1RP0A

Crystal structure of thi1 protein from arabidopsis thaliana
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiazole biosynthetic enzyme
publication title Structure of the thiazole biosynthetic enzyme THI1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Biosynthetic protein
total genus 95
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.4.2.60: Cysteine-dependent adenosine diphosphate thiazole synthase.
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01946 Thi4 Thi4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1rp0A02
4H2QA 1GXFA 1D7YA 1PBFA 1S3EA 1XPQA 2C3DA 3H8LA 3LJPA 4Z44A 2VRLA 3UTHA 3KLJA 2E4GA 2WOIA 3AE7A 2X50A 4P9SA 1H84A 2JBVA 4C3XA 4EQWA 4EQXA 3P4SA 1KSUA 1PBBA 3ICRA 2V61A 1MXTA 3AB1A 4CCQA 2OALA 3CTYA 4U2TA 4TLZA 5EB4A 4BJYA 2YM1A 2TPRA 4U8KA 1NENA 1TDEA 1VDCA 2BS4A 1S3BA 2X8CA 1Q1RA 1GPEA 1ELIA 3CN8A 3LADA 3QJ4A 4YTMA 3ICSA 3NK2X 1FEAA 4OPUA 1IUUA 5M10A 1Q9IA 4U8IA 1K0IA 1GNDA 1LPFA 1V59A 3EPTA 4RG4A 1IUTA 1EL7A 1OJTA 2R0PA 2RABA 3P1WA 3G5SA 2A87A 2HQMA 4NTEA 2VRMA 1CL0A 3QSSA 2GR0A 3CNSA 3CNJA 4FX9A 4DNAA 1TYPA 1EL8A 1VG9A 5C3JA 3I3LA 3UOYA 2GH5A 1GALA 5EBKA 3H8IA 3AYJA 2WS3A 2XLSA 4YSXA 1JU2A 2QA2A 2XFNA 3AE1A 4GRTA 2R0GA 2XVEA 3NTAA 4KPRA 1SEZA 3AD9B 4H4PA 4YWOA 4A7AA 4CNKA 3K7TA 1GRAA 1NDAA 3UKQA 2GMHA 4H4SA 5JCKA 5FS7A 1PBDA 3DA1A 5CQFA 1PJ6A 3M0OA 3NTDA 4Y4LA 2OA1A 3UOVA 4EMJA 1KNRA 2R46A 1LV0A 2EQ9A 2WDRA 2WU2A 2C3CA 4UDQA 3UKFA 3SM8A 2YAUA 1OJDA 1GV4A 1ZY8A 1B4VA 1ZK7A 2C73A 2R0CA 3AYLA 2C70A 2W0HA 2GB0A 4YSHA 2Y6QA 4X9MA 2V3BA 4E0VA 4OPIA 2XVFA 1CJ3A 1EL9A 2XVJA 3E1TA 2JB2A 1KFYA 2DKIA 4UDRA 1NHRA 2BC0A 3BHFA 4K22A 3VRDB 4PAAA 4BURA 2JB3A 4IVOB 4Z26A 3V3OA 1GERA 4Z2TA 2PYXA 1ZMDA 4OPLA 3CPHG 2C65A 3CIRA 3DJJA 5CKUA 3P4RA 4H4WA 2C7GA 2RGOA 4A99A 3UP5A 4YKFA 2YG6A 3RHAA 3R9UA 1GETA 2AAQA 1IJHA 4EMIA 4Z2RA 4AP3A 4B65A 1TRBA 2C72A 4PABA 1XANA 2A89A 2ZZBA 1PXCA 3VR9A 4XXGA 2EQ7A 2C75A 1UKVG 3GYIA 1L9CA 3NN6X 1X31B 1KF6A 3GD3A 1N1PA 5JCIA 3G5QA 2YG5A 3QSEA 1BF3A 2CULA 4TM1A 4C3YA 2WETA 3UKHA 1JNZA 4YTPA 4ZCDA 1FEBA 2XLRA 2PHHA 1HYUA 1B5QA 3QVRA 3B3RA 2X99A 3WE0A 2XVHA 2YM2A 1E39A 2O9ZA 1CHUA 1KNPA 3CNDA 3GWDA 4ICYA 1GRFA 4K7ZA 2WPFA 4IA6A 3ICTA 2WESA 5BULA 2V60A 2FJEA 1DOEA 3D1CA 5EOWA 3RP6A 2QCUA 3UTFA 3CGDA 3UKKA 3ZDNA 1CC4A 2APGA 1YQ4A 3C4NA 3M12A 2C64A 3SFDA 4B66A 1TDNA 3NT6A 4K2XA 4EM3A 4J56A 1MO9A 1IUWA 3AE3A 1GT8A 1ZDLA 2GQWA 3GMCA 1W4XA 3M13A 5HYMA 1CF3A 3L8KA 2NVKX 2VVLG 3NNEA 4ECHA 5C2TA 3AE4A 1GRGA 3IHMA 3O0HA 2XFUA 4H4ZA 4CCRA 4J36A 2WHDA 1GREA 3K7QX 5IQ1A 2JK6A 2V6OA 2WU5A 3KVEA 3C96A 1KDGA 2WP5A 3NRNA 1CBOA 1NG3A 5HXIA 3NIXA 2R45A 3G5RA 2XDOA 3RNMA 4AOXA 1VRQB 3RP8A 3PS9A 1BKWA 2B9YA 2YWLA 4TM0A 4LIIA 4A5LA 4FK1A 4RSLA 2JB1A 2WPCA 3V76A 3ADAB 4A9WA 1E6EA 4CBQA 4TLXA 1YKJA 1CJ4A 1Q1WA 2YLZA 3SGLA 4J34A 3FBSA 4A6NA 2RGHA 2XFOA 3NH3X 3ALLA 4WX1A 1TDKA 2E5VA 3DK4A 3VR8A 5KXJA 1K0JA 2YG3A 3AE9A 4U8PA 2Z5XA 4Z2UA 1DODA 2WBAA 1YY5A 4J31A 3GWFA 1F8SA 1GSNA 1QLBA 2WP9A 2YR6A 3IHGA 4GUVA 4NTDA 1S2YA 4U8MA 4J33A 1NHSA 2XFQA 1LQUA 1Z6LA 3OZ2A 4TM4A 3L1RA 1REOA 5IPYA 2WDQA 3KA7A 3B6DA 3II4A 4B64A 4UDPA 3DJGX 1GOSA 1CC2A 1NHQA 4JNQA 4XWZA 2Q7VA 4H4UA 5HHFA 4FDCB 3EAOA 4EQSA 3GD4A 4BJZA 4YT0A 3GMBA 3IWAA 4H4RA 5GRTA 2FJAA 3NHOX 2X8GA 3ABVA 2Q6UA 4X9NA 1GESA 3F8RA 2XCGA 2ARDA 1PBCA 4GCMA 2V3AA 4ZCCA 5M0ZA 2OLOA 4JDRA 2Q0KA 4EQRA 2YQUA 4JNAA 1H82A 5KRQA 1BGJA 4REKA 5J7XA 1N4VA 5J60A 2YG7A 2BXSA 1OJCA 3UCLA 4B69A 2C67A 2ZBWA 4WCTA 1GTHA 4YKGA 4USQA 3SFEA 4YXDA 3P4PA 4DGKA 1D4CA 1E7PA 1JEHA 2OAMA 3ALMA 4C74A 3Q9TA 2WPEA 3AEGA 4EIPA 4EIQA 1GRHA 2VQ7A 1IUSA 3KD9A 1O94A 3V3NA 4DSHA 1NEKA 2BACA 2R4JA 4JN9A 4GDEA 5EB5A 5DBJA 2YLSA 1DJQA 1MOKA 2VVMA 3BHKA 3FPZA 2VQBA 3EF6A 4BK3A 1IUVA 1Y56B 4OPDA 4Y4MA 4XWRA 4DSGA 1LQTA 1D4DA 3DJEA 5BUKA 1E1KA 2IVDA 4NEWA 2YLRA 3H4KA 4H7UA 1H83A 4OPGA 2F5ZA 1PXAA 4CNJA 1P2EA 3GRSA 1GRBA 4Z24A 1L9EA 4IA5A 4K5SA 5FMHA 4B63A 3GYJA 1IUXA 2GAHB 1VG0A 2ZZCA 3CPIG 4H4XA 2H89A 3LZWA 4GR1A 1B8SA 3COXA 3AE5A 1GEUA 2ACZA 2YVFA 1CJCA 2GV8A 1FECA 2X3NA 2YR4A 4HA6A 2E1MA 5FS8A 1XDIA 1FL2A 4CRTA 5HY5A 4GF7A 1L0VA 1LVLA 1CJ2A 3GRTA 2QA1A 1JNRA 3OC4A 1M6IA 3AE2A 1NPXA 3NLCA 5FS6A 4YSYA 2GQFA 1H6VA 3Q6JA 1RP0A 3GDNA 1JRXA 1PN0A 1F6MA 2VVLA 4CY6A 4I58A 1PJ5A 1BZLA 2R9ZA 4C77A 5U1OA 3QFAA 4N9XA 1N4WA 4CY8A 2R4EA 4O5UA 1DOCA 3QSMA 4O5QA 5ER0A 2BCGG 4K8DA 2BK4A 5LV9A 4AOSA 1F8WA 2TMDA 4D03A 2YG4A 1PS9A 2GMJA 1KSSA 5KOXA 1FOHA 4BV6A 1DJNA 3CPJG 3QVPA 3QFBA 1Y0PA 4H2PA 1TDOA 2B9XA 2B76A 1E1NA 1PHHA 2GR3A 4FK1C 4JY3A 3BNUA 1NG4A 1OJ9A 2ZZ0A 2YLTA 2OLNA 1D4EA 4A6NB 2GAGB 1COYA 1CC6A 1JRYA 1ZP0A 4ADWA 4H2RA 4U2LA 1DNCA 2BS2A 3KU9A 1K4QA 3DGHA 3CGBA 1K0LA 4ZN0A 3C4AA 4JY2A 1OJAA 1RYIA 1ZX9A 3BI5A 1TYTA 3BI4A 4AT2A 4A65A 4YSZA 1GTEA 3ITJA 3ZYXA 3URHA 3UKPA 3F8PA 2CDUA 1EL5A 1XHCA 2WQYA 4BK2A 1BGNA 1B37A 3KKJA 4Z25A 5KVIA 4H4YA 1H81A 5TR3A 5JCNA 1PBEA 3ALJA 3GSIA 3CNTA 2CFYA 4J2WA 1D5TA 1QO8A 1JOAA 3AEEA 2YLXA 4USRA 3IF9A 1BWCA 4OPTA 3PVCA 5U63A 1O95A 2BCPA 3NN0X 2A8XA 1H7WA 3UP4A 2XLTA 3S5WA 2BK5A 2I0ZA 2BXRA 2WDVA 1YQ3A 2BC1A 1P2HA 3LB8A 1F3PA 3NYEA 3AD8B 2FJBA 4K5RA 4TM3A 4AT0A 3FMWA 4U8JA 2XFPA 3VRBA 3UTGA 3ATRA 1EBDA 4EMWA 1N4UA 2AQJA 1O5WA 1LTXR 1F8RA 3DMEA 1RSGA 1JRZA 4H50A 4H2NA 4JQ9A 3SQPA 3K7MX 2XLPA 4AP1A 3P4QA 4BK1A 4Y4NA 3BI2A 3NKSA 2Y6RA 3DK8A 3DH9A 2GRTA 1E1LA 3PO7A 2GF3A 3LOVA 4OCGA 1VQWA 3CGCA 4B1BA 3LZXA 1ZMCA 2QAEA 3P9UA 5JCMA 5KVHA 1ZKQA 3NK0X 2Z5YA 4C5OA 4EM4A 3AE6A 3HZLA 2XVIA 3NGCX 2RGJA 4I59A 1FCDA 1GRTA 2H88A 4KX6A 1AOGA 3AYIA 2JKCA 2GEWA 1TDFA 4UP3A 2BYBA 2YLWA 2Q0LA 3LXDA 1PJ7A 1M64A 4HB9A 3FG2P 4B67A 3UOXA 4APNA 3GDPA 2XLUA 2AR8A 2FBWA 3DJDA 4J57A 3FIMB 4Z43A 3KPFA 5IQ4A 3S61A 1PDHA 2BA9A 3UOZA 3REDA 4NTCA 4GDPA 3UKLA 3VRAA 5BVAA 3EANA 4D04A 3AXBA 3AEFA 2WEUA 5GSNA 3NK1X 1QJDA 3DK9A 3ISHA 1S2QA 3BNMA 3AEAA 2XYOA 3CGEA 3AECA 3K30A 4H4VA 5FS9A 4IV9A 3AEDA 2UZZA 1D7LA 2EQ6A 4U2SA 2GVCA 2VZ2A 1ONFA 4H4QA 3UTEA 2GR2A 1DXLA 2BS3A 2C76A 2GR1A 3AEBA 4B68A 2DKHA 2WOVA 3NYFA 3AE8A 4MJWA 4X4JA 2B9WA 2X8HA 3D8XA 1E1MA 3IC9A 3DGZA 2EQ8A 2B7RA 2CVJA 2WOWA 4LU6A 1DOBA 1Y56A 4M52A 1LJ1A 1H7XA 5KWFA 2IIDA 4H4TA 4YTNA 4OVIA 5KOWA 4U8NA 3NYCA 1ZOVA 5BRTA 1YQZA 4RG3A 2JAEA 4LA1A 2B7SA 1L9DA 1H86A 4NZHA 3AD7B 3RP7A 4NEVA 2C66A 5U25A 2J3NA 2YVGA 5JCLA 2BABA 2IVEA 2FJDA 5L46A 2YVJA 4OPCA 2NPXA 2VOUA 3CNPA 3T37A 4U8OA 2YR5A 4IVMB 3I6DA 1ZOYA 3JSKA 2WP6A 3ATQA 2V5ZA 3F8DA 4A79A 1PXBA 1NHPA 3AWIA 4U8LA 3NG7X 1NAAA 3VQRA 2BK3A 3UKAA
chains in the Genus database with same CATH superfamily
4H2QA 1GXFA 1D7YA 1PBFA 1S3EA 1XPQA 2C3DA 3H8LA 3LJPA 4Z44A 2VRLA 3UTHA 3KLJA 2E4GA 2WOIA 3AE7A 2X50A 4P9SA 1H84A 2JBVA 4C3XA 4EQWA 4EQXA 3P4SA 3SZFA 1KSUA 1PBBA 3ICRA 2V61A 1MXTA 3AB1A 4CCQA 2OALA 3CTYA 4U2TA 4TLZA 5EB4A 4BJYA 2YM1A 2TPRA 4U8KA 1NENA 1TDEA 1VDCA 2BS4A 1S3BA 2X8CA 1Q1RA 1GPEA 1ELIA 3CN8A 3LADA 3QJ4A 4YTMA 3ICSA 3NK2X 1FEAA 4OPUA 1IUUA 5M10A 1Q9IA 4U8IA 1K0IA 1GNDA 1LPFA 1V59A 3EPTA 4RG4A 1IUTA 1EL7A 1OJTA 2R0PA 2RABA 3P1WA 3G5SA 2A87A 2HQMA 4NTEA 2VRMA 1CL0A 3QSSA 2GR0A 3CNSA 3CNJA 4FX9A 4DNAA 1TYPA 4GAVA 1EL8A 1VG9A 5C3JA 3I3LA 2C4CA 3UOYA 2GH5A 1GALA 5EBKA 3H8IA 3AYJA 2WS3A 2XLSA 4YSXA 1JU2A 2QA2A 2XFNA 3AE1A 4GRTA 2R0GA 2XVEA 3NTAA 2BRAA 4KPRA 1SEZA 3AD9B 4H4PA 4YWOA 4A7AA 4CNKA 3K7TA 1GRAA 1NDAA 3UKQA 2GMHA 4H4SA 5JCKA 5FS7A 1PBDA 3DA1A 5CQFA 1PJ6A 3M0OA 3NTDA 4Y4LA 2OA1A 3UOVA 4EMJA 1KNRA 2R46A 1LV0A 2EQ9A 2WDRA 2WU2A 2C3CA 4UDQA 3T2ZA 3HYWA 3SM8A 3UKFA 2YAUA 3T31A 1OJDA 3SY4A 1GV4A 1ZY8A 1B4VA 1ZK7A 2C73A 2R0CA 3AYLA 4G6GA 2C70A 2W0HA 2GB0A 4YSHA 2Y6QA 4X9MA 5KVHA 2V3BA 4E0VA 4OPIA 2XVFA 1CJ3A 1EL9A 2XVJA 3E1TA 4G6HA 2JB2A 1KFYA 2DKIA 4UDRA 1NHRA 2BC0A 3BHFA 4K22A 5KMPA 3VRDB 4PAAA 4BURA 2JB3A 4IVOB 4Z26A 3V3OA 1GERA 4Z2TA 2PYXA 1ZMDA 4OPLA 3CPHG 2C65A 3CIRA 3DJJA 5CKUA 3P4RA 4H4WA 2C7GA 2RGOA 4A99A 3UP5A 4YKFA 2YG6A 3RHAA 3R9UA 1GETA 2AAQA 1IJHA 4EMIA 4Z2RA 4AP3A 4B65A 1TRBA 2C72A 4PABA 1XANA 2A89A 2ZZBA 1PXCA 3VR9A 3GYXA 4XXGA 2EQ7A 2C75A 1UKVG 3GYIA 1L9CA 3NN6X 1X31B 1KF6A 3GD3A 1N1PA 5JCIA 3G5QA 2YG5A 3QSEA 1BF3A 2CULA 4II3A 4TM1A 4C3YA 2WETA 3UKHA 1JNZA 4YTPA 4ZCDA 1FEBA 2XLRA 2PHHA 1HYUA 1B5QA 3QVRA 3B3RA 2X99A 3WE0A 2XVHA 2YM2A 1E39A 2O9ZA 1CHUA 1KNPA 3CNDA 3GWDA 4ICYA 1GRFA 4K7ZA 2WPFA 4IA6A 3ICTA 2WESA 5BULA 2V60A 2FJEA 1DOEA 3D1CA 5EOWA 3RP6A 2QCUA 3SZCA 3UTFA 3CGDA 3UKKA 3ZDNA 1CC4A 2APGA 1YQ4A 3C4NA 3M12A 2C64A 3SFDA 4B66A 1TDNA 3NT6A 4K2XA 4EM3A 4J56A 1MO9A 3T14A 5KMSA 1IUWA 3AE3A 1GT8A 1ZDLA 2GQWA 3GMCA 1W4XA 3M13A 5HYMA 1CF3A 3L8KA 2NVKX 2VVLG 3NNEA 4ECHA 5C2TA 3AE4A 1GRGA 3IHMA 3O0HA 2XFUA 4H4ZA 4CCRA 4J36A 2WHDA 1GREA 3K7QX 5IQ1A 2JK6A 2V6OA 2WU5A 3KVEA 3C96A 1KDGA 2WP5A 3NRNA 1CBOA 1NG3A 5HXIA 3NIXA 2R45A 3G5RA 2XDOA 3RNMA 4AOXA 1VRQB 3RP8A 3PS9A 1BKWA 2B9YA 2YWLA 4TM0A 4LIIA 4A5LA 4FK1A 4RSLA 2JB1A 2WPCA 3V76A 3ADAB 4A9WA 1E6EA 4CBQA 4TLXA 1YKJA 1CJ4A 1Q1WA 2YLZA 3SGLA 4J34A 3FBSA 4A6NA 2RGHA 2XFOA 3NH3X 3ALLA 4WX1A 1TDKA 2E5VA 3DK4A 3VR8A 5KXJA 1K0JA 2YG3A 3AE9A 4U8PA 2Z5XA 4Z2UA 1DODA 2WBAA 1YY5A 4J31A 3GWFA 1F8SA 1GSNA 1QLBA 2WP9A 2YR6A 3IHGA 4GUVA 4NTDA 1S2YA 4GAPA 4J33A 1NHSA 2XFQA 4U8MA 1LQUA 1Z6LA 3OZ2A 4TM4A 3L1RA 1REOA 5IPYA 2WDQA 3KA7A 3B6DA 3II4A 4B64A 4UDPA 3DJGX 1GOSA 1CC2A 1NHQA 4JNQA 4XWZA 3T2YA 2Q7VA 4G9KA 4H4UA 5HHFA 4FDCB 3EAOA 4EQSA 3GD4A 4BJZA 5KNLA 4YT0A 3GMBA 3SYIA 3IWAA 4H4RA 5GRTA 2FJAA 3NHOX 2X8GA 3ABVA 2Q6UA 4X9NA 1GESA 3F8RA 2XCGA 2ARDA 1PBCA 4GCMA 2V3AA 4ZCCA 5M0ZA 2OLOA 4JDRA 2Q0KA 4EQRA 2YQUA 4JNAA 1H82A 5KRQA 1BGJA 4REKA 5J7XA 1N4VA 5J60A 2YG7A 2BXSA 1OJCA 3UCLA 4B69A 2C67A 2ZBWA 4WCTA 1GTHA 4YKGA 4USQA 3SFEA 4YXDA 3P4PA 3CMMA 4DGKA 1D4CA 1E7PA 1JEHA 2OAMA 3ALMA 4C74A 3Q9TA 2WPEA 3AEGA 4EIPA 2BRYA 4EIQA 1GRHA 2VQ7A 1IUSA 3KD9A 1O94A 3V3NA 4DSHA 1NEKA 2BACA 2R4JA 4JN9A 4GDEA 5EB5A 5DBJA 2YLSA 1DJQA 1MOKA 2VVMA 3BHKA 3FPZA 2VQBA 3EF6A 4BK3A 1IUVA 1Y56B 4OPDA 4Y4MA 4XWRA 4DSGA 1LQTA 1D4DA 3DJEA 5BUKA 1E1KA 2IVDA 4NEWA 2YLRA 3H4KA 4H7UA 1H83A 4OPGA 2F5ZA 1PXAA 4CNJA 1P2EA 3GRSA 1GRBA 4Z24A 1L9EA 4IA5A 4K5SA 5FMHA 4B63A 3GYJA 1IUXA 2GAHB 1VG0A 2ZZCA 3CPIG 4H4XA 2H89A 3LZWA 4GR1A 1B8SA 3COXA 3AE5A 1GEUA 2ACZA 2YVFA 1CJCA 2GV8A 1FECA 2X3NA 2YR4A 4HA6A 2E1MA 5FS8A 1XDIA 1FL2A 4CRTA 5HY5A 4GF7A 1L0VA 1LVLA 1CJ2A 3GRTA 2QA1A 1JNRA 3OC4A 1M6IA 3AE2A 1NPXA 3NLCA 5FS6A 4YSYA 2GQFA 1H6VA 3Q6JA 1RP0A 3GDNA 1JRXA 1PN0A 1F6MA 2VVLA 4CY6A 4I58A 1PJ5A 1BZLA 2R9ZA 4C77A 5U1OA 3QFAA 4N9XA 1N4WA 4CY8A 2R4EA 4O5UA 1DOCA 3QSMA 4O5QA 5ER0A 2BCGG 4K8DA 2BK4A 5LV9A 4AOSA 1F8WA 2TMDA 4D03A 2YG4A 1PS9A 2GMJA 1KSSA 5KOXA 1FOHA 4BV6A 1DJNA 3CPJG 3QVPA 3QFBA 1Y0PA 4H2PA 1TDOA 2B9XA 2B76A 1E1NA 1PHHA 2GR3A 4FK1C 4JY3A 3BNUA 1NG4A 1OJ9A 2ZZ0A 2YLTA 2OLNA 1D4EA 3SZWA 4A6NB 3SX6A 2GAGB 1COYA 1CC6A 1JRYA 1ZP0A 4ADWA 4H2RA 4U2LA 1DNCA 2BS2A 3KU9A 1K4QA 3DGHA 3CGBA 1K0LA 3SXIA 4ZN0A 3C4AA 4JY2A 1OJAA 1RYIA 1ZX9A 3BI5A 1TYTA 3BI4A 4AT2A 4A65A 4YSZA 1GTEA 3HYVA 3ITJA 3KPKA 3T2KA 4NWZA 3URHA 3ZYXA 3UKPA 3F8PA 2CDUA 1EL5A 1XHCA 2WQYA 4BK2A 1BGNA 1B37A 3KKJA 4Z25A 5KVIA 4H4YA 1H81A 5TR3A 3SZ0A 5JCNA 1PBEA 3ALJA 3GSIA 3CNTA 2CFYA 4J2WA 1D5TA 1QO8A 1JOAA 3AEEA 2YLXA 4USRA 3IF9A 1BWCA 4OPTA 3PVCA 5U63A 1O95A 2BCPA 3NN0X 2A8XA 1H7WA 3UP4A 2XLTA 3S5WA 2BK5A 2I0ZA 3HYXA 2BXRA 2WDVA 1YQ3A 2BC1A 1P2HA 3LB8A 3T0KA 1F3PA 3NYEA 3AD8B 2FJBA 4K5RA 4TM3A 4AT0A 3FMWA 5KMRA 4U8JA 2XFPA 3VRBA 3UTGA 3ATRA 1EBDA 4EMWA 1N4UA 2AQJA 1O5WA 1LTXR 1F8RA 3DMEA 1RSGA 1JRZA 4H50A 4H2NA 4JQ9A 3SQPA 3K7MX 2XLPA 4AP1A 3P4QA 4BK1A 4Y4NA 3BI2A 3NKSA 2Y6RA 3DK8A 3DH9A 2GRTA 1E1LA 3PO7A 2GF3A 3LOVA 4OCGA 1VQWA 3CGCA 5KMQA 3LZXA 1ZMCA 2QAEA 3P9UA 4B1BA 5JCMA 1ZKQA 3NK0X 2Z5YA 4C5OA 4EM4A 3AE6A 3HZLA 2XVIA 3NGCX 4G74A 2RGJA 4I59A 1FCDA 1GRTA 2H88A 4KX6A 1AOGA 3AYIA 2JKCA 2GEWA 1TDFA 4UP3A 2BYBA 2YLWA 2Q0LA 3LXDA 1PJ7A 1M64A 4HB9A 3FG2P 4B67A 3UOXA 4APNA 3GDPA 2XLUA 2AR8A 2FBWA 3DJDA 4J57A 3FIMB 4Z43A 3KPFA 5IQ4A 3S61A 1PDHA 2BA9A 3UOZA 3REDA 4NTCA 4GDPA 3UKLA 3VRAA 5BVAA 3EANA 4D04A 3AXBA 3AEFA 2WEUA 5GSNA 3NK1X 1QJDA 3DK9A 3ISHA 1S2QA 3BNMA 3AEAA 2XYOA 3CGEA 3AECA 3K30A 4H4VA 4G73A 5FS9A 4IV9A 3AEDA 2UZZA 1D7LA 2EQ6A 4U2SA 2GVCA 2VZ2A 1ONFA 4H4QA 3UTEA 2GR2A 1DXLA 2BS3A 2C76A 2GR1A 3AEBA 4B68A 2DKHA 2WOVA 3NYFA 3AE8A 4MJWA 4X4JA 2B9WA 2X8HA 3D8XA 4II2A 1E1MA 3IC9A 3DGZA 2EQ8A 2B7RA 2CVJA 2WOWA 4LU6A 1DOBA 1Y56A 4M52A 1LJ1A 1H7XA 5KWFA 2IIDA 4H4TA 4YTNA 4OVIA 5KOWA 4U8NA 3NYCA 4NNJA 1ZOVA 5BRTA 1YQZA 4RG3A 2JAEA 4LA1A 2B7SA 1L9DA 1H86A 4NZHA 3AD7B 3RP7A 4NEVA 2C66A 5U25A 2J3NA 2YVGA 5JCLA 2BABA 2IVEA 2FJDA 5L46A 2YVJA 4OPCA 2NPXA 2VOUA 3CNPA 3T37A 4U8OA 2YR5A 4IVMB 3I6DA 1ZOYA 3JSKA 2WP6A 3ATQA 2V5ZA 3F8DA 4A79A 1PXBA 1NHPA 3AWIA 4U8LA 3NG7X 1NAAA 3VQRA 2BK3A 3UKAA
chains in the Genus database with same CATH topology
4H2QA 1GXFA 1D7YA 1PBFA 1S3EA 1XPQA 2C3DA 3H8LA 3LJPA 4Z44A 2VRLA 3UTHA 3KLJA 2E4GA 2WOIA 3AE7A 2X50A 4P9SA 1H84A 2JBVA 4C3XA 4EQWA 4EQXA 3P4SA 3SZFA 1KSUA 1PBBA 3ICRA 2V61A 1MXTA 3AB1A 4CCQA 2OALA 3CTYA 4U2TA 4TLZA 5EB4A 4BJYA 2YM1A 2TPRA 4U8KA 1NENA 1TDEA 1VDCA 2BS4A 1S3BA 2X8CA 1Q1RA 1GPEA 1ELIA 3CN8A 3LADA 3QJ4A 4YTMA 3ICSA 3NK2X 1FEAA 4OPUA 1IUUA 5M10A 1Q9IA 4U8IA 1K0IA 1GNDA 1LPFA 1V59A 3EPTA 4RG4A 1IUTA 1EL7A 1OJTA 2R0PA 2RABA 3P1WA 3G5SA 2A87A 2HQMA 4NTEA 2VRMA 1CL0A 3QSSA 2GR0A 3CNSA 3CNJA 4FX9A 4DNAA 1TYPA 4GAVA 1EL8A 1VG9A 5C3JA 3I3LA 2C4CA 3UOYA 2GH5A 1GALA 5EBKA 3H8IA 3AYJA 2WS3A 2XLSA 4YSXA 1JU2A 2QA2A 2XFNA 3AE1A 4GRTA 2R0GA 2XVEA 3NTAA 2BRAA 4KPRA 1SEZA 3AD9B 4H4PA 4YWOA 4A7AA 4CNKA 3K7TA 1GRAA 1NDAA 3UKQA 2GMHA 4H4SA 5JCKA 5FS7A 1PBDA 3DA1A 5CQFA 1PJ6A 3M0OA 3NTDA 4Y4LA 2OA1A 3UOVA 4EMJA 1KNRA 2R46A 1LV0A 2EQ9A 2WDRA 2WU2A 2C3CA 4UDQA 3T2ZA 3HYWA 3SM8A 3UKFA 2YAUA 3T31A 1OJDA 3SY4A 1GV4A 1ZY8A 1B4VA 1ZK7A 2C73A 2R0CA 3AYLA 4G6GA 2C70A 2W0HA 2GB0A 4YSHA 2Y6QA 4X9MA 5KVHA 2V3BA 4E0VA 4OPIA 2XVFA 1CJ3A 1EL9A 2XVJA 3E1TA 4G6HA 2JB2A 1KFYA 2DKIA 4UDRA 1NHRA 2BC0A 3BHFA 4K22A 5KMPA 3VRDB 4PAAA 4BURA 2JB3A 4IVOB 4Z26A 3V3OA 1GERA 4Z2TA 2PYXA 1ZMDA 4OPLA 3CPHG 2C65A 3CIRA 3DJJA 5CKUA 3P4RA 4H4WA 2C7GA 2RGOA 4A99A 3UP5A 4YKFA 2YG6A 3RHAA 3R9UA 1GETA 2AAQA 1IJHA 4EMIA 4Z2RA 4AP3A 4B65A 1TRBA 2C72A 4PABA 1XANA 2A89A 2ZZBA 1PXCA 3VR9A 3GYXA 4XXGA 2EQ7A 2C75A 1UKVG 3GYIA 1L9CA 3NN6X 1X31B 1KF6A 3GD3A 1N1PA 5JCIA 3G5QA 2YG5A 3QSEA 1BF3A 2CULA 4II3A 4TM1A 4C3YA 2WETA 3UKHA 1JNZA 4YTPA 4ZCDA 1FEBA 2XLRA 2PHHA 1HYUA 1B5QA 3QVRA 3B3RA 2X99A 3WE0A 2XVHA 2YM2A 1E39A 2O9ZA 1CHUA 1KNPA 3CNDA 3GWDA 4ICYA 1GRFA 4K7ZA 2WPFA 4IA6A 3ICTA 2WESA 5BULA 2V60A 2FJEA 1DOEA 3D1CA 5EOWA 3RP6A 2QCUA 3SZCA 3UTFA 3CGDA 3UKKA 3ZDNA 1CC4A 2APGA 1YQ4A 3C4NA 3M12A 2C64A 3SFDA 4B66A 1TDNA 3NT6A 4K2XA 4EM3A 4J56A 1MO9A 3T14A 5KMSA 1IUWA 3AE3A 1GT8A 1ZDLA 2GQWA 3GMCA 1W4XA 3M13A 5HYMA 1CF3A 3L8KA 2NVKX 2VVLG 3NNEA 4ECHA 5C2TA 3AE4A 1GRGA 3IHMA 3O0HA 2XFUA 4H4ZA 4CCRA 4J36A 2WHDA 1GREA 3K7QX 5IQ1A 2JK6A 2V6OA 2WU5A 3KVEA 3C96A 1KDGA 2WP5A 3NRNA 1CBOA 1NG3A 5HXIA 3NIXA 2R45A 3G5RA 2XDOA 3RNMA 4AOXA 1VRQB 3RP8A 3PS9A 1BKWA 2B9YA 2YWLA 4TM0A 4LIIA 4A5LA 4FK1A 4RSLA 2JB1A 2WPCA 3V76A 3ADAB 4A9WA 1E6EA 4CBQA 4TLXA 1YKJA 1CJ4A 1Q1WA 2YLZA 3SGLA 4J34A 3FBSA 4A6NA 2RGHA 2XFOA 3NH3X 3ALLA 4WX1A 1TDKA 2E5VA 3DK4A 3VR8A 5KXJA 1K0JA 2YG3A 3AE9A 4U8PA 2Z5XA 4Z2UA 1DODA 2WBAA 1YY5A 4J31A 3GWFA 1F8SA 1GSNA 1QLBA 2WP9A 2YR6A 3IHGA 4GUVA 4NTDA 1S2YA 4GAPA 4J33A 1NHSA 2XFQA 4U8MA 1LQUA 1Z6LA 3OZ2A 4TM4A 3L1RA 1REOA 5IPYA 2WDQA 3KA7A 3B6DA 3II4A 4B64A 4UDPA 3DJGX 1GOSA 1CC2A 1NHQA 4JNQA 4XWZA 3T2YA 2Q7VA 4G9KA 4H4UA 5HHFA 4FDCB 3EAOA 4EQSA 3GD4A 4BJZA 5KNLA 4YT0A 3GMBA 3SYIA 3IWAA 4H4RA 5GRTA 2FJAA 3NHOX 2X8GA 3ABVA 2Q6UA 4X9NA 1GESA 3F8RA 2XCGA 2ARDA 1PBCA 4GCMA 2V3AA 4ZCCA 5M0ZA 2OLOA 4JDRA 2Q0KA 4EQRA 2YQUA 4JNAA 1H82A 5KRQA 1BGJA 4REKA 5J7XA 1N4VA 5J60A 2YG7A 2BXSA 1OJCA 3UCLA 4B69A 2C67A 2ZBWA 4WCTA 1GTHA 4YKGA 4USQA 3SFEA 4YXDA 3P4PA 3CMMA 4DGKA 1D4CA 1E7PA 1JEHA 2OAMA 3ALMA 4C74A 3Q9TA 2WPEA 3AEGA 4EIPA 2BRYA 4EIQA 1GRHA 2VQ7A 1IUSA 3KD9A 1O94A 3V3NA 4DSHA 1NEKA 2BACA 2R4JA 4JN9A 4GDEA 5EB5A 5DBJA 2YLSA 1DJQA 1MOKA 2VVMA 3BHKA 3FPZA 2VQBA 3EF6A 4BK3A 1IUVA 1Y56B 4OPDA 4Y4MA 4XWRA 4DSGA 1LQTA 1D4DA 3DJEA 5BUKA 1E1KA 2IVDA 4NEWA 2YLRA 3H4KA 4H7UA 1H83A 4OPGA 2F5ZA 1PXAA 4CNJA 1P2EA 3GRSA 1GRBA 4Z24A 1L9EA 4IA5A 4K5SA 5FMHA 4B63A 3GYJA 1IUXA 2GAHB 1VG0A 2ZZCA 3CPIG 4H4XA 2H89A 3LZWA 4GR1A 1B8SA 3COXA 3AE5A 1GEUA 2ACZA 2YVFA 1CJCA 2GV8A 1FECA 2X3NA 2YR4A 4HA6A 2E1MA 5FS8A 1XDIA 1FL2A 4CRTA 5HY5A 4GF7A 1L0VA 1LVLA 1CJ2A 3GRTA 2QA1A 1JNRA 3OC4A 1M6IA 3AE2A 1NPXA 3NLCA 5FS6A 4YSYA 2GQFA 1H6VA 3Q6JA 1RP0A 3GDNA 1JRXA 1PN0A 1F6MA 2VVLA 4CY6A 4I58A 1PJ5A 1BZLA 2R9ZA 4C77A 5U1OA 3QFAA 4N9XA 1N4WA 4CY8A 2R4EA 4O5UA 1DOCA 3QSMA 4O5QA 5ER0A 2BCGG 4K8DA 2BK4A 5LV9A 4AOSA 1F8WA 2TMDA 4D03A 2YG4A 1PS9A 2GMJA 1KSSA 5KOXA 1FOHA 4BV6A 1DJNA 3CPJG 3QVPA 3QFBA 1Y0PA 4H2PA 1TDOA 2B9XA 2B76A 1E1NA 1PHHA 2GR3A 4FK1C 4JY3A 3BNUA 1NG4A 1OJ9A 2ZZ0A 2YLTA 2OLNA 1D4EA 3SZWA 4A6NB 3SX6A 2GAGB 1COYA 1CC6A 1JRYA 1ZP0A 4ADWA 4H2RA 4U2LA 1DNCA 2BS2A 3KU9A 1K4QA 3DGHA 3CGBA 1K0LA 3SXIA 4ZN0A 3C4AA 4JY2A 1OJAA 1RYIA 1ZX9A 3BI5A 1TYTA 3BI4A 4AT2A 4A65A 4YSZA 1GTEA 3HYVA 3ITJA 3KPKA 3T2KA 4NWZA 3URHA 3ZYXA 3UKPA 3F8PA 2CDUA 1EL5A 1XHCA 2WQYA 4BK2A 1BGNA 1B37A 3KKJA 4Z25A 5KVIA 4H4YA 1H81A 5TR3A 3SZ0A 5JCNA 1PBEA 3ALJA 3GSIA 3CNTA 2CFYA 4J2WA 1D5TA 1QO8A 1JOAA 3AEEA 2YLXA 4USRA 3IF9A 1BWCA 4OPTA 3PVCA 5U63A 1O95A 2BCPA 3NN0X 2A8XA 1H7WA 3UP4A 2XLTA 3S5WA 2BK5A 2I0ZA 3HYXA 2BXRA 2WDVA 1YQ3A 2BC1A 1P2HA 3LB8A 3T0KA 1F3PA 3NYEA 3AD8B 2FJBA 4K5RA 4TM3A 4AT0A 3FMWA 5KMRA 4U8JA 2XFPA 3VRBA 3UTGA 3ATRA 1EBDA 4EMWA 1N4UA 2AQJA 1O5WA 1LTXR 1F8RA 3DMEA 1RSGA 1JRZA 4H50A 4H2NA 4JQ9A 3SQPA 3K7MX 2XLPA 4AP1A 3P4QA 4BK1A 4Y4NA 3BI2A 3NKSA 2Y6RA 3DK8A 3DH9A 2GRTA 1E1LA 3PO7A 2GF3A 3LOVA 4OCGA 1VQWA 3CGCA 5KMQA 3LZXA 1ZMCA 2QAEA 3P9UA 4B1BA 5JCMA 1ZKQA 3NK0X 2Z5YA 4C5OA 4EM4A 3AE6A 3HZLA 2XVIA 3NGCX 4G74A 2RGJA 4I59A 1FCDA 1GRTA 2H88A 4KX6A 1AOGA 3AYIA 2JKCA 2GEWA 1TDFA 4UP3A 2BYBA 2YLWA 2Q0LA 3LXDA 1PJ7A 1M64A 4HB9A 3FG2P 4B67A 3UOXA 4APNA 3GDPA 2XLUA 2AR8A 2FBWA 3DJDA 4J57A 3FIMB 4Z43A 3KPFA 5IQ4A 3S61A 1PDHA 2BA9A 3UOZA 3REDA 4NTCA 4GDPA 3UKLA 3VRAA 5BVAA 3EANA 4D04A 3AXBA 3AEFA 2WEUA 5GSNA 3NK1X 1QJDA 3DK9A 3ISHA 1S2QA 3BNMA 3AEAA 2XYOA 3CGEA 3AECA 3K30A 4H4VA 4G73A 5FS9A 4IV9A 3AEDA 2UZZA 1D7LA 2EQ6A 4U2SA 2GVCA 2VZ2A 1ONFA 4H4QA 3UTEA 2GR2A 1DXLA 2BS3A 2C76A 2GR1A 3AEBA 4B68A 2DKHA 2WOVA 3NYFA 3AE8A 4MJWA 4X4JA 2B9WA 2X8HA 3D8XA 4II2A 1E1MA 3IC9A 3DGZA 2EQ8A 2B7RA 2CVJA 2WOWA 4LU6A 1DOBA 1Y56A 4M52A 1LJ1A 1H7XA 5KWFA 2IIDA 4H4TA 4YTNA 4OVIA 5KOWA 4U8NA 3NYCA 4NNJA 1ZOVA 5BRTA 1YQZA 4RG3A 2JAEA 4LA1A 2B7SA 1L9DA 1H86A 4NZHA 3AD7B 3RP7A 4NEVA 2C66A 5U25A 2J3NA 2YVGA 5JCLA 2BABA 2IVEA 2FJDA 5L46A 2YVJA 4OPCA 2NPXA 2VOUA 3CNPA 3T37A 4U8OA 2YR5A 4IVMB 3I6DA 1ZOYA 3JSKA 2WP6A 3ATQA 2V5ZA 3F8DA 4A79A 1PXBA 1NHPA 3AWIA 4U8LA 3NG7X 1NAAA 3VQRA 2BK3A 3UKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2Q A;  1GXF A;  1D7Y A;  1PBF A;  1S3E A;  1XPQ A;  2C3D A;  3H8L A;  3LJP A;  4Z44 A;  2VRL A;  3UTH A;  3KLJ A;  2E4G A;  2WOI A;  3AE7 A;  2X50 A;  4P9S A;  1H84 A;  2JBV A;  4C3X A;  4EQW A;  4EQX A;  3P4S A;  1KSU A;  1PBB A;  3ICR A;  2V61 A;  1MXT A;  3AB1 A;  4CCQ A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  5EB4 A;  4BJY A;  2YM1 A;  2TPR A;  4U8K A;  1NEN A;  1TDE A;  1VDC A;  2BS4 A;  1S3B A;  2X8C A;  1Q1R A;  1GPE A;  1ELI A;  3CN8 A;  3LAD A;  3QJ4 A;  4YTM A;  3ICS A;  3NK2 X;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  1Q9I A;  4U8I A;  1K0I A;  1GND A;  1LPF A;  1V59 A;  3EPT A;  4RG4 A;  1IUT A;  1EL7 A;  1OJT A;  2R0P A;  2RAB A;  3P1W A;  3G5S A;  2A87 A;  2HQM A;  4NTE A;  2VRM A;  1CL0 A;  3QSS A;  2GR0 A;  3CNS A;  3CNJ A;  4FX9 A;  4DNA A;  1TYP A;  1EL8 A;  1VG9 A;  5C3J A;  3I3L A;  3UOY A;  2GH5 A;  1GAL A;  5EBK A;  3H8I A;  3AYJ A;  2WS3 A;  2XLS A;  4YSX A;  1JU2 A;  2QA2 A;  2XFN A;  3AE1 A;  4GRT A;  2R0G A;  2XVE A;  3NTA A;  4KPR A;  1SEZ A;  3AD9 B;  4H4P A;  4YWO A;  4A7A A;  4CNK A;  3K7T A;  1GRA A;  1NDA A;  3UKQ A;  2GMH A;  4H4S A;  5JCK A;  5FS7 A;  1PBD A;  3DA1 A;  5CQF A;  1PJ6 A;  3M0O A;  3NTD A;  4Y4L A;  2OA1 A;  3UOV A;  4EMJ A;  1KNR A;  2R46 A;  1LV0 A;  2EQ9 A;  2WDR A;  2WU2 A;  2C3C A;  4UDQ A;  3UKF A;  3SM8 A;  2YAU A;  1OJD A;  1GV4 A;  1ZY8 A;  1B4V A;  1ZK7 A;  2C73 A;  2R0C A;  3AYL A;  2C70 A;  2W0H A;  2GB0 A;  4YSH A;  2Y6Q A;  4X9M A;  2V3B A;  4E0V A;  4OPI A;  2XVF A;  1CJ3 A;  1EL9 A;  2XVJ A;  3E1T A;  2JB2 A;  1KFY A;  2DKI A;  4UDR A;  1NHR A;  2BC0 A;  3BHF A;  4K22 A;  3VRD B;  4PAA A;  4BUR A;  2JB3 A;  4IVO B;  4Z26 A;  3V3O A;  1GER A;  4Z2T A;  2PYX A;  1ZMD A;  4OPL A;  3CPH G;  2C65 A;  3CIR A;  3DJJ A;  5CKU A;  3P4R A;  4H4W A;  2C7G A;  2RGO A;  4A99 A;  3UP5 A;  4YKF A;  2YG6 A;  3RHA A;  3R9U A;  1GET A;  2AAQ A;  1IJH A;  4EMI A;  4Z2R A;  4AP3 A;  4B65 A;  1TRB A;  2C72 A;  4PAB A;  1XAN A;  2A89 A;  2ZZB A;  1PXC A;  3VR9 A;  4XXG A;  2EQ7 A;  2C75 A;  1UKV G;  3GYI A;  1L9C A;  3NN6 X;  1X31 B;  1KF6 A;  3GD3 A;  1N1P A;  5JCI A;  3G5Q A;  2YG5 A;  3QSE A;  1BF3 A;  2CUL A;  4TM1 A;  4C3Y A;  2WET A;  3UKH A;  1JNZ A;  4YTP A;  4ZCD A;  1FEB A;  2XLR A;  2PHH A;  1HYU A;  1B5Q A;  3QVR A;  3B3R A;  2X99 A;  3WE0 A;  2XVH A;  2YM2 A;  1E39 A;  2O9Z A;  1CHU A;  1KNP A;  3CND A;  3GWD A;  4ICY A;  1GRF A;  4K7Z A;  2WPF A;  4IA6 A;  3ICT A;  2WES A;  5BUL A;  2V60 A;  2FJE A;  1DOE A;  3D1C A;  5EOW A;  3RP6 A;  2QCU A;  3UTF A;  3CGD A;  3UKK A;  3ZDN A;  1CC4 A;  2APG A;  1YQ4 A;  3C4N A;  3M12 A;  2C64 A;  3SFD A;  4B66 A;  1TDN A;  3NT6 A;  4K2X A;  4EM3 A;  4J56 A;  1MO9 A;  1IUW A;  3AE3 A;  1GT8 A;  1ZDL A;  2GQW A;  3GMC A;  1W4X A;  3M13 A;  5HYM A;  1CF3 A;  3L8K A;  2NVK X;  2VVL G;  3NNE A;  4ECH A;  5C2T A;  3AE4 A;  1GRG A;  3IHM A;  3O0H A;  2XFU A;  4H4Z A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  3K7Q X;  5IQ1 A;  2JK6 A;  2V6O A;  2WU5 A;  3KVE A;  3C96 A;  1KDG A;  2WP5 A;  3NRN A;  1CBO A;  1NG3 A;  5HXI A;  3NIX A;  2R45 A;  3G5R A;  2XDO A;  3RNM A;  4AOX A;  1VRQ B;  3RP8 A;  3PS9 A;  1BKW A;  2B9Y A;  2YWL A;  4TM0 A;  4LII A;  4A5L A;  4FK1 A;  4RSL A;  2JB1 A;  2WPC A;  3V76 A;  3ADA B;  4A9W A;  1E6E A;  4CBQ A;  4TLX A;  1YKJ A;  1CJ4 A;  1Q1W A;  2YLZ A;  3SGL A;  4J34 A;  3FBS A;  4A6N A;  2RGH A;  2XFO A;  3NH3 X;  3ALL A;  4WX1 A;  1TDK A;  2E5V A;  3DK4 A;  3VR8 A;  5KXJ A;  1K0J A;  2YG3 A;  3AE9 A;  4U8P A;  2Z5X A;  4Z2U A;  1DOD A;  2WBA A;  1YY5 A;  4J31 A;  3GWF A;  1F8S A;  1GSN A;  1QLB A;  2WP9 A;  2YR6 A;  3IHG A;  4GUV A;  4NTD A;  1S2Y A;  4U8M A;  4J33 A;  1NHS A;  2XFQ A;  1LQU A;  1Z6L A;  3OZ2 A;  4TM4 A;  3L1R A;  1REO A;  5IPY A;  2WDQ A;  3KA7 A;  3B6D A;  3II4 A;  4B64 A;  4UDP A;  3DJG X;  1GOS A;  1CC2 A;  1NHQ A;  4JNQ A;  4XWZ A;  2Q7V A;  4H4U A;  5HHF A;  4FDC B;  3EAO A;  4EQS A;  3GD4 A;  4BJZ A;  4YT0 A;  3GMB A;  3IWA A;  4H4R A;  5GRT A;  2FJA A;  3NHO X;  2X8G A;  3ABV A;  2Q6U A;  4X9N A;  1GES A;  3F8R A;  2XCG A;  2ARD A;  1PBC A;  4GCM A;  2V3A A;  4ZCC A;  5M0Z A;  2OLO A;  4JDR A;  2Q0K A;  4EQR A;  2YQU A;  4JNA A;  1H82 A;  5KRQ A;  1BGJ A;  4REK A;  5J7X A;  1N4V A;  5J60 A;  2YG7 A;  2BXS A;  1OJC A;  3UCL A;  4B69 A;  2C67 A;  2ZBW A;  4WCT A;  1GTH A;  4YKG A;  4USQ A;  3SFE A;  4YXD A;  3P4P A;  4DGK A;  1D4C A;  1E7P A;  1JEH A;  2OAM A;  3ALM A;  4C74 A;  3Q9T A;  2WPE A;  3AEG A;  4EIP A;  4EIQ A;  1GRH A;  2VQ7 A;  1IUS A;  3KD9 A;  1O94 A;  3V3N A;  4DSH A;  1NEK A;  2BAC A;  2R4J A;  4JN9 A;  4GDE A;  5EB5 A;  5DBJ A;  2YLS A;  1DJQ A;  1MOK A;  2VVM A;  3BHK A;  3FPZ A;  2VQB A;  3EF6 A;  4BK3 A;  1IUV A;  1Y56 B;  4OPD A;  4Y4M A;  4XWR A;  4DSG A;  1LQT A;  1D4D A;  3DJE A;  5BUK A;  1E1K A;  2IVD A;  4NEW A;  2YLR A;  3H4K A;  4H7U A;  1H83 A;  4OPG A;  2F5Z A;  1PXA A;  4CNJ A;  1P2E A;  3GRS A;  1GRB A;  4Z24 A;  1L9E A;  4IA5 A;  4K5S A;  5FMH A;  4B63 A;  3GYJ A;  1IUX A;  2GAH B;  1VG0 A;  2ZZC A;  3CPI G;  4H4X A;  2H89 A;  3LZW A;  4GR1 A;  1B8S A;  3COX A;  3AE5 A;  1GEU A;  2ACZ A;  2YVF A;  1CJC A;  2GV8 A;  1FEC A;  2X3N A;  2YR4 A;  4HA6 A;  2E1M A;  5FS8 A;  1XDI A;  1FL2 A;  4CRT A;  5HY5 A;  4GF7 A;  1L0V A;  1LVL A;  1CJ2 A;  3GRT A;  2QA1 A;  1JNR A;  3OC4 A;  1M6I A;  3AE2 A;  1NPX A;  3NLC A;  5FS6 A;  4YSY A;  2GQF A;  1H6V A;  3Q6J A;  1RP0 A;  3GDN A;  1JRX A;  1PN0 A;  1F6M A;  2VVL A;  4CY6 A;  4I58 A;  1PJ5 A;  1BZL A;  2R9Z A;  4C77 A;  5U1O A;  3QFA A;  4N9X A;  1N4W A;  4CY8 A;  2R4E A;  4O5U A;  1DOC A;  3QSM A;  4O5Q A;  5ER0 A;  2BCG G;  4K8D A;  2BK4 A;  5LV9 A;  4AOS A;  1F8W A;  2TMD A;  4D03 A;  2YG4 A;  1PS9 A;  2GMJ A;  1KSS A;  5KOX A;  1FOH A;  4BV6 A;  1DJN A;  3CPJ G;  3QVP A;  3QFB A;  1Y0P A;  4H2P A;  1TDO A;  2B9X A;  2B76 A;  1E1N A;  1PHH A;  2GR3 A;  4FK1 C;  4JY3 A;  3BNU A;  1NG4 A;  1OJ9 A;  2ZZ0 A;  2YLT A;  2OLN A;  1D4E A;  4A6N B;  2GAG B;  1COY A;  1CC6 A;  1JRY A;  1ZP0 A;  4ADW A;  4H2R A;  4U2L A;  1DNC A;  2BS2 A;  3KU9 A;  1K4Q A;  3DGH A;  3CGB A;  1K0L A;  4ZN0 A;  3C4A A;  4JY2 A;  1OJA A;  1RYI A;  1ZX9 A;  3BI5 A;  1TYT A;  3BI4 A;  4AT2 A;  4A65 A;  4YSZ A;  1GTE A;  3ITJ A;  3ZYX A;  3URH A;  3UKP A;  3F8P A;  2CDU A;  1EL5 A;  1XHC A;  2WQY A;  4BK2 A;  1BGN A;  1B37 A;  3KKJ A;  4Z25 A;  5KVI A;  4H4Y A;  1H81 A;  5TR3 A;  5JCN A;  1PBE A;  3ALJ A;  3GSI A;  3CNT A;  2CFY A;  4J2W A;  1D5T A;  1QO8 A;  1JOA A;  3AEE A;  2YLX A;  4USR A;  3IF9 A;  1BWC A;  4OPT A;  3PVC A;  5U63 A;  1O95 A;  2BCP A;  3NN0 X;  2A8X A;  1H7W A;  3UP4 A;  2XLT A;  3S5W A;  2BK5 A;  2I0Z A;  2BXR A;  2WDV A;  1YQ3 A;  2BC1 A;  1P2H A;  3LB8 A;  1F3P A;  3NYE A;  3AD8 B;  2FJB A;  4K5R A;  4TM3 A;  4AT0 A;  3FMW A;  4U8J A;  2XFP A;  3VRB A;  3UTG A;  3ATR A;  1EBD A;  4EMW A;  1N4U A;  2AQJ A;  1O5W A;  1LTX R;  1F8R A;  3DME A;  1RSG A;  1JRZ A;  4H50 A;  4H2N A;  4JQ9 A;  3SQP A;  3K7M X;  2XLP A;  4AP1 A;  3P4Q A;  4BK1 A;  4Y4N A;  3BI2 A;  3NKS A;  2Y6R A;  3DK8 A;  3DH9 A;  2GRT A;  1E1L A;  3PO7 A;  2GF3 A;  3LOV A;  4OCG A;  1VQW A;  3CGC A;  4B1B A;  3LZX A;  1ZMC A;  2QAE A;  3P9U A;  5JCM A;  5KVH A;  1ZKQ A;  3NK0 X;  2Z5Y A;  4C5O A;  4EM4 A;  3AE6 A;  3HZL A;  2XVI A;  3NGC X;  2RGJ A;  4I59 A;  1FCD A;  1GRT A;  2H88 A;  4KX6 A;  1AOG A;  3AYI A;  2JKC A;  2GEW A;  1TDF A;  4UP3 A;  2BYB A;  2YLW A;  2Q0L A;  3LXD A;  1PJ7 A;  1M64 A;  4HB9 A;  3FG2 P;  4B67 A;  3UOX A;  4APN A;  3GDP A;  2XLU A;  2AR8 A;  2FBW A;  3DJD A;  4J57 A;  3FIM B;  4Z43 A;  3KPF A;  5IQ4 A;  3S61 A;  1PDH A;  2BA9 A;  3UOZ A;  3RED A;  4NTC A;  4GDP A;  3UKL A;  3VRA A;  5BVA A;  3EAN A;  4D04 A;  3AXB A;  3AEF A;  2WEU A;  5GSN A;  3NK1 X;  1QJD A;  3DK9 A;  3ISH A;  1S2Q A;  3BNM A;  3AEA A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4H4V A;  5FS9 A;  4IV9 A;  3AED A;  2UZZ A;  1D7L A;  2EQ6 A;  4U2S A;  2GVC A;  2VZ2 A;  1ONF A;  4H4Q A;  3UTE A;  2GR2 A;  1DXL A;  2BS3 A;  2C76 A;  2GR1 A;  3AEB A;  4B68 A;  2DKH A;  2WOV A;  3NYF A;  3AE8 A;  4MJW A;  4X4J A;  2B9W A;  2X8H A;  3D8X A;  1E1M A;  3IC9 A;  3DGZ A;  2EQ8 A;  2B7R A;  2CVJ A;  2WOW A;  4LU6 A;  1DOB A;  1Y56 A;  4M52 A;  1LJ1 A;  1H7X A;  5KWF A;  2IID A;  4H4T A;  4YTN A;  4OVI A;  5KOW A;  4U8N A;  3NYC A;  1ZOV A;  5BRT A;  1YQZ A;  4RG3 A;  2JAE A;  4LA1 A;  2B7S A;  1L9D A;  1H86 A;  4NZH A;  3AD7 B;  3RP7 A;  4NEV A;  2C66 A;  5U25 A;  2J3N A;  2YVG A;  5JCL A;  2BAB A;  2IVE A;  2FJD A;  5L46 A;  2YVJ A;  4OPC A;  2NPX A;  2VOU A;  3CNP A;  3T37 A;  4U8O A;  2YR5 A;  4IVM B;  3I6D A;  1ZOY A;  3JSK A;  2WP6 A;  3ATQ A;  2V5Z A;  3F8D A;  4A79 A;  1PXB A;  1NHP A;  3AWI A;  4U8L A;  3NG7 X;  1NAA A;  3VQR A;  2BK3 A;  3UKA A; 
#chains in the Genus database with same CATH topology
 4H2Q A;  1GXF A;  1D7Y A;  1PBF A;  1S3E A;  1XPQ A;  2C3D A;  3H8L A;  3LJP A;  4Z44 A;  2VRL A;  3UTH A;  3KLJ A;  2E4G A;  2WOI A;  3AE7 A;  2X50 A;  4P9S A;  1H84 A;  2JBV A;  4C3X A;  4EQW A;  4EQX A;  3P4S A;  3SZF A;  1KSU A;  1PBB A;  3ICR A;  2V61 A;  1MXT A;  3AB1 A;  4CCQ A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  5EB4 A;  4BJY A;  2YM1 A;  2TPR A;  4U8K A;  1NEN A;  1TDE A;  1VDC A;  2BS4 A;  1S3B A;  2X8C A;  1Q1R A;  1GPE A;  1ELI A;  3CN8 A;  3LAD A;  3QJ4 A;  4YTM A;  3ICS A;  3NK2 X;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  1Q9I A;  4U8I A;  1K0I A;  1GND A;  1LPF A;  1V59 A;  3EPT A;  4RG4 A;  1IUT A;  1EL7 A;  1OJT A;  2R0P A;  2RAB A;  3P1W A;  3G5S A;  2A87 A;  2HQM A;  4NTE A;  2VRM A;  1CL0 A;  3QSS A;  2GR0 A;  3CNS A;  3CNJ A;  4FX9 A;  4DNA A;  1TYP A;  4GAV A;  1EL8 A;  1VG9 A;  5C3J A;  3I3L A;  2C4C A;  3UOY A;  2GH5 A;  1GAL A;  5EBK A;  3H8I A;  3AYJ A;  2WS3 A;  2XLS A;  4YSX A;  1JU2 A;  2QA2 A;  2XFN A;  3AE1 A;  4GRT A;  2R0G A;  2XVE A;  3NTA A;  2BRA A;  4KPR A;  1SEZ A;  3AD9 B;  4H4P A;  4YWO A;  4A7A A;  4CNK A;  3K7T A;  1GRA A;  1NDA A;  3UKQ A;  2GMH A;  4H4S A;  5JCK A;  5FS7 A;  1PBD A;  3DA1 A;  5CQF A;  1PJ6 A;  3M0O A;  3NTD A;  4Y4L A;  2OA1 A;  3UOV A;  4EMJ A;  1KNR A;  2R46 A;  1LV0 A;  2EQ9 A;  2WDR A;  2WU2 A;  2C3C A;  4UDQ A;  3T2Z A;  3HYW A;  3SM8 A;  3UKF A;  2YAU A;  3T31 A;  1OJD A;  3SY4 A;  1GV4 A;  1ZY8 A;  1B4V A;  1ZK7 A;  2C73 A;  2R0C A;  3AYL A;  4G6G A;  2C70 A;  2W0H A;  2GB0 A;  4YSH A;  2Y6Q A;  4X9M A;  5KVH A;  2V3B A;  4E0V A;  4OPI A;  2XVF A;  1CJ3 A;  1EL9 A;  2XVJ A;  3E1T A;  4G6H A;  2JB2 A;  1KFY A;  2DKI A;  4UDR A;  1NHR A;  2BC0 A;  3BHF A;  4K22 A;  5KMP A;  3VRD B;  4PAA A;  4BUR A;  2JB3 A;  4IVO B;  4Z26 A;  3V3O A;  1GER A;  4Z2T A;  2PYX A;  1ZMD A;  4OPL A;  3CPH G;  2C65 A;  3CIR A;  3DJJ A;  5CKU A;  3P4R A;  4H4W A;  2C7G A;  2RGO A;  4A99 A;  3UP5 A;  4YKF A;  2YG6 A;  3RHA A;  3R9U A;  1GET A;  2AAQ A;  1IJH A;  4EMI A;  4Z2R A;  4AP3 A;  4B65 A;  1TRB A;  2C72 A;  4PAB A;  1XAN A;  2A89 A;  2ZZB A;  1PXC A;  3VR9 A;  3GYX A;  4XXG A;  2EQ7 A;  2C75 A;  1UKV G;  3GYI A;  1L9C A;  3NN6 X;  1X31 B;  1KF6 A;  3GD3 A;  1N1P A;  5JCI A;  3G5Q A;  2YG5 A;  3QSE A;  1BF3 A;  2CUL A;  4II3 A;  4TM1 A;  4C3Y A;  2WET A;  3UKH A;  1JNZ A;  4YTP A;  4ZCD A;  1FEB A;  2XLR A;  2PHH A;  1HYU A;  1B5Q A;  3QVR A;  3B3R A;  2X99 A;  3WE0 A;  2XVH A;  2YM2 A;  1E39 A;  2O9Z A;  1CHU A;  1KNP A;  3CND A;  3GWD A;  4ICY A;  1GRF A;  4K7Z A;  2WPF A;  4IA6 A;  3ICT A;  2WES A;  5BUL A;  2V60 A;  2FJE A;  1DOE A;  3D1C A;  5EOW A;  3RP6 A;  2QCU A;  3SZC A;  3UTF A;  3CGD A;  3UKK A;  3ZDN A;  1CC4 A;  2APG A;  1YQ4 A;  3C4N A;  3M12 A;  2C64 A;  3SFD A;  4B66 A;  1TDN A;  3NT6 A;  4K2X A;  4EM3 A;  4J56 A;  1MO9 A;  3T14 A;  5KMS A;  1IUW A;  3AE3 A;  1GT8 A;  1ZDL A;  2GQW A;  3GMC A;  1W4X A;  3M13 A;  5HYM A;  1CF3 A;  3L8K A;  2NVK X;  2VVL G;  3NNE A;  4ECH A;  5C2T A;  3AE4 A;  1GRG A;  3IHM A;  3O0H A;  2XFU A;  4H4Z A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  3K7Q X;  5IQ1 A;  2JK6 A;  2V6O A;  2WU5 A;  3KVE A;  3C96 A;  1KDG A;  2WP5 A;  3NRN A;  1CBO A;  1NG3 A;  5HXI A;  3NIX A;  2R45 A;  3G5R A;  2XDO A;  3RNM A;  4AOX A;  1VRQ B;  3RP8 A;  3PS9 A;  1BKW A;  2B9Y A;  2YWL A;  4TM0 A;  4LII A;  4A5L A;  4FK1 A;  4RSL A;  2JB1 A;  2WPC A;  3V76 A;  3ADA B;  4A9W A;  1E6E A;  4CBQ A;  4TLX A;  1YKJ A;  1CJ4 A;  1Q1W A;  2YLZ A;  3SGL A;  4J34 A;  3FBS A;  4A6N A;  2RGH A;  2XFO A;  3NH3 X;  3ALL A;  4WX1 A;  1TDK A;  2E5V A;  3DK4 A;  3VR8 A;  5KXJ A;  1K0J A;  2YG3 A;  3AE9 A;  4U8P A;  2Z5X A;  4Z2U A;  1DOD A;  2WBA A;  1YY5 A;  4J31 A;  3GWF A;  1F8S A;  1GSN A;  1QLB A;  2WP9 A;  2YR6 A;  3IHG A;  4GUV A;  4NTD A;  1S2Y A;  4GAP A;  4J33 A;  1NHS A;  2XFQ A;  4U8M A;  1LQU A;  1Z6L A;  3OZ2 A;  4TM4 A;  3L1R A;  1REO A;  5IPY A;  2WDQ A;  3KA7 A;  3B6D A;  3II4 A;  4B64 A;  4UDP A;  3DJG X;  1GOS A;  1CC2 A;  1NHQ A;  4JNQ A;  4XWZ A;  3T2Y A;  2Q7V A;  4G9K A;  4H4U A;  5HHF A;  4FDC B;  3EAO A;  4EQS A;  3GD4 A;  4BJZ A;  5KNL A;  4YT0 A;  3GMB A;  3SYI A;  3IWA A;  4H4R A;  5GRT A;  2FJA A;  3NHO X;  2X8G A;  3ABV A;  2Q6U A;  4X9N A;  1GES A;  3F8R A;  2XCG A;  2ARD A;  1PBC A;  4GCM A;  2V3A A;  4ZCC A;  5M0Z A;  2OLO A;  4JDR A;  2Q0K A;  4EQR A;  2YQU A;  4JNA A;  1H82 A;  5KRQ A;  1BGJ A;  4REK A;  5J7X A;  1N4V A;  5J60 A;  2YG7 A;  2BXS A;  1OJC A;  3UCL A;  4B69 A;  2C67 A;  2ZBW A;  4WCT A;  1GTH A;  4YKG A;  4USQ A;  3SFE A;  4YXD A;  3P4P A;  3CMM A;  4DGK A;  1D4C A;  1E7P A;  1JEH A;  2OAM A;  3ALM A;  4C74 A;  3Q9T A;  2WPE A;  3AEG A;  4EIP A;  2BRY A;  4EIQ A;  1GRH A;  2VQ7 A;  1IUS A;  3KD9 A;  1O94 A;  3V3N A;  4DSH A;  1NEK A;  2BAC A;  2R4J A;  4JN9 A;  4GDE A;  5EB5 A;  5DBJ A;  2YLS A;  1DJQ A;  1MOK A;  2VVM A;  3BHK A;  3FPZ A;  2VQB A;  3EF6 A;  4BK3 A;  1IUV A;  1Y56 B;  4OPD A;  4Y4M A;  4XWR A;  4DSG A;  1LQT A;  1D4D A;  3DJE A;  5BUK A;  1E1K A;  2IVD A;  4NEW A;  2YLR A;  3H4K A;  4H7U A;  1H83 A;  4OPG A;  2F5Z A;  1PXA A;  4CNJ A;  1P2E A;  3GRS A;  1GRB A;  4Z24 A;  1L9E A;  4IA5 A;  4K5S A;  5FMH A;  4B63 A;  3GYJ A;  1IUX A;  2GAH B;  1VG0 A;  2ZZC A;  3CPI G;  4H4X A;  2H89 A;  3LZW A;  4GR1 A;  1B8S A;  3COX A;  3AE5 A;  1GEU A;  2ACZ A;  2YVF A;  1CJC A;  2GV8 A;  1FEC A;  2X3N A;  2YR4 A;  4HA6 A;  2E1M A;  5FS8 A;  1XDI A;  1FL2 A;  4CRT A;  5HY5 A;  4GF7 A;  1L0V A;  1LVL A;  1CJ2 A;  3GRT A;  2QA1 A;  1JNR A;  3OC4 A;  1M6I A;  3AE2 A;  1NPX A;  3NLC A;  5FS6 A;  4YSY A;  2GQF A;  1H6V A;  3Q6J A;  1RP0 A;  3GDN A;  1JRX A;  1PN0 A;  1F6M A;  2VVL A;  4CY6 A;  4I58 A;  1PJ5 A;  1BZL A;  2R9Z A;  4C77 A;  5U1O A;  3QFA A;  4N9X A;  1N4W A;  4CY8 A;  2R4E A;  4O5U A;  1DOC A;  3QSM A;  4O5Q A;  5ER0 A;  2BCG G;  4K8D A;  2BK4 A;  5LV9 A;  4AOS A;  1F8W A;  2TMD A;  4D03 A;  2YG4 A;  1PS9 A;  2GMJ A;  1KSS A;  5KOX A;  1FOH A;  4BV6 A;  1DJN A;  3CPJ G;  3QVP A;  3QFB A;  1Y0P A;  4H2P A;  1TDO A;  2B9X A;  2B76 A;  1E1N A;  1PHH A;  2GR3 A;  4FK1 C;  4JY3 A;  3BNU A;  1NG4 A;  1OJ9 A;  2ZZ0 A;  2YLT A;  2OLN A;  1D4E A;  3SZW A;  4A6N B;  3SX6 A;  2GAG B;  1COY A;  1CC6 A;  1JRY A;  1ZP0 A;  4ADW A;  4H2R A;  4U2L A;  1DNC A;  2BS2 A;  3KU9 A;  1K4Q A;  3DGH A;  3CGB A;  1K0L A;  3SXI A;  4ZN0 A;  3C4A A;  4JY2 A;  1OJA A;  1RYI A;  1ZX9 A;  3BI5 A;  1TYT A;  3BI4 A;  4AT2 A;  4A65 A;  4YSZ A;  1GTE A;  3HYV A;  3ITJ A;  3KPK A;  3T2K A;  4NWZ A;  3URH A;  3ZYX A;  3UKP A;  3F8P A;  2CDU A;  1EL5 A;  1XHC A;  2WQY A;  4BK2 A;  1BGN A;  1B37 A;  3KKJ A;  4Z25 A;  5KVI A;  4H4Y A;  1H81 A;  5TR3 A;  3SZ0 A;  5JCN A;  1PBE A;  3ALJ A;  3GSI A;  3CNT A;  2CFY A;  4J2W A;  1D5T A;  1QO8 A;  1JOA A;  3AEE A;  2YLX A;  4USR A;  3IF9 A;  1BWC A;  4OPT A;  3PVC A;  5U63 A;  1O95 A;  2BCP A;  3NN0 X;  2A8X A;  1H7W A;  3UP4 A;  2XLT A;  3S5W A;  2BK5 A;  2I0Z A;  3HYX A;  2BXR A;  2WDV A;  1YQ3 A;  2BC1 A;  1P2H A;  3LB8 A;  3T0K A;  1F3P A;  3NYE A;  3AD8 B;  2FJB A;  4K5R A;  4TM3 A;  4AT0 A;  3FMW A;  5KMR A;  4U8J A;  2XFP A;  3VRB A;  3UTG A;  3ATR A;  1EBD A;  4EMW A;  1N4U A;  2AQJ A;  1O5W A;  1LTX R;  1F8R A;  3DME A;  1RSG A;  1JRZ A;  4H50 A;  4H2N A;  4JQ9 A;  3SQP A;  3K7M X;  2XLP A;  4AP1 A;  3P4Q A;  4BK1 A;  4Y4N A;  3BI2 A;  3NKS A;  2Y6R A;  3DK8 A;  3DH9 A;  2GRT A;  1E1L A;  3PO7 A;  2GF3 A;  3LOV A;  4OCG A;  1VQW A;  3CGC A;  5KMQ A;  3LZX A;  1ZMC A;  2QAE A;  3P9U A;  4B1B A;  5JCM A;  1ZKQ A;  3NK0 X;  2Z5Y A;  4C5O A;  4EM4 A;  3AE6 A;  3HZL A;  2XVI A;  3NGC X;  4G74 A;  2RGJ A;  4I59 A;  1FCD A;  1GRT A;  2H88 A;  4KX6 A;  1AOG A;  3AYI A;  2JKC A;  2GEW A;  1TDF A;  4UP3 A;  2BYB A;  2YLW A;  2Q0L A;  3LXD A;  1PJ7 A;  1M64 A;  4HB9 A;  3FG2 P;  4B67 A;  3UOX A;  4APN A;  3GDP A;  2XLU A;  2AR8 A;  2FBW A;  3DJD A;  4J57 A;  3FIM B;  4Z43 A;  3KPF A;  5IQ4 A;  3S61 A;  1PDH A;  2BA9 A;  3UOZ A;  3RED A;  4NTC A;  4GDP A;  3UKL A;  3VRA A;  5BVA A;  3EAN A;  4D04 A;  3AXB A;  3AEF A;  2WEU A;  5GSN A;  3NK1 X;  1QJD A;  3DK9 A;  3ISH A;  1S2Q A;  3BNM A;  3AEA A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4H4V A;  4G73 A;  5FS9 A;  4IV9 A;  3AED A;  2UZZ A;  1D7L A;  2EQ6 A;  4U2S A;  2GVC A;  2VZ2 A;  1ONF A;  4H4Q A;  3UTE A;  2GR2 A;  1DXL A;  2BS3 A;  2C76 A;  2GR1 A;  3AEB A;  4B68 A;  2DKH A;  2WOV A;  3NYF A;  3AE8 A;  4MJW A;  4X4J A;  2B9W A;  2X8H A;  3D8X A;  4II2 A;  1E1M A;  3IC9 A;  3DGZ A;  2EQ8 A;  2B7R A;  2CVJ A;  2WOW A;  4LU6 A;  1DOB A;  1Y56 A;  4M52 A;  1LJ1 A;  1H7X A;  5KWF A;  2IID A;  4H4T A;  4YTN A;  4OVI A;  5KOW A;  4U8N A;  3NYC A;  4NNJ A;  1ZOV A;  5BRT A;  1YQZ A;  4RG3 A;  2JAE A;  4LA1 A;  2B7S A;  1L9D A;  1H86 A;  4NZH A;  3AD7 B;  3RP7 A;  4NEV A;  2C66 A;  5U25 A;  2J3N A;  2YVG A;  5JCL A;  2BAB A;  2IVE A;  2FJD A;  5L46 A;  2YVJ A;  4OPC A;  2NPX A;  2VOU A;  3CNP A;  3T37 A;  4U8O A;  2YR5 A;  4IVM B;  3I6D A;  1ZOY A;  3JSK A;  2WP6 A;  3ATQ A;  2V5Z A;  3F8D A;  4A79 A;  1PXB A;  1NHP A;  3AWI A;  4U8L A;  3NG7 X;  1NAA A;  3VQR A;  2BK3 A;  3UKA A; 
#chains in the Genus database with same CATH homology
 4H2Q A;  1GXF A;  1D7Y A;  1PBF A;  1S3E A;  1XPQ A;  2C3D A;  3H8L A;  3LJP A;  4Z44 A;  2VRL A;  3UTH A;  3KLJ A;  2E4G A;  2WOI A;  3AE7 A;  2X50 A;  4P9S A;  1H84 A;  2JBV A;  4C3X A;  4EQW A;  4EQX A;  3P4S A;  3SZF A;  1KSU A;  1PBB A;  3ICR A;  2V61 A;  1MXT A;  3AB1 A;  4CCQ A;  2OAL A;  3CTY A;  4U2T A;  4TLZ A;  5EB4 A;  4BJY A;  2YM1 A;  2TPR A;  4U8K A;  1NEN A;  1TDE A;  1VDC A;  2BS4 A;  1S3B A;  2X8C A;  1Q1R A;  1GPE A;  1ELI A;  3CN8 A;  3LAD A;  3QJ4 A;  4YTM A;  3ICS A;  3NK2 X;  1FEA A;  4OPU A;  1IUU A;  5M10 A;  1Q9I A;  4U8I A;  1K0I A;  1GND A;  1LPF A;  1V59 A;  3EPT A;  4RG4 A;  1IUT A;  1EL7 A;  1OJT A;  2R0P A;  2RAB A;  3P1W A;  3G5S A;  2A87 A;  2HQM A;  4NTE A;  2VRM A;  1CL0 A;  3QSS A;  2GR0 A;  3CNS A;  3CNJ A;  4FX9 A;  4DNA A;  1TYP A;  4GAV A;  1EL8 A;  1VG9 A;  5C3J A;  3I3L A;  2C4C A;  3UOY A;  2GH5 A;  1GAL A;  5EBK A;  3H8I A;  3AYJ A;  2WS3 A;  2XLS A;  4YSX A;  1JU2 A;  2QA2 A;  2XFN A;  3AE1 A;  4GRT A;  2R0G A;  2XVE A;  3NTA A;  2BRA A;  4KPR A;  1SEZ A;  3AD9 B;  4H4P A;  4YWO A;  4A7A A;  4CNK A;  3K7T A;  1GRA A;  1NDA A;  3UKQ A;  2GMH A;  4H4S A;  5JCK A;  5FS7 A;  1PBD A;  3DA1 A;  5CQF A;  1PJ6 A;  3M0O A;  3NTD A;  4Y4L A;  2OA1 A;  3UOV A;  4EMJ A;  1KNR A;  2R46 A;  1LV0 A;  2EQ9 A;  2WDR A;  2WU2 A;  2C3C A;  4UDQ A;  3T2Z A;  3HYW A;  3SM8 A;  3UKF A;  2YAU A;  3T31 A;  1OJD A;  3SY4 A;  1GV4 A;  1ZY8 A;  1B4V A;  1ZK7 A;  2C73 A;  2R0C A;  3AYL A;  4G6G A;  2C70 A;  2W0H A;  2GB0 A;  4YSH A;  2Y6Q A;  4X9M A;  5KVH A;  2V3B A;  4E0V A;  4OPI A;  2XVF A;  1CJ3 A;  1EL9 A;  2XVJ A;  3E1T A;  4G6H A;  2JB2 A;  1KFY A;  2DKI A;  4UDR A;  1NHR A;  2BC0 A;  3BHF A;  4K22 A;  5KMP A;  3VRD B;  4PAA A;  4BUR A;  2JB3 A;  4IVO B;  4Z26 A;  3V3O A;  1GER A;  4Z2T A;  2PYX A;  1ZMD A;  4OPL A;  3CPH G;  2C65 A;  3CIR A;  3DJJ A;  5CKU A;  3P4R A;  4H4W A;  2C7G A;  2RGO A;  4A99 A;  3UP5 A;  4YKF A;  2YG6 A;  3RHA A;  3R9U A;  1GET A;  2AAQ A;  1IJH A;  4EMI A;  4Z2R A;  4AP3 A;  4B65 A;  1TRB A;  2C72 A;  4PAB A;  1XAN A;  2A89 A;  2ZZB A;  1PXC A;  3VR9 A;  3GYX A;  4XXG A;  2EQ7 A;  2C75 A;  1UKV G;  3GYI A;  1L9C A;  3NN6 X;  1X31 B;  1KF6 A;  3GD3 A;  1N1P A;  5JCI A;  3G5Q A;  2YG5 A;  3QSE A;  1BF3 A;  2CUL A;  4II3 A;  4TM1 A;  4C3Y A;  2WET A;  3UKH A;  1JNZ A;  4YTP A;  4ZCD A;  1FEB A;  2XLR A;  2PHH A;  1HYU A;  1B5Q A;  3QVR A;  3B3R A;  2X99 A;  3WE0 A;  2XVH A;  2YM2 A;  1E39 A;  2O9Z A;  1CHU A;  1KNP A;  3CND A;  3GWD A;  4ICY A;  1GRF A;  4K7Z A;  2WPF A;  4IA6 A;  3ICT A;  2WES A;  5BUL A;  2V60 A;  2FJE A;  1DOE A;  3D1C A;  5EOW A;  3RP6 A;  2QCU A;  3SZC A;  3UTF A;  3CGD A;  3UKK A;  3ZDN A;  1CC4 A;  2APG A;  1YQ4 A;  3C4N A;  3M12 A;  2C64 A;  3SFD A;  4B66 A;  1TDN A;  3NT6 A;  4K2X A;  4EM3 A;  4J56 A;  1MO9 A;  3T14 A;  5KMS A;  1IUW A;  3AE3 A;  1GT8 A;  1ZDL A;  2GQW A;  3GMC A;  1W4X A;  3M13 A;  5HYM A;  1CF3 A;  3L8K A;  2NVK X;  2VVL G;  3NNE A;  4ECH A;  5C2T A;  3AE4 A;  1GRG A;  3IHM A;  3O0H A;  2XFU A;  4H4Z A;  4CCR A;  4J36 A;  2WHD A;  1GRE A;  3K7Q X;  5IQ1 A;  2JK6 A;  2V6O A;  2WU5 A;  3KVE A;  3C96 A;  1KDG A;  2WP5 A;  3NRN A;  1CBO A;  1NG3 A;  5HXI A;  3NIX A;  2R45 A;  3G5R A;  2XDO A;  3RNM A;  4AOX A;  1VRQ B;  3RP8 A;  3PS9 A;  1BKW A;  2B9Y A;  2YWL A;  4TM0 A;  4LII A;  4A5L A;  4FK1 A;  4RSL A;  2JB1 A;  2WPC A;  3V76 A;  3ADA B;  4A9W A;  1E6E A;  4CBQ A;  4TLX A;  1YKJ A;  1CJ4 A;  1Q1W A;  2YLZ A;  3SGL A;  4J34 A;  3FBS A;  4A6N A;  2RGH A;  2XFO A;  3NH3 X;  3ALL A;  4WX1 A;  1TDK A;  2E5V A;  3DK4 A;  3VR8 A;  5KXJ A;  1K0J A;  2YG3 A;  3AE9 A;  4U8P A;  2Z5X A;  4Z2U A;  1DOD A;  2WBA A;  1YY5 A;  4J31 A;  3GWF A;  1F8S A;  1GSN A;  1QLB A;  2WP9 A;  2YR6 A;  3IHG A;  4GUV A;  4NTD A;  1S2Y A;  4GAP A;  4J33 A;  1NHS A;  2XFQ A;  4U8M A;  1LQU A;  1Z6L A;  3OZ2 A;  4TM4 A;  3L1R A;  1REO A;  5IPY A;  2WDQ A;  3KA7 A;  3B6D A;  3II4 A;  4B64 A;  4UDP A;  3DJG X;  1GOS A;  1CC2 A;  1NHQ A;  4JNQ A;  4XWZ A;  3T2Y A;  2Q7V A;  4G9K A;  4H4U A;  5HHF A;  4FDC B;  3EAO A;  4EQS A;  3GD4 A;  4BJZ A;  5KNL A;  4YT0 A;  3GMB A;  3SYI A;  3IWA A;  4H4R A;  5GRT A;  2FJA A;  3NHO X;  2X8G A;  3ABV A;  2Q6U A;  4X9N A;  1GES A;  3F8R A;  2XCG A;  2ARD A;  1PBC A;  4GCM A;  2V3A A;  4ZCC A;  5M0Z A;  2OLO A;  4JDR A;  2Q0K A;  4EQR A;  2YQU A;  4JNA A;  1H82 A;  5KRQ A;  1BGJ A;  4REK A;  5J7X A;  1N4V A;  5J60 A;  2YG7 A;  2BXS A;  1OJC A;  3UCL A;  4B69 A;  2C67 A;  2ZBW A;  4WCT A;  1GTH A;  4YKG A;  4USQ A;  3SFE A;  4YXD A;  3P4P A;  3CMM A;  4DGK A;  1D4C A;  1E7P A;  1JEH A;  2OAM A;  3ALM A;  4C74 A;  3Q9T A;  2WPE A;  3AEG A;  4EIP A;  2BRY A;  4EIQ A;  1GRH A;  2VQ7 A;  1IUS A;  3KD9 A;  1O94 A;  3V3N A;  4DSH A;  1NEK A;  2BAC A;  2R4J A;  4JN9 A;  4GDE A;  5EB5 A;  5DBJ A;  2YLS A;  1DJQ A;  1MOK A;  2VVM A;  3BHK A;  3FPZ A;  2VQB A;  3EF6 A;  4BK3 A;  1IUV A;  1Y56 B;  4OPD A;  4Y4M A;  4XWR A;  4DSG A;  1LQT A;  1D4D A;  3DJE A;  5BUK A;  1E1K A;  2IVD A;  4NEW A;  2YLR A;  3H4K A;  4H7U A;  1H83 A;  4OPG A;  2F5Z A;  1PXA A;  4CNJ A;  1P2E A;  3GRS A;  1GRB A;  4Z24 A;  1L9E A;  4IA5 A;  4K5S A;  5FMH A;  4B63 A;  3GYJ A;  1IUX A;  2GAH B;  1VG0 A;  2ZZC A;  3CPI G;  4H4X A;  2H89 A;  3LZW A;  4GR1 A;  1B8S A;  3COX A;  3AE5 A;  1GEU A;  2ACZ A;  2YVF A;  1CJC A;  2GV8 A;  1FEC A;  2X3N A;  2YR4 A;  4HA6 A;  2E1M A;  5FS8 A;  1XDI A;  1FL2 A;  4CRT A;  5HY5 A;  4GF7 A;  1L0V A;  1LVL A;  1CJ2 A;  3GRT A;  2QA1 A;  1JNR A;  3OC4 A;  1M6I A;  3AE2 A;  1NPX A;  3NLC A;  5FS6 A;  4YSY A;  2GQF A;  1H6V A;  3Q6J A;  1RP0 A;  3GDN A;  1JRX A;  1PN0 A;  1F6M A;  2VVL A;  4CY6 A;  4I58 A;  1PJ5 A;  1BZL A;  2R9Z A;  4C77 A;  5U1O A;  3QFA A;  4N9X A;  1N4W A;  4CY8 A;  2R4E A;  4O5U A;  1DOC A;  3QSM A;  4O5Q A;  5ER0 A;  2BCG G;  4K8D A;  2BK4 A;  5LV9 A;  4AOS A;  1F8W A;  2TMD A;  4D03 A;  2YG4 A;  1PS9 A;  2GMJ A;  1KSS A;  5KOX A;  1FOH A;  4BV6 A;  1DJN A;  3CPJ G;  3QVP A;  3QFB A;  1Y0P A;  4H2P A;  1TDO A;  2B9X A;  2B76 A;  1E1N A;  1PHH A;  2GR3 A;  4FK1 C;  4JY3 A;  3BNU A;  1NG4 A;  1OJ9 A;  2ZZ0 A;  2YLT A;  2OLN A;  1D4E A;  3SZW A;  4A6N B;  3SX6 A;  2GAG B;  1COY A;  1CC6 A;  1JRY A;  1ZP0 A;  4ADW A;  4H2R A;  4U2L A;  1DNC A;  2BS2 A;  3KU9 A;  1K4Q A;  3DGH A;  3CGB A;  1K0L A;  3SXI A;  4ZN0 A;  3C4A A;  4JY2 A;  1OJA A;  1RYI A;  1ZX9 A;  3BI5 A;  1TYT A;  3BI4 A;  4AT2 A;  4A65 A;  4YSZ A;  1GTE A;  3HYV A;  3ITJ A;  3KPK A;  3T2K A;  4NWZ A;  3URH A;  3ZYX A;  3UKP A;  3F8P A;  2CDU A;  1EL5 A;  1XHC A;  2WQY A;  4BK2 A;  1BGN A;  1B37 A;  3KKJ A;  4Z25 A;  5KVI A;  4H4Y A;  1H81 A;  5TR3 A;  3SZ0 A;  5JCN A;  1PBE A;  3ALJ A;  3GSI A;  3CNT A;  2CFY A;  4J2W A;  1D5T A;  1QO8 A;  1JOA A;  3AEE A;  2YLX A;  4USR A;  3IF9 A;  1BWC A;  4OPT A;  3PVC A;  5U63 A;  1O95 A;  2BCP A;  3NN0 X;  2A8X A;  1H7W A;  3UP4 A;  2XLT A;  3S5W A;  2BK5 A;  2I0Z A;  3HYX A;  2BXR A;  2WDV A;  1YQ3 A;  2BC1 A;  1P2H A;  3LB8 A;  3T0K A;  1F3P A;  3NYE A;  3AD8 B;  2FJB A;  4K5R A;  4TM3 A;  4AT0 A;  3FMW A;  5KMR A;  4U8J A;  2XFP A;  3VRB A;  3UTG A;  3ATR A;  1EBD A;  4EMW A;  1N4U A;  2AQJ A;  1O5W A;  1LTX R;  1F8R A;  3DME A;  1RSG A;  1JRZ A;  4H50 A;  4H2N A;  4JQ9 A;  3SQP A;  3K7M X;  2XLP A;  4AP1 A;  3P4Q A;  4BK1 A;  4Y4N A;  3BI2 A;  3NKS A;  2Y6R A;  3DK8 A;  3DH9 A;  2GRT A;  1E1L A;  3PO7 A;  2GF3 A;  3LOV A;  4OCG A;  1VQW A;  3CGC A;  5KMQ A;  3LZX A;  1ZMC A;  2QAE A;  3P9U A;  4B1B A;  5JCM A;  1ZKQ A;  3NK0 X;  2Z5Y A;  4C5O A;  4EM4 A;  3AE6 A;  3HZL A;  2XVI A;  3NGC X;  4G74 A;  2RGJ A;  4I59 A;  1FCD A;  1GRT A;  2H88 A;  4KX6 A;  1AOG A;  3AYI A;  2JKC A;  2GEW A;  1TDF A;  4UP3 A;  2BYB A;  2YLW A;  2Q0L A;  3LXD A;  1PJ7 A;  1M64 A;  4HB9 A;  3FG2 P;  4B67 A;  3UOX A;  4APN A;  3GDP A;  2XLU A;  2AR8 A;  2FBW A;  3DJD A;  4J57 A;  3FIM B;  4Z43 A;  3KPF A;  5IQ4 A;  3S61 A;  1PDH A;  2BA9 A;  3UOZ A;  3RED A;  4NTC A;  4GDP A;  3UKL A;  3VRA A;  5BVA A;  3EAN A;  4D04 A;  3AXB A;  3AEF A;  2WEU A;  5GSN A;  3NK1 X;  1QJD A;  3DK9 A;  3ISH A;  1S2Q A;  3BNM A;  3AEA A;  2XYO A;  3CGE A;  3AEC A;  3K30 A;  4H4V A;  4G73 A;  5FS9 A;  4IV9 A;  3AED A;  2UZZ A;  1D7L A;  2EQ6 A;  4U2S A;  2GVC A;  2VZ2 A;  1ONF A;  4H4Q A;  3UTE A;  2GR2 A;  1DXL A;  2BS3 A;  2C76 A;  2GR1 A;  3AEB A;  4B68 A;  2DKH A;  2WOV A;  3NYF A;  3AE8 A;  4MJW A;  4X4J A;  2B9W A;  2X8H A;  3D8X A;  4II2 A;  1E1M A;  3IC9 A;  3DGZ A;  2EQ8 A;  2B7R A;  2CVJ A;  2WOW A;  4LU6 A;  1DOB A;  1Y56 A;  4M52 A;  1LJ1 A;  1H7X A;  5KWF A;  2IID A;  4H4T A;  4YTN A;  4OVI A;  5KOW A;  4U8N A;  3NYC A;  4NNJ A;  1ZOV A;  5BRT A;  1YQZ A;  4RG3 A;  2JAE A;  4LA1 A;  2B7S A;  1L9D A;  1H86 A;  4NZH A;  3AD7 B;  3RP7 A;  4NEV A;  2C66 A;  5U25 A;  2J3N A;  2YVG A;  5JCL A;  2BAB A;  2IVE A;  2FJD A;  5L46 A;  2YVJ A;  4OPC A;  2NPX A;  2VOU A;  3CNP A;  3T37 A;  4U8O A;  2YR5 A;  4IVM B;  3I6D A;  1ZOY A;  3JSK A;  2WP6 A;  3ATQ A;  2V5Z A;  3F8D A;  4A79 A;  1PXB A;  1NHP A;  3AWI A;  4U8L A;  3NG7 X;  1NAA A;  3VQR A;  2BK3 A;  3UKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...