3NK0X

Complex of 6-hydroxy-l-nicotine oxidase with inhibitor bound at active site and turnover product at exit cavity
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 149
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk0X02
1JRYA 2V61A 3CNPA 4WCTA 2XFUA 2W0HA 3AE5A 4Y4NA 4EMIA 2NVKX 3GDPA 4APNA 2A8XA 2C65A 5GSNA 3UKPA 1COYA 3AE3A 1NPXA 2GAHB 3QFAA 4REKA 3SGLA 5JCNA 4CCQA 1E7PA 1PXBA 1Y56B 3UTHA 3ZYXA 3CNJA 2FJAA 2YLZA 5GRTA 4Z25A 5KWFA 2BYBA 4YTNA 4A6NB 3LZXA 1TDOA 2R0CA 4M52A 1ZK7A 5HXIA 5BULA 1DJNA 3UKQA 1RYIA 4U8KA 4OPCA 1E1KA 1E6EA 5DBJA 2ZBWA 3CGDA 4JY3A 4OPTA 1P2EA 1D7YA 3DJEA 2WP6A 3AE7A 4U2LA 5IPYA 1DODA 4ECHA 3NH3X 1B4VA 4OPGA 5CQFA 1BKWA 2JB3A 4IA6A 4UDQA 1EBDA 1ZX9A 1M64A 1QO8A 3LJPA 4IVMB 1JNRA 3VR8A 3UTGA 3LXDA 1PBDA 1TDEA 1QLBA 3GRSA 2R9ZA 2VQ7A 4NEWA 4RG4A 3R9UA 2Y6QA 2GV8A 4A65A 4GDEA 1S2QA 3LZWA 3GWFA 4H7UA 3BHFA 3NK0X 4AT0A 1Y56A 1RSGA 2R0GA 2XFQA 2XLRA 2O9ZA 3AE8A 2Z5XA 2BS2A 3NK2X 4H4SA 4C5OA 2XLTA 1K0IA 3DJJA 3NN0X 3NLCA 4H2PA 5M10A 3NIXA 4HA6A 4RSLA 1LVLA 4OVIA 5ER0A 1GXFA 1TRBA 3FPZA 5L46A 1M6IA 4BV6A 3ALJA 2XLSA 1AOGA 5IQ1A 1LTXR 3F8RA 1ZY8A 2WESA 3AE2A 4E0VA 3BI4A 4EM3A 1N4UA 5J60A 3GMCA 2ACZA 3F8DA 2JBVA 2WOIA 3DGZA 1JNZA 4YT0A 1Z6LA 2YG6A 1L9EA 2BCGG 2XLPA 1IUTA 1H7WA 1OJDA 4J33A 4Y4MA 3SFDA 1TYPA 2GF3A 4J36A 2GAGB 4BK2A 2YG4A 2FBWA 4H4ZA 2GR0A 3BHKA 1S3EA 5U1OA 2YG3A 4HB9A 4A99A 4DSHA 3C4AA 2VRLA 3I3LA 2V60A 4H2RA 4NTDA 5EBKA 2YVJA 4A5LA 2JB1A 1PN0A 1L9CA 1YQ4A 2C75A 1N1PA 2WQYA 3DK9A 1GNDA 3AE6A 4FDCB 1GTEA 2XVIA 1E1MA 1B37A 3FIMB 1IUSA 1EL8A 4A7AA 3ALMA 4FK1A 3CN8A 3RP6A 5EB4A 4CRTA 3GWDA 1NG3A 2B76A 1SEZA 4JY2A 3REDA 2GQWA 1GRTA 1VQWA 1O94A 1EL7A 4P9SA 3QJ4A 1CJCA 2C70A 4ZCCA 4U8JA 1EL5A 1X31B 2YG5A 1ZMDA 3SQPA 2DKIA 3DJGX 3FBSA 3UKFA 3CNTA 3UOXA 1L0VA 4TM3A 5LV9A 3DGHA 3VR9A 4H4UA 4J2WA 3RP7A 2F5ZA 4DSGA 1Q1WA 4B65A 1YKJA 4UDPA 3KPFA 1CBOA 5FS8A 4YSXA 1BGJA 5J7XA 2XLUA 1DOEA 3UCLA 1BF3A 4GR1A 2BABA 1KNPA 5KXJA 3AD9B 3KKJA 3LOVA 2JB2A 2QA1A 1KDGA 1V59A 1D4CA 2VQBA 5FS9A 3UOYA 3CGBA 3M12A 3I6DA 5U25A 3FMWA 1GSNA 4O5QA 2C73A 2OLNA 1F6MA 3K7TA 1NAAA 4BK1A 4X9NA 2YLXA 1K0LA 3AD8B 2C7GA 4EIPA 1YY5A 1ONFA 4PAAA 4Z26A 1PBBA 4CY6A 1GOSA 1XANA 5FS7A 3UOVA 4CBQA 4KPRA 3K30A 2E5VA 1CJ4A 1FCDA 3C96A 3DH9A 1L9DA 1OJAA 3NHOX 2C67A 2WDQA 1ZMCA 1FECA 4YSHA 1NEKA 2GR3A 3WE0A 5KOXA 1H6VA 2B7RA 4YSZA 1ZDLA 1TDFA 1VDCA 2E1MA 3IWAA 2XFNA 3UKKA 2XVHA 3ISHA 4ICYA 2VVMA 1GTHA 2XVJA 2GVCA 4K22A 3D1CA 1GETA 2QCUA 3L8KA 4AOXA 2Q7VA 4MJWA 3P4SA 4U8NA 4EQWA 1GRHA 3UKHA 2TMDA 2YM1A 4JNAA 3AD7B 1HYUA 4YTPA 1GRFA 1YQZA 2R4JA 1IUXA 1PXAA 4OPIA 3VRDB 2RABA 2B9YA 3V3OA 4J57A 4USRA 4OPLA 1F3PA 3NNEA 1GPEA 1QJDA 4GCMA 4H4YA 1OJTA 1PS9A 4IVOB 4B63A 2WETA 1B8SA 2V3BA 3UKAA 3COXA 3QFBA 1LPFA 2GMJA 1PHHA 2VZ2A 3Q6JA 4GDPA 4YTMA 4YWOA 4YKGA 2CFYA 2YG7A 3UTFA 2BXRA 3CPHG 4TLZA 4C3YA 4EQXA 2YWLA 3VQRA 1NDAA 1F8SA 2BC0A 3OZ2A 1K4QA 2X50A 3S61A 3PO7A 2H89A 1Y0PA 3H8LA 4K5RA 1CC4A 1H81A 1PJ6A 5HY5A 4ZCDA 3GMBA 1VRQB 4CCRA 1S3BA 2XFOA 4U8IA 3ALLA 3DK8A 4PABA 2X8CA 3KLJA 4KX6A 4NEVA 1H82A 2GH5A 3D8XA 2GB0A 2VVLG 4FK1C 3BI5A 3URHA 3KA7A 1FEAA 2BC1A 4H4RA 2YLTA 2XFPA 3AE1A 3NTAA 5U63A 4AT2A 1NG4A 1YQ3A 3CIRA 3CGCA 1DXLA 3AECA 1CC6A 2ZZBA 1H83A 1D4EA 2C3CA 4JNQA 2B9WA 5HYMA 4H4VA 3AEDA 2I0ZA 4Z43A 1CF3A 4EMWA 4H4TA 4LA1A 3B3RA 2YAUA 3ITJA 4U8MA 4GF7A 2BK5A 4D03A 1IJHA 1EL9A 1ZKQA 2WHDA 3DK4A 4X9MA 4XXGA 3EAOA 3ZDNA 4XWZA 3SFEA 2WP9A 2YR6A 2X3NA 1LQUA 3NGCX 1JRZA 5IQ4A 1H84A 1B5QA 3GYIA 2E4GA 1KSSA 3EF6A 5JCLA 2NPXA 2QAEA 2YLRA 4H50A 1KSUA 4H4QA 2C3DA 3V76A 1MXTA 1N4WA 1REOA 2OA1A 3AEFA 3P4RA 4BK3A 2WPEA 2YVFA 3CNDA 1LJ1A 1VG0A 2WPCA 3P9UA 3S5WA 2ZZ0A 1IUWA 1GRGA 1NENA 3KVEA 5KRQA 1JU2A 1XDIA 2WBAA 2BCPA 2WEUA 1GV4A 2EQ9A 3AYJA 3CTYA 1F8RA 4TM4A 4UDRA 2BK3A 2B9XA 4B69A 4ADWA 2OLOA 3RP8A 3K7QX 2EQ6A 4U8LA 2CVJA 4TM1A 2JKCA 1PJ7A 2YLSA 3UTEA 4A9WA 2B7SA 3GDNA 4IV9A 4BJZA 2X8HA 5FMHA 4FX9A 3PVCA 4EQSA 4A6NA 3LADA 4OCGA 4U2SA 4DNAA 3II4A 1DOCA 2A89A 1O95A 1DOBA 3GSIA 4WX1A 3NRNA 4Z24A 4Z2UA 1PBCA 4H2QA 2BS3A 3NT6A 4K8DA 3LB8A 1PBFA 2DKHA 2GQFA 2WDRA 4B67A 1JRXA 2CDUA 3GD3A 3AEGA 5CKUA 1RP0A 2AR8A 2ZZCA 1TDKA 2YR4A 4JN9A 4CY8A 3OC4A 3EANA 2CULA 3QSEA 2VRMA 3UOZA 4CNKA 3FG2P 4BURA 3B6DA 2XVEA 1Q9IA 2GR1A 5FS6A 4Z2TA 1OJCA 4ZN0A 4NZHA 4AP1A 2HQMA 1LV0A 2WDVA 1XHCA 4I59A 3JSKA 2RGHA 4JDRA 1ZOVA 1GERA 3QVRA 2C66A 2H88A 5JCKA 2AAQA 2C72A 3DA1A 2UZZA 3ATQA 4B64A 4EIQA 1KFYA 2V6OA 2WOVA 1KF6A 3GD4A 5KVIA 1CHUA 4X4JA 1PJ5A 2PYXA 2R45A 3DMEA 1FEBA 3P4QA 3VRAA 3AYLA 4Z44A 4DGKA 3E1TA 3AE4A 3QSMA 2C76A 2YLWA 3AE9A 1GT8A 4JQ9A 3BNMA 1D7LA 1ELIA 4NTEA 2BACA 3AWIA 3NKSA 2WP5A 3K7MX 1E1NA 2VVLA 2WOWA 4I58A 1PBEA 2V5ZA 3IHGA 4U2TA 1NHRA 2GMHA 3P1WA 3ADAB 1NHSA 2WS3A 4OPUA 3IC9A 2RGJA 3IHMA 4H2NA 4EM4A 3Q9TA 2A87A 2WU2A 4BJYA 5M0ZA 5JCIA 2X8GA 1P2HA 3V3NA 1Q1RA 2FJEA 1H7XA 4YXDA 1CJ3A 3NYFA 2X99A 1PXCA 3CPJG 3ICRA 2JK6A 2APGA 3L1RA 3C4NA 5C2TA 4B68A 3AYIA 1IUVA 5KVHA 2R0PA 4LIIA 4J31A 3HZLA 4OPDA 1E1LA 3NG7X 3VRBA 2IVEA 3G5SA 2BA9A 2AQJA 3KU9A 1PDHA 4TLXA 2XYOA 4CNJA 1KNRA 1N4VA 1VG9A 5TR3A 3RNMA 1CC2A 2WPFA 1ZP0A 4AP3A 1S2YA 2FJDA 3NYEA 2RGOA 3DJDA 1MO9A 4USQA 4U8PA 3AEAA 1BZLA 1IUUA 3AEBA 1W4XA 4K7ZA 4UP3A 4B1BA 1MOKA 2Y6RA 5JCMA 2IVDA 3CPIG 3EPTA 2IIDA 3GRTA 3KD9A 1FL2A 2QA2A 3NTDA 2YR5A 3P4PA 4J34A 3BNUA 1GALA 2EQ8A 2PHHA 1O5WA 1D4DA 3ATRA 4TM0A 3AB1A 2ARDA 1D5TA 3PS9A 3CGEA 1NHPA 2BXSA 2TPRA 3SM8A 3T37A 1JOAA 2XCGA 3NK1X 2VOUA 4YKFA 2Z5YA 5EOWA 4RG3A 2Q0LA 3UP4A 2XDOA 3NN6X 4GRTA 1GREA 1GRBA 4XWRA 4Y4LA 1CJ2A 1JEHA 5BVAA 2Q0KA 4H4WA 3ABVA 5HHFA 2V3AA 3H8IA 1DNCA 3ICSA 4GUVA 3GYJA 1XPQA 3G5RA 2R46A 4LU6A 3NYCA 4AOSA 4C74A 2C64A 1NHQA 2YQUA 4O5UA 3CNSA 2OAMA 4D04A 4EMJA 5C3JA 2YVGA 1GESA 3QSSA 5BUKA 5BRTA 4J56A 2WU5A 3IF9A 3F8PA 3ICTA 1CL0A 4IA5A 4B66A 2OALA 2J3NA 1TYTA 2EQ7A 2GEWA 3QVPA 1DJQA 3UP5A 2R4EA 4H4PA 3H4KA 4K5SA 4YSYA 2XVFA 4K2XA 3BI2A 2Q6UA 3RHAA 1BWCA 1K0JA 2JAEA 3AEEA 1UKVG 1H86A 1BGNA 4NTCA 3M0OA 1OJ9A 3G5QA 4C3XA 2GR2A 1GRAA 4Z2RA 4U8OA 1GEUA 2BS4A 4C77A 1ZOYA 5EB5A 1LQTA 3M13A 1E39A 2BK4A 5KOWA 3AXBA 4H4XA 3UKLA 2YM2A 2FJBA 2GRTA 4A79A 4N9XA 4EQRA 3O0HA 1F8WA 1TDNA 1FOHA
chains in the Genus database with same CATH superfamily
1JRYA 2V61A 3CNPA 4WCTA 2XFUA 2W0HA 3AE5A 4Y4NA 4EMIA 2NVKX 3GDPA 4APNA 2A8XA 2C65A 5GSNA 3UKPA 1COYA 3AE3A 1NPXA 2GAHB 3QFAA 4REKA 5KMPA 3SGLA 5JCNA 3SZ0A 4CCQA 1E7PA 1PXBA 1Y56B 3SZFA 3UTHA 3ZYXA 3CNJA 2FJAA 2YLZA 4GAVA 5GRTA 4Z25A 5KWFA 2BYBA 4YTNA 4A6NB 3LZXA 1TDOA 2R0CA 4M52A 1ZK7A 5HXIA 5BULA 1DJNA 3UKQA 1RYIA 4U8KA 4OPCA 1E1KA 1E6EA 5DBJA 2ZBWA 3CGDA 4JY3A 4OPTA 1P2EA 1D7YA 3DJEA 2WP6A 3AE7A 4U2LA 5IPYA 1DODA 4ECHA 3NH3X 1B4VA 4OPGA 5CQFA 3T2ZA 1BKWA 2JB3A 4IA6A 4UDQA 1EBDA 1ZX9A 1M64A 1QO8A 3LJPA 4IVMB 1JNRA 3VR8A 3UTGA 5KNLA 3LXDA 1PBDA 1TDEA 1QLBA 3GRSA 2R9ZA 2VQ7A 4NEWA 4RG4A 3R9UA 2Y6QA 2GV8A 4A65A 4GDEA 1S2QA 3LZWA 3GWFA 4H7UA 3BHFA 3NK0X 4AT0A 1Y56A 1RSGA 2R0GA 2XFQA 2XLRA 2O9ZA 3AE8A 2Z5XA 2BS2A 3NK2X 4H4SA 4C5OA 2XLTA 1K0IA 3SYIA 3DJJA 3NN0X 3NLCA 4H2PA 5M10A 3NIXA 4HA6A 4RSLA 1LVLA 4OVIA 5ER0A 1GXFA 1TRBA 3FPZA 5L46A 1M6IA 4BV6A 3ALJA 2XLSA 1AOGA 2BRAA 5IQ1A 1LTXR 3F8RA 1ZY8A 2WESA 3AE2A 4E0VA 3BI4A 4EM3A 1N4UA 5J60A 3GMCA 2ACZA 3F8DA 2JBVA 2WOIA 3DGZA 1JNZA 4YT0A 1Z6LA 2YG6A 1L9EA 2BCGG 2XLPA 1IUTA 1H7WA 1OJDA 4J33A 4Y4MA 3SFDA 1TYPA 2GF3A 4J36A 2GAGB 4BK2A 2YG4A 2FBWA 3CMMA 4H4ZA 2GR0A 4II3A 3BHKA 1S3EA 5U1OA 2YG3A 4HB9A 4A99A 4DSHA 3C4AA 3HYVA 2VRLA 3I3LA 2V60A 4H2RA 4NTDA 5EBKA 2YVJA 4A5LA 2JB1A 1PN0A 1L9CA 1YQ4A 2C75A 1N1PA 2WQYA 3DK9A 1GNDA 3AE6A 4FDCB 1GTEA 2XVIA 1E1MA 1B37A 3FIMB 1IUSA 1EL8A 4A7AA 3ALMA 4FK1A 3CN8A 3RP6A 5EB4A 4CRTA 3GWDA 1NG3A 2B76A 1SEZA 4JY2A 3REDA 2GQWA 1GRTA 5KMRA 1VQWA 1O94A 1EL7A 4P9SA 3QJ4A 4G73A 1CJCA 2C70A 4ZCCA 4U8JA 1EL5A 1X31B 2YG5A 1ZMDA 3SQPA 2DKIA 3DJGX 3FBSA 3UKFA 3CNTA 3UOXA 1L0VA 4TM3A 5LV9A 3DGHA 3VR9A 4H4UA 4J2WA 3RP7A 2F5ZA 4DSGA 1Q1WA 4B65A 1YKJA 4UDPA 3KPFA 1CBOA 5FS8A 4YSXA 4G74A 1BGJA 5J7XA 2XLUA 1DOEA 3UCLA 1BF3A 4GR1A 5KMQA 2BABA 1KNPA 3HYXA 3AD9B 5KXJA 3KKJA 3LOVA 2JB2A 2QA1A 1KDGA 1V59A 1D4CA 2VQBA 5FS9A 3UOYA 3CGBA 3M12A 3I6DA 5U25A 3FMWA 1GSNA 4NWZA 4O5QA 2C73A 2OLNA 1F6MA 4G6GA 3K7TA 1NAAA 4BK1A 4X9NA 3T2YA 2YLXA 1K0LA 3AD8B 2C7GA 4EIPA 1YY5A 1ONFA 4PAAA 4Z26A 1PBBA 4CY6A 1GOSA 1XANA 5FS7A 3UOVA 4CBQA 4KPRA 3K30A 2E5VA 1CJ4A 1FCDA 3C96A 3DH9A 1L9DA 1OJAA 3T2KA 3NHOX 2C67A 2WDQA 1ZMCA 1FECA 4YSHA 1NEKA 2GR3A 3WE0A 5KOXA 1H6VA 2B7RA 4YSZA 1ZDLA 1TDFA 1VDCA 2E1MA 3IWAA 3SZCA 2XFNA 3UKKA 2XVHA 3ISHA 4ICYA 2VVMA 1GTHA 2XVJA 2GVCA 4K22A 3D1CA 1GETA 2QCUA 3L8KA 4AOXA 2BRYA 2Q7VA 4MJWA 3P4SA 4U8NA 4EQWA 1GRHA 3UKHA 2TMDA 2YM1A 4JNAA 3AD7B 1HYUA 4YTPA 1GRFA 1YQZA 2R4JA 1IUXA 1PXAA 4OPIA 3VRDB 2RABA 2B9YA 3V3OA 3SZWA 4J57A 4USRA 4OPLA 1F3PA 3NNEA 1GPEA 1QJDA 4GCMA 4H4YA 1OJTA 1PS9A 4IVOB 4B63A 2WETA 1B8SA 2V3BA 3UKAA 3COXA 3QFBA 1LPFA 2GMJA 1PHHA 2VZ2A 3Q6JA 4GDPA 4YTMA 4YWOA 4YKGA 2CFYA 2YG7A 3UTFA 2BXRA 3CPHG 4TLZA 4C3YA 4EQXA 2YWLA 3VQRA 1NDAA 1F8SA 2BC0A 3OZ2A 1K4QA 2X50A 3S61A 3PO7A 2H89A 1Y0PA 3H8LA 4K5RA 1CC4A 1H81A 1PJ6A 5HY5A 4ZCDA 3GMBA 1VRQB 4CCRA 1S3BA 2XFOA 4U8IA 3ALLA 3DK8A 4PABA 2X8CA 3KLJA 4KX6A 4NEVA 1H82A 2GH5A 3D8XA 2GB0A 2VVLG 4FK1C 3BI5A 3URHA 3KA7A 1FEAA 2BC1A 4H4RA 2YLTA 2XFPA 3AE1A 3NTAA 5U63A 4AT2A 1NG4A 1YQ3A 3CIRA 3CGCA 1DXLA 3AECA 1CC6A 2ZZBA 1H83A 1D4EA 2C3CA 4JNQA 2B9WA 3HYWA 4H4VA 3AEDA 5HYMA 2I0ZA 4Z43A 1CF3A 4EMWA 4H4TA 4LA1A 3B3RA 2YAUA 3ITJA 4U8MA 4GF7A 2BK5A 4D03A 1IJHA 1EL9A 1ZKQA 2WHDA 3DK4A 4X9MA 4XXGA 3EAOA 3ZDNA 4XWZA 3SFEA 2WP9A 2YR6A 2X3NA 1LQUA 3NGCX 1JRZA 5IQ4A 1H84A 1B5QA 3GYIA 2E4GA 1KSSA 3EF6A 5JCLA 2NPXA 2QAEA 2YLRA 4H50A 1KSUA 3SY4A 4H4QA 2C3DA 3V76A 1MXTA 1N4WA 1REOA 2OA1A 3AEFA 3P4RA 4BK3A 2WPEA 2YVFA 3CNDA 1LJ1A 1VG0A 2WPCA 3P9UA 3S5WA 2ZZ0A 1IUWA 1GRGA 3T14A 1NENA 3KVEA 5KRQA 1JU2A 1XDIA 2WBAA 2BCPA 2WEUA 1GV4A 2EQ9A 3AYJA 3CTYA 1F8RA 4TM4A 4UDRA 2BK3A 2B9XA 4B69A 4ADWA 2OLOA 3RP8A 3K7QX 2EQ6A 4U8LA 2CVJA 4TM1A 2JKCA 1PJ7A 2YLSA 3UTEA 4A9WA 2B7SA 3GDNA 4IV9A 4BJZA 2X8HA 5FMHA 4FX9A 3PVCA 4EQSA 3T31A 4A6NA 3LADA 4OCGA 4U2SA 4DNAA 4G9KA 3II4A 1DOCA 2A89A 1O95A 1DOBA 3GSIA 4WX1A 3NRNA 4Z24A 4Z2UA 1PBCA 4H2QA 2BS3A 4GAPA 3NT6A 3GYXA 4K8DA 3LB8A 1PBFA 2DKHA 2GQFA 2WDRA 4B67A 1JRXA 2CDUA 3GD3A 3AEGA 5CKUA 1RP0A 2AR8A 2ZZCA 1TDKA 2YR4A 4JN9A 4CY8A 3OC4A 3EANA 2CULA 3QSEA 2VRMA 3UOZA 4CNKA 3FG2P 4BURA 3B6DA 2XVEA 1Q9IA 2GR1A 5FS6A 4Z2TA 1OJCA 4ZN0A 4NZHA 4AP1A 2HQMA 1LV0A 2WDVA 1XHCA 4I59A 3JSKA 2RGHA 4JDRA 1ZOVA 1GERA 3QVRA 2C66A 2H88A 5JCKA 2AAQA 2C72A 3DA1A 2UZZA 3ATQA 4B64A 4EIQA 1KFYA 2V6OA 2WOVA 1KF6A 3GD4A 5KVIA 1CHUA 4X4JA 1PJ5A 2PYXA 2R45A 3DMEA 1FEBA 3P4QA 3VRAA 3AYLA 4Z44A 4DGKA 3E1TA 2C4CA 3AE4A 2C76A 2YLWA 3AE9A 1GT8A 3QSMA 4JQ9A 3BNMA 1D7LA 1ELIA 4NTEA 2BACA 3AWIA 3NKSA 2WP5A 3K7MX 1E1NA 2VVLA 2WOWA 4I58A 1PBEA 2V5ZA 3IHGA 4U2TA 1NHRA 2GMHA 3P1WA 3ADAB 1NHSA 2WS3A 4OPUA 3IC9A 2RGJA 3IHMA 4H2NA 4EM4A 3Q9TA 2A87A 2WU2A 4BJYA 5M0ZA 5JCIA 2X8GA 1P2HA 3V3NA 4II2A 1Q1RA 2FJEA 1H7XA 4YXDA 1CJ3A 3NYFA 2X99A 3SX6A 1PXCA 3CPJG 3ICRA 2JK6A 2APGA 3L1RA 3C4NA 5C2TA 4B68A 3AYIA 3T0KA 1IUVA 5KVHA 2R0PA 4LIIA 4J31A 3HZLA 4OPDA 1E1LA 3NG7X 3VRBA 2IVEA 3G5SA 2BA9A 2AQJA 3KU9A 1PDHA 4TLXA 2XYOA 4CNJA 1KNRA 1N4VA 1VG9A 5TR3A 3RNMA 1CC2A 2WPFA 1ZP0A 4AP3A 1S2YA 2FJDA 3NYEA 2RGOA 3DJDA 1MO9A 4NNJA 4U8PA 4USQA 3AEAA 1BZLA 1IUUA 3AEBA 1W4XA 4K7ZA 4UP3A 4B1BA 1MOKA 2Y6RA 5JCMA 2IVDA 3CPIG 3EPTA 2IIDA 3GRTA 3KD9A 1FL2A 2QA2A 3NTDA 2YR5A 3P4PA 4J34A 5KMSA 3BNUA 1GALA 2EQ8A 2PHHA 1O5WA 1D4DA 3ATRA 4TM0A 3AB1A 2ARDA 1D5TA 3PS9A 3CGEA 1NHPA 2BXSA 2TPRA 3SM8A 3T37A 1JOAA 2XCGA 3NK1X 2VOUA 4YKFA 2Z5YA 5EOWA 4RG3A 2Q0LA 3UP4A 2XDOA 3SXIA 3NN6X 4GRTA 1GREA 1GRBA 4XWRA 4G6HA 1CJ2A 1JEHA 4Y4LA 2Q0KA 4H4WA 5BVAA 3ABVA 5HHFA 2V3AA 3H8IA 1DNCA 3ICSA 4GUVA 3GYJA 1XPQA 3G5RA 2R46A 4LU6A 3NYCA 4AOSA 4C74A 2C64A 1NHQA 2YQUA 4O5UA 3CNSA 2OAMA 4D04A 4EMJA 5C3JA 2YVGA 1GESA 3QSSA 5BUKA 5BRTA 4J56A 2WU5A 3IF9A 3F8PA 3ICTA 1CL0A 4IA5A 4B66A 2OALA 2J3NA 1TYTA 2EQ7A 2GEWA 3QVPA 1DJQA 3UP5A 2R4EA 4H4PA 3KPKA 3H4KA 4K5SA 4YSYA 2XVFA 4K2XA 3BI2A 2Q6UA 3RHAA 1BWCA 1K0JA 2JAEA 3AEEA 1UKVG 1H86A 1BGNA 4NTCA 3M0OA 1OJ9A 3G5QA 4C3XA 2GR2A 1GRAA 4Z2RA 4U8OA 1GEUA 2BS4A 4C77A 1ZOYA 5EB5A 1LQTA 3M13A 1E39A 2BK4A 5KOWA 3AXBA 4H4XA 3UKLA 2YM2A 2FJBA 2GRTA 4A79A 4N9XA 4EQRA 3O0HA 1F8WA 1TDNA 1FOHA
chains in the Genus database with same CATH topology
1JRYA 2V61A 3CNPA 4WCTA 2XFUA 2W0HA 3AE5A 4Y4NA 4EMIA 2NVKX 3GDPA 4APNA 2A8XA 2C65A 5GSNA 3UKPA 1COYA 3AE3A 1NPXA 2GAHB 3QFAA 4REKA 5KMPA 3SGLA 5JCNA 3SZ0A 4CCQA 1E7PA 1PXBA 1Y56B 3SZFA 3UTHA 3ZYXA 3CNJA 2FJAA 2YLZA 4GAVA 5GRTA 4Z25A 5KWFA 2BYBA 4YTNA 4A6NB 3LZXA 1TDOA 2R0CA 4M52A 1ZK7A 5HXIA 5BULA 1DJNA 3UKQA 1RYIA 4U8KA 4OPCA 1E1KA 1E6EA 5DBJA 2ZBWA 3CGDA 4JY3A 4OPTA 1P2EA 1D7YA 3DJEA 2WP6A 3AE7A 4U2LA 5IPYA 1DODA 4ECHA 3NH3X 1B4VA 4OPGA 5CQFA 3T2ZA 1BKWA 2JB3A 4IA6A 4UDQA 1EBDA 1ZX9A 1M64A 1QO8A 3LJPA 4IVMB 1JNRA 3VR8A 3UTGA 5KNLA 3LXDA 1PBDA 1TDEA 1QLBA 3GRSA 2R9ZA 2VQ7A 4NEWA 4RG4A 3R9UA 2Y6QA 2GV8A 4A65A 4GDEA 1S2QA 3LZWA 3GWFA 4H7UA 3BHFA 3NK0X 4AT0A 1Y56A 1RSGA 2R0GA 2XFQA 2XLRA 2O9ZA 3AE8A 2Z5XA 2BS2A 3NK2X 4H4SA 4C5OA 2XLTA 1K0IA 3SYIA 3DJJA 3NN0X 3NLCA 4H2PA 5M10A 3NIXA 4HA6A 4RSLA 1LVLA 4OVIA 5ER0A 1GXFA 1TRBA 3FPZA 5L46A 1M6IA 4BV6A 3ALJA 2XLSA 1AOGA 2BRAA 5IQ1A 1LTXR 3F8RA 1ZY8A 2WESA 3AE2A 4E0VA 3BI4A 4EM3A 1N4UA 5J60A 3GMCA 2ACZA 3F8DA 2JBVA 2WOIA 3DGZA 1JNZA 4YT0A 1Z6LA 2YG6A 1L9EA 2BCGG 2XLPA 1IUTA 1H7WA 1OJDA 4J33A 4Y4MA 3SFDA 1TYPA 2GF3A 4J36A 2GAGB 4BK2A 2YG4A 2FBWA 3CMMA 4H4ZA 2GR0A 4II3A 3BHKA 1S3EA 5U1OA 2YG3A 4HB9A 4A99A 4DSHA 3C4AA 3HYVA 2VRLA 3I3LA 2V60A 4H2RA 4NTDA 5EBKA 2YVJA 4A5LA 2JB1A 1PN0A 1L9CA 1YQ4A 2C75A 1N1PA 2WQYA 3DK9A 1GNDA 3AE6A 4FDCB 1GTEA 2XVIA 1E1MA 1B37A 3FIMB 1IUSA 1EL8A 4A7AA 3ALMA 4FK1A 3CN8A 3RP6A 5EB4A 4CRTA 3GWDA 1NG3A 2B76A 1SEZA 4JY2A 3REDA 2GQWA 1GRTA 5KMRA 1VQWA 1O94A 1EL7A 4P9SA 3QJ4A 4G73A 1CJCA 2C70A 4ZCCA 4U8JA 1EL5A 1X31B 2YG5A 1ZMDA 3SQPA 2DKIA 3DJGX 3FBSA 3UKFA 3CNTA 3UOXA 1L0VA 4TM3A 5LV9A 3DGHA 3VR9A 4H4UA 4J2WA 3RP7A 2F5ZA 4DSGA 1Q1WA 4B65A 1YKJA 4UDPA 3KPFA 1CBOA 5FS8A 4YSXA 4G74A 1BGJA 5J7XA 2XLUA 1DOEA 3UCLA 1BF3A 4GR1A 5KMQA 2BABA 1KNPA 3HYXA 3AD9B 5KXJA 3KKJA 3LOVA 2JB2A 2QA1A 1KDGA 1V59A 1D4CA 2VQBA 5FS9A 3UOYA 3CGBA 3M12A 3I6DA 5U25A 3FMWA 1GSNA 4NWZA 4O5QA 2C73A 2OLNA 1F6MA 4G6GA 3K7TA 1NAAA 4BK1A 4X9NA 3T2YA 2YLXA 1K0LA 3AD8B 2C7GA 4EIPA 1YY5A 1ONFA 4PAAA 4Z26A 1PBBA 4CY6A 1GOSA 1XANA 5FS7A 3UOVA 4CBQA 4KPRA 3K30A 2E5VA 1CJ4A 1FCDA 3C96A 3DH9A 1L9DA 1OJAA 3T2KA 3NHOX 2C67A 2WDQA 1ZMCA 1FECA 4YSHA 1NEKA 2GR3A 3WE0A 5KOXA 1H6VA 2B7RA 4YSZA 1ZDLA 1TDFA 1VDCA 2E1MA 3IWAA 3SZCA 2XFNA 3UKKA 2XVHA 3ISHA 4ICYA 2VVMA 1GTHA 2XVJA 2GVCA 4K22A 3D1CA 1GETA 2QCUA 3L8KA 4AOXA 2BRYA 2Q7VA 4MJWA 3P4SA 4U8NA 4EQWA 1GRHA 3UKHA 2TMDA 2YM1A 4JNAA 3AD7B 1HYUA 4YTPA 1GRFA 1YQZA 2R4JA 1IUXA 1PXAA 4OPIA 3VRDB 2RABA 2B9YA 3V3OA 3SZWA 4J57A 4USRA 4OPLA 1F3PA 3NNEA 1GPEA 1QJDA 4GCMA 4H4YA 1OJTA 1PS9A 4IVOB 4B63A 2WETA 1B8SA 2V3BA 3UKAA 3COXA 3QFBA 1LPFA 2GMJA 1PHHA 2VZ2A 3Q6JA 4GDPA 4YTMA 4YWOA 4YKGA 2CFYA 2YG7A 3UTFA 2BXRA 3CPHG 4TLZA 4C3YA 4EQXA 2YWLA 3VQRA 1NDAA 1F8SA 2BC0A 3OZ2A 1K4QA 2X50A 3S61A 3PO7A 2H89A 1Y0PA 3H8LA 4K5RA 1CC4A 1H81A 1PJ6A 5HY5A 4ZCDA 3GMBA 1VRQB 4CCRA 1S3BA 2XFOA 4U8IA 3ALLA 3DK8A 4PABA 2X8CA 3KLJA 4KX6A 4NEVA 1H82A 2GH5A 3D8XA 2GB0A 2VVLG 4FK1C 3BI5A 3URHA 3KA7A 1FEAA 2BC1A 4H4RA 2YLTA 2XFPA 3AE1A 3NTAA 5U63A 4AT2A 1NG4A 1YQ3A 3CIRA 3CGCA 1DXLA 3AECA 1CC6A 2ZZBA 1H83A 1D4EA 2C3CA 4JNQA 2B9WA 3HYWA 4H4VA 3AEDA 5HYMA 2I0ZA 4Z43A 1CF3A 4EMWA 4H4TA 4LA1A 3B3RA 2YAUA 3ITJA 4U8MA 4GF7A 2BK5A 4D03A 1IJHA 1EL9A 1ZKQA 2WHDA 3DK4A 4X9MA 4XXGA 3EAOA 3ZDNA 4XWZA 3SFEA 2WP9A 2YR6A 2X3NA 1LQUA 3NGCX 1JRZA 5IQ4A 1H84A 1B5QA 3GYIA 2E4GA 1KSSA 3EF6A 5JCLA 2NPXA 2QAEA 2YLRA 4H50A 1KSUA 3SY4A 4H4QA 2C3DA 3V76A 1MXTA 1N4WA 1REOA 2OA1A 3AEFA 3P4RA 4BK3A 2WPEA 2YVFA 3CNDA 1LJ1A 1VG0A 2WPCA 3P9UA 3S5WA 2ZZ0A 1IUWA 1GRGA 3T14A 1NENA 3KVEA 5KRQA 1JU2A 1XDIA 2WBAA 2BCPA 2WEUA 1GV4A 2EQ9A 3AYJA 3CTYA 1F8RA 4TM4A 4UDRA 2BK3A 2B9XA 4B69A 4ADWA 2OLOA 3RP8A 3K7QX 2EQ6A 4U8LA 2CVJA 4TM1A 2JKCA 1PJ7A 2YLSA 3UTEA 4A9WA 2B7SA 3GDNA 4IV9A 4BJZA 2X8HA 5FMHA 4FX9A 3PVCA 4EQSA 3T31A 4A6NA 3LADA 4OCGA 4U2SA 4DNAA 4G9KA 3II4A 1DOCA 2A89A 1O95A 1DOBA 3GSIA 4WX1A 3NRNA 4Z24A 4Z2UA 1PBCA 4H2QA 2BS3A 4GAPA 3NT6A 3GYXA 4K8DA 3LB8A 1PBFA 2DKHA 2GQFA 2WDRA 4B67A 1JRXA 2CDUA 3GD3A 3AEGA 5CKUA 1RP0A 2AR8A 2ZZCA 1TDKA 2YR4A 4JN9A 4CY8A 3OC4A 3EANA 2CULA 3QSEA 2VRMA 3UOZA 4CNKA 3FG2P 4BURA 3B6DA 2XVEA 1Q9IA 2GR1A 5FS6A 4Z2TA 1OJCA 4ZN0A 4NZHA 4AP1A 2HQMA 1LV0A 2WDVA 1XHCA 4I59A 3JSKA 2RGHA 4JDRA 1ZOVA 1GERA 3QVRA 2C66A 2H88A 5JCKA 2AAQA 2C72A 3DA1A 2UZZA 3ATQA 4B64A 4EIQA 1KFYA 2V6OA 2WOVA 1KF6A 3GD4A 5KVIA 1CHUA 4X4JA 1PJ5A 2PYXA 2R45A 3DMEA 1FEBA 3P4QA 3VRAA 3AYLA 4Z44A 4DGKA 3E1TA 2C4CA 3AE4A 2C76A 2YLWA 3AE9A 1GT8A 3QSMA 4JQ9A 3BNMA 1D7LA 1ELIA 4NTEA 2BACA 3AWIA 3NKSA 2WP5A 3K7MX 1E1NA 2VVLA 2WOWA 4I58A 1PBEA 2V5ZA 3IHGA 4U2TA 1NHRA 2GMHA 3P1WA 3ADAB 1NHSA 2WS3A 4OPUA 3IC9A 2RGJA 3IHMA 4H2NA 4EM4A 3Q9TA 2A87A 2WU2A 4BJYA 5M0ZA 5JCIA 2X8GA 1P2HA 3V3NA 4II2A 1Q1RA 2FJEA 1H7XA 4YXDA 1CJ3A 3NYFA 2X99A 3SX6A 1PXCA 3CPJG 3ICRA 2JK6A 2APGA 3L1RA 3C4NA 5C2TA 4B68A 3AYIA 3T0KA 1IUVA 5KVHA 2R0PA 4LIIA 4J31A 3HZLA 4OPDA 1E1LA 3NG7X 3VRBA 2IVEA 3G5SA 2BA9A 2AQJA 3KU9A 1PDHA 4TLXA 2XYOA 4CNJA 1KNRA 1N4VA 1VG9A 5TR3A 3RNMA 1CC2A 2WPFA 1ZP0A 4AP3A 1S2YA 2FJDA 3NYEA 2RGOA 3DJDA 1MO9A 4NNJA 4U8PA 4USQA 3AEAA 1BZLA 1IUUA 3AEBA 1W4XA 4K7ZA 4UP3A 4B1BA 1MOKA 2Y6RA 5JCMA 2IVDA 3CPIG 3EPTA 2IIDA 3GRTA 3KD9A 1FL2A 2QA2A 3NTDA 2YR5A 3P4PA 4J34A 5KMSA 3BNUA 1GALA 2EQ8A 2PHHA 1O5WA 1D4DA 3ATRA 4TM0A 3AB1A 2ARDA 1D5TA 3PS9A 3CGEA 1NHPA 2BXSA 2TPRA 3SM8A 3T37A 1JOAA 2XCGA 3NK1X 2VOUA 4YKFA 2Z5YA 5EOWA 4RG3A 2Q0LA 3UP4A 2XDOA 3SXIA 3NN6X 4GRTA 1GREA 1GRBA 4XWRA 4G6HA 1CJ2A 1JEHA 4Y4LA 2Q0KA 4H4WA 5BVAA 3ABVA 5HHFA 2V3AA 3H8IA 1DNCA 3ICSA 4GUVA 3GYJA 1XPQA 3G5RA 2R46A 4LU6A 3NYCA 4AOSA 4C74A 2C64A 1NHQA 2YQUA 4O5UA 3CNSA 2OAMA 4D04A 4EMJA 5C3JA 2YVGA 1GESA 3QSSA 5BUKA 5BRTA 4J56A 2WU5A 3IF9A 3F8PA 3ICTA 1CL0A 4IA5A 4B66A 2OALA 2J3NA 1TYTA 2EQ7A 2GEWA 3QVPA 1DJQA 3UP5A 2R4EA 4H4PA 3KPKA 3H4KA 4K5SA 4YSYA 2XVFA 4K2XA 3BI2A 2Q6UA 3RHAA 1BWCA 1K0JA 2JAEA 3AEEA 1UKVG 1H86A 1BGNA 4NTCA 3M0OA 1OJ9A 3G5QA 4C3XA 2GR2A 1GRAA 4Z2RA 4U8OA 1GEUA 2BS4A 4C77A 1ZOYA 5EB5A 1LQTA 3M13A 1E39A 2BK4A 5KOWA 3AXBA 4H4XA 3UKLA 2YM2A 2FJBA 2GRTA 4A79A 4N9XA 4EQRA 3O0HA 1F8WA 1TDNA 1FOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRY A;  2V61 A;  3CNP A;  4WCT A;  2XFU A;  2W0H A;  3AE5 A;  4Y4N A;  4EMI A;  2NVK X;  3GDP A;  4APN A;  2A8X A;  2C65 A;  5GSN A;  3UKP A;  1COY A;  3AE3 A;  1NPX A;  2GAH B;  3QFA A;  4REK A;  3SGL A;  5JCN A;  4CCQ A;  1E7P A;  1PXB A;  1Y56 B;  3UTH A;  3ZYX A;  3CNJ A;  2FJA A;  2YLZ A;  5GRT A;  4Z25 A;  5KWF A;  2BYB A;  4YTN A;  4A6N B;  3LZX A;  1TDO A;  2R0C A;  4M52 A;  1ZK7 A;  5HXI A;  5BUL A;  1DJN A;  3UKQ A;  1RYI A;  4U8K A;  4OPC A;  1E1K A;  1E6E A;  5DBJ A;  2ZBW A;  3CGD A;  4JY3 A;  4OPT A;  1P2E A;  1D7Y A;  3DJE A;  2WP6 A;  3AE7 A;  4U2L A;  5IPY A;  1DOD A;  4ECH A;  3NH3 X;  1B4V A;  4OPG A;  5CQF A;  1BKW A;  2JB3 A;  4IA6 A;  4UDQ A;  1EBD A;  1ZX9 A;  1M64 A;  1QO8 A;  3LJP A;  4IVM B;  1JNR A;  3VR8 A;  3UTG A;  3LXD A;  1PBD A;  1TDE A;  1QLB A;  3GRS A;  2R9Z A;  2VQ7 A;  4NEW A;  4RG4 A;  3R9U A;  2Y6Q A;  2GV8 A;  4A65 A;  4GDE A;  1S2Q A;  3LZW A;  3GWF A;  4H7U A;  3BHF A;  3NK0 X;  4AT0 A;  1Y56 A;  1RSG A;  2R0G A;  2XFQ A;  2XLR A;  2O9Z A;  3AE8 A;  2Z5X A;  2BS2 A;  3NK2 X;  4H4S A;  4C5O A;  2XLT A;  1K0I A;  3DJJ A;  3NN0 X;  3NLC A;  4H2P A;  5M10 A;  3NIX A;  4HA6 A;  4RSL A;  1LVL A;  4OVI A;  5ER0 A;  1GXF A;  1TRB A;  3FPZ A;  5L46 A;  1M6I A;  4BV6 A;  3ALJ A;  2XLS A;  1AOG A;  5IQ1 A;  1LTX R;  3F8R A;  1ZY8 A;  2WES A;  3AE2 A;  4E0V A;  3BI4 A;  4EM3 A;  1N4U A;  5J60 A;  3GMC A;  2ACZ A;  3F8D A;  2JBV A;  2WOI A;  3DGZ A;  1JNZ A;  4YT0 A;  1Z6L A;  2YG6 A;  1L9E A;  2BCG G;  2XLP A;  1IUT A;  1H7W A;  1OJD A;  4J33 A;  4Y4M A;  3SFD A;  1TYP A;  2GF3 A;  4J36 A;  2GAG B;  4BK2 A;  2YG4 A;  2FBW A;  4H4Z A;  2GR0 A;  3BHK A;  1S3E A;  5U1O A;  2YG3 A;  4HB9 A;  4A99 A;  4DSH A;  3C4A A;  2VRL A;  3I3L A;  2V60 A;  4H2R A;  4NTD A;  5EBK A;  2YVJ A;  4A5L A;  2JB1 A;  1PN0 A;  1L9C A;  1YQ4 A;  2C75 A;  1N1P A;  2WQY A;  3DK9 A;  1GND A;  3AE6 A;  4FDC B;  1GTE A;  2XVI A;  1E1M A;  1B37 A;  3FIM B;  1IUS A;  1EL8 A;  4A7A A;  3ALM A;  4FK1 A;  3CN8 A;  3RP6 A;  5EB4 A;  4CRT A;  3GWD A;  1NG3 A;  2B76 A;  1SEZ A;  4JY2 A;  3RED A;  2GQW A;  1GRT A;  1VQW A;  1O94 A;  1EL7 A;  4P9S A;  3QJ4 A;  1CJC A;  2C70 A;  4ZCC A;  4U8J A;  1EL5 A;  1X31 B;  2YG5 A;  1ZMD A;  3SQP A;  2DKI A;  3DJG X;  3FBS A;  3UKF A;  3CNT A;  3UOX A;  1L0V A;  4TM3 A;  5LV9 A;  3DGH A;  3VR9 A;  4H4U A;  4J2W A;  3RP7 A;  2F5Z A;  4DSG A;  1Q1W A;  4B65 A;  1YKJ A;  4UDP A;  3KPF A;  1CBO A;  5FS8 A;  4YSX A;  1BGJ A;  5J7X A;  2XLU A;  1DOE A;  3UCL A;  1BF3 A;  4GR1 A;  2BAB A;  1KNP A;  5KXJ A;  3AD9 B;  3KKJ A;  3LOV A;  2JB2 A;  2QA1 A;  1KDG A;  1V59 A;  1D4C A;  2VQB A;  5FS9 A;  3UOY A;  3CGB A;  3M12 A;  3I6D A;  5U25 A;  3FMW A;  1GSN A;  4O5Q A;  2C73 A;  2OLN A;  1F6M A;  3K7T A;  1NAA A;  4BK1 A;  4X9N A;  2YLX A;  1K0L A;  3AD8 B;  2C7G A;  4EIP A;  1YY5 A;  1ONF A;  4PAA A;  4Z26 A;  1PBB A;  4CY6 A;  1GOS A;  1XAN A;  5FS7 A;  3UOV A;  4CBQ A;  4KPR A;  3K30 A;  2E5V A;  1CJ4 A;  1FCD A;  3C96 A;  3DH9 A;  1L9D A;  1OJA A;  3NHO X;  2C67 A;  2WDQ A;  1ZMC A;  1FEC A;  4YSH A;  1NEK A;  2GR3 A;  3WE0 A;  5KOX A;  1H6V A;  2B7R A;  4YSZ A;  1ZDL A;  1TDF A;  1VDC A;  2E1M A;  3IWA A;  2XFN A;  3UKK A;  2XVH A;  3ISH A;  4ICY A;  2VVM A;  1GTH A;  2XVJ A;  2GVC A;  4K22 A;  3D1C A;  1GET A;  2QCU A;  3L8K A;  4AOX A;  2Q7V A;  4MJW A;  3P4S A;  4U8N A;  4EQW A;  1GRH A;  3UKH A;  2TMD A;  2YM1 A;  4JNA A;  3AD7 B;  1HYU A;  4YTP A;  1GRF A;  1YQZ A;  2R4J A;  1IUX A;  1PXA A;  4OPI A;  3VRD B;  2RAB A;  2B9Y A;  3V3O A;  4J57 A;  4USR A;  4OPL A;  1F3P A;  3NNE A;  1GPE A;  1QJD A;  4GCM A;  4H4Y A;  1OJT A;  1PS9 A;  4IVO B;  4B63 A;  2WET A;  1B8S A;  2V3B A;  3UKA A;  3COX A;  3QFB A;  1LPF A;  2GMJ A;  1PHH A;  2VZ2 A;  3Q6J A;  4GDP A;  4YTM A;  4YWO A;  4YKG A;  2CFY A;  2YG7 A;  3UTF A;  2BXR A;  3CPH G;  4TLZ A;  4C3Y A;  4EQX A;  2YWL A;  3VQR A;  1NDA A;  1F8S A;  2BC0 A;  3OZ2 A;  1K4Q A;  2X50 A;  3S61 A;  3PO7 A;  2H89 A;  1Y0P A;  3H8L A;  4K5R A;  1CC4 A;  1H81 A;  1PJ6 A;  5HY5 A;  4ZCD A;  3GMB A;  1VRQ B;  4CCR A;  1S3B A;  2XFO A;  4U8I A;  3ALL A;  3DK8 A;  4PAB A;  2X8C A;  3KLJ A;  4KX6 A;  4NEV A;  1H82 A;  2GH5 A;  3D8X A;  2GB0 A;  2VVL G;  4FK1 C;  3BI5 A;  3URH A;  3KA7 A;  1FEA A;  2BC1 A;  4H4R A;  2YLT A;  2XFP A;  3AE1 A;  3NTA A;  5U63 A;  4AT2 A;  1NG4 A;  1YQ3 A;  3CIR A;  3CGC A;  1DXL A;  3AEC A;  1CC6 A;  2ZZB A;  1H83 A;  1D4E A;  2C3C A;  4JNQ A;  2B9W A;  5HYM A;  4H4V A;  3AED A;  2I0Z A;  4Z43 A;  1CF3 A;  4EMW A;  4H4T A;  4LA1 A;  3B3R A;  2YAU A;  3ITJ A;  4U8M A;  4GF7 A;  2BK5 A;  4D03 A;  1IJH A;  1EL9 A;  1ZKQ A;  2WHD A;  3DK4 A;  4X9M A;  4XXG A;  3EAO A;  3ZDN A;  4XWZ A;  3SFE A;  2WP9 A;  2YR6 A;  2X3N A;  1LQU A;  3NGC X;  1JRZ A;  5IQ4 A;  1H84 A;  1B5Q A;  3GYI A;  2E4G A;  1KSS A;  3EF6 A;  5JCL A;  2NPX A;  2QAE A;  2YLR A;  4H50 A;  1KSU A;  4H4Q A;  2C3D A;  3V76 A;  1MXT A;  1N4W A;  1REO A;  2OA1 A;  3AEF A;  3P4R A;  4BK3 A;  2WPE A;  2YVF A;  3CND A;  1LJ1 A;  1VG0 A;  2WPC A;  3P9U A;  3S5W A;  2ZZ0 A;  1IUW A;  1GRG A;  1NEN A;  3KVE A;  5KRQ A;  1JU2 A;  1XDI A;  2WBA A;  2BCP A;  2WEU A;  1GV4 A;  2EQ9 A;  3AYJ A;  3CTY A;  1F8R A;  4TM4 A;  4UDR A;  2BK3 A;  2B9X A;  4B69 A;  4ADW A;  2OLO A;  3RP8 A;  3K7Q X;  2EQ6 A;  4U8L A;  2CVJ A;  4TM1 A;  2JKC A;  1PJ7 A;  2YLS A;  3UTE A;  4A9W A;  2B7S A;  3GDN A;  4IV9 A;  4BJZ A;  2X8H A;  5FMH A;  4FX9 A;  3PVC A;  4EQS A;  4A6N A;  3LAD A;  4OCG A;  4U2S A;  4DNA A;  3II4 A;  1DOC A;  2A89 A;  1O95 A;  1DOB A;  3GSI A;  4WX1 A;  3NRN A;  4Z24 A;  4Z2U A;  1PBC A;  4H2Q A;  2BS3 A;  3NT6 A;  4K8D A;  3LB8 A;  1PBF A;  2DKH A;  2GQF A;  2WDR A;  4B67 A;  1JRX A;  2CDU A;  3GD3 A;  3AEG A;  5CKU A;  1RP0 A;  2AR8 A;  2ZZC A;  1TDK A;  2YR4 A;  4JN9 A;  4CY8 A;  3OC4 A;  3EAN A;  2CUL A;  3QSE A;  2VRM A;  3UOZ A;  4CNK A;  3FG2 P;  4BUR A;  3B6D A;  2XVE A;  1Q9I A;  2GR1 A;  5FS6 A;  4Z2T A;  1OJC A;  4ZN0 A;  4NZH A;  4AP1 A;  2HQM A;  1LV0 A;  2WDV A;  1XHC A;  4I59 A;  3JSK A;  2RGH A;  4JDR A;  1ZOV A;  1GER A;  3QVR A;  2C66 A;  2H88 A;  5JCK A;  2AAQ A;  2C72 A;  3DA1 A;  2UZZ A;  3ATQ A;  4B64 A;  4EIQ A;  1KFY A;  2V6O A;  2WOV A;  1KF6 A;  3GD4 A;  5KVI A;  1CHU A;  4X4J A;  1PJ5 A;  2PYX A;  2R45 A;  3DME A;  1FEB A;  3P4Q A;  3VRA A;  3AYL A;  4Z44 A;  4DGK A;  3E1T A;  3AE4 A;  3QSM A;  2C76 A;  2YLW A;  3AE9 A;  1GT8 A;  4JQ9 A;  3BNM A;  1D7L A;  1ELI A;  4NTE A;  2BAC A;  3AWI A;  3NKS A;  2WP5 A;  3K7M X;  1E1N A;  2VVL A;  2WOW A;  4I58 A;  1PBE A;  2V5Z A;  3IHG A;  4U2T A;  1NHR A;  2GMH A;  3P1W A;  3ADA B;  1NHS A;  2WS3 A;  4OPU A;  3IC9 A;  2RGJ A;  3IHM A;  4H2N A;  4EM4 A;  3Q9T A;  2A87 A;  2WU2 A;  4BJY A;  5M0Z A;  5JCI A;  2X8G A;  1P2H A;  3V3N A;  1Q1R A;  2FJE A;  1H7X A;  4YXD A;  1CJ3 A;  3NYF A;  2X99 A;  1PXC A;  3CPJ G;  3ICR A;  2JK6 A;  2APG A;  3L1R A;  3C4N A;  5C2T A;  4B68 A;  3AYI A;  1IUV A;  5KVH A;  2R0P A;  4LII A;  4J31 A;  3HZL A;  4OPD A;  1E1L A;  3NG7 X;  3VRB A;  2IVE A;  3G5S A;  2BA9 A;  2AQJ A;  3KU9 A;  1PDH A;  4TLX A;  2XYO A;  4CNJ A;  1KNR A;  1N4V A;  1VG9 A;  5TR3 A;  3RNM A;  1CC2 A;  2WPF A;  1ZP0 A;  4AP3 A;  1S2Y A;  2FJD A;  3NYE A;  2RGO A;  3DJD A;  1MO9 A;  4USQ A;  4U8P A;  3AEA A;  1BZL A;  1IUU A;  3AEB A;  1W4X A;  4K7Z A;  4UP3 A;  4B1B A;  1MOK A;  2Y6R A;  5JCM A;  2IVD A;  3CPI G;  3EPT A;  2IID A;  3GRT A;  3KD9 A;  1FL2 A;  2QA2 A;  3NTD A;  2YR5 A;  3P4P A;  4J34 A;  3BNU A;  1GAL A;  2EQ8 A;  2PHH A;  1O5W A;  1D4D A;  3ATR A;  4TM0 A;  3AB1 A;  2ARD A;  1D5T A;  3PS9 A;  3CGE A;  1NHP A;  2BXS A;  2TPR A;  3SM8 A;  3T37 A;  1JOA A;  2XCG A;  3NK1 X;  2VOU A;  4YKF A;  2Z5Y A;  5EOW A;  4RG3 A;  2Q0L A;  3UP4 A;  2XDO A;  3NN6 X;  4GRT A;  1GRE A;  1GRB A;  4XWR A;  4Y4L A;  1CJ2 A;  1JEH A;  5BVA A;  2Q0K A;  4H4W A;  3ABV A;  5HHF A;  2V3A A;  3H8I A;  1DNC A;  3ICS A;  4GUV A;  3GYJ A;  1XPQ A;  3G5R A;  2R46 A;  4LU6 A;  3NYC A;  4AOS A;  4C74 A;  2C64 A;  1NHQ A;  2YQU A;  4O5U A;  3CNS A;  2OAM A;  4D04 A;  4EMJ A;  5C3J A;  2YVG A;  1GES A;  3QSS A;  5BUK A;  5BRT A;  4J56 A;  2WU5 A;  3IF9 A;  3F8P A;  3ICT A;  1CL0 A;  4IA5 A;  4B66 A;  2OAL A;  2J3N A;  1TYT A;  2EQ7 A;  2GEW A;  3QVP A;  1DJQ A;  3UP5 A;  2R4E A;  4H4P A;  3H4K A;  4K5S A;  4YSY A;  2XVF A;  4K2X A;  3BI2 A;  2Q6U A;  3RHA A;  1BWC A;  1K0J A;  2JAE A;  3AEE A;  1UKV G;  1H86 A;  1BGN A;  4NTC A;  3M0O A;  1OJ9 A;  3G5Q A;  4C3X A;  2GR2 A;  1GRA A;  4Z2R A;  4U8O A;  1GEU A;  2BS4 A;  4C77 A;  1ZOY A;  5EB5 A;  1LQT A;  3M13 A;  1E39 A;  2BK4 A;  5KOW A;  3AXB A;  4H4X A;  3UKL A;  2YM2 A;  2FJB A;  2GRT A;  4A79 A;  4N9X A;  4EQR A;  3O0H A;  1F8W A;  1TDN A;  1FOH A; 
#chains in the Genus database with same CATH topology
 1JRY A;  2V61 A;  3CNP A;  4WCT A;  2XFU A;  2W0H A;  3AE5 A;  4Y4N A;  4EMI A;  2NVK X;  3GDP A;  4APN A;  2A8X A;  2C65 A;  5GSN A;  3UKP A;  1COY A;  3AE3 A;  1NPX A;  2GAH B;  3QFA A;  4REK A;  5KMP A;  3SGL A;  5JCN A;  3SZ0 A;  4CCQ A;  1E7P A;  1PXB A;  1Y56 B;  3SZF A;  3UTH A;  3ZYX A;  3CNJ A;  2FJA A;  2YLZ A;  4GAV A;  5GRT A;  4Z25 A;  5KWF A;  2BYB A;  4YTN A;  4A6N B;  3LZX A;  1TDO A;  2R0C A;  4M52 A;  1ZK7 A;  5HXI A;  5BUL A;  1DJN A;  3UKQ A;  1RYI A;  4U8K A;  4OPC A;  1E1K A;  1E6E A;  5DBJ A;  2ZBW A;  3CGD A;  4JY3 A;  4OPT A;  1P2E A;  1D7Y A;  3DJE A;  2WP6 A;  3AE7 A;  4U2L A;  5IPY A;  1DOD A;  4ECH A;  3NH3 X;  1B4V A;  4OPG A;  5CQF A;  3T2Z A;  1BKW A;  2JB3 A;  4IA6 A;  4UDQ A;  1EBD A;  1ZX9 A;  1M64 A;  1QO8 A;  3LJP A;  4IVM B;  1JNR A;  3VR8 A;  3UTG A;  5KNL A;  3LXD A;  1PBD A;  1TDE A;  1QLB A;  3GRS A;  2R9Z A;  2VQ7 A;  4NEW A;  4RG4 A;  3R9U A;  2Y6Q A;  2GV8 A;  4A65 A;  4GDE A;  1S2Q A;  3LZW A;  3GWF A;  4H7U A;  3BHF A;  3NK0 X;  4AT0 A;  1Y56 A;  1RSG A;  2R0G A;  2XFQ A;  2XLR A;  2O9Z A;  3AE8 A;  2Z5X A;  2BS2 A;  3NK2 X;  4H4S A;  4C5O A;  2XLT A;  1K0I A;  3SYI A;  3DJJ A;  3NN0 X;  3NLC A;  4H2P A;  5M10 A;  3NIX A;  4HA6 A;  4RSL A;  1LVL A;  4OVI A;  5ER0 A;  1GXF A;  1TRB A;  3FPZ A;  5L46 A;  1M6I A;  4BV6 A;  3ALJ A;  2XLS A;  1AOG A;  2BRA A;  5IQ1 A;  1LTX R;  3F8R A;  1ZY8 A;  2WES A;  3AE2 A;  4E0V A;  3BI4 A;  4EM3 A;  1N4U A;  5J60 A;  3GMC A;  2ACZ A;  3F8D A;  2JBV A;  2WOI A;  3DGZ A;  1JNZ A;  4YT0 A;  1Z6L A;  2YG6 A;  1L9E A;  2BCG G;  2XLP A;  1IUT A;  1H7W A;  1OJD A;  4J33 A;  4Y4M A;  3SFD A;  1TYP A;  2GF3 A;  4J36 A;  2GAG B;  4BK2 A;  2YG4 A;  2FBW A;  3CMM A;  4H4Z A;  2GR0 A;  4II3 A;  3BHK A;  1S3E A;  5U1O A;  2YG3 A;  4HB9 A;  4A99 A;  4DSH A;  3C4A A;  3HYV A;  2VRL A;  3I3L A;  2V60 A;  4H2R A;  4NTD A;  5EBK A;  2YVJ A;  4A5L A;  2JB1 A;  1PN0 A;  1L9C A;  1YQ4 A;  2C75 A;  1N1P A;  2WQY A;  3DK9 A;  1GND A;  3AE6 A;  4FDC B;  1GTE A;  2XVI A;  1E1M A;  1B37 A;  3FIM B;  1IUS A;  1EL8 A;  4A7A A;  3ALM A;  4FK1 A;  3CN8 A;  3RP6 A;  5EB4 A;  4CRT A;  3GWD A;  1NG3 A;  2B76 A;  1SEZ A;  4JY2 A;  3RED A;  2GQW A;  1GRT A;  5KMR A;  1VQW A;  1O94 A;  1EL7 A;  4P9S A;  3QJ4 A;  4G73 A;  1CJC A;  2C70 A;  4ZCC A;  4U8J A;  1EL5 A;  1X31 B;  2YG5 A;  1ZMD A;  3SQP A;  2DKI A;  3DJG X;  3FBS A;  3UKF A;  3CNT A;  3UOX A;  1L0V A;  4TM3 A;  5LV9 A;  3DGH A;  3VR9 A;  4H4U A;  4J2W A;  3RP7 A;  2F5Z A;  4DSG A;  1Q1W A;  4B65 A;  1YKJ A;  4UDP A;  3KPF A;  1CBO A;  5FS8 A;  4YSX A;  4G74 A;  1BGJ A;  5J7X A;  2XLU A;  1DOE A;  3UCL A;  1BF3 A;  4GR1 A;  5KMQ A;  2BAB A;  1KNP A;  3HYX A;  3AD9 B;  5KXJ A;  3KKJ A;  3LOV A;  2JB2 A;  2QA1 A;  1KDG A;  1V59 A;  1D4C A;  2VQB A;  5FS9 A;  3UOY A;  3CGB A;  3M12 A;  3I6D A;  5U25 A;  3FMW A;  1GSN A;  4NWZ A;  4O5Q A;  2C73 A;  2OLN A;  1F6M A;  4G6G A;  3K7T A;  1NAA A;  4BK1 A;  4X9N A;  3T2Y A;  2YLX A;  1K0L A;  3AD8 B;  2C7G A;  4EIP A;  1YY5 A;  1ONF A;  4PAA A;  4Z26 A;  1PBB A;  4CY6 A;  1GOS A;  1XAN A;  5FS7 A;  3UOV A;  4CBQ A;  4KPR A;  3K30 A;  2E5V A;  1CJ4 A;  1FCD A;  3C96 A;  3DH9 A;  1L9D A;  1OJA A;  3T2K A;  3NHO X;  2C67 A;  2WDQ A;  1ZMC A;  1FEC A;  4YSH A;  1NEK A;  2GR3 A;  3WE0 A;  5KOX A;  1H6V A;  2B7R A;  4YSZ A;  1ZDL A;  1TDF A;  1VDC A;  2E1M A;  3IWA A;  3SZC A;  2XFN A;  3UKK A;  2XVH A;  3ISH A;  4ICY A;  2VVM A;  1GTH A;  2XVJ A;  2GVC A;  4K22 A;  3D1C A;  1GET A;  2QCU A;  3L8K A;  4AOX A;  2BRY A;  2Q7V A;  4MJW A;  3P4S A;  4U8N A;  4EQW A;  1GRH A;  3UKH A;  2TMD A;  2YM1 A;  4JNA A;  3AD7 B;  1HYU A;  4YTP A;  1GRF A;  1YQZ A;  2R4J A;  1IUX A;  1PXA A;  4OPI A;  3VRD B;  2RAB A;  2B9Y A;  3V3O A;  3SZW A;  4J57 A;  4USR A;  4OPL A;  1F3P A;  3NNE A;  1GPE A;  1QJD A;  4GCM A;  4H4Y A;  1OJT A;  1PS9 A;  4IVO B;  4B63 A;  2WET A;  1B8S A;  2V3B A;  3UKA A;  3COX A;  3QFB A;  1LPF A;  2GMJ A;  1PHH A;  2VZ2 A;  3Q6J A;  4GDP A;  4YTM A;  4YWO A;  4YKG A;  2CFY A;  2YG7 A;  3UTF A;  2BXR A;  3CPH G;  4TLZ A;  4C3Y A;  4EQX A;  2YWL A;  3VQR A;  1NDA A;  1F8S A;  2BC0 A;  3OZ2 A;  1K4Q A;  2X50 A;  3S61 A;  3PO7 A;  2H89 A;  1Y0P A;  3H8L A;  4K5R A;  1CC4 A;  1H81 A;  1PJ6 A;  5HY5 A;  4ZCD A;  3GMB A;  1VRQ B;  4CCR A;  1S3B A;  2XFO A;  4U8I A;  3ALL A;  3DK8 A;  4PAB A;  2X8C A;  3KLJ A;  4KX6 A;  4NEV A;  1H82 A;  2GH5 A;  3D8X A;  2GB0 A;  2VVL G;  4FK1 C;  3BI5 A;  3URH A;  3KA7 A;  1FEA A;  2BC1 A;  4H4R A;  2YLT A;  2XFP A;  3AE1 A;  3NTA A;  5U63 A;  4AT2 A;  1NG4 A;  1YQ3 A;  3CIR A;  3CGC A;  1DXL A;  3AEC A;  1CC6 A;  2ZZB A;  1H83 A;  1D4E A;  2C3C A;  4JNQ A;  2B9W A;  3HYW A;  4H4V A;  3AED A;  5HYM A;  2I0Z A;  4Z43 A;  1CF3 A;  4EMW A;  4H4T A;  4LA1 A;  3B3R A;  2YAU A;  3ITJ A;  4U8M A;  4GF7 A;  2BK5 A;  4D03 A;  1IJH A;  1EL9 A;  1ZKQ A;  2WHD A;  3DK4 A;  4X9M A;  4XXG A;  3EAO A;  3ZDN A;  4XWZ A;  3SFE A;  2WP9 A;  2YR6 A;  2X3N A;  1LQU A;  3NGC X;  1JRZ A;  5IQ4 A;  1H84 A;  1B5Q A;  3GYI A;  2E4G A;  1KSS A;  3EF6 A;  5JCL A;  2NPX A;  2QAE A;  2YLR A;  4H50 A;  1KSU A;  3SY4 A;  4H4Q A;  2C3D A;  3V76 A;  1MXT A;  1N4W A;  1REO A;  2OA1 A;  3AEF A;  3P4R A;  4BK3 A;  2WPE A;  2YVF A;  3CND A;  1LJ1 A;  1VG0 A;  2WPC A;  3P9U A;  3S5W A;  2ZZ0 A;  1IUW A;  1GRG A;  3T14 A;  1NEN A;  3KVE A;  5KRQ A;  1JU2 A;  1XDI A;  2WBA A;  2BCP A;  2WEU A;  1GV4 A;  2EQ9 A;  3AYJ A;  3CTY A;  1F8R A;  4TM4 A;  4UDR A;  2BK3 A;  2B9X A;  4B69 A;  4ADW A;  2OLO A;  3RP8 A;  3K7Q X;  2EQ6 A;  4U8L A;  2CVJ A;  4TM1 A;  2JKC A;  1PJ7 A;  2YLS A;  3UTE A;  4A9W A;  2B7S A;  3GDN A;  4IV9 A;  4BJZ A;  2X8H A;  5FMH A;  4FX9 A;  3PVC A;  4EQS A;  3T31 A;  4A6N A;  3LAD A;  4OCG A;  4U2S A;  4DNA A;  4G9K A;  3II4 A;  1DOC A;  2A89 A;  1O95 A;  1DOB A;  3GSI A;  4WX1 A;  3NRN A;  4Z24 A;  4Z2U A;  1PBC A;  4H2Q A;  2BS3 A;  4GAP A;  3NT6 A;  3GYX A;  4K8D A;  3LB8 A;  1PBF A;  2DKH A;  2GQF A;  2WDR A;  4B67 A;  1JRX A;  2CDU A;  3GD3 A;  3AEG A;  5CKU A;  1RP0 A;  2AR8 A;  2ZZC A;  1TDK A;  2YR4 A;  4JN9 A;  4CY8 A;  3OC4 A;  3EAN A;  2CUL A;  3QSE A;  2VRM A;  3UOZ A;  4CNK A;  3FG2 P;  4BUR A;  3B6D A;  2XVE A;  1Q9I A;  2GR1 A;  5FS6 A;  4Z2T A;  1OJC A;  4ZN0 A;  4NZH A;  4AP1 A;  2HQM A;  1LV0 A;  2WDV A;  1XHC A;  4I59 A;  3JSK A;  2RGH A;  4JDR A;  1ZOV A;  1GER A;  3QVR A;  2C66 A;  2H88 A;  5JCK A;  2AAQ A;  2C72 A;  3DA1 A;  2UZZ A;  3ATQ A;  4B64 A;  4EIQ A;  1KFY A;  2V6O A;  2WOV A;  1KF6 A;  3GD4 A;  5KVI A;  1CHU A;  4X4J A;  1PJ5 A;  2PYX A;  2R45 A;  3DME A;  1FEB A;  3P4Q A;  3VRA A;  3AYL A;  4Z44 A;  4DGK A;  3E1T A;  2C4C A;  3AE4 A;  2C76 A;  2YLW A;  3AE9 A;  1GT8 A;  3QSM A;  4JQ9 A;  3BNM A;  1D7L A;  1ELI A;  4NTE A;  2BAC A;  3AWI A;  3NKS A;  2WP5 A;  3K7M X;  1E1N A;  2VVL A;  2WOW A;  4I58 A;  1PBE A;  2V5Z A;  3IHG A;  4U2T A;  1NHR A;  2GMH A;  3P1W A;  3ADA B;  1NHS A;  2WS3 A;  4OPU A;  3IC9 A;  2RGJ A;  3IHM A;  4H2N A;  4EM4 A;  3Q9T A;  2A87 A;  2WU2 A;  4BJY A;  5M0Z A;  5JCI A;  2X8G A;  1P2H A;  3V3N A;  4II2 A;  1Q1R A;  2FJE A;  1H7X A;  4YXD A;  1CJ3 A;  3NYF A;  2X99 A;  3SX6 A;  1PXC A;  3CPJ G;  3ICR A;  2JK6 A;  2APG A;  3L1R A;  3C4N A;  5C2T A;  4B68 A;  3AYI A;  3T0K A;  1IUV A;  5KVH A;  2R0P A;  4LII A;  4J31 A;  3HZL A;  4OPD A;  1E1L A;  3NG7 X;  3VRB A;  2IVE A;  3G5S A;  2BA9 A;  2AQJ A;  3KU9 A;  1PDH A;  4TLX A;  2XYO A;  4CNJ A;  1KNR A;  1N4V A;  1VG9 A;  5TR3 A;  3RNM A;  1CC2 A;  2WPF A;  1ZP0 A;  4AP3 A;  1S2Y A;  2FJD A;  3NYE A;  2RGO A;  3DJD A;  1MO9 A;  4NNJ A;  4U8P A;  4USQ A;  3AEA A;  1BZL A;  1IUU A;  3AEB A;  1W4X A;  4K7Z A;  4UP3 A;  4B1B A;  1MOK A;  2Y6R A;  5JCM A;  2IVD A;  3CPI G;  3EPT A;  2IID A;  3GRT A;  3KD9 A;  1FL2 A;  2QA2 A;  3NTD A;  2YR5 A;  3P4P A;  4J34 A;  5KMS A;  3BNU A;  1GAL A;  2EQ8 A;  2PHH A;  1O5W A;  1D4D A;  3ATR A;  4TM0 A;  3AB1 A;  2ARD A;  1D5T A;  3PS9 A;  3CGE A;  1NHP A;  2BXS A;  2TPR A;  3SM8 A;  3T37 A;  1JOA A;  2XCG A;  3NK1 X;  2VOU A;  4YKF A;  2Z5Y A;  5EOW A;  4RG3 A;  2Q0L A;  3UP4 A;  2XDO A;  3SXI A;  3NN6 X;  4GRT A;  1GRE A;  1GRB A;  4XWR A;  4G6H A;  1CJ2 A;  1JEH A;  4Y4L A;  2Q0K A;  4H4W A;  5BVA A;  3ABV A;  5HHF A;  2V3A A;  3H8I A;  1DNC A;  3ICS A;  4GUV A;  3GYJ A;  1XPQ A;  3G5R A;  2R46 A;  4LU6 A;  3NYC A;  4AOS A;  4C74 A;  2C64 A;  1NHQ A;  2YQU A;  4O5U A;  3CNS A;  2OAM A;  4D04 A;  4EMJ A;  5C3J A;  2YVG A;  1GES A;  3QSS A;  5BUK A;  5BRT A;  4J56 A;  2WU5 A;  3IF9 A;  3F8P A;  3ICT A;  1CL0 A;  4IA5 A;  4B66 A;  2OAL A;  2J3N A;  1TYT A;  2EQ7 A;  2GEW A;  3QVP A;  1DJQ A;  3UP5 A;  2R4E A;  4H4P A;  3KPK A;  3H4K A;  4K5S A;  4YSY A;  2XVF A;  4K2X A;  3BI2 A;  2Q6U A;  3RHA A;  1BWC A;  1K0J A;  2JAE A;  3AEE A;  1UKV G;  1H86 A;  1BGN A;  4NTC A;  3M0O A;  1OJ9 A;  3G5Q A;  4C3X A;  2GR2 A;  1GRA A;  4Z2R A;  4U8O A;  1GEU A;  2BS4 A;  4C77 A;  1ZOY A;  5EB5 A;  1LQT A;  3M13 A;  1E39 A;  2BK4 A;  5KOW A;  3AXB A;  4H4X A;  3UKL A;  2YM2 A;  2FJB A;  2GRT A;  4A79 A;  4N9X A;  4EQR A;  3O0H A;  1F8W A;  1TDN A;  1FOH A; 
#chains in the Genus database with same CATH homology
 1JRY A;  2V61 A;  3CNP A;  4WCT A;  2XFU A;  2W0H A;  3AE5 A;  4Y4N A;  4EMI A;  2NVK X;  3GDP A;  4APN A;  2A8X A;  2C65 A;  5GSN A;  3UKP A;  1COY A;  3AE3 A;  1NPX A;  2GAH B;  3QFA A;  4REK A;  5KMP A;  3SGL A;  5JCN A;  3SZ0 A;  4CCQ A;  1E7P A;  1PXB A;  1Y56 B;  3SZF A;  3UTH A;  3ZYX A;  3CNJ A;  2FJA A;  2YLZ A;  4GAV A;  5GRT A;  4Z25 A;  5KWF A;  2BYB A;  4YTN A;  4A6N B;  3LZX A;  1TDO A;  2R0C A;  4M52 A;  1ZK7 A;  5HXI A;  5BUL A;  1DJN A;  3UKQ A;  1RYI A;  4U8K A;  4OPC A;  1E1K A;  1E6E A;  5DBJ A;  2ZBW A;  3CGD A;  4JY3 A;  4OPT A;  1P2E A;  1D7Y A;  3DJE A;  2WP6 A;  3AE7 A;  4U2L A;  5IPY A;  1DOD A;  4ECH A;  3NH3 X;  1B4V A;  4OPG A;  5CQF A;  3T2Z A;  1BKW A;  2JB3 A;  4IA6 A;  4UDQ A;  1EBD A;  1ZX9 A;  1M64 A;  1QO8 A;  3LJP A;  4IVM B;  1JNR A;  3VR8 A;  3UTG A;  5KNL A;  3LXD A;  1PBD A;  1TDE A;  1QLB A;  3GRS A;  2R9Z A;  2VQ7 A;  4NEW A;  4RG4 A;  3R9U A;  2Y6Q A;  2GV8 A;  4A65 A;  4GDE A;  1S2Q A;  3LZW A;  3GWF A;  4H7U A;  3BHF A;  3NK0 X;  4AT0 A;  1Y56 A;  1RSG A;  2R0G A;  2XFQ A;  2XLR A;  2O9Z A;  3AE8 A;  2Z5X A;  2BS2 A;  3NK2 X;  4H4S A;  4C5O A;  2XLT A;  1K0I A;  3SYI A;  3DJJ A;  3NN0 X;  3NLC A;  4H2P A;  5M10 A;  3NIX A;  4HA6 A;  4RSL A;  1LVL A;  4OVI A;  5ER0 A;  1GXF A;  1TRB A;  3FPZ A;  5L46 A;  1M6I A;  4BV6 A;  3ALJ A;  2XLS A;  1AOG A;  2BRA A;  5IQ1 A;  1LTX R;  3F8R A;  1ZY8 A;  2WES A;  3AE2 A;  4E0V A;  3BI4 A;  4EM3 A;  1N4U A;  5J60 A;  3GMC A;  2ACZ A;  3F8D A;  2JBV A;  2WOI A;  3DGZ A;  1JNZ A;  4YT0 A;  1Z6L A;  2YG6 A;  1L9E A;  2BCG G;  2XLP A;  1IUT A;  1H7W A;  1OJD A;  4J33 A;  4Y4M A;  3SFD A;  1TYP A;  2GF3 A;  4J36 A;  2GAG B;  4BK2 A;  2YG4 A;  2FBW A;  3CMM A;  4H4Z A;  2GR0 A;  4II3 A;  3BHK A;  1S3E A;  5U1O A;  2YG3 A;  4HB9 A;  4A99 A;  4DSH A;  3C4A A;  3HYV A;  2VRL A;  3I3L A;  2V60 A;  4H2R A;  4NTD A;  5EBK A;  2YVJ A;  4A5L A;  2JB1 A;  1PN0 A;  1L9C A;  1YQ4 A;  2C75 A;  1N1P A;  2WQY A;  3DK9 A;  1GND A;  3AE6 A;  4FDC B;  1GTE A;  2XVI A;  1E1M A;  1B37 A;  3FIM B;  1IUS A;  1EL8 A;  4A7A A;  3ALM A;  4FK1 A;  3CN8 A;  3RP6 A;  5EB4 A;  4CRT A;  3GWD A;  1NG3 A;  2B76 A;  1SEZ A;  4JY2 A;  3RED A;  2GQW A;  1GRT A;  5KMR A;  1VQW A;  1O94 A;  1EL7 A;  4P9S A;  3QJ4 A;  4G73 A;  1CJC A;  2C70 A;  4ZCC A;  4U8J A;  1EL5 A;  1X31 B;  2YG5 A;  1ZMD A;  3SQP A;  2DKI A;  3DJG X;  3FBS A;  3UKF A;  3CNT A;  3UOX A;  1L0V A;  4TM3 A;  5LV9 A;  3DGH A;  3VR9 A;  4H4U A;  4J2W A;  3RP7 A;  2F5Z A;  4DSG A;  1Q1W A;  4B65 A;  1YKJ A;  4UDP A;  3KPF A;  1CBO A;  5FS8 A;  4YSX A;  4G74 A;  1BGJ A;  5J7X A;  2XLU A;  1DOE A;  3UCL A;  1BF3 A;  4GR1 A;  5KMQ A;  2BAB A;  1KNP A;  3HYX A;  3AD9 B;  5KXJ A;  3KKJ A;  3LOV A;  2JB2 A;  2QA1 A;  1KDG A;  1V59 A;  1D4C A;  2VQB A;  5FS9 A;  3UOY A;  3CGB A;  3M12 A;  3I6D A;  5U25 A;  3FMW A;  1GSN A;  4NWZ A;  4O5Q A;  2C73 A;  2OLN A;  1F6M A;  4G6G A;  3K7T A;  1NAA A;  4BK1 A;  4X9N A;  3T2Y A;  2YLX A;  1K0L A;  3AD8 B;  2C7G A;  4EIP A;  1YY5 A;  1ONF A;  4PAA A;  4Z26 A;  1PBB A;  4CY6 A;  1GOS A;  1XAN A;  5FS7 A;  3UOV A;  4CBQ A;  4KPR A;  3K30 A;  2E5V A;  1CJ4 A;  1FCD A;  3C96 A;  3DH9 A;  1L9D A;  1OJA A;  3T2K A;  3NHO X;  2C67 A;  2WDQ A;  1ZMC A;  1FEC A;  4YSH A;  1NEK A;  2GR3 A;  3WE0 A;  5KOX A;  1H6V A;  2B7R A;  4YSZ A;  1ZDL A;  1TDF A;  1VDC A;  2E1M A;  3IWA A;  3SZC A;  2XFN A;  3UKK A;  2XVH A;  3ISH A;  4ICY A;  2VVM A;  1GTH A;  2XVJ A;  2GVC A;  4K22 A;  3D1C A;  1GET A;  2QCU A;  3L8K A;  4AOX A;  2BRY A;  2Q7V A;  4MJW A;  3P4S A;  4U8N A;  4EQW A;  1GRH A;  3UKH A;  2TMD A;  2YM1 A;  4JNA A;  3AD7 B;  1HYU A;  4YTP A;  1GRF A;  1YQZ A;  2R4J A;  1IUX A;  1PXA A;  4OPI A;  3VRD B;  2RAB A;  2B9Y A;  3V3O A;  3SZW A;  4J57 A;  4USR A;  4OPL A;  1F3P A;  3NNE A;  1GPE A;  1QJD A;  4GCM A;  4H4Y A;  1OJT A;  1PS9 A;  4IVO B;  4B63 A;  2WET A;  1B8S A;  2V3B A;  3UKA A;  3COX A;  3QFB A;  1LPF A;  2GMJ A;  1PHH A;  2VZ2 A;  3Q6J A;  4GDP A;  4YTM A;  4YWO A;  4YKG A;  2CFY A;  2YG7 A;  3UTF A;  2BXR A;  3CPH G;  4TLZ A;  4C3Y A;  4EQX A;  2YWL A;  3VQR A;  1NDA A;  1F8S A;  2BC0 A;  3OZ2 A;  1K4Q A;  2X50 A;  3S61 A;  3PO7 A;  2H89 A;  1Y0P A;  3H8L A;  4K5R A;  1CC4 A;  1H81 A;  1PJ6 A;  5HY5 A;  4ZCD A;  3GMB A;  1VRQ B;  4CCR A;  1S3B A;  2XFO A;  4U8I A;  3ALL A;  3DK8 A;  4PAB A;  2X8C A;  3KLJ A;  4KX6 A;  4NEV A;  1H82 A;  2GH5 A;  3D8X A;  2GB0 A;  2VVL G;  4FK1 C;  3BI5 A;  3URH A;  3KA7 A;  1FEA A;  2BC1 A;  4H4R A;  2YLT A;  2XFP A;  3AE1 A;  3NTA A;  5U63 A;  4AT2 A;  1NG4 A;  1YQ3 A;  3CIR A;  3CGC A;  1DXL A;  3AEC A;  1CC6 A;  2ZZB A;  1H83 A;  1D4E A;  2C3C A;  4JNQ A;  2B9W A;  3HYW A;  4H4V A;  3AED A;  5HYM A;  2I0Z A;  4Z43 A;  1CF3 A;  4EMW A;  4H4T A;  4LA1 A;  3B3R A;  2YAU A;  3ITJ A;  4U8M A;  4GF7 A;  2BK5 A;  4D03 A;  1IJH A;  1EL9 A;  1ZKQ A;  2WHD A;  3DK4 A;  4X9M A;  4XXG A;  3EAO A;  3ZDN A;  4XWZ A;  3SFE A;  2WP9 A;  2YR6 A;  2X3N A;  1LQU A;  3NGC X;  1JRZ A;  5IQ4 A;  1H84 A;  1B5Q A;  3GYI A;  2E4G A;  1KSS A;  3EF6 A;  5JCL A;  2NPX A;  2QAE A;  2YLR A;  4H50 A;  1KSU A;  3SY4 A;  4H4Q A;  2C3D A;  3V76 A;  1MXT A;  1N4W A;  1REO A;  2OA1 A;  3AEF A;  3P4R A;  4BK3 A;  2WPE A;  2YVF A;  3CND A;  1LJ1 A;  1VG0 A;  2WPC A;  3P9U A;  3S5W A;  2ZZ0 A;  1IUW A;  1GRG A;  3T14 A;  1NEN A;  3KVE A;  5KRQ A;  1JU2 A;  1XDI A;  2WBA A;  2BCP A;  2WEU A;  1GV4 A;  2EQ9 A;  3AYJ A;  3CTY A;  1F8R A;  4TM4 A;  4UDR A;  2BK3 A;  2B9X A;  4B69 A;  4ADW A;  2OLO A;  3RP8 A;  3K7Q X;  2EQ6 A;  4U8L A;  2CVJ A;  4TM1 A;  2JKC A;  1PJ7 A;  2YLS A;  3UTE A;  4A9W A;  2B7S A;  3GDN A;  4IV9 A;  4BJZ A;  2X8H A;  5FMH A;  4FX9 A;  3PVC A;  4EQS A;  3T31 A;  4A6N A;  3LAD A;  4OCG A;  4U2S A;  4DNA A;  4G9K A;  3II4 A;  1DOC A;  2A89 A;  1O95 A;  1DOB A;  3GSI A;  4WX1 A;  3NRN A;  4Z24 A;  4Z2U A;  1PBC A;  4H2Q A;  2BS3 A;  4GAP A;  3NT6 A;  3GYX A;  4K8D A;  3LB8 A;  1PBF A;  2DKH A;  2GQF A;  2WDR A;  4B67 A;  1JRX A;  2CDU A;  3GD3 A;  3AEG A;  5CKU A;  1RP0 A;  2AR8 A;  2ZZC A;  1TDK A;  2YR4 A;  4JN9 A;  4CY8 A;  3OC4 A;  3EAN A;  2CUL A;  3QSE A;  2VRM A;  3UOZ A;  4CNK A;  3FG2 P;  4BUR A;  3B6D A;  2XVE A;  1Q9I A;  2GR1 A;  5FS6 A;  4Z2T A;  1OJC A;  4ZN0 A;  4NZH A;  4AP1 A;  2HQM A;  1LV0 A;  2WDV A;  1XHC A;  4I59 A;  3JSK A;  2RGH A;  4JDR A;  1ZOV A;  1GER A;  3QVR A;  2C66 A;  2H88 A;  5JCK A;  2AAQ A;  2C72 A;  3DA1 A;  2UZZ A;  3ATQ A;  4B64 A;  4EIQ A;  1KFY A;  2V6O A;  2WOV A;  1KF6 A;  3GD4 A;  5KVI A;  1CHU A;  4X4J A;  1PJ5 A;  2PYX A;  2R45 A;  3DME A;  1FEB A;  3P4Q A;  3VRA A;  3AYL A;  4Z44 A;  4DGK A;  3E1T A;  2C4C A;  3AE4 A;  2C76 A;  2YLW A;  3AE9 A;  1GT8 A;  3QSM A;  4JQ9 A;  3BNM A;  1D7L A;  1ELI A;  4NTE A;  2BAC A;  3AWI A;  3NKS A;  2WP5 A;  3K7M X;  1E1N A;  2VVL A;  2WOW A;  4I58 A;  1PBE A;  2V5Z A;  3IHG A;  4U2T A;  1NHR A;  2GMH A;  3P1W A;  3ADA B;  1NHS A;  2WS3 A;  4OPU A;  3IC9 A;  2RGJ A;  3IHM A;  4H2N A;  4EM4 A;  3Q9T A;  2A87 A;  2WU2 A;  4BJY A;  5M0Z A;  5JCI A;  2X8G A;  1P2H A;  3V3N A;  4II2 A;  1Q1R A;  2FJE A;  1H7X A;  4YXD A;  1CJ3 A;  3NYF A;  2X99 A;  3SX6 A;  1PXC A;  3CPJ G;  3ICR A;  2JK6 A;  2APG A;  3L1R A;  3C4N A;  5C2T A;  4B68 A;  3AYI A;  3T0K A;  1IUV A;  5KVH A;  2R0P A;  4LII A;  4J31 A;  3HZL A;  4OPD A;  1E1L A;  3NG7 X;  3VRB A;  2IVE A;  3G5S A;  2BA9 A;  2AQJ A;  3KU9 A;  1PDH A;  4TLX A;  2XYO A;  4CNJ A;  1KNR A;  1N4V A;  1VG9 A;  5TR3 A;  3RNM A;  1CC2 A;  2WPF A;  1ZP0 A;  4AP3 A;  1S2Y A;  2FJD A;  3NYE A;  2RGO A;  3DJD A;  1MO9 A;  4NNJ A;  4U8P A;  4USQ A;  3AEA A;  1BZL A;  1IUU A;  3AEB A;  1W4X A;  4K7Z A;  4UP3 A;  4B1B A;  1MOK A;  2Y6R A;  5JCM A;  2IVD A;  3CPI G;  3EPT A;  2IID A;  3GRT A;  3KD9 A;  1FL2 A;  2QA2 A;  3NTD A;  2YR5 A;  3P4P A;  4J34 A;  5KMS A;  3BNU A;  1GAL A;  2EQ8 A;  2PHH A;  1O5W A;  1D4D A;  3ATR A;  4TM0 A;  3AB1 A;  2ARD A;  1D5T A;  3PS9 A;  3CGE A;  1NHP A;  2BXS A;  2TPR A;  3SM8 A;  3T37 A;  1JOA A;  2XCG A;  3NK1 X;  2VOU A;  4YKF A;  2Z5Y A;  5EOW A;  4RG3 A;  2Q0L A;  3UP4 A;  2XDO A;  3SXI A;  3NN6 X;  4GRT A;  1GRE A;  1GRB A;  4XWR A;  4G6H A;  1CJ2 A;  1JEH A;  4Y4L A;  2Q0K A;  4H4W A;  5BVA A;  3ABV A;  5HHF A;  2V3A A;  3H8I A;  1DNC A;  3ICS A;  4GUV A;  3GYJ A;  1XPQ A;  3G5R A;  2R46 A;  4LU6 A;  3NYC A;  4AOS A;  4C74 A;  2C64 A;  1NHQ A;  2YQU A;  4O5U A;  3CNS A;  2OAM A;  4D04 A;  4EMJ A;  5C3J A;  2YVG A;  1GES A;  3QSS A;  5BUK A;  5BRT A;  4J56 A;  2WU5 A;  3IF9 A;  3F8P A;  3ICT A;  1CL0 A;  4IA5 A;  4B66 A;  2OAL A;  2J3N A;  1TYT A;  2EQ7 A;  2GEW A;  3QVP A;  1DJQ A;  3UP5 A;  2R4E A;  4H4P A;  3KPK A;  3H4K A;  4K5S A;  4YSY A;  2XVF A;  4K2X A;  3BI2 A;  2Q6U A;  3RHA A;  1BWC A;  1K0J A;  2JAE A;  3AEE A;  1UKV G;  1H86 A;  1BGN A;  4NTC A;  3M0O A;  1OJ9 A;  3G5Q A;  4C3X A;  2GR2 A;  1GRA A;  4Z2R A;  4U8O A;  1GEU A;  2BS4 A;  4C77 A;  1ZOY A;  5EB5 A;  1LQT A;  3M13 A;  1E39 A;  2BK4 A;  5KOW A;  3AXB A;  4H4X A;  3UKL A;  2YM2 A;  2FJB A;  2GRT A;  4A79 A;  4N9X A;  4EQR A;  3O0H A;  1F8W A;  1TDN A;  1FOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...