1RP0A

Crystal structure of thi1 protein from arabidopsis thaliana
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
278
structure length
278
Chain Sequence
YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIMSKLLARPNVKLFNAVAAEDLIVKGNRVGGVVTNWALVAQNHHTQSCMDPNVMEAKIVVSSCGHDGPFGATGVKRLKSIGMIDHVPGMKALDMNTAEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMMISGQKAGQLALKALGLPNAIDGTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Thiazole biosynthetic enzyme
publication title Structure of the thiazole biosynthetic enzyme THI1 from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 95
structure length 278
sequence length 278
chains with identical sequence B
ec nomenclature ec 2.4.2.60: Cysteine-dependent adenosine diphosphate thiazole synthase.
pdb deposition date 2003-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01946 Thi4 Thi4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1rp0A02
1MO9A 1F8SA 2GR1A 3COXA 3P4PA 3UKFA 4J57A 2YM1A 1NDAA 1QJDA 1GRGA 3FPZA 3IC9A 4XWZA 5EB5A 2R4JA 3BI5A 3G5SA 5KWFA 4J2WA 4J36A 3UOVA 3DMEA 2PHHA 1L9DA 2WQYA 1V59A 4O5UA 1KNRA 1O95A 3NN6X 3UTGA 1Q1RA 5EBKA 1CC4A 4NZHA 2VQBA 4J33A 1GPEA 2X50A 3ABVA 4DSGA 3KU9A 4H4PA 1K0JA 3HZLA 1FOHA 3C96A 1PBCA 3UKAA 1TDNA 3V3NA 5LV9A 2NVKX 2XLSA 3V3OA 1PXCA 3AEAA 4H2QA 4TM1A 4KX6A 3GWDA 2FJEA 2JBVA 4TLZA 4B65A 2WP9A 5M0ZA 3H8IA 4B68A 3NG7X 1LQUA 4AT2A 3VRDB 2YLRA 1AOGA 3R9UA 2WEUA 2XVIA 4CY8A 2ZZ0A 1H86A 3G5QA 4LU6A 1PJ7A 2FJDA 1GETA 2WPFA 2GQFA 4C3YA 2WESA 3H8LA 1OJ9A 4Z2TA 1RP0A 2XVHA 3AEBA 2WBAA 3AEDA 3UCLA 4D03A 1TDEA 2QA2A 1IUSA 4NEVA 2YG4A 2V3BA 1FECA 3AD9B 2BA9A 2GR0A 2TPRA 3AECA 4LA1A 1GRHA 1LPFA 2OA1A 2WU2A 5EOWA 4IVMB 4A65A 1KF6A 1NHRA 1PDHA 3GWFA 3NKSA 4TM3A 3DA1A 4GUVA 3UOXA 1GALA 2Z5YA 3P4QA 3CNJA 4ZCCA 1BKWA 2E5VA 3AEEA 3CPJG 1KNPA 4B67A 4Z26A 3DK9A 3AE9A 3NK1X 3NTDA 2OLNA 2R0CA 1PJ6A 5DBJA 4B66A 2OAMA 2RABA 3NGCX 4EM3A 4GDPA 2BABA 1NHQA 2JKCA 2UZZA 2C72A 4K5RA 2YVJA 3S5WA 3AXBA 4I59A 3UKQA 3DGHA 4YTNA 3GMBA 3IHGA 4UDRA 4EMIA 2XLTA 4RSLA 1CJCA 5CQFA 4CCQA 1JRZA 3DK8A 2ZZBA 3SQPA 1CJ3A 3WE0A 5JCIA 4X4JA 5GSNA 5KVIA 2BS2A 3RP7A 1S3EA 3GYJA 1GT8A 2BK5A 4CBQA 1BWCA 2QAEA 2XFNA 3F8RA 5TR3A 2YM2A 1GREA 3EAOA 4Z43A 3AE3A 3VRBA 4C77A 3UKKA 3VRAA 5IPYA 3DJDA 1COYA 4DNAA 2R0PA 1DODA 4OPGA 1IUWA 3SM8A 3VR8A 2WP5A 3BNUA 4B64A 2YAUA 4OCGA 4A7AA 2WDQA 4U8NA 4JY2A 4ECHA 3BI2A 1FCDA 3O0HA 4YSYA 3AE5A 4YSXA 3CIRA 2YVFA 4NTCA 4O5QA 4H7UA 4NEWA 4UP3A 4A6NA 3AEGA 2JK6A 2C7GA 3FIMB 2WPEA 1PBDA 1DJQA 1REOA 2FBWA 2W0HA 3M0OA 4N9XA 3L1RA 3UOYA 3SFEA 1JU2A 1PJ5A 1Y56B 2E4GA 3F8PA 1XDIA 2YVGA 4RG4A 1ONFA 2IVDA 1GRAA 5HXIA 2C64A 1TDOA 4H2PA 4JNQA 2JB1A 3NN0X 1ZX9A 1PXBA 5HYMA 2C66A 2EQ9A 1GEUA 2GVCA 1VDCA 2EQ8A 3FBSA 2B9WA 3UTHA 3LJPA 4TLXA 3CNPA 3NK0X 4ADWA 4YT0A 3II4A 3ATRA 5IQ4A 4UDPA 1N4UA 1QLBA 1YY5A 1ZK7A 1JOAA 4FK1C 5FS6A 4Z25A 3NK2X 5L46A 1PBBA 2XLUA 3LADA 1Q1WA 1K0IA 4OPUA 2Z5XA 5BULA 1F8WA 3P9UA 3QFBA 5FS9A 3UKHA 4H4SA 3UP4A 4P9SA 4BJZA 2YG3A 3ZYXA 1MOKA 3QJ4A 2R9ZA 4EQXA 2C76A 3P1WA 4YKFA 1E1NA 3NYEA 3ATQA 3CNDA 4H2RA 2GR2A 3GDPA 3KLJA 2XLPA 2YR6A 1L9CA 2R0GA 2GR3A 3GMCA 3RP8A 4U8JA 1FEAA 5BVAA 4XXGA 2APGA 2C3CA 4K5SA 1BF3A 2ZZCA 3PS9A 1QO8A 3EANA 3UKLA 1H83A 1XANA 1CC2A 1ZKQA 3DK4A 3AE6A 4K22A 3UTEA 1YQ4A 4C74A 4EMJA 3NYCA 4BK1A 2E1MA 1E1KA 3GD3A 2A8XA 4C3XA 4EIQA 2BK4A 2XVFA 4OPDA 2WOWA 2WETA 1LVLA 1PBFA 4ZN0A 1P2HA 3K7QX 3AYJA 4GRTA 1O94A 3D8XA 4AOXA 1ZMCA 1F8RA 1Y0PA 4EQWA 2Q6UA 3ISHA 3GSIA 2V6OA 4USRA 1OJCA 5GRTA 3DGZA 4U8LA 1P2EA 5U1OA 3SFDA 5BRTA 4TM4A 1NAAA 4X9MA 4APNA 1E39A 4EM4A 1GRBA 4JDRA 4TM0A 1W4XA 3OC4A 1CC6A 3CN8A 1OJAA 1GRTA 3PO7A 3Q9TA 1GSNA 2VVLG 3AYLA 5IQ1A 4H4TA 2ACZA 2VRMA 2WDRA 1JNZA 1PBEA 2FJAA 4OPCA 4YXDA 1H82A 2XFUA 4HB9A 3V76A 2YG7A 4B63A 1VQWA 2EQ7A 1RSGA 3K30A 2X3NA 2OALA 2R46A 3E1TA 1N4VA 4H2NA 2RGHA 4H4ZA 3DJGX 3QVRA 3NYFA 2Q7VA 4IA6A 4CCRA 1EL8A 2AQJA 1F3PA 2GRTA 1NG4A 3CGCA 2YR5A 4H4UA 5FS8A 1EL9A 2GAGB 4B1BA 1K0LA 2FJBA 2WU5A 2YQUA 2ZBWA 5FMHA 3NNEA 2Q0LA 1D5TA 2OLOA 2CDUA 2JB2A 2X99A 4JN9A 1DJNA 2NPXA 4IVOB 1D4EA 1M6IA 1O5WA 4H4QA 4D04A 3AE7A 3REDA 1NPXA 4AP3A 3OZ2A 3IHMA 1BGNA 2BS3A 2WHDA 3JSKA 2I0ZA 4YKGA 4A99A 5JCMA 2H88A 4LIIA 5KXJA 4U2LA 4GCMA 2B9YA 3GRSA 4H4RA 4K7ZA 3QVPA 1PS9A 4ICYA 4A9WA 5BUKA 2C65A 4JNAA 1GOSA 3AEFA 3ZDNA 1BZLA 3GD4A 2GH5A 3CPHG 1L0VA 1JRXA 3LXDA 1K4QA 2IIDA 1KSSA 3AE1A 4M52A 3AD7B 1B4VA 1NHSA 2J3NA 3GYIA 2VQ7A 2HQMA 2GB0A 1GV4A 1GRFA 1E6EA 2RGOA 1EL5A 3FG2P 2X8GA 5KVHA 3UTFA 3EPTA 4H50A 4PABA 1FEBA 4GF7A 1DOEA 2RGJA 3IWAA 4YSZA 4U2SA 3DJEA 2C67A 3PVCA 4NTDA 4I58A 3M13A 4K2XA 4H4XA 2CFYA 3QSSA 1B5QA 4NTEA 2XVJA 1S3BA 1GNDA 2CULA 1OJDA 1CBOA 4A6NB 4BK3A 1GTHA 5J7XA 1L9EA 2BC0A 4EQRA 1PXAA 4J34A 3ITJA 1Z6LA 4WCTA 2YG6A 3NIXA 4K8DA 2YLSA 4AP1A 1GXFA 1LJ1A 1N4WA 2V61A 4EQSA 2IVEA 1XHCA 1XPQA 2VOUA 3T37A 3ICSA 2YLZA 2Y6RA 1JEHA 1VG0A 2WS3A 1IJHA 1RYIA 2WOVA 2YR4A 1UKVG 2O9ZA 4OPLA 4A79A 3KVEA 1DOBA 4HA6A 2ARDA 1IUTA 1X31B 1TYTA 3SGLA 1H84A 4U8KA 2XFPA 1GESA 1YQZA 4Y4LA 5M10A 3LB8A 4OPTA 1DXLA 3P4RA 3AE4A 1VG9A 2BXRA 4DSHA 4EIPA 2YLWA 1CL0A 1D7LA 1LTXR 4Z24A 1D4CA 1DNCA 1TDKA 1PHHA 3GDNA 1NENA 4RG3A 3S61A 4AT0A 2BYBA 4JQ9A 3ALMA 3IF9A 5EB4A 5ER0A 1PN0A 2GAHB 4B69A 4AOSA 2BCGG 2JB3A 2V3AA 1GERA 4MJWA 4Z2UA 1LV0A 4Z44A 4YTPA 1H81A 4FDCB 5U25A 1NG3A 1CHUA 2BC1A 3RHAA 1HYUA 2GEWA 3GRTA 3C4NA 4CNKA 2JAEA 3D1CA 1KFYA 2XFQA 3UKPA 3BHKA 1IUXA 2XVEA 2QCUA 5KOWA 1ELIA 2BK3A 3B6DA 3BNMA 3KKJA 3CGDA 5KRQA 2DKHA 2XLRA 2R45A 4U8IA 3ICRA 3AB1A 2VVLA 2B7SA 1BGJA 2PYXA 4FK1A 5KOXA 4Y4MA 4OPIA 1H6VA 1IUVA 2X8CA 2XCGA 1E7PA 2V5ZA 2H89A 1E1MA 4C5OA 1D4DA 4YWOA 3URHA 1EL7A 1F6MA 3LZWA 4IA5A 2V60A 2YWLA 5FS7A 2B76A 1Q9IA 2C75A 4ZCDA 3RNMA 4Y4NA 4Z2RA 4YTMA 3AE2A 2F5ZA 4U8OA 1NHPA 1YKJA 1ZY8A 1CJ4A 2YLTA 4DGKA 1E1LA 3H4KA 4BK2A 4EMWA 3G5RA 1H7XA 3LZXA 3QSMA 5J60A 3NT6A 2BXSA 3CNTA 2VRLA 3UP5A 4GDEA 3CPIG 2XYOA 5JCLA 1KSUA 2BS4A 3NH3X 1D7YA 4PAAA 4U8MA 3K7TA 4BV6A 3M12A 3ALLA 4H4YA 3AE8A 2VZ2A 1CJ2A 1EBDA 3CGEA 2XDOA 4CY6A 3B3RA 2GMHA 3UOZA 3I3LA 4J56A 2B7RA 4X9NA 2QA1A 2A89A 2WDVA 4BURA 3NTAA 4OVIA 1ZP0A 4GR1A 2C3DA 1S2YA 1TDFA 3CGBA 3Q6JA 1VRQB 3NHOX 4USQA 1ZOVA 2C70A 2Q0KA 5CKUA 1YQ3A 5C2TA 1JRYA 3L8KA 4YSHA 1Y56A 3I6DA 3VR9A 1SEZA 4BJYA 5JCKA 1LQTA 2X8HA 3F8DA 3CNSA 4CRTA 3LOVA 3BI4A 4KPRA 3VQRA 3AD8B 1FL2A 3DH9A 3QSEA 2VVMA 1S2QA 1TYPA 2AAQA 5U63A 2GQWA 4REKA 2C73A 3RP6A 2WP6A 5JCNA 2GV8A 4WX1A 3K7MX 1M64A 3BHFA 5HHFA 2YG5A 5HY5A 4UDQA 1MXTA 3NRNA 3DJJA 2DKIA 4FX9A 1OJTA 3ICTA 3C4AA 2AR8A 3KPFA 4IV9A 3KD9A 2TMDA 3AYIA 4J31A 1B37A 2XFOA 1H7WA 2CVJA 4JY3A 4A5LA 3CTYA 1ZDLA 2GF3A 2YLXA 3NLCA 4U2TA 2WOIA 1ZMDA 2GMJA 2WPCA 1CF3A 3P4SA 4H4WA 4H4VA 4XWRA 1KDGA 1NEKA 3KA7A 1ZOYA 2R4EA 1TRBA 2BACA 3ALJA 1DOCA 4CNJA 2BCPA 2EQ6A 4U8PA 1IUUA 1N1PA 3FMWA 3ADAB 3QFAA 4E0VA 1GTEA 2A87A 1JNRA 2B9XA 3EF6A 3AWIA 2Y6QA 5C3JA 1B8SA
chains in the Genus database with same CATH superfamily
1MO9A 1F8SA 2GR1A 3COXA 3P4PA 3UKFA 4GAVA 4J57A 2YM1A 1NDAA 1QJDA 1GRGA 3FPZA 3IC9A 4XWZA 5EB5A 3HYXA 2R4JA 3BI5A 3G5SA 5KWFA 4J2WA 4J36A 3UOVA 3DMEA 2PHHA 1L9DA 2WQYA 1V59A 4O5UA 1KNRA 1O95A 3NN6X 3UTGA 3HYWA 1Q1RA 5EBKA 1CC4A 4NZHA 2VQBA 4J33A 1GPEA 2X50A 3ABVA 4DSGA 3KU9A 4H4PA 1K0JA 4NWZA 3HZLA 1FOHA 3C96A 1PBCA 3UKAA 1TDNA 3V3NA 5LV9A 2NVKX 2XLSA 3V3OA 1PXCA 3AEAA 4H2QA 4TM1A 4KX6A 3GWDA 2FJEA 2JBVA 4TLZA 4B65A 2WP9A 5M0ZA 3H8IA 4B68A 3NG7X 1LQUA 4II3A 4AT2A 3VRDB 2YLRA 1AOGA 3R9UA 2WEUA 2XVIA 4CY8A 2ZZ0A 1H86A 3G5QA 4LU6A 1PJ7A 2FJDA 1GETA 2WPFA 2GQFA 4C3YA 2WESA 3H8LA 1OJ9A 4Z2TA 1RP0A 2XVHA 3AEBA 2WBAA 3AEDA 3UCLA 4D03A 1TDEA 2QA2A 1IUSA 4NEVA 2YG4A 2V3BA 1FECA 3AD9B 2BA9A 2GR0A 2TPRA 3AECA 4LA1A 1GRHA 1LPFA 2OA1A 2WU2A 5EOWA 3T2YA 4IVMB 4A65A 1KF6A 1NHRA 1PDHA 3GWFA 3NKSA 4TM3A 3DA1A 4GUVA 3UOXA 1GALA 2Z5YA 3P4QA 3CNJA 4ZCCA 1BKWA 2E5VA 3AEEA 3CPJG 1KNPA 4B67A 4Z26A 3DK9A 3AE9A 3NK1X 3NTDA 2OLNA 2R0CA 1PJ6A 5DBJA 4B66A 2OAMA 2RABA 4G6HA 3NGCX 4EM3A 4GDPA 2BABA 1NHQA 2JKCA 2UZZA 2C72A 4K5RA 2YVJA 3S5WA 3AXBA 4I59A 3UKQA 3DGHA 4YTNA 3GMBA 3IHGA 4UDRA 4EMIA 2XLTA 4RSLA 1CJCA 5CQFA 4CCQA 1JRZA 3DK8A 2ZZBA 3SQPA 1CJ3A 3WE0A 5JCIA 4X4JA 5GSNA 5KVIA 2BS2A 3RP7A 1S3EA 3GYJA 1GT8A 2BK5A 4CBQA 1BWCA 2QAEA 2XFNA 3F8RA 5TR3A 2YM2A 1GREA 3EAOA 4Z43A 3AE3A 3VRBA 4C77A 3UKKA 3VRAA 5IPYA 3DJDA 1COYA 4DNAA 2R0PA 1DODA 4OPGA 1IUWA 2BRAA 3SM8A 3VR8A 2WP5A 4G6GA 3BNUA 4B64A 2YAUA 4OCGA 4A7AA 2WDQA 4U8NA 4JY2A 4ECHA 3BI2A 1FCDA 3O0HA 4YSYA 3AE5A 4YSXA 3CIRA 2YVFA 4NTCA 4O5QA 4H7UA 4NEWA 4UP3A 4A6NA 3AEGA 2JK6A 2C7GA 3FIMB 2WPEA 1PBDA 1DJQA 1REOA 2FBWA 2W0HA 3M0OA 4N9XA 3L1RA 3UOYA 3SFEA 1JU2A 1PJ5A 1Y56B 2E4GA 3F8PA 1XDIA 2YVGA 3T2KA 4RG4A 1ONFA 2IVDA 1GRAA 5HXIA 2C64A 1TDOA 4H2PA 4JNQA 2JB1A 3NN0X 1ZX9A 1PXBA 5KMQA 5HYMA 2C66A 2EQ9A 1GEUA 2GVCA 1VDCA 2EQ8A 3FBSA 2B9WA 3UTHA 3LJPA 4TLXA 3CNPA 3NK0X 3SY4A 4ADWA 4YT0A 3II4A 3ATRA 5IQ4A 4UDPA 3T31A 1N4UA 1QLBA 1YY5A 1ZK7A 1JOAA 4FK1C 4GAPA 5FS6A 3SX6A 4Z25A 3NK2X 5L46A 1PBBA 2BRYA 2XLUA 3LADA 1Q1WA 1K0IA 4OPUA 2Z5XA 5BULA 1F8WA 3P9UA 3QFBA 5FS9A 3UKHA 4H4SA 3UP4A 4P9SA 4BJZA 2YG3A 3ZYXA 1MOKA 3QJ4A 2R9ZA 4EQXA 2C76A 3P1WA 4YKFA 1E1NA 3SZ0A 3NYEA 3ATQA 3CNDA 4H2RA 2GR2A 3GDPA 3KLJA 2XLPA 2YR6A 1L9CA 2R0GA 2GR3A 3GMCA 3RP8A 4U8JA 1FEAA 5BVAA 3CMMA 4XXGA 2APGA 2C3CA 4K5SA 1BF3A 2ZZCA 3PS9A 1QO8A 3EANA 3UKLA 1H83A 1XANA 1CC2A 1ZKQA 5KMRA 3DK4A 3AE6A 4K22A 3UTEA 1YQ4A 4C74A 4EMJA 3NYCA 4BK1A 2E1MA 1E1KA 3GD3A 2A8XA 4C3XA 4EIQA 2BK4A 2XVFA 4OPDA 2WOWA 2WETA 1LVLA 1PBFA 4ZN0A 1P2HA 3K7QX 3AYJA 4GRTA 1O94A 3D8XA 4G73A 4AOXA 1ZMCA 1F8RA 1Y0PA 4EQWA 2Q6UA 3ISHA 3GSIA 2V6OA 4USRA 1OJCA 5GRTA 3DGZA 4U8LA 1P2EA 5U1OA 3SFDA 5BRTA 4TM4A 1NAAA 4X9MA 4APNA 1E39A 4EM4A 1GRBA 4JDRA 4TM0A 1W4XA 3OC4A 1CC6A 3CN8A 1OJAA 1GRTA 3PO7A 3Q9TA 1GSNA 2VVLG 3AYLA 5IQ1A 4H4TA 2ACZA 2VRMA 2WDRA 1JNZA 1PBEA 2FJAA 4OPCA 4YXDA 1H82A 2XFUA 4HB9A 3V76A 2YG7A 4B63A 1VQWA 2EQ7A 1RSGA 3K30A 2X3NA 2OALA 2R46A 3E1TA 1N4VA 4H2NA 2RGHA 4H4ZA 3DJGX 3QVRA 3NYFA 2Q7VA 4IA6A 4CCRA 1EL8A 2AQJA 1F3PA 2GRTA 1NG4A 3CGCA 2YR5A 4H4UA 5FS8A 1EL9A 2GAGB 4B1BA 1K0LA 2FJBA 2WU5A 2YQUA 2ZBWA 5FMHA 3NNEA 2Q0LA 1D5TA 2OLOA 2CDUA 2JB2A 2X99A 4JN9A 1DJNA 2NPXA 4IVOB 1D4EA 1M6IA 1O5WA 4H4QA 4D04A 3T2ZA 3AE7A 3REDA 1NPXA 3KPKA 4AP3A 3OZ2A 3IHMA 1BGNA 2BS3A 2WHDA 3HYVA 2I0ZA 3JSKA 4YKGA 4A99A 5JCMA 2H88A 4LIIA 5KXJA 4U2LA 4GCMA 2B9YA 3GRSA 4H4RA 4K7ZA 3QVPA 1PS9A 4ICYA 3T14A 4A9WA 5BUKA 2C65A 4JNAA 1GOSA 3AEFA 3ZDNA 1BZLA 3GD4A 2GH5A 3CPHG 1L0VA 1JRXA 3LXDA 1K4QA 2IIDA 1KSSA 3AE1A 4M52A 3AD7B 1B4VA 1NHSA 2J3NA 3GYIA 4NNJA 2VQ7A 2HQMA 2GB0A 1GV4A 1GRFA 1E6EA 2RGOA 1EL5A 3FG2P 2X8GA 5KVHA 3UTFA 3EPTA 4H50A 4PABA 1FEBA 4GF7A 1DOEA 2RGJA 3IWAA 3SZFA 4YSZA 4U2SA 3DJEA 2C67A 3PVCA 4NTDA 4I58A 3M13A 4K2XA 4H4XA 2CFYA 3QSSA 1B5QA 4G74A 2XVJA 1S3BA 1GNDA 2CULA 1OJDA 1CBOA 4NTEA 4A6NB 1GTHA 4BK3A 5J7XA 1L9EA 2BC0A 4EQRA 1PXAA 4J34A 3ITJA 1Z6LA 4WCTA 3SYIA 2YG6A 3NIXA 4K8DA 2YLSA 4AP1A 1GXFA 1LJ1A 1N4WA 2V61A 4EQSA 2IVEA 1XHCA 1XPQA 2VOUA 3T37A 3ICSA 5KMSA 2YLZA 2Y6RA 1JEHA 1VG0A 2WS3A 1IJHA 1RYIA 2WOVA 2YR4A 1UKVG 2O9ZA 4OPLA 4A79A 3KVEA 1DOBA 4G9KA 4HA6A 2ARDA 1IUTA 1X31B 1TYTA 3SGLA 1H84A 4U8KA 2XFPA 1GESA 1YQZA 4Y4LA 5M10A 3LB8A 4OPTA 1DXLA 3P4RA 3AE4A 1VG9A 2BXRA 4DSHA 4EIPA 2YLWA 1CL0A 1D7LA 1LTXR 4Z24A 1D4CA 1DNCA 1TDKA 1PHHA 3GDNA 1NENA 4RG3A 3S61A 4AT0A 2BYBA 4JQ9A 3ALMA 3IF9A 5EB4A 5ER0A 1PN0A 2GAHB 4B69A 4AOSA 2BCGG 2JB3A 2V3AA 1GERA 4MJWA 4Z2UA 1LV0A 4Z44A 4YTPA 1H81A 4FDCB 5U25A 1NG3A 1CHUA 2BC1A 3RHAA 1HYUA 2GEWA 3GRTA 3C4NA 4CNKA 2JAEA 3D1CA 1KFYA 2XFQA 3UKPA 3SZWA 3BHKA 1IUXA 2XVEA 2QCUA 5KOWA 1ELIA 2BK3A 3B6DA 3BNMA 3KKJA 3CGDA 5KRQA 2DKHA 2XLRA 2R45A 4U8IA 3ICRA 3AB1A 2VVLA 2B7SA 5KMPA 1BGJA 2PYXA 4FK1A 5KOXA 4Y4MA 4OPIA 1H6VA 1IUVA 2X8CA 2XCGA 1E7PA 2V5ZA 2H89A 1E1MA 4C5OA 1D4DA 4YWOA 3URHA 1EL7A 1F6MA 3LZWA 4IA5A 2V60A 2YWLA 5FS7A 2B76A 1Q9IA 2C75A 4ZCDA 3RNMA 4Y4NA 4Z2RA 4YTMA 3AE2A 2F5ZA 4U8OA 1NHPA 1YKJA 1ZY8A 3SZCA 1CJ4A 2YLTA 4DGKA 1E1LA 3H4KA 4BK2A 4EMWA 3G5RA 1H7XA 3LZXA 3GYXA 3QSMA 5J60A 3NT6A 2BXSA 3CNTA 2VRLA 3UP5A 4GDEA 3CPIG 2XYOA 5JCLA 1KSUA 2BS4A 3T0KA 3NH3X 1D7YA 4PAAA 4U8MA 3K7TA 4BV6A 3M12A 3ALLA 4H4YA 3AE8A 2VZ2A 1CJ2A 1EBDA 3CGEA 2XDOA 4CY6A 3B3RA 2GMHA 3UOZA 3I3LA 4J56A 2B7RA 4X9NA 2QA1A 2A89A 2WDVA 4BURA 3NTAA 4OVIA 1ZP0A 4GR1A 2C3DA 3SXIA 1S2YA 1TDFA 3CGBA 3Q6JA 1VRQB 3NHOX 4USQA 1ZOVA 2C70A 2Q0KA 5CKUA 1YQ3A 5C2TA 1JRYA 3L8KA 4YSHA 1Y56A 2C4CA 3I6DA 3VR9A 1SEZA 4BJYA 5JCKA 1LQTA 2X8HA 3F8DA 3CNSA 4CRTA 3LOVA 3BI4A 4KPRA 3VQRA 3AD8B 1FL2A 3DH9A 3QSEA 2VVMA 1S2QA 1TYPA 2AAQA 5U63A 2GQWA 4REKA 2C73A 3RP6A 2WP6A 5JCNA 2GV8A 4WX1A 3K7MX 1M64A 3BHFA 5HHFA 2YG5A 5HY5A 4UDQA 5KNLA 1MXTA 3NRNA 3DJJA 2DKIA 4FX9A 1OJTA 3ICTA 3C4AA 2AR8A 3KPFA 4IV9A 3KD9A 2TMDA 3AYIA 4J31A 1B37A 2XFOA 1H7WA 2CVJA 4JY3A 4A5LA 3CTYA 1ZDLA 2GF3A 2YLXA 3NLCA 4U2TA 2WOIA 1ZMDA 2GMJA 2WPCA 1CF3A 3P4SA 4II2A 4H4WA 4H4VA 4XWRA 1KDGA 1NEKA 3KA7A 1ZOYA 2R4EA 1TRBA 2BACA 3ALJA 1DOCA 4CNJA 2BCPA 2EQ6A 4U8PA 1IUUA 1N1PA 3FMWA 3ADAB 3QFAA 4E0VA 1GTEA 2A87A 1JNRA 2B9XA 3EF6A 3AWIA 2Y6QA 5C3JA 1B8SA
chains in the Genus database with same CATH topology
1MO9A 1F8SA 2GR1A 3COXA 3P4PA 3UKFA 4GAVA 4J57A 2YM1A 1NDAA 1QJDA 1GRGA 3FPZA 3IC9A 4XWZA 5EB5A 3HYXA 2R4JA 3BI5A 3G5SA 5KWFA 4J2WA 4J36A 3UOVA 3DMEA 2PHHA 1L9DA 2WQYA 1V59A 4O5UA 1KNRA 1O95A 3NN6X 3UTGA 3HYWA 1Q1RA 5EBKA 1CC4A 4NZHA 2VQBA 4J33A 1GPEA 2X50A 3ABVA 4DSGA 3KU9A 4H4PA 1K0JA 4NWZA 3HZLA 1FOHA 3C96A 1PBCA 3UKAA 1TDNA 3V3NA 5LV9A 2NVKX 2XLSA 3V3OA 1PXCA 3AEAA 4H2QA 4TM1A 4KX6A 3GWDA 2FJEA 2JBVA 4TLZA 4B65A 2WP9A 5M0ZA 3H8IA 4B68A 3NG7X 1LQUA 4II3A 4AT2A 3VRDB 2YLRA 1AOGA 3R9UA 2WEUA 2XVIA 4CY8A 2ZZ0A 1H86A 3G5QA 4LU6A 1PJ7A 2FJDA 1GETA 2WPFA 2GQFA 4C3YA 2WESA 3H8LA 1OJ9A 4Z2TA 1RP0A 2XVHA 3AEBA 2WBAA 3AEDA 3UCLA 4D03A 1TDEA 2QA2A 1IUSA 4NEVA 2YG4A 2V3BA 1FECA 3AD9B 2BA9A 2GR0A 2TPRA 3AECA 4LA1A 1GRHA 1LPFA 2OA1A 2WU2A 5EOWA 3T2YA 4IVMB 4A65A 1KF6A 1NHRA 1PDHA 3GWFA 3NKSA 4TM3A 3DA1A 4GUVA 3UOXA 1GALA 2Z5YA 3P4QA 3CNJA 4ZCCA 1BKWA 2E5VA 3AEEA 3CPJG 1KNPA 4B67A 4Z26A 3DK9A 3AE9A 3NK1X 3NTDA 2OLNA 2R0CA 1PJ6A 5DBJA 4B66A 2OAMA 2RABA 4G6HA 3NGCX 4EM3A 4GDPA 2BABA 1NHQA 2JKCA 2UZZA 2C72A 4K5RA 2YVJA 3S5WA 3AXBA 4I59A 3UKQA 3DGHA 4YTNA 3GMBA 3IHGA 4UDRA 4EMIA 2XLTA 4RSLA 1CJCA 5CQFA 4CCQA 1JRZA 3DK8A 2ZZBA 3SQPA 1CJ3A 3WE0A 5JCIA 4X4JA 5GSNA 5KVIA 2BS2A 3RP7A 1S3EA 3GYJA 1GT8A 2BK5A 4CBQA 1BWCA 2QAEA 2XFNA 3F8RA 5TR3A 2YM2A 1GREA 3EAOA 4Z43A 3AE3A 3VRBA 4C77A 3UKKA 3VRAA 5IPYA 3DJDA 1COYA 4DNAA 2R0PA 1DODA 4OPGA 1IUWA 2BRAA 3SM8A 3VR8A 2WP5A 4G6GA 3BNUA 4B64A 2YAUA 4OCGA 4A7AA 2WDQA 4U8NA 4JY2A 4ECHA 3BI2A 1FCDA 3O0HA 4YSYA 3AE5A 4YSXA 3CIRA 2YVFA 4NTCA 4O5QA 4H7UA 4NEWA 4UP3A 4A6NA 3AEGA 2JK6A 2C7GA 3FIMB 2WPEA 1PBDA 1DJQA 1REOA 2FBWA 2W0HA 3M0OA 4N9XA 3L1RA 3UOYA 3SFEA 1JU2A 1PJ5A 1Y56B 2E4GA 3F8PA 1XDIA 2YVGA 3T2KA 4RG4A 1ONFA 2IVDA 1GRAA 5HXIA 2C64A 1TDOA 4H2PA 4JNQA 2JB1A 3NN0X 1ZX9A 1PXBA 5KMQA 5HYMA 2C66A 2EQ9A 1GEUA 2GVCA 1VDCA 2EQ8A 3FBSA 2B9WA 3UTHA 3LJPA 4TLXA 3CNPA 3NK0X 3SY4A 4ADWA 4YT0A 3II4A 3ATRA 5IQ4A 4UDPA 3T31A 1N4UA 1QLBA 1YY5A 1ZK7A 1JOAA 4FK1C 4GAPA 5FS6A 3SX6A 4Z25A 3NK2X 5L46A 1PBBA 2BRYA 2XLUA 3LADA 1Q1WA 1K0IA 4OPUA 2Z5XA 5BULA 1F8WA 3P9UA 3QFBA 5FS9A 3UKHA 4H4SA 3UP4A 4P9SA 4BJZA 2YG3A 3ZYXA 1MOKA 3QJ4A 2R9ZA 4EQXA 2C76A 3P1WA 4YKFA 1E1NA 3SZ0A 3NYEA 3ATQA 3CNDA 4H2RA 2GR2A 3GDPA 3KLJA 2XLPA 2YR6A 1L9CA 2R0GA 2GR3A 3GMCA 3RP8A 4U8JA 1FEAA 5BVAA 3CMMA 4XXGA 2APGA 2C3CA 4K5SA 1BF3A 2ZZCA 3PS9A 1QO8A 3EANA 3UKLA 1H83A 1XANA 1CC2A 1ZKQA 5KMRA 3DK4A 3AE6A 4K22A 3UTEA 1YQ4A 4C74A 4EMJA 3NYCA 4BK1A 2E1MA 1E1KA 3GD3A 2A8XA 4C3XA 4EIQA 2BK4A 2XVFA 4OPDA 2WOWA 2WETA 1LVLA 1PBFA 4ZN0A 1P2HA 3K7QX 3AYJA 4GRTA 1O94A 3D8XA 4G73A 4AOXA 1ZMCA 1F8RA 1Y0PA 4EQWA 2Q6UA 3ISHA 3GSIA 2V6OA 4USRA 1OJCA 5GRTA 3DGZA 4U8LA 1P2EA 5U1OA 3SFDA 5BRTA 4TM4A 1NAAA 4X9MA 4APNA 1E39A 4EM4A 1GRBA 4JDRA 4TM0A 1W4XA 3OC4A 1CC6A 3CN8A 1OJAA 1GRTA 3PO7A 3Q9TA 1GSNA 2VVLG 3AYLA 5IQ1A 4H4TA 2ACZA 2VRMA 2WDRA 1JNZA 1PBEA 2FJAA 4OPCA 4YXDA 1H82A 2XFUA 4HB9A 3V76A 2YG7A 4B63A 1VQWA 2EQ7A 1RSGA 3K30A 2X3NA 2OALA 2R46A 3E1TA 1N4VA 4H2NA 2RGHA 4H4ZA 3DJGX 3QVRA 3NYFA 2Q7VA 4IA6A 4CCRA 1EL8A 2AQJA 1F3PA 2GRTA 1NG4A 3CGCA 2YR5A 4H4UA 5FS8A 1EL9A 2GAGB 4B1BA 1K0LA 2FJBA 2WU5A 2YQUA 2ZBWA 5FMHA 3NNEA 2Q0LA 1D5TA 2OLOA 2CDUA 2JB2A 2X99A 4JN9A 1DJNA 2NPXA 4IVOB 1D4EA 1M6IA 1O5WA 4H4QA 4D04A 3T2ZA 3AE7A 3REDA 1NPXA 3KPKA 4AP3A 3OZ2A 3IHMA 1BGNA 2BS3A 2WHDA 3HYVA 2I0ZA 3JSKA 4YKGA 4A99A 5JCMA 2H88A 4LIIA 5KXJA 4U2LA 4GCMA 2B9YA 3GRSA 4H4RA 4K7ZA 3QVPA 1PS9A 4ICYA 3T14A 4A9WA 5BUKA 2C65A 4JNAA 1GOSA 3AEFA 3ZDNA 1BZLA 3GD4A 2GH5A 3CPHG 1L0VA 1JRXA 3LXDA 1K4QA 2IIDA 1KSSA 3AE1A 4M52A 3AD7B 1B4VA 1NHSA 2J3NA 3GYIA 4NNJA 2VQ7A 2HQMA 2GB0A 1GV4A 1GRFA 1E6EA 2RGOA 1EL5A 3FG2P 2X8GA 5KVHA 3UTFA 3EPTA 4H50A 4PABA 1FEBA 4GF7A 1DOEA 2RGJA 3IWAA 3SZFA 4YSZA 4U2SA 3DJEA 2C67A 3PVCA 4NTDA 4I58A 3M13A 4K2XA 4H4XA 2CFYA 3QSSA 1B5QA 4G74A 2XVJA 1S3BA 1GNDA 2CULA 1OJDA 1CBOA 4NTEA 4A6NB 1GTHA 4BK3A 5J7XA 1L9EA 2BC0A 4EQRA 1PXAA 4J34A 3ITJA 1Z6LA 4WCTA 3SYIA 2YG6A 3NIXA 4K8DA 2YLSA 4AP1A 1GXFA 1LJ1A 1N4WA 2V61A 4EQSA 2IVEA 1XHCA 1XPQA 2VOUA 3T37A 3ICSA 5KMSA 2YLZA 2Y6RA 1JEHA 1VG0A 2WS3A 1IJHA 1RYIA 2WOVA 2YR4A 1UKVG 2O9ZA 4OPLA 4A79A 3KVEA 1DOBA 4G9KA 4HA6A 2ARDA 1IUTA 1X31B 1TYTA 3SGLA 1H84A 4U8KA 2XFPA 1GESA 1YQZA 4Y4LA 5M10A 3LB8A 4OPTA 1DXLA 3P4RA 3AE4A 1VG9A 2BXRA 4DSHA 4EIPA 2YLWA 1CL0A 1D7LA 1LTXR 4Z24A 1D4CA 1DNCA 1TDKA 1PHHA 3GDNA 1NENA 4RG3A 3S61A 4AT0A 2BYBA 4JQ9A 3ALMA 3IF9A 5EB4A 5ER0A 1PN0A 2GAHB 4B69A 4AOSA 2BCGG 2JB3A 2V3AA 1GERA 4MJWA 4Z2UA 1LV0A 4Z44A 4YTPA 1H81A 4FDCB 5U25A 1NG3A 1CHUA 2BC1A 3RHAA 1HYUA 2GEWA 3GRTA 3C4NA 4CNKA 2JAEA 3D1CA 1KFYA 2XFQA 3UKPA 3SZWA 3BHKA 1IUXA 2XVEA 2QCUA 5KOWA 1ELIA 2BK3A 3B6DA 3BNMA 3KKJA 3CGDA 5KRQA 2DKHA 2XLRA 2R45A 4U8IA 3ICRA 3AB1A 2VVLA 2B7SA 5KMPA 1BGJA 2PYXA 4FK1A 5KOXA 4Y4MA 4OPIA 1H6VA 1IUVA 2X8CA 2XCGA 1E7PA 2V5ZA 2H89A 1E1MA 4C5OA 1D4DA 4YWOA 3URHA 1EL7A 1F6MA 3LZWA 4IA5A 2V60A 2YWLA 5FS7A 2B76A 1Q9IA 2C75A 4ZCDA 3RNMA 4Y4NA 4Z2RA 4YTMA 3AE2A 2F5ZA 4U8OA 1NHPA 1YKJA 1ZY8A 3SZCA 1CJ4A 2YLTA 4DGKA 1E1LA 3H4KA 4BK2A 4EMWA 3G5RA 1H7XA 3LZXA 3GYXA 3QSMA 5J60A 3NT6A 2BXSA 3CNTA 2VRLA 3UP5A 4GDEA 3CPIG 2XYOA 5JCLA 1KSUA 2BS4A 3T0KA 3NH3X 1D7YA 4PAAA 4U8MA 3K7TA 4BV6A 3M12A 3ALLA 4H4YA 3AE8A 2VZ2A 1CJ2A 1EBDA 3CGEA 2XDOA 4CY6A 3B3RA 2GMHA 3UOZA 3I3LA 4J56A 2B7RA 4X9NA 2QA1A 2A89A 2WDVA 4BURA 3NTAA 4OVIA 1ZP0A 4GR1A 2C3DA 3SXIA 1S2YA 1TDFA 3CGBA 3Q6JA 1VRQB 3NHOX 4USQA 1ZOVA 2C70A 2Q0KA 5CKUA 1YQ3A 5C2TA 1JRYA 3L8KA 4YSHA 1Y56A 2C4CA 3I6DA 3VR9A 1SEZA 4BJYA 5JCKA 1LQTA 2X8HA 3F8DA 3CNSA 4CRTA 3LOVA 3BI4A 4KPRA 3VQRA 3AD8B 1FL2A 3DH9A 3QSEA 2VVMA 1S2QA 1TYPA 2AAQA 5U63A 2GQWA 4REKA 2C73A 3RP6A 2WP6A 5JCNA 2GV8A 4WX1A 3K7MX 1M64A 3BHFA 5HHFA 2YG5A 5HY5A 4UDQA 5KNLA 1MXTA 3NRNA 3DJJA 2DKIA 4FX9A 1OJTA 3ICTA 3C4AA 2AR8A 3KPFA 4IV9A 3KD9A 2TMDA 3AYIA 4J31A 1B37A 2XFOA 1H7WA 2CVJA 4JY3A 4A5LA 3CTYA 1ZDLA 2GF3A 2YLXA 3NLCA 4U2TA 2WOIA 1ZMDA 2GMJA 2WPCA 1CF3A 3P4SA 4II2A 4H4WA 4H4VA 4XWRA 1KDGA 1NEKA 3KA7A 1ZOYA 2R4EA 1TRBA 2BACA 3ALJA 1DOCA 4CNJA 2BCPA 2EQ6A 4U8PA 1IUUA 1N1PA 3FMWA 3ADAB 3QFAA 4E0VA 1GTEA 2A87A 1JNRA 2B9XA 3EF6A 3AWIA 2Y6QA 5C3JA 1B8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MO9 A;  1F8S A;  2GR1 A;  3COX A;  3P4P A;  3UKF A;  4J57 A;  2YM1 A;  1NDA A;  1QJD A;  1GRG A;  3FPZ A;  3IC9 A;  4XWZ A;  5EB5 A;  2R4J A;  3BI5 A;  3G5S A;  5KWF A;  4J2W A;  4J36 A;  3UOV A;  3DME A;  2PHH A;  1L9D A;  2WQY A;  1V59 A;  4O5U A;  1KNR A;  1O95 A;  3NN6 X;  3UTG A;  1Q1R A;  5EBK A;  1CC4 A;  4NZH A;  2VQB A;  4J33 A;  1GPE A;  2X50 A;  3ABV A;  4DSG A;  3KU9 A;  4H4P A;  1K0J A;  3HZL A;  1FOH A;  3C96 A;  1PBC A;  3UKA A;  1TDN A;  3V3N A;  5LV9 A;  2NVK X;  2XLS A;  3V3O A;  1PXC A;  3AEA A;  4H2Q A;  4TM1 A;  4KX6 A;  3GWD A;  2FJE A;  2JBV A;  4TLZ A;  4B65 A;  2WP9 A;  5M0Z A;  3H8I A;  4B68 A;  3NG7 X;  1LQU A;  4AT2 A;  3VRD B;  2YLR A;  1AOG A;  3R9U A;  2WEU A;  2XVI A;  4CY8 A;  2ZZ0 A;  1H86 A;  3G5Q A;  4LU6 A;  1PJ7 A;  2FJD A;  1GET A;  2WPF A;  2GQF A;  4C3Y A;  2WES A;  3H8L A;  1OJ9 A;  4Z2T A;  1RP0 A;  2XVH A;  3AEB A;  2WBA A;  3AED A;  3UCL A;  4D03 A;  1TDE A;  2QA2 A;  1IUS A;  4NEV A;  2YG4 A;  2V3B A;  1FEC A;  3AD9 B;  2BA9 A;  2GR0 A;  2TPR A;  3AEC A;  4LA1 A;  1GRH A;  1LPF A;  2OA1 A;  2WU2 A;  5EOW A;  4IVM B;  4A65 A;  1KF6 A;  1NHR A;  1PDH A;  3GWF A;  3NKS A;  4TM3 A;  3DA1 A;  4GUV A;  3UOX A;  1GAL A;  2Z5Y A;  3P4Q A;  3CNJ A;  4ZCC A;  1BKW A;  2E5V A;  3AEE A;  3CPJ G;  1KNP A;  4B67 A;  4Z26 A;  3DK9 A;  3AE9 A;  3NK1 X;  3NTD A;  2OLN A;  2R0C A;  1PJ6 A;  5DBJ A;  4B66 A;  2OAM A;  2RAB A;  3NGC X;  4EM3 A;  4GDP A;  2BAB A;  1NHQ A;  2JKC A;  2UZZ A;  2C72 A;  4K5R A;  2YVJ A;  3S5W A;  3AXB A;  4I59 A;  3UKQ A;  3DGH A;  4YTN A;  3GMB A;  3IHG A;  4UDR A;  4EMI A;  2XLT A;  4RSL A;  1CJC A;  5CQF A;  4CCQ A;  1JRZ A;  3DK8 A;  2ZZB A;  3SQP A;  1CJ3 A;  3WE0 A;  5JCI A;  4X4J A;  5GSN A;  5KVI A;  2BS2 A;  3RP7 A;  1S3E A;  3GYJ A;  1GT8 A;  2BK5 A;  4CBQ A;  1BWC A;  2QAE A;  2XFN A;  3F8R A;  5TR3 A;  2YM2 A;  1GRE A;  3EAO A;  4Z43 A;  3AE3 A;  3VRB A;  4C77 A;  3UKK A;  3VRA A;  5IPY A;  3DJD A;  1COY A;  4DNA A;  2R0P A;  1DOD A;  4OPG A;  1IUW A;  3SM8 A;  3VR8 A;  2WP5 A;  3BNU A;  4B64 A;  2YAU A;  4OCG A;  4A7A A;  2WDQ A;  4U8N A;  4JY2 A;  4ECH A;  3BI2 A;  1FCD A;  3O0H A;  4YSY A;  3AE5 A;  4YSX A;  3CIR A;  2YVF A;  4NTC A;  4O5Q A;  4H7U A;  4NEW A;  4UP3 A;  4A6N A;  3AEG A;  2JK6 A;  2C7G A;  3FIM B;  2WPE A;  1PBD A;  1DJQ A;  1REO A;  2FBW A;  2W0H A;  3M0O A;  4N9X A;  3L1R A;  3UOY A;  3SFE A;  1JU2 A;  1PJ5 A;  1Y56 B;  2E4G A;  3F8P A;  1XDI A;  2YVG A;  4RG4 A;  1ONF A;  2IVD A;  1GRA A;  5HXI A;  2C64 A;  1TDO A;  4H2P A;  4JNQ A;  2JB1 A;  3NN0 X;  1ZX9 A;  1PXB A;  5HYM A;  2C66 A;  2EQ9 A;  1GEU A;  2GVC A;  1VDC A;  2EQ8 A;  3FBS A;  2B9W A;  3UTH A;  3LJP A;  4TLX A;  3CNP A;  3NK0 X;  4ADW A;  4YT0 A;  3II4 A;  3ATR A;  5IQ4 A;  4UDP A;  1N4U A;  1QLB A;  1YY5 A;  1ZK7 A;  1JOA A;  4FK1 C;  5FS6 A;  4Z25 A;  3NK2 X;  5L46 A;  1PBB A;  2XLU A;  3LAD A;  1Q1W A;  1K0I A;  4OPU A;  2Z5X A;  5BUL A;  1F8W A;  3P9U A;  3QFB A;  5FS9 A;  3UKH A;  4H4S A;  3UP4 A;  4P9S A;  4BJZ A;  2YG3 A;  3ZYX A;  1MOK A;  3QJ4 A;  2R9Z A;  4EQX A;  2C76 A;  3P1W A;  4YKF A;  1E1N A;  3NYE A;  3ATQ A;  3CND A;  4H2R A;  2GR2 A;  3GDP A;  3KLJ A;  2XLP A;  2YR6 A;  1L9C A;  2R0G A;  2GR3 A;  3GMC A;  3RP8 A;  4U8J A;  1FEA A;  5BVA A;  4XXG A;  2APG A;  2C3C A;  4K5S A;  1BF3 A;  2ZZC A;  3PS9 A;  1QO8 A;  3EAN A;  3UKL A;  1H83 A;  1XAN A;  1CC2 A;  1ZKQ A;  3DK4 A;  3AE6 A;  4K22 A;  3UTE A;  1YQ4 A;  4C74 A;  4EMJ A;  3NYC A;  4BK1 A;  2E1M A;  1E1K A;  3GD3 A;  2A8X A;  4C3X A;  4EIQ A;  2BK4 A;  2XVF A;  4OPD A;  2WOW A;  2WET A;  1LVL A;  1PBF A;  4ZN0 A;  1P2H A;  3K7Q X;  3AYJ A;  4GRT A;  1O94 A;  3D8X A;  4AOX A;  1ZMC A;  1F8R A;  1Y0P A;  4EQW A;  2Q6U A;  3ISH A;  3GSI A;  2V6O A;  4USR A;  1OJC A;  5GRT A;  3DGZ A;  4U8L A;  1P2E A;  5U1O A;  3SFD A;  5BRT A;  4TM4 A;  1NAA A;  4X9M A;  4APN A;  1E39 A;  4EM4 A;  1GRB A;  4JDR A;  4TM0 A;  1W4X A;  3OC4 A;  1CC6 A;  3CN8 A;  1OJA A;  1GRT A;  3PO7 A;  3Q9T A;  1GSN A;  2VVL G;  3AYL A;  5IQ1 A;  4H4T A;  2ACZ A;  2VRM A;  2WDR A;  1JNZ A;  1PBE A;  2FJA A;  4OPC A;  4YXD A;  1H82 A;  2XFU A;  4HB9 A;  3V76 A;  2YG7 A;  4B63 A;  1VQW A;  2EQ7 A;  1RSG A;  3K30 A;  2X3N A;  2OAL A;  2R46 A;  3E1T A;  1N4V A;  4H2N A;  2RGH A;  4H4Z A;  3DJG X;  3QVR A;  3NYF A;  2Q7V A;  4IA6 A;  4CCR A;  1EL8 A;  2AQJ A;  1F3P A;  2GRT A;  1NG4 A;  3CGC A;  2YR5 A;  4H4U A;  5FS8 A;  1EL9 A;  2GAG B;  4B1B A;  1K0L A;  2FJB A;  2WU5 A;  2YQU A;  2ZBW A;  5FMH A;  3NNE A;  2Q0L A;  1D5T A;  2OLO A;  2CDU A;  2JB2 A;  2X99 A;  4JN9 A;  1DJN A;  2NPX A;  4IVO B;  1D4E A;  1M6I A;  1O5W A;  4H4Q A;  4D04 A;  3AE7 A;  3RED A;  1NPX A;  4AP3 A;  3OZ2 A;  3IHM A;  1BGN A;  2BS3 A;  2WHD A;  3JSK A;  2I0Z A;  4YKG A;  4A99 A;  5JCM A;  2H88 A;  4LII A;  5KXJ A;  4U2L A;  4GCM A;  2B9Y A;  3GRS A;  4H4R A;  4K7Z A;  3QVP A;  1PS9 A;  4ICY A;  4A9W A;  5BUK A;  2C65 A;  4JNA A;  1GOS A;  3AEF A;  3ZDN A;  1BZL A;  3GD4 A;  2GH5 A;  3CPH G;  1L0V A;  1JRX A;  3LXD A;  1K4Q A;  2IID A;  1KSS A;  3AE1 A;  4M52 A;  3AD7 B;  1B4V A;  1NHS A;  2J3N A;  3GYI A;  2VQ7 A;  2HQM A;  2GB0 A;  1GV4 A;  1GRF A;  1E6E A;  2RGO A;  1EL5 A;  3FG2 P;  2X8G A;  5KVH A;  3UTF A;  3EPT A;  4H50 A;  4PAB A;  1FEB A;  4GF7 A;  1DOE A;  2RGJ A;  3IWA A;  4YSZ A;  4U2S A;  3DJE A;  2C67 A;  3PVC A;  4NTD A;  4I58 A;  3M13 A;  4K2X A;  4H4X A;  2CFY A;  3QSS A;  1B5Q A;  4NTE A;  2XVJ A;  1S3B A;  1GND A;  2CUL A;  1OJD A;  1CBO A;  4A6N B;  4BK3 A;  1GTH A;  5J7X A;  1L9E A;  2BC0 A;  4EQR A;  1PXA A;  4J34 A;  3ITJ A;  1Z6L A;  4WCT A;  2YG6 A;  3NIX A;  4K8D A;  2YLS A;  4AP1 A;  1GXF A;  1LJ1 A;  1N4W A;  2V61 A;  4EQS A;  2IVE A;  1XHC A;  1XPQ A;  2VOU A;  3T37 A;  3ICS A;  2YLZ A;  2Y6R A;  1JEH A;  1VG0 A;  2WS3 A;  1IJH A;  1RYI A;  2WOV A;  2YR4 A;  1UKV G;  2O9Z A;  4OPL A;  4A79 A;  3KVE A;  1DOB A;  4HA6 A;  2ARD A;  1IUT A;  1X31 B;  1TYT A;  3SGL A;  1H84 A;  4U8K A;  2XFP A;  1GES A;  1YQZ A;  4Y4L A;  5M10 A;  3LB8 A;  4OPT A;  1DXL A;  3P4R A;  3AE4 A;  1VG9 A;  2BXR A;  4DSH A;  4EIP A;  2YLW A;  1CL0 A;  1D7L A;  1LTX R;  4Z24 A;  1D4C A;  1DNC A;  1TDK A;  1PHH A;  3GDN A;  1NEN A;  4RG3 A;  3S61 A;  4AT0 A;  2BYB A;  4JQ9 A;  3ALM A;  3IF9 A;  5EB4 A;  5ER0 A;  1PN0 A;  2GAH B;  4B69 A;  4AOS A;  2BCG G;  2JB3 A;  2V3A A;  1GER A;  4MJW A;  4Z2U A;  1LV0 A;  4Z44 A;  4YTP A;  1H81 A;  4FDC B;  5U25 A;  1NG3 A;  1CHU A;  2BC1 A;  3RHA A;  1HYU A;  2GEW A;  3GRT A;  3C4N A;  4CNK A;  2JAE A;  3D1C A;  1KFY A;  2XFQ A;  3UKP A;  3BHK A;  1IUX A;  2XVE A;  2QCU A;  5KOW A;  1ELI A;  2BK3 A;  3B6D A;  3BNM A;  3KKJ A;  3CGD A;  5KRQ A;  2DKH A;  2XLR A;  2R45 A;  4U8I A;  3ICR A;  3AB1 A;  2VVL A;  2B7S A;  1BGJ A;  2PYX A;  4FK1 A;  5KOX A;  4Y4M A;  4OPI A;  1H6V A;  1IUV A;  2X8C A;  2XCG A;  1E7P A;  2V5Z A;  2H89 A;  1E1M A;  4C5O A;  1D4D A;  4YWO A;  3URH A;  1EL7 A;  1F6M A;  3LZW A;  4IA5 A;  2V60 A;  2YWL A;  5FS7 A;  2B76 A;  1Q9I A;  2C75 A;  4ZCD A;  3RNM A;  4Y4N A;  4Z2R A;  4YTM A;  3AE2 A;  2F5Z A;  4U8O A;  1NHP A;  1YKJ A;  1ZY8 A;  1CJ4 A;  2YLT A;  4DGK A;  1E1L A;  3H4K A;  4BK2 A;  4EMW A;  3G5R A;  1H7X A;  3LZX A;  3QSM A;  5J60 A;  3NT6 A;  2BXS A;  3CNT A;  2VRL A;  3UP5 A;  4GDE A;  3CPI G;  2XYO A;  5JCL A;  1KSU A;  2BS4 A;  3NH3 X;  1D7Y A;  4PAA A;  4U8M A;  3K7T A;  4BV6 A;  3M12 A;  3ALL A;  4H4Y A;  3AE8 A;  2VZ2 A;  1CJ2 A;  1EBD A;  3CGE A;  2XDO A;  4CY6 A;  3B3R A;  2GMH A;  3UOZ A;  3I3L A;  4J56 A;  2B7R A;  4X9N A;  2QA1 A;  2A89 A;  2WDV A;  4BUR A;  3NTA A;  4OVI A;  1ZP0 A;  4GR1 A;  2C3D A;  1S2Y A;  1TDF A;  3CGB A;  3Q6J A;  1VRQ B;  3NHO X;  4USQ A;  1ZOV A;  2C70 A;  2Q0K A;  5CKU A;  1YQ3 A;  5C2T A;  1JRY A;  3L8K A;  4YSH A;  1Y56 A;  3I6D A;  3VR9 A;  1SEZ A;  4BJY A;  5JCK A;  1LQT A;  2X8H A;  3F8D A;  3CNS A;  4CRT A;  3LOV A;  3BI4 A;  4KPR A;  3VQR A;  3AD8 B;  1FL2 A;  3DH9 A;  3QSE A;  2VVM A;  1S2Q A;  1TYP A;  2AAQ A;  5U63 A;  2GQW A;  4REK A;  2C73 A;  3RP6 A;  2WP6 A;  5JCN A;  2GV8 A;  4WX1 A;  3K7M X;  1M64 A;  3BHF A;  5HHF A;  2YG5 A;  5HY5 A;  4UDQ A;  1MXT A;  3NRN A;  3DJJ A;  2DKI A;  4FX9 A;  1OJT A;  3ICT A;  3C4A A;  2AR8 A;  3KPF A;  4IV9 A;  3KD9 A;  2TMD A;  3AYI A;  4J31 A;  1B37 A;  2XFO A;  1H7W A;  2CVJ A;  4JY3 A;  4A5L A;  3CTY A;  1ZDL A;  2GF3 A;  2YLX A;  3NLC A;  4U2T A;  2WOI A;  1ZMD A;  2GMJ A;  2WPC A;  1CF3 A;  3P4S A;  4H4W A;  4H4V A;  4XWR A;  1KDG A;  1NEK A;  3KA7 A;  1ZOY A;  2R4E A;  1TRB A;  2BAC A;  3ALJ A;  1DOC A;  4CNJ A;  2BCP A;  2EQ6 A;  4U8P A;  1IUU A;  1N1P A;  3FMW A;  3ADA B;  3QFA A;  4E0V A;  1GTE A;  2A87 A;  1JNR A;  2B9X A;  3EF6 A;  3AWI A;  2Y6Q A;  5C3J A;  1B8S A; 
#chains in the Genus database with same CATH topology
 1MO9 A;  1F8S A;  2GR1 A;  3COX A;  3P4P A;  3UKF A;  4GAV A;  4J57 A;  2YM1 A;  1NDA A;  1QJD A;  1GRG A;  3FPZ A;  3IC9 A;  4XWZ A;  5EB5 A;  3HYX A;  2R4J A;  3BI5 A;  3G5S A;  5KWF A;  4J2W A;  4J36 A;  3UOV A;  3DME A;  2PHH A;  1L9D A;  2WQY A;  1V59 A;  4O5U A;  1KNR A;  1O95 A;  3NN6 X;  3UTG A;  3HYW A;  1Q1R A;  5EBK A;  1CC4 A;  4NZH A;  2VQB A;  4J33 A;  1GPE A;  2X50 A;  3ABV A;  4DSG A;  3KU9 A;  4H4P A;  1K0J A;  4NWZ A;  3HZL A;  1FOH A;  3C96 A;  1PBC A;  3UKA A;  1TDN A;  3V3N A;  5LV9 A;  2NVK X;  2XLS A;  3V3O A;  1PXC A;  3AEA A;  4H2Q A;  4TM1 A;  4KX6 A;  3GWD A;  2FJE A;  2JBV A;  4TLZ A;  4B65 A;  2WP9 A;  5M0Z A;  3H8I A;  4B68 A;  3NG7 X;  1LQU A;  4II3 A;  4AT2 A;  3VRD B;  2YLR A;  1AOG A;  3R9U A;  2WEU A;  2XVI A;  4CY8 A;  2ZZ0 A;  1H86 A;  3G5Q A;  4LU6 A;  1PJ7 A;  2FJD A;  1GET A;  2WPF A;  2GQF A;  4C3Y A;  2WES A;  3H8L A;  1OJ9 A;  4Z2T A;  1RP0 A;  2XVH A;  3AEB A;  2WBA A;  3AED A;  3UCL A;  4D03 A;  1TDE A;  2QA2 A;  1IUS A;  4NEV A;  2YG4 A;  2V3B A;  1FEC A;  3AD9 B;  2BA9 A;  2GR0 A;  2TPR A;  3AEC A;  4LA1 A;  1GRH A;  1LPF A;  2OA1 A;  2WU2 A;  5EOW A;  3T2Y A;  4IVM B;  4A65 A;  1KF6 A;  1NHR A;  1PDH A;  3GWF A;  3NKS A;  4TM3 A;  3DA1 A;  4GUV A;  3UOX A;  1GAL A;  2Z5Y A;  3P4Q A;  3CNJ A;  4ZCC A;  1BKW A;  2E5V A;  3AEE A;  3CPJ G;  1KNP A;  4B67 A;  4Z26 A;  3DK9 A;  3AE9 A;  3NK1 X;  3NTD A;  2OLN A;  2R0C A;  1PJ6 A;  5DBJ A;  4B66 A;  2OAM A;  2RAB A;  4G6H A;  3NGC X;  4EM3 A;  4GDP A;  2BAB A;  1NHQ A;  2JKC A;  2UZZ A;  2C72 A;  4K5R A;  2YVJ A;  3S5W A;  3AXB A;  4I59 A;  3UKQ A;  3DGH A;  4YTN A;  3GMB A;  3IHG A;  4UDR A;  4EMI A;  2XLT A;  4RSL A;  1CJC A;  5CQF A;  4CCQ A;  1JRZ A;  3DK8 A;  2ZZB A;  3SQP A;  1CJ3 A;  3WE0 A;  5JCI A;  4X4J A;  5GSN A;  5KVI A;  2BS2 A;  3RP7 A;  1S3E A;  3GYJ A;  1GT8 A;  2BK5 A;  4CBQ A;  1BWC A;  2QAE A;  2XFN A;  3F8R A;  5TR3 A;  2YM2 A;  1GRE A;  3EAO A;  4Z43 A;  3AE3 A;  3VRB A;  4C77 A;  3UKK A;  3VRA A;  5IPY A;  3DJD A;  1COY A;  4DNA A;  2R0P A;  1DOD A;  4OPG A;  1IUW A;  2BRA A;  3SM8 A;  3VR8 A;  2WP5 A;  4G6G A;  3BNU A;  4B64 A;  2YAU A;  4OCG A;  4A7A A;  2WDQ A;  4U8N A;  4JY2 A;  4ECH A;  3BI2 A;  1FCD A;  3O0H A;  4YSY A;  3AE5 A;  4YSX A;  3CIR A;  2YVF A;  4NTC A;  4O5Q A;  4H7U A;  4NEW A;  4UP3 A;  4A6N A;  3AEG A;  2JK6 A;  2C7G A;  3FIM B;  2WPE A;  1PBD A;  1DJQ A;  1REO A;  2FBW A;  2W0H A;  3M0O A;  4N9X A;  3L1R A;  3UOY A;  3SFE A;  1JU2 A;  1PJ5 A;  1Y56 B;  2E4G A;  3F8P A;  1XDI A;  2YVG A;  3T2K A;  4RG4 A;  1ONF A;  2IVD A;  1GRA A;  5HXI A;  2C64 A;  1TDO A;  4H2P A;  4JNQ A;  2JB1 A;  3NN0 X;  1ZX9 A;  1PXB A;  5KMQ A;  5HYM A;  2C66 A;  2EQ9 A;  1GEU A;  2GVC A;  1VDC A;  2EQ8 A;  3FBS A;  2B9W A;  3UTH A;  3LJP A;  4TLX A;  3CNP A;  3NK0 X;  3SY4 A;  4ADW A;  4YT0 A;  3II4 A;  3ATR A;  5IQ4 A;  4UDP A;  3T31 A;  1N4U A;  1QLB A;  1YY5 A;  1ZK7 A;  1JOA A;  4FK1 C;  4GAP A;  5FS6 A;  3SX6 A;  4Z25 A;  3NK2 X;  5L46 A;  1PBB A;  2BRY A;  2XLU A;  3LAD A;  1Q1W A;  1K0I A;  4OPU A;  2Z5X A;  5BUL A;  1F8W A;  3P9U A;  3QFB A;  5FS9 A;  3UKH A;  4H4S A;  3UP4 A;  4P9S A;  4BJZ A;  2YG3 A;  3ZYX A;  1MOK A;  3QJ4 A;  2R9Z A;  4EQX A;  2C76 A;  3P1W A;  4YKF A;  1E1N A;  3SZ0 A;  3NYE A;  3ATQ A;  3CND A;  4H2R A;  2GR2 A;  3GDP A;  3KLJ A;  2XLP A;  2YR6 A;  1L9C A;  2R0G A;  2GR3 A;  3GMC A;  3RP8 A;  4U8J A;  1FEA A;  5BVA A;  3CMM A;  4XXG A;  2APG A;  2C3C A;  4K5S A;  1BF3 A;  2ZZC A;  3PS9 A;  1QO8 A;  3EAN A;  3UKL A;  1H83 A;  1XAN A;  1CC2 A;  1ZKQ A;  5KMR A;  3DK4 A;  3AE6 A;  4K22 A;  3UTE A;  1YQ4 A;  4C74 A;  4EMJ A;  3NYC A;  4BK1 A;  2E1M A;  1E1K A;  3GD3 A;  2A8X A;  4C3X A;  4EIQ A;  2BK4 A;  2XVF A;  4OPD A;  2WOW A;  2WET A;  1LVL A;  1PBF A;  4ZN0 A;  1P2H A;  3K7Q X;  3AYJ A;  4GRT A;  1O94 A;  3D8X A;  4G73 A;  4AOX A;  1ZMC A;  1F8R A;  1Y0P A;  4EQW A;  2Q6U A;  3ISH A;  3GSI A;  2V6O A;  4USR A;  1OJC A;  5GRT A;  3DGZ A;  4U8L A;  1P2E A;  5U1O A;  3SFD A;  5BRT A;  4TM4 A;  1NAA A;  4X9M A;  4APN A;  1E39 A;  4EM4 A;  1GRB A;  4JDR A;  4TM0 A;  1W4X A;  3OC4 A;  1CC6 A;  3CN8 A;  1OJA A;  1GRT A;  3PO7 A;  3Q9T A;  1GSN A;  2VVL G;  3AYL A;  5IQ1 A;  4H4T A;  2ACZ A;  2VRM A;  2WDR A;  1JNZ A;  1PBE A;  2FJA A;  4OPC A;  4YXD A;  1H82 A;  2XFU A;  4HB9 A;  3V76 A;  2YG7 A;  4B63 A;  1VQW A;  2EQ7 A;  1RSG A;  3K30 A;  2X3N A;  2OAL A;  2R46 A;  3E1T A;  1N4V A;  4H2N A;  2RGH A;  4H4Z A;  3DJG X;  3QVR A;  3NYF A;  2Q7V A;  4IA6 A;  4CCR A;  1EL8 A;  2AQJ A;  1F3P A;  2GRT A;  1NG4 A;  3CGC A;  2YR5 A;  4H4U A;  5FS8 A;  1EL9 A;  2GAG B;  4B1B A;  1K0L A;  2FJB A;  2WU5 A;  2YQU A;  2ZBW A;  5FMH A;  3NNE A;  2Q0L A;  1D5T A;  2OLO A;  2CDU A;  2JB2 A;  2X99 A;  4JN9 A;  1DJN A;  2NPX A;  4IVO B;  1D4E A;  1M6I A;  1O5W A;  4H4Q A;  4D04 A;  3T2Z A;  3AE7 A;  3RED A;  1NPX A;  3KPK A;  4AP3 A;  3OZ2 A;  3IHM A;  1BGN A;  2BS3 A;  2WHD A;  3HYV A;  2I0Z A;  3JSK A;  4YKG A;  4A99 A;  5JCM A;  2H88 A;  4LII A;  5KXJ A;  4U2L A;  4GCM A;  2B9Y A;  3GRS A;  4H4R A;  4K7Z A;  3QVP A;  1PS9 A;  4ICY A;  3T14 A;  4A9W A;  5BUK A;  2C65 A;  4JNA A;  1GOS A;  3AEF A;  3ZDN A;  1BZL A;  3GD4 A;  2GH5 A;  3CPH G;  1L0V A;  1JRX A;  3LXD A;  1K4Q A;  2IID A;  1KSS A;  3AE1 A;  4M52 A;  3AD7 B;  1B4V A;  1NHS A;  2J3N A;  3GYI A;  4NNJ A;  2VQ7 A;  2HQM A;  2GB0 A;  1GV4 A;  1GRF A;  1E6E A;  2RGO A;  1EL5 A;  3FG2 P;  2X8G A;  5KVH A;  3UTF A;  3EPT A;  4H50 A;  4PAB A;  1FEB A;  4GF7 A;  1DOE A;  2RGJ A;  3IWA A;  3SZF A;  4YSZ A;  4U2S A;  3DJE A;  2C67 A;  3PVC A;  4NTD A;  4I58 A;  3M13 A;  4K2X A;  4H4X A;  2CFY A;  3QSS A;  1B5Q A;  4G74 A;  2XVJ A;  1S3B A;  1GND A;  2CUL A;  1OJD A;  1CBO A;  4NTE A;  4A6N B;  1GTH A;  4BK3 A;  5J7X A;  1L9E A;  2BC0 A;  4EQR A;  1PXA A;  4J34 A;  3ITJ A;  1Z6L A;  4WCT A;  3SYI A;  2YG6 A;  3NIX A;  4K8D A;  2YLS A;  4AP1 A;  1GXF A;  1LJ1 A;  1N4W A;  2V61 A;  4EQS A;  2IVE A;  1XHC A;  1XPQ A;  2VOU A;  3T37 A;  3ICS A;  5KMS A;  2YLZ A;  2Y6R A;  1JEH A;  1VG0 A;  2WS3 A;  1IJH A;  1RYI A;  2WOV A;  2YR4 A;  1UKV G;  2O9Z A;  4OPL A;  4A79 A;  3KVE A;  1DOB A;  4G9K A;  4HA6 A;  2ARD A;  1IUT A;  1X31 B;  1TYT A;  3SGL A;  1H84 A;  4U8K A;  2XFP A;  1GES A;  1YQZ A;  4Y4L A;  5M10 A;  3LB8 A;  4OPT A;  1DXL A;  3P4R A;  3AE4 A;  1VG9 A;  2BXR A;  4DSH A;  4EIP A;  2YLW A;  1CL0 A;  1D7L A;  1LTX R;  4Z24 A;  1D4C A;  1DNC A;  1TDK A;  1PHH A;  3GDN A;  1NEN A;  4RG3 A;  3S61 A;  4AT0 A;  2BYB A;  4JQ9 A;  3ALM A;  3IF9 A;  5EB4 A;  5ER0 A;  1PN0 A;  2GAH B;  4B69 A;  4AOS A;  2BCG G;  2JB3 A;  2V3A A;  1GER A;  4MJW A;  4Z2U A;  1LV0 A;  4Z44 A;  4YTP A;  1H81 A;  4FDC B;  5U25 A;  1NG3 A;  1CHU A;  2BC1 A;  3RHA A;  1HYU A;  2GEW A;  3GRT A;  3C4N A;  4CNK A;  2JAE A;  3D1C A;  1KFY A;  2XFQ A;  3UKP A;  3SZW A;  3BHK A;  1IUX A;  2XVE A;  2QCU A;  5KOW A;  1ELI A;  2BK3 A;  3B6D A;  3BNM A;  3KKJ A;  3CGD A;  5KRQ A;  2DKH A;  2XLR A;  2R45 A;  4U8I A;  3ICR A;  3AB1 A;  2VVL A;  2B7S A;  5KMP A;  1BGJ A;  2PYX A;  4FK1 A;  5KOX A;  4Y4M A;  4OPI A;  1H6V A;  1IUV A;  2X8C A;  2XCG A;  1E7P A;  2V5Z A;  2H89 A;  1E1M A;  4C5O A;  1D4D A;  4YWO A;  3URH A;  1EL7 A;  1F6M A;  3LZW A;  4IA5 A;  2V60 A;  2YWL A;  5FS7 A;  2B76 A;  1Q9I A;  2C75 A;  4ZCD A;  3RNM A;  4Y4N A;  4Z2R A;  4YTM A;  3AE2 A;  2F5Z A;  4U8O A;  1NHP A;  1YKJ A;  1ZY8 A;  3SZC A;  1CJ4 A;  2YLT A;  4DGK A;  1E1L A;  3H4K A;  4BK2 A;  4EMW A;  3G5R A;  1H7X A;  3LZX A;  3GYX A;  3QSM A;  5J60 A;  3NT6 A;  2BXS A;  3CNT A;  2VRL A;  3UP5 A;  4GDE A;  3CPI G;  2XYO A;  5JCL A;  1KSU A;  2BS4 A;  3T0K A;  3NH3 X;  1D7Y A;  4PAA A;  4U8M A;  3K7T A;  4BV6 A;  3M12 A;  3ALL A;  4H4Y A;  3AE8 A;  2VZ2 A;  1CJ2 A;  1EBD A;  3CGE A;  2XDO A;  4CY6 A;  3B3R A;  2GMH A;  3UOZ A;  3I3L A;  4J56 A;  2B7R A;  4X9N A;  2QA1 A;  2A89 A;  2WDV A;  4BUR A;  3NTA A;  4OVI A;  1ZP0 A;  4GR1 A;  2C3D A;  3SXI A;  1S2Y A;  1TDF A;  3CGB A;  3Q6J A;  1VRQ B;  3NHO X;  4USQ A;  1ZOV A;  2C70 A;  2Q0K A;  5CKU A;  1YQ3 A;  5C2T A;  1JRY A;  3L8K A;  4YSH A;  1Y56 A;  2C4C A;  3I6D A;  3VR9 A;  1SEZ A;  4BJY A;  5JCK A;  1LQT A;  2X8H A;  3F8D A;  3CNS A;  4CRT A;  3LOV A;  3BI4 A;  4KPR A;  3VQR A;  3AD8 B;  1FL2 A;  3DH9 A;  3QSE A;  2VVM A;  1S2Q A;  1TYP A;  2AAQ A;  5U63 A;  2GQW A;  4REK A;  2C73 A;  3RP6 A;  2WP6 A;  5JCN A;  2GV8 A;  4WX1 A;  3K7M X;  1M64 A;  3BHF A;  5HHF A;  2YG5 A;  5HY5 A;  4UDQ A;  5KNL A;  1MXT A;  3NRN A;  3DJJ A;  2DKI A;  4FX9 A;  1OJT A;  3ICT A;  3C4A A;  2AR8 A;  3KPF A;  4IV9 A;  3KD9 A;  2TMD A;  3AYI A;  4J31 A;  1B37 A;  2XFO A;  1H7W A;  2CVJ A;  4JY3 A;  4A5L A;  3CTY A;  1ZDL A;  2GF3 A;  2YLX A;  3NLC A;  4U2T A;  2WOI A;  1ZMD A;  2GMJ A;  2WPC A;  1CF3 A;  3P4S A;  4II2 A;  4H4W A;  4H4V A;  4XWR A;  1KDG A;  1NEK A;  3KA7 A;  1ZOY A;  2R4E A;  1TRB A;  2BAC A;  3ALJ A;  1DOC A;  4CNJ A;  2BCP A;  2EQ6 A;  4U8P A;  1IUU A;  1N1P A;  3FMW A;  3ADA B;  3QFA A;  4E0V A;  1GTE A;  2A87 A;  1JNR A;  2B9X A;  3EF6 A;  3AWI A;  2Y6Q A;  5C3J A;  1B8S A; 
#chains in the Genus database with same CATH homology
 1MO9 A;  1F8S A;  2GR1 A;  3COX A;  3P4P A;  3UKF A;  4GAV A;  4J57 A;  2YM1 A;  1NDA A;  1QJD A;  1GRG A;  3FPZ A;  3IC9 A;  4XWZ A;  5EB5 A;  3HYX A;  2R4J A;  3BI5 A;  3G5S A;  5KWF A;  4J2W A;  4J36 A;  3UOV A;  3DME A;  2PHH A;  1L9D A;  2WQY A;  1V59 A;  4O5U A;  1KNR A;  1O95 A;  3NN6 X;  3UTG A;  3HYW A;  1Q1R A;  5EBK A;  1CC4 A;  4NZH A;  2VQB A;  4J33 A;  1GPE A;  2X50 A;  3ABV A;  4DSG A;  3KU9 A;  4H4P A;  1K0J A;  4NWZ A;  3HZL A;  1FOH A;  3C96 A;  1PBC A;  3UKA A;  1TDN A;  3V3N A;  5LV9 A;  2NVK X;  2XLS A;  3V3O A;  1PXC A;  3AEA A;  4H2Q A;  4TM1 A;  4KX6 A;  3GWD A;  2FJE A;  2JBV A;  4TLZ A;  4B65 A;  2WP9 A;  5M0Z A;  3H8I A;  4B68 A;  3NG7 X;  1LQU A;  4II3 A;  4AT2 A;  3VRD B;  2YLR A;  1AOG A;  3R9U A;  2WEU A;  2XVI A;  4CY8 A;  2ZZ0 A;  1H86 A;  3G5Q A;  4LU6 A;  1PJ7 A;  2FJD A;  1GET A;  2WPF A;  2GQF A;  4C3Y A;  2WES A;  3H8L A;  1OJ9 A;  4Z2T A;  1RP0 A;  2XVH A;  3AEB A;  2WBA A;  3AED A;  3UCL A;  4D03 A;  1TDE A;  2QA2 A;  1IUS A;  4NEV A;  2YG4 A;  2V3B A;  1FEC A;  3AD9 B;  2BA9 A;  2GR0 A;  2TPR A;  3AEC A;  4LA1 A;  1GRH A;  1LPF A;  2OA1 A;  2WU2 A;  5EOW A;  3T2Y A;  4IVM B;  4A65 A;  1KF6 A;  1NHR A;  1PDH A;  3GWF A;  3NKS A;  4TM3 A;  3DA1 A;  4GUV A;  3UOX A;  1GAL A;  2Z5Y A;  3P4Q A;  3CNJ A;  4ZCC A;  1BKW A;  2E5V A;  3AEE A;  3CPJ G;  1KNP A;  4B67 A;  4Z26 A;  3DK9 A;  3AE9 A;  3NK1 X;  3NTD A;  2OLN A;  2R0C A;  1PJ6 A;  5DBJ A;  4B66 A;  2OAM A;  2RAB A;  4G6H A;  3NGC X;  4EM3 A;  4GDP A;  2BAB A;  1NHQ A;  2JKC A;  2UZZ A;  2C72 A;  4K5R A;  2YVJ A;  3S5W A;  3AXB A;  4I59 A;  3UKQ A;  3DGH A;  4YTN A;  3GMB A;  3IHG A;  4UDR A;  4EMI A;  2XLT A;  4RSL A;  1CJC A;  5CQF A;  4CCQ A;  1JRZ A;  3DK8 A;  2ZZB A;  3SQP A;  1CJ3 A;  3WE0 A;  5JCI A;  4X4J A;  5GSN A;  5KVI A;  2BS2 A;  3RP7 A;  1S3E A;  3GYJ A;  1GT8 A;  2BK5 A;  4CBQ A;  1BWC A;  2QAE A;  2XFN A;  3F8R A;  5TR3 A;  2YM2 A;  1GRE A;  3EAO A;  4Z43 A;  3AE3 A;  3VRB A;  4C77 A;  3UKK A;  3VRA A;  5IPY A;  3DJD A;  1COY A;  4DNA A;  2R0P A;  1DOD A;  4OPG A;  1IUW A;  2BRA A;  3SM8 A;  3VR8 A;  2WP5 A;  4G6G A;  3BNU A;  4B64 A;  2YAU A;  4OCG A;  4A7A A;  2WDQ A;  4U8N A;  4JY2 A;  4ECH A;  3BI2 A;  1FCD A;  3O0H A;  4YSY A;  3AE5 A;  4YSX A;  3CIR A;  2YVF A;  4NTC A;  4O5Q A;  4H7U A;  4NEW A;  4UP3 A;  4A6N A;  3AEG A;  2JK6 A;  2C7G A;  3FIM B;  2WPE A;  1PBD A;  1DJQ A;  1REO A;  2FBW A;  2W0H A;  3M0O A;  4N9X A;  3L1R A;  3UOY A;  3SFE A;  1JU2 A;  1PJ5 A;  1Y56 B;  2E4G A;  3F8P A;  1XDI A;  2YVG A;  3T2K A;  4RG4 A;  1ONF A;  2IVD A;  1GRA A;  5HXI A;  2C64 A;  1TDO A;  4H2P A;  4JNQ A;  2JB1 A;  3NN0 X;  1ZX9 A;  1PXB A;  5KMQ A;  5HYM A;  2C66 A;  2EQ9 A;  1GEU A;  2GVC A;  1VDC A;  2EQ8 A;  3FBS A;  2B9W A;  3UTH A;  3LJP A;  4TLX A;  3CNP A;  3NK0 X;  3SY4 A;  4ADW A;  4YT0 A;  3II4 A;  3ATR A;  5IQ4 A;  4UDP A;  3T31 A;  1N4U A;  1QLB A;  1YY5 A;  1ZK7 A;  1JOA A;  4FK1 C;  4GAP A;  5FS6 A;  3SX6 A;  4Z25 A;  3NK2 X;  5L46 A;  1PBB A;  2BRY A;  2XLU A;  3LAD A;  1Q1W A;  1K0I A;  4OPU A;  2Z5X A;  5BUL A;  1F8W A;  3P9U A;  3QFB A;  5FS9 A;  3UKH A;  4H4S A;  3UP4 A;  4P9S A;  4BJZ A;  2YG3 A;  3ZYX A;  1MOK A;  3QJ4 A;  2R9Z A;  4EQX A;  2C76 A;  3P1W A;  4YKF A;  1E1N A;  3SZ0 A;  3NYE A;  3ATQ A;  3CND A;  4H2R A;  2GR2 A;  3GDP A;  3KLJ A;  2XLP A;  2YR6 A;  1L9C A;  2R0G A;  2GR3 A;  3GMC A;  3RP8 A;  4U8J A;  1FEA A;  5BVA A;  3CMM A;  4XXG A;  2APG A;  2C3C A;  4K5S A;  1BF3 A;  2ZZC A;  3PS9 A;  1QO8 A;  3EAN A;  3UKL A;  1H83 A;  1XAN A;  1CC2 A;  1ZKQ A;  5KMR A;  3DK4 A;  3AE6 A;  4K22 A;  3UTE A;  1YQ4 A;  4C74 A;  4EMJ A;  3NYC A;  4BK1 A;  2E1M A;  1E1K A;  3GD3 A;  2A8X A;  4C3X A;  4EIQ A;  2BK4 A;  2XVF A;  4OPD A;  2WOW A;  2WET A;  1LVL A;  1PBF A;  4ZN0 A;  1P2H A;  3K7Q X;  3AYJ A;  4GRT A;  1O94 A;  3D8X A;  4G73 A;  4AOX A;  1ZMC A;  1F8R A;  1Y0P A;  4EQW A;  2Q6U A;  3ISH A;  3GSI A;  2V6O A;  4USR A;  1OJC A;  5GRT A;  3DGZ A;  4U8L A;  1P2E A;  5U1O A;  3SFD A;  5BRT A;  4TM4 A;  1NAA A;  4X9M A;  4APN A;  1E39 A;  4EM4 A;  1GRB A;  4JDR A;  4TM0 A;  1W4X A;  3OC4 A;  1CC6 A;  3CN8 A;  1OJA A;  1GRT A;  3PO7 A;  3Q9T A;  1GSN A;  2VVL G;  3AYL A;  5IQ1 A;  4H4T A;  2ACZ A;  2VRM A;  2WDR A;  1JNZ A;  1PBE A;  2FJA A;  4OPC A;  4YXD A;  1H82 A;  2XFU A;  4HB9 A;  3V76 A;  2YG7 A;  4B63 A;  1VQW A;  2EQ7 A;  1RSG A;  3K30 A;  2X3N A;  2OAL A;  2R46 A;  3E1T A;  1N4V A;  4H2N A;  2RGH A;  4H4Z A;  3DJG X;  3QVR A;  3NYF A;  2Q7V A;  4IA6 A;  4CCR A;  1EL8 A;  2AQJ A;  1F3P A;  2GRT A;  1NG4 A;  3CGC A;  2YR5 A;  4H4U A;  5FS8 A;  1EL9 A;  2GAG B;  4B1B A;  1K0L A;  2FJB A;  2WU5 A;  2YQU A;  2ZBW A;  5FMH A;  3NNE A;  2Q0L A;  1D5T A;  2OLO A;  2CDU A;  2JB2 A;  2X99 A;  4JN9 A;  1DJN A;  2NPX A;  4IVO B;  1D4E A;  1M6I A;  1O5W A;  4H4Q A;  4D04 A;  3T2Z A;  3AE7 A;  3RED A;  1NPX A;  3KPK A;  4AP3 A;  3OZ2 A;  3IHM A;  1BGN A;  2BS3 A;  2WHD A;  3HYV A;  2I0Z A;  3JSK A;  4YKG A;  4A99 A;  5JCM A;  2H88 A;  4LII A;  5KXJ A;  4U2L A;  4GCM A;  2B9Y A;  3GRS A;  4H4R A;  4K7Z A;  3QVP A;  1PS9 A;  4ICY A;  3T14 A;  4A9W A;  5BUK A;  2C65 A;  4JNA A;  1GOS A;  3AEF A;  3ZDN A;  1BZL A;  3GD4 A;  2GH5 A;  3CPH G;  1L0V A;  1JRX A;  3LXD A;  1K4Q A;  2IID A;  1KSS A;  3AE1 A;  4M52 A;  3AD7 B;  1B4V A;  1NHS A;  2J3N A;  3GYI A;  4NNJ A;  2VQ7 A;  2HQM A;  2GB0 A;  1GV4 A;  1GRF A;  1E6E A;  2RGO A;  1EL5 A;  3FG2 P;  2X8G A;  5KVH A;  3UTF A;  3EPT A;  4H50 A;  4PAB A;  1FEB A;  4GF7 A;  1DOE A;  2RGJ A;  3IWA A;  3SZF A;  4YSZ A;  4U2S A;  3DJE A;  2C67 A;  3PVC A;  4NTD A;  4I58 A;  3M13 A;  4K2X A;  4H4X A;  2CFY A;  3QSS A;  1B5Q A;  4G74 A;  2XVJ A;  1S3B A;  1GND A;  2CUL A;  1OJD A;  1CBO A;  4NTE A;  4A6N B;  1GTH A;  4BK3 A;  5J7X A;  1L9E A;  2BC0 A;  4EQR A;  1PXA A;  4J34 A;  3ITJ A;  1Z6L A;  4WCT A;  3SYI A;  2YG6 A;  3NIX A;  4K8D A;  2YLS A;  4AP1 A;  1GXF A;  1LJ1 A;  1N4W A;  2V61 A;  4EQS A;  2IVE A;  1XHC A;  1XPQ A;  2VOU A;  3T37 A;  3ICS A;  5KMS A;  2YLZ A;  2Y6R A;  1JEH A;  1VG0 A;  2WS3 A;  1IJH A;  1RYI A;  2WOV A;  2YR4 A;  1UKV G;  2O9Z A;  4OPL A;  4A79 A;  3KVE A;  1DOB A;  4G9K A;  4HA6 A;  2ARD A;  1IUT A;  1X31 B;  1TYT A;  3SGL A;  1H84 A;  4U8K A;  2XFP A;  1GES A;  1YQZ A;  4Y4L A;  5M10 A;  3LB8 A;  4OPT A;  1DXL A;  3P4R A;  3AE4 A;  1VG9 A;  2BXR A;  4DSH A;  4EIP A;  2YLW A;  1CL0 A;  1D7L A;  1LTX R;  4Z24 A;  1D4C A;  1DNC A;  1TDK A;  1PHH A;  3GDN A;  1NEN A;  4RG3 A;  3S61 A;  4AT0 A;  2BYB A;  4JQ9 A;  3ALM A;  3IF9 A;  5EB4 A;  5ER0 A;  1PN0 A;  2GAH B;  4B69 A;  4AOS A;  2BCG G;  2JB3 A;  2V3A A;  1GER A;  4MJW A;  4Z2U A;  1LV0 A;  4Z44 A;  4YTP A;  1H81 A;  4FDC B;  5U25 A;  1NG3 A;  1CHU A;  2BC1 A;  3RHA A;  1HYU A;  2GEW A;  3GRT A;  3C4N A;  4CNK A;  2JAE A;  3D1C A;  1KFY A;  2XFQ A;  3UKP A;  3SZW A;  3BHK A;  1IUX A;  2XVE A;  2QCU A;  5KOW A;  1ELI A;  2BK3 A;  3B6D A;  3BNM A;  3KKJ A;  3CGD A;  5KRQ A;  2DKH A;  2XLR A;  2R45 A;  4U8I A;  3ICR A;  3AB1 A;  2VVL A;  2B7S A;  5KMP A;  1BGJ A;  2PYX A;  4FK1 A;  5KOX A;  4Y4M A;  4OPI A;  1H6V A;  1IUV A;  2X8C A;  2XCG A;  1E7P A;  2V5Z A;  2H89 A;  1E1M A;  4C5O A;  1D4D A;  4YWO A;  3URH A;  1EL7 A;  1F6M A;  3LZW A;  4IA5 A;  2V60 A;  2YWL A;  5FS7 A;  2B76 A;  1Q9I A;  2C75 A;  4ZCD A;  3RNM A;  4Y4N A;  4Z2R A;  4YTM A;  3AE2 A;  2F5Z A;  4U8O A;  1NHP A;  1YKJ A;  1ZY8 A;  3SZC A;  1CJ4 A;  2YLT A;  4DGK A;  1E1L A;  3H4K A;  4BK2 A;  4EMW A;  3G5R A;  1H7X A;  3LZX A;  3GYX A;  3QSM A;  5J60 A;  3NT6 A;  2BXS A;  3CNT A;  2VRL A;  3UP5 A;  4GDE A;  3CPI G;  2XYO A;  5JCL A;  1KSU A;  2BS4 A;  3T0K A;  3NH3 X;  1D7Y A;  4PAA A;  4U8M A;  3K7T A;  4BV6 A;  3M12 A;  3ALL A;  4H4Y A;  3AE8 A;  2VZ2 A;  1CJ2 A;  1EBD A;  3CGE A;  2XDO A;  4CY6 A;  3B3R A;  2GMH A;  3UOZ A;  3I3L A;  4J56 A;  2B7R A;  4X9N A;  2QA1 A;  2A89 A;  2WDV A;  4BUR A;  3NTA A;  4OVI A;  1ZP0 A;  4GR1 A;  2C3D A;  3SXI A;  1S2Y A;  1TDF A;  3CGB A;  3Q6J A;  1VRQ B;  3NHO X;  4USQ A;  1ZOV A;  2C70 A;  2Q0K A;  5CKU A;  1YQ3 A;  5C2T A;  1JRY A;  3L8K A;  4YSH A;  1Y56 A;  2C4C A;  3I6D A;  3VR9 A;  1SEZ A;  4BJY A;  5JCK A;  1LQT A;  2X8H A;  3F8D A;  3CNS A;  4CRT A;  3LOV A;  3BI4 A;  4KPR A;  3VQR A;  3AD8 B;  1FL2 A;  3DH9 A;  3QSE A;  2VVM A;  1S2Q A;  1TYP A;  2AAQ A;  5U63 A;  2GQW A;  4REK A;  2C73 A;  3RP6 A;  2WP6 A;  5JCN A;  2GV8 A;  4WX1 A;  3K7M X;  1M64 A;  3BHF A;  5HHF A;  2YG5 A;  5HY5 A;  4UDQ A;  5KNL A;  1MXT A;  3NRN A;  3DJJ A;  2DKI A;  4FX9 A;  1OJT A;  3ICT A;  3C4A A;  2AR8 A;  3KPF A;  4IV9 A;  3KD9 A;  2TMD A;  3AYI A;  4J31 A;  1B37 A;  2XFO A;  1H7W A;  2CVJ A;  4JY3 A;  4A5L A;  3CTY A;  1ZDL A;  2GF3 A;  2YLX A;  3NLC A;  4U2T A;  2WOI A;  1ZMD A;  2GMJ A;  2WPC A;  1CF3 A;  3P4S A;  4II2 A;  4H4W A;  4H4V A;  4XWR A;  1KDG A;  1NEK A;  3KA7 A;  1ZOY A;  2R4E A;  1TRB A;  2BAC A;  3ALJ A;  1DOC A;  4CNJ A;  2BCP A;  2EQ6 A;  4U8P A;  1IUU A;  1N1P A;  3FMW A;  3ADA B;  3QFA A;  4E0V A;  1GTE A;  2A87 A;  1JNR A;  2B9X A;  3EF6 A;  3AWI A;  2Y6Q A;  5C3J A;  1B8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...