4H2RA

Structure of mhpco y270f mutant, 5-hydroxynicotinic acid complex
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-Methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 125
structure length 369
sequence length 369
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2rA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2rA01
3LJPA 5FS9A 3DJEA 1K4QA 3AE9A 5BUKA 4IVOB 2WESA 4C3YA 4OPIA 3VR9A 1OJCA 4H4UA 3UCLA 5U25A 2VRLA 3H8IA 5EBKA 3DMEA 4NTCA 4RG3A 3REDA 3IWAA 4XXGA 2BK4A 3UKHA 2E4GA 2YM1A 1Q1RA 3BI5A 3DJGX 4JN9A 1B5QA 3FBSA 2DKHA 1N4VA 2C64A 1O5WA 1H7WA 4GDEA 4YKFA 3UKQA 2QA1A 3DA1A 3IC9A 2BS2A 2YLZA 2C70A 4EQSA 1GOSA 3GRTA 4B68A 3CGEA 2V60A 1D5TA 1NEKA 3CNTA 1CF3A 2BYBA 3L8KA 1GSNA 2E5VA 4JDRA 4D03A 1COYA 2GEWA 1TDOA 4U8KA 3M13A 2GF3A 1JEHA 2R45A 3AE2A 3B3RA 3JSKA 3K7QX 4EIPA 1CJ4A 4U2TA 2ACZA 3KPFA 2VVLG 4YTPA 5FS6A 3G5SA 2Q0LA 3AD7B 3FMWA 1F6MA 1N1PA 3CNJA 3F8DA 3NRNA 3UKKA 1DXLA 3AEFA 4Z25A 1B8SA 4BK1A 2EQ7A 1D4DA 1V59A 2R9ZA 3ALMA 3QJ4A 3UP4A 4U8OA 3AD8B 3UTGA 3NNEA 3CPHG 3KLJA 2YQUA 3D8XA 1GT8A 3AYIA 3NK2X 5KVIA 1GERA 2EQ6A 5M0ZA 2B9YA 2DKIA 1Z6LA 2YG6A 2YWLA 1OJAA 3GDPA 1REOA 3OZ2A 2GVCA 4Z2UA 4CNKA 2BCPA 1JRZA 1K0IA 1L9DA 1ZOYA 2GQWA 3FG2P 1TDFA 3K7MX 4A7AA 2RGOA 2V3AA 2WU2A 3AE5A 2B76A 4BURA 4DSHA 4ECHA 4OCGA 2YR5A 3VQRA 1W4XA 1ZX9A 1D4CA 2ZZ0A 4OVIA 4U8PA 4A5LA 3UOVA 3UTHA 4H4RA 2X3NA 3RP6A 4IA5A 3BNMA 3NH3X 4UP3A 3CIRA 4J57A 4XWRA 4JY3A 4TM1A 4WX1A 3NTAA 4J36A 1DOBA 5ER0A 1GALA 4B65A 1HYUA 2AQJA 2IVDA 1PBCA 1E1NA 5M10A 2V3BA 1MXTA 3O0HA 2ZZBA 4USRA 1OJTA 2YLTA 2WP5A 4APNA 4GR1A 2Q6UA 1ZDLA 1ZMDA 3BI4A 1FL2A 3GWFA 1GESA 2YM2A 1JNRA 2Y6RA 1H83A 3S61A 4ZN0A 4O5UA 2UZZA 4TM4A 1QLBA 2V61A 2C72A 3II4A 2XVEA 3QVPA 2OLNA 2WPEA 2WP6A 2YLRA 3SGLA 4ADWA 3NLCA 5TR3A 3LXDA 3UOYA 3NYCA 1RSGA 3FIMB 4YSHA 5KOXA 1E7PA 1ZY8A 3QSSA 4AOSA 4BK3A 4U8MA 2RABA 4YKGA 2YG4A 2GH5A 4H4QA 1Q9IA 2C75A 2YLWA 3AE4A 3CN8A 2FJBA 1VG0A 2EQ8A 2JBVA 1PDHA 3F8PA 4IA6A 4YT0A 1RP0A 2NPXA 2XLTA 1CHUA 2QA2A 4TLXA 1LPFA 3COXA 4H4VA 2YG3A 5HXIA 4K22A 4UDRA 1GRBA 1OJDA 4EMJA 2IVEA 4X4JA 3URHA 3VRAA 3AEAA 5BRTA 5JCKA 3CGBA 2WDVA 2WU5A 4PABA 3UKPA 4IVMB 1LTXR 3NYFA 1D4EA 3P4RA 2XFQA 1CC2A 3P1WA 3EANA 2BCGG 3IHGA 2GB0A 2GAGB 1KNRA 2GR3A 2WOWA 1O95A 3NHOX 3NG7X 2WPCA 4U8LA 1NAAA 1XHCA 1GNDA 3C96A 3HZLA 1D7LA 1SEZA 4CCQA 2WQYA 2XLSA 4EQXA 4CBQA 1VDCA 2YAUA 1D7YA 4FK1C 4YWOA 2XFUA 4GRTA 1JNZA 1RYIA 3PS9A 4OPTA 2WHDA 3LOVA 3QFBA 4NTEA 5IQ1A 3B6DA 2BK3A 4RG4A 2H88A 2OALA 2NVKX 2VRMA 3Q9TA 3AECA 2BACA 2BC1A 1Y56A 3LZWA 3R9UA 4NZHA 4D04A 1GTEA 4YXDA 1GRTA 2Q0KA 3QVRA 3ZDNA 4Z26A 3GMCA 1OJ9A 3GMBA 2FJDA 2WETA 3GYJA 4EQRA 2X99A 1FEAA 2EQ9A 4H2RA 2JKCA 4AOXA 5IPYA 3NKSA 2TMDA 2B9WA 3CNPA 2X8HA 3LB8A 4FDCB 4TM0A 3VRBA 4KX6A 1CBOA 2WP9A 3AEEA 4CY6A 5JCNA 4EMIA 3BHFA 1F8SA 5U1OA 4H50A 4Y4LA 1S2YA 2CULA 4EQWA 3NYEA 3ICRA 1KSSA 5FS7A 1NG4A 4C3XA 4Z24A 4EIQA 2H89A 4BJYA 4XWZA 4Y4MA 4B66A 4H4TA 3ATRA 2AAQA 4CCRA 1BGNA 2GR2A 1PS9A 2ZZCA 2FBWA 1JOAA 2C67A 2GR0A 3AXBA 3T37A 2R0PA 1CC6A 4DSGA 1YQZA 4TLZA 5C3JA 2IIDA 4Y4NA 3VRDB 1PJ5A 4JY2A 3DJJA 1VRQB 4FK1A 4FX9A 1LVLA 5C2TA 1BF3A 4Z44A 4HA6A 5JCLA 3AEGA 5GSNA 4ZCDA 4CRTA 4DGKA 1EL8A 3NGCX 3CPJG 2RGHA 4NTDA 2R4EA 3KKJA 1TRBA 2WS3A 2BXSA 1TDNA 1F3PA 1FECA 2ARDA 2YR6A 3QSMA 3ZYXA 2XLRA 2VOUA 4WCTA 5CKUA 3UOZA 1PJ6A 1F8WA 2JB1A 4A65A 2Z5YA 3K30A 1TDKA 3FPZA 2FJEA 4ICYA 1NENA 3AE6A 3ICTA 4I59A 5IQ4A 3G5QA 3L1RA 1EL9A 1PXBA 4H4YA 4J2WA 5HHFA 3QFAA 3LADA 2X8CA 4GUVA 4H4WA 5KOWA 2Z5XA 3CGDA 2XVFA 4BV6A 2XVJA 1IUXA 1L9CA 3KVEA 3P4PA 1PJ7A 5KVHA 1GRGA 2C3CA 2X50A 2PHHA 1Y56B 1PBFA 2VVMA 3G5RA 3GYIA 3DH9A 4EM4A 2XVIA 4AT0A 1NDAA 2Q7VA 3ALLA 5HYMA 1PBBA 1DODA 4B67A 2BABA 1FEBA 1P2EA 2WBAA 3VR8A 1EL7A 1LV0A 1MO9A 1N4WA 3CPIG 4ZCCA 3ICSA 3ATQA 3F8RA 5EB5A 4U8IA 4A79A 3UTEA 3SFEA 4YTMA 2OLOA 4OPLA 3CTYA 3PO7A 3Q6JA 4J34A 3NT6A 2CDUA 3DGHA 2VZ2A 2YLSA 2XLUA 3P9UA 4TM3A 4YSXA 4REKA 3BI2A 4H4SA 3GWDA 3AE3A 3UKLA 4H4ZA 3AB1A 1K0LA 1XANA 1E1LA 2C3DA 3CNDA 1E1MA 1PXAA 2CVJA 4NEVA 4JQ9A 2XDOA 2YG5A 1BWCA 1LJ1A 1TYTA 4B69A 2GMJA 3KD9A 4HB9A 2AR8A 3V3OA 3V76A 3NK0X 1ONFA 1ZMCA 4C77A 4YTNA 1ELIA 2XYOA 4Z2TA 1KF6A 3EAOA 4A99A 4C5OA 3UOXA 3AYJA 4AP3A 4P9SA 4OPGA 2V6OA 1LQUA 4O5QA 1IUSA 3GD4A 1PN0A 2R4JA 3AWIA 5FMHA 2OA1A 1KNPA 5U63A 4Z2RA 3AD9B 1YQ4A 1PBEA 1XDIA 3V3NA 1X31B 1GPEA 1E1KA 3ADAB 5KXJA 2I0ZA 3OC4A 2C66A 1IUVA 3GRSA 2XLPA 1GREA 1KSUA 3K7TA 4LA1A 4C74A 1ZOVA 2X8GA 5JCIA 3DK8A 1H81A 3EPTA 5BULA 1DJNA 3UP5A 2VQ7A 1FOHA 4YSYA 1ZK7A 2YR4A 3LZXA 3QSEA 1QO8A 2GMHA 3BNUA 5J7XA 1H84A 2YG7A 2BXRA 3P4SA 4E0VA 4NEWA 2A8XA 5CQFA 5LV9A 2B7SA 1NPXA 1GRAA 1L9EA 1H6VA 2WPFA 3RHAA 2CFYA 2O9ZA 2QCUA 4U2SA 3GD3A 2R0CA 3UKFA 1JU2A 4B63A 5HY5A 1YY5A 2XFOA 1CL0A 1DNCA 3M0OA 4H4PA 1TDEA 4X9NA 1ZKQA 1IUTA 1NHPA 1DOCA 1DOEA 2YVFA 3C4NA 1PXCA 1P2HA 3NN6X 4U8JA 2TPRA 1NG3A 3P4QA 4GF7A 3KA7A 4CY8A 1EL5A 4X9MA 3NTDA 4MJWA 1E6EA 4J56A 1S3BA 1XPQA 3SM8A 2YVGA 2V5ZA 2R46A 4AP1A 1NHRA 1GEUA 1M64A 4K5SA 1K0JA 4J31A 4LIIA 1DJQA 3IHMA 2C7GA 4U2LA 1GTHA 4H2QA 3EF6A 3I3LA 4KPRA 2VQBA 3CNSA 2OAMA 3RNMA 2WOIA 3IF9A 3NN0X 4B1BA 1JRXA 2BS3A 3AE8A 3CGCA 3E1TA 1H7XA 4K7ZA 4M52A 3S5WA 1IUWA 3DK4A 4K5RA 3AEBA 1VQWA 1CJ2A 3DGZA 3ALJA 4USQA 4UDPA 4A6NA 3AE1A 2WOVA 2XVHA 2JB3A 3DK9A 3C4AA 4U8NA 3NK1X 2GQFA 2GAHB 3KU9A 3GSIA 1NHQA 1UKVG 2B9XA 1Y0PA 1GXFA 3AEDA 2J3NA 3AYLA 1B37A 1CJ3A 1GRFA 1L0VA 1S3EA 3DJDA 2GR1A 3PVCA 5FS8A 4LU6A 1PBDA 1B4VA 2GV8A 2HQMA 4H4XA 4EM3A 5J60A 4PAAA 1AOGA 1KDGA 4A6NB 2WDQA 1JRYA 2PYXA 3I6DA 1EBDA 4H2PA 1KFYA 1H86A 2YLXA 4OPCA 2QAEA 2Y6QA 3AE7A 3M12A 4OPUA 2XFNA 2W0HA 1BZLA 2WDRA 2E1MA 1LQTA 1CC4A 1QJDA 2VVLA 2WEUA 4BJZA 1H82A 2APGA 4JNAA 4CNJA 4GDPA 1IUUA 2GRTA 3ABVA 4AT2A 2BK5A 4J33A 2F5ZA 1M6IA 2XCGA 2B7RA 5KWFA 1YKJA 3SQPA 4Z43A 2XFPA 4GCMA 4BK2A 3ITJA 3ISHA 1GRHA 2BS4A 2FJAA 5EOWA 4OPDA 3SFDA 4A9WA 4EMWA 1MOKA 1ZP0A 2C65A 3H4KA 5DBJA 3GDNA 1VG9A 1GV4A 4DNAA 1NHSA 4B64A 2BC0A 1Q1WA 3RP8A 2BA9A 5EB4A 3H8LA 2C76A 3NIXA 3BHKA 2R0GA 5GRTA 4JNQA 2RGJA 3RP7A 2YVJA 4RSLA 4N9XA 2A89A 4UDQA 5L46A 2JK6A 1GETA 4I58A 1BGJA 1FCDA 1E39A 2C73A 5KRQA 3UTFA 1IJHA 1PHHA 3UKAA 1YQ3A 1BKWA 5JCMA 4K2XA 4IV9A 1S2QA 1F8RA 4K8DA 4YSZA 1N4UA 2JB2A 3WE0A 4H7UA 2ZBWA 4H2NA 2JAEA 3D1CA 5BVAA 2A87A 1CJCA 1O94A 1TYPA
chains in the Genus database with same CATH superfamily
3LJPA 5FS9A 3DJEA 1K4QA 3AE9A 5BUKA 4IVOB 2WESA 4C3YA 4OPIA 3VR9A 1OJCA 4H4UA 3UCLA 5U25A 2VRLA 3H8IA 5EBKA 3DMEA 4NTCA 4RG3A 3REDA 3IWAA 4XXGA 2BK4A 3UKHA 2E4GA 2YM1A 1Q1RA 3BI5A 3DJGX 4JN9A 1B5QA 3FBSA 2DKHA 1N4VA 2C64A 1O5WA 1H7WA 3WGTA 4GDEA 4YKFA 3UKQA 3DA1A 2QA1A 3IC9A 2BS2A 2YLZA 2C70A 3SZWA 1GOSA 4EQSA 3GRTA 4B68A 3CGEA 2V60A 1D5TA 1NEKA 3CNTA 1CF3A 2BYBA 3L8KA 1GSNA 2E5VA 4JDRA 4D03A 1COYA 2GEWA 1TDOA 4U8KA 3M13A 2E48A 2GF3A 2R45A 4YJFA 1JEHA 3AE2A 3B3RA 3JSKA 3K7QX 4EIPA 1CJ4A 4U2TA 2ACZA 3KPFA 2VVLG 4YTPA 5FS6A 3G5SA 3AD7B 2Q0LA 3FMWA 1F6MA 1N1PA 3ZNPA 3CNJA 3F8DA 3NRNA 3UKKA 1DXLA 3AEFA 4Z25A 1B8SA 4NWZA 4BK1A 2EQ7A 1D4DA 1V59A 2R9ZA 3ALMA 3QJ4A 3UP4A 4U8OA 3AD8B 3UTGA 3NNEA 3CPHG 3KLJA 3W4IA 2YQUA 3D8XA 1GT8A 3AYIA 3NK2X 5KVIA 1GERA 2EQ6A 5M0ZA 2B9YA 2DKIA 1Z6LA 2YG6A 2YWLA 1OJAA 3OZ2A 1REOA 3GDPA 2GVCA 4Z2UA 4CNKA 2BCPA 1K0IA 1L9DA 1JRZA 1ZOYA 2GQWA 3FG2P 1TDFA 3K7MX 4A7AA 2RGOA 2V3AA 2WU2A 3AE5A 2B76A 4BURA 4DSHA 4ECHA 4OCGA 2YR5A 3VQRA 1W4XA 1ZX9A 1D4CA 2ZZ0A 4OVIA 4U8PA 4GAPA 4A5LA 3UOVA 3UTHA 4H4RA 2X3NA 3RP6A 4IA5A 3T14A 3BNMA 3NH3X 4UP3A 3CIRA 3GYXA 4J57A 4XWRA 4JY3A 4TM1A 4WX1A 3NTAA 4J36A 4G9KA 1DOBA 5ER0A 1GALA 4B65A 1HYUA 2AQJA 2IVDA 1PBCA 1E1NA 5M10A 2V3BA 5KNLA 1MXTA 3O0HA 5KMQA 2ZZBA 4USRA 1OJTA 2YLTA 2WP5A 4APNA 4GR1A 2Q6UA 1ZDLA 1ZMDA 3BI4A 1FL2A 3GWFA 1GESA 2YM2A 1JNRA 2Y6RA 1H83A 3CMMA 3HYVA 3S61A 4O5UA 2UZZA 4ZN0A 4TM4A 1QLBA 2V61A 2C72A 3II4A 2XVEA 3QVPA 2OLNA 2WPEA 2WP6A 3SGLA 3ZNOA 2YLRA 3NLCA 5TR3A 4ADWA 3LXDA 3UOYA 3NYCA 1RSGA 4YSHA 3FIMB 5KOXA 1E7PA 4BK3A 3QSSA 1ZY8A 4AOSA 4U8MA 2RABA 4QFDA 2YG4A 4YKGA 2GH5A 4H4QA 1Q9IA 2C75A 2YLWA 3AE4A 3CN8A 2FJBA 5KMRA 1VG0A 2EQ8A 2JBVA 1PDHA 3F8PA 4IA6A 4YT0A 1RP0A 2NPXA 2XLTA 1CHUA 2QA2A 4TLXA 1LPFA 3COXA 4H4VA 2YG3A 5HXIA 4K22A 4UDRA 1GRBA 1OJDA 4EMJA 2IVEA 4X4JA 3SZCA 3SZFA 3URHA 3VRAA 3AEAA 5BRTA 5JCKA 3CGBA 3T2KA 2WDVA 2WU5A 4PABA 3HYXA 3UKPA 4YJHB 4IVMB 1LTXR 3NYFA 1D4EA 3W4KA 2XFQA 1CC2A 3P1WA 3P4RA 3EANA 2BCGG 2GB0A 3IHGA 2GAGB 1KNRA 2GR3A 2WOWA 1O95A 3NHOX 3NG7X 2WPCA 4U8LA 1NAAA 1XHCA 4II2A 1GNDA 3C96A 3HZLA 1D7LA 1SEZA 4CCQA 2WQYA 2XLSA 4EQXA 4CBQA 1C0IA 1VDCA 2YAUA 1D7YA 4FK1C 1KIFA 4YWOA 2XFUA 4GRTA 1JNZA 1RYIA 3PS9A 4OPTA 2WHDA 3LOVA 3QFBA 4NTEA 5IQ1A 3B6DA 4YJDA 2BK3A 4RG4A 2H88A 2OALA 3G3EA 2NVKX 2VRMA 3AECA 3Q9TA 2BACA 2BC1A 1Y56A 3LZWA 3R9UA 4NZHA 4D04A 1GTEA 4YXDA 5KMSA 1GRTA 2Q0KA 3QVRA 3ZDNA 4Z26A 3GMCA 1OJ9A 1C0PA 3GMBA 2FJDA 2WETA 3GYJA 4EQRA 2X99A 1FEAA 2EQ9A 4H2RA 2JKCA 4AOXA 5IPYA 3NKSA 3T31A 2TMDA 2B9WA 3CNPA 2X8HA 3LB8A 4FDCB 4TM0A 3VRBA 4KX6A 3ZNNA 2DU8A 2E4AA 1CBOA 2WP9A 3AEEA 4CY6A 5JCNA 4EMIA 3BHFA 1F8SA 5U1OA 4H50A 4Y4LA 1S2YA 2CULA 4EQWA 3NYEA 3ICRA 1KSSA 5FS7A 1NG4A 3SXIA 4C3XA 4Z24A 4EIQA 2H89A 4BJYA 4XWZA 4Y4MA 4B66A 4H4TA 3ATRA 2AAQA 4CCRA 1BGNA 2GR2A 1PS9A 2ZZCA 2FBWA 1JOAA 2C67A 2GR0A 3AXBA 3HYWA 3T37A 1CC6A 2R0PA 4DSGA 1YQZA 4TLZA 5C3JA 2IIDA 4Y4NA 3VRDB 1PJ5A 4JY2A 3DJJA 1VRQB 4FK1A 4FX9A 1LVLA 5C2TA 1BF3A 4Z44A 4HA6A 5JCLA 3AEGA 5GSNA 4ZCDA 4CRTA 4DGKA 1EL8A 3NGCX 3CPJG 2RGHA 4NTDA 2R4EA 3QSMA 1TRBA 2WS3A 1TDNA 1F3PA 2ARDA 1FECA 2BXSA 2YR6A 3KKJA 3ZYXA 2XLRA 2VOUA 4WCTA 5CKUA 3UOZA 1PJ6A 1F8WA 2JB1A 4G6HA 4A65A 2Z5YA 3K30A 1TDKA 3FPZA 2FJEA 4ICYA 4YJGA 1NENA 3AE6A 3ICTA 4I59A 5IQ4A 3G5QA 3L1RA 1EL9A 1PXBA 4H4YA 4J2WA 5HHFA 3QFAA 4II3A 3LADA 2X8CA 4GUVA 4H4WA 5KOWA 2Z5XA 3CGDA 2XVFA 4BV6A 2XVJA 1IUXA 1L9CA 3KVEA 3P4PA 1PJ7A 5KVHA 1GRGA 4G73A 2C3CA 2X50A 2PHHA 1Y56B 3T2YA 1PBFA 2VVMA 3G5RA 3GYIA 3DH9A 4EM4A 2XVIA 4AT0A 1NDAA 2Q7VA 3ALLA 5HYMA 1PBBA 1DODA 4B67A 2BABA 1FEBA 1P2EA 2WBAA 4GAVA 3VR8A 1EL7A 4YJHA 1LV0A 1MO9A 1N4WA 3CPIG 4ZCCA 3ICSA 3ATQA 3F8RA 3CUKA 5EB5A 4U8IA 4A79A 3ZNQA 1VE9A 3UTEA 3SFEA 4YTMA 2OLOA 4OPLA 3CTYA 3PO7A 3Q6JA 4J34A 2BRAA 3NT6A 2CDUA 3SYIA 3DGHA 2VZ2A 2YLSA 2XLUA 3P9UA 4TM3A 4YSXA 4REKA 3BI2A 4H4SA 3GWDA 3AE3A 3UKLA 4H4ZA 3AB1A 1K0LA 1XANA 1E1LA 2C3DA 3CNDA 1E1MA 4QFCA 1PXAA 2CVJA 4NEVA 4JQ9A 2XDOA 2YG5A 1BWCA 1LJ1A 1TYTA 4B69A 2GMJA 3KD9A 4HB9A 2AR8A 3V3OA 3V76A 1DDOA 3NK0X 1ONFA 1ZMCA 4C77A 4YTNA 1ELIA 2XYOA 4Z2TA 1KF6A 3EAOA 4A99A 4C5OA 3UOXA 3AYJA 4AP3A 4P9SA 4OPGA 2V6OA 1LQUA 4O5QA 1IUSA 3GD4A 1PN0A 2R4JA 3AWIA 5FMHA 2OA1A 1KNPA 5U63A 4Z2RA 3AD9B 1YQ4A 1PBEA 1XDIA 3V3NA 1X31B 1GPEA 3ADAB 1E1KA 5KXJA 2I0ZA 3OC4A 2C66A 1IUVA 2BRYA 3GRSA 2XLPA 1GREA 1KSUA 3K7TA 4LA1A 4C74A 1ZOVA 2X8GA 5JCIA 3DK8A 1H81A 3EPTA 5BULA 1DJNA 3UP5A 2VQ7A 1FOHA 4YSYA 1ZK7A 2YR4A 3SZ0A 3LZXA 3QSEA 1QO8A 2GMHA 3BNUA 5J7XA 1H84A 2YG7A 2BXRA 3P4SA 4E0VA 4NEWA 2A8XA 5CQFA 5LV9A 2B7SA 1NPXA 1GRAA 1L9EA 1H6VA 2WPFA 3RHAA 2QCUA 2CFYA 2O9ZA 4U2SA 3GD3A 2R0CA 3UKFA 1JU2A 4B63A 5HY5A 1YY5A 2XFOA 1DNCA 1CL0A 3M0OA 4H4PA 4X9NA 1TDEA 1ZKQA 1IUTA 1NHPA 1DOCA 1DOEA 2YVFA 3C4NA 4G6GA 1PXCA 1P2HA 3NN6X 4U8JA 2TPRA 1NG3A 3P4QA 4GF7A 3KA7A 4CY8A 1EL5A 4X9MA 3W4JA 3NTDA 4MJWA 1E6EA 4J56A 3SM8A 1S3BA 1XPQA 2YVGA 2V5ZA 2R46A 4AP1A 1NHRA 1GEUA 1M64A 4K5SA 1K0JA 4J31A 4LIIA 1DJQA 3IHMA 2C7GA 4U2LA 1GTHA 2E49A 4H2QA 3EF6A 3I3LA 4KPRA 1AN9A 2VQBA 3CNSA 4YJFB 2OAMA 3RNMA 2WOIA 3IF9A 3NN0X 4B1BA 1JRXA 2BS3A 3AE8A 3E1TA 3CGCA 1H7XA 4K7ZA 4M52A 3S5WA 1IUWA 3DK4A 4K5RA 3AEBA 2E82A 1VQWA 1CJ2A 3DGZA 3ALJA 4USQA 4UDPA 4A6NA 3AE1A 2WOVA 4NNJA 2XVHA 2JB3A 3T2ZA 2C4CA 3C4AA 3DK9A 4U8NA 3NK1X 1EVIA 2GQFA 2GAHB 3KU9A 3GSIA 1NHQA 1UKVG 2B9XA 1Y0PA 1GXFA 4YJGB 3AEDA 2J3NA 3AYLA 1B37A 1CJ3A 1GRFA 1L0VA 3KPKA 1S3EA 3DJDA 2GR1A 3PVCA 5FS8A 4LU6A 1PBDA 1B4VA 2GV8A 2HQMA 4H4XA 4EM3A 5J60A 4PAAA 1AOGA 1KDGA 4A6NB 2WDQA 1JRYA 2PYXA 3I6DA 1EBDA 4H2PA 1KFYA 1H86A 2YLXA 4OPCA 2QAEA 2Y6QA 3AE7A 3M12A 4OPUA 2XFNA 2W0HA 1BZLA 2WDRA 2E1MA 1LQTA 5KMPA 1CC4A 1QJDA 2VVLA 2WEUA 4BJZA 1H82A 2APGA 4JNAA 4CNJA 4GDPA 1IUUA 2GRTA 3ABVA 4AT2A 2BK5A 1DAOA 4J33A 2F5ZA 1M6IA 2XCGA 2B7RA 5KWFA 1YKJA 3SQPA 4Z43A 2XFPA 4GCMA 4BK2A 3ITJA 3ISHA 1GRHA 2BS4A 2FJAA 5EOWA 4OPDA 3T0KA 3SFDA 4A9WA 4EMWA 1MOKA 1ZP0A 2C65A 3H4KA 5DBJA 3GDNA 1VG9A 1GV4A 4DNAA 1NHSA 4B64A 2BC0A 1Q1WA 3SY4A 3RP8A 2BA9A 5EB4A 3H8LA 1C0KA 2C76A 3NIXA 3BHKA 2R0GA 3RP7A 4JNQA 2RGJA 5GRTA 2YVJA 4RSLA 4N9XA 2A89A 4UDQA 5L46A 2JK6A 1GETA 4I58A 1BGJA 1FCDA 1E39A 2C73A 5KRQA 3UTFA 1PHHA 1IJHA 4G74A 3UKAA 1YQ3A 3SX6A 1BKWA 5JCMA 4K2XA 4IV9A 1S2QA 1C0LA 1F8RA 4K8DA 4YSZA 1N4UA 2JB2A 3WE0A 4H7UA 2ZBWA 4H2NA 2JAEA 3D1CA 5BVAA 2A87A 1CJCA 1O94A 1TYPA
chains in the Genus database with same CATH topology
3LJPA 5FS9A 3DJEA 1K4QA 3AE9A 5BUKA 4IVOB 2WESA 4C3YA 4OPIA 3VR9A 1OJCA 4H4UA 3UCLA 5U25A 2VRLA 3H8IA 5EBKA 3DMEA 4NTCA 4RG3A 3REDA 3IWAA 4XXGA 2BK4A 3UKHA 2E4GA 2YM1A 1Q1RA 3BI5A 3DJGX 4JN9A 1B5QA 3FBSA 2DKHA 1N4VA 2C64A 1O5WA 1H7WA 4GDEA 4YKFA 3UKQA 2QA1A 3DA1A 3IC9A 2BS2A 2YLZA 2C70A 3SZWA 1GOSA 4EQSA 3GRTA 4B68A 3CGEA 2V60A 1D5TA 1NEKA 3CNTA 1CF3A 2BYBA 3L8KA 1GSNA 2E5VA 4JDRA 4D03A 1COYA 2GEWA 1TDOA 4U8KA 3M13A 2GF3A 1JEHA 2R45A 3AE2A 3B3RA 3JSKA 3K7QX 4EIPA 1CJ4A 4U2TA 2ACZA 3KPFA 2VVLG 4YTPA 5FS6A 3G5SA 2Q0LA 3AD7B 3FMWA 1F6MA 1N1PA 3CNJA 3F8DA 3NRNA 3UKKA 1DXLA 3AEFA 4Z25A 1B8SA 4NWZA 4BK1A 2EQ7A 1D4DA 1V59A 2R9ZA 3ALMA 3QJ4A 3UP4A 4U8OA 3AD8B 3UTGA 3NNEA 3CPHG 3KLJA 2YQUA 3D8XA 1GT8A 3AYIA 3NK2X 5KVIA 1GERA 2EQ6A 5M0ZA 2B9YA 2DKIA 1Z6LA 2YG6A 2YWLA 1OJAA 3GDPA 1REOA 3OZ2A 2GVCA 4Z2UA 4CNKA 2BCPA 1JRZA 1K0IA 1L9DA 1ZOYA 2GQWA 3FG2P 1TDFA 3K7MX 4A7AA 2RGOA 2V3AA 2WU2A 3AE5A 2B76A 4BURA 4DSHA 4ECHA 4OCGA 2YR5A 3VQRA 1W4XA 1ZX9A 1D4CA 2ZZ0A 4OVIA 4U8PA 4GAPA 4A5LA 3UOVA 3UTHA 4H4RA 2X3NA 3RP6A 4IA5A 3T14A 3BNMA 3NH3X 4UP3A 3CIRA 3GYXA 4J57A 4XWRA 4JY3A 4TM1A 4WX1A 3NTAA 4J36A 4G9KA 1DOBA 5ER0A 1GALA 4B65A 1HYUA 2AQJA 2IVDA 1PBCA 1E1NA 5M10A 2V3BA 5KNLA 1MXTA 3O0HA 5KMQA 2ZZBA 4USRA 1OJTA 2YLTA 2WP5A 4APNA 4GR1A 2Q6UA 1ZDLA 1ZMDA 3BI4A 1FL2A 3GWFA 1GESA 2YM2A 1JNRA 2Y6RA 1H83A 3CMMA 3HYVA 3S61A 4O5UA 2UZZA 4ZN0A 4TM4A 1QLBA 2V61A 2C72A 3II4A 2XVEA 3QVPA 2OLNA 2WPEA 2WP6A 2YLRA 3SGLA 4ADWA 3NLCA 5TR3A 3LXDA 3UOYA 3NYCA 1RSGA 3FIMB 4YSHA 5KOXA 1E7PA 4BK3A 1ZY8A 3QSSA 4AOSA 4U8MA 2RABA 4YKGA 2YG4A 2GH5A 4H4QA 1Q9IA 2C75A 2YLWA 3AE4A 3CN8A 2FJBA 5KMRA 1VG0A 2EQ8A 2JBVA 1PDHA 3F8PA 4IA6A 4YT0A 1RP0A 2NPXA 2XLTA 1CHUA 2QA2A 4TLXA 1LPFA 3COXA 4H4VA 2YG3A 5HXIA 4K22A 4UDRA 1GRBA 1OJDA 4EMJA 2IVEA 4X4JA 3SZCA 3SZFA 3URHA 3VRAA 3AEAA 5BRTA 5JCKA 3CGBA 3T2KA 2WDVA 2WU5A 4PABA 3HYXA 3UKPA 4IVMB 1LTXR 3NYFA 1D4EA 3P4RA 2XFQA 1CC2A 3P1WA 3EANA 2BCGG 3IHGA 2GB0A 2GAGB 1KNRA 2GR3A 2WOWA 1O95A 3NHOX 3NG7X 2WPCA 4U8LA 1NAAA 1XHCA 4II2A 1GNDA 3C96A 3HZLA 1D7LA 1SEZA 4CCQA 2WQYA 2XLSA 4EQXA 4CBQA 1VDCA 2YAUA 1D7YA 4FK1C 4YWOA 2XFUA 4GRTA 1JNZA 1RYIA 3PS9A 4OPTA 2WHDA 3LOVA 3QFBA 4NTEA 5IQ1A 3B6DA 2BK3A 4RG4A 2H88A 2OALA 2NVKX 2VRMA 3Q9TA 3AECA 2BACA 2BC1A 1Y56A 3LZWA 3R9UA 4NZHA 4D04A 1GTEA 4YXDA 5KMSA 1GRTA 2Q0KA 3QVRA 3ZDNA 4Z26A 3GMCA 1OJ9A 3GMBA 2FJDA 2WETA 3GYJA 4EQRA 2X99A 1FEAA 2EQ9A 4H2RA 2JKCA 4AOXA 5IPYA 3NKSA 3T31A 2TMDA 2B9WA 3CNPA 2X8HA 3LB8A 4FDCB 4TM0A 3VRBA 4KX6A 1CBOA 2WP9A 3AEEA 4CY6A 5JCNA 4EMIA 3BHFA 1F8SA 5U1OA 4H50A 4Y4LA 1S2YA 2CULA 4EQWA 3NYEA 3ICRA 1KSSA 5FS7A 1NG4A 3SXIA 4C3XA 4Z24A 4EIQA 2H89A 4BJYA 4XWZA 4Y4MA 4B66A 4H4TA 3ATRA 2AAQA 4CCRA 1BGNA 2GR2A 1PS9A 2ZZCA 2FBWA 1JOAA 2C67A 2GR0A 3AXBA 3HYWA 3T37A 2R0PA 1CC6A 4DSGA 1YQZA 4TLZA 5C3JA 2IIDA 4Y4NA 3VRDB 1PJ5A 4JY2A 3DJJA 1VRQB 4FK1A 4FX9A 1LVLA 5C2TA 1BF3A 4Z44A 4HA6A 5JCLA 3AEGA 5GSNA 4ZCDA 4CRTA 4DGKA 1EL8A 3NGCX 3CPJG 2RGHA 4NTDA 2R4EA 3KKJA 1TRBA 2WS3A 2BXSA 1TDNA 1F3PA 1FECA 2ARDA 2YR6A 3QSMA 3ZYXA 2XLRA 2VOUA 4WCTA 5CKUA 3UOZA 1PJ6A 1F8WA 2JB1A 4G6HA 4A65A 2Z5YA 3K30A 1TDKA 3FPZA 2FJEA 4ICYA 1NENA 3AE6A 3ICTA 4I59A 5IQ4A 3G5QA 3L1RA 1EL9A 1PXBA 4H4YA 4J2WA 5HHFA 3QFAA 4II3A 3LADA 2X8CA 4GUVA 4H4WA 5KOWA 2Z5XA 3CGDA 2XVFA 4BV6A 2XVJA 1IUXA 1L9CA 3KVEA 3P4PA 1PJ7A 5KVHA 1GRGA 4G73A 2C3CA 2X50A 2PHHA 1Y56B 3T2YA 1PBFA 2VVMA 3G5RA 3GYIA 3DH9A 4EM4A 2XVIA 4AT0A 1NDAA 2Q7VA 3ALLA 5HYMA 1PBBA 1DODA 4B67A 2BABA 1FEBA 1P2EA 2WBAA 4GAVA 3VR8A 1EL7A 1LV0A 1MO9A 1N4WA 3CPIG 4ZCCA 3ICSA 3ATQA 3F8RA 5EB5A 4U8IA 4A79A 3UTEA 3SFEA 4YTMA 2OLOA 4OPLA 3CTYA 3PO7A 3Q6JA 4J34A 2BRAA 3NT6A 2CDUA 3SYIA 3DGHA 2VZ2A 2YLSA 2XLUA 3P9UA 4TM3A 4YSXA 4REKA 3BI2A 4H4SA 3GWDA 3AE3A 3UKLA 4H4ZA 3AB1A 1K0LA 1XANA 1E1LA 2C3DA 3CNDA 1E1MA 1PXAA 2CVJA 4NEVA 4JQ9A 2XDOA 2YG5A 1BWCA 1LJ1A 1TYTA 4B69A 2GMJA 3KD9A 4HB9A 2AR8A 3V3OA 3V76A 3NK0X 1ONFA 1ZMCA 4C77A 4YTNA 1ELIA 2XYOA 4Z2TA 1KF6A 3EAOA 4A99A 4C5OA 3UOXA 3AYJA 4AP3A 4P9SA 4OPGA 2V6OA 1LQUA 4O5QA 1IUSA 3GD4A 1PN0A 2R4JA 3AWIA 5FMHA 2OA1A 1KNPA 5U63A 4Z2RA 3AD9B 1YQ4A 1PBEA 1XDIA 3V3NA 1X31B 1GPEA 1E1KA 3ADAB 5KXJA 2I0ZA 3OC4A 2C66A 1IUVA 2BRYA 3GRSA 2XLPA 1GREA 1KSUA 3K7TA 4LA1A 4C74A 1ZOVA 2X8GA 5JCIA 3DK8A 1H81A 3EPTA 5BULA 1DJNA 3UP5A 2VQ7A 1FOHA 4YSYA 1ZK7A 2YR4A 3SZ0A 3LZXA 3QSEA 1QO8A 2GMHA 3BNUA 5J7XA 1H84A 2YG7A 2BXRA 3P4SA 4E0VA 4NEWA 2A8XA 5CQFA 5LV9A 2B7SA 1NPXA 1GRAA 1L9EA 1H6VA 2WPFA 3RHAA 2CFYA 2O9ZA 2QCUA 4U2SA 3GD3A 2R0CA 3UKFA 1JU2A 4B63A 5HY5A 1YY5A 2XFOA 1CL0A 1DNCA 3M0OA 4H4PA 1TDEA 4X9NA 1ZKQA 1IUTA 1NHPA 1DOCA 1DOEA 2YVFA 3C4NA 4G6GA 1PXCA 1P2HA 3NN6X 4U8JA 2TPRA 1NG3A 3P4QA 4GF7A 3KA7A 4CY8A 1EL5A 4X9MA 3NTDA 4MJWA 1E6EA 4J56A 1S3BA 1XPQA 3SM8A 2YVGA 2V5ZA 2R46A 4AP1A 1NHRA 1GEUA 1M64A 4K5SA 1K0JA 4J31A 4LIIA 1DJQA 3IHMA 2C7GA 4U2LA 1GTHA 4H2QA 3EF6A 3I3LA 4KPRA 2VQBA 3CNSA 2OAMA 3RNMA 2WOIA 3IF9A 3NN0X 4B1BA 1JRXA 2BS3A 3AE8A 3E1TA 3CGCA 1H7XA 4K7ZA 4M52A 3S5WA 1IUWA 3DK4A 4K5RA 3AEBA 1VQWA 1CJ2A 3DGZA 3ALJA 4USQA 4UDPA 4A6NA 3AE1A 2WOVA 4NNJA 2XVHA 2JB3A 3T2ZA 2C4CA 3C4AA 3DK9A 4U8NA 3NK1X 2GQFA 2GAHB 3KU9A 3GSIA 1NHQA 1UKVG 2B9XA 1Y0PA 1GXFA 3AEDA 2J3NA 3AYLA 1B37A 1CJ3A 1GRFA 1L0VA 3KPKA 1S3EA 3DJDA 2GR1A 3PVCA 5FS8A 4LU6A 1PBDA 1B4VA 2GV8A 2HQMA 4H4XA 4EM3A 5J60A 4PAAA 1AOGA 1KDGA 4A6NB 2WDQA 1JRYA 2PYXA 3I6DA 1EBDA 4H2PA 1KFYA 1H86A 2YLXA 4OPCA 2QAEA 2Y6QA 3AE7A 3M12A 4OPUA 2XFNA 2W0HA 1BZLA 2WDRA 2E1MA 1LQTA 5KMPA 1CC4A 1QJDA 2VVLA 2WEUA 4BJZA 1H82A 2APGA 4JNAA 4CNJA 4GDPA 1IUUA 2GRTA 3ABVA 4AT2A 2BK5A 4J33A 2F5ZA 1M6IA 2XCGA 2B7RA 5KWFA 1YKJA 3SQPA 4Z43A 2XFPA 4GCMA 4BK2A 3ITJA 3ISHA 1GRHA 2BS4A 2FJAA 5EOWA 4OPDA 3T0KA 3SFDA 4A9WA 4EMWA 1MOKA 1ZP0A 2C65A 3H4KA 5DBJA 3GDNA 1VG9A 1GV4A 4DNAA 1NHSA 4B64A 2BC0A 1Q1WA 3SY4A 3RP8A 2BA9A 5EB4A 3H8LA 2C76A 3NIXA 3BHKA 2R0GA 3RP7A 4JNQA 2RGJA 5GRTA 2YVJA 4RSLA 4N9XA 2A89A 4UDQA 5L46A 2JK6A 1GETA 4I58A 1BGJA 1FCDA 1E39A 2C73A 5KRQA 3UTFA 1IJHA 1PHHA 4G74A 3UKAA 1YQ3A 3SX6A 1BKWA 5JCMA 4K2XA 4IV9A 1S2QA 1F8RA 4K8DA 4YSZA 1N4UA 2JB2A 3WE0A 4H7UA 2ZBWA 4H2NA 2JAEA 3D1CA 5BVAA 2A87A 1CJCA 1O94A 1TYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJP A;  5FS9 A;  3DJE A;  1K4Q A;  3AE9 A;  5BUK A;  4IVO B;  2WES A;  4C3Y A;  4OPI A;  3VR9 A;  1OJC A;  4H4U A;  3UCL A;  5U25 A;  2VRL A;  3H8I A;  5EBK A;  3DME A;  4NTC A;  4RG3 A;  3RED A;  3IWA A;  4XXG A;  2BK4 A;  3UKH A;  2E4G A;  2YM1 A;  1Q1R A;  3BI5 A;  3DJG X;  4JN9 A;  1B5Q A;  3FBS A;  2DKH A;  1N4V A;  2C64 A;  1O5W A;  1H7W A;  4GDE A;  4YKF A;  3UKQ A;  2QA1 A;  3DA1 A;  3IC9 A;  2BS2 A;  2YLZ A;  2C70 A;  4EQS A;  1GOS A;  3GRT A;  4B68 A;  3CGE A;  2V60 A;  1D5T A;  1NEK A;  3CNT A;  1CF3 A;  2BYB A;  3L8K A;  1GSN A;  2E5V A;  4JDR A;  4D03 A;  1COY A;  2GEW A;  1TDO A;  4U8K A;  3M13 A;  2GF3 A;  1JEH A;  2R45 A;  3AE2 A;  3B3R A;  3JSK A;  3K7Q X;  4EIP A;  1CJ4 A;  4U2T A;  2ACZ A;  3KPF A;  2VVL G;  4YTP A;  5FS6 A;  3G5S A;  2Q0L A;  3AD7 B;  3FMW A;  1F6M A;  1N1P A;  3CNJ A;  3F8D A;  3NRN A;  3UKK A;  1DXL A;  3AEF A;  4Z25 A;  1B8S A;  4BK1 A;  2EQ7 A;  1D4D A;  1V59 A;  2R9Z A;  3ALM A;  3QJ4 A;  3UP4 A;  4U8O A;  3AD8 B;  3UTG A;  3NNE A;  3CPH G;  3KLJ A;  2YQU A;  3D8X A;  1GT8 A;  3AYI A;  3NK2 X;  5KVI A;  1GER A;  2EQ6 A;  5M0Z A;  2B9Y A;  2DKI A;  1Z6L A;  2YG6 A;  2YWL A;  1OJA A;  3GDP A;  1REO A;  3OZ2 A;  2GVC A;  4Z2U A;  4CNK A;  2BCP A;  1JRZ A;  1K0I A;  1L9D A;  1ZOY A;  2GQW A;  3FG2 P;  1TDF A;  3K7M X;  4A7A A;  2RGO A;  2V3A A;  2WU2 A;  3AE5 A;  2B76 A;  4BUR A;  4DSH A;  4ECH A;  4OCG A;  2YR5 A;  3VQR A;  1W4X A;  1ZX9 A;  1D4C A;  2ZZ0 A;  4OVI A;  4U8P A;  4A5L A;  3UOV A;  3UTH A;  4H4R A;  2X3N A;  3RP6 A;  4IA5 A;  3BNM A;  3NH3 X;  4UP3 A;  3CIR A;  4J57 A;  4XWR A;  4JY3 A;  4TM1 A;  4WX1 A;  3NTA A;  4J36 A;  1DOB A;  5ER0 A;  1GAL A;  4B65 A;  1HYU A;  2AQJ A;  2IVD A;  1PBC A;  1E1N A;  5M10 A;  2V3B A;  1MXT A;  3O0H A;  2ZZB A;  4USR A;  1OJT A;  2YLT A;  2WP5 A;  4APN A;  4GR1 A;  2Q6U A;  1ZDL A;  1ZMD A;  3BI4 A;  1FL2 A;  3GWF A;  1GES A;  2YM2 A;  1JNR A;  2Y6R A;  1H83 A;  3S61 A;  4ZN0 A;  4O5U A;  2UZZ A;  4TM4 A;  1QLB A;  2V61 A;  2C72 A;  3II4 A;  2XVE A;  3QVP A;  2OLN A;  2WPE A;  2WP6 A;  2YLR A;  3SGL A;  4ADW A;  3NLC A;  5TR3 A;  3LXD A;  3UOY A;  3NYC A;  1RSG A;  3FIM B;  4YSH A;  5KOX A;  1E7P A;  1ZY8 A;  3QSS A;  4AOS A;  4BK3 A;  4U8M A;  2RAB A;  4YKG A;  2YG4 A;  2GH5 A;  4H4Q A;  1Q9I A;  2C75 A;  2YLW A;  3AE4 A;  3CN8 A;  2FJB A;  1VG0 A;  2EQ8 A;  2JBV A;  1PDH A;  3F8P A;  4IA6 A;  4YT0 A;  1RP0 A;  2NPX A;  2XLT A;  1CHU A;  2QA2 A;  4TLX A;  1LPF A;  3COX A;  4H4V A;  2YG3 A;  5HXI A;  4K22 A;  4UDR A;  1GRB A;  1OJD A;  4EMJ A;  2IVE A;  4X4J A;  3URH A;  3VRA A;  3AEA A;  5BRT A;  5JCK A;  3CGB A;  2WDV A;  2WU5 A;  4PAB A;  3UKP A;  4IVM B;  1LTX R;  3NYF A;  1D4E A;  3P4R A;  2XFQ A;  1CC2 A;  3P1W A;  3EAN A;  2BCG G;  3IHG A;  2GB0 A;  2GAG B;  1KNR A;  2GR3 A;  2WOW A;  1O95 A;  3NHO X;  3NG7 X;  2WPC A;  4U8L A;  1NAA A;  1XHC A;  1GND A;  3C96 A;  3HZL A;  1D7L A;  1SEZ A;  4CCQ A;  2WQY A;  2XLS A;  4EQX A;  4CBQ A;  1VDC A;  2YAU A;  1D7Y A;  4FK1 C;  4YWO A;  2XFU A;  4GRT A;  1JNZ A;  1RYI A;  3PS9 A;  4OPT A;  2WHD A;  3LOV A;  3QFB A;  4NTE A;  5IQ1 A;  3B6D A;  2BK3 A;  4RG4 A;  2H88 A;  2OAL A;  2NVK X;  2VRM A;  3Q9T A;  3AEC A;  2BAC A;  2BC1 A;  1Y56 A;  3LZW A;  3R9U A;  4NZH A;  4D04 A;  1GTE A;  4YXD A;  1GRT A;  2Q0K A;  3QVR A;  3ZDN A;  4Z26 A;  3GMC A;  1OJ9 A;  3GMB A;  2FJD A;  2WET A;  3GYJ A;  4EQR A;  2X99 A;  1FEA A;  2EQ9 A;  4H2R A;  2JKC A;  4AOX A;  5IPY A;  3NKS A;  2TMD A;  2B9W A;  3CNP A;  2X8H A;  3LB8 A;  4FDC B;  4TM0 A;  3VRB A;  4KX6 A;  1CBO A;  2WP9 A;  3AEE A;  4CY6 A;  5JCN A;  4EMI A;  3BHF A;  1F8S A;  5U1O A;  4H50 A;  4Y4L A;  1S2Y A;  2CUL A;  4EQW A;  3NYE A;  3ICR A;  1KSS A;  5FS7 A;  1NG4 A;  4C3X A;  4Z24 A;  4EIQ A;  2H89 A;  4BJY A;  4XWZ A;  4Y4M A;  4B66 A;  4H4T A;  3ATR A;  2AAQ A;  4CCR A;  1BGN A;  2GR2 A;  1PS9 A;  2ZZC A;  2FBW A;  1JOA A;  2C67 A;  2GR0 A;  3AXB A;  3T37 A;  2R0P A;  1CC6 A;  4DSG A;  1YQZ A;  4TLZ A;  5C3J A;  2IID A;  4Y4N A;  3VRD B;  1PJ5 A;  4JY2 A;  3DJJ A;  1VRQ B;  4FK1 A;  4FX9 A;  1LVL A;  5C2T A;  1BF3 A;  4Z44 A;  4HA6 A;  5JCL A;  3AEG A;  5GSN A;  4ZCD A;  4CRT A;  4DGK A;  1EL8 A;  3NGC X;  3CPJ G;  2RGH A;  4NTD A;  2R4E A;  3KKJ A;  1TRB A;  2WS3 A;  2BXS A;  1TDN A;  1F3P A;  1FEC A;  2ARD A;  2YR6 A;  3QSM A;  3ZYX A;  2XLR A;  2VOU A;  4WCT A;  5CKU A;  3UOZ A;  1PJ6 A;  1F8W A;  2JB1 A;  4A65 A;  2Z5Y A;  3K30 A;  1TDK A;  3FPZ A;  2FJE A;  4ICY A;  1NEN A;  3AE6 A;  3ICT A;  4I59 A;  5IQ4 A;  3G5Q A;  3L1R A;  1EL9 A;  1PXB A;  4H4Y A;  4J2W A;  5HHF A;  3QFA A;  3LAD A;  2X8C A;  4GUV A;  4H4W A;  5KOW A;  2Z5X A;  3CGD A;  2XVF A;  4BV6 A;  2XVJ A;  1IUX A;  1L9C A;  3KVE A;  3P4P A;  1PJ7 A;  5KVH A;  1GRG A;  2C3C A;  2X50 A;  2PHH A;  1Y56 B;  1PBF A;  2VVM A;  3G5R A;  3GYI A;  3DH9 A;  4EM4 A;  2XVI A;  4AT0 A;  1NDA A;  2Q7V A;  3ALL A;  5HYM A;  1PBB A;  1DOD A;  4B67 A;  2BAB A;  1FEB A;  1P2E A;  2WBA A;  3VR8 A;  1EL7 A;  1LV0 A;  1MO9 A;  1N4W A;  3CPI G;  4ZCC A;  3ICS A;  3ATQ A;  3F8R A;  5EB5 A;  4U8I A;  4A79 A;  3UTE A;  3SFE A;  4YTM A;  2OLO A;  4OPL A;  3CTY A;  3PO7 A;  3Q6J A;  4J34 A;  3NT6 A;  2CDU A;  3DGH A;  2VZ2 A;  2YLS A;  2XLU A;  3P9U A;  4TM3 A;  4YSX A;  4REK A;  3BI2 A;  4H4S A;  3GWD A;  3AE3 A;  3UKL A;  4H4Z A;  3AB1 A;  1K0L A;  1XAN A;  1E1L A;  2C3D A;  3CND A;  1E1M A;  1PXA A;  2CVJ A;  4NEV A;  4JQ9 A;  2XDO A;  2YG5 A;  1BWC A;  1LJ1 A;  1TYT A;  4B69 A;  2GMJ A;  3KD9 A;  4HB9 A;  2AR8 A;  3V3O A;  3V76 A;  3NK0 X;  1ONF A;  1ZMC A;  4C77 A;  4YTN A;  1ELI A;  2XYO A;  4Z2T A;  1KF6 A;  3EAO A;  4A99 A;  4C5O A;  3UOX A;  3AYJ A;  4AP3 A;  4P9S A;  4OPG A;  2V6O A;  1LQU A;  4O5Q A;  1IUS A;  3GD4 A;  1PN0 A;  2R4J A;  3AWI A;  5FMH A;  2OA1 A;  1KNP A;  5U63 A;  4Z2R A;  3AD9 B;  1YQ4 A;  1PBE A;  1XDI A;  3V3N A;  1X31 B;  1GPE A;  1E1K A;  3ADA B;  5KXJ A;  2I0Z A;  3OC4 A;  2C66 A;  1IUV A;  3GRS A;  2XLP A;  1GRE A;  1KSU A;  3K7T A;  4LA1 A;  4C74 A;  1ZOV A;  2X8G A;  5JCI A;  3DK8 A;  1H81 A;  3EPT A;  5BUL A;  1DJN A;  3UP5 A;  2VQ7 A;  1FOH A;  4YSY A;  1ZK7 A;  2YR4 A;  3LZX A;  3QSE A;  1QO8 A;  2GMH A;  3BNU A;  5J7X A;  1H84 A;  2YG7 A;  2BXR A;  3P4S A;  4E0V A;  4NEW A;  2A8X A;  5CQF A;  5LV9 A;  2B7S A;  1NPX A;  1GRA A;  1L9E A;  1H6V A;  2WPF A;  3RHA A;  2CFY A;  2O9Z A;  2QCU A;  4U2S A;  3GD3 A;  2R0C A;  3UKF A;  1JU2 A;  4B63 A;  5HY5 A;  1YY5 A;  2XFO A;  1CL0 A;  1DNC A;  3M0O A;  4H4P A;  1TDE A;  4X9N A;  1ZKQ A;  1IUT A;  1NHP A;  1DOC A;  1DOE A;  2YVF A;  3C4N A;  1PXC A;  1P2H A;  3NN6 X;  4U8J A;  2TPR A;  1NG3 A;  3P4Q A;  4GF7 A;  3KA7 A;  4CY8 A;  1EL5 A;  4X9M A;  3NTD A;  4MJW A;  1E6E A;  4J56 A;  1S3B A;  1XPQ A;  3SM8 A;  2YVG A;  2V5Z A;  2R46 A;  4AP1 A;  1NHR A;  1GEU A;  1M64 A;  4K5S A;  1K0J A;  4J31 A;  4LII A;  1DJQ A;  3IHM A;  2C7G A;  4U2L A;  1GTH A;  4H2Q A;  3EF6 A;  3I3L A;  4KPR A;  2VQB A;  3CNS A;  2OAM A;  3RNM A;  2WOI A;  3IF9 A;  3NN0 X;  4B1B A;  1JRX A;  2BS3 A;  3AE8 A;  3CGC A;  3E1T A;  1H7X A;  4K7Z A;  4M52 A;  3S5W A;  1IUW A;  3DK4 A;  4K5R A;  3AEB A;  1VQW A;  1CJ2 A;  3DGZ A;  3ALJ A;  4USQ A;  4UDP A;  4A6N A;  3AE1 A;  2WOV A;  2XVH A;  2JB3 A;  3DK9 A;  3C4A A;  4U8N A;  3NK1 X;  2GQF A;  2GAH B;  3KU9 A;  3GSI A;  1NHQ A;  1UKV G;  2B9X A;  1Y0P A;  1GXF A;  3AED A;  2J3N A;  3AYL A;  1B37 A;  1CJ3 A;  1GRF A;  1L0V A;  1S3E A;  3DJD A;  2GR1 A;  3PVC A;  5FS8 A;  4LU6 A;  1PBD A;  1B4V A;  2GV8 A;  2HQM A;  4H4X A;  4EM3 A;  5J60 A;  4PAA A;  1AOG A;  1KDG A;  4A6N B;  2WDQ A;  1JRY A;  2PYX A;  3I6D A;  1EBD A;  4H2P A;  1KFY A;  1H86 A;  2YLX A;  4OPC A;  2QAE A;  2Y6Q A;  3AE7 A;  3M12 A;  4OPU A;  2XFN A;  2W0H A;  1BZL A;  2WDR A;  2E1M A;  1LQT A;  1CC4 A;  1QJD A;  2VVL A;  2WEU A;  4BJZ A;  1H82 A;  2APG A;  4JNA A;  4CNJ A;  4GDP A;  1IUU A;  2GRT A;  3ABV A;  4AT2 A;  2BK5 A;  4J33 A;  2F5Z A;  1M6I A;  2XCG A;  2B7R A;  5KWF A;  1YKJ A;  3SQP A;  4Z43 A;  2XFP A;  4GCM A;  4BK2 A;  3ITJ A;  3ISH A;  1GRH A;  2BS4 A;  2FJA A;  5EOW A;  4OPD A;  3SFD A;  4A9W A;  4EMW A;  1MOK A;  1ZP0 A;  2C65 A;  3H4K A;  5DBJ A;  3GDN A;  1VG9 A;  1GV4 A;  4DNA A;  1NHS A;  4B64 A;  2BC0 A;  1Q1W A;  3RP8 A;  2BA9 A;  5EB4 A;  3H8L A;  2C76 A;  3NIX A;  3BHK A;  2R0G A;  5GRT A;  4JNQ A;  2RGJ A;  3RP7 A;  2YVJ A;  4RSL A;  4N9X A;  2A89 A;  4UDQ A;  5L46 A;  2JK6 A;  1GET A;  4I58 A;  1BGJ A;  1FCD A;  1E39 A;  2C73 A;  5KRQ A;  3UTF A;  1IJH A;  1PHH A;  3UKA A;  1YQ3 A;  1BKW A;  5JCM A;  4K2X A;  4IV9 A;  1S2Q A;  1F8R A;  4K8D A;  4YSZ A;  1N4U A;  2JB2 A;  3WE0 A;  4H7U A;  2ZBW A;  4H2N A;  2JAE A;  3D1C A;  5BVA A;  2A87 A;  1CJC A;  1O94 A;  1TYP A; 
#chains in the Genus database with same CATH topology
 3LJP A;  5FS9 A;  3DJE A;  1K4Q A;  3AE9 A;  5BUK A;  4IVO B;  2WES A;  4C3Y A;  4OPI A;  3VR9 A;  1OJC A;  4H4U A;  3UCL A;  5U25 A;  2VRL A;  3H8I A;  5EBK A;  3DME A;  4NTC A;  4RG3 A;  3RED A;  3IWA A;  4XXG A;  2BK4 A;  3UKH A;  2E4G A;  2YM1 A;  1Q1R A;  3BI5 A;  3DJG X;  4JN9 A;  1B5Q A;  3FBS A;  2DKH A;  1N4V A;  2C64 A;  1O5W A;  1H7W A;  3WGT A;  4GDE A;  4YKF A;  3UKQ A;  3DA1 A;  2QA1 A;  3IC9 A;  2BS2 A;  2YLZ A;  2C70 A;  3SZW A;  1GOS A;  4EQS A;  3GRT A;  4B68 A;  3CGE A;  2V60 A;  1D5T A;  1NEK A;  3CNT A;  1CF3 A;  2BYB A;  3L8K A;  1GSN A;  2E5V A;  4JDR A;  4D03 A;  1COY A;  2GEW A;  1TDO A;  4U8K A;  3M13 A;  2E48 A;  2GF3 A;  2R45 A;  4YJF A;  1JEH A;  3AE2 A;  3B3R A;  3JSK A;  3K7Q X;  4EIP A;  1CJ4 A;  4U2T A;  2ACZ A;  3KPF A;  2VVL G;  4YTP A;  5FS6 A;  3G5S A;  3AD7 B;  2Q0L A;  3FMW A;  1F6M A;  1N1P A;  3ZNP A;  3CNJ A;  3F8D A;  3NRN A;  3UKK A;  1DXL A;  3AEF A;  4Z25 A;  1B8S A;  4NWZ A;  4BK1 A;  2EQ7 A;  1D4D A;  1V59 A;  2R9Z A;  3ALM A;  3QJ4 A;  3UP4 A;  4U8O A;  3AD8 B;  3UTG A;  3NNE A;  3CPH G;  3KLJ A;  3W4I A;  2YQU A;  3D8X A;  1GT8 A;  3AYI A;  3NK2 X;  5KVI A;  1GER A;  2EQ6 A;  5M0Z A;  2B9Y A;  2DKI A;  1Z6L A;  2YG6 A;  2YWL A;  1OJA A;  3OZ2 A;  1REO A;  3GDP A;  2GVC A;  4Z2U A;  4CNK A;  2BCP A;  1K0I A;  1L9D A;  1JRZ A;  1ZOY A;  2GQW A;  3FG2 P;  1TDF A;  3K7M X;  4A7A A;  2RGO A;  2V3A A;  2WU2 A;  3AE5 A;  2B76 A;  4BUR A;  4DSH A;  4ECH A;  4OCG A;  2YR5 A;  3VQR A;  1W4X A;  1ZX9 A;  1D4C A;  2ZZ0 A;  4OVI A;  4U8P A;  4GAP A;  4A5L A;  3UOV A;  3UTH A;  4H4R A;  2X3N A;  3RP6 A;  4IA5 A;  3T14 A;  3BNM A;  3NH3 X;  4UP3 A;  3CIR A;  3GYX A;  4J57 A;  4XWR A;  4JY3 A;  4TM1 A;  4WX1 A;  3NTA A;  4J36 A;  4G9K A;  1DOB A;  5ER0 A;  1GAL A;  4B65 A;  1HYU A;  2AQJ A;  2IVD A;  1PBC A;  1E1N A;  5M10 A;  2V3B A;  5KNL A;  1MXT A;  3O0H A;  5KMQ A;  2ZZB A;  4USR A;  1OJT A;  2YLT A;  2WP5 A;  4APN A;  4GR1 A;  2Q6U A;  1ZDL A;  1ZMD A;  3BI4 A;  1FL2 A;  3GWF A;  1GES A;  2YM2 A;  1JNR A;  2Y6R A;  1H83 A;  3CMM A;  3HYV A;  3S61 A;  4O5U A;  2UZZ A;  4ZN0 A;  4TM4 A;  1QLB A;  2V61 A;  2C72 A;  3II4 A;  2XVE A;  3QVP A;  2OLN A;  2WPE A;  2WP6 A;  3SGL A;  3ZNO A;  2YLR A;  3NLC A;  5TR3 A;  4ADW A;  3LXD A;  3UOY A;  3NYC A;  1RSG A;  4YSH A;  3FIM B;  5KOX A;  1E7P A;  4BK3 A;  3QSS A;  1ZY8 A;  4AOS A;  4U8M A;  2RAB A;  4QFD A;  2YG4 A;  4YKG A;  2GH5 A;  4H4Q A;  1Q9I A;  2C75 A;  2YLW A;  3AE4 A;  3CN8 A;  2FJB A;  5KMR A;  1VG0 A;  2EQ8 A;  2JBV A;  1PDH A;  3F8P A;  4IA6 A;  4YT0 A;  1RP0 A;  2NPX A;  2XLT A;  1CHU A;  2QA2 A;  4TLX A;  1LPF A;  3COX A;  4H4V A;  2YG3 A;  5HXI A;  4K22 A;  4UDR A;  1GRB A;  1OJD A;  4EMJ A;  2IVE A;  4X4J A;  3SZC A;  3SZF A;  3URH A;  3VRA A;  3AEA A;  5BRT A;  5JCK A;  3CGB A;  3T2K A;  2WDV A;  2WU5 A;  4PAB A;  3HYX A;  3UKP A;  4YJH B;  4IVM B;  1LTX R;  3NYF A;  1D4E A;  3W4K A;  2XFQ A;  1CC2 A;  3P1W A;  3P4R A;  3EAN A;  2BCG G;  2GB0 A;  3IHG A;  2GAG B;  1KNR A;  2GR3 A;  2WOW A;  1O95 A;  3NHO X;  3NG7 X;  2WPC A;  4U8L A;  1NAA A;  1XHC A;  4II2 A;  1GND A;  3C96 A;  3HZL A;  1D7L A;  1SEZ A;  4CCQ A;  2WQY A;  2XLS A;  4EQX A;  4CBQ A;  1C0I A;  1VDC A;  2YAU A;  1D7Y A;  4FK1 C;  1KIF A;  4YWO A;  2XFU A;  4GRT A;  1JNZ A;  1RYI A;  3PS9 A;  4OPT A;  2WHD A;  3LOV A;  3QFB A;  4NTE A;  5IQ1 A;  3B6D A;  4YJD A;  2BK3 A;  4RG4 A;  2H88 A;  2OAL A;  3G3E A;  2NVK X;  2VRM A;  3AEC A;  3Q9T A;  2BAC A;  2BC1 A;  1Y56 A;  3LZW A;  3R9U A;  4NZH A;  4D04 A;  1GTE A;  4YXD A;  5KMS A;  1GRT A;  2Q0K A;  3QVR A;  3ZDN A;  4Z26 A;  3GMC A;  1OJ9 A;  1C0P A;  3GMB A;  2FJD A;  2WET A;  3GYJ A;  4EQR A;  2X99 A;  1FEA A;  2EQ9 A;  4H2R A;  2JKC A;  4AOX A;  5IPY A;  3NKS A;  3T31 A;  2TMD A;  2B9W A;  3CNP A;  2X8H A;  3LB8 A;  4FDC B;  4TM0 A;  3VRB A;  4KX6 A;  3ZNN A;  2DU8 A;  2E4A A;  1CBO A;  2WP9 A;  3AEE A;  4CY6 A;  5JCN A;  4EMI A;  3BHF A;  1F8S A;  5U1O A;  4H50 A;  4Y4L A;  1S2Y A;  2CUL A;  4EQW A;  3NYE A;  3ICR A;  1KSS A;  5FS7 A;  1NG4 A;  3SXI A;  4C3X A;  4Z24 A;  4EIQ A;  2H89 A;  4BJY A;  4XWZ A;  4Y4M A;  4B66 A;  4H4T A;  3ATR A;  2AAQ A;  4CCR A;  1BGN A;  2GR2 A;  1PS9 A;  2ZZC A;  2FBW A;  1JOA A;  2C67 A;  2GR0 A;  3AXB A;  3HYW A;  3T37 A;  1CC6 A;  2R0P A;  4DSG A;  1YQZ A;  4TLZ A;  5C3J A;  2IID A;  4Y4N A;  3VRD B;  1PJ5 A;  4JY2 A;  3DJJ A;  1VRQ B;  4FK1 A;  4FX9 A;  1LVL A;  5C2T A;  1BF3 A;  4Z44 A;  4HA6 A;  5JCL A;  3AEG A;  5GSN A;  4ZCD A;  4CRT A;  4DGK A;  1EL8 A;  3NGC X;  3CPJ G;  2RGH A;  4NTD A;  2R4E A;  3QSM A;  1TRB A;  2WS3 A;  1TDN A;  1F3P A;  2ARD A;  1FEC A;  2BXS A;  2YR6 A;  3KKJ A;  3ZYX A;  2XLR A;  2VOU A;  4WCT A;  5CKU A;  3UOZ A;  1PJ6 A;  1F8W A;  2JB1 A;  4G6H A;  4A65 A;  2Z5Y A;  3K30 A;  1TDK A;  3FPZ A;  2FJE A;  4ICY A;  4YJG A;  1NEN A;  3AE6 A;  3ICT A;  4I59 A;  5IQ4 A;  3G5Q A;  3L1R A;  1EL9 A;  1PXB A;  4H4Y A;  4J2W A;  5HHF A;  3QFA A;  4II3 A;  3LAD A;  2X8C A;  4GUV A;  4H4W A;  5KOW A;  2Z5X A;  3CGD A;  2XVF A;  4BV6 A;  2XVJ A;  1IUX A;  1L9C A;  3KVE A;  3P4P A;  1PJ7 A;  5KVH A;  1GRG A;  4G73 A;  2C3C A;  2X50 A;  2PHH A;  1Y56 B;  3T2Y A;  1PBF A;  2VVM A;  3G5R A;  3GYI A;  3DH9 A;  4EM4 A;  2XVI A;  4AT0 A;  1NDA A;  2Q7V A;  3ALL A;  5HYM A;  1PBB A;  1DOD A;  4B67 A;  2BAB A;  1FEB A;  1P2E A;  2WBA A;  4GAV A;  3VR8 A;  1EL7 A;  4YJH A;  1LV0 A;  1MO9 A;  1N4W A;  3CPI G;  4ZCC A;  3ICS A;  3ATQ A;  3F8R A;  3CUK A;  5EB5 A;  4U8I A;  4A79 A;  3ZNQ A;  1VE9 A;  3UTE A;  3SFE A;  4YTM A;  2OLO A;  4OPL A;  3CTY A;  3PO7 A;  3Q6J A;  4J34 A;  2BRA A;  3NT6 A;  2CDU A;  3SYI A;  3DGH A;  2VZ2 A;  2YLS A;  2XLU A;  3P9U A;  4TM3 A;  4YSX A;  4REK A;  3BI2 A;  4H4S A;  3GWD A;  3AE3 A;  3UKL A;  4H4Z A;  3AB1 A;  1K0L A;  1XAN A;  1E1L A;  2C3D A;  3CND A;  1E1M A;  4QFC A;  1PXA A;  2CVJ A;  4NEV A;  4JQ9 A;  2XDO A;  2YG5 A;  1BWC A;  1LJ1 A;  1TYT A;  4B69 A;  2GMJ A;  3KD9 A;  4HB9 A;  2AR8 A;  3V3O A;  3V76 A;  1DDO A;  3NK0 X;  1ONF A;  1ZMC A;  4C77 A;  4YTN A;  1ELI A;  2XYO A;  4Z2T A;  1KF6 A;  3EAO A;  4A99 A;  4C5O A;  3UOX A;  3AYJ A;  4AP3 A;  4P9S A;  4OPG A;  2V6O A;  1LQU A;  4O5Q A;  1IUS A;  3GD4 A;  1PN0 A;  2R4J A;  3AWI A;  5FMH A;  2OA1 A;  1KNP A;  5U63 A;  4Z2R A;  3AD9 B;  1YQ4 A;  1PBE A;  1XDI A;  3V3N A;  1X31 B;  1GPE A;  3ADA B;  1E1K A;  5KXJ A;  2I0Z A;  3OC4 A;  2C66 A;  1IUV A;  2BRY A;  3GRS A;  2XLP A;  1GRE A;  1KSU A;  3K7T A;  4LA1 A;  4C74 A;  1ZOV A;  2X8G A;  5JCI A;  3DK8 A;  1H81 A;  3EPT A;  5BUL A;  1DJN A;  3UP5 A;  2VQ7 A;  1FOH A;  4YSY A;  1ZK7 A;  2YR4 A;  3SZ0 A;  3LZX A;  3QSE A;  1QO8 A;  2GMH A;  3BNU A;  5J7X A;  1H84 A;  2YG7 A;  2BXR A;  3P4S A;  4E0V A;  4NEW A;  2A8X A;  5CQF A;  5LV9 A;  2B7S A;  1NPX A;  1GRA A;  1L9E A;  1H6V A;  2WPF A;  3RHA A;  2QCU A;  2CFY A;  2O9Z A;  4U2S A;  3GD3 A;  2R0C A;  3UKF A;  1JU2 A;  4B63 A;  5HY5 A;  1YY5 A;  2XFO A;  1DNC A;  1CL0 A;  3M0O A;  4H4P A;  4X9N A;  1TDE A;  1ZKQ A;  1IUT A;  1NHP A;  1DOC A;  1DOE A;  2YVF A;  3C4N A;  4G6G A;  1PXC A;  1P2H A;  3NN6 X;  4U8J A;  2TPR A;  1NG3 A;  3P4Q A;  4GF7 A;  3KA7 A;  4CY8 A;  1EL5 A;  4X9M A;  3W4J A;  3NTD A;  4MJW A;  1E6E A;  4J56 A;  3SM8 A;  1S3B A;  1XPQ A;  2YVG A;  2V5Z A;  2R46 A;  4AP1 A;  1NHR A;  1GEU A;  1M64 A;  4K5S A;  1K0J A;  4J31 A;  4LII A;  1DJQ A;  3IHM A;  2C7G A;  4U2L A;  1GTH A;  2E49 A;  4H2Q A;  3EF6 A;  3I3L A;  4KPR A;  1AN9 A;  2VQB A;  3CNS A;  4YJF B;  2OAM A;  3RNM A;  2WOI A;  3IF9 A;  3NN0 X;  4B1B A;  1JRX A;  2BS3 A;  3AE8 A;  3E1T A;  3CGC A;  1H7X A;  4K7Z A;  4M52 A;  3S5W A;  1IUW A;  3DK4 A;  4K5R A;  3AEB A;  2E82 A;  1VQW A;  1CJ2 A;  3DGZ A;  3ALJ A;  4USQ A;  4UDP A;  4A6N A;  3AE1 A;  2WOV A;  4NNJ A;  2XVH A;  2JB3 A;  3T2Z A;  2C4C A;  3C4A A;  3DK9 A;  4U8N A;  3NK1 X;  1EVI A;  2GQF A;  2GAH B;  3KU9 A;  3GSI A;  1NHQ A;  1UKV G;  2B9X A;  1Y0P A;  1GXF A;  4YJG B;  3AED A;  2J3N A;  3AYL A;  1B37 A;  1CJ3 A;  1GRF A;  1L0V A;  3KPK A;  1S3E A;  3DJD A;  2GR1 A;  3PVC A;  5FS8 A;  4LU6 A;  1PBD A;  1B4V A;  2GV8 A;  2HQM A;  4H4X A;  4EM3 A;  5J60 A;  4PAA A;  1AOG A;  1KDG A;  4A6N B;  2WDQ A;  1JRY A;  2PYX A;  3I6D A;  1EBD A;  4H2P A;  1KFY A;  1H86 A;  2YLX A;  4OPC A;  2QAE A;  2Y6Q A;  3AE7 A;  3M12 A;  4OPU A;  2XFN A;  2W0H A;  1BZL A;  2WDR A;  2E1M A;  1LQT A;  5KMP A;  1CC4 A;  1QJD A;  2VVL A;  2WEU A;  4BJZ A;  1H82 A;  2APG A;  4JNA A;  4CNJ A;  4GDP A;  1IUU A;  2GRT A;  3ABV A;  4AT2 A;  2BK5 A;  1DAO A;  4J33 A;  2F5Z A;  1M6I A;  2XCG A;  2B7R A;  5KWF A;  1YKJ A;  3SQP A;  4Z43 A;  2XFP A;  4GCM A;  4BK2 A;  3ITJ A;  3ISH A;  1GRH A;  2BS4 A;  2FJA A;  5EOW A;  4OPD A;  3T0K A;  3SFD A;  4A9W A;  4EMW A;  1MOK A;  1ZP0 A;  2C65 A;  3H4K A;  5DBJ A;  3GDN A;  1VG9 A;  1GV4 A;  4DNA A;  1NHS A;  4B64 A;  2BC0 A;  1Q1W A;  3SY4 A;  3RP8 A;  2BA9 A;  5EB4 A;  3H8L A;  1C0K A;  2C76 A;  3NIX A;  3BHK A;  2R0G A;  3RP7 A;  4JNQ A;  2RGJ A;  5GRT A;  2YVJ A;  4RSL A;  4N9X A;  2A89 A;  4UDQ A;  5L46 A;  2JK6 A;  1GET A;  4I58 A;  1BGJ A;  1FCD A;  1E39 A;  2C73 A;  5KRQ A;  3UTF A;  1PHH A;  1IJH A;  4G74 A;  3UKA A;  1YQ3 A;  3SX6 A;  1BKW A;  5JCM A;  4K2X A;  4IV9 A;  1S2Q A;  1C0L A;  1F8R A;  4K8D A;  4YSZ A;  1N4U A;  2JB2 A;  3WE0 A;  4H7U A;  2ZBW A;  4H2N A;  2JAE A;  3D1C A;  5BVA A;  2A87 A;  1CJC A;  1O94 A;  1TYP A; 
#chains in the Genus database with same CATH homology
 3LJP A;  5FS9 A;  3DJE A;  1K4Q A;  3AE9 A;  5BUK A;  4IVO B;  2WES A;  4C3Y A;  4OPI A;  3VR9 A;  1OJC A;  4H4U A;  3UCL A;  5U25 A;  2VRL A;  3H8I A;  5EBK A;  3DME A;  4NTC A;  4RG3 A;  3RED A;  3IWA A;  4XXG A;  2BK4 A;  3UKH A;  2E4G A;  2YM1 A;  1Q1R A;  3BI5 A;  3DJG X;  4JN9 A;  1B5Q A;  3FBS A;  2DKH A;  1N4V A;  2C64 A;  1O5W A;  1H7W A;  4GDE A;  4YKF A;  3UKQ A;  2QA1 A;  3DA1 A;  3IC9 A;  2BS2 A;  2YLZ A;  2C70 A;  3SZW A;  1GOS A;  4EQS A;  3GRT A;  4B68 A;  3CGE A;  2V60 A;  1D5T A;  1NEK A;  3CNT A;  1CF3 A;  2BYB A;  3L8K A;  1GSN A;  2E5V A;  4JDR A;  4D03 A;  1COY A;  2GEW A;  1TDO A;  4U8K A;  3M13 A;  2GF3 A;  1JEH A;  2R45 A;  3AE2 A;  3B3R A;  3JSK A;  3K7Q X;  4EIP A;  1CJ4 A;  4U2T A;  2ACZ A;  3KPF A;  2VVL G;  4YTP A;  5FS6 A;  3G5S A;  2Q0L A;  3AD7 B;  3FMW A;  1F6M A;  1N1P A;  3CNJ A;  3F8D A;  3NRN A;  3UKK A;  1DXL A;  3AEF A;  4Z25 A;  1B8S A;  4NWZ A;  4BK1 A;  2EQ7 A;  1D4D A;  1V59 A;  2R9Z A;  3ALM A;  3QJ4 A;  3UP4 A;  4U8O A;  3AD8 B;  3UTG A;  3NNE A;  3CPH G;  3KLJ A;  2YQU A;  3D8X A;  1GT8 A;  3AYI A;  3NK2 X;  5KVI A;  1GER A;  2EQ6 A;  5M0Z A;  2B9Y A;  2DKI A;  1Z6L A;  2YG6 A;  2YWL A;  1OJA A;  3GDP A;  1REO A;  3OZ2 A;  2GVC A;  4Z2U A;  4CNK A;  2BCP A;  1JRZ A;  1K0I A;  1L9D A;  1ZOY A;  2GQW A;  3FG2 P;  1TDF A;  3K7M X;  4A7A A;  2RGO A;  2V3A A;  2WU2 A;  3AE5 A;  2B76 A;  4BUR A;  4DSH A;  4ECH A;  4OCG A;  2YR5 A;  3VQR A;  1W4X A;  1ZX9 A;  1D4C A;  2ZZ0 A;  4OVI A;  4U8P A;  4GAP A;  4A5L A;  3UOV A;  3UTH A;  4H4R A;  2X3N A;  3RP6 A;  4IA5 A;  3T14 A;  3BNM A;  3NH3 X;  4UP3 A;  3CIR A;  3GYX A;  4J57 A;  4XWR A;  4JY3 A;  4TM1 A;  4WX1 A;  3NTA A;  4J36 A;  4G9K A;  1DOB A;  5ER0 A;  1GAL A;  4B65 A;  1HYU A;  2AQJ A;  2IVD A;  1PBC A;  1E1N A;  5M10 A;  2V3B A;  5KNL A;  1MXT A;  3O0H A;  5KMQ A;  2ZZB A;  4USR A;  1OJT A;  2YLT A;  2WP5 A;  4APN A;  4GR1 A;  2Q6U A;  1ZDL A;  1ZMD A;  3BI4 A;  1FL2 A;  3GWF A;  1GES A;  2YM2 A;  1JNR A;  2Y6R A;  1H83 A;  3CMM A;  3HYV A;  3S61 A;  4O5U A;  2UZZ A;  4ZN0 A;  4TM4 A;  1QLB A;  2V61 A;  2C72 A;  3II4 A;  2XVE A;  3QVP A;  2OLN A;  2WPE A;  2WP6 A;  2YLR A;  3SGL A;  4ADW A;  3NLC A;  5TR3 A;  3LXD A;  3UOY A;  3NYC A;  1RSG A;  3FIM B;  4YSH A;  5KOX A;  1E7P A;  4BK3 A;  1ZY8 A;  3QSS A;  4AOS A;  4U8M A;  2RAB A;  4YKG A;  2YG4 A;  2GH5 A;  4H4Q A;  1Q9I A;  2C75 A;  2YLW A;  3AE4 A;  3CN8 A;  2FJB A;  5KMR A;  1VG0 A;  2EQ8 A;  2JBV A;  1PDH A;  3F8P A;  4IA6 A;  4YT0 A;  1RP0 A;  2NPX A;  2XLT A;  1CHU A;  2QA2 A;  4TLX A;  1LPF A;  3COX A;  4H4V A;  2YG3 A;  5HXI A;  4K22 A;  4UDR A;  1GRB A;  1OJD A;  4EMJ A;  2IVE A;  4X4J A;  3SZC A;  3SZF A;  3URH A;  3VRA A;  3AEA A;  5BRT A;  5JCK A;  3CGB A;  3T2K A;  2WDV A;  2WU5 A;  4PAB A;  3HYX A;  3UKP A;  4IVM B;  1LTX R;  3NYF A;  1D4E A;  3P4R A;  2XFQ A;  1CC2 A;  3P1W A;  3EAN A;  2BCG G;  3IHG A;  2GB0 A;  2GAG B;  1KNR A;  2GR3 A;  2WOW A;  1O95 A;  3NHO X;  3NG7 X;  2WPC A;  4U8L A;  1NAA A;  1XHC A;  4II2 A;  1GND A;  3C96 A;  3HZL A;  1D7L A;  1SEZ A;  4CCQ A;  2WQY A;  2XLS A;  4EQX A;  4CBQ A;  1VDC A;  2YAU A;  1D7Y A;  4FK1 C;  4YWO A;  2XFU A;  4GRT A;  1JNZ A;  1RYI A;  3PS9 A;  4OPT A;  2WHD A;  3LOV A;  3QFB A;  4NTE A;  5IQ1 A;  3B6D A;  2BK3 A;  4RG4 A;  2H88 A;  2OAL A;  2NVK X;  2VRM A;  3Q9T A;  3AEC A;  2BAC A;  2BC1 A;  1Y56 A;  3LZW A;  3R9U A;  4NZH A;  4D04 A;  1GTE A;  4YXD A;  5KMS A;  1GRT A;  2Q0K A;  3QVR A;  3ZDN A;  4Z26 A;  3GMC A;  1OJ9 A;  3GMB A;  2FJD A;  2WET A;  3GYJ A;  4EQR A;  2X99 A;  1FEA A;  2EQ9 A;  4H2R A;  2JKC A;  4AOX A;  5IPY A;  3NKS A;  3T31 A;  2TMD A;  2B9W A;  3CNP A;  2X8H A;  3LB8 A;  4FDC B;  4TM0 A;  3VRB A;  4KX6 A;  1CBO A;  2WP9 A;  3AEE A;  4CY6 A;  5JCN A;  4EMI A;  3BHF A;  1F8S A;  5U1O A;  4H50 A;  4Y4L A;  1S2Y A;  2CUL A;  4EQW A;  3NYE A;  3ICR A;  1KSS A;  5FS7 A;  1NG4 A;  3SXI A;  4C3X A;  4Z24 A;  4EIQ A;  2H89 A;  4BJY A;  4XWZ A;  4Y4M A;  4B66 A;  4H4T A;  3ATR A;  2AAQ A;  4CCR A;  1BGN A;  2GR2 A;  1PS9 A;  2ZZC A;  2FBW A;  1JOA A;  2C67 A;  2GR0 A;  3AXB A;  3HYW A;  3T37 A;  2R0P A;  1CC6 A;  4DSG A;  1YQZ A;  4TLZ A;  5C3J A;  2IID A;  4Y4N A;  3VRD B;  1PJ5 A;  4JY2 A;  3DJJ A;  1VRQ B;  4FK1 A;  4FX9 A;  1LVL A;  5C2T A;  1BF3 A;  4Z44 A;  4HA6 A;  5JCL A;  3AEG A;  5GSN A;  4ZCD A;  4CRT A;  4DGK A;  1EL8 A;  3NGC X;  3CPJ G;  2RGH A;  4NTD A;  2R4E A;  3KKJ A;  1TRB A;  2WS3 A;  2BXS A;  1TDN A;  1F3P A;  1FEC A;  2ARD A;  2YR6 A;  3QSM A;  3ZYX A;  2XLR A;  2VOU A;  4WCT A;  5CKU A;  3UOZ A;  1PJ6 A;  1F8W A;  2JB1 A;  4G6H A;  4A65 A;  2Z5Y A;  3K30 A;  1TDK A;  3FPZ A;  2FJE A;  4ICY A;  1NEN A;  3AE6 A;  3ICT A;  4I59 A;  5IQ4 A;  3G5Q A;  3L1R A;  1EL9 A;  1PXB A;  4H4Y A;  4J2W A;  5HHF A;  3QFA A;  4II3 A;  3LAD A;  2X8C A;  4GUV A;  4H4W A;  5KOW A;  2Z5X A;  3CGD A;  2XVF A;  4BV6 A;  2XVJ A;  1IUX A;  1L9C A;  3KVE A;  3P4P A;  1PJ7 A;  5KVH A;  1GRG A;  4G73 A;  2C3C A;  2X50 A;  2PHH A;  1Y56 B;  3T2Y A;  1PBF A;  2VVM A;  3G5R A;  3GYI A;  3DH9 A;  4EM4 A;  2XVI A;  4AT0 A;  1NDA A;  2Q7V A;  3ALL A;  5HYM A;  1PBB A;  1DOD A;  4B67 A;  2BAB A;  1FEB A;  1P2E A;  2WBA A;  4GAV A;  3VR8 A;  1EL7 A;  1LV0 A;  1MO9 A;  1N4W A;  3CPI G;  4ZCC A;  3ICS A;  3ATQ A;  3F8R A;  5EB5 A;  4U8I A;  4A79 A;  3UTE A;  3SFE A;  4YTM A;  2OLO A;  4OPL A;  3CTY A;  3PO7 A;  3Q6J A;  4J34 A;  2BRA A;  3NT6 A;  2CDU A;  3SYI A;  3DGH A;  2VZ2 A;  2YLS A;  2XLU A;  3P9U A;  4TM3 A;  4YSX A;  4REK A;  3BI2 A;  4H4S A;  3GWD A;  3AE3 A;  3UKL A;  4H4Z A;  3AB1 A;  1K0L A;  1XAN A;  1E1L A;  2C3D A;  3CND A;  1E1M A;  1PXA A;  2CVJ A;  4NEV A;  4JQ9 A;  2XDO A;  2YG5 A;  1BWC A;  1LJ1 A;  1TYT A;  4B69 A;  2GMJ A;  3KD9 A;  4HB9 A;  2AR8 A;  3V3O A;  3V76 A;  3NK0 X;  1ONF A;  1ZMC A;  4C77 A;  4YTN A;  1ELI A;  2XYO A;  4Z2T A;  1KF6 A;  3EAO A;  4A99 A;  4C5O A;  3UOX A;  3AYJ A;  4AP3 A;  4P9S A;  4OPG A;  2V6O A;  1LQU A;  4O5Q A;  1IUS A;  3GD4 A;  1PN0 A;  2R4J A;  3AWI A;  5FMH A;  2OA1 A;  1KNP A;  5U63 A;  4Z2R A;  3AD9 B;  1YQ4 A;  1PBE A;  1XDI A;  3V3N A;  1X31 B;  1GPE A;  1E1K A;  3ADA B;  5KXJ A;  2I0Z A;  3OC4 A;  2C66 A;  1IUV A;  2BRY A;  3GRS A;  2XLP A;  1GRE A;  1KSU A;  3K7T A;  4LA1 A;  4C74 A;  1ZOV A;  2X8G A;  5JCI A;  3DK8 A;  1H81 A;  3EPT A;  5BUL A;  1DJN A;  3UP5 A;  2VQ7 A;  1FOH A;  4YSY A;  1ZK7 A;  2YR4 A;  3SZ0 A;  3LZX A;  3QSE A;  1QO8 A;  2GMH A;  3BNU A;  5J7X A;  1H84 A;  2YG7 A;  2BXR A;  3P4S A;  4E0V A;  4NEW A;  2A8X A;  5CQF A;  5LV9 A;  2B7S A;  1NPX A;  1GRA A;  1L9E A;  1H6V A;  2WPF A;  3RHA A;  2CFY A;  2O9Z A;  2QCU A;  4U2S A;  3GD3 A;  2R0C A;  3UKF A;  1JU2 A;  4B63 A;  5HY5 A;  1YY5 A;  2XFO A;  1CL0 A;  1DNC A;  3M0O A;  4H4P A;  1TDE A;  4X9N A;  1ZKQ A;  1IUT A;  1NHP A;  1DOC A;  1DOE A;  2YVF A;  3C4N A;  4G6G A;  1PXC A;  1P2H A;  3NN6 X;  4U8J A;  2TPR A;  1NG3 A;  3P4Q A;  4GF7 A;  3KA7 A;  4CY8 A;  1EL5 A;  4X9M A;  3NTD A;  4MJW A;  1E6E A;  4J56 A;  1S3B A;  1XPQ A;  3SM8 A;  2YVG A;  2V5Z A;  2R46 A;  4AP1 A;  1NHR A;  1GEU A;  1M64 A;  4K5S A;  1K0J A;  4J31 A;  4LII A;  1DJQ A;  3IHM A;  2C7G A;  4U2L A;  1GTH A;  4H2Q A;  3EF6 A;  3I3L A;  4KPR A;  2VQB A;  3CNS A;  2OAM A;  3RNM A;  2WOI A;  3IF9 A;  3NN0 X;  4B1B A;  1JRX A;  2BS3 A;  3AE8 A;  3E1T A;  3CGC A;  1H7X A;  4K7Z A;  4M52 A;  3S5W A;  1IUW A;  3DK4 A;  4K5R A;  3AEB A;  1VQW A;  1CJ2 A;  3DGZ A;  3ALJ A;  4USQ A;  4UDP A;  4A6N A;  3AE1 A;  2WOV A;  4NNJ A;  2XVH A;  2JB3 A;  3T2Z A;  2C4C A;  3C4A A;  3DK9 A;  4U8N A;  3NK1 X;  2GQF A;  2GAH B;  3KU9 A;  3GSI A;  1NHQ A;  1UKV G;  2B9X A;  1Y0P A;  1GXF A;  3AED A;  2J3N A;  3AYL A;  1B37 A;  1CJ3 A;  1GRF A;  1L0V A;  3KPK A;  1S3E A;  3DJD A;  2GR1 A;  3PVC A;  5FS8 A;  4LU6 A;  1PBD A;  1B4V A;  2GV8 A;  2HQM A;  4H4X A;  4EM3 A;  5J60 A;  4PAA A;  1AOG A;  1KDG A;  4A6N B;  2WDQ A;  1JRY A;  2PYX A;  3I6D A;  1EBD A;  4H2P A;  1KFY A;  1H86 A;  2YLX A;  4OPC A;  2QAE A;  2Y6Q A;  3AE7 A;  3M12 A;  4OPU A;  2XFN A;  2W0H A;  1BZL A;  2WDR A;  2E1M A;  1LQT A;  5KMP A;  1CC4 A;  1QJD A;  2VVL A;  2WEU A;  4BJZ A;  1H82 A;  2APG A;  4JNA A;  4CNJ A;  4GDP A;  1IUU A;  2GRT A;  3ABV A;  4AT2 A;  2BK5 A;  4J33 A;  2F5Z A;  1M6I A;  2XCG A;  2B7R A;  5KWF A;  1YKJ A;  3SQP A;  4Z43 A;  2XFP A;  4GCM A;  4BK2 A;  3ITJ A;  3ISH A;  1GRH A;  2BS4 A;  2FJA A;  5EOW A;  4OPD A;  3T0K A;  3SFD A;  4A9W A;  4EMW A;  1MOK A;  1ZP0 A;  2C65 A;  3H4K A;  5DBJ A;  3GDN A;  1VG9 A;  1GV4 A;  4DNA A;  1NHS A;  4B64 A;  2BC0 A;  1Q1W A;  3SY4 A;  3RP8 A;  2BA9 A;  5EB4 A;  3H8L A;  2C76 A;  3NIX A;  3BHK A;  2R0G A;  3RP7 A;  4JNQ A;  2RGJ A;  5GRT A;  2YVJ A;  4RSL A;  4N9X A;  2A89 A;  4UDQ A;  5L46 A;  2JK6 A;  1GET A;  4I58 A;  1BGJ A;  1FCD A;  1E39 A;  2C73 A;  5KRQ A;  3UTF A;  1IJH A;  1PHH A;  4G74 A;  3UKA A;  1YQ3 A;  3SX6 A;  1BKW A;  5JCM A;  4K2X A;  4IV9 A;  1S2Q A;  1F8R A;  4K8D A;  4YSZ A;  1N4U A;  2JB2 A;  3WE0 A;  4H7U A;  2ZBW A;  4H2N A;  2JAE A;  3D1C A;  5BVA A;  2A87 A;  1CJC A;  1O94 A;  1TYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...