A;  4C3Y A;  5U63 A;  3LZW A;  5JCN A;  1CBO A;  1IUU A;  2PYX A;  3IC9 A;  4CCR A;  2DKH A;  4AP1 A;  2OAM A;  4UDQ A;  3AEA A;  1L9D A;  4UP3 A;  2Z5Y A;  5GSN A;  5GRT A;  1LQT A;  3RP6 A;  1H81 A;  2R9Z A;  2XLU A;  1O5W A;  3ICR A;  5FS9 A;  2VQ7 A;  4ZN0 A;  3KVE A;  2GRT A;  1IUV A;  3UP4 A;  1BWC A;  2C64 A;  3CTY A;  1EL9 A;  4DGK A;  4H4U A;  1EL7 A;  1D4D A;  4RG4 A;  2IVD A;  2XLT A;  1K0J A;  1GET A;  2BC0 A;  3IF9 A;  2C73 A;  4OPL A;  5J60 A;  1FCD A;  4Z2R A;  2YM2 A;  3EAN A;  3DJE A;  3H4K A;  4Z25 A;  1IJH A;  1N4W A;  2GR1 A;  2WU5 A;  4APN A;  2YWL A;  4EMI A;  2WDR A;  1JRX A;  3KKJ A;  4OPI A;  3ALJ A;  1CJ3 A;  3UKP A;  2RGJ A;  3ITJ A;  2BA9 A;  2TPR A;  2V6O A;  1DOB A;  1GND A;  2EQ9 A;  5BVA A;  4FX9 A;  3BHK A;  4BK1 A;  2R4J A;  1EBD A;  2V61 A;  4II3 A;  2BAB A;  3DA1 A;  5EOW A;  3FPZ A;  1IUX A;  1GTH A;  1CC4 A;  3UOZ A;  4EM3 A;  3QFA A;  1F8S A;  4NTE A;  2E5V A;  1LJ1 A;  2YR5 A;  3SZC A;  3FBS A;  2O9Z A;  3ATQ A;  1NG3 A;  3K7Q X;  3OZ2 A;  3P4R A;  5FS6 A;  2YVF A;  3M12 A;  3BI2 A;  3P4S A;  3T37 A;  3NLC A;  4OPC A;  4JN9 A;  4JY3 A;  4C3X A;  4LII A;  3SQP A;  1GRE A;  1PJ6 A;  4K7Z A;  4TLX A;  1ZY8 A;  2WDV A;  3NGC X;  1NHR A;  4OPD A;  1KNR A;  4A99 A;  4YXD A;  1N4V A;  5KVH A;  3ALM A;  3NNE A;  2YVJ A;  4NTC A;  3FMW A;  5ER0 A;  4EM4 A;  3B3R A;  1QJD A;  1CL0 A;  2VRM A;  4PAA A;  1DOC A;  5KMP A;  4BK2 A;  3VRD B;  1GRF A;  2IVE A;  2XFN A;  1F8R A;  4U8I A;  2R0C A;  3AE4 A;  2GQF A;  1OJC A;  2EQ7 A;  1JRZ A;  2WPE A;  3K7T A;  3V76 A;  5KMS A;  2Z5X A;  5JCL A;  2BS4 A;  4AOS A;  2Q0L A;  1GTE A;  2GR2 A;  3GDN A;  3Q9T A;  3SZW A;  2BAC A;  4YKG A;  1GV4 A;  1NEK A;  2XVH A;  2UZZ A;  2OLO A;  1B4V A;  4IVM B;  1CJ4 A;  4HA6 A;  4Z43 A;  4EMW A;  4YSX A;  2WP9 A;  3AWI A;  2Q6U A;  5HYM A;  5KOW A;  3SFE A;  4USR A;  2YG5 A;  1YQZ A;  3LJP A;  3BNM A;  3AD7 B;  2CUL A;  1VDC A;  2R45 A;  1L0V A; 
#chains in the Genus database with same CATH homology
 1VG9 A;  3AEC A;  3T2Z A;  4EQS A;  4MJW A;  2YG6 A;  3VQR A;  3CGD A;  5C3J A;  4OVI A;  1W4X A;  4A65 A;  1ZMD A;  3KLJ A;  3AE1 A;  1JEH A;  4H50 A;  1E6E A;  2ACZ A;  2WU2 A;  3AYL A;  3GWF A;  3VRA A;  1GXF A;  4YSY A;  2C72 A;  1ELI A;  2BRY A;  1Y0P A;  2FJE A;  3GMC A;  4U2L A;  3AED A;  3I3L A;  4REK A;  2WEU A;  4Z2T A;  2YLS A;  3HZL A;  2QAE A;  2XCG A;  3O0H A;  2YR4 A;  4H4P A;  4H4R A;  3VR9 A;  1PJ7 A;  3AEE A;  4B68 A;  1REO A;  2C3C A;  3V3N A;  4IA6 A;  4O5Q A;  1IUT A;  1KFY A;  3P1W A;  4YTM A;  3CND A;  3CNJ A;  3GWD A;  3COX A;  3UTH A;  4TM1 A;  3UCL A;  3HYX A;  3PO7 A;  4K5R A;  1DNC A;  3NHO X;  1YY5 A;  3QJ4 A;  1PBF A;  2XLP A;  2C70 A;  1CHU A;  4YT0 A;  1QO8 A;  3ATR A;  4H4T A;  2A89 A;  4GDP A;  3G5R A;  1GRG A;  3UKF A;  4Z24 A;  1AOG A;  2IID A;  2WPC A;  4U8P A;  1PXC A;  2C75 A;  3NT6 A;  4FK1 A;  2GMH A;  3DH9 A;  1DJQ A;  3Q6J A;  4Y4M A;  1GPE A;  3NTA A;  1ZOV A;  3DK4 A;  3P4P A;  4IA5 A;  1ZKQ A;  4H2N A;  3S61 A;  1PXB A;  4ADW A;  1XHC A;  2TMD A;  3B6D A;  4H2P A;  3AB1 A;  4JNA A;  2B9X A;  5EB4 A;  4JDR A;  3KU9 A;  2OA1 A;  3UKH A;  3QVP A;  2C65 A;  4A79 A;  1OJT A;  1TDO A;  4G73 A;  2GVC A;  1PJ5 A;  1K0I A;  2B7R A;  4II2 A;  5CQF A;  3NN0 X;  1S2Y A;  1S2Q A;  3L1R A;  4H4Q A;  4X9N A;  1GES A;  2B76 A;  1PBD A;  1KF6 A;  2GEW A;  4GDE A;  4U8J A;  1FEA A;  2Q0K A;  4EIQ A;  2XVF A;  3UTG A;  4E0V A;  5BUL A;  1PBC A;  2BCG G;  4CY6 A;  3BHF A;  1O94 A;  2RGH A;  5BUK A;  2WPF A;  1DOD A;  1L9E A;  2V60 A;  4Y4L A;  5FMH A;  4EQR A;  2E4G A;  3II4 A;  3CIR A;  4RG3 A;  4A7A A;  2OAL A;  3DME A;  4U8O A;  4YTN A;  4BJZ A;  2C76 A;  1H82 A;  5KNL A;  1D7L A;  2R46 A;  1H86 A;  3EF6 A;  3SFD A;  4B63 A;  3LZX A;  2YQU A;  1MXT A;  2GB0 A;  3AE3 A;  3EPT A;  2XVJ A;  3D1C A;  4X4J A;  4Z2U A;  2BXS A;  1S3B A;  2B9W A;  2YR6 A;  3T0K A;  3ZDN A;  4B67 A;  2VRL A;  3UTE A;  1EL8 A;  3KA7 A;  4CRT A;  2H88 A;  1Q9I A;  3AE9 A;  3KD9 A;  3AD9 B;  3AE2 A;  5U25 A;  2F5Z A;  2ARD A;  3CPH G;  3SX6 A;  1CC2 A;  2ZZ0 A;  3EAO A;  4UDR A;  3CPI G;  1CC6 A;  4WCT A;  2FBW A;  1PS9 A;  2BYB A;  3NH3 X;  4TM4 A;  2Y6Q A;  2VVL A;  4BK3 A;  4D03 A;  3D8X A;  4TM0 A;  2XFQ A;  3AD8 B;  3OC4 A;  3LOV A;  1GRH A;  3QSM A;  4U2T A;  2XLR A;  1M64 A;  2QCU A;  1V59 A;  4J31 A;  1TYP A;  5KVI A;  2JB3 A;  2XLS A;  4BUR A;  4IV9 A;  4N9X A;  5KXJ A;  1CF3 A;  1BGN A;  2WOV A;  1Q1R A;  4GR1 A;  4XWZ A;  1TRB A;  2WP5 A;  4O5U A;  2BRA A;  1PXA A;  3URH A;  4FDC B;  4J36 A;  1NAA A;  1H83 A;  2X50 A;  3RED A;  5JCI A;  2YLZ A;  5IPY A;  4YSH A;  4DSH A;  3T14 A;  2GQW A;  3AXB A;  4NEV A;  5JCK A;  3NTD A;  3FIM B;  2RAB A;  1NEN A;  2C4C A;  4JNQ A;  3AYJ A;  1NG4 A;  1E1N A;  4U8L A;  3AEG A;  3AYI A;  2WES A;  1BZL A;  3GD3 A;  2FJD A;  3ICT A;  3GDP A;  3SM8 A;  3QSE A;  4AOX A;  4AT0 A;  4ZCD A;  1F6M A;  5U1O A;  4H4Y A;  3ZYX A;  3NIX A;  1YQ4 A;  3HYV A;  1H6V A;  1P2H A;  3DK9 A;  3NN6 X;  4EQX A;  1FL2 A;  1OJA A;  3P9U A;  4YTP A;  2VVL G;  4NTD A;  2EQ6 A;  1H84 A;  5HY5 A;  2XFP A;  1BKW A;  3UKA A;  1XAN A;  4KPR A;  1BF3 A;  2I0Z A;  2BXR A;  4H2Q A;  1NHS A;  4U8M A;  3FG2 P;  3BNU A;  1FEC A;  1E1L A;  3GRT A;  3CNS A;  2YG4 A;  2YM1 A;  3NRN A;  3ADA B;  1E39 A;  2DKI A;  4OCG A;  2NPX A;  5EB5 A;  2WP6 A;  1D5T A;  4G6H A;  3PS9 A;  2BCP A;  1TDF A;  2JKC A;  5CKU A;  1LPF A;  4YSZ A;  2R0P A;  2CVJ A;  2WOI A;  3UKL A;  2BK3 A;  4CY8 A;  4YWO A;  3RHA A;  1KNP A;  2YG7 A;  3H8L A;  4JY2 A;  4U2S A;  2APG A;  3K7M X;  2X8G A;  4CNJ A;  4J33 A;  3T2Y A;  2BS2 A;  3ALL A;  1PBE A;  3VRB A;  3IHM A;  5M0Z A;  4C74 A;  2WS3 A;  3GD4 A;  4C5O A;  4H4Z A;  4NEW A;  5J7X A;  3HYW A;  3DJD A;  4ICY A;  1DOE A;  3PVC A;  4XXG A;  3DK8 A;  3UTF A;  1E1M A;  2FJA A;  3QFB A;  2WHD A;  2X99 A;  2ZBW A;  1E7P A;  3DGZ A;  1D4E A;  1SEZ A;  4USQ A;  4ZCC A;  1B5Q A;  2VVM A;  1VQW A;  1GT8 A;  4H4X A;  1F3P A;  3SY4 A;  2R0G A;  4NNJ A;  5FS7 A;  4CCQ A;  2C7G A;  3H8I A;  1GER A;  2GH5 A;  3VR8 A;  3RNM A;  1H7W A;  1LVL A;  4K2X A;  2BS3 A;  2B9Y A;  1PN0 A;  4DNA A;  4Z26 A;  2QA1 A;  1COY A;  2XDO A;  1FOH A;  4G9K A;  2Q7V A;  4AP3 A;  4I58 A;  3ICS A;  4LA1 A;  3E1T A;  4TLZ A;  3C4A A;  2E1M A;  3G5S A;  2W0H A;  3GYX A;  4UDP A;  1RYI A;  4A6N A;  1NHQ A;  2A87 A;  1YKJ A;  3QVR A;  1ZDL A;  3NK1 X;  4H7U A;  5HXI A;  3KPK A;  3CN8 A;  3RP8 A;  1XPQ A;  1IUS A;  1E1K A;  4GUV A;  3F8P A;  3SZF A;  2JB2 A;  4K5S A;  4A5L A;  3T2K A;  4EIP A;  1OJD A;  2C67 A;  2C3D A;  3CGB A;  5KWF A;  2R4E A;  3UOY A;  1JU2 A;  1P2E A;  2JB1 A;  2YLX A;  1ZOY A;  4A9W A;  1TDN A;  3LXD A;  4NZH A;  2AR8 A;  3T31 A;  3C4N A;  3F8D A;  3GYJ A;  4H4V A;  1Z6L A;  4G6G A;  1FEB A;  1N1P A;  1KSS A;  1LTX R;  3CNT A;  3NYE A;  1O95 A;  2ZZC A;  3NG7 X;  4B66 A;  3JSK A;  2BK5 A;  4FK1 C;  4H2R A;  3LAD A;  1NHP A;  1IUW A;  2BK4 A;  2AAQ A;  1S3E A;  5KRQ A;  4J34 A;  3NKS A;  1K0L A;  1LQU A;  3BI4 A;  1JOA A;  4XWR A;  3NK0 X;  2V3B A;  4IVO B;  2GR0 A;  2Y6R A;  2NVK X;  1D4C A;  3NYF A;  1DXL A;  2JAE A;  3GMB A;  1GAL A;  4KX6 A;  3S5W A;  1LV0 A;  4K22 A;  5IQ1 A;  3K30 A;  3UP5 A;  4AT2 A;  4DSG A;  2WBA A;  4PAB A;  4HB9 A;  4U8K A;  1L9C A;  3ABV A;  2HQM A;  1QLB A;  4NWZ A;  4U8N A;  1GEU A;  2GR3 A;  5FS8 A;  4JQ9 A;  2X8C A;  1KDG A;  1CJC A;  4Z44 A;  1GOS A;  4A6N B;  2FJB A;  4GAP A;  4P9S A;  3SXI A;  1HYU A;  1Y56 A;  1F8W A;  1H7X A;  3C96 A;  3SGL A;  2B7S A;  3ISH A;  3SYI A;  2VOU A;  1Q1W A;  1NDA A;  3NYC A;  5KMQ A;  3F8R A;  3QSS A;  2YVG A;  3UOX A;  4EMJ A;  3DJG X;  4BJY A;  3R9U A;  5KMR A;  3LB8 A;  5C2T A;  4C77 A;  3CMM A;  3IHG A;  1JNZ A;  1TDE A;  2CDU A;  4H4S A;  5TR3 A;  2V3A A;  3M0O A;  1PDH A;  3BI5 A;  2BC1 A;  1X31 B;  4D04 A;  1B37 A;  3CGC A;  2XFU A;  1RP0 A;  3CPJ G;  3KPF A;  4GRT A;  4M52 A;  2H89 A;  2OLN A;  2WQY A;  4YKF A;  2WOW A;  3SZ0 A;  5IQ4 A;  3IWA A;  2YLT A;  2VZ2 A;  2XYO A;  1GSN A;  2PHH A;  4CBQ A;  1GRB A;  3WE0 A;  2XFO A;  4I59 A;  3L8K A;  1TYT A;  5BRT A;  3UOV A;  2V5Z A;  3AE6 A;  1ZP0 A;  2X8H A;  3AEB A;  4X9M A;  4GF7 A;  3GSI A;  4ECH A;  2J3N A;  1ZK7 A;  3G5Q A;  5KOX A;  1GRA A;  3RP7 A;  2CFY A;  3GRS A;  1JNR A;  1ZMC A;  2JBV A;  3AE8 A;  2WDQ A;  4K8D A;  1M6I A;  3AE5 A;  1ZX9 A;  2ZZB A;  1VRQ B;  2C66 A;  2X3N A;  1NPX A;  3AEF A;  4BV6 A;  2YLR A;  4J57 A;  4J56 A;  1N4U A;  2GF3 A;  1MO9 A;  4CNK A;  4GCM A;  1B8S A;  2GV8 A;  3I6D A;  4OPT A;  1PBB A;  4Y4N A;  3UKK A;  4B1B A;  1KSU A;  3GYI A;  1TDK A;  4RSL A;  3V3O A;  1Y56 B;  3CNP A;  4OPU A;  3AE7 A;  2YAU A;  5L46 A;  1XDI A;  4B64 A;  4J2W A;  4WX1 A;  2GMJ A;  1BGJ A;  1JRY A;  1K4Q A;  3DJJ A;  2JK6 A;  2EQ8 A;  5JCM A;  4G74 A;  2GAH B;  2RGO A;  4OPG A;  2A8X A;  1RSG A;  2XVI A;  3DGH A;  4LU6 A;  5HHF A;  4B69 A;  4GAV A;  5M10 A;  3UKQ A;  1YQ3 A;  2GAG B;  5EBK A;  5LV9 A;  3CGE A;  1EL5 A;  2YG3 A;  3M13 A;  3P4Q A;  1UKV G;  1CJ2 A;  1D7Y A;  4H4W A;  4TM3 A;  1PHH A;  1ONF A;  4B65 A;  1OJ9 A;  2XVE A;  3NK2 X;  5DBJ A;  1DJN A;  4EQW A;  1GRT A;  2YLW A;  1MOK A;  2QA2 A;  1VG0 A;  2AQJ A;  2VQB A;  2WET A;  4C3Y A;  5U63 A;  3LZW A;  5JCN A;  1CBO A;  1IUU A;  2PYX A;  3IC9 A;  4CCR A;  2DKH A;  4AP1 A;  2OAM A;  4UDQ A;  3AEA A;  1L9D A;  4UP3 A;  2Z5Y A;  5GSN A;  5GRT A;  1LQT A;  3RP6 A;  1H81 A;  2R9Z A;  2XLU A;  1O5W A;  3ICR A;  5FS9 A;  2VQ7 A;  4ZN0 A;  3KVE A;  2GRT A;  1IUV A;  3UP4 A;  1BWC A;  2C64 A;  3CTY A;  1EL9 A;  4DGK A;  4H4U A;  1EL7 A;  1D4D A;  4RG4 A;  2IVD A;  2XLT A;  1K0J A;  1GET A;  2BC0 A;  3IF9 A;  2C73 A;  4OPL A;  5J60 A;  1FCD A;  4Z2R A;  2YM2 A;  3EAN A;  3DJE A;  3H4K A;  4Z25 A;  1IJH A;  1N4W A;  2GR1 A;  2WU5 A;  4APN A;  2YWL A;  4EMI A;  2WDR A;  1JRX A;  3KKJ A;  4OPI A;  3ALJ A;  1CJ3 A;  3UKP A;  2RGJ A;  3ITJ A;  2BA9 A;  2TPR A;  2V6O A;  1DOB A;  1GND A;  2EQ9 A;  5BVA A;  4FX9 A;  3BHK A;  4BK1 A;  2R4J A;  1EBD A;  2V61 A;  4II3 A;  2BAB A;  3DA1 A;  5EOW A;  3FPZ A;  1IUX A;  1GTH A;  1CC4 A;  3UOZ A;  4EM3 A;  3QFA A;  1F8S A;  4NTE A;  2E5V A;  1LJ1 A;  2YR5 A;  3SZC A;  3FBS A;  2O9Z A;  3ATQ A;  1NG3 A;  3K7Q X;  3OZ2 A;  3P4R A;  5FS6 A;  2YVF A;  3M12 A;  3BI2 A;  3P4S A;  3T37 A;  3NLC A;  4OPC A;  4JN9 A;  4JY3 A;  4C3X A;  4LII A;  3SQP A;  1GRE A;  1PJ6 A;  4K7Z A;  4TLX A;  1ZY8 A;  2WDV A;  3NGC X;  1NHR A;  4OPD A;  1KNR A;  4A99 A;  4YXD A;  1N4V A;  5KVH A;  3ALM A;  3NNE A;  2YVJ A;  4NTC A;  3FMW A;  5ER0 A;  4EM4 A;  3B3R A;  1QJD A;  1CL0 A;  2VRM A;  4PAA A;  1DOC A;  5KMP A;  4BK2 A;  3VRD B;  1GRF A;  2IVE A;  2XFN A;  1F8R A;  4U8I A;  2R0C A;  3AE4 A;  2GQF A;  1OJC A;  2EQ7 A;  1JRZ A;  2WPE A;  3K7T A;  3V76 A;  5KMS A;  2Z5X A;  5JCL A;  2BS4 A;  4AOS A;  2Q0L A;  1GTE A;  2GR2 A;  3GDN A;  3Q9T A;  3SZW A;  2BAC A;  4YKG A;  1GV4 A;  1NEK A;  2XVH A;  2UZZ A;  2OLO A;  1B4V A;  4IVM B;  1CJ4 A;  4HA6 A;  4Z43 A;  4EMW A;  4YSX A;  2WP9 A;  3AWI A;  2Q6U A;  5HYM A;  5KOW A;  3SFE A;  4USR A;  2YG5 A;  1YQZ A;  3LJP A;  3BNM A;  3AD7 B;  2CUL A;  1VDC A;  2R45 A;  1L0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...