3KVEA

Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNSKEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRTNCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEKDTSSNTADYVIVCTTSRAARRIQFEPPLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNFSTGVGVIIAYGIGDDANFFQALKFKDCADIVFNDLSLIHQLPKEEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of native L-amino acid oxidase from Vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
rcsb
molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
total genus 178
structure length 484
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3kveA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kveA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kveA01
1H81A 5HYMA 3NTAA 3CTYA 4HA6A 2XVEA 2QCUA 2QA1A 2HQMA 3DJJA 3VRAA 5KOWA 1O5WA 1TDFA 2ACZA 5U1OA 4OPDA 1E1MA 4BJZA 3E1TA 3GYIA 4YSXA 2GQWA 4JNAA 1ELIA 2W0HA 1JRYA 3CGCA 5TR3A 1E7PA 4WCTA 1GETA 4J31A 1O95A 3K7QX 2BS4A 2YLXA 2Q7VA 3GMCA 1ZOVA 3EAOA 1X31B 1EL5A 1LVLA 2GQFA 2BACA 1VDCA 2ZZBA 2FBWA 2V3BA 3GD3A 3NRNA 2YG4A 4I59A 2V6OA 2WOWA 5U63A 1PJ5A 3EANA 1ZX9A 1MO9A 1RSGA 2YQUA 3KPFA 2YG3A 1H86A 2XVJA 4KPRA 3S61A 1IUVA 2GR3A 2BYBA 2WS3A 3VR9A 2H88A 2Z5XA 2RGHA 1GRBA 1LV0A 1NENA 3NK2X 3UOYA 4BJYA 3FPZA 3UKQA 1VQWA 3CNSA 3SFDA 5EB5A 3GDNA 2C7GA 5C2TA 2WU5A 1M64A 3AWIA 1NHSA 3G5QA 1BGJA 3V76A 4H4QA 4Y4LA 3CNJA 4AOSA 2BS3A 1P2HA 1D5TA 2TMDA 4K5RA 4H4YA 3DMEA 2XVFA 2WPFA 2VQBA 3AE7A 3IHMA 1FOHA 3NKSA 2CVJA 4U8PA 3AEFA 2YLWA 4XXGA 2A8XA 3F8PA 3ICRA 1XDIA 2BK3A 4J56A 4Z43A 1GNDA 3UTEA 1QLBA 4OVIA 1PN0A 3DH9A 4H4TA 2UZZA 5FS6A 3RP8A 3M13A 1BF3A 4YSZA 5KVIA 2VVLA 3AD8B 2IVEA 3C4AA 4X9MA 1CJCA 3ATRA 2B7SA 4A99A 5BRTA 3LOVA 1F6MA 3M0OA 2GR2A 1FL2A 4FDCB 4K22A 3CGBA 4C77A 2DKIA 1D4CA 2ZZ0A 1NAAA 2I0ZA 1TDNA 3SM8A 4UDRA 1Q1RA 3C96A 1EL8A 2WP5A 3DJEA 3KA7A 3OZ2A 1PBCA 4AP3A 2FJEA 3UTHA 2B9XA 4CCQA 2A89A 2GVCA 1FCDA 1KF6A 1TRBA 2GAGB 3C4NA 4U8NA 3M12A 4APNA 2NVKX 2YAUA 2E4GA 1GRTA 2WQYA 3ZYXA 4AT2A 3AE6A 2R4EA 5JCMA 3BNUA 1KFYA 1CC4A 1E1LA 1L9CA 1NEKA 3UKKA 2WOIA 3BI5A 2J3NA 2GB0A 2Y6RA 3DK8A 1GT8A 2WPCA 2TPRA 5M10A 1UKVG 3GSIA 1OJTA 4J34A 2R0CA 5FS8A 2R0PA 5M0ZA 5IQ4A 1RP0A 2VVLG 1GALA 3RNMA 1TDKA 2YM1A 4GDPA 4CY8A 3GDPA 2XLRA 1H83A 4TLZA 1D4DA 3NGCX 3REDA 1FECA 3DA1A 5EB4A 4ZCDA 1HYUA 2BK4A 2WPEA 2JKCA 4J57A 1LTXR 4B66A 1XPQA 4P9SA 2XFUA 2FJAA 2Y6QA 4H4UA 4EM3A 4B1BA 2AR8A 4OPCA 3DK4A 4PAAA 1L9EA 2XCGA 1XANA 3BI4A 2GAHB 4GUVA 4JQ9A 4Y4NA 4EMJA 4J2WA 2YLZA 5KXJA 2C3CA 4U8KA 2B9YA 5KWFA 1GOSA 5JCNA 2FJBA 1COYA 1JNZA 1Y56A 4B67A 2XLTA 2VOUA 1M6IA 1YQ4A 2PHHA 2R46A 4U2SA 1S3EA 2EQ8A 3PS9A 3NN6X 2F5ZA 5KRQA 3LB8A 3QFBA 2JBVA 4GF7A 2VRLA 1NG3A 1F3PA 3UCLA 5HY5A 4A9WA 1JRZA 4DSHA 4JY3A 3RP6A 3ICTA 3COXA 5KOXA 4GRTA 5FS9A 1CC6A 2WETA 2YWLA 3VQRA 4EQSA 3IF9A 4EIPA 2GF3A 3UP4A 2CULA 3GMBA 2BABA 1XHCA 2OALA 1PS9A 3AE2A 4LIIA 1H84A 2RGOA 4FX9A 3GD4A 2H89A 2YR6A 1PBBA 2E5VA 1KSUA 3P4PA 3VR8A 1BKWA 3ADAB 2WESA 1EBDA 3AECA 4H4VA 4H4RA 1B4VA 1NHQA 3FIMB 4RG3A 2WDVA 1P2EA 4A5LA 3JSKA 5GSNA 4CCRA 2JK6A 4EM4A 3PO7A 3BNMA 2Q6UA 2YG7A 1F8SA 4RSLA 1B8SA 3URHA 5ER0A 4EQRA 3AEAA 1E1NA 1DXLA 3NH3X 1CL0A 1PDHA 3GWDA 3BHFA 4TM3A 4C74A 3LXDA 3UP5A 5KVHA 2V5ZA 1KSSA 1TYTA 4EIQA 4K5SA 1MOKA 1F8WA 5L46A 4D03A 4ZCCA 1L0VA 4ZN0A 4Y4MA 4GDEA 1IUTA 1GPEA 1GXFA 1CJ2A 1H7WA 1B5QA 1JNRA 3Q9TA 4OPUA 4X4JA 1IUSA 3P9UA 2R45A 3NHOX 4EQWA 1Q9IA 2YVFA 3AE9A 3K7TA 4C3YA 3UOXA 4J36A 1NHPA 4FK1C 4YTPA 2AAQA 3AB1A 2O9ZA 3NYFA 4RG4A 4CBQA 2R9ZA 3FG2P 1H6VA 4D04A 2YR4A 3QSEA 3NLCA 3AE1A 4H50A 1V59A 1CBOA 3KVEA 1IUUA 4XWRA 3DK9A 3ZDNA 3IWAA 3AEEA 2IVDA 4CNJA 3II4A 1GV4A 5JCKA 3V3OA 3DJDA 4UP3A 2ZBWA 3GYJA 1CHUA 2YR5A 1GSNA 1ZOYA 3DJGX 4YWOA 5LV9A 4NZHA 2C76A 2XYOA 3SFEA 4AT0A 1YQ3A 3H8LA 1Y0PA 3K30A 5BUKA 2C70A 1PJ7A 4AP1A 4YSHA 1K4QA 1D7LA 3V3NA 3CN8A 2GRTA 1PJ6A 2WP6A 3NNEA 3K7MX 4UDPA 3SGLA 4PABA 3KLJA 1TYPA 1GREA 3CGDA 3I3LA 2GEWA 2YLSA 2WOVA 1VG0A 2XFQA 3ICSA 4FK1A 2C72A 1DOCA 2NPXA 4B64A 4BV6A 2XLSA 3H8IA 3QVRA 4U8OA 4USRA 1H82A 2FJDA 1DOEA 2BC0A 2YVJA 1ZDLA 1GESA 3HZLA 5J7XA 2YG6A 3AXBA 2BC1A 3T37A 2EQ9A 4A79A 4I58A 4A6NA 4BK2A 1E39A 2AQJA 4JN9A 4C3XA 4M52A 1PXAA 1BGNA 2BS2A 2OAMA 1MXTA 4USQA 3SQPA 1GRGA 1YKJA 3D1CA 1LQTA 4YKFA 4Z2TA 1S2YA 3QSSA 1F8RA 4E0VA 1IUXA 4H4WA 5HHFA 3G5RA 4NTEA 4GCMA 2YVGA 3IHGA 1SEZA 5J60A 3UKAA 2V3AA 4H7UA 4MJWA 1S2QA 2WDRA 3FMWA 4C5OA 2VZ2A 2XLUA 3R9UA 1Z6LA 1GRHA 4H4XA 4IVOB 4ADWA 1RYIA 3F8RA 1CJ4A 3WE0A 4B68A 5CQFA 1O94A 1W4XA 2Q0LA 4UDQA 4OCGA 1CF3A 1JOAA 2OA1A 1EL9A 1D4EA 3QJ4A 4O5QA 1JEHA 1PBFA 1ZP0A 1E1KA 2WU2A 3LZXA 3AYIA 3NN0X 1QO8A 3NG7X 5DBJA 2BCPA 3O0HA 4YKGA 2ARDA 2XLPA 3RP7A 2VRMA 2R4JA 3UTFA 3DGHA 2XVHA 3ALMA 1JU2A 1NG4A 5FMHA 2QAEA 3QFAA 1KNRA 2X99A 2BXRA 1DOBA 4CY6A 1LPFA 2YG5A 1Y56B 4IA5A 4KX6A 4H4ZA 1N4WA 4H4SA 4H2NA 2BK5A 4REKA 1NDAA 1N1PA 3LJPA 4H2RA 4LU6A 5GRTA 1PXCA 3DGZA 2PYXA 3B6DA 2YLRA 2VVMA 4N9XA 4NTCA 4IVMB 3LADA 1DJNA 3GRTA 1YY5A 3ABVA 3I6DA 2JB3A 3CNPA 2BXSA 5EBKA 2APGA 3ISHA 1BWCA 2Z5YA 4TM1A 4XWZA 3GRSA 4YTMA 3ITJA 1GTHA 2C64A 3QVPA 3ALLA 4JNQA 4DGKA 2RABA 2BA9A 4BK1A 2GV8A 4Z2UA 4OPGA 1ZMCA 1L9DA 1NHRA 4K2XA 5HXIA 3BHKA 4EQXA 3RHAA 3VRBA 4J33A 2ZZCA 2JB1A 4EMIA 3CNDA 2C67A 1K0IA 3L1RA 1VG9A 4GR1A 1AOGA 2YLTA 1QJDA 1Q1WA 2GR0A 3KD9A 3P4RA 3EPTA 1ONFA 2C3DA 4Z25A 2B7RA 1TDOA 3G5SA 4B69A 1ZK7A 1DODA 1PHHA 3NK0X 4AOXA 2WEUA 3UOZA 1GTEA 3UKFA 4A6NB 1ZMDA 3CPIG 2DKHA 1FEAA 3AEDA 3IC9A 4LA1A 4O5UA 4U8LA 5U25A 1GRAA 4EMWA 3NYCA 2A87A 4HB9A 4WX1A 1E6EA 2BCGG 1DNCA 3NK1X 5FS7A 2C66A 4JY2A 1K0LA 3AE3A 3CGEA 2X8GA 5JCLA 2XVIA 1OJ9A 1B37A 1KNPA 3AD7B 1S3BA 3P4QA 3AYLA 3ALJA 1GRFA 2XFNA 4H2PA 1D7YA 3EF6A 3QSMA 4X9NA 4YT0A 1CC2A 4H4PA 1TDEA 2X50A 1GERA 4IV9A 4U2TA 4Z2RA 1LQUA 3GWFA 4ICYA 4DSGA 2CFYA 2XFPA 1OJDA 2C73A 2XDOA 4NEVA 3UKPA 1PXBA 4YXDA 1DJQA 2X8HA 4Z26A 1N4VA 3PVCA 5BULA 3AE4A 4B63A 2WDQA 2VQ7A 3L8KA 2GMJA 5JCIA 4CNKA 4YTNA 1NPXA 3F8DA 4NTDA 2XFOA 3S5WA 4BK3A 2V60A 4CRTA 3AE5A 3NT6A 1OJAA 3H4KA 3NTDA 2GH5A 2B9WA 3ATQA 4U2LA 2RGJA 3Q6JA 2OLOA 2C75A 3CPJG 1PBEA 1ZKQA 2Q0KA 3FBSA 3KU9A 1REOA 4TLXA 3LZWA 1N4UA 4TM0A 3AEGA 3OC4A 5IQ1A 1VRQB 5EOWA 4YSYA 4DNAA 1PBDA 2E1MA 2B76A 2R0GA 2GMHA 1EL7A 4Z44A 4Z24A 1H7XA 1IUWA 3UKHA 3B3RA 3VRDB 4B65A 5IPYA 4K8DA 3P4SA 4ECHA 5BVAA 4A7AA 2X3NA 3AD9B 1LJ1A 2EQ6A 5C3JA 1JRXA 4JDRA 1KDGA 4OPIA 4U8MA 2QA2A 2X8CA 3KKJA 1OJCA 1BZLA 2WP9A 5CKUA 3UOVA 2WHDA 2V61A 1K0JA 3AYJA 2CDUA 2JB2A 3P1WA 2YM2A 3UKLA 3UTGA 2C65A 3AEBA 3CIRA 3CNTA 1FEBA 4NEWA 4OPTA 4H2QA 4K7ZA 3CPHG 2WBAA 4IA6A 2JAEA 3BI2A 4U8JA 3NYEA 2EQ7A 4TM4A 1ZY8A 4A65A 1IJHA 4U8IA 3NIXA 3AE8A 2IIDA 1CJ3A 4OPLA 2OLNA 3D8XA 4BURA 1GEUA 1YQZA 2GR1A
chains in the Genus database with same CATH superfamily
1H81A 5HYMA 3NTAA 3CTYA 3SXIA 4HA6A 2XVEA 2QCUA 2QA1A 2HQMA 3DJJA 3VRAA 5KOWA 1O5WA 1TDFA 2ACZA 4GAVA 4OPDA 1E1MA 5U1OA 4BJZA 3E1TA 3GYIA 4YSXA 2GQWA 4JNAA 1ELIA 2W0HA 5KMQA 1JRYA 3CGCA 5TR3A 1E7PA 4WCTA 1GETA 4J31A 1O95A 3K7QX 2BS4A 2YLXA 2Q7VA 3GMCA 1ZOVA 3EAOA 1X31B 1EL5A 1LVLA 2GQFA 3T2ZA 2BACA 1VDCA 2ZZBA 2FBWA 2V3BA 3GD3A 3NRNA 2YG4A 4I59A 2V6OA 2WOWA 5U63A 1PJ5A 3EANA 1ZX9A 1MO9A 3GYXA 1RSGA 2YQUA 3KPFA 2YG3A 1H86A 3T2YA 2XVJA 4KPRA 3S61A 1IUVA 2GR3A 2BYBA 2WS3A 3VR9A 3HYXA 2H88A 2Z5XA 2RGHA 1GRBA 1LV0A 1NENA 3NK2X 3UOYA 4BJYA 3FPZA 3UKQA 1VQWA 3CNSA 3SFDA 5EB5A 3GDNA 2C7GA 5C2TA 2WU5A 1M64A 3AWIA 1NHSA 3G5QA 1BGJA 3V76A 3SX6A 4H4QA 4Y4LA 3CNJA 4AOSA 2BS3A 1P2HA 1D5TA 2TMDA 4K5RA 4H4YA 3DMEA 2XVFA 2WPFA 2VQBA 3AE7A 3IHMA 1FOHA 3NKSA 2CVJA 4U8PA 3AEFA 2YLWA 4XXGA 2A8XA 3F8PA 3ICRA 1XDIA 2BK3A 4J56A 3SY4A 4Z43A 1GNDA 3UTEA 1QLBA 4OVIA 1PN0A 3DH9A 4H4TA 2UZZA 5FS6A 3RP8A 3M13A 1BF3A 4YSZA 5KVIA 2VVLA 3AD8B 2IVEA 3C4AA 4X9MA 1CJCA 3ATRA 3SZ0A 2B7SA 4A99A 5BRTA 3LOVA 1F6MA 3M0OA 2GR2A 1FL2A 4G6GA 4FDCB 4K22A 3CGBA 4C77A 2DKIA 1D4CA 2ZZ0A 1NAAA 2I0ZA 1TDNA 4II3A 5KNLA 3SM8A 4UDRA 1Q1RA 3C96A 1EL8A 2WP5A 3DJEA 3KA7A 3OZ2A 1PBCA 4AP3A 2FJEA 3UTHA 2B9XA 4CCQA 2A89A 3SYIA 2GVCA 1FCDA 1KF6A 1TRBA 2GAGB 3C4NA 4U8NA 3M12A 4APNA 2NVKX 2YAUA 2E4GA 1GRTA 2WQYA 3ZYXA 4AT2A 3AE6A 2R4EA 5JCMA 3BNUA 1KFYA 1CC4A 1E1LA 1L9CA 1NEKA 3UKKA 2WOIA 3BI5A 2J3NA 2GB0A 2Y6RA 3DK8A 1GT8A 2WPCA 2TPRA 5M10A 1UKVG 3GSIA 1OJTA 4J34A 2R0CA 5FS8A 2R0PA 5M0ZA 5IQ4A 1RP0A 2VVLG 1GALA 3RNMA 1TDKA 3T14A 5KMRA 2YM1A 4GDPA 4CY8A 3GDPA 4G74A 2XLRA 1H83A 4TLZA 1D4DA 3NGCX 3REDA 1FECA 3DA1A 5EB4A 4ZCDA 1HYUA 2BK4A 2BRAA 2WPEA 2JKCA 4J57A 1LTXR 4B66A 1XPQA 4P9SA 2XFUA 2FJAA 2Y6QA 4H4UA 4EM3A 4B1BA 2AR8A 4OPCA 3DK4A 4PAAA 1L9EA 2XCGA 1XANA 3BI4A 2GAHB 4GUVA 3T31A 4JQ9A 4Y4NA 4EMJA 4J2WA 2YLZA 5KXJA 2C3CA 4U8KA 2B9YA 5KWFA 1GOSA 5JCNA 2FJBA 1COYA 1JNZA 1Y56A 4B67A 2XLTA 2VOUA 1M6IA 1YQ4A 2PHHA 2R46A 4U2SA 1S3EA 2EQ8A 3PS9A 3NN6X 2F5ZA 5KRQA 3LB8A 3QFBA 2JBVA 4GF7A 2VRLA 1NG3A 1F3PA 3UCLA 5HY5A 4A9WA 1JRZA 4DSHA 4JY3A 3RP6A 3ICTA 3COXA 5KOXA 3KPKA 4GRTA 5FS9A 1CC6A 2WETA 2YWLA 4NWZA 3VQRA 4EQSA 3IF9A 4EIPA 2GF3A 3UP4A 2CULA 3GMBA 2BABA 1XHCA 2OALA 1PS9A 3AE2A 4LIIA 1H84A 2RGOA 4FX9A 3GD4A 2H89A 2YR6A 1PBBA 2E5VA 1KSUA 3P4PA 3VR8A 1BKWA 3ADAB 2WESA 1EBDA 3AECA 4H4VA 4H4RA 1B4VA 1NHQA 3FIMB 4RG3A 2WDVA 1P2EA 4A5LA 3JSKA 5GSNA 4CCRA 2JK6A 4EM4A 3PO7A 3BNMA 2Q6UA 2YG7A 1F8SA 4RSLA 1B8SA 3URHA 5ER0A 4EQRA 3AEAA 1E1NA 1DXLA 3NH3X 1CL0A 1PDHA 3GWDA 3BHFA 4TM3A 4C74A 3LXDA 3UP5A 5KVHA 2V5ZA 1KSSA 1TYTA 4EIQA 4K5SA 1MOKA 1F8WA 5L46A 4D03A 4ZCCA 1L0VA 4ZN0A 4Y4MA 4GDEA 1IUTA 1GPEA 1GXFA 1CJ2A 1H7WA 1B5QA 1JNRA 3Q9TA 4II2A 4OPUA 4X4JA 1IUSA 3P9UA 2R45A 3NHOX 4EQWA 1Q9IA 2YVFA 3AE9A 3K7TA 4C3YA 3UOXA 4J36A 1NHPA 4FK1C 4YTPA 2AAQA 3AB1A 2O9ZA 3NYFA 4RG4A 4CBQA 2R9ZA 3FG2P 1H6VA 4D04A 2YR4A 2BRYA 3QSEA 3NLCA 3AE1A 4H50A 1V59A 1CBOA 3KVEA 1IUUA 4XWRA 3DK9A 3ZDNA 3IWAA 3AEEA 2IVDA 4CNJA 3II4A 1GV4A 5JCKA 3V3OA 3DJDA 4UP3A 5KMPA 2ZBWA 3GYJA 1CHUA 2YR5A 1GSNA 1ZOYA 3DJGX 4YWOA 3HYVA 5LV9A 4NZHA 2C76A 2XYOA 3SFEA 4AT0A 1YQ3A 3H8LA 1Y0PA 3K30A 5BUKA 2C70A 1PJ7A 4AP1A 4YSHA 1K4QA 1D7LA 3V3NA 3CN8A 2GRTA 1PJ6A 2WP6A 3NNEA 3K7MX 4UDPA 3SGLA 4PABA 3KLJA 1TYPA 1GREA 3CGDA 3I3LA 2GEWA 2YLSA 2WOVA 1VG0A 2XFQA 3ICSA 4FK1A 2C72A 1DOCA 2NPXA 4B64A 4BV6A 2XLSA 3H8IA 3QVRA 4U8OA 4USRA 1H82A 2FJDA 1DOEA 2BC0A 2YVJA 1ZDLA 1GESA 3HZLA 5J7XA 2YG6A 3AXBA 2BC1A 3T37A 2EQ9A 4A79A 4I58A 4A6NA 4BK2A 1E39A 4G9KA 2AQJA 4JN9A 4C3XA 4M52A 1PXAA 3T0KA 1BGNA 2BS2A 2OAMA 1MXTA 4USQA 3SQPA 1GRGA 1YKJA 3D1CA 1LQTA 4YKFA 4Z2TA 1S2YA 3QSSA 1F8RA 4E0VA 1IUXA 4H4WA 5HHFA 3G5RA 4NTEA 4GCMA 2YVGA 3IHGA 1SEZA 5J60A 3UKAA 2V3AA 4H7UA 4MJWA 1S2QA 2WDRA 3FMWA 4C5OA 2VZ2A 2XLUA 3R9UA 1Z6LA 1GRHA 4H4XA 4IVOB 4ADWA 1RYIA 3WE0A 1CJ4A 3F8RA 4B68A 5CQFA 1O94A 1W4XA 2Q0LA 4UDQA 4OCGA 1CF3A 1JOAA 2OA1A 1EL9A 1D4EA 3QJ4A 4O5QA 1JEHA 1PBFA 1ZP0A 1E1KA 2WU2A 3LZXA 3AYIA 3NN0X 1QO8A 3NG7X 5DBJA 2BCPA 3O0HA 4YKGA 2ARDA 2XLPA 3RP7A 2VRMA 2R4JA 3UTFA 3DGHA 2XVHA 3ALMA 4G6HA 3SZWA 1JU2A 1NG4A 5FMHA 2QAEA 3QFAA 1KNRA 2X99A 2BXRA 1DOBA 3CMMA 4CY6A 1LPFA 2YG5A 1Y56B 4IA5A 4KX6A 4H4ZA 1N4WA 4H4SA 4H2NA 2BK5A 4REKA 1NDAA 1N1PA 3LJPA 4H2RA 4LU6A 5GRTA 1PXCA 3DGZA 2PYXA 3B6DA 2YLRA 2VVMA 4N9XA 4NTCA 4IVMB 3LADA 1DJNA 3GRTA 1YY5A 3ABVA 3I6DA 2JB3A 3CNPA 2BXSA 5EBKA 2APGA 3ISHA 1BWCA 2Z5YA 4TM1A 4XWZA 4NNJA 3GRSA 4YTMA 3ITJA 1GTHA 2C64A 3QVPA 3ALLA 4JNQA 3T2KA 2RABA 2BA9A 4BK1A 4DGKA 2GV8A 4Z2UA 4OPGA 1ZMCA 1L9DA 1NHRA 4K2XA 5HXIA 3BHKA 4EQXA 3RHAA 3VRBA 4J33A 2ZZCA 2JB1A 4EMIA 3CNDA 4GAPA 2C67A 1K0IA 3L1RA 1VG9A 4GR1A 1AOGA 2YLTA 1QJDA 1Q1WA 2GR0A 3KD9A 3P4RA 3EPTA 1ONFA 2C3DA 4Z25A 2B7RA 1TDOA 3G5SA 4B69A 1ZK7A 1DODA 1PHHA 3NK0X 4AOXA 2WEUA 3UOZA 1GTEA 3UKFA 4A6NB 1ZMDA 3CPIG 2C4CA 1FEAA 2DKHA 3AEDA 3IC9A 4LA1A 4O5UA 4U8LA 5U25A 1GRAA 4EMWA 3NYCA 2A87A 4HB9A 4WX1A 1E6EA 2BCGG 1DNCA 3NK1X 5FS7A 2C66A 4JY2A 1K0LA 3AE3A 3CGEA 2X8GA 5JCLA 4G73A 2XVIA 1OJ9A 1B37A 1KNPA 3AD7B 1S3BA 3P4QA 3AYLA 3ALJA 1GRFA 2XFNA 4H2PA 3SZCA 1D7YA 3EF6A 3QSMA 4X9NA 4YT0A 1CC2A 4H4PA 1TDEA 4IV9A 1GERA 2X50A 4U2TA 4Z2RA 1LQUA 3GWFA 4ICYA 4DSGA 2CFYA 2XFPA 1OJDA 2C73A 2XDOA 4NEVA 3UKPA 1PXBA 4YXDA 1DJQA 2X8HA 4Z26A 1N4VA 3PVCA 5BULA 3AE4A 4B63A 2WDQA 2VQ7A 3L8KA 2GMJA 5JCIA 4CNKA 4YTNA 1NPXA 3F8DA 4NTDA 2XFOA 3S5WA 4BK3A 2V60A 4CRTA 3AE5A 3NT6A 1OJAA 3H4KA 3NTDA 2GH5A 2B9WA 3ATQA 4U2LA 2RGJA 3Q6JA 2OLOA 2C75A 3CPJG 1PBEA 1ZKQA 2Q0KA 3FBSA 3KU9A 1REOA 4TLXA 3LZWA 1N4UA 4TM0A 3AEGA 3OC4A 5IQ1A 1VRQB 5EOWA 4YSYA 4DNAA 1PBDA 2E1MA 2B76A 2R0GA 2GMHA 1EL7A 4Z44A 4Z24A 3SZFA 1H7XA 1IUWA 3UKHA 3B3RA 3VRDB 4B65A 5IPYA 4K8DA 3P4SA 4ECHA 5BVAA 4A7AA 5KMSA 2X3NA 3AD9B 1LJ1A 2EQ6A 5C3JA 1JRXA 4JDRA 1KDGA 4OPIA 4U8MA 2QA2A 2X8CA 3KKJA 1OJCA 1BZLA 2WP9A 5CKUA 3UOVA 2WHDA 2V61A 3HYWA 1K0JA 3AYJA 2CDUA 2JB2A 3P1WA 2YM2A 3UKLA 3UTGA 2C65A 3AEBA 3CIRA 3CNTA 1FEBA 4NEWA 4OPTA 4H2QA 4K7ZA 3CPHG 2WBAA 4IA6A 2JAEA 3BI2A 4U8JA 3NYEA 2EQ7A 4TM4A 1ZY8A 4A65A 1IJHA 4U8IA 3NIXA 3AE8A 2IIDA 1CJ3A 4OPLA 2OLNA 3D8XA 4BURA 1GEUA 1YQZA 2GR1A
chains in the Genus database with same CATH topology
1H81A 5HYMA 3NTAA 3CTYA 3SXIA 4HA6A 2XVEA 2QCUA 2QA1A 2HQMA 3DJJA 3VRAA 5KOWA 1O5WA 1TDFA 2ACZA 4GAVA 4OPDA 1E1MA 5U1OA 4BJZA 3E1TA 3GYIA 4YSXA 2GQWA 4JNAA 1ELIA 2W0HA 5KMQA 1JRYA 3CGCA 5TR3A 1E7PA 4WCTA 1GETA 4J31A 1O95A 3K7QX 2BS4A 2YLXA 2Q7VA 3GMCA 1ZOVA 3EAOA 1X31B 1EL5A 1LVLA 2GQFA 3T2ZA 2BACA 1VDCA 2ZZBA 2FBWA 2V3BA 3GD3A 3NRNA 2YG4A 4I59A 2V6OA 2WOWA 5U63A 1PJ5A 3EANA 1ZX9A 1MO9A 3GYXA 1RSGA 2YQUA 3KPFA 2YG3A 1H86A 3T2YA 2XVJA 4KPRA 3S61A 1IUVA 2GR3A 2BYBA 2WS3A 3VR9A 3HYXA 2H88A 2Z5XA 2RGHA 1GRBA 1LV0A 1NENA 3NK2X 3UOYA 4BJYA 3FPZA 3UKQA 1VQWA 3CNSA 3SFDA 5EB5A 3GDNA 2C7GA 5C2TA 2WU5A 1M64A 3AWIA 1NHSA 3G5QA 1BGJA 3V76A 3SX6A 4H4QA 4Y4LA 3CNJA 4AOSA 2BS3A 1P2HA 1D5TA 2TMDA 4K5RA 4H4YA 3DMEA 2XVFA 2WPFA 2VQBA 3AE7A 3IHMA 1FOHA 3NKSA 2CVJA 4U8PA 3AEFA 2YLWA 4XXGA 2A8XA 3F8PA 3ICRA 1XDIA 2BK3A 4J56A 3SY4A 4Z43A 1GNDA 3UTEA 1QLBA 4OVIA 1PN0A 3DH9A 4H4TA 2UZZA 5FS6A 3RP8A 3M13A 1BF3A 4YSZA 5KVIA 2VVLA 3AD8B 2IVEA 3C4AA 4X9MA 1CJCA 3ATRA 3SZ0A 2B7SA 4A99A 5BRTA 3LOVA 1F6MA 3M0OA 2GR2A 1FL2A 4G6GA 4FDCB 4K22A 3CGBA 4C77A 2DKIA 1D4CA 2ZZ0A 1NAAA 2I0ZA 1TDNA 4II3A 5KNLA 3SM8A 4UDRA 1Q1RA 3C96A 1EL8A 2WP5A 3DJEA 3KA7A 3OZ2A 1PBCA 4AP3A 2FJEA 3UTHA 2B9XA 4CCQA 2A89A 3SYIA 2GVCA 1FCDA 1KF6A 1TRBA 2GAGB 3C4NA 4U8NA 3M12A 4APNA 2NVKX 2YAUA 2E4GA 1GRTA 2WQYA 3ZYXA 4AT2A 3AE6A 2R4EA 5JCMA 3BNUA 1KFYA 1CC4A 1E1LA 1L9CA 1NEKA 3UKKA 2WOIA 3BI5A 2J3NA 2GB0A 2Y6RA 3DK8A 1GT8A 2WPCA 2TPRA 5M10A 1UKVG 3GSIA 1OJTA 4J34A 2R0CA 5FS8A 2R0PA 5M0ZA 5IQ4A 1RP0A 2VVLG 1GALA 3RNMA 1TDKA 3T14A 5KMRA 2YM1A 4GDPA 4CY8A 3GDPA 4G74A 2XLRA 1H83A 4TLZA 1D4DA 3NGCX 3REDA 1FECA 3DA1A 5EB4A 4ZCDA 1HYUA 2BK4A 2BRAA 2WPEA 2JKCA 4J57A 1LTXR 4B66A 1XPQA 4P9SA 2XFUA 2FJAA 2Y6QA 4H4UA 4EM3A 4B1BA 2AR8A 4OPCA 3DK4A 4PAAA 1L9EA 2XCGA 1XANA 3BI4A 2GAHB 4GUVA 3T31A 4JQ9A 4Y4NA 4EMJA 4J2WA 2YLZA 5KXJA 2C3CA 4U8KA 2B9YA 5KWFA 1GOSA 5JCNA 2FJBA 1COYA 1JNZA 1Y56A 4B67A 2XLTA 2VOUA 1M6IA 1YQ4A 2PHHA 2R46A 4U2SA 1S3EA 2EQ8A 3PS9A 3NN6X 2F5ZA 5KRQA 3LB8A 3QFBA 2JBVA 4GF7A 2VRLA 1NG3A 1F3PA 3UCLA 5HY5A 4A9WA 1JRZA 4DSHA 4JY3A 3RP6A 3ICTA 3COXA 5KOXA 3KPKA 4GRTA 5FS9A 1CC6A 2WETA 2YWLA 4NWZA 3VQRA 4EQSA 3IF9A 4EIPA 2GF3A 3UP4A 2CULA 3GMBA 2BABA 1XHCA 2OALA 1PS9A 3AE2A 4LIIA 1H84A 2RGOA 4FX9A 3GD4A 2H89A 2YR6A 1PBBA 2E5VA 1KSUA 3P4PA 3VR8A 1BKWA 3ADAB 2WESA 1EBDA 3AECA 4H4VA 4H4RA 1B4VA 1NHQA 3FIMB 4RG3A 2WDVA 1P2EA 4A5LA 3JSKA 5GSNA 4CCRA 2JK6A 4EM4A 3PO7A 3BNMA 2Q6UA 2YG7A 1F8SA 4RSLA 1B8SA 3URHA 5ER0A 4EQRA 3AEAA 1E1NA 1DXLA 3NH3X 1CL0A 1PDHA 3GWDA 3BHFA 4TM3A 4C74A 3LXDA 3UP5A 5KVHA 2V5ZA 1KSSA 1TYTA 4EIQA 4K5SA 1MOKA 1F8WA 5L46A 4D03A 4ZCCA 1L0VA 4ZN0A 4Y4MA 4GDEA 1IUTA 1GPEA 1GXFA 1CJ2A 1H7WA 1B5QA 1JNRA 3Q9TA 4II2A 4OPUA 4X4JA 1IUSA 3P9UA 2R45A 3NHOX 4EQWA 1Q9IA 2YVFA 3AE9A 3K7TA 4C3YA 3UOXA 4J36A 1NHPA 4FK1C 4YTPA 2AAQA 3AB1A 2O9ZA 3NYFA 4RG4A 4CBQA 2R9ZA 3FG2P 1H6VA 4D04A 2YR4A 2BRYA 3QSEA 3NLCA 3AE1A 4H50A 1V59A 1CBOA 3KVEA 1IUUA 4XWRA 3DK9A 3ZDNA 3IWAA 3AEEA 2IVDA 4CNJA 3II4A 1GV4A 5JCKA 3V3OA 3DJDA 4UP3A 5KMPA 2ZBWA 3GYJA 1CHUA 2YR5A 1GSNA 1ZOYA 3DJGX 4YWOA 3HYVA 5LV9A 4NZHA 2C76A 2XYOA 3SFEA 4AT0A 1YQ3A 3H8LA 1Y0PA 3K30A 5BUKA 2C70A 1PJ7A 4AP1A 4YSHA 1K4QA 1D7LA 3V3NA 3CN8A 2GRTA 1PJ6A 2WP6A 3NNEA 3K7MX 4UDPA 3SGLA 4PABA 3KLJA 1TYPA 1GREA 3CGDA 3I3LA 2GEWA 2YLSA 2WOVA 1VG0A 2XFQA 3ICSA 4FK1A 2C72A 1DOCA 2NPXA 4B64A 4BV6A 2XLSA 3H8IA 3QVRA 4U8OA 4USRA 1H82A 2FJDA 1DOEA 2BC0A 2YVJA 1ZDLA 1GESA 3HZLA 5J7XA 2YG6A 3AXBA 2BC1A 3T37A 2EQ9A 4A79A 4I58A 4A6NA 4BK2A 1E39A 4G9KA 2AQJA 4JN9A 4C3XA 4M52A 1PXAA 3T0KA 1BGNA 2BS2A 2OAMA 1MXTA 4USQA 3SQPA 1GRGA 1YKJA 3D1CA 1LQTA 4YKFA 4Z2TA 1S2YA 3QSSA 1F8RA 4E0VA 1IUXA 4H4WA 5HHFA 3G5RA 4NTEA 4GCMA 2YVGA 3IHGA 1SEZA 5J60A 3UKAA 2V3AA 4H7UA 4MJWA 1S2QA 2WDRA 3FMWA 4C5OA 2VZ2A 2XLUA 3R9UA 1Z6LA 1GRHA 4H4XA 4IVOB 4ADWA 1RYIA 3F8RA 1CJ4A 3WE0A 4B68A 5CQFA 1O94A 1W4XA 2Q0LA 4UDQA 4OCGA 1CF3A 1JOAA 2OA1A 1EL9A 1D4EA 3QJ4A 4O5QA 1JEHA 1PBFA 1ZP0A 1E1KA 2WU2A 3LZXA 3AYIA 3NN0X 1QO8A 3NG7X 5DBJA 2BCPA 3O0HA 4YKGA 2ARDA 2XLPA 3RP7A 2VRMA 2R4JA 3UTFA 3DGHA 2XVHA 3ALMA 4G6HA 3SZWA 1JU2A 1NG4A 5FMHA 2QAEA 3QFAA 1KNRA 2X99A 2BXRA 1DOBA 3CMMA 4CY6A 1LPFA 2YG5A 1Y56B 4IA5A 4KX6A 4H4ZA 1N4WA 4H4SA 4H2NA 2BK5A 4REKA 1NDAA 1N1PA 3LJPA 4H2RA 4LU6A 5GRTA 1PXCA 3DGZA 2PYXA 3B6DA 2YLRA 2VVMA 4N9XA 4NTCA 4IVMB 3LADA 1DJNA 3GRTA 1YY5A 3ABVA 3I6DA 2JB3A 3CNPA 2BXSA 5EBKA 2APGA 3ISHA 1BWCA 2Z5YA 4TM1A 4XWZA 4NNJA 3GRSA 4YTMA 3ITJA 1GTHA 2C64A 3QVPA 3ALLA 4JNQA 3T2KA 2RABA 2BA9A 4BK1A 4DGKA 2GV8A 4Z2UA 4OPGA 1ZMCA 1L9DA 1NHRA 4K2XA 5HXIA 3BHKA 4EQXA 3RHAA 3VRBA 4J33A 2ZZCA 2JB1A 4EMIA 3CNDA 4GAPA 2C67A 1K0IA 3L1RA 1VG9A 4GR1A 1AOGA 2YLTA 1QJDA 1Q1WA 2GR0A 3KD9A 3P4RA 3EPTA 1ONFA 2C3DA 4Z25A 2B7RA 1TDOA 3G5SA 4B69A 1ZK7A 1DODA 1PHHA 3NK0X 4AOXA 2WEUA 3UOZA 1GTEA 3UKFA 4A6NB 1ZMDA 3CPIG 2C4CA 1FEAA 2DKHA 3AEDA 3IC9A 4LA1A 4O5UA 4U8LA 5U25A 1GRAA 4EMWA 3NYCA 2A87A 4HB9A 4WX1A 1E6EA 2BCGG 1DNCA 3NK1X 5FS7A 2C66A 4JY2A 1K0LA 3AE3A 3CGEA 2X8GA 5JCLA 4G73A 2XVIA 1OJ9A 1B37A 1KNPA 3AD7B 1S3BA 3P4QA 3AYLA 3ALJA 1GRFA 2XFNA 4H2PA 3SZCA 1D7YA 3EF6A 3QSMA 4X9NA 4YT0A 1CC2A 4H4PA 1TDEA 2X50A 1GERA 4IV9A 4U2TA 4Z2RA 1LQUA 3GWFA 4ICYA 4DSGA 2CFYA 2XFPA 1OJDA 2C73A 2XDOA 4NEVA 3UKPA 1PXBA 4YXDA 1DJQA 2X8HA 4Z26A 1N4VA 3PVCA 5BULA 3AE4A 4B63A 2WDQA 2VQ7A 3L8KA 2GMJA 5JCIA 4CNKA 4YTNA 1NPXA 3F8DA 4NTDA 2XFOA 3S5WA 4BK3A 2V60A 4CRTA 3AE5A 3NT6A 1OJAA 3H4KA 3NTDA 2GH5A 2B9WA 3ATQA 4U2LA 2RGJA 3Q6JA 2OLOA 2C75A 3CPJG 1PBEA 1ZKQA 2Q0KA 3FBSA 3KU9A 1REOA 4TLXA 3LZWA 1N4UA 4TM0A 3AEGA 3OC4A 5IQ1A 1VRQB 5EOWA 4YSYA 4DNAA 1PBDA 2E1MA 2B76A 2R0GA 2GMHA 1EL7A 4Z44A 4Z24A 3SZFA 1H7XA 1IUWA 3UKHA 3B3RA 3VRDB 4B65A 5IPYA 4K8DA 3P4SA 4ECHA 5BVAA 4A7AA 5KMSA 2X3NA 3AD9B 1LJ1A 2EQ6A 5C3JA 1JRXA 4JDRA 1KDGA 4OPIA 4U8MA 2QA2A 2X8CA 3KKJA 1OJCA 1BZLA 2WP9A 5CKUA 3UOVA 2WHDA 2V61A 3HYWA 1K0JA 3AYJA 2CDUA 2JB2A 3P1WA 2YM2A 3UKLA 3UTGA 2C65A 3AEBA 3CIRA 3CNTA 1FEBA 4NEWA 4OPTA 4H2QA 4K7ZA 3CPHG 2WBAA 4IA6A 2JAEA 3BI2A 4U8JA 3NYEA 2EQ7A 4TM4A 1ZY8A 4A65A 1IJHA 4U8IA 3NIXA 3AE8A 2IIDA 1CJ3A 4OPLA 2OLNA 3D8XA 4BURA 1GEUA 1YQZA 2GR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H81 A;  5HYM A;  3NTA A;  3CTY A;  4HA6 A;  2XVE A;  2QCU A;  2QA1 A;  2HQM A;  3DJJ A;  3VRA A;  5KOW A;  1O5W A;  1TDF A;  2ACZ A;  5U1O A;  4OPD A;  1E1M A;  4BJZ A;  3E1T A;  3GYI A;  4YSX A;  2GQW A;  4JNA A;  1ELI A;  2W0H A;  1JRY A;  3CGC A;  5TR3 A;  1E7P A;  4WCT A;  1GET A;  4J31 A;  1O95 A;  3K7Q X;  2BS4 A;  2YLX A;  2Q7V A;  3GMC A;  1ZOV A;  3EAO A;  1X31 B;  1EL5 A;  1LVL A;  2GQF A;  2BAC A;  1VDC A;  2ZZB A;  2FBW A;  2V3B A;  3GD3 A;  3NRN A;  2YG4 A;  4I59 A;  2V6O A;  2WOW A;  5U63 A;  1PJ5 A;  3EAN A;  1ZX9 A;  1MO9 A;  1RSG A;  2YQU A;  3KPF A;  2YG3 A;  1H86 A;  2XVJ A;  4KPR A;  3S61 A;  1IUV A;  2GR3 A;  2BYB A;  2WS3 A;  3VR9 A;  2H88 A;  2Z5X A;  2RGH A;  1GRB A;  1LV0 A;  1NEN A;  3NK2 X;  3UOY A;  4BJY A;  3FPZ A;  3UKQ A;  1VQW A;  3CNS A;  3SFD A;  5EB5 A;  3GDN A;  2C7G A;  5C2T A;  2WU5 A;  1M64 A;  3AWI A;  1NHS A;  3G5Q A;  1BGJ A;  3V76 A;  4H4Q A;  4Y4L A;  3CNJ A;  4AOS A;  2BS3 A;  1P2H A;  1D5T A;  2TMD A;  4K5R A;  4H4Y A;  3DME A;  2XVF A;  2WPF A;  2VQB A;  3AE7 A;  3IHM A;  1FOH A;  3NKS A;  2CVJ A;  4U8P A;  3AEF A;  2YLW A;  4XXG A;  2A8X A;  3F8P A;  3ICR A;  1XDI A;  2BK3 A;  4J56 A;  4Z43 A;  1GND A;  3UTE A;  1QLB A;  4OVI A;  1PN0 A;  3DH9 A;  4H4T A;  2UZZ A;  5FS6 A;  3RP8 A;  3M13 A;  1BF3 A;  4YSZ A;  5KVI A;  2VVL A;  3AD8 B;  2IVE A;  3C4A A;  4X9M A;  1CJC A;  3ATR A;  2B7S A;  4A99 A;  5BRT A;  3LOV A;  1F6M A;  3M0O A;  2GR2 A;  1FL2 A;  4FDC B;  4K22 A;  3CGB A;  4C77 A;  2DKI A;  1D4C A;  2ZZ0 A;  1NAA A;  2I0Z A;  1TDN A;  3SM8 A;  4UDR A;  1Q1R A;  3C96 A;  1EL8 A;  2WP5 A;  3DJE A;  3KA7 A;  3OZ2 A;  1PBC A;  4AP3 A;  2FJE A;  3UTH A;  2B9X A;  4CCQ A;  2A89 A;  2GVC A;  1FCD A;  1KF6 A;  1TRB A;  2GAG B;  3C4N A;  4U8N A;  3M12 A;  4APN A;  2NVK X;  2YAU A;  2E4G A;  1GRT A;  2WQY A;  3ZYX A;  4AT2 A;  3AE6 A;  2R4E A;  5JCM A;  3BNU A;  1KFY A;  1CC4 A;  1E1L A;  1L9C A;  1NEK A;  3UKK A;  2WOI A;  3BI5 A;  2J3N A;  2GB0 A;  2Y6R A;  3DK8 A;  1GT8 A;  2WPC A;  2TPR A;  5M10 A;  1UKV G;  3GSI A;  1OJT A;  4J34 A;  2R0C A;  5FS8 A;  2R0P A;  5M0Z A;  5IQ4 A;  1RP0 A;  2VVL G;  1GAL A;  3RNM A;  1TDK A;  2YM1 A;  4GDP A;  4CY8 A;  3GDP A;  2XLR A;  1H83 A;  4TLZ A;  1D4D A;  3NGC X;  3RED A;  1FEC A;  3DA1 A;  5EB4 A;  4ZCD A;  1HYU A;  2BK4 A;  2WPE A;  2JKC A;  4J57 A;  1LTX R;  4B66 A;  1XPQ A;  4P9S A;  2XFU A;  2FJA A;  2Y6Q A;  4H4U A;  4EM3 A;  4B1B A;  2AR8 A;  4OPC A;  3DK4 A;  4PAA A;  1L9E A;  2XCG A;  1XAN A;  3BI4 A;  2GAH B;  4GUV A;  4JQ9 A;  4Y4N A;  4EMJ A;  4J2W A;  2YLZ A;  5KXJ A;  2C3C A;  4U8K A;  2B9Y A;  5KWF A;  1GOS A;  5JCN A;  2FJB A;  1COY A;  1JNZ A;  1Y56 A;  4B67 A;  2XLT A;  2VOU A;  1M6I A;  1YQ4 A;  2PHH A;  2R46 A;  4U2S A;  1S3E A;  2EQ8 A;  3PS9 A;  3NN6 X;  2F5Z A;  5KRQ A;  3LB8 A;  3QFB A;  2JBV A;  4GF7 A;  2VRL A;  1NG3 A;  1F3P A;  3UCL A;  5HY5 A;  4A9W A;  1JRZ A;  4DSH A;  4JY3 A;  3RP6 A;  3ICT A;  3COX A;  5KOX A;  4GRT A;  5FS9 A;  1CC6 A;  2WET A;  2YWL A;  3VQR A;  4EQS A;  3IF9 A;  4EIP A;  2GF3 A;  3UP4 A;  2CUL A;  3GMB A;  2BAB A;  1XHC A;  2OAL A;  1PS9 A;  3AE2 A;  4LII A;  1H84 A;  2RGO A;  4FX9 A;  3GD4 A;  2H89 A;  2YR6 A;  1PBB A;  2E5V A;  1KSU A;  3P4P A;  3VR8 A;  1BKW A;  3ADA B;  2WES A;  1EBD A;  3AEC A;  4H4V A;  4H4R A;  1B4V A;  1NHQ A;  3FIM B;  4RG3 A;  2WDV A;  1P2E A;  4A5L A;  3JSK A;  5GSN A;  4CCR A;  2JK6 A;  4EM4 A;  3PO7 A;  3BNM A;  2Q6U A;  2YG7 A;  1F8S A;  4RSL A;  1B8S A;  3URH A;  5ER0 A;  4EQR A;  3AEA A;  1E1N A;  1DXL A;  3NH3 X;  1CL0 A;  1PDH A;  3GWD A;  3BHF A;  4TM3 A;  4C74 A;  3LXD A;  3UP5 A;  5KVH A;  2V5Z A;  1KSS A;  1TYT A;  4EIQ A;  4K5S A;  1MOK A;  1F8W A;  5L46 A;  4D03 A;  4ZCC A;  1L0V A;  4ZN0 A;  4Y4M A;  4GDE A;  1IUT A;  1GPE A;  1GXF A;  1CJ2 A;  1H7W A;  1B5Q A;  1JNR A;  3Q9T A;  4OPU A;  4X4J A;  1IUS A;  3P9U A;  2R45 A;  3NHO X;  4EQW A;  1Q9I A;  2YVF A;  3AE9 A;  3K7T A;  4C3Y A;  3UOX A;  4J36 A;  1NHP A;  4FK1 C;  4YTP A;  2AAQ A;  3AB1 A;  2O9Z A;  3NYF A;  4RG4 A;  4CBQ A;  2R9Z A;  3FG2 P;  1H6V A;  4D04 A;  2YR4 A;  3QSE A;  3NLC A;  3AE1 A;  4H50 A;  1V59 A;  1CBO A;  3KVE A;  1IUU A;  4XWR A;  3DK9 A;  3ZDN A;  3IWA A;  3AEE A;  2IVD A;  4CNJ A;  3II4 A;  1GV4 A;  5JCK A;  3V3O A;  3DJD A;  4UP3 A;  2ZBW A;  3GYJ A;  1CHU A;  2YR5 A;  1GSN A;  1ZOY A;  3DJG X;  4YWO A;  5LV9 A;  4NZH A;  2C76 A;  2XYO A;  3SFE A;  4AT0 A;  1YQ3 A;  3H8L A;  1Y0P A;  3K30 A;  5BUK A;  2C70 A;  1PJ7 A;  4AP1 A;  4YSH A;  1K4Q A;  1D7L A;  3V3N A;  3CN8 A;  2GRT A;  1PJ6 A;  2WP6 A;  3NNE A;  3K7M X;  4UDP A;  3SGL A;  4PAB A;  3KLJ A;  1TYP A;  1GRE A;  3CGD A;  3I3L A;  2GEW A;  2YLS A;  2WOV A;  1VG0 A;  2XFQ A;  3ICS A;  4FK1 A;  2C72 A;  1DOC A;  2NPX A;  4B64 A;  4BV6 A;  2XLS A;  3H8I A;  3QVR A;  4U8O A;  4USR A;  1H82 A;  2FJD A;  1DOE A;  2BC0 A;  2YVJ A;  1ZDL A;  1GES A;  3HZL A;  5J7X A;  2YG6 A;  3AXB A;  2BC1 A;  3T37 A;  2EQ9 A;  4A79 A;  4I58 A;  4A6N A;  4BK2 A;  1E39 A;  2AQJ A;  4JN9 A;  4C3X A;  4M52 A;  1PXA A;  1BGN A;  2BS2 A;  2OAM A;  1MXT A;  4USQ A;  3SQP A;  1GRG A;  1YKJ A;  3D1C A;  1LQT A;  4YKF A;  4Z2T A;  1S2Y A;  3QSS A;  1F8R A;  4E0V A;  1IUX A;  4H4W A;  5HHF A;  3G5R A;  4NTE A;  4GCM A;  2YVG A;  3IHG A;  1SEZ A;  5J60 A;  3UKA A;  2V3A A;  4H7U A;  4MJW A;  1S2Q A;  2WDR A;  3FMW A;  4C5O A;  2VZ2 A;  2XLU A;  3R9U A;  1Z6L A;  1GRH A;  4H4X A;  4IVO B;  4ADW A;  1RYI A;  3F8R A;  1CJ4 A;  3WE0 A;  4B68 A;  5CQF A;  1O94 A;  1W4X A;  2Q0L A;  4UDQ A;  4OCG A;  1CF3 A;  1JOA A;  2OA1 A;  1EL9 A;  1D4E A;  3QJ4 A;  4O5Q A;  1JEH A;  1PBF A;  1ZP0 A;  1E1K A;  2WU2 A;  3LZX A;  3AYI A;  3NN0 X;  1QO8 A;  3NG7 X;  5DBJ A;  2BCP A;  3O0H A;  4YKG A;  2ARD A;  2XLP A;  3RP7 A;  2VRM A;  2R4J A;  3UTF A;  3DGH A;  2XVH A;  3ALM A;  1JU2 A;  1NG4 A;  5FMH A;  2QAE A;  3QFA A;  1KNR A;  2X99 A;  2BXR A;  1DOB A;  4CY6 A;  1LPF A;  2YG5 A;  1Y56 B;  4IA5 A;  4KX6 A;  4H4Z A;  1N4W A;  4H4S A;  4H2N A;  2BK5 A;  4REK A;  1NDA A;  1N1P A;  3LJP A;  4H2R A;  4LU6 A;  5GRT A;  1PXC A;  3DGZ A;  2PYX A;  3B6D A;  2YLR A;  2VVM A;  4N9X A;  4NTC A;  4IVM B;  3LAD A;  1DJN A;  3GRT A;  1YY5 A;  3ABV A;  3I6D A;  2JB3 A;  3CNP A;  2BXS A;  5EBK A;  2APG A;  3ISH A;  1BWC A;  2Z5Y A;  4TM1 A;  4XWZ A;  3GRS A;  4YTM A;  3ITJ A;  1GTH A;  2C64 A;  3QVP A;  3ALL A;  4JNQ A;  4DGK A;  2RAB A;  2BA9 A;  4BK1 A;  2GV8 A;  4Z2U A;  4OPG A;  1ZMC A;  1L9D A;  1NHR A;  4K2X A;  5HXI A;  3BHK A;  4EQX A;  3RHA A;  3VRB A;  4J33 A;  2ZZC A;  2JB1 A;  4EMI A;  3CND A;  2C67 A;  1K0I A;  3L1R A;  1VG9 A;  4GR1 A;  1AOG A;  2YLT A;  1QJD A;  1Q1W A;  2GR0 A;  3KD9 A;  3P4R A;  3EPT A;  1ONF A;  2C3D A;  4Z25 A;  2B7R A;  1TDO A;  3G5S A;  4B69 A;  1ZK7 A;  1DOD A;  1PHH A;  3NK0 X;  4AOX A;  2WEU A;  3UOZ A;  1GTE A;  3UKF A;  4A6N B;  1ZMD A;  3CPI G;  2DKH A;  1FEA A;  3AED A;  3IC9 A;  4LA1 A;  4O5U A;  4U8L A;  5U25 A;  1GRA A;  4EMW A;  3NYC A;  2A87 A;  4HB9 A;  4WX1 A;  1E6E A;  2BCG G;  1DNC A;  3NK1 X;  5FS7 A;  2C66 A;  4JY2 A;  1K0L A;  3AE3 A;  3CGE A;  2X8G A;  5JCL A;  2XVI A;  1OJ9 A;  1B37 A;  1KNP A;  3AD7 B;  1S3B A;  3P4Q A;  3AYL A;  3ALJ A;  1GRF A;  2XFN A;  4H2P A;  1D7Y A;  3EF6 A;  3QSM A;  4X9N A;  4YT0 A;  1CC2 A;  4H4P A;  1TDE A;  2X50 A;  1GER A;  4IV9 A;  4U2T A;  4Z2R A;  1LQU A;  3GWF A;  4ICY A;  4DSG A;  2CFY A;  2XFP A;  1OJD A;  2C73 A;  2XDO A;  4NEV A;  3UKP A;  1PXB A;  4YXD A;  1DJQ A;  2X8H A;  4Z26 A;  1N4V A;  3PVC A;  5BUL A;  3AE4 A;  4B63 A;  2WDQ A;  2VQ7 A;  3L8K A;  2GMJ A;  5JCI A;  4CNK A;  4YTN A;  1NPX A;  3F8D A;  4NTD A;  2XFO A;  3S5W A;  4BK3 A;  2V60 A;  4CRT A;  3AE5 A;  3NT6 A;  1OJA A;  3H4K A;  3NTD A;  2GH5 A;  2B9W A;  3ATQ A;  4U2L A;  2RGJ A;  3Q6J A;  2OLO A;  2C75 A;  3CPJ G;  1PBE A;  1ZKQ A;  2Q0K A;  3FBS A;  3KU9 A;  1REO A;  4TLX A;  3LZW A;  1N4U A;  4TM0 A;  3AEG A;  3OC4 A;  5IQ1 A;  1VRQ B;  5EOW A;  4YSY A;  4DNA A;  1PBD A;  2E1M A;  2B76 A;  2R0G A;  2GMH A;  1EL7 A;  4Z44 A;  4Z24 A;  1H7X A;  1IUW A;  3UKH A;  3B3R A;  3VRD B;  4B65 A;  5IPY A;  4K8D A;  3P4S A;  4ECH A;  5BVA A;  4A7A A;  2X3N A;  3AD9 B;  1LJ1 A;  2EQ6 A;  5C3J A;  1JRX A;  4JDR A;  1KDG A;  4OPI A;  4U8M A;  2QA2 A;  2X8C A;  3KKJ A;  1OJC A;  1BZL A;  2WP9 A;  5CKU A;  3UOV A;  2WHD A;  2V61 A;  1K0J A;  3AYJ A;  2CDU A;  2JB2 A;  3P1W A;  2YM2 A;  3UKL A;  3UTG A;  2C65 A;  3AEB A;  3CIR A;  3CNT A;  1FEB A;  4NEW A;  4OPT A;  4H2Q A;  4K7Z A;  3CPH G;  2WBA A;  4IA6 A;  2JAE A;  3BI2 A;  4U8J A;  3NYE A;  2EQ7 A;  4TM4 A;  1ZY8 A;  4A65 A;  1IJH A;  4U8I A;  3NIX A;  3AE8 A;  2IID A;  1CJ3 A;  4OPL A;  2OLN A;  3D8X A;  4BUR A;  1GEU A;  1YQZ A;  2GR1 A; 
#chains in the Genus database with same CATH topology
 1H81 A;  5HYM A;  3NTA A;  3CTY A;  3SXI A;  4HA6 A;  2XVE A;  2QCU A;  2QA1 A;  2HQM A;  3DJJ A;  3VRA A;  5KOW A;  1O5W A;  1TDF A;  2ACZ A;  4GAV A;  4OPD A;  1E1M A;  5U1O A;  4BJZ A;  3E1T A;  3GYI A;  4YSX A;  2GQW A;  4JNA A;  1ELI A;  2W0H A;  5KMQ A;  1JRY A;  3CGC A;  5TR3 A;  1E7P A;  4WCT A;  1GET A;  4J31 A;  1O95 A;  3K7Q X;  2BS4 A;  2YLX A;  2Q7V A;  3GMC A;  1ZOV A;  3EAO A;  1X31 B;  1EL5 A;  1LVL A;  2GQF A;  3T2Z A;  2BAC A;  1VDC A;  2ZZB A;  2FBW A;  2V3B A;  3GD3 A;  3NRN A;  2YG4 A;  4I59 A;  2V6O A;  2WOW A;  5U63 A;  1PJ5 A;  3EAN A;  1ZX9 A;  1MO9 A;  3GYX A;  1RSG A;  2YQU A;  3KPF A;  2YG3 A;  1H86 A;  3T2Y A;  2XVJ A;  4KPR A;  3S61 A;  1IUV A;  2GR3 A;  2BYB A;  2WS3 A;  3VR9 A;  3HYX A;  2H88 A;  2Z5X A;  2RGH A;  1GRB A;  1LV0 A;  1NEN A;  3NK2 X;  3UOY A;  4BJY A;  3FPZ A;  3UKQ A;  1VQW A;  3CNS A;  3SFD A;  5EB5 A;  3GDN A;  2C7G A;  5C2T A;  2WU5 A;  1M64 A;  3AWI A;  1NHS A;  3G5Q A;  1BGJ A;  3V76 A;  3SX6 A;  4H4Q A;  4Y4L A;  3CNJ A;  4AOS A;  2BS3 A;  1P2H A;  1D5T A;  2TMD A;  4K5R A;  4H4Y A;  3DME A;  2XVF A;  2WPF A;  2VQB A;  3AE7 A;  3IHM A;  1FOH A;  3NKS A;  2CVJ A;  4U8P A;  3AEF A;  2YLW A;  4XXG A;  2A8X A;  3F8P A;  3ICR A;  1XDI A;  2BK3 A;  4J56 A;  3SY4 A;  4Z43 A;  1GND A;  3UTE A;  1QLB A;  4OVI A;  1PN0 A;  3DH9 A;  4H4T A;  2UZZ A;  5FS6 A;  3RP8 A;  3M13 A;  1BF3 A;  4YSZ A;  5KVI A;  2VVL A;  3AD8 B;  2IVE A;  3C4A A;  4X9M A;  1CJC A;  3ATR A;  3SZ0 A;  2B7S A;  4A99 A;  5BRT A;  3LOV A;  1F6M A;  3M0O A;  2GR2 A;  1FL2 A;  4G6G A;  4FDC B;  4K22 A;  3CGB A;  4C77 A;  2DKI A;  1D4C A;  2ZZ0 A;  1NAA A;  2I0Z A;  1TDN A;  4II3 A;  5KNL A;  3SM8 A;  4UDR A;  1Q1R A;  3C96 A;  1EL8 A;  2WP5 A;  3DJE A;  3KA7 A;  3OZ2 A;  1PBC A;  4AP3 A;  2FJE A;  3UTH A;  2B9X A;  4CCQ A;  2A89 A;  3SYI A;  2GVC A;  1FCD A;  1KF6 A;  1TRB A;  2GAG B;  3C4N A;  4U8N A;  3M12 A;  4APN A;  2NVK X;  2YAU A;  2E4G A;  1GRT A;  2WQY A;  3ZYX A;  4AT2 A;  3AE6 A;  2R4E A;  5JCM A;  3BNU A;  1KFY A;  1CC4 A;  1E1L A;  1L9C A;  1NEK A;  3UKK A;  2WOI A;  3BI5 A;  2J3N A;  2GB0 A;  2Y6R A;  3DK8 A;  1GT8 A;  2WPC A;  2TPR A;  5M10 A;  1UKV G;  3GSI A;  1OJT A;  4J34 A;  2R0C A;  5FS8 A;  2R0P A;  5M0Z A;  5IQ4 A;  1RP0 A;  2VVL G;  1GAL A;  3RNM A;  1TDK A;  3T14 A;  5KMR A;  2YM1 A;  4GDP A;  4CY8 A;  3GDP A;  4G74 A;  2XLR A;  1H83 A;  4TLZ A;  1D4D A;  3NGC X;  3RED A;  1FEC A;  3DA1 A;  5EB4 A;  4ZCD A;  1HYU A;  2BK4 A;  2BRA A;  2WPE A;  2JKC A;  4J57 A;  1LTX R;  4B66 A;  1XPQ A;  4P9S A;  2XFU A;  2FJA A;  2Y6Q A;  4H4U A;  4EM3 A;  4B1B A;  2AR8 A;  4OPC A;  3DK4 A;  4PAA A;  1L9E A;  2XCG A;  1XAN A;  3BI4 A;  2GAH B;  4GUV A;  3T31 A;  4JQ9 A;  4Y4N A;  4EMJ A;  4J2W A;  2YLZ A;  5KXJ A;  2C3C A;  4U8K A;  2B9Y A;  5KWF A;  1GOS A;  5JCN A;  2FJB A;  1COY A;  1JNZ A;  1Y56 A;  4B67 A;  2XLT A;  2VOU A;  1M6I A;  1YQ4 A;  2PHH A;  2R46 A;  4U2S A;  1S3E A;  2EQ8 A;  3PS9 A;  3NN6 X;  2F5Z A;  5KRQ A;  3LB8 A;  3QFB A;  2JBV A;  4GF7 A;  2VRL A;  1NG3 A;  1F3P A;  3UCL A;  5HY5 A;  4A9W A;  1JRZ A;  4DSH A;  4JY3 A;  3RP6 A;  3ICT A;  3COX A;  5KOX A;  3KPK A;  4GRT A;  5FS9 A;  1CC6 A;  2WET A;  2YWL A;  4NWZ A;  3VQR A;  4EQS A;  3IF9 A;  4EIP A;  2GF3 A;  3UP4 A;  2CUL A;  3GMB A;  2BAB A;  1XHC A;  2OAL A;  1PS9 A;  3AE2 A;  4LII A;  1H84 A;  2RGO A;  4FX9 A;  3GD4 A;  2H89 A;  2YR6 A;  1PBB A;  2E5V A;  1KSU A;  3P4P A;  3VR8 A;  1BKW A;  3ADA B;  2WES A;  1EBD A;  3AEC A;  4H4V A;  4H4R A;  1B4V A;  1NHQ A;  3FIM B;  4RG3 A;  2WDV A;  1P2E A;  4A5L A;  3JSK A;  5GSN A;  4CCR A;  2JK6 A;  4EM4 A;  3PO7 A;  3BNM A;  2Q6U A;  2YG7 A;  1F8S A;  4RSL A;  1B8S A;  3URH A;  5ER0 A;  4EQR A;  3AEA A;  1E1N A;  1DXL A;  3NH3 X;  1CL0 A;  1PDH A;  3GWD A;  3BHF A;  4TM3 A;  4C74 A;  3LXD A;  3UP5 A;  5KVH A;  2V5Z A;  1KSS A;  1TYT A;  4EIQ A;  4K5S A;  1MOK A;  1F8W A;  5L46 A;  4D03 A;  4ZCC A;  1L0V A;  4ZN0 A;  4Y4M A;  4GDE A;  1IUT A;  1GPE A;  1GXF A;  1CJ2 A;  1H7W A;  1B5Q A;  1JNR A;  3Q9T A;  4II2 A;  4OPU A;  4X4J A;  1IUS A;  3P9U A;  2R45 A;  3NHO X;  4EQW A;  1Q9I A;  2YVF A;  3AE9 A;  3K7T A;  4C3Y A;  3UOX A;  4J36 A;  1NHP A;  4FK1 C;  4YTP A;  2AAQ A;  3AB1 A;  2O9Z A;  3NYF A;  4RG4 A;  4CBQ A;  2R9Z A;  3FG2 P;  1H6V A;  4D04 A;  2YR4 A;  2BRY A;  3QSE A;  3NLC A;  3AE1 A;  4H50 A;  1V59 A;  1CBO A;  3KVE A;  1IUU A;  4XWR A;  3DK9 A;  3ZDN A;  3IWA A;  3AEE A;  2IVD A;  4CNJ A;  3II4 A;  1GV4 A;  5JCK A;  3V3O A;  3DJD A;  4UP3 A;  5KMP A;  2ZBW A;  3GYJ A;  1CHU A;  2YR5 A;  1GSN A;  1ZOY A;  3DJG X;  4YWO A;  3HYV A;  5LV9 A;  4NZH A;  2C76 A;  2XYO A;  3SFE A;  4AT0 A;  1YQ3 A;  3H8L A;  1Y0P A;  3K30 A;  5BUK A;  2C70 A;  1PJ7 A;  4AP1 A;  4YSH A;  1K4Q A;  1D7L A;  3V3N A;  3CN8 A;  2GRT A;  1PJ6 A;  2WP6 A;  3NNE A;  3K7M X;  4UDP A;  3SGL A;  4PAB A;  3KLJ A;  1TYP A;  1GRE A;  3CGD A;  3I3L A;  2GEW A;  2YLS A;  2WOV A;  1VG0 A;  2XFQ A;  3ICS A;  4FK1 A;  2C72 A;  1DOC A;  2NPX A;  4B64 A;  4BV6 A;  2XLS A;  3H8I A;  3QVR A;  4U8O A;  4USR A;  1H82 A;  2FJD A;  1DOE A;  2BC0 A;  2YVJ A;  1ZDL A;  1GES A;  3HZL A;  5J7X A;  2YG6 A;  3AXB A;  2BC1 A;  3T37 A;  2EQ9 A;  4A79 A;  4I58 A;  4A6N A;  4BK2 A;  1E39 A;  4G9K A;  2AQJ A;  4JN9 A;  4C3X A;  4M52 A;  1PXA A;  3T0K A;  1BGN A;  2BS2 A;  2OAM A;  1MXT A;  4USQ A;  3SQP A;  1GRG A;  1YKJ A;  3D1C A;  1LQT A;  4YKF A;  4Z2T A;  1S2Y A;  3QSS A;  1F8R A;  4E0V A;  1IUX A;  4H4W A;  5HHF A;  3G5R A;  4NTE A;  4GCM A;  2YVG A;  3IHG A;  1SEZ A;  5J60 A;  3UKA A;  2V3A A;  4H7U A;  4MJW A;  1S2Q A;  2WDR A;  3FMW A;  4C5O A;  2VZ2 A;  2XLU A;  3R9U A;  1Z6L A;  1GRH A;  4H4X A;  4IVO B;  4ADW A;  1RYI A;  3WE0 A;  1CJ4 A;  3F8R A;  4B68 A;  5CQF A;  1O94 A;  1W4X A;  2Q0L A;  4UDQ A;  4OCG A;  1CF3 A;  1JOA A;  2OA1 A;  1EL9 A;  1D4E A;  3QJ4 A;  4O5Q A;  1JEH A;  1PBF A;  1ZP0 A;  1E1K A;  2WU2 A;  3LZX A;  3AYI A;  3NN0 X;  1QO8 A;  3NG7 X;  5DBJ A;  2BCP A;  3O0H A;  4YKG A;  2ARD A;  2XLP A;  3RP7 A;  2VRM A;  2R4J A;  3UTF A;  3DGH A;  2XVH A;  3ALM A;  4G6H A;  3SZW A;  1JU2 A;  1NG4 A;  5FMH A;  2QAE A;  3QFA A;  1KNR A;  2X99 A;  2BXR A;  1DOB A;  3CMM A;  4CY6 A;  1LPF A;  2YG5 A;  1Y56 B;  4IA5 A;  4KX6 A;  4H4Z A;  1N4W A;  4H4S A;  4H2N A;  2BK5 A;  4REK A;  1NDA A;  1N1P A;  3LJP A;  4H2R A;  4LU6 A;  5GRT A;  1PXC A;  3DGZ A;  2PYX A;  3B6D A;  2YLR A;  2VVM A;  4N9X A;  4NTC A;  4IVM B;  3LAD A;  1DJN A;  3GRT A;  1YY5 A;  3ABV A;  3I6D A;  2JB3 A;  3CNP A;  2BXS A;  5EBK A;  2APG A;  3ISH A;  1BWC A;  2Z5Y A;  4TM1 A;  4XWZ A;  4NNJ A;  3GRS A;  4YTM A;  3ITJ A;  1GTH A;  2C64 A;  3QVP A;  3ALL A;  4JNQ A;  3T2K A;  2RAB A;  2BA9 A;  4BK1 A;  4DGK A;  2GV8 A;  4Z2U A;  4OPG A;  1ZMC A;  1L9D A;  1NHR A;  4K2X A;  5HXI A;  3BHK A;  4EQX A;  3RHA A;  3VRB A;  4J33 A;  2ZZC A;  2JB1 A;  4EMI A;  3CND A;  4GAP A;  2C67 A;  1K0I A;  3L1R A;  1VG9 A;  4GR1 A;  1AOG A;  2YLT A;  1QJD A;  1Q1W A;  2GR0 A;  3KD9 A;  3P4R A;  3EPT A;  1ONF A;  2C3D A;  4Z25 A;  2B7R A;  1TDO A;  3G5S A;  4B69 A;  1ZK7 A;  1DOD A;  1PHH A;  3NK0 X;  4AOX A;  2WEU A;  3UOZ A;  1GTE A;  3UKF A;  4A6N B;  1ZMD A;  3CPI G;  2C4C A;  1FEA A;  2DKH A;  3AED A;  3IC9 A;  4LA1 A;  4O5U A;  4U8L A;  5U25 A;  1GRA A;  4EMW A;  3NYC A;  2A87 A;  4HB9 A;  4WX1 A;  1E6E A;  2BCG G;  1DNC A;  3NK1 X;  5FS7 A;  2C66 A;  4JY2 A;  1K0L A;  3AE3 A;  3CGE A;  2X8G A;  5JCL A;  4G73 A;  2XVI A;  1OJ9 A;  1B37 A;  1KNP A;  3AD7 B;  1S3B A;  3P4Q A;  3AYL A;  3ALJ A;  1GRF A;  2XFN A;  4H2P A;  3SZC A;  1D7Y A;  3EF6 A;  3QSM A;  4X9N A;  4YT0 A;  1CC2 A;  4H4P A;  1TDE A;  4IV9 A;  1GER A;  2X50 A;  4U2T A;  4Z2R A;  1LQU A;  3GWF A;  4ICY A;  4DSG A;  2CFY A;  2XFP A;  1OJD A;  2C73 A;  2XDO A;  4NEV A;  3UKP A;  1PXB A;  4YXD A;  1DJQ A;  2X8H A;  4Z26 A;  1N4V A;  3PVC A;  5BUL A;  3AE4 A;  4B63 A;  2WDQ A;  2VQ7 A;  3L8K A;  2GMJ A;  5JCI A;  4CNK A;  4YTN A;  1NPX A;  3F8D A;  4NTD A;  2XFO A;  3S5W A;  4BK3 A;  2V60 A;  4CRT A;  3AE5 A;  3NT6 A;  1OJA A;  3H4K A;  3NTD A;  2GH5 A;  2B9W A;  3ATQ A;  4U2L A;  2RGJ A;  3Q6J A;  2OLO A;  2C75 A;  3CPJ G;  1PBE A;  1ZKQ A;  2Q0K A;  3FBS A;  3KU9 A;  1REO A;  4TLX A;  3LZW A;  1N4U A;  4TM0 A;  3AEG A;  3OC4 A;  5IQ1 A;  1VRQ B;  5EOW A;  4YSY A;  4DNA A;  1PBD A;  2E1M A;  2B76 A;  2R0G A;  2GMH A;  1EL7 A;  4Z44 A;  4Z24 A;  3SZF A;  1H7X A;  1IUW A;  3UKH A;  3B3R A;  3VRD B;  4B65 A;  5IPY A;  4K8D A;  3P4S A;  4ECH A;  5BVA A;  4A7A A;  5KMS A;  2X3N A;  3AD9 B;  1LJ1 A;  2EQ6 A;  5C3J A;  1JRX A;  4JDR A;  1KDG A;  4OPI A;  4U8M A;  2QA2 A;  2X8C A;  3KKJ A;  1OJC A;  1BZL A;  2WP9 A;  5CKU A;  3UOV A;  2WHD A;  2V61 A;  3HYW A;  1K0J A;  3AYJ A;  2CDU A;  2JB2 A;  3P1W A;  2YM2 A;  3UKL A;  3UTG A;  2C65 A;  3AEB A;  3CIR A;  3CNT A;  1FEB A;  4NEW A;  4OPT A;  4H2Q A;  4K7Z A;  3CPH G;  2WBA A;  4IA6 A;  2JAE A;  3BI2 A;  4U8J A;  3NYE A;  2EQ7 A;  4TM4 A;  1ZY8 A;  4A65 A;  1IJH A;  4U8I A;  3NIX A;  3AE8 A;  2IID A;  1CJ3 A;  4OPL A;  2OLN A;  3D8X A;  4BUR A;  1GEU A;  1YQZ A;  2GR1 A; 
#chains in the Genus database with same CATH homology
 1H81 A;  5HYM A;  3NTA A;  3CTY A;  3SXI A;  4HA6 A;  2XVE A;  2QCU A;  2QA1 A;  2HQM A;  3DJJ A;  3VRA A;  5KOW A;  1O5W A;  1TDF A;  2ACZ A;  4GAV A;  4OPD A;  1E1M A;  5U1O A;  4BJZ A;  3E1T A;  3GYI A;  4YSX A;  2GQW A;  4JNA A;  1ELI A;  2W0H A;  5KMQ A;  1JRY A;  3CGC A;  5TR3 A;  1E7P A;  4WCT A;  1GET A;  4J31 A;  1O95 A;  3K7Q X;  2BS4 A;  2YLX A;  2Q7V A;  3GMC A;  1ZOV A;  3EAO A;  1X31 B;  1EL5 A;  1LVL A;  2GQF A;  3T2Z A;  2BAC A;  1VDC A;  2ZZB A;  2FBW A;  2V3B A;  3GD3 A;  3NRN A;  2YG4 A;  4I59 A;  2V6O A;  2WOW A;  5U63 A;  1PJ5 A;  3EAN A;  1ZX9 A;  1MO9 A;  3GYX A;  1RSG A;  2YQU A;  3KPF A;  2YG3 A;  1H86 A;  3T2Y A;  2XVJ A;  4KPR A;  3S61 A;  1IUV A;  2GR3 A;  2BYB A;  2WS3 A;  3VR9 A;  3HYX A;  2H88 A;  2Z5X A;  2RGH A;  1GRB A;  1LV0 A;  1NEN A;  3NK2 X;  3UOY A;  4BJY A;  3FPZ A;  3UKQ A;  1VQW A;  3CNS A;  3SFD A;  5EB5 A;  3GDN A;  2C7G A;  5C2T A;  2WU5 A;  1M64 A;  3AWI A;  1NHS A;  3G5Q A;  1BGJ A;  3V76 A;  3SX6 A;  4H4Q A;  4Y4L A;  3CNJ A;  4AOS A;  2BS3 A;  1P2H A;  1D5T A;  2TMD A;  4K5R A;  4H4Y A;  3DME A;  2XVF A;  2WPF A;  2VQB A;  3AE7 A;  3IHM A;  1FOH A;  3NKS A;  2CVJ A;  4U8P A;  3AEF A;  2YLW A;  4XXG A;  2A8X A;  3F8P A;  3ICR A;  1XDI A;  2BK3 A;  4J56 A;  3SY4 A;  4Z43 A;  1GND A;  3UTE A;  1QLB A;  4OVI A;  1PN0 A;  3DH9 A;  4H4T A;  2UZZ A;  5FS6 A;  3RP8 A;  3M13 A;  1BF3 A;  4YSZ A;  5KVI A;  2VVL A;  3AD8 B;  2IVE A;  3C4A A;  4X9M A;  1CJC A;  3ATR A;  3SZ0 A;  2B7S A;  4A99 A;  5BRT A;  3LOV A;  1F6M A;  3M0O A;  2GR2 A;  1FL2 A;  4G6G A;  4FDC B;  4K22 A;  3CGB A;  4C77 A;  2DKI A;  1D4C A;  2ZZ0 A;  1NAA A;  2I0Z A;  1TDN A;  4II3 A;  5KNL A;  3SM8 A;  4UDR A;  1Q1R A;  3C96 A;  1EL8 A;  2WP5 A;  3DJE A;  3KA7 A;  3OZ2 A;  1PBC A;  4AP3 A;  2FJE A;  3UTH A;  2B9X A;  4CCQ A;  2A89 A;  3SYI A;  2GVC A;  1FCD A;  1KF6 A;  1TRB A;  2GAG B;  3C4N A;  4U8N A;  3M12 A;  4APN A;  2NVK X;  2YAU A;  2E4G A;  1GRT A;  2WQY A;  3ZYX A;  4AT2 A;  3AE6 A;  2R4E A;  5JCM A;  3BNU A;  1KFY A;  1CC4 A;  1E1L A;  1L9C A;  1NEK A;  3UKK A;  2WOI A;  3BI5 A;  2J3N A;  2GB0 A;  2Y6R A;  3DK8 A;  1GT8 A;  2WPC A;  2TPR A;  5M10 A;  1UKV G;  3GSI A;  1OJT A;  4J34 A;  2R0C A;  5FS8 A;  2R0P A;  5M0Z A;  5IQ4 A;  1RP0 A;  2VVL G;  1GAL A;  3RNM A;  1TDK A;  3T14 A;  5KMR A;  2YM1 A;  4GDP A;  4CY8 A;  3GDP A;  4G74 A;  2XLR A;  1H83 A;  4TLZ A;  1D4D A;  3NGC X;  3RED A;  1FEC A;  3DA1 A;  5EB4 A;  4ZCD A;  1HYU A;  2BK4 A;  2BRA A;  2WPE A;  2JKC A;  4J57 A;  1LTX R;  4B66 A;  1XPQ A;  4P9S A;  2XFU A;  2FJA A;  2Y6Q A;  4H4U A;  4EM3 A;  4B1B A;  2AR8 A;  4OPC A;  3DK4 A;  4PAA A;  1L9E A;  2XCG A;  1XAN A;  3BI4 A;  2GAH B;  4GUV A;  3T31 A;  4JQ9 A;  4Y4N A;  4EMJ A;  4J2W A;  2YLZ A;  5KXJ A;  2C3C A;  4U8K A;  2B9Y A;  5KWF A;  1GOS A;  5JCN A;  2FJB A;  1COY A;  1JNZ A;  1Y56 A;  4B67 A;  2XLT A;  2VOU A;  1M6I A;  1YQ4 A;  2PHH A;  2R46 A;  4U2S A;  1S3E A;  2EQ8 A;  3PS9 A;  3NN6 X;  2F5Z A;  5KRQ A;  3LB8 A;  3QFB A;  2JBV A;  4GF7 A;  2VRL A;  1NG3 A;  1F3P A;  3UCL A;  5HY5 A;  4A9W A;  1JRZ A;  4DSH A;  4JY3 A;  3RP6 A;  3ICT A;  3COX A;  5KOX A;  3KPK A;  4GRT A;  5FS9 A;  1CC6 A;  2WET A;  2YWL A;  4NWZ A;  3VQR A;  4EQS A;  3IF9 A;  4EIP A;  2GF3 A;  3UP4 A;  2CUL A;  3GMB A;  2BAB A;  1XHC A;  2OAL A;  1PS9 A;  3AE2 A;  4LII A;  1H84 A;  2RGO A;  4FX9 A;  3GD4 A;  2H89 A;  2YR6 A;  1PBB A;  2E5V A;  1KSU A;  3P4P A;  3VR8 A;  1BKW A;  3ADA B;  2WES A;  1EBD A;  3AEC A;  4H4V A;  4H4R A;  1B4V A;  1NHQ A;  3FIM B;  4RG3 A;  2WDV A;  1P2E A;  4A5L A;  3JSK A;  5GSN A;  4CCR A;  2JK6 A;  4EM4 A;  3PO7 A;  3BNM A;  2Q6U A;  2YG7 A;  1F8S A;  4RSL A;  1B8S A;  3URH A;  5ER0 A;  4EQR A;  3AEA A;  1E1N A;  1DXL A;  3NH3 X;  1CL0 A;  1PDH A;  3GWD A;  3BHF A;  4TM3 A;  4C74 A;  3LXD A;  3UP5 A;  5KVH A;  2V5Z A;  1KSS A;  1TYT A;  4EIQ A;  4K5S A;  1MOK A;  1F8W A;  5L46 A;  4D03 A;  4ZCC A;  1L0V A;  4ZN0 A;  4Y4M A;  4GDE A;  1IUT A;  1GPE A;  1GXF A;  1CJ2 A;  1H7W A;  1B5Q A;  1JNR A;  3Q9T A;  4II2 A;  4OPU A;  4X4J A;  1IUS A;  3P9U A;  2R45 A;  3NHO X;  4EQW A;  1Q9I A;  2YVF A;  3AE9 A;  3K7T A;  4C3Y A;  3UOX A;  4J36 A;  1NHP A;  4FK1 C;  4YTP A;  2AAQ A;  3AB1 A;  2O9Z A;  3NYF A;  4RG4 A;  4CBQ A;  2R9Z A;  3FG2 P;  1H6V A;  4D04 A;  2YR4 A;  2BRY A;  3QSE A;  3NLC A;  3AE1 A;  4H50 A;  1V59 A;  1CBO A;  3KVE A;  1IUU A;  4XWR A;  3DK9 A;  3ZDN A;  3IWA A;  3AEE A;  2IVD A;  4CNJ A;  3II4 A;  1GV4 A;  5JCK A;  3V3O A;  3DJD A;  4UP3 A;  5KMP A;  2ZBW A;  3GYJ A;  1CHU A;  2YR5 A;  1GSN A;  1ZOY A;  3DJG X;  4YWO A;  3HYV A;  5LV9 A;  4NZH A;  2C76 A;  2XYO A;  3SFE A;  4AT0 A;  1YQ3 A;  3H8L A;  1Y0P A;  3K30 A;  5BUK A;  2C70 A;  1PJ7 A;  4AP1 A;  4YSH A;  1K4Q A;  1D7L A;  3V3N A;  3CN8 A;  2GRT A;  1PJ6 A;  2WP6 A;  3NNE A;  3K7M X;  4UDP A;  3SGL A;  4PAB A;  3KLJ A;  1TYP A;  1GRE A;  3CGD A;  3I3L A;  2GEW A;  2YLS A;  2WOV A;  1VG0 A;  2XFQ A;  3ICS A;  4FK1 A;  2C72 A;  1DOC A;  2NPX A;  4B64 A;  4BV6 A;  2XLS A;  3H8I A;  3QVR A;  4U8O A;  4USR A;  1H82 A;  2FJD A;  1DOE A;  2BC0 A;  2YVJ A;  1ZDL A;  1GES A;  3HZL A;  5J7X A;  2YG6 A;  3AXB A;  2BC1 A;  3T37 A;  2EQ9 A;  4A79 A;  4I58 A;  4A6N A;  4BK2 A;  1E39 A;  4G9K A;  2AQJ A;  4JN9 A;  4C3X A;  4M52 A;  1PXA A;  3T0K A;  1BGN A;  2BS2 A;  2OAM A;  1MXT A;  4USQ A;  3SQP A;  1GRG A;  1YKJ A;  3D1C A;  1LQT A;  4YKF A;  4Z2T A;  1S2Y A;  3QSS A;  1F8R A;  4E0V A;  1IUX A;  4H4W A;  5HHF A;  3G5R A;  4NTE A;  4GCM A;  2YVG A;  3IHG A;  1SEZ A;  5J60 A;  3UKA A;  2V3A A;  4H7U A;  4MJW A;  1S2Q A;  2WDR A;  3FMW A;  4C5O A;  2VZ2 A;  2XLU A;  3R9U A;  1Z6L A;  1GRH A;  4H4X A;  4IVO B;  4ADW A;  1RYI A;  3F8R A;  1CJ4 A;  3WE0 A;  4B68 A;  5CQF A;  1O94 A;  1W4X A;  2Q0L A;  4UDQ A;  4OCG A;  1CF3 A;  1JOA A;  2OA1 A;  1EL9 A;  1D4E A;  3QJ4 A;  4O5Q A;  1JEH A;  1PBF A;  1ZP0 A;  1E1K A;  2WU2 A;  3LZX A;  3AYI A;  3NN0 X;  1QO8 A;  3NG7 X;  5DBJ A;  2BCP A;  3O0H A;  4YKG A;  2ARD A;  2XLP A;  3RP7 A;  2VRM A;  2R4J A;  3UTF A;  3DGH A;  2XVH A;  3ALM A;  4G6H A;  3SZW A;  1JU2 A;  1NG4 A;  5FMH A;  2QAE A;  3QFA A;  1KNR A;  2X99 A;  2BXR A;  1DOB A;  3CMM A;  4CY6 A;  1LPF A;  2YG5 A;  1Y56 B;  4IA5 A;  4KX6 A;  4H4Z A;  1N4W A;  4H4S A;  4H2N A;  2BK5 A;  4REK A;  1NDA A;  1N1P A;  3LJP A;  4H2R A;  4LU6 A;  5GRT A;  1PXC A;  3DGZ A;  2PYX A;  3B6D A;  2YLR A;  2VVM A;  4N9X A;  4NTC A;  4IVM B;  3LAD A;  1DJN A;  3GRT A;  1YY5 A;  3ABV A;  3I6D A;  2JB3 A;  3CNP A;  2BXS A;  5EBK A;  2APG A;  3ISH A;  1BWC A;  2Z5Y A;  4TM1 A;  4XWZ A;  4NNJ A;  3GRS A;  4YTM A;  3ITJ A;  1GTH A;  2C64 A;  3QVP A;  3ALL A;  4JNQ A;  3T2K A;  2RAB A;  2BA9 A;  4BK1 A;  4DGK A;  2GV8 A;  4Z2U A;  4OPG A;  1ZMC A;  1L9D A;  1NHR A;  4K2X A;  5HXI A;  3BHK A;  4EQX A;  3RHA A;  3VRB A;  4J33 A;  2ZZC A;  2JB1 A;  4EMI A;  3CND A;  4GAP A;  2C67 A;  1K0I A;  3L1R A;  1VG9 A;  4GR1 A;  1AOG A;  2YLT A;  1QJD A;  1Q1W A;  2GR0 A;  3KD9 A;  3P4R A;  3EPT A;  1ONF A;  2C3D A;  4Z25 A;  2B7R A;  1TDO A;  3G5S A;  4B69 A;  1ZK7 A;  1DOD A;  1PHH A;  3NK0 X;  4AOX A;  2WEU A;  3UOZ A;  1GTE A;  3UKF A;  4A6N B;  1ZMD A;  3CPI G;  2C4C A;  1FEA A;  2DKH A;  3AED A;  3IC9 A;  4LA1 A;  4O5U A;  4U8L A;  5U25 A;  1GRA A;  4EMW A;  3NYC A;  2A87 A;  4HB9 A;  4WX1 A;  1E6E A;  2BCG G;  1DNC A;  3NK1 X;  5FS7 A;  2C66 A;  4JY2 A;  1K0L A;  3AE3 A;  3CGE A;  2X8G A;  5JCL A;  4G73 A;  2XVI A;  1OJ9 A;  1B37 A;  1KNP A;  3AD7 B;  1S3B A;  3P4Q A;  3AYL A;  3ALJ A;  1GRF A;  2XFN A;  4H2P A;  3SZC A;  1D7Y A;  3EF6 A;  3QSM A;  4X9N A;  4YT0 A;  1CC2 A;  4H4P A;  1TDE A;  2X50 A;  1GER A;  4IV9 A;  4U2T A;  4Z2R A;  1LQU A;  3GWF A;  4ICY A;  4DSG A;  2CFY A;  2XFP A;  1OJD A;  2C73 A;  2XDO A;  4NEV A;  3UKP A;  1PXB A;  4YXD A;  1DJQ A;  2X8H A;  4Z26 A;  1N4V A;  3PVC A;  5BUL A;  3AE4 A;  4B63 A;  2WDQ A;  2VQ7 A;  3L8K A;  2GMJ A;  5JCI A;  4CNK A;  4YTN A;  1NPX A;  3F8D A;  4NTD A;  2XFO A;  3S5W A;  4BK3 A;  2V60 A;  4CRT A;  3AE5 A;  3NT6 A;  1OJA A;  3H4K A;  3NTD A;  2GH5 A;  2B9W A;  3ATQ A;  4U2L A;  2RGJ A;  3Q6J A;  2OLO A;  2C75 A;  3CPJ G;  1PBE A;  1ZKQ A;  2Q0K A;  3FBS A;  3KU9 A;  1REO A;  4TLX A;  3LZW A;  1N4U A;  4TM0 A;  3AEG A;  3OC4 A;  5IQ1 A;  1VRQ B;  5EOW A;  4YSY A;  4DNA A;  1PBD A;  2E1M A;  2B76 A;  2R0G A;  2GMH A;  1EL7 A;  4Z44 A;  4Z24 A;  3SZF A;  1H7X A;  1IUW A;  3UKH A;  3B3R A;  3VRD B;  4B65 A;  5IPY A;  4K8D A;  3P4S A;  4ECH A;  5BVA A;  4A7A A;  5KMS A;  2X3N A;  3AD9 B;  1LJ1 A;  2EQ6 A;  5C3J A;  1JRX A;  4JDR A;  1KDG A;  4OPI A;  4U8M A;  2QA2 A;  2X8C A;  3KKJ A;  1OJC A;  1BZL A;  2WP9 A;  5CKU A;  3UOV A;  2WHD A;  2V61 A;  3HYW A;  1K0J A;  3AYJ A;  2CDU A;  2JB2 A;  3P1W A;  2YM2 A;  3UKL A;  3UTG A;  2C65 A;  3AEB A;  3CIR A;  3CNT A;  1FEB A;  4NEW A;  4OPT A;  4H2Q A;  4K7Z A;  3CPH G;  2WBA A;  4IA6 A;  2JAE A;  3BI2 A;  4U8J A;  3NYE A;  2EQ7 A;  4TM4 A;  1ZY8 A;  4A65 A;  1IJH A;  4U8I A;  3NIX A;  3AE8 A;  2IID A;  1CJ3 A;  4OPL A;  2OLN A;  3D8X A;  4BUR A;  1GEU A;  1YQZ A;  2GR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...