1RP0A

Crystal structure of thi1 protein from arabidopsis thaliana
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiazole biosynthetic enzyme
publication title Structure of the thiazole biosynthetic enzyme THI1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Biosynthetic protein
total genus 95
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.4.2.60: Cysteine-dependent adenosine diphosphate thiazole synthase.
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01946 Thi4 Thi4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1rp0A02
1N1PA 1F3PA 2A8XA 4Y4LA 1B4VA 2V61A 5JCNA 1TYPA 3ABVA 3DJGX 1GRTA 2B7SA 3ALJA 4Z26A 1F6MA 3FPZA 4H50A 2C64A 1H7WA 4A65A 3DJEA 3NT6A 5IQ1A 2YVJA 3ICTA 3UP4A 2B76A 2GQWA 4OPDA 2XLTA 2XVEA 3IHMA 3P4RA 4TM3A 5LV9A 2CVJA 2VOUA 4P9SA 2H88A 3LB8A 4I58A 4YTMA 2BA9A 3LOVA 3K7QX 4AOXA 3UKQA 4JDRA 1PXBA 5U63A 4XWZA 5M0ZA 3NYEA 3AD8B 1CHUA 2IIDA 1DJNA 4HB9A 3UKKA 1Q1WA 2GF3A 2APGA 2IVDA 3AB1A 3AEEA 2BCGG 4Z43A 3P1WA 2WDQA 3AE9A 1JRYA 4BJZA 3NYFA 1YQ3A 3CN8A 5BRTA 1KNRA 2XDOA 4GCMA 4C74A 1JEHA 1IUTA 3OC4A 2R0CA 1NHSA 1Z6LA 2GMHA 2R4EA 1EL7A 1GRGA 1RYIA 4WCTA 1GETA 4U8KA 1S3EA 4BJYA 2CULA 1FEBA 3UKHA 3GWDA 3KA7A 4GUVA 3K30A 5J60A 2VRLA 1NENA 1VRQB 1XANA 2BK4A 3BHFA 3EF6A 4YSYA 3AE5A 3JSKA 1ZMDA 4H7UA 1XPQA 2BS2A 3AECA 3V3NA 3B3RA 2GAHB 1DNCA 3NTDA 2WPEA 3DK8A 2JKCA 5EOWA 2EQ9A 1E1LA 4A7AA 1LV0A 1E7PA 4CY6A 5KXJA 1NPXA 1F8WA 3QJ4A 1COYA 3P4QA 4TM0A 4J56A 2JB1A 1DOEA 1E1KA 1RP0A 2TPRA 4K2XA 1GERA 2XFOA 2BC0A 3AEAA 1L9DA 1CF3A 3NKSA 3D8XA 5HYMA 3ADAB 3AEGA 4BK3A 1GT8A 2VRMA 4RG3A 3CIRA 3Q6JA 1GRFA 3NH3X 5KOWA 5JCMA 4CBQA 1NHRA 1TDFA 3Q9TA 2XFQA 3AWIA 4A79A 1H86A 1GREA 3NK1X 4A6NA 1LJ1A 1K0JA 1O5WA 2QA1A 1D4EA 2WPFA 1LQTA 2RABA 1F8RA 3QSEA 2YR4A 3WE0A 2R46A 3KPFA 4DSGA 3DK4A 1E6EA 2XVJA 3NGCX 1QJDA 3CGEA 1K4QA 3UKFA 2OAMA 2VVMA 1TDOA 1MXTA 4JNAA 2ARDA 3RP6A 1CC6A 1CBOA 5JCKA 4H4WA 4B63A 1ELIA 2YLWA 2R0GA 1JRZA 4Y4NA 3NN0X 4UDPA 1EBDA 1ZMCA 4A6NB 4K5RA 2WP5A 1B8SA 1TDKA 2C3DA 1OJDA 2V6OA 2CFYA 3H8IA 4OPCA 4X9MA 2YLTA 3VRDB 2BS3A 2JAEA 2ZBWA 3AE7A 4OPTA 4FDCB 2X8HA 2GB0A 2OLNA 1PJ7A 3GSIA 3T37A 5L46A 3R9UA 3AEBA 3F8PA 3QSMA 4H4YA 4JY3A 3BNMA 3C4AA 4IVMB 3VR9A 3UP5A 5BULA 3QVPA 5JCLA 3GYIA 2FJEA 4Z24A 1GEUA 3CNJA 3URHA 2C76A 4TLXA 2H89A 1BF3A 3CTYA 3KVEA 1D5TA 1PBEA 3PS9A 5ER0A 2BC1A 1KSUA 4YTNA 1PBDA 1E1MA 1FEAA 1P2HA 1F8SA 4KPRA 2WBAA 1Q9IA 1H82A 2WHDA 3P9UA 2WU2A 3KD9A 2E5VA 2YG4A 3KU9A 3DGZA 5C3JA 3UCLA 1D7LA 1TYTA 4XWRA 1ZOVA 2YM2A 1VG0A 4WX1A 1FL2A 2ZZ0A 4O5UA 2YQUA 3FMWA 3GD3A 4GF7A 1L0VA 4M52A 2XFNA 1CC2A 2YG3A 4U8IA 3NNEA 4J34A 3LZXA 1NAAA 1X31B 2O9ZA 3CPHG 1E1NA 4FX9A 4H2QA 4H4TA 5HY5A 4NTCA 4Z44A 4DGKA 4YTPA 3LXDA 4C5OA 1GTEA 1PJ6A 2GMJA 3IWAA 3KKJA 1CJCA 4Z2TA 1OJCA 1B5QA 3CGDA 1GESA 3NYCA 4YT0A 2XFPA 1O95A 4BV6A 2XLPA 1NDAA 4J57A 1EL8A 2WP6A 3GMBA 3NG7X 4LA1A 1LVLA 2Y6RA 3UOXA 4PABA 2OA1A 1IUWA 1PBFA 2NPXA 4JNQA 4K22A 4X9NA 2E1MA 3ITJA 1ZK7A 3H4KA 4YSXA 3AE2A 2C67A 3I3LA 4H2RA 3V3OA 5DBJA 4YKGA 5FS6A 1CJ3A 1PN0A 4EQXA 1PJ5A 3ATQA 2C72A 4C3XA 4TLZA 1Y56A 1TDEA 2YLSA 4AT2A 1DJQA 4U2TA 2C66A 1YKJA 4H4QA 4USQA 4B68A 3AE4A 3ICSA 2XVFA 3LZWA 2NVKX 1GTHA 2PHHA 4ADWA 1V59A 2V60A 1EL9A 1REOA 3LADA 1ZOYA 1FCDA 3AXBA 3GMCA 4FK1C 4OPGA 4Y4MA 4AT0A 4UDRA 2YM1A 2PYXA 1JOAA 4IA5A 4U8LA 4EMIA 3SQPA 5KOXA 1PHHA 2F5ZA 4MJWA 4Z2RA 3NN6X 3UTHA 3O0HA 3P4SA 4ICYA 3ZYXA 1QO8A 1GRBA 1KSSA 2RGHA 3QSSA 2Z5XA 5CQFA 1NG3A 4NEVA 1PXAA 1Y56B 4H4RA 1ZKQA 3FIMB 4ECHA 2ZZCA 2GR2A 1YY5A 2B9YA 1Q1RA 4PAAA 3CPIG 4BK2A 4X4JA 1BGJA 4I59A 3UKAA 5EBKA 1MO9A 1PBBA 1IJHA 2WDVA 2WESA 4B69A 3NIXA 4C77A 3KLJA 2OALA 2X8GA 1BKWA 4NEWA 5IQ4A 1DODA 1ZX9A 3I6DA 3LJPA 1GSNA 3G5SA 3PO7A 1GRAA 1JU2A 3G5RA 4ZCDA 3C96A 3SFDA 1W4XA 3RHAA 1N4WA 2JB3A 4U8JA 2V3AA 3VQRA 4B1BA 4YXDA 4H2PA 3UOZA 4APNA 4N9XA 1XHCA 1VDCA 5GSNA 2AAQA 3AYLA 1JRXA 2OLOA 2YAUA 4EIPA 3CNPA 4OPUA 5C2TA 3FBSA 4CRTA 5FMHA 1LTXR 2R9ZA 2B9XA 4U2SA 3NRNA 2BXRA 2JBVA 2FJAA 4D03A 3BNUA 2VQBA 3S5WA 1L9EA 2GV8A 4KX6A 3V76A 3DGHA 1NEKA 4H4SA 5GRTA 1BWCA 2X3NA 4K5SA 3H8LA 4OPIA 2VVLG 2WP9A 3IC9A 3OZ2A 1M64A 3VRBA 1ZY8A 1GNDA 3COXA 2YVFA 4GRTA 4EIQA 3NTAA 1YQZA 3CNTA 2WDRA 3FG2P 2AR8A 3AE3A 4AP1A 4DNAA 3ALLA 3GRSA 4EM3A 3UTFA 1S3BA 5JCIA 3REDA 3D1CA 3GYJA 1CC4A 2AQJA 2YWLA 3GD4A 4ZCCA 2ZZBA 1IUXA 4D04A 3AYIA 4AP3A 2QA2A 1CL0A 2XFUA 4EQSA 1IUVA 1KF6A 2VZ2A 5HXIA 2BCPA 3RP7A 3AE6A 2BACA 2R4JA 4BURA 2C70A 2YG6A 2JB2A 1DXLA 1LQUA 4Z2UA 2GQFA 5M10A 1OJAA 4CY8A 4U2LA 1E39A 3AE8A 3L8KA 1CJ4A 4U8OA 5KRQA 1GALA 3UTEA 4OCGA 1K0LA 2XVIA 4J31A 5HHFA 1ZDLA 3G5QA 3UKPA 5FS7A 3EAOA 3E1TA 4YWOA 1VQWA 1D4DA 3CNSA 4ZN0A 1GPEA 1BGNA 1H84A 2B9WA 3AEDA 4IV9A 2V3BA 3IHGA 2E4GA 2WOVA 2WPCA 3GWFA 3SGLA 2FJDA 2Q7VA 1B37A 5CKUA 1S2YA 2XLSA 1LPFA 4J2WA 4A99A 1GOSA 2WETA 1NHQA 1Y0PA 2C75A 4J36A 4A9WA 3II4A 3B6DA 3K7TA 2TMDA 5U25A 3EANA 1ONFA 4B66A 1PXCA 2HQMA 2BK3A 3CGCA 3ZDNA 1NHPA 4FK1A 4USRA 3UOVA 4EMWA 1H7XA 4JQ9A 2GEWA 2W0HA 1GV4A 4CNKA 3QFBA 2Q6UA 3CNDA 4TM4A 3L1RA 4O5QA 3DJDA 5FS9A 4TM1A 5KVIA 3UKLA 3ALMA 5EB5A 1D7YA 3GDPA 1RSGA 1N4UA 1SEZA 3ATRA 3HZLA 1GRHA 2DKIA 2RGOA 2X99A 5KVHA 5KWFA 1QLBA 3ICRA 2A87A 1K0IA 2CDUA 2GVCA 4B67A 4RSLA 4LU6A 1JNRA 5EB4A 2GH5A 3QVRA 3NK2X 4IVOB 5TR3A 1AOGA 2I0ZA 4NZHA 2V5ZA 4YSHA 2XLRA 3EPTA 3DMEA 4YKFA 3RNMA 2Z5YA 2YLZA 1FOHA 2XYOA 4H4XA 2Q0LA 2X8CA 3IF9A 4REKA 2YR6A 2GR0A 3NHOX 4EMJA 1ZP0A 3UOYA 3BI2A 3UTGA 4B65A 3DA1A 4RG4A 2C65A 5IPYA 2UZZA 4BK1A 3SFEA 4OPLA 2FBWA 1KNPA 3BI5A 4JY2A 4NTEA 4UDQA 4GDPA 3M12A 1HYUA 4H4PA 2WS3A 2XCGA 1UKVG 2R45A 1NG4A 1D4CA 2GRTA 2BXSA 1OJ9A 2YG5A 2YLXA 4U8MA 4K7ZA 2YLRA 1TRBA 2BYBA 2J3NA 4C3YA 4CNJA 1H81A 1XDIA 4EM4A 3GRTA 2FJBA 5FS8A 1O94A 4DSHA 4H2NA 4OVIA 1OJTA 1PDHA 1H83A 1PBCA 2C73A 2YG7A 3AD9B 3DK9A 1IUSA 2ACZA 2R0PA 2BK5A 3CPJG 1GXFA 2YVGA 4NTDA 2WQYA 2QCUA 4IA6A 2X50A 4EQWA 1S2QA 2XLUA 2QAEA 2BS4A 2WEUA 3DH9A 3BI4A 4A5LA 2Q0KA 2DKHA 3AYJA 1M6IA 2WOWA 2WU5A 3RP8A 1BZLA 2EQ7A 4CCRA 3M0OA 3M13A 3BHKA 1FECA 4U8PA 2Y6QA 4GR1A 4JN9A 3VRAA 1JNZA 1VG9A 3AE1A 1MOKA 3ISHA 3NK0X 4K8DA 4J33A 1L9CA 4U8NA 4LIIA 4E0VA 5BUKA 3VR8A 1N4VA 2EQ6A 4YSZA 2EQ8A 3C4NA 1DOBA 2GAGB 4GDEA 2WOIA 2IVEA 4H4UA 1PS9A 1H6VA 4CCQA 1P2EA 2B7RA 2C7GA 2VQ7A 3PVCA 3DJJA 4AOSA 4EQRA 4Z25A 1EL5A 3SM8A 4XXGA 3F8RA 2JK6A 5U1OA 2XVHA 2RGJA 1CJ2A 1KFYA 2VVLA 3P4PA 1TDNA 2GR3A 1IUUA 4H4VA 1KDGA 5J7XA 3QFAA 5BVAA 3NLCA 2YR5A 4H4ZA 3GDNA 2A89A 3S61A 2C3CA 1YQ4A 4HA6A 4UP3A 1DOCA 3CGBA 3F8DA 4B64A 2BABA 3K7MX 3AEFA 2GR1A 3AD7B
chains in the Genus database with same CATH superfamily
1N1PA 1F3PA 2A8XA 4Y4LA 1B4VA 2V61A 5JCNA 1TYPA 3ABVA 3DJGX 1GRTA 2B7SA 4GAVA 3ALJA 4Z26A 1F6MA 3FPZA 4H50A 2C64A 1H7WA 4A65A 3DJEA 3NT6A 5IQ1A 2YVJA 3ICTA 3UP4A 2B76A 2GQWA 4OPDA 2XLTA 2XVEA 3IHMA 3P4RA 4TM3A 5LV9A 2CVJA 2VOUA 4P9SA 2H88A 3LB8A 4I58A 4YTMA 2BA9A 3LOVA 3K7QX 4AOXA 3UKQA 4JDRA 3SY4A 1PXBA 5U63A 4XWZA 5M0ZA 3NYEA 3AD8B 1CHUA 2IIDA 1DJNA 4HB9A 3UKKA 1Q1WA 2GF3A 2APGA 2IVDA 3AB1A 3AEEA 2BCGG 4Z43A 3P1WA 2WDQA 3AE9A 1JRYA 4BJZA 3NYFA 1YQ3A 3CN8A 3T2KA 1KNRA 2XDOA 4GCMA 4C74A 5BRTA 1JEHA 1IUTA 3OC4A 2R0CA 1NHSA 1Z6LA 2GMHA 2R4EA 1EL7A 1GRGA 1RYIA 4WCTA 1GETA 4U8KA 1S3EA 4BJYA 2CULA 1FEBA 3UKHA 3GWDA 3KA7A 4GUVA 3K30A 5J60A 2VRLA 1NENA 1VRQB 1XANA 2BK4A 3BHFA 3EF6A 4YSYA 4NWZA 3AE5A 3JSKA 1ZMDA 4H7UA 1XPQA 2BS2A 4G6GA 3AECA 3V3NA 3B3RA 2GAHB 1DNCA 3NTDA 2WPEA 3DK8A 2JKCA 5EOWA 2EQ9A 1E1LA 4A7AA 1LV0A 1E7PA 4CY6A 5KXJA 1NPXA 1F8WA 3QJ4A 1COYA 2BRAA 3P4QA 4TM0A 4J56A 2JB1A 1DOEA 1E1KA 1RP0A 2TPRA 4K2XA 1GERA 2XFOA 2BC0A 3AEAA 1L9DA 1CF3A 3NKSA 3D8XA 5HYMA 3ADAB 3AEGA 4BK3A 1GT8A 2VRMA 4RG3A 3CIRA 3Q6JA 1GRFA 3NH3X 5KOWA 5JCMA 4CBQA 1NHRA 1TDFA 3Q9TA 2XFQA 3AWIA 4A79A 1H86A 3SZWA 1GREA 3NK1X 4A6NA 1LJ1A 1K0JA 1O5WA 2QA1A 1D4EA 4G6HA 2WPFA 1LQTA 2RABA 1F8RA 3QSEA 2YR4A 3WE0A 2R46A 3KPFA 4DSGA 3DK4A 1E6EA 2XVJA 3NGCX 1QJDA 3CGEA 1K4QA 3UKFA 2OAMA 2VVMA 1TDOA 1MXTA 4JNAA 2ARDA 3RP6A 1CC6A 1CBOA 5JCKA 4H4WA 4B63A 1ELIA 2YLWA 2R0GA 1JRZA 4Y4NA 3NN0X 4UDPA 1EBDA 1ZMCA 4A6NB 4K5RA 2WP5A 1B8SA 1TDKA 2C3DA 1OJDA 2V6OA 2CFYA 3H8IA 4OPCA 4X9MA 2YLTA 3VRDB 2BS3A 2JAEA 2ZBWA 3AE7A 4OPTA 4FDCB 3SXIA 2X8HA 2GB0A 2OLNA 1PJ7A 3GSIA 3T37A 5L46A 3R9UA 3AEBA 3F8PA 3QSMA 4H4YA 4JY3A 3BNMA 3C4AA 4IVMB 3VR9A 3UP5A 5BULA 3QVPA 5JCLA 3GYIA 2FJEA 4Z24A 1GEUA 3CNJA 3URHA 2C76A 4TLXA 2H89A 1BF3A 3CTYA 3KVEA 1D5TA 1PBEA 4GAPA 3PS9A 5ER0A 2BC1A 1KSUA 4YTNA 1PBDA 1E1MA 1FEAA 1P2HA 1F8SA 4KPRA 2WBAA 1Q9IA 1H82A 2WHDA 3P9UA 2WU2A 3KD9A 2E5VA 2YG4A 3KU9A 3DGZA 5C3JA 3UCLA 1D7LA 1TYTA 4XWRA 1ZOVA 2YM2A 1VG0A 4WX1A 1FL2A 2ZZ0A 4O5UA 2YQUA 3FMWA 3GD3A 4GF7A 1L0VA 4M52A 2XFNA 1CC2A 2YG3A 4U8IA 5KMQA 3NNEA 4J34A 3LZXA 1NAAA 1X31B 2O9ZA 3CPHG 1E1NA 4FX9A 4H2QA 4H4TA 5HY5A 4NTCA 5KMSA 4Z44A 4DGKA 4YTPA 3LXDA 4C5OA 1GTEA 1PJ6A 2GMJA 3IWAA 3KKJA 1CJCA 4Z2TA 1OJCA 1B5QA 3CGDA 1GESA 3NYCA 3T0KA 3SZFA 4YT0A 2XFPA 1O95A 4BV6A 2XLPA 1NDAA 4J57A 1EL8A 2WP6A 3GMBA 3NG7X 4LA1A 1LVLA 2Y6RA 3UOXA 4PABA 2OA1A 1IUWA 1PBFA 2NPXA 4JNQA 4K22A 4X9NA 2E1MA 3ITJA 1ZK7A 3H4KA 4YSXA 3AE2A 2C67A 3I3LA 4H2RA 3V3OA 5DBJA 4YKGA 5FS6A 1CJ3A 1PN0A 4EQXA 1PJ5A 3ATQA 2C72A 4C3XA 4II2A 4TLZA 1Y56A 1TDEA 2YLSA 3SYIA 4AT2A 1DJQA 4U2TA 2C66A 1YKJA 4H4QA 4USQA 4B68A 3AE4A 3ICSA 2XVFA 3LZWA 3HYWA 2NVKX 1GTHA 2PHHA 4ADWA 1V59A 2V60A 1EL9A 1REOA 3LADA 1ZOYA 1FCDA 3AXBA 3GMCA 4FK1C 4OPGA 4Y4MA 4AT0A 4UDRA 2YM1A 2PYXA 1JOAA 4IA5A 4U8LA 4EMIA 3SQPA 5KOXA 1PHHA 2F5ZA 3HYXA 4MJWA 4Z2RA 3NN6X 3UTHA 3O0HA 3P4SA 4ICYA 3ZYXA 3T2YA 1QO8A 1GRBA 1KSSA 2RGHA 3QSSA 2Z5XA 5CQFA 1NG3A 4NEVA 1PXAA 1Y56B 4H4RA 1ZKQA 3FIMB 4ECHA 2ZZCA 2GR2A 1YY5A 2B9YA 1Q1RA 4PAAA 3CPIG 3T31A 4BK2A 4X4JA 1BGJA 4I59A 3UKAA 5EBKA 1MO9A 1PBBA 1IJHA 2WDVA 2WESA 4B69A 3NIXA 4C77A 3KLJA 2OALA 2X8GA 1BKWA 4NEWA 5IQ4A 1DODA 1ZX9A 3I6DA 3LJPA 1GSNA 3G5SA 3PO7A 1GRAA 1JU2A 3G5RA 4ZCDA 3C96A 3SFDA 1W4XA 3RHAA 1N4WA 2JB3A 4U8JA 2V3AA 3VQRA 4B1BA 4YXDA 4H2PA 3UOZA 4APNA 4N9XA 1XHCA 1VDCA 5GSNA 2AAQA 3AYLA 1JRXA 2OLOA 2YAUA 4EIPA 3CNPA 4OPUA 5C2TA 3FBSA 4CRTA 5FMHA 1LTXR 2R9ZA 2B9XA 4U2SA 3NRNA 2BXRA 2JBVA 2FJAA 4D03A 3BNUA 2VQBA 3S5WA 1L9EA 3T14A 2GV8A 4KX6A 3V76A 3SZ0A 3DGHA 4G74A 1NEKA 4H4SA 4II3A 5GRTA 3T2ZA 1BWCA 2X3NA 4K5SA 3H8LA 4OPIA 2VVLG 2WP9A 3IC9A 3OZ2A 1M64A 3VRBA 1ZY8A 1GNDA 3COXA 2YVFA 4GRTA 4EIQA 3NTAA 1YQZA 3CNTA 2WDRA 3FG2P 2AR8A 3AE3A 4AP1A 4DNAA 3ALLA 3GRSA 4EM3A 3UTFA 1S3BA 5JCIA 3REDA 3D1CA 3GYJA 1CC4A 2AQJA 2YWLA 3GD4A 4ZCCA 2ZZBA 1IUXA 4D04A 3AYIA 4AP3A 2QA2A 1CL0A 2XFUA 3GYXA 4EQSA 1IUVA 1KF6A 2VZ2A 5HXIA 2BCPA 3RP7A 3AE6A 2BACA 2R4JA 4BURA 2C70A 2YG6A 2JB2A 1DXLA 1LQUA 4Z2UA 2GQFA 5M10A 1OJAA 4CY8A 4U2LA 1E39A 3AE8A 3L8KA 1CJ4A 4U8OA 5KRQA 1GALA 3UTEA 4OCGA 1K0LA 2XVIA 4J31A 5HHFA 1ZDLA 3G5QA 3UKPA 5FS7A 3EAOA 3E1TA 4YWOA 1VQWA 1D4DA 3CNSA 4ZN0A 1GPEA 1BGNA 1H84A 2B9WA 3AEDA 4IV9A 2V3BA 3IHGA 2E4GA 2WOVA 2WPCA 3GWFA 3SGLA 2FJDA 2Q7VA 1B37A 5CKUA 1S2YA 2XLSA 1LPFA 4J2WA 4A99A 1GOSA 2WETA 1NHQA 1Y0PA 2C75A 4J36A 4A9WA 3II4A 3B6DA 3K7TA 2TMDA 5U25A 3EANA 1ONFA 4B66A 1PXCA 2HQMA 2BK3A 3CGCA 3ZDNA 5KMPA 1NHPA 4FK1A 4USRA 3UOVA 4EMWA 1H7XA 4JQ9A 2GEWA 2W0HA 1GV4A 4CNKA 3QFBA 2Q6UA 2C4CA 3CNDA 4TM4A 3L1RA 4O5QA 3DJDA 5FS9A 4TM1A 5KVIA 3UKLA 3ALMA 5EB5A 1D7YA 3GDPA 1RSGA 1N4UA 1SEZA 3ATRA 3HZLA 1GRHA 2DKIA 2RGOA 2X99A 5KVHA 5KWFA 1QLBA 3ICRA 2A87A 1K0IA 2CDUA 2GVCA 4B67A 4RSLA 4LU6A 1JNRA 5EB4A 2GH5A 3QVRA 3NK2X 4IVOB 5TR3A 1AOGA 2I0ZA 4NZHA 2V5ZA 4YSHA 2XLRA 3EPTA 3DMEA 4YKFA 3RNMA 2Z5YA 2BRYA 2YLZA 1FOHA 2XYOA 4H4XA 2Q0LA 2X8CA 3IF9A 4REKA 2YR6A 2GR0A 3NHOX 4EMJA 1ZP0A 3UOYA 3BI2A 3UTGA 4G73A 4B65A 3DA1A 4RG4A 2C65A 5IPYA 2UZZA 5KNLA 4BK1A 3SFEA 4OPLA 2FBWA 1KNPA 3BI5A 4JY2A 4NTEA 4UDQA 4GDPA 3M12A 1HYUA 4H4PA 2WS3A 2XCGA 3HYVA 1UKVG 2R45A 1NG4A 1D4CA 2GRTA 2BXSA 1OJ9A 2YG5A 2YLXA 4U8MA 4K7ZA 2YLRA 1TRBA 2BYBA 2J3NA 4C3YA 4CNJA 1H81A 1XDIA 4EM4A 3GRTA 2FJBA 5FS8A 1O94A 4DSHA 4H2NA 4OVIA 1OJTA 1PDHA 1H83A 1PBCA 2C73A 2YG7A 3AD9B 3DK9A 1IUSA 2ACZA 2R0PA 2BK5A 3CPJG 3KPKA 1GXFA 2YVGA 4NTDA 2WQYA 2QCUA 4IA6A 2X50A 4EQWA 1S2QA 2XLUA 2QAEA 2BS4A 2WEUA 3DH9A 3BI4A 4A5LA 2Q0KA 2DKHA 3CMMA 3AYJA 1M6IA 2WOWA 2WU5A 3RP8A 3SX6A 1BZLA 2EQ7A 4CCRA 3M0OA 3M13A 4NNJA 3BHKA 1FECA 4U8PA 2Y6QA 4GR1A 4JN9A 3VRAA 1JNZA 1VG9A 3AE1A 1MOKA 3ISHA 3NK0X 4K8DA 4J33A 1L9CA 4U8NA 3SZCA 4LIIA 4E0VA 5BUKA 4G9KA 3VR8A 1N4VA 2EQ6A 4YSZA 2EQ8A 3C4NA 1DOBA 2GAGB 4GDEA 2WOIA 2IVEA 5KMRA 4H4UA 1PS9A 1H6VA 4CCQA 1P2EA 2B7RA 2C7GA 2VQ7A 3PVCA 3DJJA 4AOSA 4EQRA 4Z25A 1EL5A 3SM8A 4XXGA 3F8RA 2JK6A 5U1OA 2XVHA 2RGJA 1CJ2A 1KFYA 2VVLA 3P4PA 1TDNA 2GR3A 1IUUA 4H4VA 1KDGA 5J7XA 3QFAA 5BVAA 3NLCA 2YR5A 4H4ZA 3GDNA 2A89A 3S61A 2C3CA 1YQ4A 4HA6A 4UP3A 1DOCA 3CGBA 3F8DA 4B64A 2BABA 3K7MX 3AEFA 2GR1A 3AD7B
chains in the Genus database with same CATH topology
1N1PA 1F3PA 2A8XA 4Y4LA 1B4VA 2V61A 5JCNA 1TYPA 3ABVA 3DJGX 1GRTA 2B7SA 4GAVA 3ALJA 4Z26A 1F6MA 3FPZA 4H50A 2C64A 1H7WA 4A65A 3DJEA 3NT6A 5IQ1A 2YVJA 3ICTA 3UP4A 2B76A 2GQWA 4OPDA 2XLTA 2XVEA 3IHMA 3P4RA 4TM3A 5LV9A 2CVJA 2VOUA 4P9SA 2H88A 3LB8A 4I58A 4YTMA 2BA9A 3LOVA 3K7QX 4AOXA 3UKQA 4JDRA 3SY4A 1PXBA 5U63A 4XWZA 5M0ZA 3NYEA 3AD8B 1CHUA 2IIDA 1DJNA 4HB9A 3UKKA 1Q1WA 2GF3A 2APGA 2IVDA 3AB1A 3AEEA 2BCGG 4Z43A 3P1WA 2WDQA 3AE9A 1JRYA 4BJZA 3NYFA 1YQ3A 3CN8A 3T2KA 1KNRA 2XDOA 4GCMA 4C74A 5BRTA 1JEHA 1IUTA 3OC4A 2R0CA 1NHSA 1Z6LA 2GMHA 2R4EA 1EL7A 1GRGA 1RYIA 4WCTA 1GETA 4U8KA 1S3EA 4BJYA 2CULA 1FEBA 3UKHA 3GWDA 3KA7A 4GUVA 3K30A 5J60A 2VRLA 1NENA 1VRQB 1XANA 2BK4A 3BHFA 3EF6A 4YSYA 4NWZA 3AE5A 3JSKA 1ZMDA 4H7UA 1XPQA 2BS2A 4G6GA 3AECA 3V3NA 3B3RA 2GAHB 1DNCA 3NTDA 2WPEA 3DK8A 2JKCA 5EOWA 2EQ9A 1E1LA 4A7AA 1LV0A 1E7PA 4CY6A 5KXJA 1NPXA 1F8WA 3QJ4A 1COYA 2BRAA 3P4QA 4TM0A 4J56A 2JB1A 1DOEA 1E1KA 1RP0A 2TPRA 4K2XA 1GERA 2XFOA 2BC0A 3AEAA 1L9DA 1CF3A 3NKSA 3D8XA 5HYMA 3ADAB 3AEGA 4BK3A 1GT8A 2VRMA 4RG3A 3CIRA 3Q6JA 1GRFA 3NH3X 5KOWA 5JCMA 4CBQA 1NHRA 1TDFA 3Q9TA 2XFQA 3AWIA 4A79A 1H86A 3SZWA 1GREA 3NK1X 4A6NA 1LJ1A 1K0JA 1O5WA 2QA1A 1D4EA 4G6HA 2WPFA 1LQTA 2RABA 1F8RA 3QSEA 2YR4A 3WE0A 2R46A 3KPFA 4DSGA 3DK4A 1E6EA 2XVJA 3NGCX 1QJDA 3CGEA 1K4QA 3UKFA 2OAMA 2VVMA 1TDOA 1MXTA 4JNAA 2ARDA 3RP6A 1CC6A 1CBOA 5JCKA 4H4WA 4B63A 1ELIA 2YLWA 2R0GA 1JRZA 4Y4NA 3NN0X 4UDPA 1EBDA 1ZMCA 4A6NB 4K5RA 2WP5A 1B8SA 1TDKA 2C3DA 1OJDA 2V6OA 2CFYA 3H8IA 4OPCA 4X9MA 2YLTA 3VRDB 2BS3A 2JAEA 2ZBWA 3AE7A 4OPTA 4FDCB 3SXIA 2X8HA 2GB0A 2OLNA 1PJ7A 3GSIA 3T37A 5L46A 3R9UA 3AEBA 3F8PA 3QSMA 4H4YA 4JY3A 3BNMA 3C4AA 4IVMB 3VR9A 3UP5A 5BULA 3QVPA 5JCLA 3GYIA 2FJEA 4Z24A 1GEUA 3CNJA 3URHA 2C76A 4TLXA 2H89A 1BF3A 3CTYA 3KVEA 1D5TA 1PBEA 4GAPA 3PS9A 5ER0A 2BC1A 1KSUA 4YTNA 1PBDA 1E1MA 1FEAA 1P2HA 1F8SA 4KPRA 2WBAA 1Q9IA 1H82A 2WHDA 3P9UA 2WU2A 3KD9A 2E5VA 2YG4A 3KU9A 3DGZA 5C3JA 3UCLA 1D7LA 1TYTA 4XWRA 1ZOVA 2YM2A 1VG0A 4WX1A 1FL2A 2ZZ0A 4O5UA 2YQUA 3FMWA 3GD3A 4GF7A 1L0VA 4M52A 2XFNA 1CC2A 2YG3A 4U8IA 5KMQA 3NNEA 4J34A 3LZXA 1NAAA 1X31B 2O9ZA 3CPHG 1E1NA 4FX9A 4H2QA 4H4TA 5HY5A 4NTCA 5KMSA 4Z44A 4DGKA 4YTPA 3LXDA 4C5OA 1GTEA 1PJ6A 2GMJA 3IWAA 3KKJA 1CJCA 4Z2TA 1OJCA 1B5QA 3CGDA 1GESA 3NYCA 3T0KA 3SZFA 4YT0A 2XFPA 1O95A 4BV6A 2XLPA 1NDAA 4J57A 1EL8A 2WP6A 3GMBA 3NG7X 4LA1A 1LVLA 2Y6RA 3UOXA 4PABA 2OA1A 1IUWA 1PBFA 2NPXA 4JNQA 4K22A 4X9NA 2E1MA 3ITJA 1ZK7A 3H4KA 4YSXA 3AE2A 2C67A 3I3LA 4H2RA 3V3OA 5DBJA 4YKGA 5FS6A 1CJ3A 1PN0A 4EQXA 1PJ5A 3ATQA 2C72A 4C3XA 4II2A 4TLZA 1Y56A 1TDEA 2YLSA 3SYIA 4AT2A 1DJQA 4U2TA 2C66A 1YKJA 4H4QA 4USQA 4B68A 3AE4A 3ICSA 2XVFA 3LZWA 3HYWA 2NVKX 1GTHA 2PHHA 4ADWA 1V59A 2V60A 1EL9A 1REOA 3LADA 1ZOYA 1FCDA 3AXBA 3GMCA 4FK1C 4OPGA 4Y4MA 4AT0A 4UDRA 2YM1A 2PYXA 1JOAA 4IA5A 4U8LA 4EMIA 3SQPA 5KOXA 1PHHA 2F5ZA 3HYXA 4MJWA 4Z2RA 3NN6X 3UTHA 3O0HA 3P4SA 4ICYA 3ZYXA 3T2YA 1QO8A 1GRBA 1KSSA 2RGHA 3QSSA 2Z5XA 5CQFA 1NG3A 4NEVA 1PXAA 1Y56B 4H4RA 1ZKQA 3FIMB 4ECHA 2ZZCA 2GR2A 1YY5A 2B9YA 1Q1RA 4PAAA 3CPIG 3T31A 4BK2A 4X4JA 1BGJA 4I59A 3UKAA 5EBKA 1MO9A 1PBBA 1IJHA 2WDVA 2WESA 4B69A 3NIXA 4C77A 3KLJA 2OALA 2X8GA 1BKWA 4NEWA 5IQ4A 1DODA 1ZX9A 3I6DA 3LJPA 1GSNA 3G5SA 3PO7A 1GRAA 1JU2A 3G5RA 4ZCDA 3C96A 3SFDA 1W4XA 3RHAA 1N4WA 2JB3A 4U8JA 2V3AA 3VQRA 4B1BA 4YXDA 4H2PA 3UOZA 4APNA 4N9XA 1XHCA 1VDCA 5GSNA 2AAQA 3AYLA 1JRXA 2OLOA 2YAUA 4EIPA 3CNPA 4OPUA 5C2TA 3FBSA 4CRTA 5FMHA 1LTXR 2R9ZA 2B9XA 4U2SA 3NRNA 2BXRA 2JBVA 2FJAA 4D03A 3BNUA 2VQBA 3S5WA 1L9EA 3T14A 2GV8A 4KX6A 3V76A 3SZ0A 3DGHA 4G74A 1NEKA 4H4SA 4II3A 5GRTA 3T2ZA 1BWCA 2X3NA 4K5SA 3H8LA 4OPIA 2VVLG 2WP9A 3IC9A 3OZ2A 1M64A 3VRBA 1ZY8A 1GNDA 3COXA 2YVFA 4GRTA 4EIQA 3NTAA 1YQZA 3CNTA 2WDRA 3FG2P 2AR8A 3AE3A 4AP1A 4DNAA 3ALLA 3GRSA 4EM3A 3UTFA 1S3BA 5JCIA 3REDA 3D1CA 3GYJA 1CC4A 2AQJA 2YWLA 3GD4A 4ZCCA 2ZZBA 1IUXA 4D04A 3AYIA 4AP3A 2QA2A 1CL0A 2XFUA 3GYXA 4EQSA 1IUVA 1KF6A 2VZ2A 5HXIA 2BCPA 3RP7A 3AE6A 2BACA 2R4JA 4BURA 2C70A 2YG6A 2JB2A 1DXLA 1LQUA 4Z2UA 2GQFA 5M10A 1OJAA 4CY8A 4U2LA 1E39A 3AE8A 3L8KA 1CJ4A 4U8OA 5KRQA 1GALA 3UTEA 4OCGA 1K0LA 2XVIA 4J31A 5HHFA 1ZDLA 3G5QA 3UKPA 5FS7A 3EAOA 3E1TA 4YWOA 1VQWA 1D4DA 3CNSA 4ZN0A 1GPEA 1BGNA 1H84A 2B9WA 3AEDA 4IV9A 2V3BA 3IHGA 2E4GA 2WOVA 2WPCA 3GWFA 3SGLA 2FJDA 2Q7VA 1B37A 5CKUA 1S2YA 2XLSA 1LPFA 4J2WA 4A99A 1GOSA 2WETA 1NHQA 1Y0PA 2C75A 4J36A 4A9WA 3II4A 3B6DA 3K7TA 2TMDA 5U25A 3EANA 1ONFA 4B66A 1PXCA 2HQMA 2BK3A 3CGCA 3ZDNA 5KMPA 1NHPA 4FK1A 4USRA 3UOVA 4EMWA 1H7XA 4JQ9A 2GEWA 2W0HA 1GV4A 4CNKA 3QFBA 2Q6UA 2C4CA 3CNDA 4TM4A 3L1RA 4O5QA 3DJDA 5FS9A 4TM1A 5KVIA 3UKLA 3ALMA 5EB5A 1D7YA 3GDPA 1RSGA 1N4UA 1SEZA 3ATRA 3HZLA 1GRHA 2DKIA 2RGOA 2X99A 5KVHA 5KWFA 1QLBA 3ICRA 2A87A 1K0IA 2CDUA 2GVCA 4B67A 4RSLA 4LU6A 1JNRA 5EB4A 2GH5A 3QVRA 3NK2X 4IVOB 5TR3A 1AOGA 2I0ZA 4NZHA 2V5ZA 4YSHA 2XLRA 3EPTA 3DMEA 4YKFA 3RNMA 2Z5YA 2BRYA 2YLZA 1FOHA 2XYOA 4H4XA 2Q0LA 2X8CA 3IF9A 4REKA 2YR6A 2GR0A 3NHOX 4EMJA 1ZP0A 3UOYA 3BI2A 3UTGA 4G73A 4B65A 3DA1A 4RG4A 2C65A 5IPYA 2UZZA 5KNLA 4BK1A 3SFEA 4OPLA 2FBWA 1KNPA 3BI5A 4JY2A 4NTEA 4UDQA 4GDPA 3M12A 1HYUA 4H4PA 2WS3A 2XCGA 3HYVA 1UKVG 2R45A 1NG4A 1D4CA 2GRTA 2BXSA 1OJ9A 2YG5A 2YLXA 4U8MA 4K7ZA 2YLRA 1TRBA 2BYBA 2J3NA 4C3YA 4CNJA 1H81A 1XDIA 4EM4A 3GRTA 2FJBA 5FS8A 1O94A 4DSHA 4H2NA 4OVIA 1OJTA 1PDHA 1H83A 1PBCA 2C73A 2YG7A 3AD9B 3DK9A 1IUSA 2ACZA 2R0PA 2BK5A 3CPJG 3KPKA 1GXFA 2YVGA 4NTDA 2WQYA 2QCUA 4IA6A 2X50A 4EQWA 1S2QA 2XLUA 2QAEA 2BS4A 2WEUA 3DH9A 3BI4A 4A5LA 2Q0KA 2DKHA 3CMMA 3AYJA 1M6IA 2WOWA 2WU5A 3RP8A 3SX6A 1BZLA 2EQ7A 4CCRA 3M0OA 3M13A 4NNJA 3BHKA 1FECA 4U8PA 2Y6QA 4GR1A 4JN9A 3VRAA 1JNZA 1VG9A 3AE1A 1MOKA 3ISHA 3NK0X 4K8DA 4J33A 1L9CA 4U8NA 3SZCA 4LIIA 4E0VA 5BUKA 4G9KA 3VR8A 1N4VA 2EQ6A 4YSZA 2EQ8A 3C4NA 1DOBA 2GAGB 4GDEA 2WOIA 2IVEA 5KMRA 4H4UA 1PS9A 1H6VA 4CCQA 1P2EA 2B7RA 2C7GA 2VQ7A 3PVCA 3DJJA 4AOSA 4EQRA 4Z25A 1EL5A 3SM8A 4XXGA 3F8RA 2JK6A 5U1OA 2XVHA 2RGJA 1CJ2A 1KFYA 2VVLA 3P4PA 1TDNA 2GR3A 1IUUA 4H4VA 1KDGA 5J7XA 3QFAA 5BVAA 3NLCA 2YR5A 4H4ZA 3GDNA 2A89A 3S61A 2C3CA 1YQ4A 4HA6A 4UP3A 1DOCA 3CGBA 3F8DA 4B64A 2BABA 3K7MX 3AEFA 2GR1A 3AD7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N1P A;  1F3P A;  2A8X A;  4Y4L A;  1B4V A;  2V61 A;  5JCN A;  1TYP A;  3ABV A;  3DJG X;  1GRT A;  2B7S A;  3ALJ A;  4Z26 A;  1F6M A;  3FPZ A;  4H50 A;  2C64 A;  1H7W A;  4A65 A;  3DJE A;  3NT6 A;  5IQ1 A;  2YVJ A;  3ICT A;  3UP4 A;  2B76 A;  2GQW A;  4OPD A;  2XLT A;  2XVE A;  3IHM A;  3P4R A;  4TM3 A;  5LV9 A;  2CVJ A;  2VOU A;  4P9S A;  2H88 A;  3LB8 A;  4I58 A;  4YTM A;  2BA9 A;  3LOV A;  3K7Q X;  4AOX A;  3UKQ A;  4JDR A;  1PXB A;  5U63 A;  4XWZ A;  5M0Z A;  3NYE A;  3AD8 B;  1CHU A;  2IID A;  1DJN A;  4HB9 A;  3UKK A;  1Q1W A;  2GF3 A;  2APG A;  2IVD A;  3AB1 A;  3AEE A;  2BCG G;  4Z43 A;  3P1W A;  2WDQ A;  3AE9 A;  1JRY A;  4BJZ A;  3NYF A;  1YQ3 A;  3CN8 A;  5BRT A;  1KNR A;  2XDO A;  4GCM A;  4C74 A;  1JEH A;  1IUT A;  3OC4 A;  2R0C A;  1NHS A;  1Z6L A;  2GMH A;  2R4E A;  1EL7 A;  1GRG A;  1RYI A;  4WCT A;  1GET A;  4U8K A;  1S3E A;  4BJY A;  2CUL A;  1FEB A;  3UKH A;  3GWD A;  3KA7 A;  4GUV A;  3K30 A;  5J60 A;  2VRL A;  1NEN A;  1VRQ B;  1XAN A;  2BK4 A;  3BHF A;  3EF6 A;  4YSY A;  3AE5 A;  3JSK A;  1ZMD A;  4H7U A;  1XPQ A;  2BS2 A;  3AEC A;  3V3N A;  3B3R A;  2GAH B;  1DNC A;  3NTD A;  2WPE A;  3DK8 A;  2JKC A;  5EOW A;  2EQ9 A;  1E1L A;  4A7A A;  1LV0 A;  1E7P A;  4CY6 A;  5KXJ A;  1NPX A;  1F8W A;  3QJ4 A;  1COY A;  3P4Q A;  4TM0 A;  4J56 A;  2JB1 A;  1DOE A;  1E1K A;  1RP0 A;  2TPR A;  4K2X A;  1GER A;  2XFO A;  2BC0 A;  3AEA A;  1L9D A;  1CF3 A;  3NKS A;  3D8X A;  5HYM A;  3ADA B;  3AEG A;  4BK3 A;  1GT8 A;  2VRM A;  4RG3 A;  3CIR A;  3Q6J A;  1GRF A;  3NH3 X;  5KOW A;  5JCM A;  4CBQ A;  1NHR A;  1TDF A;  3Q9T A;  2XFQ A;  3AWI A;  4A79 A;  1H86 A;  1GRE A;  3NK1 X;  4A6N A;  1LJ1 A;  1K0J A;  1O5W A;  2QA1 A;  1D4E A;  2WPF A;  1LQT A;  2RAB A;  1F8R A;  3QSE A;  2YR4 A;  3WE0 A;  2R46 A;  3KPF A;  4DSG A;  3DK4 A;  1E6E A;  2XVJ A;  3NGC X;  1QJD A;  3CGE A;  1K4Q A;  3UKF A;  2OAM A;  2VVM A;  1TDO A;  1MXT A;  4JNA A;  2ARD A;  3RP6 A;  1CC6 A;  1CBO A;  5JCK A;  4H4W A;  4B63 A;  1ELI A;  2YLW A;  2R0G A;  1JRZ A;  4Y4N A;  3NN0 X;  4UDP A;  1EBD A;  1ZMC A;  4A6N B;  4K5R A;  2WP5 A;  1B8S A;  1TDK A;  2C3D A;  1OJD A;  2V6O A;  2CFY A;  3H8I A;  4OPC A;  4X9M A;  2YLT A;  3VRD B;  2BS3 A;  2JAE A;  2ZBW A;  3AE7 A;  4OPT A;  4FDC B;  2X8H A;  2GB0 A;  2OLN A;  1PJ7 A;  3GSI A;  3T37 A;  5L46 A;  3R9U A;  3AEB A;  3F8P A;  3QSM A;  4H4Y A;  4JY3 A;  3BNM A;  3C4A A;  4IVM B;  3VR9 A;  3UP5 A;  5BUL A;  3QVP A;  5JCL A;  3GYI A;  2FJE A;  4Z24 A;  1GEU A;  3CNJ A;  3URH A;  2C76 A;  4TLX A;  2H89 A;  1BF3 A;  3CTY A;  3KVE A;  1D5T A;  1PBE A;  3PS9 A;  5ER0 A;  2BC1 A;  1KSU A;  4YTN A;  1PBD A;  1E1M A;  1FEA A;  1P2H A;  1F8S A;  4KPR A;  2WBA A;  1Q9I A;  1H82 A;  2WHD A;  3P9U A;  2WU2 A;  3KD9 A;  2E5V A;  2YG4 A;  3KU9 A;  3DGZ A;  5C3J A;  3UCL A;  1D7L A;  1TYT A;  4XWR A;  1ZOV A;  2YM2 A;  1VG0 A;  4WX1 A;  1FL2 A;  2ZZ0 A;  4O5U A;  2YQU A;  3FMW A;  3GD3 A;  4GF7 A;  1L0V A;  4M52 A;  2XFN A;  1CC2 A;  2YG3 A;  4U8I A;  3NNE A;  4J34 A;  3LZX A;  1NAA A;  1X31 B;  2O9Z A;  3CPH G;  1E1N A;  4FX9 A;  4H2Q A;  4H4T A;  5HY5 A;  4NTC A;  4Z44 A;  4DGK A;  4YTP A;  3LXD A;  4C5O A;  1GTE A;  1PJ6 A;  2GMJ A;  3IWA A;  3KKJ A;  1CJC A;  4Z2T A;  1OJC A;  1B5Q A;  3CGD A;  1GES A;  3NYC A;  4YT0 A;  2XFP A;  1O95 A;  4BV6 A;  2XLP A;  1NDA A;  4J57 A;  1EL8 A;  2WP6 A;  3GMB A;  3NG7 X;  4LA1 A;  1LVL A;  2Y6R A;  3UOX A;  4PAB A;  2OA1 A;  1IUW A;  1PBF A;  2NPX A;  4JNQ A;  4K22 A;  4X9N A;  2E1M A;  3ITJ A;  1ZK7 A;  3H4K A;  4YSX A;  3AE2 A;  2C67 A;  3I3L A;  4H2R A;  3V3O A;  5DBJ A;  4YKG A;  5FS6 A;  1CJ3 A;  1PN0 A;  4EQX A;  1PJ5 A;  3ATQ A;  2C72 A;  4C3X A;  4TLZ A;  1Y56 A;  1TDE A;  2YLS A;  4AT2 A;  1DJQ A;  4U2T A;  2C66 A;  1YKJ A;  4H4Q A;  4USQ A;  4B68 A;  3AE4 A;  3ICS A;  2XVF A;  3LZW A;  2NVK X;  1GTH A;  2PHH A;  4ADW A;  1V59 A;  2V60 A;  1EL9 A;  1REO A;  3LAD A;  1ZOY A;  1FCD A;  3AXB A;  3GMC A;  4FK1 C;  4OPG A;  4Y4M A;  4AT0 A;  4UDR A;  2YM1 A;  2PYX A;  1JOA A;  4IA5 A;  4U8L A;  4EMI A;  3SQP A;  5KOX A;  1PHH A;  2F5Z A;  4MJW A;  4Z2R A;  3NN6 X;  3UTH A;  3O0H A;  3P4S A;  4ICY A;  3ZYX A;  1QO8 A;  1GRB A;  1KSS A;  2RGH A;  3QSS A;  2Z5X A;  5CQF A;  1NG3 A;  4NEV A;  1PXA A;  1Y56 B;  4H4R A;  1ZKQ A;  3FIM B;  4ECH A;  2ZZC A;  2GR2 A;  1YY5 A;  2B9Y A;  1Q1R A;  4PAA A;  3CPI G;  4BK2 A;  4X4J A;  1BGJ A;  4I59 A;  3UKA A;  5EBK A;  1MO9 A;  1PBB A;  1IJH A;  2WDV A;  2WES A;  4B69 A;  3NIX A;  4C77 A;  3KLJ A;  2OAL A;  2X8G A;  1BKW A;  4NEW A;  5IQ4 A;  1DOD A;  1ZX9 A;  3I6D A;  3LJP A;  1GSN A;  3G5S A;  3PO7 A;  1GRA A;  1JU2 A;  3G5R A;  4ZCD A;  3C96 A;  3SFD A;  1W4X A;  3RHA A;  1N4W A;  2JB3 A;  4U8J A;  2V3A A;  3VQR A;  4B1B A;  4YXD A;  4H2P A;  3UOZ A;  4APN A;  4N9X A;  1XHC A;  1VDC A;  5GSN A;  2AAQ A;  3AYL A;  1JRX A;  2OLO A;  2YAU A;  4EIP A;  3CNP A;  4OPU A;  5C2T A;  3FBS A;  4CRT A;  5FMH A;  1LTX R;  2R9Z A;  2B9X A;  4U2S A;  3NRN A;  2BXR A;  2JBV A;  2FJA A;  4D03 A;  3BNU A;  2VQB A;  3S5W A;  1L9E A;  2GV8 A;  4KX6 A;  3V76 A;  3DGH A;  1NEK A;  4H4S A;  5GRT A;  1BWC A;  2X3N A;  4K5S A;  3H8L A;  4OPI A;  2VVL G;  2WP9 A;  3IC9 A;  3OZ2 A;  1M64 A;  3VRB A;  1ZY8 A;  1GND A;  3COX A;  2YVF A;  4GRT A;  4EIQ A;  3NTA A;  1YQZ A;  3CNT A;  2WDR A;  3FG2 P;  2AR8 A;  3AE3 A;  4AP1 A;  4DNA A;  3ALL A;  3GRS A;  4EM3 A;  3UTF A;  1S3B A;  5JCI A;  3RED A;  3D1C A;  3GYJ A;  1CC4 A;  2AQJ A;  2YWL A;  3GD4 A;  4ZCC A;  2ZZB A;  1IUX A;  4D04 A;  3AYI A;  4AP3 A;  2QA2 A;  1CL0 A;  2XFU A;  4EQS A;  1IUV A;  1KF6 A;  2VZ2 A;  5HXI A;  2BCP A;  3RP7 A;  3AE6 A;  2BAC A;  2R4J A;  4BUR A;  2C70 A;  2YG6 A;  2JB2 A;  1DXL A;  1LQU A;  4Z2U A;  2GQF A;  5M10 A;  1OJA A;  4CY8 A;  4U2L A;  1E39 A;  3AE8 A;  3L8K A;  1CJ4 A;  4U8O A;  5KRQ A;  1GAL A;  3UTE A;  4OCG A;  1K0L A;  2XVI A;  4J31 A;  5HHF A;  1ZDL A;  3G5Q A;  3UKP A;  5FS7 A;  3EAO A;  3E1T A;  4YWO A;  1VQW A;  1D4D A;  3CNS A;  4ZN0 A;  1GPE A;  1BGN A;  1H84 A;  2B9W A;  3AED A;  4IV9 A;  2V3B A;  3IHG A;  2E4G A;  2WOV A;  2WPC A;  3GWF A;  3SGL A;  2FJD A;  2Q7V A;  1B37 A;  5CKU A;  1S2Y A;  2XLS A;  1LPF A;  4J2W A;  4A99 A;  1GOS A;  2WET A;  1NHQ A;  1Y0P A;  2C75 A;  4J36 A;  4A9W A;  3II4 A;  3B6D A;  3K7T A;  2TMD A;  5U25 A;  3EAN A;  1ONF A;  4B66 A;  1PXC A;  2HQM A;  2BK3 A;  3CGC A;  3ZDN A;  1NHP A;  4FK1 A;  4USR A;  3UOV A;  4EMW A;  1H7X A;  4JQ9 A;  2GEW A;  2W0H A;  1GV4 A;  4CNK A;  3QFB A;  2Q6U A;  3CND A;  4TM4 A;  3L1R A;  4O5Q A;  3DJD A;  5FS9 A;  4TM1 A;  5KVI A;  3UKL A;  3ALM A;  5EB5 A;  1D7Y A;  3GDP A;  1RSG A;  1N4U A;  1SEZ A;  3ATR A;  3HZL A;  1GRH A;  2DKI A;  2RGO A;  2X99 A;  5KVH A;  5KWF A;  1QLB A;  3ICR A;  2A87 A;  1K0I A;  2CDU A;  2GVC A;  4B67 A;  4RSL A;  4LU6 A;  1JNR A;  5EB4 A;  2GH5 A;  3QVR A;  3NK2 X;  4IVO B;  5TR3 A;  1AOG A;  2I0Z A;  4NZH A;  2V5Z A;  4YSH A;  2XLR A;  3EPT A;  3DME A;  4YKF A;  3RNM A;  2Z5Y A;  2YLZ A;  1FOH A;  2XYO A;  4H4X A;  2Q0L A;  2X8C A;  3IF9 A;  4REK A;  2YR6 A;  2GR0 A;  3NHO X;  4EMJ A;  1ZP0 A;  3UOY A;  3BI2 A;  3UTG A;  4B65 A;  3DA1 A;  4RG4 A;  2C65 A;  5IPY A;  2UZZ A;  4BK1 A;  3SFE A;  4OPL A;  2FBW A;  1KNP A;  3BI5 A;  4JY2 A;  4NTE A;  4UDQ A;  4GDP A;  3M12 A;  1HYU A;  4H4P A;  2WS3 A;  2XCG A;  1UKV G;  2R45 A;  1NG4 A;  1D4C A;  2GRT A;  2BXS A;  1OJ9 A;  2YG5 A;  2YLX A;  4U8M A;  4K7Z A;  2YLR A;  1TRB A;  2BYB A;  2J3N A;  4C3Y A;  4CNJ A;  1H81 A;  1XDI A;  4EM4 A;  3GRT A;  2FJB A;  5FS8 A;  1O94 A;  4DSH A;  4H2N A;  4OVI A;  1OJT A;  1PDH A;  1H83 A;  1PBC A;  2C73 A;  2YG7 A;  3AD9 B;  3DK9 A;  1IUS A;  2ACZ A;  2R0P A;  2BK5 A;  3CPJ G;  1GXF A;  2YVG A;  4NTD A;  2WQY A;  2QCU A;  4IA6 A;  2X50 A;  4EQW A;  1S2Q A;  2XLU A;  2QAE A;  2BS4 A;  2WEU A;  3DH9 A;  3BI4 A;  4A5L A;  2Q0K A;  2DKH A;  3AYJ A;  1M6I A;  2WOW A;  2WU5 A;  3RP8 A;  1BZL A;  2EQ7 A;  4CCR A;  3M0O A;  3M13 A;  3BHK A;  1FEC A;  4U8P A;  2Y6Q A;  4GR1 A;  4JN9 A;  3VRA A;  1JNZ A;  1VG9 A;  3AE1 A;  1MOK A;  3ISH A;  3NK0 X;  4K8D A;  4J33 A;  1L9C A;  4U8N A;  4LII A;  4E0V A;  5BUK A;  3VR8 A;  1N4V A;  2EQ6 A;  4YSZ A;  2EQ8 A;  3C4N A;  1DOB A;  2GAG B;  4GDE A;  2WOI A;  2IVE A;  4H4U A;  1PS9 A;  1H6V A;  4CCQ A;  1P2E A;  2B7R A;  2C7G A;  2VQ7 A;  3PVC A;  3DJJ A;  4AOS A;  4EQR A;  4Z25 A;  1EL5 A;  3SM8 A;  4XXG A;  3F8R A;  2JK6 A;  5U1O A;  2XVH A;  2RGJ A;  1CJ2 A;  1KFY A;  2VVL A;  3P4P A;  1TDN A;  2GR3 A;  1IUU A;  4H4V A;  1KDG A;  5J7X A;  3QFA A;  5BVA A;  3NLC A;  2YR5 A;  4H4Z A;  3GDN A;  2A89 A;  3S61 A;  2C3C A;  1YQ4 A;  4HA6 A;  4UP3 A;  1DOC A;  3CGB A;  3F8D A;  4B64 A;  2BAB A;  3K7M X;  3AEF A;  2GR1 A;  3AD7 B; 
#chains in the Genus database with same CATH topology
 1N1P A;  1F3P A;  2A8X A;  4Y4L A;  1B4V A;  2V61 A;  5JCN A;  1TYP A;  3ABV A;  3DJG X;  1GRT A;  2B7S A;  4GAV A;  3ALJ A;  4Z26 A;  1F6M A;  3FPZ A;  4H50 A;  2C64 A;  1H7W A;  4A65 A;  3DJE A;  3NT6 A;  5IQ1 A;  2YVJ A;  3ICT A;  3UP4 A;  2B76 A;  2GQW A;  4OPD A;  2XLT A;  2XVE A;  3IHM A;  3P4R A;  4TM3 A;  5LV9 A;  2CVJ A;  2VOU A;  4P9S A;  2H88 A;  3LB8 A;  4I58 A;  4YTM A;  2BA9 A;  3LOV A;  3K7Q X;  4AOX A;  3UKQ A;  4JDR A;  3SY4 A;  1PXB A;  5U63 A;  4XWZ A;  5M0Z A;  3NYE A;  3AD8 B;  1CHU A;  2IID A;  1DJN A;  4HB9 A;  3UKK A;  1Q1W A;  2GF3 A;  2APG A;  2IVD A;  3AB1 A;  3AEE A;  2BCG G;  4Z43 A;  3P1W A;  2WDQ A;  3AE9 A;  1JRY A;  4BJZ A;  3NYF A;  1YQ3 A;  3CN8 A;  3T2K A;  1KNR A;  2XDO A;  4GCM A;  4C74 A;  5BRT A;  1JEH A;  1IUT A;  3OC4 A;  2R0C A;  1NHS A;  1Z6L A;  2GMH A;  2R4E A;  1EL7 A;  1GRG A;  1RYI A;  4WCT A;  1GET A;  4U8K A;  1S3E A;  4BJY A;  2CUL A;  1FEB A;  3UKH A;  3GWD A;  3KA7 A;  4GUV A;  3K30 A;  5J60 A;  2VRL A;  1NEN A;  1VRQ B;  1XAN A;  2BK4 A;  3BHF A;  3EF6 A;  4YSY A;  4NWZ A;  3AE5 A;  3JSK A;  1ZMD A;  4H7U A;  1XPQ A;  2BS2 A;  4G6G A;  3AEC A;  3V3N A;  3B3R A;  2GAH B;  1DNC A;  3NTD A;  2WPE A;  3DK8 A;  2JKC A;  5EOW A;  2EQ9 A;  1E1L A;  4A7A A;  1LV0 A;  1E7P A;  4CY6 A;  5KXJ A;  1NPX A;  1F8W A;  3QJ4 A;  1COY A;  2BRA A;  3P4Q A;  4TM0 A;  4J56 A;  2JB1 A;  1DOE A;  1E1K A;  1RP0 A;  2TPR A;  4K2X A;  1GER A;  2XFO A;  2BC0 A;  3AEA A;  1L9D A;  1CF3 A;  3NKS A;  3D8X A;  5HYM A;  3ADA B;  3AEG A;  4BK3 A;  1GT8 A;  2VRM A;  4RG3 A;  3CIR A;  3Q6J A;  1GRF A;  3NH3 X;  5KOW A;  5JCM A;  4CBQ A;  1NHR A;  1TDF A;  3Q9T A;  2XFQ A;  3AWI A;  4A79 A;  1H86 A;  3SZW A;  1GRE A;  3NK1 X;  4A6N A;  1LJ1 A;  1K0J A;  1O5W A;  2QA1 A;  1D4E A;  4G6H A;  2WPF A;  1LQT A;  2RAB A;  1F8R A;  3QSE A;  2YR4 A;  3WE0 A;  2R46 A;  3KPF A;  4DSG A;  3DK4 A;  1E6E A;  2XVJ A;  3NGC X;  1QJD A;  3CGE A;  1K4Q A;  3UKF A;  2OAM A;  2VVM A;  1TDO A;  1MXT A;  4JNA A;  2ARD A;  3RP6 A;  1CC6 A;  1CBO A;  5JCK A;  4H4W A;  4B63 A;  1ELI A;  2YLW A;  2R0G A;  1JRZ A;  4Y4N A;  3NN0 X;  4UDP A;  1EBD A;  1ZMC A;  4A6N B;  4K5R A;  2WP5 A;  1B8S A;  1TDK A;  2C3D A;  1OJD A;  2V6O A;  2CFY A;  3H8I A;  4OPC A;  4X9M A;  2YLT A;  3VRD B;  2BS3 A;  2JAE A;  2ZBW A;  3AE7 A;  4OPT A;  4FDC B;  3SXI A;  2X8H A;  2GB0 A;  2OLN A;  1PJ7 A;  3GSI A;  3T37 A;  5L46 A;  3R9U A;  3AEB A;  3F8P A;  3QSM A;  4H4Y A;  4JY3 A;  3BNM A;  3C4A A;  4IVM B;  3VR9 A;  3UP5 A;  5BUL A;  3QVP A;  5JCL A;  3GYI A;  2FJE A;  4Z24 A;  1GEU A;  3CNJ A;  3URH A;  2C76 A;  4TLX A;  2H89 A;  1BF3 A;  3CTY A;  3KVE A;  1D5T A;  1PBE A;  4GAP A;  3PS9 A;  5ER0 A;  2BC1 A;  1KSU A;  4YTN A;  1PBD A;  1E1M A;  1FEA A;  1P2H A;  1F8S A;  4KPR A;  2WBA A;  1Q9I A;  1H82 A;  2WHD A;  3P9U A;  2WU2 A;  3KD9 A;  2E5V A;  2YG4 A;  3KU9 A;  3DGZ A;  5C3J A;  3UCL A;  1D7L A;  1TYT A;  4XWR A;  1ZOV A;  2YM2 A;  1VG0 A;  4WX1 A;  1FL2 A;  2ZZ0 A;  4O5U A;  2YQU A;  3FMW A;  3GD3 A;  4GF7 A;  1L0V A;  4M52 A;  2XFN A;  1CC2 A;  2YG3 A;  4U8I A;  5KMQ A;  3NNE A;  4J34 A;  3LZX A;  1NAA A;  1X31 B;  2O9Z A;  3CPH G;  1E1N A;  4FX9 A;  4H2Q A;  4H4T A;  5HY5 A;  4NTC A;  5KMS A;  4Z44 A;  4DGK A;  4YTP A;  3LXD A;  4C5O A;  1GTE A;  1PJ6 A;  2GMJ A;  3IWA A;  3KKJ A;  1CJC A;  4Z2T A;  1OJC A;  1B5Q A;  3CGD A;  1GES A;  3NYC A;  3T0K A;  3SZF A;  4YT0 A;  2XFP A;  1O95 A;  4BV6 A;  2XLP A;  1NDA A;  4J57 A;  1EL8 A;  2WP6 A;  3GMB A;  3NG7 X;  4LA1 A;  1LVL A;  2Y6R A;  3UOX A;  4PAB A;  2OA1 A;  1IUW A;  1PBF A;  2NPX A;  4JNQ A;  4K22 A;  4X9N A;  2E1M A;  3ITJ A;  1ZK7 A;  3H4K A;  4YSX A;  3AE2 A;  2C67 A;  3I3L A;  4H2R A;  3V3O A;  5DBJ A;  4YKG A;  5FS6 A;  1CJ3 A;  1PN0 A;  4EQX A;  1PJ5 A;  3ATQ A;  2C72 A;  4C3X A;  4II2 A;  4TLZ A;  1Y56 A;  1TDE A;  2YLS A;  3SYI A;  4AT2 A;  1DJQ A;  4U2T A;  2C66 A;  1YKJ A;  4H4Q A;  4USQ A;  4B68 A;  3AE4 A;  3ICS A;  2XVF A;  3LZW A;  3HYW A;  2NVK X;  1GTH A;  2PHH A;  4ADW A;  1V59 A;  2V60 A;  1EL9 A;  1REO A;  3LAD A;  1ZOY A;  1FCD A;  3AXB A;  3GMC A;  4FK1 C;  4OPG A;  4Y4M A;  4AT0 A;  4UDR A;  2YM1 A;  2PYX A;  1JOA A;  4IA5 A;  4U8L A;  4EMI A;  3SQP A;  5KOX A;  1PHH A;  2F5Z A;  3HYX A;  4MJW A;  4Z2R A;  3NN6 X;  3UTH A;  3O0H A;  3P4S A;  4ICY A;  3ZYX A;  3T2Y A;  1QO8 A;  1GRB A;  1KSS A;  2RGH A;  3QSS A;  2Z5X A;  5CQF A;  1NG3 A;  4NEV A;  1PXA A;  1Y56 B;  4H4R A;  1ZKQ A;  3FIM B;  4ECH A;  2ZZC A;  2GR2 A;  1YY5 A;  2B9Y A;  1Q1R A;  4PAA A;  3CPI G;  3T31 A;  4BK2 A;  4X4J A;  1BGJ A;  4I59 A;  3UKA A;  5EBK A;  1MO9 A;  1PBB A;  1IJH A;  2WDV A;  2WES A;  4B69 A;  3NIX A;  4C77 A;  3KLJ A;  2OAL A;  2X8G A;  1BKW A;  4NEW A;  5IQ4 A;  1DOD A;  1ZX9 A;  3I6D A;  3LJP A;  1GSN A;  3G5S A;  3PO7 A;  1GRA A;  1JU2 A;  3G5R A;  4ZCD A;  3C96 A;  3SFD A;  1W4X A;  3RHA A;  1N4W A;  2JB3 A;  4U8J A;  2V3A A;  3VQR A;  4B1B A;  4YXD A;  4H2P A;  3UOZ A;  4APN A;  4N9X A;  1XHC A;  1VDC A;  5GSN A;  2AAQ A;  3AYL A;  1JRX A;  2OLO A;  2YAU A;  4EIP A;  3CNP A;  4OPU A;  5C2T A;  3FBS A;  4CRT A;  5FMH A;  1LTX R;  2R9Z A;  2B9X A;  4U2S A;  3NRN A;  2BXR A;  2JBV A;  2FJA A;  4D03 A;  3BNU A;  2VQB A;  3S5W A;  1L9E A;  3T14 A;  2GV8 A;  4KX6 A;  3V76 A;  3SZ0 A;  3DGH A;  4G74 A;  1NEK A;  4H4S A;  4II3 A;  5GRT A;  3T2Z A;  1BWC A;  2X3N A;  4K5S A;  3H8L A;  4OPI A;  2VVL G;  2WP9 A;  3IC9 A;  3OZ2 A;  1M64 A;  3VRB A;  1ZY8 A;  1GND A;  3COX A;  2YVF A;  4GRT A;  4EIQ A;  3NTA A;  1YQZ A;  3CNT A;  2WDR A;  3FG2 P;  2AR8 A;  3AE3 A;  4AP1 A;  4DNA A;  3ALL A;  3GRS A;  4EM3 A;  3UTF A;  1S3B A;  5JCI A;  3RED A;  3D1C A;  3GYJ A;  1CC4 A;  2AQJ A;  2YWL A;  3GD4 A;  4ZCC A;  2ZZB A;  1IUX A;  4D04 A;  3AYI A;  4AP3 A;  2QA2 A;  1CL0 A;  2XFU A;  3GYX A;  4EQS A;  1IUV A;  1KF6 A;  2VZ2 A;  5HXI A;  2BCP A;  3RP7 A;  3AE6 A;  2BAC A;  2R4J A;  4BUR A;  2C70 A;  2YG6 A;  2JB2 A;  1DXL A;  1LQU A;  4Z2U A;  2GQF A;  5M10 A;  1OJA A;  4CY8 A;  4U2L A;  1E39 A;  3AE8 A;  3L8K A;  1CJ4 A;  4U8O A;  5KRQ A;  1GAL A;  3UTE A;  4OCG A;  1K0L A;  2XVI A;  4J31 A;  5HHF A;  1ZDL A;  3G5Q A;  3UKP A;  5FS7 A;  3EAO A;  3E1T A;  4YWO A;  1VQW A;  1D4D A;  3CNS A;  4ZN0 A;  1GPE A;  1BGN A;  1H84 A;  2B9W A;  3AED A;  4IV9 A;  2V3B A;  3IHG A;  2E4G A;  2WOV A;  2WPC A;  3GWF A;  3SGL A;  2FJD A;  2Q7V A;  1B37 A;  5CKU A;  1S2Y A;  2XLS A;  1LPF A;  4J2W A;  4A99 A;  1GOS A;  2WET A;  1NHQ A;  1Y0P A;  2C75 A;  4J36 A;  4A9W A;  3II4 A;  3B6D A;  3K7T A;  2TMD A;  5U25 A;  3EAN A;  1ONF A;  4B66 A;  1PXC A;  2HQM A;  2BK3 A;  3CGC A;  3ZDN A;  5KMP A;  1NHP A;  4FK1 A;  4USR A;  3UOV A;  4EMW A;  1H7X A;  4JQ9 A;  2GEW A;  2W0H A;  1GV4 A;  4CNK A;  3QFB A;  2Q6U A;  2C4C A;  3CND A;  4TM4 A;  3L1R A;  4O5Q A;  3DJD A;  5FS9 A;  4TM1 A;  5KVI A;  3UKL A;  3ALM A;  5EB5 A;  1D7Y A;  3GDP A;  1RSG A;  1N4U A;  1SEZ A;  3ATR A;  3HZL A;  1GRH A;  2DKI A;  2RGO A;  2X99 A;  5KVH A;  5KWF A;  1QLB A;  3ICR A;  2A87 A;  1K0I A;  2CDU A;  2GVC A;  4B67 A;  4RSL A;  4LU6 A;  1JNR A;  5EB4 A;  2GH5 A;  3QVR A;  3NK2 X;  4IVO B;  5TR3 A;  1AOG A;  2I0Z A;  4NZH A;  2V5Z A;  4YSH A;  2XLR A;  3EPT A;  3DME A;  4YKF A;  3RNM A;  2Z5Y A;  2BRY A;  2YLZ A;  1FOH A;  2XYO A;  4H4X A;  2Q0L A;  2X8C A;  3IF9 A;  4REK A;  2YR6 A;  2GR0 A;  3NHO X;  4EMJ A;  1ZP0 A;  3UOY A;  3BI2 A;  3UTG A;  4G73 A;  4B65 A;  3DA1 A;  4RG4 A;  2C65 A;  5IPY A;  2UZZ A;  5KNL A;  4BK1 A;  3SFE A;  4OPL A;  2FBW A;  1KNP A;  3BI5 A;  4JY2 A;  4NTE A;  4UDQ A;  4GDP A;  3M12 A;  1HYU A;  4H4P A;  2WS3 A;  2XCG A;  3HYV A;  1UKV G;  2R45 A;  1NG4 A;  1D4C A;  2GRT A;  2BXS A;  1OJ9 A;  2YG5 A;  2YLX A;  4U8M A;  4K7Z A;  2YLR A;  1TRB A;  2BYB A;  2J3N A;  4C3Y A;  4CNJ A;  1H81 A;  1XDI A;  4EM4 A;  3GRT A;  2FJB A;  5FS8 A;  1O94 A;  4DSH A;  4H2N A;  4OVI A;  1OJT A;  1PDH A;  1H83 A;  1PBC A;  2C73 A;  2YG7 A;  3AD9 B;  3DK9 A;  1IUS A;  2ACZ A;  2R0P A;  2BK5 A;  3CPJ G;  3KPK A;  1GXF A;  2YVG A;  4NTD A;  2WQY A;  2QCU A;  4IA6 A;  2X50 A;  4EQW A;  1S2Q A;  2XLU A;  2QAE A;  2BS4 A;  2WEU A;  3DH9 A;  3BI4 A;  4A5L A;  2Q0K A;  2DKH A;  3CMM A;  3AYJ A;  1M6I A;  2WOW A;  2WU5 A;  3RP8 A;  3SX6 A;  1BZL A;  2EQ7 A;  4CCR A;  3M0O A;  3M13 A;  4NNJ A;  3BHK A;  1FEC A;  4U8P A;  2Y6Q A;  4GR1 A;  4JN9 A;  3VRA A;  1JNZ A;  1VG9 A;  3AE1 A;  1MOK A;  3ISH A;  3NK0 X;  4K8D A;  4J33 A;  1L9C A;  4U8N A;  3SZC A;  4LII A;  4E0V A;  5BUK A;  4G9K A;  3VR8 A;  1N4V A;  2EQ6 A;  4YSZ A;  2EQ8 A;  3C4N A;  1DOB A;  2GAG B;  4GDE A;  2WOI A;  2IVE A;  5KMR A;  4H4U A;  1PS9 A;  1H6V A;  4CCQ A;  1P2E A;  2B7R A;  2C7G A;  2VQ7 A;  3PVC A;  3DJJ A;  4AOS A;  4EQR A;  4Z25 A;  1EL5 A;  3SM8 A;  4XXG A;  3F8R A;  2JK6 A;  5U1O A;  2XVH A;  2RGJ A;  1CJ2 A;  1KFY A;  2VVL A;  3P4P A;  1TDN A;  2GR3 A;  1IUU A;  4H4V A;  1KDG A;  5J7X A;  3QFA A;  5BVA A;  3NLC A;  2YR5 A;  4H4Z A;  3GDN A;  2A89 A;  3S61 A;  2C3C A;  1YQ4 A;  4HA6 A;  4UP3 A;  1DOC A;  3CGB A;  3F8D A;  4B64 A;  2BAB A;  3K7M X;  3AEF A;  2GR1 A;  3AD7 B; 
#chains in the Genus database with same CATH homology
 1N1P A;  1F3P A;  2A8X A;  4Y4L A;  1B4V A;  2V61 A;  5JCN A;  1TYP A;  3ABV A;  3DJG X;  1GRT A;  2B7S A;  4GAV A;  3ALJ A;  4Z26 A;  1F6M A;  3FPZ A;  4H50 A;  2C64 A;  1H7W A;  4A65 A;  3DJE A;  3NT6 A;  5IQ1 A;  2YVJ A;  3ICT A;  3UP4 A;  2B76 A;  2GQW A;  4OPD A;  2XLT A;  2XVE A;  3IHM A;  3P4R A;  4TM3 A;  5LV9 A;  2CVJ A;  2VOU A;  4P9S A;  2H88 A;  3LB8 A;  4I58 A;  4YTM A;  2BA9 A;  3LOV A;  3K7Q X;  4AOX A;  3UKQ A;  4JDR A;  3SY4 A;  1PXB A;  5U63 A;  4XWZ A;  5M0Z A;  3NYE A;  3AD8 B;  1CHU A;  2IID A;  1DJN A;  4HB9 A;  3UKK A;  1Q1W A;  2GF3 A;  2APG A;  2IVD A;  3AB1 A;  3AEE A;  2BCG G;  4Z43 A;  3P1W A;  2WDQ A;  3AE9 A;  1JRY A;  4BJZ A;  3NYF A;  1YQ3 A;  3CN8 A;  3T2K A;  1KNR A;  2XDO A;  4GCM A;  4C74 A;  5BRT A;  1JEH A;  1IUT A;  3OC4 A;  2R0C A;  1NHS A;  1Z6L A;  2GMH A;  2R4E A;  1EL7 A;  1GRG A;  1RYI A;  4WCT A;  1GET A;  4U8K A;  1S3E A;  4BJY A;  2CUL A;  1FEB A;  3UKH A;  3GWD A;  3KA7 A;  4GUV A;  3K30 A;  5J60 A;  2VRL A;  1NEN A;  1VRQ B;  1XAN A;  2BK4 A;  3BHF A;  3EF6 A;  4YSY A;  4NWZ A;  3AE5 A;  3JSK A;  1ZMD A;  4H7U A;  1XPQ A;  2BS2 A;  4G6G A;  3AEC A;  3V3N A;  3B3R A;  2GAH B;  1DNC A;  3NTD A;  2WPE A;  3DK8 A;  2JKC A;  5EOW A;  2EQ9 A;  1E1L A;  4A7A A;  1LV0 A;  1E7P A;  4CY6 A;  5KXJ A;  1NPX A;  1F8W A;  3QJ4 A;  1COY A;  2BRA A;  3P4Q A;  4TM0 A;  4J56 A;  2JB1 A;  1DOE A;  1E1K A;  1RP0 A;  2TPR A;  4K2X A;  1GER A;  2XFO A;  2BC0 A;  3AEA A;  1L9D A;  1CF3 A;  3NKS A;  3D8X A;  5HYM A;  3ADA B;  3AEG A;  4BK3 A;  1GT8 A;  2VRM A;  4RG3 A;  3CIR A;  3Q6J A;  1GRF A;  3NH3 X;  5KOW A;  5JCM A;  4CBQ A;  1NHR A;  1TDF A;  3Q9T A;  2XFQ A;  3AWI A;  4A79 A;  1H86 A;  3SZW A;  1GRE A;  3NK1 X;  4A6N A;  1LJ1 A;  1K0J A;  1O5W A;  2QA1 A;  1D4E A;  4G6H A;  2WPF A;  1LQT A;  2RAB A;  1F8R A;  3QSE A;  2YR4 A;  3WE0 A;  2R46 A;  3KPF A;  4DSG A;  3DK4 A;  1E6E A;  2XVJ A;  3NGC X;  1QJD A;  3CGE A;  1K4Q A;  3UKF A;  2OAM A;  2VVM A;  1TDO A;  1MXT A;  4JNA A;  2ARD A;  3RP6 A;  1CC6 A;  1CBO A;  5JCK A;  4H4W A;  4B63 A;  1ELI A;  2YLW A;  2R0G A;  1JRZ A;  4Y4N A;  3NN0 X;  4UDP A;  1EBD A;  1ZMC A;  4A6N B;  4K5R A;  2WP5 A;  1B8S A;  1TDK A;  2C3D A;  1OJD A;  2V6O A;  2CFY A;  3H8I A;  4OPC A;  4X9M A;  2YLT A;  3VRD B;  2BS3 A;  2JAE A;  2ZBW A;  3AE7 A;  4OPT A;  4FDC B;  3SXI A;  2X8H A;  2GB0 A;  2OLN A;  1PJ7 A;  3GSI A;  3T37 A;  5L46 A;  3R9U A;  3AEB A;  3F8P A;  3QSM A;  4H4Y A;  4JY3 A;  3BNM A;  3C4A A;  4IVM B;  3VR9 A;  3UP5 A;  5BUL A;  3QVP A;  5JCL A;  3GYI A;  2FJE A;  4Z24 A;  1GEU A;  3CNJ A;  3URH A;  2C76 A;  4TLX A;  2H89 A;  1BF3 A;  3CTY A;  3KVE A;  1D5T A;  1PBE A;  4GAP A;  3PS9 A;  5ER0 A;  2BC1 A;  1KSU A;  4YTN A;  1PBD A;  1E1M A;  1FEA A;  1P2H A;  1F8S A;  4KPR A;  2WBA A;  1Q9I A;  1H82 A;  2WHD A;  3P9U A;  2WU2 A;  3KD9 A;  2E5V A;  2YG4 A;  3KU9 A;  3DGZ A;  5C3J A;  3UCL A;  1D7L A;  1TYT A;  4XWR A;  1ZOV A;  2YM2 A;  1VG0 A;  4WX1 A;  1FL2 A;  2ZZ0 A;  4O5U A;  2YQU A;  3FMW A;  3GD3 A;  4GF7 A;  1L0V A;  4M52 A;  2XFN A;  1CC2 A;  2YG3 A;  4U8I A;  5KMQ A;  3NNE A;  4J34 A;  3LZX A;  1NAA A;  1X31 B;  2O9Z A;  3CPH G;  1E1N A;  4FX9 A;  4H2Q A;  4H4T A;  5HY5 A;  4NTC A;  5KMS A;  4Z44 A;  4DGK A;  4YTP A;  3LXD A;  4C5O A;  1GTE A;  1PJ6 A;  2GMJ A;  3IWA A;  3KKJ A;  1CJC A;  4Z2T A;  1OJC A;  1B5Q A;  3CGD A;  1GES A;  3NYC A;  3T0K A;  3SZF A;  4YT0 A;  2XFP A;  1O95 A;  4BV6 A;  2XLP A;  1NDA A;  4J57 A;  1EL8 A;  2WP6 A;  3GMB A;  3NG7 X;  4LA1 A;  1LVL A;  2Y6R A;  3UOX A;  4PAB A;  2OA1 A;  1IUW A;  1PBF A;  2NPX A;  4JNQ A;  4K22 A;  4X9N A;  2E1M A;  3ITJ A;  1ZK7 A;  3H4K A;  4YSX A;  3AE2 A;  2C67 A;  3I3L A;  4H2R A;  3V3O A;  5DBJ A;  4YKG A;  5FS6 A;  1CJ3 A;  1PN0 A;  4EQX A;  1PJ5 A;  3ATQ A;  2C72 A;  4C3X A;  4II2 A;  4TLZ A;  1Y56 A;  1TDE A;  2YLS A;  3SYI A;  4AT2 A;  1DJQ A;  4U2T A;  2C66 A;  1YKJ A;  4H4Q A;  4USQ A;  4B68 A;  3AE4 A;  3ICS A;  2XVF A;  3LZW A;  3HYW A;  2NVK X;  1GTH A;  2PHH A;  4ADW A;  1V59 A;  2V60 A;  1EL9 A;  1REO A;  3LAD A;  1ZOY A;  1FCD A;  3AXB A;  3GMC A;  4FK1 C;  4OPG A;  4Y4M A;  4AT0 A;  4UDR A;  2YM1 A;  2PYX A;  1JOA A;  4IA5 A;  4U8L A;  4EMI A;  3SQP A;  5KOX A;  1PHH A;  2F5Z A;  3HYX A;  4MJW A;  4Z2R A;  3NN6 X;  3UTH A;  3O0H A;  3P4S A;  4ICY A;  3ZYX A;  3T2Y A;  1QO8 A;  1GRB A;  1KSS A;  2RGH A;  3QSS A;  2Z5X A;  5CQF A;  1NG3 A;  4NEV A;  1PXA A;  1Y56 B;  4H4R A;  1ZKQ A;  3FIM B;  4ECH A;  2ZZC A;  2GR2 A;  1YY5 A;  2B9Y A;  1Q1R A;  4PAA A;  3CPI G;  3T31 A;  4BK2 A;  4X4J A;  1BGJ A;  4I59 A;  3UKA A;  5EBK A;  1MO9 A;  1PBB A;  1IJH A;  2WDV A;  2WES A;  4B69 A;  3NIX A;  4C77 A;  3KLJ A;  2OAL A;  2X8G A;  1BKW A;  4NEW A;  5IQ4 A;  1DOD A;  1ZX9 A;  3I6D A;  3LJP A;  1GSN A;  3G5S A;  3PO7 A;  1GRA A;  1JU2 A;  3G5R A;  4ZCD A;  3C96 A;  3SFD A;  1W4X A;  3RHA A;  1N4W A;  2JB3 A;  4U8J A;  2V3A A;  3VQR A;  4B1B A;  4YXD A;  4H2P A;  3UOZ A;  4APN A;  4N9X A;  1XHC A;  1VDC A;  5GSN A;  2AAQ A;  3AYL A;  1JRX A;  2OLO A;  2YAU A;  4EIP A;  3CNP A;  4OPU A;  5C2T A;  3FBS A;  4CRT A;  5FMH A;  1LTX R;  2R9Z A;  2B9X A;  4U2S A;  3NRN A;  2BXR A;  2JBV A;  2FJA A;  4D03 A;  3BNU A;  2VQB A;  3S5W A;  1L9E A;  3T14 A;  2GV8 A;  4KX6 A;  3V76 A;  3SZ0 A;  3DGH A;  4G74 A;  1NEK A;  4H4S A;  4II3 A;  5GRT A;  3T2Z A;  1BWC A;  2X3N A;  4K5S A;  3H8L A;  4OPI A;  2VVL G;  2WP9 A;  3IC9 A;  3OZ2 A;  1M64 A;  3VRB A;  1ZY8 A;  1GND A;  3COX A;  2YVF A;  4GRT A;  4EIQ A;  3NTA A;  1YQZ A;  3CNT A;  2WDR A;  3FG2 P;  2AR8 A;  3AE3 A;  4AP1 A;  4DNA A;  3ALL A;  3GRS A;  4EM3 A;  3UTF A;  1S3B A;  5JCI A;  3RED A;  3D1C A;  3GYJ A;  1CC4 A;  2AQJ A;  2YWL A;  3GD4 A;  4ZCC A;  2ZZB A;  1IUX A;  4D04 A;  3AYI A;  4AP3 A;  2QA2 A;  1CL0 A;  2XFU A;  3GYX A;  4EQS A;  1IUV A;  1KF6 A;  2VZ2 A;  5HXI A;  2BCP A;  3RP7 A;  3AE6 A;  2BAC A;  2R4J A;  4BUR A;  2C70 A;  2YG6 A;  2JB2 A;  1DXL A;  1LQU A;  4Z2U A;  2GQF A;  5M10 A;  1OJA A;  4CY8 A;  4U2L A;  1E39 A;  3AE8 A;  3L8K A;  1CJ4 A;  4U8O A;  5KRQ A;  1GAL A;  3UTE A;  4OCG A;  1K0L A;  2XVI A;  4J31 A;  5HHF A;  1ZDL A;  3G5Q A;  3UKP A;  5FS7 A;  3EAO A;  3E1T A;  4YWO A;  1VQW A;  1D4D A;  3CNS A;  4ZN0 A;  1GPE A;  1BGN A;  1H84 A;  2B9W A;  3AED A;  4IV9 A;  2V3B A;  3IHG A;  2E4G A;  2WOV A;  2WPC A;  3GWF A;  3SGL A;  2FJD A;  2Q7V A;  1B37 A;  5CKU A;  1S2Y A;  2XLS A;  1LPF A;  4J2W A;  4A99 A;  1GOS A;  2WET A;  1NHQ A;  1Y0P A;  2C75 A;  4J36 A;  4A9W A;  3II4 A;  3B6D A;  3K7T A;  2TMD A;  5U25 A;  3EAN A;  1ONF A;  4B66 A;  1PXC A;  2HQM A;  2BK3 A;  3CGC A;  3ZDN A;  5KMP A;  1NHP A;  4FK1 A;  4USR A;  3UOV A;  4EMW A;  1H7X A;  4JQ9 A;  2GEW A;  2W0H A;  1GV4 A;  4CNK A;  3QFB A;  2Q6U A;  2C4C A;  3CND A;  4TM4 A;  3L1R A;  4O5Q A;  3DJD A;  5FS9 A;  4TM1 A;  5KVI A;  3UKL A;  3ALM A;  5EB5 A;  1D7Y A;  3GDP A;  1RSG A;  1N4U A;  1SEZ A;  3ATR A;  3HZL A;  1GRH A;  2DKI A;  2RGO A;  2X99 A;  5KVH A;  5KWF A;  1QLB A;  3ICR A;  2A87 A;  1K0I A;  2CDU A;  2GVC A;  4B67 A;  4RSL A;  4LU6 A;  1JNR A;  5EB4 A;  2GH5 A;  3QVR A;  3NK2 X;  4IVO B;  5TR3 A;  1AOG A;  2I0Z A;  4NZH A;  2V5Z A;  4YSH A;  2XLR A;  3EPT A;  3DME A;  4YKF A;  3RNM A;  2Z5Y A;  2BRY A;  2YLZ A;  1FOH A;  2XYO A;  4H4X A;  2Q0L A;  2X8C A;  3IF9 A;  4REK A;  2YR6 A;  2GR0 A;  3NHO X;  4EMJ A;  1ZP0 A;  3UOY A;  3BI2 A;  3UTG A;  4G73 A;  4B65 A;  3DA1 A;  4RG4 A;  2C65 A;  5IPY A;  2UZZ A;  5KNL A;  4BK1 A;  3SFE A;  4OPL A;  2FBW A;  1KNP A;  3BI5 A;  4JY2 A;  4NTE A;  4UDQ A;  4GDP A;  3M12 A;  1HYU A;  4H4P A;  2WS3 A;  2XCG A;  3HYV A;  1UKV G;  2R45 A;  1NG4 A;  1D4C A;  2GRT A;  2BXS A;  1OJ9 A;  2YG5 A;  2YLX A;  4U8M A;  4K7Z A;  2YLR A;  1TRB A;  2BYB A;  2J3N A;  4C3Y A;  4CNJ A;  1H81 A;  1XDI A;  4EM4 A;  3GRT A;  2FJB A;  5FS8 A;  1O94 A;  4DSH A;  4H2N A;  4OVI A;  1OJT A;  1PDH A;  1H83 A;  1PBC A;  2C73 A;  2YG7 A;  3AD9 B;  3DK9 A;  1IUS A;  2ACZ A;  2R0P A;  2BK5 A;  3CPJ G;  3KPK A;  1GXF A;  2YVG A;  4NTD A;  2WQY A;  2QCU A;  4IA6 A;  2X50 A;  4EQW A;  1S2Q A;  2XLU A;  2QAE A;  2BS4 A;  2WEU A;  3DH9 A;  3BI4 A;  4A5L A;  2Q0K A;  2DKH A;  3CMM A;  3AYJ A;  1M6I A;  2WOW A;  2WU5 A;  3RP8 A;  3SX6 A;  1BZL A;  2EQ7 A;  4CCR A;  3M0O A;  3M13 A;  4NNJ A;  3BHK A;  1FEC A;  4U8P A;  2Y6Q A;  4GR1 A;  4JN9 A;  3VRA A;  1JNZ A;  1VG9 A;  3AE1 A;  1MOK A;  3ISH A;  3NK0 X;  4K8D A;  4J33 A;  1L9C A;  4U8N A;  3SZC A;  4LII A;  4E0V A;  5BUK A;  4G9K A;  3VR8 A;  1N4V A;  2EQ6 A;  4YSZ A;  2EQ8 A;  3C4N A;  1DOB A;  2GAG B;  4GDE A;  2WOI A;  2IVE A;  5KMR A;  4H4U A;  1PS9 A;  1H6V A;  4CCQ A;  1P2E A;  2B7R A;  2C7G A;  2VQ7 A;  3PVC A;  3DJJ A;  4AOS A;  4EQR A;  4Z25 A;  1EL5 A;  3SM8 A;  4XXG A;  3F8R A;  2JK6 A;  5U1O A;  2XVH A;  2RGJ A;  1CJ2 A;  1KFY A;  2VVL A;  3P4P A;  1TDN A;  2GR3 A;  1IUU A;  4H4V A;  1KDG A;  5J7X A;  3QFA A;  5BVA A;  3NLC A;  2YR5 A;  4H4Z A;  3GDN A;  2A89 A;  3S61 A;  2C3C A;  1YQ4 A;  4HA6 A;  4UP3 A;  1DOC A;  3CGB A;  3F8D A;  4B64 A;  2BAB A;  3K7M X;  3AEF A;  2GR1 A;  3AD7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...