3KVEA

Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNSKEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRTNCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEKDTSSNTADYVIVCTTSRAARRIQFEPPLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNFSTGVGVIIAYGIGDDANFFQALKFKDCADIVFNDLSLIHQLPKEEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structure of native L-amino acid oxidase from Vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
rcsb
molecule tags Oxidoreductase
total genus 178
structure length 484
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3kveA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kveA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kveA01
2BS2A 3BI4A 1IUUA 3FIMB 4H4TA 2B9XA 1XHCA 4TLXA 1JRXA 2ZZCA 2F5ZA 3K30A 2OALA 4C5OA 3NYCA 1LV0A 3CNPA 1H82A 3DGZA 3BNMA 3S5WA 5CQFA 2C70A 1PXBA 2XVIA 3LJPA 1TDFA 1E6EA 4X9NA 3P4QA 1VDCA 4Z2UA 2JAEA 2Q6UA 2JB2A 4TM0A 2EQ8A 3CNDA 2QA1A 2YG7A 1GERA 1TYTA 1K0LA 4DSHA 3H8LA 3QFAA 2C67A 1EL7A 5L46A 5FS8A 3GRTA 1NG4A 3UTGA 4PABA 4BJYA 2VVLG 4UDRA 3Q9TA 3CGDA 4H2RA 2WOVA 3DMEA 5CKUA 4YKFA 4LIIA 2C65A 1D4DA 2C75A 2V60A 1BF3A 2WS3A 3ITJA 3QSMA 1YKJA 3RP8A 2WBAA 1GETA 1GRAA 3AD8B 2VZ2A 3SQPA 5BULA 5EB4A 5JCLA 1GPEA 1JRZA 5BUKA 1H86A 1PJ6A 1PXAA 1GNDA 1K0JA 3K7QX 4IV9A 5M0ZA 1N4VA 4Z26A 5JCMA 4CBQA 1Y56A 1GRBA 5M10A 1GTEA 3UKPA 1H7XA 5DBJA 4GDEA 2BCPA 1L9EA 2C64A 1X31B 3CIRA 1IUWA 3ICSA 3P4RA 4A65A 1ZY8A 3IF9A 3KD9A 4FK1A 1OJAA 3IC9A 1NPXA 1GT8A 5U1OA 3ALMA 4H2PA 3CNTA 2VRMA 2BC1A 1H6VA 4H4UA 5HHFA 1ZMDA 5HXIA 3AE5A 1BGJA 3QFBA 4J2WA 2YWLA 4YWOA 1YY5A 3SFDA 4BK2A 2XVJA 1JEHA 4EQXA 4FX9A 4H4PA 3D8XA 3UTEA 3C4NA 3VQRA 1ZOVA 4OPCA 3KA7A 3CPHG 1FEBA 2Y6QA 2YLWA 3AE3A 2WOIA 1BZLA 4H50A 1EL5A 1TDOA 2B9YA 1LTXR 2WEUA 5U63A 3RHAA 1GOSA 4U2LA 2IIDA 4CCQA 5ER0A 3G5SA 3NN0X 3NRNA 2GF3A 2GV8A 2WDQA 4A9WA 1CJ3A 1E1LA 2NVKX 4YXDA 4WX1A 3RP7A 1VG9A 3GD3A 3V76A 1CF3A 3M12A 2BXRA 2RGOA 1KDGA 4JDRA 3NN6X 2W0HA 4GUVA 3SFEA 3NK1X 3NH3X 1O5WA 2JB1A 4GCMA 1ZX9A 3ATQA 1NHRA 2BC0A 4J56A 2XLPA 4U8KA 1S3EA 4H4YA 2X99A 1SEZA 2X8CA 4A79A 2C3DA 5EB5A 3GWDA 3JSKA 1CC2A 1TYPA 2GR0A 1F6MA 2YG4A 3CNSA 4ZN0A 1ZMCA 1LPFA 3EF6A 2E1MA 1L9DA 1S3BA 3OC4A 3RNMA 2H89A 3ZDNA 4CY6A 2WPEA 1S2YA 3DGHA 1KNPA 2RGJA 4OPTA 2CVJA 3EAOA 4B1BA 3AE4A 3ZYXA 1NDAA 1IUVA 2JKCA 4C74A 1Y0PA 5C3JA 3NKSA 4H2QA 3UOZA 4U8LA 2YG6A 2E4GA 1E1NA 1F8SA 4USRA 2BS4A 3AE8A 4USQA 1M6IA 2YLTA 1PDHA 5EOWA 2FJDA 4FDCB 3LB8A 1DOBA 3NK0X 2WPFA 3SGLA 4YTNA 2OLOA 3F8DA 2EQ9A 2BK4A 2C72A 2YR4A 3H8IA 3NIXA 1MXTA 2GR1A 5JCKA 3P4PA 4U2SA 1DOCA 3GMBA 3T37A 5JCNA 4YSHA 4DGKA 2QA2A 1FOHA 1K4QA 3VRDB 1D4EA 1V59A 3IHGA 4KX6A 4AP3A 2R0CA 1PN0A 4OVIA 4A5LA 2R45A 3AWIA 1TDKA 3PS9A 2EQ7A 4H4RA 4K7ZA 3FMWA 4C77A 4XXGA 2A8XA 3NLCA 4B67A 3REDA 3UKQA 5IQ4A 3ALLA 1D4CA 1CL0A 3UCLA 3AE6A 3UP4A 1MO9A 3DJEA 3CNJA 2J3NA 2ZZBA 4B69A 2ACZA 1NHSA 4AOSA 3QSSA 4U8OA 1TDEA 2WU2A 2VOUA 3BHKA 2Q7VA 5J7XA 1Y56B 2C3CA 1O95A 3ATRA 2R9ZA 3I3LA 4J36A 2GB0A 3URHA 5C2TA 2O9ZA 2RABA 3KLJA 4K5RA 3GWFA 2C66A 3NHOX 1H7WA 1N4UA 2R4EA 2FJBA 1F3PA 3LADA 3DK4A 4EMIA 3SM8A 1E7PA 2V3BA 5TR3A 3AYJA 2GAGB 4Z44A 4U8NA 2Y6RA 4OPDA 3G5RA 4EM4A 4Y4NA 1KF6A 1E39A 3AEAA 4OPLA 2XFPA 4GRTA 4Y4LA 2GR3A 1N1PA 4OPUA 2BK5A 3VRBA 1TDNA 4EMJA 1KFYA 2X50A 4TM1A 3NT6A 5KXJA 1CJ2A 4ADWA 2B7RA 2PYXA 4I59A 3KPFA 3UP5A 4MJWA 4OCGA 3BNUA 3KKJA 4CY8A 4EQWA 4YTPA 3GDNA 4J33A 1EBDA 4A6NA 1ELIA 3VR9A 4YT0A 2GR2A 4DNAA 4OPGA 2XFQA 5KWFA 2TPRA 2YAUA 1IUSA 4ECHA 2XFNA 2YVFA 1RP0A 4YSYA 3EPTA 4AOXA 3RP6A 1NHQA 1GSNA 1YQZA 2XVHA 3ALJA 4K8DA 1ONFA 4WCTA 5FMHA 1KSSA 1Q1RA 1W4XA 2FJAA 3Q6JA 4BK3A 4UDPA 3DK8A 1B8SA 2OA1A 2BS3A 3C4AA 2X8GA 3ICTA 4LA1A 5GSNA 4B66A 4X4JA 2VVLA 4AP1A 1H81A 1FL2A 3DK9A 2Q0KA 2V61A 4YSXA 4NTCA 2YLRA 4H4VA 1NHPA 4B68A 4JY3A 1OJDA 4AT2A 2YLSA 4EIPA 1JNRA 1HYUA 3NG7X 3COXA 3GMCA 4J57A 2C73A 5FS6A 2XYOA 4ZCCA 4ZCDA 1ZK7A 1P2EA 1QO8A 3DJJA 3AYLA 4ICYA 4Z25A 2DKHA 4DSGA 4D04A 3NNEA 4NEWA 4J34A 3KVEA 2BABA 3NK2X 1IUTA 1EL9A 2WHDA 2GMJA 4U8PA 5U25A 4C3YA 4Z2TA 2GMHA 3FG2P 1DNCA 3UTHA 3HZLA 4NTDA 2WPCA 1NAAA 2QAEA 3FBSA 4IVMB 1GALA 2CFYA 3CGEA 3UOYA 5KOXA 3V3NA 1GRHA 5LV9A 1NG3A 4BJZA 4C3XA 3AE2A 4EM3A 4BV6A 5HY5A 3PO7A 2YLXA 3AD7B 2YG5A 4GF7A 2A87A 3H4KA 3AE1A 3UKFA 2FBWA 1B5QA 1H83A 3V3OA 3NGCX 1BKWA 2V6OA 4H4WA 2BXSA 1GTHA 2E5VA 4H7UA 4APNA 3F8RA 5BRTA 4BK1A 2AAQA 3F8PA 1PJ7A 2GQWA 3GSIA 4GDPA 5EBKA 3DJGX 2R0PA 2CDUA 2WU5A 2XFUA 1Q1WA 2WOWA 4KPRA 3D1CA 3CPIG 3CN8A 3QVRA 2V5ZA 4O5UA 4BURA 1JRYA 2XLRA 4Y4MA 1N4WA 2Z5XA 4YSZA 4NTEA 3M0OA 2XLSA 4H2NA 3IWAA 1M64A 3BHFA 4UP3A 3B6DA 2R4JA 1CJCA 3LOVA 3NTDA 4CRTA 3DJDA 2GAHB 3M13A 2JBVA 2X3NA 5GRTA 4YTMA 3KU9A 5BVAA 1JNZA 4CNJA 3IHMA 4JN9A 4IA5A 4IA6A 4EQSA 1OJ9A 1IUXA 3C96A 1XDIA 1PBCA 2H88A 4Z2RA 3CPJG 2YLZA 3VR8A 1D7YA 1GREA 5J60A 4H4SA 2CULA 1BGNA 3UOVA 4U8IA 4XWZA 4A6NB 1BWCA 3AB1A 2QCUA 2VQ7A 4D03A 1FCDA 2ARDA 5KRQA 1VRQB 2YM1A 2YR6A 1GESA 1DJQA 4B65A 2Q0LA 4H4XA 1NENA 4I58A 1L0VA 1LQTA 1MOKA 2PHHA 3AECA 3AD9B 4U8MA 2IVEA 2C76A 3NYFA 2GVCA 2GRTA 2VQBA 5FS7A 2Z5YA 3UKKA 4NZHA 1E1KA 5KVHA 1JOAA 2YR5A 3UOXA 4Z24A 2JK6A 3E1TA 1LJ1A 2WQYA 3K7MX 1FECA 1CJ4A 1QLBA 2AQJA 5FS9A 1O94A 2X8HA 1D7LA 4TM4A 5IQ1A 1PXCA 3P9UA 2XFOA 3GRSA 3AEDA 2R46A 4XWRA 3G5QA 1P2HA 3UKLA 2XVEA 1YQ3A 4E0VA 1FEAA 2YVJA 3EANA 1DOEA 1RSGA 2R0GA 2NPXA 1OJTA 2ZZ0A 3CGBA 2B7SA 3QJ4A 1PS9A 3AEFA 2AR8A 4JNQA 2GQFA 2VRLA 3VRAA 1PBFA 4M52A 2WDVA 2IVDA 5KOWA 4K22A 4HB9A 4A7AA 1ZP0A 4EQRA 1PBBA 1L9CA 1ZOYA 1GV4A 3AXBA 4REKA 1CBOA 2FJEA 2XLUA 3R9UA 4NEVA 1QJDA 2APGA 1LVLA 2C7GA 4Z43A 1DODA 3ABVA 1EL8A 1DXLA 4AT0A 4GR1A 4U2TA 4RG4A 3GDPA 4CCRA 2WDRA 4K5SA 4A99A 1OJCA 1K0IA 3BI5A 1B4VA 1F8WA 2YG3A 3LZWA 4UDQA 4RG3A 3ICRA 2A89A 1CC6A 2TMDA 2WESA 3II4A 3NYEA 3AE7A 4EMWA 4JY2A 2B76A 1CC4A 3AYIA 2I0ZA 4H4ZA 2DKIA 4RSLA 1GRTA 1PBEA 4P9SA 3UTFA 3B3RA 3CTYA 4OPIA 3S61A 1KNRA 2UZZA 2ZBWA 4EIQA 2VVMA 3L8KA 5HYMA 2XVFA 3OZ2A 3WE0A 1NEKA 3QSEA 4K2XA 2XDOA 3CGCA 3ISHA 2V3AA 4HA6A 1XANA 4U8JA 1GEUA 4IVOB 2XLTA 1IJHA 4FK1C 5KVIA 2WP6A 3O0HA 4H4QA 1E1MA 1KSUA 2WP5A 4O5QA 2RGHA 3UKAA 1LQUA 3LZXA 3GYJA 4CNKA 2GEWA 3UKHA 1ZKQA 3ADAB 1CHUA 1XPQA 5IPYA 1F8RA 4X9MA 2YM2A 3FPZA 1UKVG 2YVGA 3AEEA 3I6DA 2YQUA 1Z6LA 5JCIA 1ZDLA 2BYBA 1H84A 3P1WA 2WETA 3QVPA 2B9WA 1REOA 1RYIA 3K7TA 3L1RA 4TM3A 2XCGA 3GYIA 3NTAA 2JB3A 4TLZA 1D5TA 3AEBA 4PAAA 1PBDA 2BCGG 2BACA 4B64A 1Q9IA 2OAMA 1TRBA 3DA1A 1PJ5A 1PHHA 1COYA 1VQWA 4J31A 1GRFA 1GXFA 3P4SA 2GH5A 3AE9A 2EQ6A 1DJNA 1YQ4A 4B63A 4YKGA 1S2QA 2OLNA 3BI2A 2WP9A 3GD4A 1AOGA 3AEGA 3LXDA 3DH9A 4LU6A 1GRGA 3PVCA 1VG0A 4JQ9A 4JNAA 4N9XA 1JU2A 2BA9A 1B37A 2BK3A 2HQMA
chains in the Genus database with same CATH superfamily
2BS2A 3BI4A 1IUUA 3FIMB 4H4TA 2B9XA 1XHCA 4TLXA 1JRXA 2ZZCA 2F5ZA 3K30A 2OALA 4C5OA 3NYCA 1LV0A 3CNPA 1H82A 2BRYA 3BNMA 3DGZA 5CQFA 3S5WA 2C70A 1PXBA 2XVIA 3LJPA 1TDFA 1E6EA 4X9NA 3P4QA 1VDCA 4Z2UA 2JAEA 2Q6UA 2JB2A 4TM0A 2EQ8A 3CNDA 2QA1A 2YG7A 1GERA 1TYTA 1K0LA 4DSHA 3H8LA 3QFAA 2C67A 1EL7A 5L46A 5FS8A 3GRTA 1NG4A 3UTGA 4PABA 4BJYA 2VVLG 4UDRA 3Q9TA 3CGDA 4H2RA 2WOVA 3DMEA 5CKUA 4YKFA 4LIIA 2C65A 1D4DA 2C75A 2V60A 1BF3A 2WS3A 3ITJA 3QSMA 1YKJA 3RP8A 2WBAA 1GETA 1GRAA 3AD8B 2VZ2A 3SQPA 5BULA 5EB4A 5JCLA 1GPEA 1JRZA 5BUKA 1H86A 4IV9A 1PXAA 1GNDA 1K0JA 1PJ6A 3K7QX 5KMRA 5M0ZA 1N4VA 4Z26A 5JCMA 4CBQA 1Y56A 1GRBA 5M10A 1GTEA 3UKPA 1H7XA 5DBJA 4GDEA 2BCPA 1L9EA 4G73A 2C64A 1X31B 3CIRA 1IUWA 3ICSA 3P4RA 4A65A 1ZY8A 3IF9A 3KD9A 4FK1A 1OJAA 3IC9A 1NPXA 1GT8A 5U1OA 3ALMA 4H2PA 3CNTA 2VRMA 2BC1A 1H6VA 4H4UA 5HHFA 1ZMDA 5HXIA 3AE5A 1BGJA 3QFBA 4J2WA 3T14A 2YWLA 4YWOA 1YY5A 3SFDA 4BK2A 2XVJA 1JEHA 4EQXA 4FX9A 4H4PA 3D8XA 3UTEA 3C4NA 3VQRA 1ZOVA 4OPCA 3KA7A 3CPHG 1FEBA 2Y6QA 2YLWA 3AE3A 2WOIA 1BZLA 4H50A 1EL5A 1TDOA 2B9YA 1LTXR 2WEUA 5U63A 3RHAA 1GOSA 4U2LA 2IIDA 4CCQA 5ER0A 3G5SA 3NN0X 3NRNA 2GF3A 2GV8A 2WDQA 4A9WA 1CJ3A 1E1LA 2NVKX 4YXDA 4WX1A 3RP7A 1VG9A 3GD3A 3V76A 1CF3A 3M12A 2BXRA 2RGOA 1KDGA 4JDRA 3NN6X 2W0HA 4GUVA 3SFEA 3NK1X 3NH3X 1O5WA 2JB1A 4GCMA 4G74A 1ZX9A 3ATQA 1NHRA 2BC0A 4J56A 2XLPA 4U8KA 1S3EA 4H4YA 2X99A 1SEZA 2X8CA 4A79A 2C3DA 5EB5A 3GWDA 3JSKA 1CC2A 1TYPA 4G6GA 2GR0A 1F6MA 2YG4A 3CNSA 4ZN0A 1ZMCA 1LPFA 3EF6A 2E1MA 1L9DA 4GAPA 1S3BA 3OC4A 3SZWA 3RNMA 2H89A 3T0KA 3ZDNA 4CY6A 2WPEA 1S2YA 3DGHA 1KNPA 2RGJA 4OPTA 2CVJA 3EAOA 4B1BA 3AE4A 3ZYXA 1NDAA 1IUVA 2JKCA 4C74A 1Y0PA 5C3JA 3NKSA 4H2QA 3UOZA 4U8LA 2YG6A 2E4GA 1E1NA 1F8SA 4USRA 2BS4A 3AE8A 4USQA 1M6IA 2YLTA 1PDHA 5EOWA 2FJDA 4FDCB 3LB8A 1DOBA 3NK0X 2WPFA 3SGLA 4YTNA 2OLOA 3F8DA 2EQ9A 2BK4A 2C72A 2YR4A 3H8IA 3NIXA 1MXTA 2GR1A 5JCKA 3P4PA 4U2SA 1DOCA 3GMBA 3T37A 5JCNA 4YSHA 4DGKA 2QA2A 1FOHA 1K4QA 3VRDB 1D4EA 1V59A 3IHGA 4KX6A 4AP3A 2R0CA 1PN0A 4OVIA 4A5LA 2R45A 3AWIA 1TDKA 3PS9A 2EQ7A 4H4RA 4K7ZA 3FMWA 4C77A 4XXGA 2A8XA 3NLCA 4B67A 3REDA 3UKQA 5IQ4A 3ALLA 1D4CA 1CL0A 4G6HA 3T2KA 3UCLA 3AE6A 3UP4A 1MO9A 3DJEA 3CNJA 2J3NA 2ZZBA 5KMQA 2ACZA 1NHSA 4B69A 4AOSA 3T2ZA 3QSSA 4U8OA 1TDEA 2WU2A 2VOUA 3BHKA 2Q7VA 5KMSA 5J7XA 1Y56B 2C3CA 1O95A 3ATRA 2R9ZA 3I3LA 4II2A 4J36A 2GB0A 3URHA 5C2TA 2O9ZA 2RABA 4II3A 3KLJA 4K5RA 3GWFA 2C66A 3NHOX 3SX6A 1H7WA 1N4UA 2R4EA 2FJBA 1F3PA 3LADA 3DK4A 4EMIA 3SM8A 1E7PA 3GYXA 2V3BA 5TR3A 3AYJA 2GAGB 4Z44A 4U8NA 3CMMA 2Y6RA 4OPDA 3G5RA 4EM4A 4Y4NA 1KF6A 1E39A 3AEAA 4OPLA 2XFPA 4GRTA 4Y4LA 2GR3A 1N1PA 4OPUA 2BK5A 3VRBA 1TDNA 4EMJA 1KFYA 2X50A 4TM1A 3NT6A 5KXJA 1CJ2A 4ADWA 2B7RA 2PYXA 4I59A 3KPFA 3UP5A 4MJWA 4OCGA 3BNUA 3KKJA 4CY8A 4EQWA 4YTPA 3GDNA 4J33A 1EBDA 4A6NA 1ELIA 3VR9A 4YT0A 2GR2A 4DNAA 4OPGA 2XFQA 5KWFA 2TPRA 2YAUA 1IUSA 4ECHA 2XFNA 2YVFA 1RP0A 3T2YA 4YSYA 3EPTA 4AOXA 3RP6A 1NHQA 1GSNA 1YQZA 2XVHA 3ALJA 4K8DA 1ONFA 4WCTA 5FMHA 1KSSA 1Q1RA 1W4XA 2FJAA 3Q6JA 4BK3A 4UDPA 3DK8A 1B8SA 2OA1A 2BS3A 3C4AA 2X8GA 3ICTA 4LA1A 5GSNA 4B66A 4X4JA 2VVLA 4AP1A 1H81A 1FL2A 3DK9A 3SZ0A 2Q0KA 2V61A 4YSXA 4NTCA 2YLRA 4H4VA 1NHPA 4B68A 4JY3A 1OJDA 4AT2A 2YLSA 4EIPA 1JNRA 1HYUA 3NG7X 3COXA 3GMCA 4J57A 2C73A 5FS6A 2XYOA 4ZCCA 4ZCDA 1ZK7A 1P2EA 1QO8A 3DJJA 3AYLA 4ICYA 4NWZA 4Z25A 2DKHA 4DSGA 4D04A 3NNEA 4NEWA 4J34A 3KVEA 2BABA 3NK2X 1IUTA 1EL9A 2WHDA 2GMJA 4U8PA 5U25A 4C3YA 4Z2TA 2GMHA 3FG2P 1DNCA 3UTHA 3HZLA 4NTDA 2WPCA 1NAAA 2QAEA 3FBSA 4IVMB 4G9KA 1GALA 2CFYA 3CGEA 3UOYA 5KOXA 3V3NA 1GRHA 5LV9A 1NG3A 4BJZA 4C3XA 3AE2A 4EM3A 4BV6A 5HY5A 3PO7A 2YLXA 3AD7B 2YG5A 3SZFA 4GF7A 2A87A 3H4KA 3AE1A 3UKFA 2FBWA 1B5QA 1H83A 3V3OA 3NGCX 1BKWA 2V6OA 4H4WA 2BXSA 1GTHA 2E5VA 4H7UA 4APNA 3F8RA 5BRTA 5KNLA 4BK1A 2AAQA 3F8PA 1PJ7A 2GQWA 5KMPA 3GSIA 4GDPA 5EBKA 3DJGX 2R0PA 2CDUA 2WU5A 2XFUA 1Q1WA 2WOWA 4KPRA 3D1CA 3CPIG 3CN8A 3QVRA 2V5ZA 4O5UA 4BURA 1JRYA 2XLRA 4Y4MA 1N4WA 2Z5XA 4YSZA 4NTEA 3M0OA 2XLSA 3HYWA 4H2NA 3IWAA 1M64A 3BHFA 4UP3A 3KPKA 3B6DA 2R4JA 1CJCA 3LOVA 3NTDA 4CRTA 3DJDA 2GAHB 3M13A 2JBVA 2X3NA 5GRTA 4YTMA 3KU9A 5BVAA 1JNZA 4CNJA 3IHMA 4JN9A 4IA5A 4IA6A 3HYXA 4EQSA 1OJ9A 1IUXA 3C96A 1XDIA 1PBCA 2H88A 4Z2RA 3CPJG 2YLZA 3VR8A 1D7YA 1GREA 5J60A 4H4SA 2CULA 1BGNA 3UOVA 4U8IA 4XWZA 4A6NB 1BWCA 3AB1A 2QCUA 2VQ7A 4D03A 1FCDA 2ARDA 5KRQA 2C4CA 1VRQB 2YM1A 2YR6A 1GESA 1DJQA 4B65A 2Q0LA 4H4XA 1NENA 4I58A 1L0VA 1LQTA 1MOKA 2PHHA 3AECA 3AD9B 4U8MA 2IVEA 2C76A 3NYFA 2GVCA 2GRTA 2VQBA 5FS7A 2Z5YA 3UKKA 4NZHA 1E1KA 5KVHA 1JOAA 2YR5A 3UOXA 4Z24A 2JK6A 3E1TA 1LJ1A 2WQYA 3K7MX 1FECA 1CJ4A 1QLBA 2AQJA 5FS9A 1O94A 2X8HA 1D7LA 4TM4A 3T31A 5IQ1A 1PXCA 3P9UA 2XFOA 3GRSA 3AEDA 2R46A 4XWRA 3G5QA 1P2HA 3UKLA 2XVEA 1YQ3A 4E0VA 1FEAA 2YVJA 3EANA 1DOEA 3SY4A 1RSGA 2R0GA 2NPXA 1OJTA 2ZZ0A 3CGBA 2B7SA 3QJ4A 1PS9A 2BRAA 2AR8A 3AEFA 4JNQA 2GQFA 2VRLA 3VRAA 1PBFA 4M52A 2WDVA 2IVDA 5KOWA 4K22A 4HB9A 4A7AA 1ZP0A 4EQRA 1PBBA 1L9CA 1ZOYA 1GV4A 3AXBA 4REKA 1CBOA 2FJEA 2XLUA 3R9UA 4NEVA 1QJDA 2APGA 1LVLA 2C7GA 4Z43A 1DODA 3ABVA 1EL8A 1DXLA 4AT0A 4GR1A 3SZCA 4U2TA 4RG4A 3GDPA 4CCRA 2WDRA 4K5SA 4A99A 1OJCA 1K0IA 3BI5A 1B4VA 1F8WA 2YG3A 3LZWA 4UDQA 4RG3A 3ICRA 2A89A 1CC6A 2TMDA 2WESA 3II4A 3NYEA 3AE7A 4EMWA 4JY2A 2B76A 1CC4A 3AYIA 2I0ZA 4H4ZA 2DKIA 4RSLA 3SXIA 1GRTA 1PBEA 4P9SA 3UTFA 3B3RA 3CTYA 4OPIA 3S61A 1KNRA 2UZZA 2ZBWA 4EIQA 2VVMA 3L8KA 5HYMA 2XVFA 4NNJA 3OZ2A 3WE0A 4GAVA 1NEKA 3QSEA 4K2XA 2XDOA 3CGCA 3ISHA 2V3AA 4HA6A 1XANA 4U8JA 1GEUA 4IVOB 2XLTA 1IJHA 4FK1C 5KVIA 2WP6A 3O0HA 4H4QA 1E1MA 1KSUA 2WP5A 4O5QA 2RGHA 3UKAA 1LQUA 3LZXA 3GYJA 4CNKA 2GEWA 3UKHA 1ZKQA 3ADAB 1CHUA 1XPQA 5IPYA 1F8RA 4X9MA 2YM2A 3FPZA 1UKVG 2YVGA 3AEEA 3I6DA 2YQUA 1Z6LA 5JCIA 1ZDLA 3SYIA 2BYBA 1H84A 3P1WA 2WETA 3QVPA 2B9WA 1REOA 1RYIA 3K7TA 3L1RA 4TM3A 2XCGA 3GYIA 3NTAA 2JB3A 4TLZA 1D5TA 3AEBA 4PAAA 1PBDA 2BCGG 2BACA 4B64A 1Q9IA 2OAMA 1TRBA 3DA1A 1PJ5A 1PHHA 1COYA 1VQWA 4J31A 1GRFA 1GXFA 3P4SA 2GH5A 3AE9A 2EQ6A 1DJNA 1YQ4A 4B63A 4YKGA 1S2QA 2OLNA 3BI2A 2WP9A 3HYVA 3GD4A 1AOGA 3AEGA 3LXDA 3DH9A 4LU6A 1GRGA 3PVCA 1VG0A 4JQ9A 4JNAA 4N9XA 1JU2A 2BA9A 1B37A 2BK3A 2HQMA
chains in the Genus database with same CATH topology
2BS2A 3BI4A 1IUUA 3FIMB 4H4TA 2B9XA 1XHCA 4TLXA 1JRXA 2ZZCA 2F5ZA 3K30A 2OALA 4C5OA 3NYCA 1LV0A 3CNPA 1H82A 2BRYA 3BNMA 3DGZA 5CQFA 3S5WA 2C70A 1PXBA 2XVIA 3LJPA 1TDFA 1E6EA 4X9NA 3P4QA 1VDCA 4Z2UA 2JAEA 2Q6UA 2JB2A 4TM0A 2EQ8A 3CNDA 2QA1A 2YG7A 1GERA 1TYTA 1K0LA 4DSHA 3H8LA 3QFAA 2C67A 1EL7A 5L46A 5FS8A 3GRTA 1NG4A 3UTGA 4PABA 4BJYA 2VVLG 4UDRA 3Q9TA 3CGDA 4H2RA 2WOVA 3DMEA 5CKUA 4YKFA 4LIIA 2C65A 1D4DA 2C75A 2V60A 1BF3A 2WS3A 3ITJA 3QSMA 1YKJA 3RP8A 2WBAA 1GETA 1GRAA 3AD8B 2VZ2A 3SQPA 5BULA 5EB4A 5JCLA 1GPEA 1JRZA 5BUKA 1H86A 1PJ6A 1PXAA 1GNDA 1K0JA 3K7QX 4IV9A 5KMRA 5M0ZA 1N4VA 4Z26A 5JCMA 4CBQA 1Y56A 1GRBA 5M10A 1GTEA 3UKPA 1H7XA 5DBJA 4GDEA 2BCPA 1L9EA 4G73A 2C64A 1X31B 3CIRA 1IUWA 3ICSA 3P4RA 4A65A 1ZY8A 3IF9A 3KD9A 4FK1A 1OJAA 3IC9A 1NPXA 1GT8A 5U1OA 3ALMA 4H2PA 3CNTA 2VRMA 2BC1A 1H6VA 4H4UA 5HHFA 1ZMDA 5HXIA 3AE5A 1BGJA 3QFBA 4J2WA 3T14A 2YWLA 4YWOA 1YY5A 3SFDA 4BK2A 2XVJA 1JEHA 4EQXA 4FX9A 4H4PA 3D8XA 3UTEA 3C4NA 3VQRA 1ZOVA 4OPCA 3KA7A 3CPHG 1FEBA 2Y6QA 2YLWA 3AE3A 2WOIA 1BZLA 4H50A 1EL5A 1TDOA 2B9YA 1LTXR 2WEUA 5U63A 3RHAA 1GOSA 4U2LA 2IIDA 4CCQA 5ER0A 3G5SA 3NN0X 3NRNA 2GF3A 2GV8A 2WDQA 4A9WA 1CJ3A 1E1LA 2NVKX 4YXDA 4WX1A 3RP7A 1VG9A 3GD3A 3V76A 1CF3A 3M12A 2BXRA 2RGOA 1KDGA 4JDRA 3NN6X 2W0HA 4GUVA 3SFEA 3NK1X 3NH3X 1O5WA 2JB1A 4GCMA 4G74A 1ZX9A 3ATQA 1NHRA 2BC0A 4J56A 2XLPA 4U8KA 1S3EA 4H4YA 2X99A 1SEZA 2X8CA 4A79A 2C3DA 5EB5A 3GWDA 3JSKA 1CC2A 1TYPA 4G6GA 2GR0A 1F6MA 2YG4A 3CNSA 4ZN0A 1ZMCA 1LPFA 3EF6A 2E1MA 1L9DA 4GAPA 1S3BA 3OC4A 3SZWA 3RNMA 2H89A 3T0KA 3ZDNA 4CY6A 2WPEA 1S2YA 3DGHA 1KNPA 2RGJA 4OPTA 2CVJA 3EAOA 4B1BA 3AE4A 3ZYXA 1NDAA 1IUVA 2JKCA 4C74A 1Y0PA 5C3JA 3NKSA 4H2QA 3UOZA 4U8LA 2YG6A 2E4GA 1E1NA 1F8SA 4USRA 2BS4A 3AE8A 4USQA 1M6IA 2YLTA 1PDHA 5EOWA 2FJDA 4FDCB 3LB8A 1DOBA 3NK0X 2WPFA 3SGLA 4YTNA 2OLOA 3F8DA 2EQ9A 2BK4A 2C72A 2YR4A 3H8IA 3NIXA 1MXTA 2GR1A 5JCKA 3P4PA 4U2SA 1DOCA 3GMBA 3T37A 5JCNA 4YSHA 4DGKA 2QA2A 1FOHA 1K4QA 3VRDB 1D4EA 1V59A 3IHGA 4KX6A 4AP3A 2R0CA 1PN0A 4OVIA 4A5LA 2R45A 3AWIA 1TDKA 3PS9A 2EQ7A 4H4RA 4K7ZA 3FMWA 4C77A 4XXGA 2A8XA 3NLCA 4B67A 3REDA 3UKQA 5IQ4A 3ALLA 1D4CA 1CL0A 4G6HA 3T2KA 3UCLA 3AE6A 3UP4A 1MO9A 3DJEA 3CNJA 2J3NA 2ZZBA 5KMQA 2ACZA 1NHSA 4B69A 4AOSA 3T2ZA 3QSSA 4U8OA 1TDEA 2WU2A 2VOUA 3BHKA 2Q7VA 5KMSA 5J7XA 1Y56B 2C3CA 1O95A 3ATRA 2R9ZA 3I3LA 4II2A 4J36A 2GB0A 3URHA 5C2TA 2O9ZA 2RABA 4II3A 3KLJA 4K5RA 3GWFA 2C66A 3NHOX 3SX6A 1H7WA 1N4UA 2R4EA 2FJBA 1F3PA 3LADA 3DK4A 4EMIA 3SM8A 1E7PA 3GYXA 2V3BA 5TR3A 3AYJA 2GAGB 4Z44A 4U8NA 3CMMA 2Y6RA 4OPDA 3G5RA 4EM4A 4Y4NA 1KF6A 1E39A 3AEAA 4OPLA 2XFPA 4GRTA 4Y4LA 2GR3A 1N1PA 4OPUA 2BK5A 3VRBA 1TDNA 4EMJA 1KFYA 2X50A 4TM1A 3NT6A 5KXJA 1CJ2A 4ADWA 2B7RA 2PYXA 4I59A 3KPFA 3UP5A 4MJWA 4OCGA 3BNUA 3KKJA 4CY8A 4EQWA 4YTPA 3GDNA 4J33A 1EBDA 4A6NA 1ELIA 3VR9A 4YT0A 2GR2A 4DNAA 4OPGA 2XFQA 5KWFA 2TPRA 2YAUA 1IUSA 4ECHA 2XFNA 2YVFA 1RP0A 3T2YA 4YSYA 3EPTA 4AOXA 3RP6A 1NHQA 1GSNA 1YQZA 2XVHA 3ALJA 4K8DA 1ONFA 4WCTA 5FMHA 1KSSA 1Q1RA 1W4XA 2FJAA 3Q6JA 4BK3A 4UDPA 3DK8A 1B8SA 2OA1A 2BS3A 3C4AA 2X8GA 3ICTA 4LA1A 5GSNA 4B66A 4X4JA 2VVLA 4AP1A 1H81A 1FL2A 3DK9A 3SZ0A 2Q0KA 2V61A 4YSXA 4NTCA 2YLRA 4H4VA 1NHPA 4B68A 4JY3A 1OJDA 4AT2A 2YLSA 4EIPA 1JNRA 1HYUA 3NG7X 3COXA 3GMCA 4J57A 2C73A 5FS6A 2XYOA 4ZCCA 4ZCDA 1ZK7A 1P2EA 1QO8A 3DJJA 3AYLA 4ICYA 4NWZA 4Z25A 2DKHA 4DSGA 4D04A 3NNEA 4NEWA 4J34A 3KVEA 2BABA 3NK2X 1IUTA 1EL9A 2WHDA 2GMJA 4U8PA 5U25A 4C3YA 4Z2TA 2GMHA 3FG2P 1DNCA 3UTHA 3HZLA 4NTDA 2WPCA 1NAAA 2QAEA 3FBSA 4IVMB 4G9KA 1GALA 2CFYA 3CGEA 3UOYA 5KOXA 3V3NA 1GRHA 5LV9A 1NG3A 4BJZA 4C3XA 3AE2A 4EM3A 4BV6A 5HY5A 3PO7A 2YLXA 3AD7B 2YG5A 3SZFA 4GF7A 2A87A 3H4KA 3AE1A 3UKFA 2FBWA 1B5QA 1H83A 3V3OA 3NGCX 1BKWA 2V6OA 4H4WA 2BXSA 1GTHA 2E5VA 4H7UA 4APNA 3F8RA 5BRTA 5KNLA 4BK1A 2AAQA 3F8PA 1PJ7A 2GQWA 5KMPA 3GSIA 4GDPA 5EBKA 3DJGX 2R0PA 2CDUA 2WU5A 2XFUA 1Q1WA 2WOWA 4KPRA 3D1CA 3CPIG 3CN8A 3QVRA 2V5ZA 4O5UA 4BURA 1JRYA 2XLRA 4Y4MA 1N4WA 2Z5XA 4YSZA 4NTEA 3M0OA 2XLSA 3HYWA 4H2NA 3IWAA 1M64A 3BHFA 4UP3A 3KPKA 3B6DA 2R4JA 1CJCA 3LOVA 3NTDA 4CRTA 3DJDA 2GAHB 3M13A 2JBVA 2X3NA 5GRTA 4YTMA 3KU9A 5BVAA 1JNZA 4CNJA 3IHMA 4JN9A 4IA5A 4IA6A 3HYXA 4EQSA 1OJ9A 1IUXA 3C96A 1XDIA 1PBCA 2H88A 4Z2RA 3CPJG 2YLZA 3VR8A 1D7YA 1GREA 5J60A 4H4SA 2CULA 1BGNA 3UOVA 4U8IA 4XWZA 4A6NB 1BWCA 3AB1A 2QCUA 2VQ7A 4D03A 1FCDA 2ARDA 5KRQA 2C4CA 1VRQB 2YM1A 2YR6A 1GESA 1DJQA 4B65A 2Q0LA 4H4XA 1NENA 4I58A 1L0VA 1LQTA 1MOKA 2PHHA 3AECA 3AD9B 4U8MA 2IVEA 2C76A 3NYFA 2GVCA 2GRTA 2VQBA 5FS7A 2Z5YA 3UKKA 4NZHA 1E1KA 5KVHA 1JOAA 2YR5A 3UOXA 4Z24A 2JK6A 3E1TA 1LJ1A 2WQYA 3K7MX 1FECA 1CJ4A 1QLBA 2AQJA 5FS9A 1O94A 2X8HA 1D7LA 4TM4A 3T31A 5IQ1A 1PXCA 3P9UA 2XFOA 3GRSA 3AEDA 2R46A 4XWRA 3G5QA 1P2HA 3UKLA 2XVEA 1YQ3A 4E0VA 1FEAA 2YVJA 3EANA 1DOEA 3SY4A 1RSGA 2R0GA 2NPXA 1OJTA 2ZZ0A 3CGBA 2B7SA 3QJ4A 1PS9A 2BRAA 2AR8A 3AEFA 4JNQA 2GQFA 2VRLA 3VRAA 1PBFA 4M52A 2WDVA 2IVDA 5KOWA 4K22A 4HB9A 4A7AA 1ZP0A 4EQRA 1PBBA 1L9CA 1ZOYA 1GV4A 3AXBA 4REKA 1CBOA 2FJEA 2XLUA 3R9UA 4NEVA 1QJDA 2APGA 1LVLA 2C7GA 4Z43A 1DODA 3ABVA 1EL8A 1DXLA 4AT0A 4GR1A 3SZCA 4U2TA 4RG4A 3GDPA 4CCRA 2WDRA 4K5SA 4A99A 1OJCA 1K0IA 3BI5A 1B4VA 1F8WA 2YG3A 3LZWA 4UDQA 4RG3A 3ICRA 2A89A 1CC6A 2TMDA 2WESA 3II4A 3NYEA 3AE7A 4EMWA 4JY2A 2B76A 1CC4A 3AYIA 2I0ZA 4H4ZA 2DKIA 4RSLA 3SXIA 1GRTA 1PBEA 4P9SA 3UTFA 3B3RA 3CTYA 4OPIA 3S61A 1KNRA 2UZZA 2ZBWA 4EIQA 2VVMA 3L8KA 5HYMA 2XVFA 4NNJA 3OZ2A 4GAVA 3WE0A 1NEKA 3QSEA 4K2XA 2XDOA 3CGCA 3ISHA 2V3AA 4HA6A 1XANA 4U8JA 1GEUA 4IVOB 2XLTA 1IJHA 4FK1C 5KVIA 2WP6A 3O0HA 4H4QA 1E1MA 1KSUA 2WP5A 4O5QA 2RGHA 3UKAA 1LQUA 3LZXA 3GYJA 4CNKA 2GEWA 3UKHA 1ZKQA 3ADAB 1CHUA 1XPQA 5IPYA 1F8RA 4X9MA 2YM2A 3FPZA 1UKVG 2YVGA 3AEEA 3I6DA 2YQUA 1Z6LA 5JCIA 1ZDLA 3SYIA 2BYBA 1H84A 3P1WA 2WETA 3QVPA 2B9WA 1REOA 1RYIA 3K7TA 3L1RA 4TM3A 2XCGA 3GYIA 3NTAA 2JB3A 4TLZA 1D5TA 3AEBA 4PAAA 1PBDA 2BCGG 2BACA 4B64A 1Q9IA 2OAMA 1TRBA 3DA1A 1PJ5A 1PHHA 1COYA 1VQWA 4J31A 1GRFA 1GXFA 3P4SA 2GH5A 3AE9A 2EQ6A 1DJNA 1YQ4A 4B63A 4YKGA 1S2QA 2OLNA 3BI2A 2WP9A 3HYVA 3GD4A 1AOGA 3AEGA 3LXDA 3DH9A 4LU6A 1GRGA 3PVCA 1VG0A 4JQ9A 4JNAA 4N9XA 1JU2A 2BA9A 1B37A 2BK3A 2HQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS2 A;  3BI4 A;  1IUU A;  3FIM B;  4H4T A;  2B9X A;  1XHC A;  4TLX A;  1JRX A;  2ZZC A;  2F5Z A;  3K30 A;  2OAL A;  4C5O A;  3NYC A;  1LV0 A;  3CNP A;  1H82 A;  3DGZ A;  3BNM A;  3S5W A;  5CQF A;  2C70 A;  1PXB A;  2XVI A;  3LJP A;  1TDF A;  1E6E A;  4X9N A;  3P4Q A;  1VDC A;  4Z2U A;  2JAE A;  2Q6U A;  2JB2 A;  4TM0 A;  2EQ8 A;  3CND A;  2QA1 A;  2YG7 A;  1GER A;  1TYT A;  1K0L A;  4DSH A;  3H8L A;  3QFA A;  2C67 A;  1EL7 A;  5L46 A;  5FS8 A;  3GRT A;  1NG4 A;  3UTG A;  4PAB A;  4BJY A;  2VVL G;  4UDR A;  3Q9T A;  3CGD A;  4H2R A;  2WOV A;  3DME A;  5CKU A;  4YKF A;  4LII A;  2C65 A;  1D4D A;  2C75 A;  2V60 A;  1BF3 A;  2WS3 A;  3ITJ A;  3QSM A;  1YKJ A;  3RP8 A;  2WBA A;  1GET A;  1GRA A;  3AD8 B;  2VZ2 A;  3SQP A;  5BUL A;  5EB4 A;  5JCL A;  1GPE A;  1JRZ A;  5BUK A;  1H86 A;  1PJ6 A;  1PXA A;  1GND A;  1K0J A;  3K7Q X;  4IV9 A;  5M0Z A;  1N4V A;  4Z26 A;  5JCM A;  4CBQ A;  1Y56 A;  1GRB A;  5M10 A;  1GTE A;  3UKP A;  1H7X A;  5DBJ A;  4GDE A;  2BCP A;  1L9E A;  2C64 A;  1X31 B;  3CIR A;  1IUW A;  3ICS A;  3P4R A;  4A65 A;  1ZY8 A;  3IF9 A;  3KD9 A;  4FK1 A;  1OJA A;  3IC9 A;  1NPX A;  1GT8 A;  5U1O A;  3ALM A;  4H2P A;  3CNT A;  2VRM A;  2BC1 A;  1H6V A;  4H4U A;  5HHF A;  1ZMD A;  5HXI A;  3AE5 A;  1BGJ A;  3QFB A;  4J2W A;  2YWL A;  4YWO A;  1YY5 A;  3SFD A;  4BK2 A;  2XVJ A;  1JEH A;  4EQX A;  4FX9 A;  4H4P A;  3D8X A;  3UTE A;  3C4N A;  3VQR A;  1ZOV A;  4OPC A;  3KA7 A;  3CPH G;  1FEB A;  2Y6Q A;  2YLW A;  3AE3 A;  2WOI A;  1BZL A;  4H50 A;  1EL5 A;  1TDO A;  2B9Y A;  1LTX R;  2WEU A;  5U63 A;  3RHA A;  1GOS A;  4U2L A;  2IID A;  4CCQ A;  5ER0 A;  3G5S A;  3NN0 X;  3NRN A;  2GF3 A;  2GV8 A;  2WDQ A;  4A9W A;  1CJ3 A;  1E1L A;  2NVK X;  4YXD A;  4WX1 A;  3RP7 A;  1VG9 A;  3GD3 A;  3V76 A;  1CF3 A;  3M12 A;  2BXR A;  2RGO A;  1KDG A;  4JDR A;  3NN6 X;  2W0H A;  4GUV A;  3SFE A;  3NK1 X;  3NH3 X;  1O5W A;  2JB1 A;  4GCM A;  1ZX9 A;  3ATQ A;  1NHR A;  2BC0 A;  4J56 A;  2XLP A;  4U8K A;  1S3E A;  4H4Y A;  2X99 A;  1SEZ A;  2X8C A;  4A79 A;  2C3D A;  5EB5 A;  3GWD A;  3JSK A;  1CC2 A;  1TYP A;  2GR0 A;  1F6M A;  2YG4 A;  3CNS A;  4ZN0 A;  1ZMC A;  1LPF A;  3EF6 A;  2E1M A;  1L9D A;  1S3B A;  3OC4 A;  3RNM A;  2H89 A;  3ZDN A;  4CY6 A;  2WPE A;  1S2Y A;  3DGH A;  1KNP A;  2RGJ A;  4OPT A;  2CVJ A;  3EAO A;  4B1B A;  3AE4 A;  3ZYX A;  1NDA A;  1IUV A;  2JKC A;  4C74 A;  1Y0P A;  5C3J A;  3NKS A;  4H2Q A;  3UOZ A;  4U8L A;  2YG6 A;  2E4G A;  1E1N A;  1F8S A;  4USR A;  2BS4 A;  3AE8 A;  4USQ A;  1M6I A;  2YLT A;  1PDH A;  5EOW A;  2FJD A;  4FDC B;  3LB8 A;  1DOB A;  3NK0 X;  2WPF A;  3SGL A;  4YTN A;  2OLO A;  3F8D A;  2EQ9 A;  2BK4 A;  2C72 A;  2YR4 A;  3H8I A;  3NIX A;  1MXT A;  2GR1 A;  5JCK A;  3P4P A;  4U2S A;  1DOC A;  3GMB A;  3T37 A;  5JCN A;  4YSH A;  4DGK A;  2QA2 A;  1FOH A;  1K4Q A;  3VRD B;  1D4E A;  1V59 A;  3IHG A;  4KX6 A;  4AP3 A;  2R0C A;  1PN0 A;  4OVI A;  4A5L A;  2R45 A;  3AWI A;  1TDK A;  3PS9 A;  2EQ7 A;  4H4R A;  4K7Z A;  3FMW A;  4C77 A;  4XXG A;  2A8X A;  3NLC A;  4B67 A;  3RED A;  3UKQ A;  5IQ4 A;  3ALL A;  1D4C A;  1CL0 A;  3UCL A;  3AE6 A;  3UP4 A;  1MO9 A;  3DJE A;  3CNJ A;  2J3N A;  2ZZB A;  4B69 A;  2ACZ A;  1NHS A;  4AOS A;  3QSS A;  4U8O A;  1TDE A;  2WU2 A;  2VOU A;  3BHK A;  2Q7V A;  5J7X A;  1Y56 B;  2C3C A;  1O95 A;  3ATR A;  2R9Z A;  3I3L A;  4J36 A;  2GB0 A;  3URH A;  5C2T A;  2O9Z A;  2RAB A;  3KLJ A;  4K5R A;  3GWF A;  2C66 A;  3NHO X;  1H7W A;  1N4U A;  2R4E A;  2FJB A;  1F3P A;  3LAD A;  3DK4 A;  4EMI A;  3SM8 A;  1E7P A;  2V3B A;  5TR3 A;  3AYJ A;  2GAG B;  4Z44 A;  4U8N A;  2Y6R A;  4OPD A;  3G5R A;  4EM4 A;  4Y4N A;  1KF6 A;  1E39 A;  3AEA A;  4OPL A;  2XFP A;  4GRT A;  4Y4L A;  2GR3 A;  1N1P A;  4OPU A;  2BK5 A;  3VRB A;  1TDN A;  4EMJ A;  1KFY A;  2X50 A;  4TM1 A;  3NT6 A;  5KXJ A;  1CJ2 A;  4ADW A;  2B7R A;  2PYX A;  4I59 A;  3KPF A;  3UP5 A;  4MJW A;  4OCG A;  3BNU A;  3KKJ A;  4CY8 A;  4EQW A;  4YTP A;  3GDN A;  4J33 A;  1EBD A;  4A6N A;  1ELI A;  3VR9 A;  4YT0 A;  2GR2 A;  4DNA A;  4OPG A;  2XFQ A;  5KWF A;  2TPR A;  2YAU A;  1IUS A;  4ECH A;  2XFN A;  2YVF A;  1RP0 A;  4YSY A;  3EPT A;  4AOX A;  3RP6 A;  1NHQ A;  1GSN A;  1YQZ A;  2XVH A;  3ALJ A;  4K8D A;  1ONF A;  4WCT A;  5FMH A;  1KSS A;  1Q1R A;  1W4X A;  2FJA A;  3Q6J A;  4BK3 A;  4UDP A;  3DK8 A;  1B8S A;  2OA1 A;  2BS3 A;  3C4A A;  2X8G A;  3ICT A;  4LA1 A;  5GSN A;  4B66 A;  4X4J A;  2VVL A;  4AP1 A;  1H81 A;  1FL2 A;  3DK9 A;  2Q0K A;  2V61 A;  4YSX A;  4NTC A;  2YLR A;  4H4V A;  1NHP A;  4B68 A;  4JY3 A;  1OJD A;  4AT2 A;  2YLS A;  4EIP A;  1JNR A;  1HYU A;  3NG7 X;  3COX A;  3GMC A;  4J57 A;  2C73 A;  5FS6 A;  2XYO A;  4ZCC A;  4ZCD A;  1ZK7 A;  1P2E A;  1QO8 A;  3DJJ A;  3AYL A;  4ICY A;  4Z25 A;  2DKH A;  4DSG A;  4D04 A;  3NNE A;  4NEW A;  4J34 A;  3KVE A;  2BAB A;  3NK2 X;  1IUT A;  1EL9 A;  2WHD A;  2GMJ A;  4U8P A;  5U25 A;  4C3Y A;  4Z2T A;  2GMH A;  3FG2 P;  1DNC A;  3UTH A;  3HZL A;  4NTD A;  2WPC A;  1NAA A;  2QAE A;  3FBS A;  4IVM B;  1GAL A;  2CFY A;  3CGE A;  3UOY A;  5KOX A;  3V3N A;  1GRH A;  5LV9 A;  1NG3 A;  4BJZ A;  4C3X A;  3AE2 A;  4EM3 A;  4BV6 A;  5HY5 A;  3PO7 A;  2YLX A;  3AD7 B;  2YG5 A;  4GF7 A;  2A87 A;  3H4K A;  3AE1 A;  3UKF A;  2FBW A;  1B5Q A;  1H83 A;  3V3O A;  3NGC X;  1BKW A;  2V6O A;  4H4W A;  2BXS A;  1GTH A;  2E5V A;  4H7U A;  4APN A;  3F8R A;  5BRT A;  4BK1 A;  2AAQ A;  3F8P A;  1PJ7 A;  2GQW A;  3GSI A;  4GDP A;  5EBK A;  3DJG X;  2R0P A;  2CDU A;  2WU5 A;  2XFU A;  1Q1W A;  2WOW A;  4KPR A;  3D1C A;  3CPI G;  3CN8 A;  3QVR A;  2V5Z A;  4O5U A;  4BUR A;  1JRY A;  2XLR A;  4Y4M A;  1N4W A;  2Z5X A;  4YSZ A;  4NTE A;  3M0O A;  2XLS A;  4H2N A;  3IWA A;  1M64 A;  3BHF A;  4UP3 A;  3B6D A;  2R4J A;  1CJC A;  3LOV A;  3NTD A;  4CRT A;  3DJD A;  2GAH B;  3M13 A;  2JBV A;  2X3N A;  5GRT A;  4YTM A;  3KU9 A;  5BVA A;  1JNZ A;  4CNJ A;  3IHM A;  4JN9 A;  4IA5 A;  4IA6 A;  4EQS A;  1OJ9 A;  1IUX A;  3C96 A;  1XDI A;  1PBC A;  2H88 A;  4Z2R A;  3CPJ G;  2YLZ A;  3VR8 A;  1D7Y A;  1GRE A;  5J60 A;  4H4S A;  2CUL A;  1BGN A;  3UOV A;  4U8I A;  4XWZ A;  4A6N B;  1BWC A;  3AB1 A;  2QCU A;  2VQ7 A;  4D03 A;  1FCD A;  2ARD A;  5KRQ A;  1VRQ B;  2YM1 A;  2YR6 A;  1GES A;  1DJQ A;  4B65 A;  2Q0L A;  4H4X A;  1NEN A;  4I58 A;  1L0V A;  1LQT A;  1MOK A;  2PHH A;  3AEC A;  3AD9 B;  4U8M A;  2IVE A;  2C76 A;  3NYF A;  2GVC A;  2GRT A;  2VQB A;  5FS7 A;  2Z5Y A;  3UKK A;  4NZH A;  1E1K A;  5KVH A;  1JOA A;  2YR5 A;  3UOX A;  4Z24 A;  2JK6 A;  3E1T A;  1LJ1 A;  2WQY A;  3K7M X;  1FEC A;  1CJ4 A;  1QLB A;  2AQJ A;  5FS9 A;  1O94 A;  2X8H A;  1D7L A;  4TM4 A;  5IQ1 A;  1PXC A;  3P9U A;  2XFO A;  3GRS A;  3AED A;  2R46 A;  4XWR A;  3G5Q A;  1P2H A;  3UKL A;  2XVE A;  1YQ3 A;  4E0V A;  1FEA A;  2YVJ A;  3EAN A;  1DOE A;  1RSG A;  2R0G A;  2NPX A;  1OJT A;  2ZZ0 A;  3CGB A;  2B7S A;  3QJ4 A;  1PS9 A;  3AEF A;  2AR8 A;  4JNQ A;  2GQF A;  2VRL A;  3VRA A;  1PBF A;  4M52 A;  2WDV A;  2IVD A;  5KOW A;  4K22 A;  4HB9 A;  4A7A A;  1ZP0 A;  4EQR A;  1PBB A;  1L9C A;  1ZOY A;  1GV4 A;  3AXB A;  4REK A;  1CBO A;  2FJE A;  2XLU A;  3R9U A;  4NEV A;  1QJD A;  2APG A;  1LVL A;  2C7G A;  4Z43 A;  1DOD A;  3ABV A;  1EL8 A;  1DXL A;  4AT0 A;  4GR1 A;  4U2T A;  4RG4 A;  3GDP A;  4CCR A;  2WDR A;  4K5S A;  4A99 A;  1OJC A;  1K0I A;  3BI5 A;  1B4V A;  1F8W A;  2YG3 A;  3LZW A;  4UDQ A;  4RG3 A;  3ICR A;  2A89 A;  1CC6 A;  2TMD A;  2WES A;  3II4 A;  3NYE A;  3AE7 A;  4EMW A;  4JY2 A;  2B76 A;  1CC4 A;  3AYI A;  2I0Z A;  4H4Z A;  2DKI A;  4RSL A;  1GRT A;  1PBE A;  4P9S A;  3UTF A;  3B3R A;  3CTY A;  4OPI A;  3S61 A;  1KNR A;  2UZZ A;  2ZBW A;  4EIQ A;  2VVM A;  3L8K A;  5HYM A;  2XVF A;  3OZ2 A;  3WE0 A;  1NEK A;  3QSE A;  4K2X A;  2XDO A;  3CGC A;  3ISH A;  2V3A A;  4HA6 A;  1XAN A;  4U8J A;  1GEU A;  4IVO B;  2XLT A;  1IJH A;  4FK1 C;  5KVI A;  2WP6 A;  3O0H A;  4H4Q A;  1E1M A;  1KSU A;  2WP5 A;  4O5Q A;  2RGH A;  3UKA A;  1LQU A;  3LZX A;  3GYJ A;  4CNK A;  2GEW A;  3UKH A;  1ZKQ A;  3ADA B;  1CHU A;  1XPQ A;  5IPY A;  1F8R A;  4X9M A;  2YM2 A;  3FPZ A;  1UKV G;  2YVG A;  3AEE A;  3I6D A;  2YQU A;  1Z6L A;  5JCI A;  1ZDL A;  2BYB A;  1H84 A;  3P1W A;  2WET A;  3QVP A;  2B9W A;  1REO A;  1RYI A;  3K7T A;  3L1R A;  4TM3 A;  2XCG A;  3GYI A;  3NTA A;  2JB3 A;  4TLZ A;  1D5T A;  3AEB A;  4PAA A;  1PBD A;  2BCG G;  2BAC A;  4B64 A;  1Q9I A;  2OAM A;  1TRB A;  3DA1 A;  1PJ5 A;  1PHH A;  1COY A;  1VQW A;  4J31 A;  1GRF A;  1GXF A;  3P4S A;  2GH5 A;  3AE9 A;  2EQ6 A;  1DJN A;  1YQ4 A;  4B63 A;  4YKG A;  1S2Q A;  2OLN A;  3BI2 A;  2WP9 A;  3GD4 A;  1AOG A;  3AEG A;  3LXD A;  3DH9 A;  4LU6 A;  1GRG A;  3PVC A;  1VG0 A;  4JQ9 A;  4JNA A;  4N9X A;  1JU2 A;  2BA9 A;  1B37 A;  2BK3 A;  2HQM A; 
#chains in the Genus database with same CATH topology
 2BS2 A;  3BI4 A;  1IUU A;  3FIM B;  4H4T A;  2B9X A;  1XHC A;  4TLX A;  1JRX A;  2ZZC A;  2F5Z A;  3K30 A;  2OAL A;  4C5O A;  3NYC A;  1LV0 A;  3CNP A;  1H82 A;  2BRY A;  3BNM A;  3DGZ A;  5CQF A;  3S5W A;  2C70 A;  1PXB A;  2XVI A;  3LJP A;  1TDF A;  1E6E A;  4X9N A;  3P4Q A;  1VDC A;  4Z2U A;  2JAE A;  2Q6U A;  2JB2 A;  4TM0 A;  2EQ8 A;  3CND A;  2QA1 A;  2YG7 A;  1GER A;  1TYT A;  1K0L A;  4DSH A;  3H8L A;  3QFA A;  2C67 A;  1EL7 A;  5L46 A;  5FS8 A;  3GRT A;  1NG4 A;  3UTG A;  4PAB A;  4BJY A;  2VVL G;  4UDR A;  3Q9T A;  3CGD A;  4H2R A;  2WOV A;  3DME A;  5CKU A;  4YKF A;  4LII A;  2C65 A;  1D4D A;  2C75 A;  2V60 A;  1BF3 A;  2WS3 A;  3ITJ A;  3QSM A;  1YKJ A;  3RP8 A;  2WBA A;  1GET A;  1GRA A;  3AD8 B;  2VZ2 A;  3SQP A;  5BUL A;  5EB4 A;  5JCL A;  1GPE A;  1JRZ A;  5BUK A;  1H86 A;  4IV9 A;  1PXA A;  1GND A;  1K0J A;  1PJ6 A;  3K7Q X;  5KMR A;  5M0Z A;  1N4V A;  4Z26 A;  5JCM A;  4CBQ A;  1Y56 A;  1GRB A;  5M10 A;  1GTE A;  3UKP A;  1H7X A;  5DBJ A;  4GDE A;  2BCP A;  1L9E A;  4G73 A;  2C64 A;  1X31 B;  3CIR A;  1IUW A;  3ICS A;  3P4R A;  4A65 A;  1ZY8 A;  3IF9 A;  3KD9 A;  4FK1 A;  1OJA A;  3IC9 A;  1NPX A;  1GT8 A;  5U1O A;  3ALM A;  4H2P A;  3CNT A;  2VRM A;  2BC1 A;  1H6V A;  4H4U A;  5HHF A;  1ZMD A;  5HXI A;  3AE5 A;  1BGJ A;  3QFB A;  4J2W A;  3T14 A;  2YWL A;  4YWO A;  1YY5 A;  3SFD A;  4BK2 A;  2XVJ A;  1JEH A;  4EQX A;  4FX9 A;  4H4P A;  3D8X A;  3UTE A;  3C4N A;  3VQR A;  1ZOV A;  4OPC A;  3KA7 A;  3CPH G;  1FEB A;  2Y6Q A;  2YLW A;  3AE3 A;  2WOI A;  1BZL A;  4H50 A;  1EL5 A;  1TDO A;  2B9Y A;  1LTX R;  2WEU A;  5U63 A;  3RHA A;  1GOS A;  4U2L A;  2IID A;  4CCQ A;  5ER0 A;  3G5S A;  3NN0 X;  3NRN A;  2GF3 A;  2GV8 A;  2WDQ A;  4A9W A;  1CJ3 A;  1E1L A;  2NVK X;  4YXD A;  4WX1 A;  3RP7 A;  1VG9 A;  3GD3 A;  3V76 A;  1CF3 A;  3M12 A;  2BXR A;  2RGO A;  1KDG A;  4JDR A;  3NN6 X;  2W0H A;  4GUV A;  3SFE A;  3NK1 X;  3NH3 X;  1O5W A;  2JB1 A;  4GCM A;  4G74 A;  1ZX9 A;  3ATQ A;  1NHR A;  2BC0 A;  4J56 A;  2XLP A;  4U8K A;  1S3E A;  4H4Y A;  2X99 A;  1SEZ A;  2X8C A;  4A79 A;  2C3D A;  5EB5 A;  3GWD A;  3JSK A;  1CC2 A;  1TYP A;  4G6G A;  2GR0 A;  1F6M A;  2YG4 A;  3CNS A;  4ZN0 A;  1ZMC A;  1LPF A;  3EF6 A;  2E1M A;  1L9D A;  4GAP A;  1S3B A;  3OC4 A;  3SZW A;  3RNM A;  2H89 A;  3T0K A;  3ZDN A;  4CY6 A;  2WPE A;  1S2Y A;  3DGH A;  1KNP A;  2RGJ A;  4OPT A;  2CVJ A;  3EAO A;  4B1B A;  3AE4 A;  3ZYX A;  1NDA A;  1IUV A;  2JKC A;  4C74 A;  1Y0P A;  5C3J A;  3NKS A;  4H2Q A;  3UOZ A;  4U8L A;  2YG6 A;  2E4G A;  1E1N A;  1F8S A;  4USR A;  2BS4 A;  3AE8 A;  4USQ A;  1M6I A;  2YLT A;  1PDH A;  5EOW A;  2FJD A;  4FDC B;  3LB8 A;  1DOB A;  3NK0 X;  2WPF A;  3SGL A;  4YTN A;  2OLO A;  3F8D A;  2EQ9 A;  2BK4 A;  2C72 A;  2YR4 A;  3H8I A;  3NIX A;  1MXT A;  2GR1 A;  5JCK A;  3P4P A;  4U2S A;  1DOC A;  3GMB A;  3T37 A;  5JCN A;  4YSH A;  4DGK A;  2QA2 A;  1FOH A;  1K4Q A;  3VRD B;  1D4E A;  1V59 A;  3IHG A;  4KX6 A;  4AP3 A;  2R0C A;  1PN0 A;  4OVI A;  4A5L A;  2R45 A;  3AWI A;  1TDK A;  3PS9 A;  2EQ7 A;  4H4R A;  4K7Z A;  3FMW A;  4C77 A;  4XXG A;  2A8X A;  3NLC A;  4B67 A;  3RED A;  3UKQ A;  5IQ4 A;  3ALL A;  1D4C A;  1CL0 A;  4G6H A;  3T2K A;  3UCL A;  3AE6 A;  3UP4 A;  1MO9 A;  3DJE A;  3CNJ A;  2J3N A;  2ZZB A;  5KMQ A;  2ACZ A;  1NHS A;  4B69 A;  4AOS A;  3T2Z A;  3QSS A;  4U8O A;  1TDE A;  2WU2 A;  2VOU A;  3BHK A;  2Q7V A;  5KMS A;  5J7X A;  1Y56 B;  2C3C A;  1O95 A;  3ATR A;  2R9Z A;  3I3L A;  4II2 A;  4J36 A;  2GB0 A;  3URH A;  5C2T A;  2O9Z A;  2RAB A;  4II3 A;  3KLJ A;  4K5R A;  3GWF A;  2C66 A;  3NHO X;  3SX6 A;  1H7W A;  1N4U A;  2R4E A;  2FJB A;  1F3P A;  3LAD A;  3DK4 A;  4EMI A;  3SM8 A;  1E7P A;  3GYX A;  2V3B A;  5TR3 A;  3AYJ A;  2GAG B;  4Z44 A;  4U8N A;  3CMM A;  2Y6R A;  4OPD A;  3G5R A;  4EM4 A;  4Y4N A;  1KF6 A;  1E39 A;  3AEA A;  4OPL A;  2XFP A;  4GRT A;  4Y4L A;  2GR3 A;  1N1P A;  4OPU A;  2BK5 A;  3VRB A;  1TDN A;  4EMJ A;  1KFY A;  2X50 A;  4TM1 A;  3NT6 A;  5KXJ A;  1CJ2 A;  4ADW A;  2B7R A;  2PYX A;  4I59 A;  3KPF A;  3UP5 A;  4MJW A;  4OCG A;  3BNU A;  3KKJ A;  4CY8 A;  4EQW A;  4YTP A;  3GDN A;  4J33 A;  1EBD A;  4A6N A;  1ELI A;  3VR9 A;  4YT0 A;  2GR2 A;  4DNA A;  4OPG A;  2XFQ A;  5KWF A;  2TPR A;  2YAU A;  1IUS A;  4ECH A;  2XFN A;  2YVF A;  1RP0 A;  3T2Y A;  4YSY A;  3EPT A;  4AOX A;  3RP6 A;  1NHQ A;  1GSN A;  1YQZ A;  2XVH A;  3ALJ A;  4K8D A;  1ONF A;  4WCT A;  5FMH A;  1KSS A;  1Q1R A;  1W4X A;  2FJA A;  3Q6J A;  4BK3 A;  4UDP A;  3DK8 A;  1B8S A;  2OA1 A;  2BS3 A;  3C4A A;  2X8G A;  3ICT A;  4LA1 A;  5GSN A;  4B66 A;  4X4J A;  2VVL A;  4AP1 A;  1H81 A;  1FL2 A;  3DK9 A;  3SZ0 A;  2Q0K A;  2V61 A;  4YSX A;  4NTC A;  2YLR A;  4H4V A;  1NHP A;  4B68 A;  4JY3 A;  1OJD A;  4AT2 A;  2YLS A;  4EIP A;  1JNR A;  1HYU A;  3NG7 X;  3COX A;  3GMC A;  4J57 A;  2C73 A;  5FS6 A;  2XYO A;  4ZCC A;  4ZCD A;  1ZK7 A;  1P2E A;  1QO8 A;  3DJJ A;  3AYL A;  4ICY A;  4NWZ A;  4Z25 A;  2DKH A;  4DSG A;  4D04 A;  3NNE A;  4NEW A;  4J34 A;  3KVE A;  2BAB A;  3NK2 X;  1IUT A;  1EL9 A;  2WHD A;  2GMJ A;  4U8P A;  5U25 A;  4C3Y A;  4Z2T A;  2GMH A;  3FG2 P;  1DNC A;  3UTH A;  3HZL A;  4NTD A;  2WPC A;  1NAA A;  2QAE A;  3FBS A;  4IVM B;  4G9K A;  1GAL A;  2CFY A;  3CGE A;  3UOY A;  5KOX A;  3V3N A;  1GRH A;  5LV9 A;  1NG3 A;  4BJZ A;  4C3X A;  3AE2 A;  4EM3 A;  4BV6 A;  5HY5 A;  3PO7 A;  2YLX A;  3AD7 B;  2YG5 A;  3SZF A;  4GF7 A;  2A87 A;  3H4K A;  3AE1 A;  3UKF A;  2FBW A;  1B5Q A;  1H83 A;  3V3O A;  3NGC X;  1BKW A;  2V6O A;  4H4W A;  2BXS A;  1GTH A;  2E5V A;  4H7U A;  4APN A;  3F8R A;  5BRT A;  5KNL A;  4BK1 A;  2AAQ A;  3F8P A;  1PJ7 A;  2GQW A;  5KMP A;  3GSI A;  4GDP A;  5EBK A;  3DJG X;  2R0P A;  2CDU A;  2WU5 A;  2XFU A;  1Q1W A;  2WOW A;  4KPR A;  3D1C A;  3CPI G;  3CN8 A;  3QVR A;  2V5Z A;  4O5U A;  4BUR A;  1JRY A;  2XLR A;  4Y4M A;  1N4W A;  2Z5X A;  4YSZ A;  4NTE A;  3M0O A;  2XLS A;  3HYW A;  4H2N A;  3IWA A;  1M64 A;  3BHF A;  4UP3 A;  3KPK A;  3B6D A;  2R4J A;  1CJC A;  3LOV A;  3NTD A;  4CRT A;  3DJD A;  2GAH B;  3M13 A;  2JBV A;  2X3N A;  5GRT A;  4YTM A;  3KU9 A;  5BVA A;  1JNZ A;  4CNJ A;  3IHM A;  4JN9 A;  4IA5 A;  4IA6 A;  3HYX A;  4EQS A;  1OJ9 A;  1IUX A;  3C96 A;  1XDI A;  1PBC A;  2H88 A;  4Z2R A;  3CPJ G;  2YLZ A;  3VR8 A;  1D7Y A;  1GRE A;  5J60 A;  4H4S A;  2CUL A;  1BGN A;  3UOV A;  4U8I A;  4XWZ A;  4A6N B;  1BWC A;  3AB1 A;  2QCU A;  2VQ7 A;  4D03 A;  1FCD A;  2ARD A;  5KRQ A;  2C4C A;  1VRQ B;  2YM1 A;  2YR6 A;  1GES A;  1DJQ A;  4B65 A;  2Q0L A;  4H4X A;  1NEN A;  4I58 A;  1L0V A;  1LQT A;  1MOK A;  2PHH A;  3AEC A;  3AD9 B;  4U8M A;  2IVE A;  2C76 A;  3NYF A;  2GVC A;  2GRT A;  2VQB A;  5FS7 A;  2Z5Y A;  3UKK A;  4NZH A;  1E1K A;  5KVH A;  1JOA A;  2YR5 A;  3UOX A;  4Z24 A;  2JK6 A;  3E1T A;  1LJ1 A;  2WQY A;  3K7M X;  1FEC A;  1CJ4 A;  1QLB A;  2AQJ A;  5FS9 A;  1O94 A;  2X8H A;  1D7L A;  4TM4 A;  3T31 A;  5IQ1 A;  1PXC A;  3P9U A;  2XFO A;  3GRS A;  3AED A;  2R46 A;  4XWR A;  3G5Q A;  1P2H A;  3UKL A;  2XVE A;  1YQ3 A;  4E0V A;  1FEA A;  2YVJ A;  3EAN A;  1DOE A;  3SY4 A;  1RSG A;  2R0G A;  2NPX A;  1OJT A;  2ZZ0 A;  3CGB A;  2B7S A;  3QJ4 A;  1PS9 A;  2BRA A;  2AR8 A;  3AEF A;  4JNQ A;  2GQF A;  2VRL A;  3VRA A;  1PBF A;  4M52 A;  2WDV A;  2IVD A;  5KOW A;  4K22 A;  4HB9 A;  4A7A A;  1ZP0 A;  4EQR A;  1PBB A;  1L9C A;  1ZOY A;  1GV4 A;  3AXB A;  4REK A;  1CBO A;  2FJE A;  2XLU A;  3R9U A;  4NEV A;  1QJD A;  2APG A;  1LVL A;  2C7G A;  4Z43 A;  1DOD A;  3ABV A;  1EL8 A;  1DXL A;  4AT0 A;  4GR1 A;  3SZC A;  4U2T A;  4RG4 A;  3GDP A;  4CCR A;  2WDR A;  4K5S A;  4A99 A;  1OJC A;  1K0I A;  3BI5 A;  1B4V A;  1F8W A;  2YG3 A;  3LZW A;  4UDQ A;  4RG3 A;  3ICR A;  2A89 A;  1CC6 A;  2TMD A;  2WES A;  3II4 A;  3NYE A;  3AE7 A;  4EMW A;  4JY2 A;  2B76 A;  1CC4 A;  3AYI A;  2I0Z A;  4H4Z A;  2DKI A;  4RSL A;  3SXI A;  1GRT A;  1PBE A;  4P9S A;  3UTF A;  3B3R A;  3CTY A;  4OPI A;  3S61 A;  1KNR A;  2UZZ A;  2ZBW A;  4EIQ A;  2VVM A;  3L8K A;  5HYM A;  2XVF A;  4NNJ A;  3OZ2 A;  3WE0 A;  4GAV A;  1NEK A;  3QSE A;  4K2X A;  2XDO A;  3CGC A;  3ISH A;  2V3A A;  4HA6 A;  1XAN A;  4U8J A;  1GEU A;  4IVO B;  2XLT A;  1IJH A;  4FK1 C;  5KVI A;  2WP6 A;  3O0H A;  4H4Q A;  1E1M A;  1KSU A;  2WP5 A;  4O5Q A;  2RGH A;  3UKA A;  1LQU A;  3LZX A;  3GYJ A;  4CNK A;  2GEW A;  3UKH A;  1ZKQ A;  3ADA B;  1CHU A;  1XPQ A;  5IPY A;  1F8R A;  4X9M A;  2YM2 A;  3FPZ A;  1UKV G;  2YVG A;  3AEE A;  3I6D A;  2YQU A;  1Z6L A;  5JCI A;  1ZDL A;  3SYI A;  2BYB A;  1H84 A;  3P1W A;  2WET A;  3QVP A;  2B9W A;  1REO A;  1RYI A;  3K7T A;  3L1R A;  4TM3 A;  2XCG A;  3GYI A;  3NTA A;  2JB3 A;  4TLZ A;  1D5T A;  3AEB A;  4PAA A;  1PBD A;  2BCG G;  2BAC A;  4B64 A;  1Q9I A;  2OAM A;  1TRB A;  3DA1 A;  1PJ5 A;  1PHH A;  1COY A;  1VQW A;  4J31 A;  1GRF A;  1GXF A;  3P4S A;  2GH5 A;  3AE9 A;  2EQ6 A;  1DJN A;  1YQ4 A;  4B63 A;  4YKG A;  1S2Q A;  2OLN A;  3BI2 A;  2WP9 A;  3HYV A;  3GD4 A;  1AOG A;  3AEG A;  3LXD A;  3DH9 A;  4LU6 A;  1GRG A;  3PVC A;  1VG0 A;  4JQ9 A;  4JNA A;  4N9X A;  1JU2 A;  2BA9 A;  1B37 A;  2BK3 A;  2HQM A; 
#chains in the Genus database with same CATH homology
 2BS2 A;  3BI4 A;  1IUU A;  3FIM B;  4H4T A;  2B9X A;  1XHC A;  4TLX A;  1JRX A;  2ZZC A;  2F5Z A;  3K30 A;  2OAL A;  4C5O A;  3NYC A;  1LV0 A;  3CNP A;  1H82 A;  2BRY A;  3BNM A;  3DGZ A;  5CQF A;  3S5W A;  2C70 A;  1PXB A;  2XVI A;  3LJP A;  1TDF A;  1E6E A;  4X9N A;  3P4Q A;  1VDC A;  4Z2U A;  2JAE A;  2Q6U A;  2JB2 A;  4TM0 A;  2EQ8 A;  3CND A;  2QA1 A;  2YG7 A;  1GER A;  1TYT A;  1K0L A;  4DSH A;  3H8L A;  3QFA A;  2C67 A;  1EL7 A;  5L46 A;  5FS8 A;  3GRT A;  1NG4 A;  3UTG A;  4PAB A;  4BJY A;  2VVL G;  4UDR A;  3Q9T A;  3CGD A;  4H2R A;  2WOV A;  3DME A;  5CKU A;  4YKF A;  4LII A;  2C65 A;  1D4D A;  2C75 A;  2V60 A;  1BF3 A;  2WS3 A;  3ITJ A;  3QSM A;  1YKJ A;  3RP8 A;  2WBA A;  1GET A;  1GRA A;  3AD8 B;  2VZ2 A;  3SQP A;  5BUL A;  5EB4 A;  5JCL A;  1GPE A;  1JRZ A;  5BUK A;  1H86 A;  1PJ6 A;  1PXA A;  1GND A;  1K0J A;  3K7Q X;  4IV9 A;  5KMR A;  5M0Z A;  1N4V A;  4Z26 A;  5JCM A;  4CBQ A;  1Y56 A;  1GRB A;  5M10 A;  1GTE A;  3UKP A;  1H7X A;  5DBJ A;  4GDE A;  2BCP A;  1L9E A;  4G73 A;  2C64 A;  1X31 B;  3CIR A;  1IUW A;  3ICS A;  3P4R A;  4A65 A;  1ZY8 A;  3IF9 A;  3KD9 A;  4FK1 A;  1OJA A;  3IC9 A;  1NPX A;  1GT8 A;  5U1O A;  3ALM A;  4H2P A;  3CNT A;  2VRM A;  2BC1 A;  1H6V A;  4H4U A;  5HHF A;  1ZMD A;  5HXI A;  3AE5 A;  1BGJ A;  3QFB A;  4J2W A;  3T14 A;  2YWL A;  4YWO A;  1YY5 A;  3SFD A;  4BK2 A;  2XVJ A;  1JEH A;  4EQX A;  4FX9 A;  4H4P A;  3D8X A;  3UTE A;  3C4N A;  3VQR A;  1ZOV A;  4OPC A;  3KA7 A;  3CPH G;  1FEB A;  2Y6Q A;  2YLW A;  3AE3 A;  2WOI A;  1BZL A;  4H50 A;  1EL5 A;  1TDO A;  2B9Y A;  1LTX R;  2WEU A;  5U63 A;  3RHA A;  1GOS A;  4U2L A;  2IID A;  4CCQ A;  5ER0 A;  3G5S A;  3NN0 X;  3NRN A;  2GF3 A;  2GV8 A;  2WDQ A;  4A9W A;  1CJ3 A;  1E1L A;  2NVK X;  4YXD A;  4WX1 A;  3RP7 A;  1VG9 A;  3GD3 A;  3V76 A;  1CF3 A;  3M12 A;  2BXR A;  2RGO A;  1KDG A;  4JDR A;  3NN6 X;  2W0H A;  4GUV A;  3SFE A;  3NK1 X;  3NH3 X;  1O5W A;  2JB1 A;  4GCM A;  4G74 A;  1ZX9 A;  3ATQ A;  1NHR A;  2BC0 A;  4J56 A;  2XLP A;  4U8K A;  1S3E A;  4H4Y A;  2X99 A;  1SEZ A;  2X8C A;  4A79 A;  2C3D A;  5EB5 A;  3GWD A;  3JSK A;  1CC2 A;  1TYP A;  4G6G A;  2GR0 A;  1F6M A;  2YG4 A;  3CNS A;  4ZN0 A;  1ZMC A;  1LPF A;  3EF6 A;  2E1M A;  1L9D A;  4GAP A;  1S3B A;  3OC4 A;  3SZW A;  3RNM A;  2H89 A;  3T0K A;  3ZDN A;  4CY6 A;  2WPE A;  1S2Y A;  3DGH A;  1KNP A;  2RGJ A;  4OPT A;  2CVJ A;  3EAO A;  4B1B A;  3AE4 A;  3ZYX A;  1NDA A;  1IUV A;  2JKC A;  4C74 A;  1Y0P A;  5C3J A;  3NKS A;  4H2Q A;  3UOZ A;  4U8L A;  2YG6 A;  2E4G A;  1E1N A;  1F8S A;  4USR A;  2BS4 A;  3AE8 A;  4USQ A;  1M6I A;  2YLT A;  1PDH A;  5EOW A;  2FJD A;  4FDC B;  3LB8 A;  1DOB A;  3NK0 X;  2WPF A;  3SGL A;  4YTN A;  2OLO A;  3F8D A;  2EQ9 A;  2BK4 A;  2C72 A;  2YR4 A;  3H8I A;  3NIX A;  1MXT A;  2GR1 A;  5JCK A;  3P4P A;  4U2S A;  1DOC A;  3GMB A;  3T37 A;  5JCN A;  4YSH A;  4DGK A;  2QA2 A;  1FOH A;  1K4Q A;  3VRD B;  1D4E A;  1V59 A;  3IHG A;  4KX6 A;  4AP3 A;  2R0C A;  1PN0 A;  4OVI A;  4A5L A;  2R45 A;  3AWI A;  1TDK A;  3PS9 A;  2EQ7 A;  4H4R A;  4K7Z A;  3FMW A;  4C77 A;  4XXG A;  2A8X A;  3NLC A;  4B67 A;  3RED A;  3UKQ A;  5IQ4 A;  3ALL A;  1D4C A;  1CL0 A;  4G6H A;  3T2K A;  3UCL A;  3AE6 A;  3UP4 A;  1MO9 A;  3DJE A;  3CNJ A;  2J3N A;  2ZZB A;  5KMQ A;  2ACZ A;  1NHS A;  4B69 A;  4AOS A;  3T2Z A;  3QSS A;  4U8O A;  1TDE A;  2WU2 A;  2VOU A;  3BHK A;  2Q7V A;  5KMS A;  5J7X A;  1Y56 B;  2C3C A;  1O95 A;  3ATR A;  2R9Z A;  3I3L A;  4II2 A;  4J36 A;  2GB0 A;  3URH A;  5C2T A;  2O9Z A;  2RAB A;  4II3 A;  3KLJ A;  4K5R A;  3GWF A;  2C66 A;  3NHO X;  3SX6 A;  1H7W A;  1N4U A;  2R4E A;  2FJB A;  1F3P A;  3LAD A;  3DK4 A;  4EMI A;  3SM8 A;  1E7P A;  3GYX A;  2V3B A;  5TR3 A;  3AYJ A;  2GAG B;  4Z44 A;  4U8N A;  3CMM A;  2Y6R A;  4OPD A;  3G5R A;  4EM4 A;  4Y4N A;  1KF6 A;  1E39 A;  3AEA A;  4OPL A;  2XFP A;  4GRT A;  4Y4L A;  2GR3 A;  1N1P A;  4OPU A;  2BK5 A;  3VRB A;  1TDN A;  4EMJ A;  1KFY A;  2X50 A;  4TM1 A;  3NT6 A;  5KXJ A;  1CJ2 A;  4ADW A;  2B7R A;  2PYX A;  4I59 A;  3KPF A;  3UP5 A;  4MJW A;  4OCG A;  3BNU A;  3KKJ A;  4CY8 A;  4EQW A;  4YTP A;  3GDN A;  4J33 A;  1EBD A;  4A6N A;  1ELI A;  3VR9 A;  4YT0 A;  2GR2 A;  4DNA A;  4OPG A;  2XFQ A;  5KWF A;  2TPR A;  2YAU A;  1IUS A;  4ECH A;  2XFN A;  2YVF A;  1RP0 A;  3T2Y A;  4YSY A;  3EPT A;  4AOX A;  3RP6 A;  1NHQ A;  1GSN A;  1YQZ A;  2XVH A;  3ALJ A;  4K8D A;  1ONF A;  4WCT A;  5FMH A;  1KSS A;  1Q1R A;  1W4X A;  2FJA A;  3Q6J A;  4BK3 A;  4UDP A;  3DK8 A;  1B8S A;  2OA1 A;  2BS3 A;  3C4A A;  2X8G A;  3ICT A;  4LA1 A;  5GSN A;  4B66 A;  4X4J A;  2VVL A;  4AP1 A;  1H81 A;  1FL2 A;  3DK9 A;  3SZ0 A;  2Q0K A;  2V61 A;  4YSX A;  4NTC A;  2YLR A;  4H4V A;  1NHP A;  4B68 A;  4JY3 A;  1OJD A;  4AT2 A;  2YLS A;  4EIP A;  1JNR A;  1HYU A;  3NG7 X;  3COX A;  3GMC A;  4J57 A;  2C73 A;  5FS6 A;  2XYO A;  4ZCC A;  4ZCD A;  1ZK7 A;  1P2E A;  1QO8 A;  3DJJ A;  3AYL A;  4ICY A;  4NWZ A;  4Z25 A;  2DKH A;  4DSG A;  4D04 A;  3NNE A;  4NEW A;  4J34 A;  3KVE A;  2BAB A;  3NK2 X;  1IUT A;  1EL9 A;  2WHD A;  2GMJ A;  4U8P A;  5U25 A;  4C3Y A;  4Z2T A;  2GMH A;  3FG2 P;  1DNC A;  3UTH A;  3HZL A;  4NTD A;  2WPC A;  1NAA A;  2QAE A;  3FBS A;  4IVM B;  4G9K A;  1GAL A;  2CFY A;  3CGE A;  3UOY A;  5KOX A;  3V3N A;  1GRH A;  5LV9 A;  1NG3 A;  4BJZ A;  4C3X A;  3AE2 A;  4EM3 A;  4BV6 A;  5HY5 A;  3PO7 A;  2YLX A;  3AD7 B;  2YG5 A;  3SZF A;  4GF7 A;  2A87 A;  3H4K A;  3AE1 A;  3UKF A;  2FBW A;  1B5Q A;  1H83 A;  3V3O A;  3NGC X;  1BKW A;  2V6O A;  4H4W A;  2BXS A;  1GTH A;  2E5V A;  4H7U A;  4APN A;  3F8R A;  5BRT A;  5KNL A;  4BK1 A;  2AAQ A;  3F8P A;  1PJ7 A;  2GQW A;  5KMP A;  3GSI A;  4GDP A;  5EBK A;  3DJG X;  2R0P A;  2CDU A;  2WU5 A;  2XFU A;  1Q1W A;  2WOW A;  4KPR A;  3D1C A;  3CPI G;  3CN8 A;  3QVR A;  2V5Z A;  4O5U A;  4BUR A;  1JRY A;  2XLR A;  4Y4M A;  1N4W A;  2Z5X A;  4YSZ A;  4NTE A;  3M0O A;  2XLS A;  3HYW A;  4H2N A;  3IWA A;  1M64 A;  3BHF A;  4UP3 A;  3KPK A;  3B6D A;  2R4J A;  1CJC A;  3LOV A;  3NTD A;  4CRT A;  3DJD A;  2GAH B;  3M13 A;  2JBV A;  2X3N A;  5GRT A;  4YTM A;  3KU9 A;  5BVA A;  1JNZ A;  4CNJ A;  3IHM A;  4JN9 A;  4IA5 A;  4IA6 A;  3HYX A;  4EQS A;  1OJ9 A;  1IUX A;  3C96 A;  1XDI A;  1PBC A;  2H88 A;  4Z2R A;  3CPJ G;  2YLZ A;  3VR8 A;  1D7Y A;  1GRE A;  5J60 A;  4H4S A;  2CUL A;  1BGN A;  3UOV A;  4U8I A;  4XWZ A;  4A6N B;  1BWC A;  3AB1 A;  2QCU A;  2VQ7 A;  4D03 A;  1FCD A;  2ARD A;  5KRQ A;  2C4C A;  1VRQ B;  2YM1 A;  2YR6 A;  1GES A;  1DJQ A;  4B65 A;  2Q0L A;  4H4X A;  1NEN A;  4I58 A;  1L0V A;  1LQT A;  1MOK A;  2PHH A;  3AEC A;  3AD9 B;  4U8M A;  2IVE A;  2C76 A;  3NYF A;  2GVC A;  2GRT A;  2VQB A;  5FS7 A;  2Z5Y A;  3UKK A;  4NZH A;  1E1K A;  5KVH A;  1JOA A;  2YR5 A;  3UOX A;  4Z24 A;  2JK6 A;  3E1T A;  1LJ1 A;  2WQY A;  3K7M X;  1FEC A;  1CJ4 A;  1QLB A;  2AQJ A;  5FS9 A;  1O94 A;  2X8H A;  1D7L A;  4TM4 A;  3T31 A;  5IQ1 A;  1PXC A;  3P9U A;  2XFO A;  3GRS A;  3AED A;  2R46 A;  4XWR A;  3G5Q A;  1P2H A;  3UKL A;  2XVE A;  1YQ3 A;  4E0V A;  1FEA A;  2YVJ A;  3EAN A;  1DOE A;  3SY4 A;  1RSG A;  2R0G A;  2NPX A;  1OJT A;  2ZZ0 A;  3CGB A;  2B7S A;  3QJ4 A;  1PS9 A;  2BRA A;  2AR8 A;  3AEF A;  4JNQ A;  2GQF A;  2VRL A;  3VRA A;  1PBF A;  4M52 A;  2WDV A;  2IVD A;  5KOW A;  4K22 A;  4HB9 A;  4A7A A;  1ZP0 A;  4EQR A;  1PBB A;  1L9C A;  1ZOY A;  1GV4 A;  3AXB A;  4REK A;  1CBO A;  2FJE A;  2XLU A;  3R9U A;  4NEV A;  1QJD A;  2APG A;  1LVL A;  2C7G A;  4Z43 A;  1DOD A;  3ABV A;  1EL8 A;  1DXL A;  4AT0 A;  4GR1 A;  3SZC A;  4U2T A;  4RG4 A;  3GDP A;  4CCR A;  2WDR A;  4K5S A;  4A99 A;  1OJC A;  1K0I A;  3BI5 A;  1B4V A;  1F8W A;  2YG3 A;  3LZW A;  4UDQ A;  4RG3 A;  3ICR A;  2A89 A;  1CC6 A;  2TMD A;  2WES A;  3II4 A;  3NYE A;  3AE7 A;  4EMW A;  4JY2 A;  2B76 A;  1CC4 A;  3AYI A;  2I0Z A;  4H4Z A;  2DKI A;  4RSL A;  3SXI A;  1GRT A;  1PBE A;  4P9S A;  3UTF A;  3B3R A;  3CTY A;  4OPI A;  3S61 A;  1KNR A;  2UZZ A;  2ZBW A;  4EIQ A;  2VVM A;  3L8K A;  5HYM A;  2XVF A;  4NNJ A;  3OZ2 A;  4GAV A;  3WE0 A;  1NEK A;  3QSE A;  4K2X A;  2XDO A;  3CGC A;  3ISH A;  2V3A A;  4HA6 A;  1XAN A;  4U8J A;  1GEU A;  4IVO B;  2XLT A;  1IJH A;  4FK1 C;  5KVI A;  2WP6 A;  3O0H A;  4H4Q A;  1E1M A;  1KSU A;  2WP5 A;  4O5Q A;  2RGH A;  3UKA A;  1LQU A;  3LZX A;  3GYJ A;  4CNK A;  2GEW A;  3UKH A;  1ZKQ A;  3ADA B;  1CHU A;  1XPQ A;  5IPY A;  1F8R A;  4X9M A;  2YM2 A;  3FPZ A;  1UKV G;  2YVG A;  3AEE A;  3I6D A;  2YQU A;  1Z6L A;  5JCI A;  1ZDL A;  3SYI A;  2BYB A;  1H84 A;  3P1W A;  2WET A;  3QVP A;  2B9W A;  1REO A;  1RYI A;  3K7T A;  3L1R A;  4TM3 A;  2XCG A;  3GYI A;  3NTA A;  2JB3 A;  4TLZ A;  1D5T A;  3AEB A;  4PAA A;  1PBD A;  2BCG G;  2BAC A;  4B64 A;  1Q9I A;  2OAM A;  1TRB A;  3DA1 A;  1PJ5 A;  1PHH A;  1COY A;  1VQW A;  4J31 A;  1GRF A;  1GXF A;  3P4S A;  2GH5 A;  3AE9 A;  2EQ6 A;  1DJN A;  1YQ4 A;  4B63 A;  4YKG A;  1S2Q A;  2OLN A;  3BI2 A;  2WP9 A;  3HYV A;  3GD4 A;  1AOG A;  3AEG A;  3LXD A;  3DH9 A;  4LU6 A;  1GRG A;  3PVC A;  1VG0 A;  4JQ9 A;  4JNA A;  4N9X A;  1JU2 A;  2BA9 A;  1B37 A;  2BK3 A;  2HQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...