3NK0X

Complex of 6-hydroxy-l-nicotine oxidase with inhibitor bound at active site and turnover product at exit cavity
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 149
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nk0X01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nk0X02
2GH5A 4BK2A 3VRAA 2BK4A 1CC6A 2VQBA 3LZXA 3P4RA 4RSLA 4DNAA 2E4GA 3FBSA 3K7QX 2GAGB 3NYEA 4ICYA 4O5QA 1K0IA 1OJTA 1MXTA 3KVEA 2XLRA 1TDFA 3BHFA 3QSEA 4GCMA 3BHKA 2XVJA 4CY8A 3CNPA 2ACZA 4EQWA 1AOGA 2XLTA 2YVFA 4H4VA 1V59A 4TM3A 4TM0A 3OC4A 3T37A 2BXSA 2YLZA 1M6IA 1F6MA 4K5RA 4NZHA 2GMJA 1ONFA 3AEDA 4HB9A 1PS9A 4OPDA 2DKIA 1OJDA 4OPLA 2CDUA 3CNJA 2WPCA 4PABA 4RG4A 2X99A 4FX9A 3GYJA 2WP5A 2FJDA 1F8RA 3G5SA 4H4TA 3O0HA 4I58A 4CRTA 2WDRA 1GNDA 2IVDA 2DKHA 1HYUA 3DGZA 4AT2A 1JNZA 1NEKA 2B9YA 4JQ9A 5KXJA 3GWFA 4FK1C 3UTFA 4BK3A 2JK6A 2R4EA 2ZBWA 3KLJA 5HHFA 2WHDA 2B9XA 5EB5A 2WP9A 3AEFA 4J34A 3CNSA 3REDA 3NKSA 1LPFA 2CVJA 2XFPA 4IV9A 1E1LA 4BJZA 2J3NA 1ZMDA 3B3RA 2WESA 4AP3A 1D4DA 1TDKA 2YQUA 1EL7A 5EOWA 1FCDA 3FG2P 2JB3A 4FDCB 3UKQA 1JOAA 5HYMA 5KVHA 5HXIA 1Y0PA 2R0PA 2YVGA 3M13A 1ZOVA 4H4UA 2WOIA 3VRBA 4C77A 3QSSA 4KX6A 2V60A 2WQYA 3KKJA 4JDRA 1GPEA 4A99A 3K30A 2A8XA 4U8IA 1TRBA 1LQTA 5J7XA 4JN9A 3CGDA 2BCGG 1QO8A 4H2PA 4A65A 1NDAA 1PBDA 4C3YA 4H50A 1KSUA 1P2EA 1D5TA 4KPRA 1D4CA 3BNUA 1KNRA 1GTEA 2Y6QA 3UOXA 1H81A 1S3BA 4OCGA 2Q0LA 3UKHA 3AE5A 3DJEA 2XFOA 5JCLA 2WP6A 2JB1A 5BUKA 3WE0A 5U1OA 3AE7A 3AE9A 2WPEA 3AEAA 4EIQA 1CC2A 1X31B 4XXGA 1NAAA 4GUVA 2WDQA 4U2TA 3NT6A 1CC4A 1E1NA 2BC0A 4H4XA 4Z44A 1PJ6A 2UZZA 3SQPA 1S2YA 3FMWA 3GD4A 4J36A 1Y56B 3EF6A 3KPFA 4J57A 2BK5A 1D4EA 1GT8A 4MJWA 4UP3A 1L9CA 4H2QA 2XLUA 1LJ1A 4U8KA 3GDNA 3FIMB 3BI4A 1IUVA 2BS3A 2YG4A 3NHOX 5CQFA 3UP4A 1NHSA 5U63A 2X3NA 4CBQA 3AEBA 1DJQA 2YG5A 3UKAA 4D03A 4B64A 2GRTA 3DGHA 2JKCA 4U8OA 4CNKA 4B1BA 1O95A 5JCKA 5J60A 3QSMA 2VRMA 3B6DA 2OALA 3V3NA 3AYIA 3DA1A 1XDIA 2XLPA 3DH9A 5ER0A 1GRGA 2XVEA 2Z5XA 4U8NA 4WCTA 5KVIA 3KD9A 3PVCA 1IUSA 2F5ZA 4IVOB 4X9NA 1CJCA 3VRDB 3UCLA 1Q9IA 1CF3A 2R46A 3IF9A 1TDNA 1BGNA 1JNRA 4AOXA 4EMIA 1PXCA 4H2RA 5FMHA 2C72A 4I59A 2V5ZA 1KNPA 4ZCCA 3LJPA 2XFNA 2YG3A 4BV6A 1JRZA 2ARDA 4YSHA 1IUUA 1L9EA 3QFBA 4A6NA 2Q7VA 5U25A 3G5RA 2C65A 1S2QA 1H84A 4APNA 1SEZA 3UOZA 2QA1A 3UOVA 1DJNA 3ICSA 3UTEA 4Z2RA 1GEUA 2GV8A 1LV0A 2BS2A 3ISHA 2WEUA 2ZZ0A 4YTNA 2JAEA 3NTDA 1D7LA 2VRLA 5JCMA 2R9ZA 2X8HA 3VQRA 3NLCA 1GALA 2YR6A 1TYPA 3AE6A 2V61A 4DSHA 2C75A 4USQA 4ZN0A 1E6EA 2XYOA 2VZ2A 4OPGA 1NHQA 4TLXA 1XPQA 4A9WA 4H4RA 2B7RA 1GTHA 2ZZBA 2GVCA 4M52A 1ZOYA 5BVAA 2YR5A 2B7SA 4A7AA 3AE8A 3F8DA 3RP8A 1CBOA 1PJ7A 2GR0A 3UKPA 4LIIA 3SFEA 3C4AA 2GMHA 3SGLA 3CPJG 5FS8A 3QJ4A 4AT0A 3COXA 3DJJA 3NG7X 1FECA 2E1MA 4O5UA 4U8JA 4A5LA 1OJ9A 1M64A 4U8LA 3AXBA 2BK3A 1EBDA 4C74A 1ZKQA 4DGKA 1EL8A 1F8WA 1OJCA 5FS7A 2R0GA 4UDQA 2APGA 2NVKX 3Q9TA 4K2XA 1H86A 2C3CA 3LADA 2VVMA 2VVLA 2W0HA 2C3DA 2FJAA 4C3XA 1FL2A 3DJGX 3UKFA 2H88A 4HA6A 4USRA 1FEBA 1H7WA 1Q1RA 1O94A 1CJ2A 1YKJA 2V3AA 1UKVG 3NIXA 4XWZA 2GB0A 2BC1A 2GR3A 2WBAA 1KFYA 3AD9B 5M0ZA 3UKKA 1E1KA 1BF3A 1GV4A 4B66A 2WPFA 1BGJA 1FOHA 1LVLA 3K7MX 4JY2A 3ALMA 3AB1A 4J31A 3NK1X 1H83A 2YM1A 4H2NA 4YTMA 1ZX9A 3UOYA 1CL0A 1PXAA 3IC9A 1VQWA 2XDOA 3NRNA 1REOA 2YG6A 3LB8A 4NEWA 3DK8A 2XFUA 3ATRA 4GDPA 3GMBA 2AAQA 2OLNA 4TM1A 1IJHA 1L9DA 1GREA 4YKFA 3URHA 4REKA 3NN6X 4EM4A 1E39A 3ALLA 3GMCA 4K8DA 1RYIA 4TM4A 3RP6A 4Y4LA 3GDPA 1FEAA 4EQRA 3R9UA 1YQ3A 2TMDA 3AEGA 2O9ZA 1VG9A 1MOKA 2JBVA 1PJ5A 3AEEA 4BK1A 4JY3A 2OLOA 5KWFA 1MO9A 4H4QA 1B5QA 3KA7A 3P9UA 1W4XA 2Q6UA 3E1TA 2PYXA 5FS6A 3AD7B 4OPCA 2IVEA 5KRQA 1TDEA 3UTGA 3ZDNA 1ZY8A 2WDVA 5IPYA 2C70A 4CY6A 3QVRA 1GRTA 2BS4A 2V3BA 1PXBA 1P2HA 2WU2A 4J33A 3CGCA 3NTAA 2BACA 4Z26A 1Q1WA 2E5VA 3ICRA 2C73A 3S61A 2Z5YA 1DODA 3L8KA 1XANA 1KSSA 2XVIA 2RGHA 4XWRA 3LZWA 2AQJA 2WU5A 3AE1A 1EL5A 1N4UA 2WS3A 3H8LA 2XLSA 1VDCA 1GXFA 2BYBA 3CNTA 3RHAA 3UKLA 3D1CA 4B65A 3F8PA 4ADWA 1COYA 2R0CA 3M0OA 3Q6JA 5LV9A 1KF6A 3RNMA 3OZ2A 1GOSA 5IQ4A 1CJ4A 1F3PA 3CNDA 4LU6A 4X4JA 3L1RA 3I6DA 4B67A 3UP5A 3S5WA 1Y56A 1K0LA 3AE2A 4K7ZA 2CULA 4J56A 4B69A 2YLXA 4U8MA 5BULA 4H4YA 4Z2UA 3NNEA 4RG3A 2GR1A 2B9WA 1JRXA 4YSXA 3AWIA 1K0JA 2BXRA 3EAOA 1ZMCA 4U8PA 2GQFA 2AR8A 4AOSA 1EL9A 5KOXA 4OVIA 2X8CA 1QJDA 2XVHA 3NK2X 4H4WA 2Q0KA 4IVMB 4IA5A 2C67A 5IQ1A 1LTXR 1DNCA 3P1WA 1BKWA 4H4PA 2RGOA 4U2SA 2A87A 2R45A 1NHPA 3P4SA 2QAEA 5TR3A 2XFQA 4CCQA 1VG0A 5M10A 2BCPA 1GSNA 1PN0A 2I0ZA 4Y4NA 1F8SA 4OPTA 3ICTA 4A79A 3V3OA 2FJEA 2OA1A 4GR1A 2CFYA 4EMWA 2IIDA 1KDGA 4NTEA 2XCGA 3P4PA 1N4VA 3ZYXA 1DXLA 2YM2A 1H6VA 2YLRA 3AD8B 1B37A 1NPXA 3ADAB 3CGEA 3GD3A 3HZLA 3BI2A 4U2LA 4WX1A 1VRQB 3AECA 1YQZA 3H4KA 3QFAA 2RGJA 5JCIA 1ZDLA 1GRAA 1PBFA 1D7YA 1RP0A 4J2WA 4YWOA 1E7PA 2PHHA 1GESA 5L46A 4JNAA 4YXDA 1IUTA 2C76A 3VR8A 2V6OA 4BJYA 4UDPA 3PO7A 3C4NA 1XHCA 4NEVA 4EQSA 1PBCA 1TYTA 4YKGA 2EQ8A 1Z6LA 4K22A 4OPUA 2VOUA 3CGBA 3BNMA 4YT0A 1PDHA 2BABA 2EQ7A 2JB2A 3DK4A 1GRBA 1DOEA 1YQ4A 1B4VA 3G5QA 3K7TA 3GSIA 1S3EA 3CN8A 2C64A 5FS9A 2YLSA 2C66A 3LOVA 2GAHB 2ZZCA 3QVPA 1NHRA 2BA9A 3ALJA 3DMEA 4E0VA 2GR2A 3AE4A 1ZK7A 2A89A 3GWDA 4CCRA 1N4WA 1PBEA 2FBWA 4Z43A 1CJ3A 3GRSA 1GRFA 3ATQA 3IWAA 3II4A 4UDRA 4H4ZA 5GRTA 3GRTA 1RSGA 4Z2TA 2X50A 2WOVA 5DBJA 3F8RA 4P9SA 5HY5A 3SM8A 2EQ6A 2OAMA 1E1MA 3AYLA 3RP7A 5KOWA 1LQUA 2NPXA 1ZP0A 2YLTA 2R4JA 4Z24A 2EQ9A 1O5WA 4IA6A 3DJDA 1DOCA 4GF7A 4AP1A 1BWCA 2GEWA 4CNJA 4YTPA 3CPHG 1H82A 4OPIA 4Y4MA 3JSKA 1YY5A 5C2TA 3FPZA 3NK0X 4JNQA 3DK9A 2YWLA 4TLZA 1ELIA 2C7GA 2B76A 4EMJA 4K5SA 4DSGA 4EIPA 3GYIA 3PS9A 3M12A 3NYCA 1JRYA 3H8IA 4A6NB 1NG4A 2VVLG 2HQMA 3NGCX 4X9MA 4C5OA 2WOWA 4PAAA 3AE3A 2YR4A 2YAUA 1IUXA 1DOBA 1L0VA 1IUWA 4Z25A 5CKUA 4D04A 3IHGA 5EBKA 3EANA 3V76A 2TPRA 3NYFA 2YVJA 1CHUA 3D8XA 2H89A 4NTCA 3AYJA 1QLBA 3C96A 4B63A 1B8SA 3NN0X 3ITJA 4EQXA 4EM3A 1GETA 3LXDA 4H7UA 1GERA 2RABA 1JEHA 2QA2A 3SFDA 2X8GA 4B68A 3BI5A 1PBBA 3CIRA 3P4QA 3KU9A 2VQ7A 3ABVA 1H7XA 2YG7A 1JU2A 4YSYA 1K4QA 1N1PA 3VR9A 4FK1A 4ECHA 2GQWA 3UTHA 5GSNA 3I3LA 1TDOA 3IHMA 1NENA 2Y6RA 4N9XA 5EB4A 4ZCDA 2XVFA 1OJAA 3EPTA 1BZLA 4GRTA 5C3JA 5JCNA 4BURA 5BRTA 1GRHA 3CTYA 1PHHA 4GDEA 2WETA 4NTDA 4LA1A 2FJBA 4H4SA 3NH3X 4YSZA 2GF3A 2QCUA 1NG3A 3CPIG 2YLWA
chains in the Genus database with same CATH superfamily
2GH5A 4BK2A 3VRAA 2BK4A 1CC6A 2VQBA 3LZXA 3P4RA 4RSLA 4DNAA 2E4GA 3FBSA 3K7QX 2GAGB 3NYEA 4ICYA 4O5QA 1K0IA 1OJTA 1MXTA 3KVEA 2XLRA 1TDFA 3BHFA 3QSEA 4GCMA 3BHKA 2XVJA 4CY8A 3CNPA 2ACZA 2BRAA 4EQWA 2XLTA 1AOGA 2YVFA 4H4VA 1V59A 4TM3A 4TM0A 3OC4A 3T37A 2BXSA 2YLZA 1M6IA 1F6MA 4K5RA 4NZHA 2GMJA 1ONFA 3HYVA 3AEDA 4HB9A 1PS9A 4OPDA 2DKIA 1OJDA 4OPLA 2CDUA 3CNJA 2WPCA 4PABA 4RG4A 2X99A 4FX9A 3GYJA 2WP5A 2FJDA 1F8RA 3G5SA 4H4TA 3O0HA 4I58A 4CRTA 2WDRA 1GNDA 2IVDA 2DKHA 1HYUA 3DGZA 4AT2A 1JNZA 1NEKA 2B9YA 4JQ9A 3KPKA 5KXJA 3GWFA 4FK1C 3UTFA 4BK3A 2JK6A 2R4EA 2ZBWA 3KLJA 5HHFA 2WHDA 2B9XA 5EB5A 2WP9A 3AEFA 4J34A 3CNSA 3REDA 3NKSA 1LPFA 2CVJA 2XFPA 3HYWA 1E1LA 4IV9A 4BJZA 2J3NA 1ZMDA 3B3RA 2WESA 4AP3A 1D4DA 1TDKA 2YQUA 1EL7A 5EOWA 1FCDA 3FG2P 2JB3A 4FDCB 3UKQA 1JOAA 5HYMA 5KVHA 5HXIA 1Y0PA 2R0PA 2YVGA 3M13A 1ZOVA 4H4UA 2WOIA 3VRBA 4C77A 3QSSA 4KX6A 2V60A 2WQYA 3KKJA 4JDRA 1GPEA 4A99A 3K30A 2A8XA 4U8IA 1TRBA 1LQTA 5J7XA 4JN9A 3CGDA 2BCGG 1QO8A 4H2PA 4A65A 1NDAA 1PBDA 4C3YA 4H50A 1KSUA 1P2EA 4GAVA 1D5TA 4KPRA 1D4CA 3BNUA 1KNRA 1GTEA 2Y6QA 3UOXA 1H81A 1S3BA 4OCGA 2Q0LA 3UKHA 3AE5A 3DJEA 2XFOA 5JCLA 2WP6A 2JB1A 5BUKA 3WE0A 5U1OA 3AE7A 3AE9A 2WPEA 3AEAA 4EIQA 1CC2A 1X31B 4XXGA 1NAAA 4GUVA 2WDQA 4U2TA 3NT6A 1CC4A 1E1NA 2BC0A 5KMPA 4H4XA 4Z44A 1PJ6A 2UZZA 3SQPA 1S2YA 3FMWA 3GD4A 4J36A 1Y56B 3EF6A 3KPFA 4J57A 2BK5A 1D4EA 1GT8A 4MJWA 4UP3A 1L9CA 4H2QA 2XLUA 1LJ1A 4U8KA 3GDNA 3FIMB 3BI4A 1IUVA 2BS3A 2YG4A 3NHOX 5CQFA 3UP4A 1NHSA 5U63A 2X3NA 4CBQA 3AEBA 1DJQA 2YG5A 3UKAA 4D03A 4B64A 2GRTA 3DGHA 2JKCA 4U8OA 4CNKA 4B1BA 1O95A 5JCKA 5J60A 3QSMA 4II3A 2VRMA 3B6DA 2OALA 3V3NA 3AYIA 3DA1A 1XDIA 2XLPA 3DH9A 5KMQA 5ER0A 1GRGA 2XVEA 2Z5XA 4U8NA 4WCTA 5KVIA 3KD9A 3PVCA 1IUSA 4NWZA 2F5ZA 4IVOB 4X9NA 1CJCA 3CMMA 3VRDB 3UCLA 1Q9IA 1CF3A 2R46A 3IF9A 1TDNA 1BGNA 1JNRA 4AOXA 4EMIA 1PXCA 4H2RA 5FMHA 2C72A 4I59A 2V5ZA 1KNPA 4ZCCA 3LJPA 2XFNA 2YG3A 4BV6A 1JRZA 2ARDA 4YSHA 1IUUA 1L9EA 3QFBA 4A6NA 2Q7VA 5U25A 3G5RA 2C65A 1S2QA 1H84A 4APNA 1SEZA 3UOZA 2QA1A 3UOVA 1DJNA 3ICSA 3UTEA 4Z2RA 1GEUA 2GV8A 1LV0A 2BS2A 3ISHA 2WEUA 2ZZ0A 4YTNA 2JAEA 3NTDA 1D7LA 2VRLA 5JCMA 2R9ZA 2X8HA 3VQRA 3NLCA 1GALA 2YR6A 1TYPA 3SYIA 3AE6A 2V61A 4DSHA 2C75A 4USQA 4ZN0A 1E6EA 2XYOA 2VZ2A 4OPGA 1NHQA 3T2ZA 4TLXA 1XPQA 4A9WA 4H4RA 2B7RA 1GTHA 2ZZBA 2GVCA 4M52A 1ZOYA 5BVAA 2YR5A 2B7SA 4A7AA 3AE8A 3F8DA 3RP8A 1CBOA 1PJ7A 2GR0A 3UKPA 4LIIA 3SFEA 3C4AA 2GMHA 3SGLA 3CPJG 5FS8A 3QJ4A 4AT0A 3COXA 3DJJA 3NG7X 1FECA 2E1MA 3HYXA 4G9KA 4O5UA 4U8JA 1OJ9A 1M64A 4U8LA 3AXBA 3T31A 2BK3A 4A5LA 1EBDA 4C74A 1ZKQA 4DGKA 1EL8A 1F8WA 1OJCA 5FS7A 2R0GA 4UDQA 2APGA 2NVKX 3Q9TA 4K2XA 1H86A 2C3CA 3LADA 2VVMA 2VVLA 3T2YA 2W0HA 5KNLA 2C3DA 2FJAA 4C3XA 1FL2A 3DJGX 4G74A 3UKFA 2H88A 4HA6A 4USRA 1FEBA 1H7WA 1Q1RA 1O94A 1CJ2A 1YKJA 2V3AA 1UKVG 3NIXA 4XWZA 3SX6A 2GB0A 2BC1A 2GR3A 2WBAA 1KFYA 3AD9B 5M0ZA 3UKKA 1E1KA 1BF3A 1GV4A 4II2A 2WPFA 4B66A 1BGJA 1FOHA 1LVLA 3K7MX 4JY2A 3ALMA 3AB1A 4J31A 3NK1X 1H83A 2YM1A 4H2NA 4YTMA 1ZX9A 3UOYA 1CL0A 1PXAA 3IC9A 3SY4A 1VQWA 2XDOA 3NRNA 3SZWA 1REOA 2YG6A 3LB8A 4NEWA 3DK8A 2XFUA 3ATRA 4GDPA 3GMBA 2AAQA 2OLNA 4TM1A 1IJHA 1L9DA 1GREA 4YKFA 3GYXA 3URHA 4REKA 3NN6X 3SZFA 1E39A 3ALLA 3GMCA 4K8DA 4EM4A 1RYIA 4TM4A 3RP6A 4Y4LA 3GDPA 1FEAA 4EQRA 3R9UA 1YQ3A 2TMDA 3AEGA 2O9ZA 1VG9A 1MOKA 2JBVA 1PJ5A 3AEEA 4BK1A 4JY3A 2OLOA 5KWFA 1MO9A 5KMRA 4H4QA 1B5QA 3KA7A 3P9UA 1W4XA 2Q6UA 3E1TA 2PYXA 5FS6A 3AD7B 4OPCA 2IVEA 5KRQA 1TDEA 3UTGA 3ZDNA 1ZY8A 2WDVA 3T0KA 3T14A 2C70A 4CY6A 3QVRA 5IPYA 1GRTA 2BS4A 2V3BA 1PXBA 1P2HA 2WU2A 4J33A 3CGCA 3NTAA 2BACA 4Z26A 1Q1WA 2E5VA 3ICRA 2C73A 3S61A 2Z5YA 1DODA 3L8KA 1XANA 1KSSA 2XVIA 2RGHA 4XWRA 3LZWA 2AQJA 2WU5A 3AE1A 1EL5A 1N4UA 2WS3A 3H8LA 2XLSA 1VDCA 1GXFA 2BYBA 3CNTA 3RHAA 3UKLA 3D1CA 4B65A 3F8PA 4ADWA 1COYA 2R0CA 3M0OA 3Q6JA 5LV9A 1KF6A 3RNMA 3OZ2A 1GOSA 5IQ4A 1CJ4A 1F3PA 3CNDA 4LU6A 4X4JA 3L1RA 3I6DA 4B67A 3UP5A 3S5WA 1Y56A 1K0LA 3AE2A 4K7ZA 2CULA 4J56A 4B69A 2YLXA 4U8MA 5BULA 4H4YA 4Z2UA 3NNEA 4RG3A 2GR1A 2B9WA 1JRXA 3SZCA 4YSXA 3AWIA 1K0JA 2BXRA 3EAOA 1ZMCA 4U8PA 2GQFA 2AR8A 4AOSA 1EL9A 5KOXA 4OVIA 2X8CA 1QJDA 4NNJA 2XVHA 3NK2X 4H4WA 2Q0KA 4IVMB 4IA5A 2C67A 5IQ1A 1LTXR 1DNCA 3P1WA 1BKWA 4H4PA 2RGOA 4U2SA 2A87A 2R45A 1NHPA 3P4SA 2QAEA 5TR3A 2XFQA 4CCQA 1VG0A 5M10A 2BCPA 1GSNA 1PN0A 2I0ZA 4Y4NA 1F8SA 4OPTA 3ICTA 4A79A 3V3OA 2FJEA 2OA1A 4GR1A 2CFYA 4EMWA 2IIDA 1KDGA 4NTEA 2XCGA 3P4PA 1N4VA 3ZYXA 1DXLA 2YM2A 1H6VA 2YLRA 3AD8B 1B37A 1NPXA 3ADAB 3CGEA 5KMSA 3GD3A 3HZLA 3BI2A 4U2LA 4WX1A 1VRQB 3AECA 1YQZA 2BRYA 3H4KA 3QFAA 2RGJA 5JCIA 1ZDLA 1GRAA 1PBFA 1D7YA 1RP0A 4J2WA 4YWOA 1E7PA 2PHHA 1GESA 5L46A 4JNAA 4YXDA 1IUTA 2C76A 3VR8A 2V6OA 4BJYA 4UDPA 3PO7A 3C4NA 1XHCA 4G6HA 4NEVA 4EQSA 1PBCA 1TYTA 4YKGA 2EQ8A 1Z6LA 4K22A 4OPUA 2VOUA 4G6GA 3CGBA 3BNMA 4YT0A 1PDHA 3SXIA 2BABA 2EQ7A 2JB2A 3DK4A 1GRBA 1DOEA 1YQ4A 1B4VA 3G5QA 3K7TA 3GSIA 1S3EA 3CN8A 2C64A 5FS9A 2YLSA 2C66A 3LOVA 2GAHB 2ZZCA 3QVPA 1NHRA 2BA9A 3ALJA 3DMEA 4E0VA 2GR2A 3AE4A 1ZK7A 2A89A 3GWDA 4CCRA 1N4WA 1PBEA 2FBWA 4Z43A 1CJ3A 3GRSA 1GRFA 3ATQA 3IWAA 3II4A 4UDRA 4H4ZA 5GRTA 3GRTA 1RSGA 4Z2TA 2X50A 2WOVA 5DBJA 3F8RA 4P9SA 5HY5A 3SM8A 2EQ6A 2OAMA 1E1MA 4GAPA 3AYLA 3RP7A 5KOWA 1LQUA 2NPXA 1ZP0A 2YLTA 2R4JA 4Z24A 2EQ9A 1O5WA 4IA6A 3DJDA 1DOCA 4GF7A 4AP1A 1BWCA 2GEWA 4CNJA 4YTPA 3CPHG 1H82A 4OPIA 4Y4MA 3JSKA 1YY5A 5C2TA 3FPZA 3NK0X 4JNQA 3DK9A 2YWLA 4TLZA 1ELIA 2C7GA 2B76A 4EMJA 4K5SA 4DSGA 4EIPA 3GYIA 3PS9A 3M12A 3NYCA 1JRYA 3SZ0A 3H8IA 4A6NB 1NG4A 2VVLG 2HQMA 3NGCX 4X9MA 4C5OA 2WOWA 4PAAA 3AE3A 2YR4A 2YAUA 1IUXA 1DOBA 1L0VA 1IUWA 4Z25A 5CKUA 4D04A 3IHGA 5EBKA 3EANA 2C4CA 3V76A 2TPRA 3NYFA 2YVJA 1CHUA 3D8XA 2H89A 4NTCA 3AYJA 1QLBA 3C96A 4B63A 1B8SA 3NN0X 3ITJA 4EQXA 4EM3A 1GETA 3LXDA 4H7UA 1GERA 2RABA 1JEHA 2QA2A 3SFDA 2X8GA 4B68A 3BI5A 1PBBA 3CIRA 3P4QA 3KU9A 2VQ7A 3ABVA 1H7XA 2YG7A 1JU2A 4YSYA 1K4QA 1N1PA 3VR9A 4FK1A 4ECHA 2GQWA 3UTHA 5GSNA 3I3LA 1TDOA 3IHMA 1NENA 2Y6RA 4N9XA 5EB4A 4ZCDA 2XVFA 1OJAA 3EPTA 1BZLA 4G73A 4GRTA 5C3JA 5JCNA 4BURA 5BRTA 1GRHA 3CTYA 1PHHA 4GDEA 2WETA 4NTDA 4LA1A 2FJBA 4H4SA 3NH3X 3T2KA 2GF3A 2QCUA 4YSZA 1NG3A 3CPIG 2YLWA
chains in the Genus database with same CATH topology
2GH5A 4BK2A 3VRAA 2BK4A 1CC6A 2VQBA 3LZXA 3P4RA 4RSLA 4DNAA 2E4GA 3FBSA 3K7QX 2GAGB 3NYEA 4ICYA 4O5QA 1K0IA 1OJTA 1MXTA 3KVEA 2XLRA 1TDFA 3BHFA 3QSEA 4GCMA 3BHKA 2XVJA 4CY8A 3CNPA 2ACZA 2BRAA 4EQWA 2XLTA 1AOGA 2YVFA 4H4VA 1V59A 4TM3A 4TM0A 3OC4A 3T37A 2BXSA 2YLZA 1M6IA 1F6MA 4K5RA 4NZHA 2GMJA 1ONFA 3HYVA 3AEDA 4HB9A 1PS9A 4OPDA 2DKIA 1OJDA 4OPLA 2CDUA 3CNJA 2WPCA 4PABA 4RG4A 2X99A 4FX9A 3GYJA 2WP5A 2FJDA 1F8RA 3G5SA 4H4TA 3O0HA 4I58A 4CRTA 2WDRA 1GNDA 2IVDA 2DKHA 1HYUA 3DGZA 4AT2A 1JNZA 1NEKA 2B9YA 4JQ9A 3KPKA 5KXJA 3GWFA 4FK1C 3UTFA 4BK3A 2JK6A 2R4EA 2ZBWA 3KLJA 5HHFA 2WHDA 2B9XA 5EB5A 2WP9A 3AEFA 4J34A 3CNSA 3REDA 3NKSA 1LPFA 2CVJA 2XFPA 3HYWA 1E1LA 4IV9A 4BJZA 2J3NA 1ZMDA 3B3RA 2WESA 4AP3A 1D4DA 1TDKA 2YQUA 1EL7A 5EOWA 1FCDA 3FG2P 2JB3A 4FDCB 3UKQA 1JOAA 5HYMA 5KVHA 5HXIA 1Y0PA 2R0PA 2YVGA 3M13A 1ZOVA 4H4UA 2WOIA 3VRBA 4C77A 3QSSA 4KX6A 2V60A 2WQYA 3KKJA 4JDRA 1GPEA 4A99A 3K30A 2A8XA 4U8IA 1TRBA 1LQTA 5J7XA 4JN9A 3CGDA 2BCGG 1QO8A 4H2PA 4A65A 1NDAA 1PBDA 4C3YA 4H50A 1KSUA 1P2EA 4GAVA 1D5TA 4KPRA 1D4CA 3BNUA 1KNRA 1GTEA 2Y6QA 3UOXA 1H81A 1S3BA 4OCGA 2Q0LA 3UKHA 3AE5A 3DJEA 2XFOA 5JCLA 2WP6A 2JB1A 5BUKA 3WE0A 5U1OA 3AE7A 3AE9A 2WPEA 3AEAA 4EIQA 1CC2A 1X31B 4XXGA 1NAAA 4GUVA 2WDQA 4U2TA 3NT6A 1CC4A 1E1NA 2BC0A 5KMPA 4H4XA 4Z44A 1PJ6A 2UZZA 3SQPA 1S2YA 3FMWA 3GD4A 4J36A 1Y56B 3EF6A 3KPFA 4J57A 2BK5A 1D4EA 1GT8A 4MJWA 4UP3A 1L9CA 4H2QA 2XLUA 1LJ1A 4U8KA 3GDNA 3FIMB 3BI4A 1IUVA 2BS3A 2YG4A 3NHOX 5CQFA 3UP4A 1NHSA 5U63A 2X3NA 4CBQA 3AEBA 1DJQA 2YG5A 3UKAA 4D03A 4B64A 2GRTA 3DGHA 2JKCA 4U8OA 4CNKA 4B1BA 1O95A 5JCKA 5J60A 3QSMA 4II3A 2VRMA 3B6DA 2OALA 3V3NA 3AYIA 3DA1A 1XDIA 2XLPA 3DH9A 5KMQA 5ER0A 1GRGA 2XVEA 2Z5XA 4U8NA 4WCTA 5KVIA 3KD9A 3PVCA 1IUSA 4NWZA 2F5ZA 4IVOB 4X9NA 1CJCA 3CMMA 3VRDB 3UCLA 1Q9IA 1CF3A 2R46A 3IF9A 1TDNA 1BGNA 1JNRA 4AOXA 4EMIA 1PXCA 4H2RA 5FMHA 2C72A 4I59A 2V5ZA 1KNPA 4ZCCA 3LJPA 2XFNA 2YG3A 4BV6A 1JRZA 2ARDA 4YSHA 1IUUA 1L9EA 3QFBA 4A6NA 2Q7VA 5U25A 3G5RA 2C65A 1S2QA 1H84A 4APNA 1SEZA 3UOZA 2QA1A 3UOVA 1DJNA 3ICSA 3UTEA 4Z2RA 1GEUA 2GV8A 1LV0A 2BS2A 3ISHA 2WEUA 2ZZ0A 4YTNA 2JAEA 3NTDA 1D7LA 2VRLA 5JCMA 2R9ZA 2X8HA 3VQRA 3NLCA 1GALA 2YR6A 1TYPA 3SYIA 3AE6A 2V61A 4DSHA 2C75A 4USQA 4ZN0A 1E6EA 2XYOA 2VZ2A 4OPGA 1NHQA 3T2ZA 4TLXA 1XPQA 4A9WA 4H4RA 2B7RA 1GTHA 2ZZBA 2GVCA 4M52A 1ZOYA 5BVAA 2YR5A 2B7SA 4A7AA 3AE8A 3F8DA 3RP8A 1CBOA 1PJ7A 2GR0A 3UKPA 4LIIA 3SFEA 3C4AA 2GMHA 3SGLA 3CPJG 5FS8A 3QJ4A 4AT0A 3COXA 3DJJA 3NG7X 1FECA 2E1MA 3HYXA 4G9KA 4O5UA 4U8JA 1OJ9A 1M64A 4U8LA 3AXBA 3T31A 2BK3A 4A5LA 1EBDA 4C74A 1ZKQA 4DGKA 1EL8A 1F8WA 1OJCA 5FS7A 2R0GA 4UDQA 2APGA 2NVKX 3Q9TA 4K2XA 1H86A 2C3CA 3LADA 2VVMA 2VVLA 3T2YA 2W0HA 5KNLA 2C3DA 2FJAA 4C3XA 1FL2A 3DJGX 4G74A 3UKFA 2H88A 4HA6A 4USRA 1FEBA 1H7WA 1Q1RA 1O94A 1CJ2A 1YKJA 2V3AA 1UKVG 3NIXA 4XWZA 3SX6A 2GB0A 2BC1A 2GR3A 2WBAA 1KFYA 3AD9B 5M0ZA 3UKKA 1E1KA 1BF3A 1GV4A 4II2A 2WPFA 4B66A 1BGJA 1FOHA 1LVLA 3K7MX 4JY2A 3ALMA 3AB1A 4J31A 3NK1X 1H83A 2YM1A 4H2NA 4YTMA 1ZX9A 3UOYA 1CL0A 1PXAA 3IC9A 3SY4A 1VQWA 2XDOA 3NRNA 3SZWA 1REOA 2YG6A 3LB8A 4NEWA 3DK8A 2XFUA 3ATRA 4GDPA 3GMBA 2AAQA 2OLNA 4TM1A 1IJHA 1L9DA 1GREA 4YKFA 3GYXA 3URHA 4REKA 3NN6X 3SZFA 1E39A 3ALLA 3GMCA 4K8DA 4EM4A 1RYIA 4TM4A 3RP6A 4Y4LA 3GDPA 1FEAA 4EQRA 3R9UA 1YQ3A 2TMDA 3AEGA 2O9ZA 1VG9A 1MOKA 2JBVA 1PJ5A 3AEEA 4BK1A 4JY3A 2OLOA 5KWFA 1MO9A 5KMRA 4H4QA 1B5QA 3KA7A 3P9UA 1W4XA 2Q6UA 3E1TA 2PYXA 5FS6A 3AD7B 4OPCA 2IVEA 5KRQA 1TDEA 3UTGA 3ZDNA 1ZY8A 2WDVA 3T0KA 3T14A 2C70A 4CY6A 3QVRA 5IPYA 1GRTA 2BS4A 2V3BA 1PXBA 1P2HA 2WU2A 4J33A 3CGCA 3NTAA 2BACA 4Z26A 1Q1WA 2E5VA 3ICRA 2C73A 3S61A 2Z5YA 1DODA 3L8KA 1XANA 1KSSA 2XVIA 2RGHA 4XWRA 3LZWA 2AQJA 2WU5A 3AE1A 1EL5A 1N4UA 2WS3A 3H8LA 2XLSA 1VDCA 1GXFA 2BYBA 3CNTA 3RHAA 3UKLA 3D1CA 4B65A 3F8PA 4ADWA 1COYA 2R0CA 3M0OA 3Q6JA 5LV9A 1KF6A 3RNMA 3OZ2A 1GOSA 5IQ4A 1CJ4A 1F3PA 3CNDA 4LU6A 4X4JA 3L1RA 3I6DA 4B67A 3UP5A 3S5WA 1Y56A 1K0LA 3AE2A 4K7ZA 2CULA 4J56A 4B69A 2YLXA 4U8MA 5BULA 4H4YA 4Z2UA 3NNEA 4RG3A 2GR1A 2B9WA 1JRXA 3SZCA 4YSXA 3AWIA 1K0JA 2BXRA 3EAOA 1ZMCA 4U8PA 2GQFA 2AR8A 4AOSA 1EL9A 5KOXA 4OVIA 2X8CA 1QJDA 4NNJA 2XVHA 3NK2X 4H4WA 2Q0KA 4IVMB 4IA5A 2C67A 5IQ1A 1LTXR 1DNCA 3P1WA 1BKWA 4H4PA 2RGOA 4U2SA 2A87A 2R45A 1NHPA 3P4SA 2QAEA 5TR3A 2XFQA 4CCQA 1VG0A 5M10A 2BCPA 1GSNA 1PN0A 2I0ZA 4Y4NA 1F8SA 4OPTA 3ICTA 4A79A 3V3OA 2FJEA 2OA1A 4GR1A 2CFYA 4EMWA 2IIDA 1KDGA 4NTEA 2XCGA 3P4PA 1N4VA 3ZYXA 1DXLA 2YM2A 1H6VA 2YLRA 3AD8B 1B37A 1NPXA 3ADAB 3CGEA 5KMSA 3GD3A 3HZLA 3BI2A 4U2LA 4WX1A 1VRQB 3AECA 1YQZA 2BRYA 3H4KA 3QFAA 2RGJA 5JCIA 1ZDLA 1GRAA 1PBFA 1D7YA 1RP0A 4J2WA 4YWOA 1E7PA 2PHHA 1GESA 5L46A 4JNAA 4YXDA 1IUTA 2C76A 3VR8A 2V6OA 4BJYA 4UDPA 3PO7A 3C4NA 1XHCA 4G6HA 4NEVA 4EQSA 1PBCA 1TYTA 4YKGA 2EQ8A 1Z6LA 4K22A 4OPUA 2VOUA 4G6GA 3CGBA 3BNMA 4YT0A 1PDHA 3SXIA 2BABA 2EQ7A 2JB2A 3DK4A 1GRBA 1DOEA 1YQ4A 1B4VA 3G5QA 3K7TA 3GSIA 1S3EA 3CN8A 2C64A 5FS9A 2YLSA 2C66A 3LOVA 2GAHB 2ZZCA 3QVPA 1NHRA 2BA9A 3ALJA 3DMEA 4E0VA 2GR2A 3AE4A 1ZK7A 2A89A 3GWDA 4CCRA 1N4WA 1PBEA 2FBWA 4Z43A 1CJ3A 3GRSA 1GRFA 3ATQA 3IWAA 3II4A 4UDRA 4H4ZA 5GRTA 3GRTA 1RSGA 4Z2TA 2X50A 2WOVA 5DBJA 3F8RA 4P9SA 5HY5A 3SM8A 2EQ6A 2OAMA 1E1MA 4GAPA 3AYLA 3RP7A 5KOWA 1LQUA 2NPXA 1ZP0A 2YLTA 2R4JA 4Z24A 2EQ9A 1O5WA 4IA6A 3DJDA 1DOCA 4GF7A 4AP1A 1BWCA 2GEWA 4CNJA 4YTPA 3CPHG 1H82A 4OPIA 4Y4MA 3JSKA 1YY5A 5C2TA 3FPZA 3NK0X 4JNQA 3DK9A 2YWLA 4TLZA 1ELIA 2C7GA 2B76A 4EMJA 4K5SA 4DSGA 4EIPA 3GYIA 3PS9A 3M12A 3NYCA 1JRYA 3SZ0A 3H8IA 4A6NB 1NG4A 2VVLG 2HQMA 3NGCX 4X9MA 4C5OA 2WOWA 4PAAA 3AE3A 2YR4A 2YAUA 1IUXA 1DOBA 1L0VA 1IUWA 4Z25A 5CKUA 4D04A 3IHGA 5EBKA 3EANA 2C4CA 3V76A 2TPRA 3NYFA 2YVJA 1CHUA 3D8XA 2H89A 4NTCA 3AYJA 1QLBA 3C96A 4B63A 1B8SA 3NN0X 3ITJA 4EQXA 4EM3A 1GETA 3LXDA 4H7UA 1GERA 2RABA 1JEHA 2QA2A 3SFDA 2X8GA 4B68A 3BI5A 1PBBA 3CIRA 3P4QA 3KU9A 2VQ7A 3ABVA 1H7XA 2YG7A 1JU2A 4YSYA 1K4QA 1N1PA 3VR9A 4FK1A 4ECHA 2GQWA 3UTHA 5GSNA 3I3LA 1TDOA 3IHMA 1NENA 2Y6RA 4N9XA 5EB4A 4ZCDA 2XVFA 1OJAA 3EPTA 1BZLA 4G73A 4GRTA 5C3JA 5JCNA 4BURA 5BRTA 1GRHA 3CTYA 1PHHA 4GDEA 2WETA 4NTDA 4LA1A 2FJBA 4H4SA 3NH3X 3T2KA 2GF3A 2QCUA 4YSZA 1NG3A 3CPIG 2YLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH5 A;  4BK2 A;  3VRA A;  2BK4 A;  1CC6 A;  2VQB A;  3LZX A;  3P4R A;  4RSL A;  4DNA A;  2E4G A;  3FBS A;  3K7Q X;  2GAG B;  3NYE A;  4ICY A;  4O5Q A;  1K0I A;  1OJT A;  1MXT A;  3KVE A;  2XLR A;  1TDF A;  3BHF A;  3QSE A;  4GCM A;  3BHK A;  2XVJ A;  4CY8 A;  3CNP A;  2ACZ A;  4EQW A;  1AOG A;  2XLT A;  2YVF A;  4H4V A;  1V59 A;  4TM3 A;  4TM0 A;  3OC4 A;  3T37 A;  2BXS A;  2YLZ A;  1M6I A;  1F6M A;  4K5R A;  4NZH A;  2GMJ A;  1ONF A;  3AED A;  4HB9 A;  1PS9 A;  4OPD A;  2DKI A;  1OJD A;  4OPL A;  2CDU A;  3CNJ A;  2WPC A;  4PAB A;  4RG4 A;  2X99 A;  4FX9 A;  3GYJ A;  2WP5 A;  2FJD A;  1F8R A;  3G5S A;  4H4T A;  3O0H A;  4I58 A;  4CRT A;  2WDR A;  1GND A;  2IVD A;  2DKH A;  1HYU A;  3DGZ A;  4AT2 A;  1JNZ A;  1NEK A;  2B9Y A;  4JQ9 A;  5KXJ A;  3GWF A;  4FK1 C;  3UTF A;  4BK3 A;  2JK6 A;  2R4E A;  2ZBW A;  3KLJ A;  5HHF A;  2WHD A;  2B9X A;  5EB5 A;  2WP9 A;  3AEF A;  4J34 A;  3CNS A;  3RED A;  3NKS A;  1LPF A;  2CVJ A;  2XFP A;  4IV9 A;  1E1L A;  4BJZ A;  2J3N A;  1ZMD A;  3B3R A;  2WES A;  4AP3 A;  1D4D A;  1TDK A;  2YQU A;  1EL7 A;  5EOW A;  1FCD A;  3FG2 P;  2JB3 A;  4FDC B;  3UKQ A;  1JOA A;  5HYM A;  5KVH A;  5HXI A;  1Y0P A;  2R0P A;  2YVG A;  3M13 A;  1ZOV A;  4H4U A;  2WOI A;  3VRB A;  4C77 A;  3QSS A;  4KX6 A;  2V60 A;  2WQY A;  3KKJ A;  4JDR A;  1GPE A;  4A99 A;  3K30 A;  2A8X A;  4U8I A;  1TRB A;  1LQT A;  5J7X A;  4JN9 A;  3CGD A;  2BCG G;  1QO8 A;  4H2P A;  4A65 A;  1NDA A;  1PBD A;  4C3Y A;  4H50 A;  1KSU A;  1P2E A;  1D5T A;  4KPR A;  1D4C A;  3BNU A;  1KNR A;  1GTE A;  2Y6Q A;  3UOX A;  1H81 A;  1S3B A;  4OCG A;  2Q0L A;  3UKH A;  3AE5 A;  3DJE A;  2XFO A;  5JCL A;  2WP6 A;  2JB1 A;  5BUK A;  3WE0 A;  5U1O A;  3AE7 A;  3AE9 A;  2WPE A;  3AEA A;  4EIQ A;  1CC2 A;  1X31 B;  4XXG A;  1NAA A;  4GUV A;  2WDQ A;  4U2T A;  3NT6 A;  1CC4 A;  1E1N A;  2BC0 A;  4H4X A;  4Z44 A;  1PJ6 A;  2UZZ A;  3SQP A;  1S2Y A;  3FMW A;  3GD4 A;  4J36 A;  1Y56 B;  3EF6 A;  3KPF A;  4J57 A;  2BK5 A;  1D4E A;  1GT8 A;  4MJW A;  4UP3 A;  1L9C A;  4H2Q A;  2XLU A;  1LJ1 A;  4U8K A;  3GDN A;  3FIM B;  3BI4 A;  1IUV A;  2BS3 A;  2YG4 A;  3NHO X;  5CQF A;  3UP4 A;  1NHS A;  5U63 A;  2X3N A;  4CBQ A;  3AEB A;  1DJQ A;  2YG5 A;  3UKA A;  4D03 A;  4B64 A;  2GRT A;  3DGH A;  2JKC A;  4U8O A;  4CNK A;  4B1B A;  1O95 A;  5JCK A;  5J60 A;  3QSM A;  2VRM A;  3B6D A;  2OAL A;  3V3N A;  3AYI A;  3DA1 A;  1XDI A;  2XLP A;  3DH9 A;  5ER0 A;  1GRG A;  2XVE A;  2Z5X A;  4U8N A;  4WCT A;  5KVI A;  3KD9 A;  3PVC A;  1IUS A;  2F5Z A;  4IVO B;  4X9N A;  1CJC A;  3VRD B;  3UCL A;  1Q9I A;  1CF3 A;  2R46 A;  3IF9 A;  1TDN A;  1BGN A;  1JNR A;  4AOX A;  4EMI A;  1PXC A;  4H2R A;  5FMH A;  2C72 A;  4I59 A;  2V5Z A;  1KNP A;  4ZCC A;  3LJP A;  2XFN A;  2YG3 A;  4BV6 A;  1JRZ A;  2ARD A;  4YSH A;  1IUU A;  1L9E A;  3QFB A;  4A6N A;  2Q7V A;  5U25 A;  3G5R A;  2C65 A;  1S2Q A;  1H84 A;  4APN A;  1SEZ A;  3UOZ A;  2QA1 A;  3UOV A;  1DJN A;  3ICS A;  3UTE A;  4Z2R A;  1GEU A;  2GV8 A;  1LV0 A;  2BS2 A;  3ISH A;  2WEU A;  2ZZ0 A;  4YTN A;  2JAE A;  3NTD A;  1D7L A;  2VRL A;  5JCM A;  2R9Z A;  2X8H A;  3VQR A;  3NLC A;  1GAL A;  2YR6 A;  1TYP A;  3AE6 A;  2V61 A;  4DSH A;  2C75 A;  4USQ A;  4ZN0 A;  1E6E A;  2XYO A;  2VZ2 A;  4OPG A;  1NHQ A;  4TLX A;  1XPQ A;  4A9W A;  4H4R A;  2B7R A;  1GTH A;  2ZZB A;  2GVC A;  4M52 A;  1ZOY A;  5BVA A;  2YR5 A;  2B7S A;  4A7A A;  3AE8 A;  3F8D A;  3RP8 A;  1CBO A;  1PJ7 A;  2GR0 A;  3UKP A;  4LII A;  3SFE A;  3C4A A;  2GMH A;  3SGL A;  3CPJ G;  5FS8 A;  3QJ4 A;  4AT0 A;  3COX A;  3DJJ A;  3NG7 X;  1FEC A;  2E1M A;  4O5U A;  4U8J A;  4A5L A;  1OJ9 A;  1M64 A;  4U8L A;  3AXB A;  2BK3 A;  1EBD A;  4C74 A;  1ZKQ A;  4DGK A;  1EL8 A;  1F8W A;  1OJC A;  5FS7 A;  2R0G A;  4UDQ A;  2APG A;  2NVK X;  3Q9T A;  4K2X A;  1H86 A;  2C3C A;  3LAD A;  2VVM A;  2VVL A;  2W0H A;  2C3D A;  2FJA A;  4C3X A;  1FL2 A;  3DJG X;  3UKF A;  2H88 A;  4HA6 A;  4USR A;  1FEB A;  1H7W A;  1Q1R A;  1O94 A;  1CJ2 A;  1YKJ A;  2V3A A;  1UKV G;  3NIX A;  4XWZ A;  2GB0 A;  2BC1 A;  2GR3 A;  2WBA A;  1KFY A;  3AD9 B;  5M0Z A;  3UKK A;  1E1K A;  1BF3 A;  1GV4 A;  4B66 A;  2WPF A;  1BGJ A;  1FOH A;  1LVL A;  3K7M X;  4JY2 A;  3ALM A;  3AB1 A;  4J31 A;  3NK1 X;  1H83 A;  2YM1 A;  4H2N A;  4YTM A;  1ZX9 A;  3UOY A;  1CL0 A;  1PXA A;  3IC9 A;  1VQW A;  2XDO A;  3NRN A;  1REO A;  2YG6 A;  3LB8 A;  4NEW A;  3DK8 A;  2XFU A;  3ATR A;  4GDP A;  3GMB A;  2AAQ A;  2OLN A;  4TM1 A;  1IJH A;  1L9D A;  1GRE A;  4YKF A;  3URH A;  4REK A;  3NN6 X;  4EM4 A;  1E39 A;  3ALL A;  3GMC A;  4K8D A;  1RYI A;  4TM4 A;  3RP6 A;  4Y4L A;  3GDP A;  1FEA A;  4EQR A;  3R9U A;  1YQ3 A;  2TMD A;  3AEG A;  2O9Z A;  1VG9 A;  1MOK A;  2JBV A;  1PJ5 A;  3AEE A;  4BK1 A;  4JY3 A;  2OLO A;  5KWF A;  1MO9 A;  4H4Q A;  1B5Q A;  3KA7 A;  3P9U A;  1W4X A;  2Q6U A;  3E1T A;  2PYX A;  5FS6 A;  3AD7 B;  4OPC A;  2IVE A;  5KRQ A;  1TDE A;  3UTG A;  3ZDN A;  1ZY8 A;  2WDV A;  5IPY A;  2C70 A;  4CY6 A;  3QVR A;  1GRT A;  2BS4 A;  2V3B A;  1PXB A;  1P2H A;  2WU2 A;  4J33 A;  3CGC A;  3NTA A;  2BAC A;  4Z26 A;  1Q1W A;  2E5V A;  3ICR A;  2C73 A;  3S61 A;  2Z5Y A;  1DOD A;  3L8K A;  1XAN A;  1KSS A;  2XVI A;  2RGH A;  4XWR A;  3LZW A;  2AQJ A;  2WU5 A;  3AE1 A;  1EL5 A;  1N4U A;  2WS3 A;  3H8L A;  2XLS A;  1VDC A;  1GXF A;  2BYB A;  3CNT A;  3RHA A;  3UKL A;  3D1C A;  4B65 A;  3F8P A;  4ADW A;  1COY A;  2R0C A;  3M0O A;  3Q6J A;  5LV9 A;  1KF6 A;  3RNM A;  3OZ2 A;  1GOS A;  5IQ4 A;  1CJ4 A;  1F3P A;  3CND A;  4LU6 A;  4X4J A;  3L1R A;  3I6D A;  4B67 A;  3UP5 A;  3S5W A;  1Y56 A;  1K0L A;  3AE2 A;  4K7Z A;  2CUL A;  4J56 A;  4B69 A;  2YLX A;  4U8M A;  5BUL A;  4H4Y A;  4Z2U A;  3NNE A;  4RG3 A;  2GR1 A;  2B9W A;  1JRX A;  4YSX A;  3AWI A;  1K0J A;  2BXR A;  3EAO A;  1ZMC A;  4U8P A;  2GQF A;  2AR8 A;  4AOS A;  1EL9 A;  5KOX A;  4OVI A;  2X8C A;  1QJD A;  2XVH A;  3NK2 X;  4H4W A;  2Q0K A;  4IVM B;  4IA5 A;  2C67 A;  5IQ1 A;  1LTX R;  1DNC A;  3P1W A;  1BKW A;  4H4P A;  2RGO A;  4U2S A;  2A87 A;  2R45 A;  1NHP A;  3P4S A;  2QAE A;  5TR3 A;  2XFQ A;  4CCQ A;  1VG0 A;  5M10 A;  2BCP A;  1GSN A;  1PN0 A;  2I0Z A;  4Y4N A;  1F8S A;  4OPT A;  3ICT A;  4A79 A;  3V3O A;  2FJE A;  2OA1 A;  4GR1 A;  2CFY A;  4EMW A;  2IID A;  1KDG A;  4NTE A;  2XCG A;  3P4P A;  1N4V A;  3ZYX A;  1DXL A;  2YM2 A;  1H6V A;  2YLR A;  3AD8 B;  1B37 A;  1NPX A;  3ADA B;  3CGE A;  3GD3 A;  3HZL A;  3BI2 A;  4U2L A;  4WX1 A;  1VRQ B;  3AEC A;  1YQZ A;  3H4K A;  3QFA A;  2RGJ A;  5JCI A;  1ZDL A;  1GRA A;  1PBF A;  1D7Y A;  1RP0 A;  4J2W A;  4YWO A;  1E7P A;  2PHH A;  1GES A;  5L46 A;  4JNA A;  4YXD A;  1IUT A;  2C76 A;  3VR8 A;  2V6O A;  4BJY A;  4UDP A;  3PO7 A;  3C4N A;  1XHC A;  4NEV A;  4EQS A;  1PBC A;  1TYT A;  4YKG A;  2EQ8 A;  1Z6L A;  4K22 A;  4OPU A;  2VOU A;  3CGB A;  3BNM A;  4YT0 A;  1PDH A;  2BAB A;  2EQ7 A;  2JB2 A;  3DK4 A;  1GRB A;  1DOE A;  1YQ4 A;  1B4V A;  3G5Q A;  3K7T A;  3GSI A;  1S3E A;  3CN8 A;  2C64 A;  5FS9 A;  2YLS A;  2C66 A;  3LOV A;  2GAH B;  2ZZC A;  3QVP A;  1NHR A;  2BA9 A;  3ALJ A;  3DME A;  4E0V A;  2GR2 A;  3AE4 A;  1ZK7 A;  2A89 A;  3GWD A;  4CCR A;  1N4W A;  1PBE A;  2FBW A;  4Z43 A;  1CJ3 A;  3GRS A;  1GRF A;  3ATQ A;  3IWA A;  3II4 A;  4UDR A;  4H4Z A;  5GRT A;  3GRT A;  1RSG A;  4Z2T A;  2X50 A;  2WOV A;  5DBJ A;  3F8R A;  4P9S A;  5HY5 A;  3SM8 A;  2EQ6 A;  2OAM A;  1E1M A;  3AYL A;  3RP7 A;  5KOW A;  1LQU A;  2NPX A;  1ZP0 A;  2YLT A;  2R4J A;  4Z24 A;  2EQ9 A;  1O5W A;  4IA6 A;  3DJD A;  1DOC A;  4GF7 A;  4AP1 A;  1BWC A;  2GEW A;  4CNJ A;  4YTP A;  3CPH G;  1H82 A;  4OPI A;  4Y4M A;  3JSK A;  1YY5 A;  5C2T A;  3FPZ A;  3NK0 X;  4JNQ A;  3DK9 A;  2YWL A;  4TLZ A;  1ELI A;  2C7G A;  2B76 A;  4EMJ A;  4K5S A;  4DSG A;  4EIP A;  3GYI A;  3PS9 A;  3M12 A;  3NYC A;  1JRY A;  3H8I A;  4A6N B;  1NG4 A;  2VVL G;  2HQM A;  3NGC X;  4X9M A;  4C5O A;  2WOW A;  4PAA A;  3AE3 A;  2YR4 A;  2YAU A;  1IUX A;  1DOB A;  1L0V A;  1IUW A;  4Z25 A;  5CKU A;  4D04 A;  3IHG A;  5EBK A;  3EAN A;  3V76 A;  2TPR A;  3NYF A;  2YVJ A;  1CHU A;  3D8X A;  2H89 A;  4NTC A;  3AYJ A;  1QLB A;  3C96 A;  4B63 A;  1B8S A;  3NN0 X;  3ITJ A;  4EQX A;  4EM3 A;  1GET A;  3LXD A;  4H7U A;  1GER A;  2RAB A;  1JEH A;  2QA2 A;  3SFD A;  2X8G A;  4B68 A;  3BI5 A;  1PBB A;  3CIR A;  3P4Q A;  3KU9 A;  2VQ7 A;  3ABV A;  1H7X A;  2YG7 A;  1JU2 A;  4YSY A;  1K4Q A;  1N1P A;  3VR9 A;  4FK1 A;  4ECH A;  2GQW A;  3UTH A;  5GSN A;  3I3L A;  1TDO A;  3IHM A;  1NEN A;  2Y6R A;  4N9X A;  5EB4 A;  4ZCD A;  2XVF A;  1OJA A;  3EPT A;  1BZL A;  4GRT A;  5C3J A;  5JCN A;  4BUR A;  5BRT A;  1GRH A;  3CTY A;  1PHH A;  4GDE A;  2WET A;  4NTD A;  4LA1 A;  2FJB A;  4H4S A;  3NH3 X;  4YSZ A;  2GF3 A;  2QCU A;  1NG3 A;  3CPI G;  2YLW A; 
#chains in the Genus database with same CATH topology
 2GH5 A;  4BK2 A;  3VRA A;  2BK4 A;  1CC6 A;  2VQB A;  3LZX A;  3P4R A;  4RSL A;  4DNA A;  2E4G A;  3FBS A;  3K7Q X;  2GAG B;  3NYE A;  4ICY A;  4O5Q A;  1K0I A;  1OJT A;  1MXT A;  3KVE A;  2XLR A;  1TDF A;  3BHF A;  3QSE A;  4GCM A;  3BHK A;  2XVJ A;  4CY8 A;  3CNP A;  2ACZ A;  2BRA A;  4EQW A;  2XLT A;  1AOG A;  2YVF A;  4H4V A;  1V59 A;  4TM3 A;  4TM0 A;  3OC4 A;  3T37 A;  2BXS A;  2YLZ A;  1M6I A;  1F6M A;  4K5R A;  4NZH A;  2GMJ A;  1ONF A;  3HYV A;  3AED A;  4HB9 A;  1PS9 A;  4OPD A;  2DKI A;  1OJD A;  4OPL A;  2CDU A;  3CNJ A;  2WPC A;  4PAB A;  4RG4 A;  2X99 A;  4FX9 A;  3GYJ A;  2WP5 A;  2FJD A;  1F8R A;  3G5S A;  4H4T A;  3O0H A;  4I58 A;  4CRT A;  2WDR A;  1GND A;  2IVD A;  2DKH A;  1HYU A;  3DGZ A;  4AT2 A;  1JNZ A;  1NEK A;  2B9Y A;  4JQ9 A;  3KPK A;  5KXJ A;  3GWF A;  4FK1 C;  3UTF A;  4BK3 A;  2JK6 A;  2R4E A;  2ZBW A;  3KLJ A;  5HHF A;  2WHD A;  2B9X A;  5EB5 A;  2WP9 A;  3AEF A;  4J34 A;  3CNS A;  3RED A;  3NKS A;  1LPF A;  2CVJ A;  2XFP A;  3HYW A;  1E1L A;  4IV9 A;  4BJZ A;  2J3N A;  1ZMD A;  3B3R A;  2WES A;  4AP3 A;  1D4D A;  1TDK A;  2YQU A;  1EL7 A;  5EOW A;  1FCD A;  3FG2 P;  2JB3 A;  4FDC B;  3UKQ A;  1JOA A;  5HYM A;  5KVH A;  5HXI A;  1Y0P A;  2R0P A;  2YVG A;  3M13 A;  1ZOV A;  4H4U A;  2WOI A;  3VRB A;  4C77 A;  3QSS A;  4KX6 A;  2V60 A;  2WQY A;  3KKJ A;  4JDR A;  1GPE A;  4A99 A;  3K30 A;  2A8X A;  4U8I A;  1TRB A;  1LQT A;  5J7X A;  4JN9 A;  3CGD A;  2BCG G;  1QO8 A;  4H2P A;  4A65 A;  1NDA A;  1PBD A;  4C3Y A;  4H50 A;  1KSU A;  1P2E A;  4GAV A;  1D5T A;  4KPR A;  1D4C A;  3BNU A;  1KNR A;  1GTE A;  2Y6Q A;  3UOX A;  1H81 A;  1S3B A;  4OCG A;  2Q0L A;  3UKH A;  3AE5 A;  3DJE A;  2XFO A;  5JCL A;  2WP6 A;  2JB1 A;  5BUK A;  3WE0 A;  5U1O A;  3AE7 A;  3AE9 A;  2WPE A;  3AEA A;  4EIQ A;  1CC2 A;  1X31 B;  4XXG A;  1NAA A;  4GUV A;  2WDQ A;  4U2T A;  3NT6 A;  1CC4 A;  1E1N A;  2BC0 A;  5KMP A;  4H4X A;  4Z44 A;  1PJ6 A;  2UZZ A;  3SQP A;  1S2Y A;  3FMW A;  3GD4 A;  4J36 A;  1Y56 B;  3EF6 A;  3KPF A;  4J57 A;  2BK5 A;  1D4E A;  1GT8 A;  4MJW A;  4UP3 A;  1L9C A;  4H2Q A;  2XLU A;  1LJ1 A;  4U8K A;  3GDN A;  3FIM B;  3BI4 A;  1IUV A;  2BS3 A;  2YG4 A;  3NHO X;  5CQF A;  3UP4 A;  1NHS A;  5U63 A;  2X3N A;  4CBQ A;  3AEB A;  1DJQ A;  2YG5 A;  3UKA A;  4D03 A;  4B64 A;  2GRT A;  3DGH A;  2JKC A;  4U8O A;  4CNK A;  4B1B A;  1O95 A;  5JCK A;  5J60 A;  3QSM A;  4II3 A;  2VRM A;  3B6D A;  2OAL A;  3V3N A;  3AYI A;  3DA1 A;  1XDI A;  2XLP A;  3DH9 A;  5KMQ A;  5ER0 A;  1GRG A;  2XVE A;  2Z5X A;  4U8N A;  4WCT A;  5KVI A;  3KD9 A;  3PVC A;  1IUS A;  4NWZ A;  2F5Z A;  4IVO B;  4X9N A;  1CJC A;  3CMM A;  3VRD B;  3UCL A;  1Q9I A;  1CF3 A;  2R46 A;  3IF9 A;  1TDN A;  1BGN A;  1JNR A;  4AOX A;  4EMI A;  1PXC A;  4H2R A;  5FMH A;  2C72 A;  4I59 A;  2V5Z A;  1KNP A;  4ZCC A;  3LJP A;  2XFN A;  2YG3 A;  4BV6 A;  1JRZ A;  2ARD A;  4YSH A;  1IUU A;  1L9E A;  3QFB A;  4A6N A;  2Q7V A;  5U25 A;  3G5R A;  2C65 A;  1S2Q A;  1H84 A;  4APN A;  1SEZ A;  3UOZ A;  2QA1 A;  3UOV A;  1DJN A;  3ICS A;  3UTE A;  4Z2R A;  1GEU A;  2GV8 A;  1LV0 A;  2BS2 A;  3ISH A;  2WEU A;  2ZZ0 A;  4YTN A;  2JAE A;  3NTD A;  1D7L A;  2VRL A;  5JCM A;  2R9Z A;  2X8H A;  3VQR A;  3NLC A;  1GAL A;  2YR6 A;  1TYP A;  3SYI A;  3AE6 A;  2V61 A;  4DSH A;  2C75 A;  4USQ A;  4ZN0 A;  1E6E A;  2XYO A;  2VZ2 A;  4OPG A;  1NHQ A;  3T2Z A;  4TLX A;  1XPQ A;  4A9W A;  4H4R A;  2B7R A;  1GTH A;  2ZZB A;  2GVC A;  4M52 A;  1ZOY A;  5BVA A;  2YR5 A;  2B7S A;  4A7A A;  3AE8 A;  3F8D A;  3RP8 A;  1CBO A;  1PJ7 A;  2GR0 A;  3UKP A;  4LII A;  3SFE A;  3C4A A;  2GMH A;  3SGL A;  3CPJ G;  5FS8 A;  3QJ4 A;  4AT0 A;  3COX A;  3DJJ A;  3NG7 X;  1FEC A;  2E1M A;  3HYX A;  4G9K A;  4O5U A;  4U8J A;  1OJ9 A;  1M64 A;  4U8L A;  3AXB A;  3T31 A;  2BK3 A;  4A5L A;  1EBD A;  4C74 A;  1ZKQ A;  4DGK A;  1EL8 A;  1F8W A;  1OJC A;  5FS7 A;  2R0G A;  4UDQ A;  2APG A;  2NVK X;  3Q9T A;  4K2X A;  1H86 A;  2C3C A;  3LAD A;  2VVM A;  2VVL A;  3T2Y A;  2W0H A;  5KNL A;  2C3D A;  2FJA A;  4C3X A;  1FL2 A;  3DJG X;  4G74 A;  3UKF A;  2H88 A;  4HA6 A;  4USR A;  1FEB A;  1H7W A;  1Q1R A;  1O94 A;  1CJ2 A;  1YKJ A;  2V3A A;  1UKV G;  3NIX A;  4XWZ A;  3SX6 A;  2GB0 A;  2BC1 A;  2GR3 A;  2WBA A;  1KFY A;  3AD9 B;  5M0Z A;  3UKK A;  1E1K A;  1BF3 A;  1GV4 A;  4II2 A;  2WPF A;  4B66 A;  1BGJ A;  1FOH A;  1LVL A;  3K7M X;  4JY2 A;  3ALM A;  3AB1 A;  4J31 A;  3NK1 X;  1H83 A;  2YM1 A;  4H2N A;  4YTM A;  1ZX9 A;  3UOY A;  1CL0 A;  1PXA A;  3IC9 A;  3SY4 A;  1VQW A;  2XDO A;  3NRN A;  3SZW A;  1REO A;  2YG6 A;  3LB8 A;  4NEW A;  3DK8 A;  2XFU A;  3ATR A;  4GDP A;  3GMB A;  2AAQ A;  2OLN A;  4TM1 A;  1IJH A;  1L9D A;  1GRE A;  4YKF A;  3GYX A;  3URH A;  4REK A;  3NN6 X;  3SZF A;  1E39 A;  3ALL A;  3GMC A;  4K8D A;  4EM4 A;  1RYI A;  4TM4 A;  3RP6 A;  4Y4L A;  3GDP A;  1FEA A;  4EQR A;  3R9U A;  1YQ3 A;  2TMD A;  3AEG A;  2O9Z A;  1VG9 A;  1MOK A;  2JBV A;  1PJ5 A;  3AEE A;  4BK1 A;  4JY3 A;  2OLO A;  5KWF A;  1MO9 A;  5KMR A;  4H4Q A;  1B5Q A;  3KA7 A;  3P9U A;  1W4X A;  2Q6U A;  3E1T A;  2PYX A;  5FS6 A;  3AD7 B;  4OPC A;  2IVE A;  5KRQ A;  1TDE A;  3UTG A;  3ZDN A;  1ZY8 A;  2WDV A;  3T0K A;  3T14 A;  2C70 A;  4CY6 A;  3QVR A;  5IPY A;  1GRT A;  2BS4 A;  2V3B A;  1PXB A;  1P2H A;  2WU2 A;  4J33 A;  3CGC A;  3NTA A;  2BAC A;  4Z26 A;  1Q1W A;  2E5V A;  3ICR A;  2C73 A;  3S61 A;  2Z5Y A;  1DOD A;  3L8K A;  1XAN A;  1KSS A;  2XVI A;  2RGH A;  4XWR A;  3LZW A;  2AQJ A;  2WU5 A;  3AE1 A;  1EL5 A;  1N4U A;  2WS3 A;  3H8L A;  2XLS A;  1VDC A;  1GXF A;  2BYB A;  3CNT A;  3RHA A;  3UKL A;  3D1C A;  4B65 A;  3F8P A;  4ADW A;  1COY A;  2R0C A;  3M0O A;  3Q6J A;  5LV9 A;  1KF6 A;  3RNM A;  3OZ2 A;  1GOS A;  5IQ4 A;  1CJ4 A;  1F3P A;  3CND A;  4LU6 A;  4X4J A;  3L1R A;  3I6D A;  4B67 A;  3UP5 A;  3S5W A;  1Y56 A;  1K0L A;  3AE2 A;  4K7Z A;  2CUL A;  4J56 A;  4B69 A;  2YLX A;  4U8M A;  5BUL A;  4H4Y A;  4Z2U A;  3NNE A;  4RG3 A;  2GR1 A;  2B9W A;  1JRX A;  3SZC A;  4YSX A;  3AWI A;  1K0J A;  2BXR A;  3EAO A;  1ZMC A;  4U8P A;  2GQF A;  2AR8 A;  4AOS A;  1EL9 A;  5KOX A;  4OVI A;  2X8C A;  1QJD A;  4NNJ A;  2XVH A;  3NK2 X;  4H4W A;  2Q0K A;  4IVM B;  4IA5 A;  2C67 A;  5IQ1 A;  1LTX R;  1DNC A;  3P1W A;  1BKW A;  4H4P A;  2RGO A;  4U2S A;  2A87 A;  2R45 A;  1NHP A;  3P4S A;  2QAE A;  5TR3 A;  2XFQ A;  4CCQ A;  1VG0 A;  5M10 A;  2BCP A;  1GSN A;  1PN0 A;  2I0Z A;  4Y4N A;  1F8S A;  4OPT A;  3ICT A;  4A79 A;  3V3O A;  2FJE A;  2OA1 A;  4GR1 A;  2CFY A;  4EMW A;  2IID A;  1KDG A;  4NTE A;  2XCG A;  3P4P A;  1N4V A;  3ZYX A;  1DXL A;  2YM2 A;  1H6V A;  2YLR A;  3AD8 B;  1B37 A;  1NPX A;  3ADA B;  3CGE A;  5KMS A;  3GD3 A;  3HZL A;  3BI2 A;  4U2L A;  4WX1 A;  1VRQ B;  3AEC A;  1YQZ A;  2BRY A;  3H4K A;  3QFA A;  2RGJ A;  5JCI A;  1ZDL A;  1GRA A;  1PBF A;  1D7Y A;  1RP0 A;  4J2W A;  4YWO A;  1E7P A;  2PHH A;  1GES A;  5L46 A;  4JNA A;  4YXD A;  1IUT A;  2C76 A;  3VR8 A;  2V6O A;  4BJY A;  4UDP A;  3PO7 A;  3C4N A;  1XHC A;  4G6H A;  4NEV A;  4EQS A;  1PBC A;  1TYT A;  4YKG A;  2EQ8 A;  1Z6L A;  4K22 A;  4OPU A;  2VOU A;  4G6G A;  3CGB A;  3BNM A;  4YT0 A;  1PDH A;  3SXI A;  2BAB A;  2EQ7 A;  2JB2 A;  3DK4 A;  1GRB A;  1DOE A;  1YQ4 A;  1B4V A;  3G5Q A;  3K7T A;  3GSI A;  1S3E A;  3CN8 A;  2C64 A;  5FS9 A;  2YLS A;  2C66 A;  3LOV A;  2GAH B;  2ZZC A;  3QVP A;  1NHR A;  2BA9 A;  3ALJ A;  3DME A;  4E0V A;  2GR2 A;  3AE4 A;  1ZK7 A;  2A89 A;  3GWD A;  4CCR A;  1N4W A;  1PBE A;  2FBW A;  4Z43 A;  1CJ3 A;  3GRS A;  1GRF A;  3ATQ A;  3IWA A;  3II4 A;  4UDR A;  4H4Z A;  5GRT A;  3GRT A;  1RSG A;  4Z2T A;  2X50 A;  2WOV A;  5DBJ A;  3F8R A;  4P9S A;  5HY5 A;  3SM8 A;  2EQ6 A;  2OAM A;  1E1M A;  4GAP A;  3AYL A;  3RP7 A;  5KOW A;  1LQU A;  2NPX A;  1ZP0 A;  2YLT A;  2R4J A;  4Z24 A;  2EQ9 A;  1O5W A;  4IA6 A;  3DJD A;  1DOC A;  4GF7 A;  4AP1 A;  1BWC A;  2GEW A;  4CNJ A;  4YTP A;  3CPH G;  1H82 A;  4OPI A;  4Y4M A;  3JSK A;  1YY5 A;  5C2T A;  3FPZ A;  3NK0 X;  4JNQ A;  3DK9 A;  2YWL A;  4TLZ A;  1ELI A;  2C7G A;  2B76 A;  4EMJ A;  4K5S A;  4DSG A;  4EIP A;  3GYI A;  3PS9 A;  3M12 A;  3NYC A;  1JRY A;  3SZ0 A;  3H8I A;  4A6N B;  1NG4 A;  2VVL G;  2HQM A;  3NGC X;  4X9M A;  4C5O A;  2WOW A;  4PAA A;  3AE3 A;  2YR4 A;  2YAU A;  1IUX A;  1DOB A;  1L0V A;  1IUW A;  4Z25 A;  5CKU A;  4D04 A;  3IHG A;  5EBK A;  3EAN A;  2C4C A;  3V76 A;  2TPR A;  3NYF A;  2YVJ A;  1CHU A;  3D8X A;  2H89 A;  4NTC A;  3AYJ A;  1QLB A;  3C96 A;  4B63 A;  1B8S A;  3NN0 X;  3ITJ A;  4EQX A;  4EM3 A;  1GET A;  3LXD A;  4H7U A;  1GER A;  2RAB A;  1JEH A;  2QA2 A;  3SFD A;  2X8G A;  4B68 A;  3BI5 A;  1PBB A;  3CIR A;  3P4Q A;  3KU9 A;  2VQ7 A;  3ABV A;  1H7X A;  2YG7 A;  1JU2 A;  4YSY A;  1K4Q A;  1N1P A;  3VR9 A;  4FK1 A;  4ECH A;  2GQW A;  3UTH A;  5GSN A;  3I3L A;  1TDO A;  3IHM A;  1NEN A;  2Y6R A;  4N9X A;  5EB4 A;  4ZCD A;  2XVF A;  1OJA A;  3EPT A;  1BZL A;  4G73 A;  4GRT A;  5C3J A;  5JCN A;  4BUR A;  5BRT A;  1GRH A;  3CTY A;  1PHH A;  4GDE A;  2WET A;  4NTD A;  4LA1 A;  2FJB A;  4H4S A;  3NH3 X;  3T2K A;  2GF3 A;  2QCU A;  4YSZ A;  1NG3 A;  3CPI G;  2YLW A; 
#chains in the Genus database with same CATH homology
 2GH5 A;  4BK2 A;  3VRA A;  2BK4 A;  1CC6 A;  2VQB A;  3LZX A;  3P4R A;  4RSL A;  4DNA A;  2E4G A;  3FBS A;  3K7Q X;  2GAG B;  3NYE A;  4ICY A;  4O5Q A;  1K0I A;  1OJT A;  1MXT A;  3KVE A;  2XLR A;  1TDF A;  3BHF A;  3QSE A;  4GCM A;  3BHK A;  2XVJ A;  4CY8 A;  3CNP A;  2ACZ A;  2BRA A;  4EQW A;  2XLT A;  1AOG A;  2YVF A;  4H4V A;  1V59 A;  4TM3 A;  4TM0 A;  3OC4 A;  3T37 A;  2BXS A;  2YLZ A;  1M6I A;  1F6M A;  4K5R A;  4NZH A;  2GMJ A;  1ONF A;  3HYV A;  3AED A;  4HB9 A;  1PS9 A;  4OPD A;  2DKI A;  1OJD A;  4OPL A;  2CDU A;  3CNJ A;  2WPC A;  4PAB A;  4RG4 A;  2X99 A;  4FX9 A;  3GYJ A;  2WP5 A;  2FJD A;  1F8R A;  3G5S A;  4H4T A;  3O0H A;  4I58 A;  4CRT A;  2WDR A;  1GND A;  2IVD A;  2DKH A;  1HYU A;  3DGZ A;  4AT2 A;  1JNZ A;  1NEK A;  2B9Y A;  4JQ9 A;  3KPK A;  5KXJ A;  3GWF A;  4FK1 C;  3UTF A;  4BK3 A;  2JK6 A;  2R4E A;  2ZBW A;  3KLJ A;  5HHF A;  2WHD A;  2B9X A;  5EB5 A;  2WP9 A;  3AEF A;  4J34 A;  3CNS A;  3RED A;  3NKS A;  1LPF A;  2CVJ A;  2XFP A;  3HYW A;  1E1L A;  4IV9 A;  4BJZ A;  2J3N A;  1ZMD A;  3B3R A;  2WES A;  4AP3 A;  1D4D A;  1TDK A;  2YQU A;  1EL7 A;  5EOW A;  1FCD A;  3FG2 P;  2JB3 A;  4FDC B;  3UKQ A;  1JOA A;  5HYM A;  5KVH A;  5HXI A;  1Y0P A;  2R0P A;  2YVG A;  3M13 A;  1ZOV A;  4H4U A;  2WOI A;  3VRB A;  4C77 A;  3QSS A;  4KX6 A;  2V60 A;  2WQY A;  3KKJ A;  4JDR A;  1GPE A;  4A99 A;  3K30 A;  2A8X A;  4U8I A;  1TRB A;  1LQT A;  5J7X A;  4JN9 A;  3CGD A;  2BCG G;  1QO8 A;  4H2P A;  4A65 A;  1NDA A;  1PBD A;  4C3Y A;  4H50 A;  1KSU A;  1P2E A;  4GAV A;  1D5T A;  4KPR A;  1D4C A;  3BNU A;  1KNR A;  1GTE A;  2Y6Q A;  3UOX A;  1H81 A;  1S3B A;  4OCG A;  2Q0L A;  3UKH A;  3AE5 A;  3DJE A;  2XFO A;  5JCL A;  2WP6 A;  2JB1 A;  5BUK A;  3WE0 A;  5U1O A;  3AE7 A;  3AE9 A;  2WPE A;  3AEA A;  4EIQ A;  1CC2 A;  1X31 B;  4XXG A;  1NAA A;  4GUV A;  2WDQ A;  4U2T A;  3NT6 A;  1CC4 A;  1E1N A;  2BC0 A;  5KMP A;  4H4X A;  4Z44 A;  1PJ6 A;  2UZZ A;  3SQP A;  1S2Y A;  3FMW A;  3GD4 A;  4J36 A;  1Y56 B;  3EF6 A;  3KPF A;  4J57 A;  2BK5 A;  1D4E A;  1GT8 A;  4MJW A;  4UP3 A;  1L9C A;  4H2Q A;  2XLU A;  1LJ1 A;  4U8K A;  3GDN A;  3FIM B;  3BI4 A;  1IUV A;  2BS3 A;  2YG4 A;  3NHO X;  5CQF A;  3UP4 A;  1NHS A;  5U63 A;  2X3N A;  4CBQ A;  3AEB A;  1DJQ A;  2YG5 A;  3UKA A;  4D03 A;  4B64 A;  2GRT A;  3DGH A;  2JKC A;  4U8O A;  4CNK A;  4B1B A;  1O95 A;  5JCK A;  5J60 A;  3QSM A;  4II3 A;  2VRM A;  3B6D A;  2OAL A;  3V3N A;  3AYI A;  3DA1 A;  1XDI A;  2XLP A;  3DH9 A;  5KMQ A;  5ER0 A;  1GRG A;  2XVE A;  2Z5X A;  4U8N A;  4WCT A;  5KVI A;  3KD9 A;  3PVC A;  1IUS A;  4NWZ A;  2F5Z A;  4IVO B;  4X9N A;  1CJC A;  3CMM A;  3VRD B;  3UCL A;  1Q9I A;  1CF3 A;  2R46 A;  3IF9 A;  1TDN A;  1BGN A;  1JNR A;  4AOX A;  4EMI A;  1PXC A;  4H2R A;  5FMH A;  2C72 A;  4I59 A;  2V5Z A;  1KNP A;  4ZCC A;  3LJP A;  2XFN A;  2YG3 A;  4BV6 A;  1JRZ A;  2ARD A;  4YSH A;  1IUU A;  1L9E A;  3QFB A;  4A6N A;  2Q7V A;  5U25 A;  3G5R A;  2C65 A;  1S2Q A;  1H84 A;  4APN A;  1SEZ A;  3UOZ A;  2QA1 A;  3UOV A;  1DJN A;  3ICS A;  3UTE A;  4Z2R A;  1GEU A;  2GV8 A;  1LV0 A;  2BS2 A;  3ISH A;  2WEU A;  2ZZ0 A;  4YTN A;  2JAE A;  3NTD A;  1D7L A;  2VRL A;  5JCM A;  2R9Z A;  2X8H A;  3VQR A;  3NLC A;  1GAL A;  2YR6 A;  1TYP A;  3SYI A;  3AE6 A;  2V61 A;  4DSH A;  2C75 A;  4USQ A;  4ZN0 A;  1E6E A;  2XYO A;  2VZ2 A;  4OPG A;  1NHQ A;  3T2Z A;  4TLX A;  1XPQ A;  4A9W A;  4H4R A;  2B7R A;  1GTH A;  2ZZB A;  2GVC A;  4M52 A;  1ZOY A;  5BVA A;  2YR5 A;  2B7S A;  4A7A A;  3AE8 A;  3F8D A;  3RP8 A;  1CBO A;  1PJ7 A;  2GR0 A;  3UKP A;  4LII A;  3SFE A;  3C4A A;  2GMH A;  3SGL A;  3CPJ G;  5FS8 A;  3QJ4 A;  4AT0 A;  3COX A;  3DJJ A;  3NG7 X;  1FEC A;  2E1M A;  3HYX A;  4G9K A;  4O5U A;  4U8J A;  1OJ9 A;  1M64 A;  4U8L A;  3AXB A;  3T31 A;  2BK3 A;  4A5L A;  1EBD A;  4C74 A;  1ZKQ A;  4DGK A;  1EL8 A;  1F8W A;  1OJC A;  5FS7 A;  2R0G A;  4UDQ A;  2APG A;  2NVK X;  3Q9T A;  4K2X A;  1H86 A;  2C3C A;  3LAD A;  2VVM A;  2VVL A;  3T2Y A;  2W0H A;  5KNL A;  2C3D A;  2FJA A;  4C3X A;  1FL2 A;  3DJG X;  4G74 A;  3UKF A;  2H88 A;  4HA6 A;  4USR A;  1FEB A;  1H7W A;  1Q1R A;  1O94 A;  1CJ2 A;  1YKJ A;  2V3A A;  1UKV G;  3NIX A;  4XWZ A;  3SX6 A;  2GB0 A;  2BC1 A;  2GR3 A;  2WBA A;  1KFY A;  3AD9 B;  5M0Z A;  3UKK A;  1E1K A;  1BF3 A;  1GV4 A;  4II2 A;  2WPF A;  4B66 A;  1BGJ A;  1FOH A;  1LVL A;  3K7M X;  4JY2 A;  3ALM A;  3AB1 A;  4J31 A;  3NK1 X;  1H83 A;  2YM1 A;  4H2N A;  4YTM A;  1ZX9 A;  3UOY A;  1CL0 A;  1PXA A;  3IC9 A;  3SY4 A;  1VQW A;  2XDO A;  3NRN A;  3SZW A;  1REO A;  2YG6 A;  3LB8 A;  4NEW A;  3DK8 A;  2XFU A;  3ATR A;  4GDP A;  3GMB A;  2AAQ A;  2OLN A;  4TM1 A;  1IJH A;  1L9D A;  1GRE A;  4YKF A;  3GYX A;  3URH A;  4REK A;  3NN6 X;  3SZF A;  1E39 A;  3ALL A;  3GMC A;  4K8D A;  4EM4 A;  1RYI A;  4TM4 A;  3RP6 A;  4Y4L A;  3GDP A;  1FEA A;  4EQR A;  3R9U A;  1YQ3 A;  2TMD A;  3AEG A;  2O9Z A;  1VG9 A;  1MOK A;  2JBV A;  1PJ5 A;  3AEE A;  4BK1 A;  4JY3 A;  2OLO A;  5KWF A;  1MO9 A;  5KMR A;  4H4Q A;  1B5Q A;  3KA7 A;  3P9U A;  1W4X A;  2Q6U A;  3E1T A;  2PYX A;  5FS6 A;  3AD7 B;  4OPC A;  2IVE A;  5KRQ A;  1TDE A;  3UTG A;  3ZDN A;  1ZY8 A;  2WDV A;  3T0K A;  3T14 A;  2C70 A;  4CY6 A;  3QVR A;  5IPY A;  1GRT A;  2BS4 A;  2V3B A;  1PXB A;  1P2H A;  2WU2 A;  4J33 A;  3CGC A;  3NTA A;  2BAC A;  4Z26 A;  1Q1W A;  2E5V A;  3ICR A;  2C73 A;  3S61 A;  2Z5Y A;  1DOD A;  3L8K A;  1XAN A;  1KSS A;  2XVI A;  2RGH A;  4XWR A;  3LZW A;  2AQJ A;  2WU5 A;  3AE1 A;  1EL5 A;  1N4U A;  2WS3 A;  3H8L A;  2XLS A;  1VDC A;  1GXF A;  2BYB A;  3CNT A;  3RHA A;  3UKL A;  3D1C A;  4B65 A;  3F8P A;  4ADW A;  1COY A;  2R0C A;  3M0O A;  3Q6J A;  5LV9 A;  1KF6 A;  3RNM A;  3OZ2 A;  1GOS A;  5IQ4 A;  1CJ4 A;  1F3P A;  3CND A;  4LU6 A;  4X4J A;  3L1R A;  3I6D A;  4B67 A;  3UP5 A;  3S5W A;  1Y56 A;  1K0L A;  3AE2 A;  4K7Z A;  2CUL A;  4J56 A;  4B69 A;  2YLX A;  4U8M A;  5BUL A;  4H4Y A;  4Z2U A;  3NNE A;  4RG3 A;  2GR1 A;  2B9W A;  1JRX A;  3SZC A;  4YSX A;  3AWI A;  1K0J A;  2BXR A;  3EAO A;  1ZMC A;  4U8P A;  2GQF A;  2AR8 A;  4AOS A;  1EL9 A;  5KOX A;  4OVI A;  2X8C A;  1QJD A;  4NNJ A;  2XVH A;  3NK2 X;  4H4W A;  2Q0K A;  4IVM B;  4IA5 A;  2C67 A;  5IQ1 A;  1LTX R;  1DNC A;  3P1W A;  1BKW A;  4H4P A;  2RGO A;  4U2S A;  2A87 A;  2R45 A;  1NHP A;  3P4S A;  2QAE A;  5TR3 A;  2XFQ A;  4CCQ A;  1VG0 A;  5M10 A;  2BCP A;  1GSN A;  1PN0 A;  2I0Z A;  4Y4N A;  1F8S A;  4OPT A;  3ICT A;  4A79 A;  3V3O A;  2FJE A;  2OA1 A;  4GR1 A;  2CFY A;  4EMW A;  2IID A;  1KDG A;  4NTE A;  2XCG A;  3P4P A;  1N4V A;  3ZYX A;  1DXL A;  2YM2 A;  1H6V A;  2YLR A;  3AD8 B;  1B37 A;  1NPX A;  3ADA B;  3CGE A;  5KMS A;  3GD3 A;  3HZL A;  3BI2 A;  4U2L A;  4WX1 A;  1VRQ B;  3AEC A;  1YQZ A;  2BRY A;  3H4K A;  3QFA A;  2RGJ A;  5JCI A;  1ZDL A;  1GRA A;  1PBF A;  1D7Y A;  1RP0 A;  4J2W A;  4YWO A;  1E7P A;  2PHH A;  1GES A;  5L46 A;  4JNA A;  4YXD A;  1IUT A;  2C76 A;  3VR8 A;  2V6O A;  4BJY A;  4UDP A;  3PO7 A;  3C4N A;  1XHC A;  4G6H A;  4NEV A;  4EQS A;  1PBC A;  1TYT A;  4YKG A;  2EQ8 A;  1Z6L A;  4K22 A;  4OPU A;  2VOU A;  4G6G A;  3CGB A;  3BNM A;  4YT0 A;  1PDH A;  3SXI A;  2BAB A;  2EQ7 A;  2JB2 A;  3DK4 A;  1GRB A;  1DOE A;  1YQ4 A;  1B4V A;  3G5Q A;  3K7T A;  3GSI A;  1S3E A;  3CN8 A;  2C64 A;  5FS9 A;  2YLS A;  2C66 A;  3LOV A;  2GAH B;  2ZZC A;  3QVP A;  1NHR A;  2BA9 A;  3ALJ A;  3DME A;  4E0V A;  2GR2 A;  3AE4 A;  1ZK7 A;  2A89 A;  3GWD A;  4CCR A;  1N4W A;  1PBE A;  2FBW A;  4Z43 A;  1CJ3 A;  3GRS A;  1GRF A;  3ATQ A;  3IWA A;  3II4 A;  4UDR A;  4H4Z A;  5GRT A;  3GRT A;  1RSG A;  4Z2T A;  2X50 A;  2WOV A;  5DBJ A;  3F8R A;  4P9S A;  5HY5 A;  3SM8 A;  2EQ6 A;  2OAM A;  1E1M A;  4GAP A;  3AYL A;  3RP7 A;  5KOW A;  1LQU A;  2NPX A;  1ZP0 A;  2YLT A;  2R4J A;  4Z24 A;  2EQ9 A;  1O5W A;  4IA6 A;  3DJD A;  1DOC A;  4GF7 A;  4AP1 A;  1BWC A;  2GEW A;  4CNJ A;  4YTP A;  3CPH G;  1H82 A;  4OPI A;  4Y4M A;  3JSK A;  1YY5 A;  5C2T A;  3FPZ A;  3NK0 X;  4JNQ A;  3DK9 A;  2YWL A;  4TLZ A;  1ELI A;  2C7G A;  2B76 A;  4EMJ A;  4K5S A;  4DSG A;  4EIP A;  3GYI A;  3PS9 A;  3M12 A;  3NYC A;  1JRY A;  3SZ0 A;  3H8I A;  4A6N B;  1NG4 A;  2VVL G;  2HQM A;  3NGC X;  4X9M A;  4C5O A;  2WOW A;  4PAA A;  3AE3 A;  2YR4 A;  2YAU A;  1IUX A;  1DOB A;  1L0V A;  1IUW A;  4Z25 A;  5CKU A;  4D04 A;  3IHG A;  5EBK A;  3EAN A;  2C4C A;  3V76 A;  2TPR A;  3NYF A;  2YVJ A;  1CHU A;  3D8X A;  2H89 A;  4NTC A;  3AYJ A;  1QLB A;  3C96 A;  4B63 A;  1B8S A;  3NN0 X;  3ITJ A;  4EQX A;  4EM3 A;  1GET A;  3LXD A;  4H7U A;  1GER A;  2RAB A;  1JEH A;  2QA2 A;  3SFD A;  2X8G A;  4B68 A;  3BI5 A;  1PBB A;  3CIR A;  3P4Q A;  3KU9 A;  2VQ7 A;  3ABV A;  1H7X A;  2YG7 A;  1JU2 A;  4YSY A;  1K4Q A;  1N1P A;  3VR9 A;  4FK1 A;  4ECH A;  2GQW A;  3UTH A;  5GSN A;  3I3L A;  1TDO A;  3IHM A;  1NEN A;  2Y6R A;  4N9X A;  5EB4 A;  4ZCD A;  2XVF A;  1OJA A;  3EPT A;  1BZL A;  4G73 A;  4GRT A;  5C3J A;  5JCN A;  4BUR A;  5BRT A;  1GRH A;  3CTY A;  1PHH A;  4GDE A;  2WET A;  4NTD A;  4LA1 A;  2FJB A;  4H4S A;  3NH3 X;  3T2K A;  2GF3 A;  2QCU A;  4YSZ A;  1NG3 A;  3CPI G;  2YLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...