3KVEA

Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNSKEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRTNCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEKDTSSNTADYVIVCTTSRAARRIQFEPPLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNFSTGVGVIIAYGIGDDANFFQALKFKDCADIVFNDLSLIHQLPKEEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
publication title Structure of native L-amino acid oxidase from Vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
rcsb
total genus 178
structure length 484
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3kveA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kveA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kveA01
3ALJA 1REOA 1FECA 1M64A 3UOXA 1ZDLA 2OALA 3II4A 2GEWA 3GRTA 3B3RA 2R0CA 3NG7X 5JCLA 1SEZA 1JRZA 2GVCA 2X8HA 5C2TA 4Z2RA 1YQZA 2Q0LA 1ZOYA 4GF7A 4OPLA 3SM8A 2BYBA 3KVEA 4U8NA 1CF3A 2BS4A 3ATRA 1Y0PA 3DJEA 3GDPA 3DJJA 3GYJA 3NKSA 2OAMA 3SFEA 3DA1A 5BVAA 1IUWA 4ZN0A 3BI5A 3UCLA 4OPCA 4J34A 5ER0A 2VQ7A 2XVIA 3AE4A 3E1TA 3AE6A 3GWFA 3KA7A 4JNAA 3AEAA 5DBJA 1RYIA 4J2WA 1QO8A 1ELIA 4FX9A 4IVMB 4ICYA 4TLZA 2BS3A 2Y6QA 3BI2A 4JN9A 5CKUA 4A6NA 1TDEA 4A99A 2WU5A 4OCGA 3V3OA 1BGNA 2R46A 5BRTA 3UKKA 4AP3A 1PN0A 1F8RA 1IUUA 3AE8A 2H88A 3ATQA 4CNKA 3AE7A 2QA1A 3M0OA 1KSUA 3WE0A 2B9WA 2IVDA 4J57A 1ZK7A 2Q6UA 3AYJA 3IC9A 4YSZA 2WOVA 2WP6A 4Z2UA 1B5QA 1PBBA 3NNEA 4U8JA 4AT0A 2WU2A 3UKAA 1VRQB 1O95A 4H4YA 3BHKA 2GRTA 2RABA 5J7XA 4B64A 2WP5A 2GAGB 3GWDA 2YAUA 1O5WA 1H84A 1L9EA 2YVFA 3BHFA 2R9ZA 5GSNA 3ZYXA 2VQBA 3AE3A 1XPQA 3ICRA 4BK3A 4GDEA 3UTFA 3H8LA 1GRTA 4U8OA 4U2LA 3REDA 3VRBA 4AT2A 4K2XA 4U2TA 4YSYA 2WDVA 1LJ1A 1ZP0A 4NTCA 1JU2A 4N9XA 1TDKA 1CBOA 3UKHA 1BWCA 2JB2A 3IWAA 3LADA 3AECA 4H4PA 3DMEA 3NN0X 4FK1C 1KFYA 3RHAA 2FJEA 2CVJA 2WPFA 3PO7A 1GESA 2XVJA 1IUXA 3P9UA 4EIQA 3OZ2A 4TM3A 5JCKA 2C72A 4AOSA 2YWLA 2YLTA 5HXIA 4PAAA 4APNA 2YLSA 4ZCCA 3NT6A 1Y56A 2ZBWA 1H6VA 5EOWA 4CCRA 3CGEA 2JB1A 1B8SA 4B68A 4REKA 4C77A 2GR1A 3CIRA 3D8XA 5EB4A 2YG4A 2C75A 1F3PA 1NHPA 2YM1A 4DNAA 3DK9A 1ZKQA 2JKCA 3NYCA 3CGDA 2R0PA 2QA2A 3DJDA 2C67A 1TRBA 3ITJA 1TDOA 1E39A 2X50A 3H8IA 2XLPA 3CNTA 3AE2A 4IA5A 3FG2P 2ARDA 1K0LA 3NYEA 1NHQA 4OPDA 1N1PA 4YKGA 1IUTA 1GRHA 4U8IA 1Q1WA 4H4RA 4GRTA 3ALLA 3CTYA 2EQ9A 2B9XA 3ISHA 3CPJG 3B6DA 2GF3A 1LVLA 1DODA 4DSHA 1F8SA 2XVEA 1GT8A 1PBCA 2APGA 4YKFA 3UP4A 1LQTA 4X9NA 1EL5A 1JRXA 2WDQA 3AEBA 3SQPA 2X99A 4BURA 2C73A 2FJDA 1CC6A 2WEUA 1KNRA 2WS3A 4YT0A 2YM2A 1OJDA 4H2NA 2HQMA 4LA1A 3AE5A 4H4SA 1IUSA 4EIPA 1KNPA 2NPXA 4YWOA 1LTXR 3Q9TA 1JNZA 2AQJA 2BXRA 3LZWA 1OJ9A 4DGKA 5KVHA 5IPYA 2BK4A 4EM3A 3PS9A 2C3CA 2C65A 3QSMA 1YY5A 3NHOX 1PBDA 2BA9A 2XLRA 1N4WA 1CJ3A 3F8DA 4WX1A 4C74A 1D7YA 4X9MA 2B9YA 1EL8A 4Y4MA 4XWRA 4DSGA 4I58A 2WP9A 3KD9A 1GTHA 3QFAA 4TM1A 5FMHA 1CC2A 3UP5A 1GV4A 1Z6LA 4B1BA 2ACZA 3GMCA 3EF6A 5EBKA 4H4ZA 1BKWA 4BV6A 1CJ4A 4A65A 3SGLA 1GALA 3AD9B 4H4WA 5TR3A 2VVMA 3ZDNA 3AEDA 3IHMA 4Z43A 2FJBA 3K7MX 3RP7A 1OJCA 2C66A 1NHSA 4A79A 1GPEA 1O94A 5EB5A 1W4XA 3BNMA 3GRSA 3AEFA 3LJPA 3QSSA 4H4QA 3S5WA 3RNMA 1UKVG 2BC0A 1MXTA 2QCUA 1LV0A 1LPFA 3GDNA 2CFYA 4CRTA 4H2PA 4H50A 4KPRA 1GRFA 4KX6A 3GYIA 2X8CA 2E4GA 1GTEA 4CCQA 2QAEA 1H7XA 4D04A 4Z2TA 1DXLA 2H89A 2WDRA 3VR8A 1BF3A 4E0VA 5C3JA 2GV8A 3L1RA 3NRNA 3OC4A 2WHDA 3V3NA 3AYIA 3NTAA 2E1MA 2ZZ0A 3DH9A 3CGCA 4H4VA 1M6IA 4J56A 5JCIA 1D4CA 1NPXA 3P4QA 1XHCA 4TLXA 4K5SA 1Q1RA 1GREA 3LZXA 3C4NA 1P2EA 2PYXA 1KDGA 3URHA 2XCGA 2GH5A 2YG6A 4B66A 2V3AA 3NLCA 2UZZA 3FPZA 4NZHA 1D4DA 2V6OA 3DK4A 2BC1A 3EANA 1P2HA 2Q0KA 4NTEA 3VR9A 5HY5A 4C5OA 4P9SA 1JNRA 2A89A 4TM0A 3VRAA 1L0VA 1S2QA 2BXSA 1AOGA 3I3LA 2ZZBA 4ECHA 2BK3A 2EQ7A 4EMIA 4ADWA 3QVPA 1VG9A 2J3NA 3CGBA 1E1KA 1VG0A 2C76A 2NVKX 5FS7A 4YSXA 4RSLA 1VDCA 3DJGX 4YTPA 4IA6A 4J33A 1EBDA 3C4AA 4Y4NA 3M13A 3GMBA 1K0IA 1NG3A 3IF9A 4Z24A 2C7GA 3KLJA 5KOWA 2BK5A 1Q9IA 4H4TA 3UOYA 3BI4A 1NDAA 2R4EA 3AD7B 2BS2A 2WESA 1JEHA 3K7QX 1GNDA 1H82A 2XYOA 1DOEA 4EM4A 1HYUA 5CQFA 2F5ZA 2VOUA 3IHGA 3CNDA 4K8DA 2XFNA 2EQ8A 3K7TA 5BULA 1TDFA 4OPUA 2AR8A 1ZMCA 1E1LA 5FS9A 1COYA 4H7UA 4OVIA 3VQRA 5GRTA 2R0GA 3NIXA 5HYMA 1F8WA 4GCMA 2IIDA 2WQYA 4JY2A 1PDHA 4RG3A 4MJWA 3CPIG 1NHRA 1LQUA 3NTDA 4CNJA 2V5ZA 1H7WA 2A87A 4LU6A 1CL0A 1MO9A 2BACA 1FL2A 2C70A 4Z44A 2XFQA 3QJ4A 2Y6RA 1CJCA 2GAHB 4O5UA 2I0ZA 2YR6A 3GD4A 1ONFA 2JAEA 1FEAA 3F8PA 2YG3A 5U63A 3R9UA 2GB0A 1E1NA 1ZOVA 3O0HA 4FK1A 3NYFA 3COXA 2YVGA 3FIMB 4UDQA 3P4RA 1Y56B 1N4UA 3JSKA 1GOSA 2DKHA 3ALMA 2AAQA 1V59A 3UTHA 2RGOA 1GRGA 3KKJA 1L9DA 1ZMDA 3DK8A 3QVRA 4U2SA 4EQRA 1S3BA 1H81A 2GQFA 1IUVA 1PXBA 1CHUA 2YLXA 2Z5YA 1TYPA 3H4KA 2C3DA 1PS9A 3UOVA 3ADAB 3G5SA 3P4SA 3NH3X 2VRMA 4C3YA 4B69A 4USQA 1YQ3A 4Z26A 4A9WA 1ZX9A 3UTEA 5FS8A 4UDPA 3AE9A 3GD3A 3ICSA 1X31B 3AWIA 1D5TA 2GR0A 5LV9A 4U8MA 3P1WA 4A7AA 2VVLG 2XFOA 4HB9A 3UKPA 2IVEA 3AD8B 3QSEA 5KVIA 4JQ9A 2E5VA 4RG4A 2C64A 3C96A 3S61A 1GETA 5L46A 1DOCA 1F6MA 5IQ1A 1N4VA 2XFUA 1MOKA 3SFDA 1DJQA 4UP3A 4J36A 3FMWA 4EQWA 5KWFA 2GR2A 1YKJA 1B4VA 1BGJA 2WOIA 3UTGA 3GSIA 4YXDA 1D4EA 3QFBA 4YTMA 3G5RA 5BUKA 2JK6A 4EQSA 2WPCA 1E6EA 2WPEA 4U8PA 4BJZA 1H86A 1H83A 4K22A 2WOWA 3UKLA 2JB3A 4UDRA 3ICTA 3NN6X 1E1MA 1JOAA 2XLSA 4J31A 3CPHG 1GXFA 1DOBA 4H4XA 2BCGG 1E7PA 4U8LA 3NK2X 2CDUA 5JCMA 1GRAA 3LXDA 4B63A 4M52A 2YLWA 4Y4LA 2YR5A 2DKIA 5KOXA 2Z5XA 4LIIA 4O5QA 3CNSA 5J60A 1D7LA 3HZLA 1DJNA 2FBWA 3L8KA 4NEVA 1PHHA 4GDPA 4H4UA 1GRBA 2FJAA 2OLNA 3M12A 4IVOB 2O9ZA 2Q7VA 1GERA 2V3BA 2WBAA 4I59A 2GMHA 3KU9A 1OJTA 1TDNA 2XFPA 3F8RA 4PABA 4EMWA 2BABA 2GMJA 2R4JA 1RSGA 3K30A 1BZLA 3PVCA 4HA6A 4A6NB 1YQ4A 2XVFA 2GR3A 4XXGA 1PXAA 4D03A 1GEUA 1NENA 3P4PA 2YG5A 2PHHA 4U8KA 4USRA 4CBQA 2YVJA 4GUVA 3CN8A 3RP8A 3ABVA 4BK2A 3EAOA 1JRYA 1XDIA 3AE1A 1NG4A 2WETA 3UKFA 2XLTA 1NAAA 1PJ6A 3KPFA 4B65A 3AEEA 4OPIA 1QLBA 1FCDA 1FOHA 1IJHA 3AYLA 2YLZA 2XLUA 4ZCDA 5M0ZA 1B37A 2ZZCA 4FDCB 1S3EA 2YLRA 2V61A 2A8XA 4IV9A 1OJAA 2RGHA 2X8GA 1PXCA 4H2QA 4TM4A 4YTNA 5IQ4A 4Z25A 3CNJA 1TYTA 3BNUA 2YG7A 1PBEA 1KSSA 1CC4A 1K4QA 3D1CA 4K5RA 4AP1A 3LOVA 2R45A 4OPTA 4NTDA 3VRDB 4X4JA 3UOZA 4EMJA 4BK1A 2W0HA 3CNPA 2B76A 3Q6JA 4B67A 5JCNA 4A5LA 3NGCX 3AXBA 4YSHA 2OA1A 4BJYA 5KXJA 1VQWA 3AEGA 2JBVA 2VVLA 4H2RA 5M10A 2BCPA 1QJDA 3NK0X 4XWZA 1CJ2A 2VZ2A 3AB1A 3G5QA 2VRLA 1L9CA 2XVHA 5U1OA 2YQUA 4GR1A 3T37A 5KRQA 4WCTA 4JDRA 2OLOA 4C3XA 4JY3A 3I6DA 1EL7A 5FS6A 4EQXA 2X3NA 1EL9A 2EQ6A 3NK1X 1ZY8A 4OPGA 1DNCA 4K7ZA 5U25A 3UKQA 1KF6A 5HHFA 1PJ5A 3DGHA 1PJ7A 1FEBA 2YR4A 2B7SA 3FBSA 1GSNA 2GQWA 2B7RA 2RGJA 1XANA 4JNQA 2CULA 1NEKA 3EPTA 4AOXA 2TPRA 3LB8A 3V76A 1S2YA 3RP6A 4CY6A 4CY8A 3DGZA 1RP0A 2TMDA 1PBFA 1K0JA 2XDOA 4NEWA 2V60A
chains in the Genus database with same CATH superfamily
3ALJA 1REOA 1FECA 1M64A 3UOXA 1ZDLA 2OALA 3II4A 2GEWA 3GRTA 3B3RA 2R0CA 3NG7X 5JCLA 1SEZA 1JRZA 2BRYA 2GVCA 2X8HA 5C2TA 4Z2RA 1YQZA 2Q0LA 1ZOYA 4GF7A 4OPLA 3SM8A 2BYBA 3KVEA 4U8NA 1CF3A 2BS4A 3ATRA 1Y0PA 3DJEA 3GDPA 3DJJA 3GYJA 3GYXA 2OAMA 3NKSA 3DA1A 3SFEA 5BVAA 1IUWA 4ZN0A 3BI5A 3UCLA 4OPCA 4J34A 5ER0A 2VQ7A 2XVIA 3AE4A 3E1TA 3AE6A 3GWFA 3KA7A 4JNAA 3AEAA 5DBJA 1RYIA 4J2WA 1QO8A 1ELIA 4FX9A 4IVMB 4ICYA 4TLZA 2BS3A 2Y6QA 3BI2A 4JN9A 5CKUA 4A6NA 1TDEA 4A99A 2WU5A 4OCGA 3V3OA 1BGNA 2R46A 5BRTA 3UKKA 4AP3A 1PN0A 1F8RA 1IUUA 3AE8A 2H88A 3ATQA 4CNKA 3AE7A 2QA1A 3M0OA 1KSUA 3WE0A 2B9WA 2IVDA 4J57A 1ZK7A 2Q6UA 3AYJA 3IC9A 4NNJA 4YSZA 2WOVA 2WP6A 4Z2UA 1B5QA 1PBBA 3NNEA 4U8JA 4AT0A 2WU2A 3UKAA 1VRQB 1O95A 4H4YA 3BHKA 2GRTA 2RABA 5J7XA 4B64A 2WP5A 2GAGB 3GWDA 2YAUA 1O5WA 1H84A 1L9EA 2YVFA 3BHFA 2R9ZA 5GSNA 3ZYXA 2VQBA 3AE3A 1XPQA 3ICRA 4BK3A 4GDEA 3UTFA 3H8LA 1GRTA 4U8OA 4U2LA 3REDA 3VRBA 4AT2A 4K2XA 4U2TA 4YSYA 2WDVA 1LJ1A 1ZP0A 4NTCA 1JU2A 4N9XA 1TDKA 1CBOA 3UKHA 1BWCA 2JB2A 3IWAA 3LADA 3AECA 4H4PA 3DMEA 3NN0X 4FK1C 1KFYA 3RHAA 2FJEA 2CVJA 2WPFA 3PO7A 1GESA 2XVJA 4G74A 1IUXA 3P9UA 4EIQA 3OZ2A 4TM3A 5JCKA 2C72A 4AOSA 2YWLA 2YLTA 5HXIA 4PAAA 4APNA 2YLSA 4ZCCA 3NT6A 1Y56A 2ZBWA 1H6VA 4GAVA 4II3A 5EOWA 3CGEA 4CCRA 2JB1A 1B8SA 4B68A 4REKA 4C77A 2GR1A 3CIRA 3D8XA 5EB4A 2YG4A 2C75A 1F3PA 1NHPA 2YM1A 4DNAA 3DK9A 1ZKQA 2JKCA 3KPKA 4G73A 3NYCA 3CGDA 2R0PA 3T2ZA 2QA2A 3T14A 3DJDA 2C67A 1TRBA 3ITJA 1TDOA 1E39A 2X50A 3H8IA 2XLPA 3CNTA 3AE2A 4IA5A 3FG2P 2ARDA 1K0LA 3NYEA 1NHQA 4OPDA 1N1PA 4YKGA 1IUTA 1GRHA 4U8IA 1Q1WA 4H4RA 4GRTA 3ALLA 3CTYA 2EQ9A 5KMRA 2B9XA 3ISHA 4G6GA 3CPJG 3B6DA 3SX6A 2GF3A 1LVLA 1DODA 4DSHA 1F8SA 2XVEA 1GT8A 1PBCA 2APGA 4YKFA 3UP4A 1LQTA 4X9NA 1EL5A 1JRXA 2WDQA 3AEBA 3SQPA 2X99A 4BURA 2C73A 2FJDA 1CC6A 2WEUA 1KNRA 2WS3A 4G9KA 4YT0A 2YM2A 1OJDA 4H2NA 2HQMA 4LA1A 3SZFA 3AE5A 4H4SA 1IUSA 4EIPA 1KNPA 5KMPA 2NPXA 4YWOA 1LTXR 3Q9TA 1JNZA 2AQJA 2BXRA 3LZWA 1OJ9A 4DGKA 5KVHA 5IPYA 2BK4A 4EM3A 3PS9A 2C3CA 2C65A 2C4CA 3QSMA 1YY5A 3NHOX 1PBDA 2BA9A 2XLRA 1N4WA 1CJ3A 3F8DA 4WX1A 4C74A 1D7YA 4X9MA 2B9YA 1EL8A 4Y4MA 4XWRA 4DSGA 4I58A 2WP9A 3KD9A 1GTHA 3QFAA 4TM1A 5FMHA 1CC2A 3UP5A 1GV4A 1Z6LA 4B1BA 2ACZA 3GMCA 3EF6A 5EBKA 4H4ZA 1BKWA 4BV6A 1CJ4A 4A65A 3CMMA 3SGLA 1GALA 3AD9B 4H4WA 5TR3A 2VVMA 3ZDNA 3AEDA 3IHMA 4Z43A 2FJBA 3K7MX 3RP7A 1OJCA 2C66A 1NHSA 4A79A 1GPEA 1O94A 5EB5A 1W4XA 3BNMA 3GRSA 3AEFA 3LJPA 3QSSA 4H4QA 3S5WA 3RNMA 1UKVG 2BC0A 1MXTA 2QCUA 1LV0A 1LPFA 3GDNA 2CFYA 4CRTA 4H2PA 4H50A 4KPRA 1GRFA 4KX6A 3GYIA 2X8CA 2E4GA 1GTEA 4CCQA 2QAEA 1H7XA 3T2YA 4D04A 4GAPA 4Z2TA 1DXLA 2H89A 2WDRA 3VR8A 1BF3A 4E0VA 5C3JA 2GV8A 3L1RA 3NRNA 3OC4A 2WHDA 3V3NA 3AYIA 3NTAA 2E1MA 2ZZ0A 3DH9A 3CGCA 4H4VA 1M6IA 4J56A 5JCIA 1D4CA 1NPXA 3P4QA 1XHCA 4TLXA 4K5SA 1Q1RA 1GREA 3LZXA 3C4NA 1P2EA 2PYXA 1KDGA 3URHA 2XCGA 2GH5A 2YG6A 4B66A 2V3AA 3NLCA 2UZZA 3FPZA 4NZHA 1D4DA 2V6OA 3HYXA 3DK4A 2BC1A 3EANA 1P2HA 2Q0KA 4NTEA 3VR9A 5HY5A 4C5OA 4P9SA 1JNRA 2A89A 4TM0A 3VRAA 1L0VA 1S2QA 2BXSA 1AOGA 3I3LA 2ZZBA 4ECHA 2BK3A 2EQ7A 4EMIA 4ADWA 3QVPA 1VG9A 2J3NA 3CGBA 1E1KA 1VG0A 2C76A 2NVKX 5FS7A 3SY4A 4YSXA 4RSLA 1VDCA 3DJGX 4YTPA 4IA6A 4J33A 1EBDA 3C4AA 4Y4NA 3M13A 3GMBA 1K0IA 1NG3A 3IF9A 4Z24A 2C7GA 3KLJA 5KOWA 2BK5A 1Q9IA 4H4TA 3UOYA 3BI4A 1NDAA 2R4EA 3AD7B 3SYIA 2BS2A 2WESA 1JEHA 3K7QX 1GNDA 1H82A 2XYOA 1DOEA 4EM4A 1HYUA 5CQFA 2F5ZA 2VOUA 3IHGA 3CNDA 4K8DA 2XFNA 2EQ8A 3K7TA 5BULA 1TDFA 4OPUA 2AR8A 1ZMCA 4II2A 1E1LA 5FS9A 1COYA 4H7UA 4OVIA 3VQRA 5GRTA 2R0GA 3NIXA 5HYMA 1F8WA 4GCMA 2IIDA 2WQYA 4JY2A 1PDHA 4RG3A 4MJWA 3CPIG 1NHRA 1LQUA 3NTDA 4CNJA 2V5ZA 1H7WA 2A87A 4LU6A 1CL0A 2BACA 1MO9A 1FL2A 2C70A 4Z44A 2XFQA 3QJ4A 2Y6RA 1CJCA 2GAHB 4O5UA 2I0ZA 2YR6A 3GD4A 1ONFA 2JAEA 1FEAA 3F8PA 2YG3A 5U63A 3R9UA 2GB0A 1E1NA 1ZOVA 3O0HA 4FK1A 3NYFA 3COXA 2YVGA 3FIMB 4UDQA 3P4RA 1Y56B 1N4UA 3JSKA 1GOSA 2DKHA 3ALMA 2AAQA 1V59A 3T2KA 2RGOA 3UTHA 1GRGA 3KKJA 1L9DA 1ZMDA 3HYVA 3DK8A 3QVRA 4U2SA 4EQRA 1S3BA 3SZ0A 1H81A 2GQFA 1IUVA 1PXBA 1CHUA 2YLXA 2Z5YA 1TYPA 3H4KA 4G6HA 2C3DA 1PS9A 3UOVA 3ADAB 3G5SA 3P4SA 3NH3X 2VRMA 4C3YA 4B69A 4USQA 1YQ3A 4Z26A 4A9WA 1ZX9A 3UTEA 5FS8A 4UDPA 3AE9A 3GD3A 3ICSA 1X31B 3AWIA 1D5TA 2GR0A 5LV9A 4U8MA 3P1WA 4A7AA 2VVLG 2XFOA 4HB9A 3UKPA 2IVEA 3AD8B 3QSEA 5KVIA 4JQ9A 2E5VA 4RG4A 2C64A 3C96A 3S61A 1GETA 5KMSA 5L46A 1DOCA 1F6MA 5IQ1A 1N4VA 2XFUA 1MOKA 3SFDA 1DJQA 4UP3A 4J36A 3FMWA 4EQWA 5KWFA 2GR2A 1YKJA 1B4VA 1BGJA 2WOIA 3UTGA 3GSIA 4YXDA 1D4EA 3QFBA 4YTMA 3G5RA 5BUKA 2JK6A 4EQSA 2WPCA 1E6EA 2WPEA 4U8PA 4BJZA 1H86A 1H83A 4K22A 2WOWA 3UKLA 2JB3A 4UDRA 3ICTA 3NN6X 1E1MA 1JOAA 2XLSA 4J31A 3CPHG 1GXFA 1DOBA 4H4XA 2BCGG 1E7PA 2BRAA 4U8LA 3NK2X 2CDUA 5JCMA 1GRAA 5KMQA 3LXDA 4B63A 4M52A 2YLWA 4Y4LA 2YR5A 2DKIA 5KOXA 2Z5XA 4LIIA 4O5QA 3CNSA 5J60A 1D7LA 3HZLA 3SZCA 1DJNA 2FBWA 3L8KA 4NEVA 1PHHA 4GDPA 4H4UA 1GRBA 2FJAA 2OLNA 3M12A 4IVOB 2O9ZA 2Q7VA 1GERA 2V3BA 2WBAA 4I59A 2GMHA 3KU9A 1OJTA 3T31A 1TDNA 2XFPA 3F8RA 4PABA 4EMWA 2BABA 2GMJA 2R4JA 1RSGA 3K30A 1BZLA 3PVCA 4HA6A 4A6NB 1YQ4A 2XVFA 2GR3A 4NWZA 1PXAA 4XXGA 4D03A 5KNLA 1GEUA 1NENA 3P4PA 2YG5A 2PHHA 4U8KA 4USRA 4CBQA 2YVJA 4GUVA 3CN8A 3RP8A 3ABVA 4BK2A 3EAOA 1JRYA 1XDIA 3AE1A 1NG4A 2WETA 3UKFA 2XLTA 1NAAA 1PJ6A 3KPFA 4B65A 3AEEA 4OPIA 1QLBA 1FCDA 1FOHA 1IJHA 3AYLA 2YLZA 2XLUA 4ZCDA 5M0ZA 1B37A 2ZZCA 4FDCB 1S3EA 2YLRA 2V61A 2A8XA 4IV9A 1OJAA 2RGHA 2X8GA 1PXCA 4H2QA 4TM4A 4YTNA 5IQ4A 4Z25A 3CNJA 1TYTA 3BNUA 2YG7A 1PBEA 1KSSA 1CC4A 1K4QA 3D1CA 4K5RA 4AP1A 3LOVA 2R45A 4OPTA 4NTDA 3VRDB 4X4JA 3UOZA 4EMJA 4BK1A 2W0HA 3CNPA 2B76A 3Q6JA 4B67A 5JCNA 4A5LA 3NGCX 3T0KA 3AXBA 4YSHA 2OA1A 4BJYA 5KXJA 1VQWA 3AEGA 2JBVA 2VVLA 4H2RA 5M10A 2BCPA 1QJDA 3NK0X 4XWZA 1CJ2A 2VZ2A 3AB1A 3G5QA 2VRLA 1L9CA 2XVHA 5U1OA 2YQUA 4GR1A 3T37A 5KRQA 4WCTA 4JDRA 2OLOA 4C3XA 4JY3A 3I6DA 1EL7A 5FS6A 4EQXA 2X3NA 1EL9A 2EQ6A 3NK1X 1ZY8A 4OPGA 3SXIA 3SZWA 1DNCA 4K7ZA 5U25A 3UKQA 1KF6A 5HHFA 1PJ5A 3DGHA 1PJ7A 1FEBA 2YR4A 2B7SA 3FBSA 1GSNA 2GQWA 2B7RA 2RGJA 1XANA 4JNQA 2CULA 1NEKA 3EPTA 4AOXA 2TPRA 3LB8A 3V76A 1S2YA 3RP6A 4CY6A 4CY8A 3HYWA 3DGZA 1RP0A 2TMDA 1PBFA 1K0JA 2XDOA 4NEWA 2V60A
chains in the Genus database with same CATH topology
3ALJA 1REOA 1FECA 1M64A 3UOXA 1ZDLA 2OALA 3II4A 2GEWA 3GRTA 3B3RA 2R0CA 3NG7X 5JCLA 1SEZA 1JRZA 2BRYA 2GVCA 2X8HA 5C2TA 4Z2RA 1YQZA 2Q0LA 1ZOYA 4GF7A 4OPLA 3SM8A 2BYBA 3KVEA 4U8NA 1CF3A 2BS4A 3ATRA 1Y0PA 3DJEA 3GDPA 3DJJA 3GYJA 3GYXA 2OAMA 3NKSA 3DA1A 3SFEA 5BVAA 1IUWA 4ZN0A 3BI5A 3UCLA 4OPCA 4J34A 5ER0A 2VQ7A 2XVIA 3AE4A 3E1TA 3AE6A 3GWFA 3KA7A 4JNAA 3AEAA 5DBJA 1RYIA 4J2WA 1QO8A 1ELIA 4FX9A 4IVMB 4ICYA 4TLZA 2BS3A 2Y6QA 3BI2A 4JN9A 5CKUA 4A6NA 1TDEA 4A99A 2WU5A 4OCGA 3V3OA 1BGNA 2R46A 5BRTA 3UKKA 4AP3A 1PN0A 1F8RA 1IUUA 3AE8A 2H88A 3ATQA 4CNKA 3AE7A 2QA1A 3M0OA 1KSUA 3WE0A 2B9WA 2IVDA 4J57A 1ZK7A 2Q6UA 3AYJA 3IC9A 4NNJA 4YSZA 2WOVA 2WP6A 4Z2UA 1B5QA 1PBBA 3NNEA 4U8JA 4AT0A 2WU2A 3UKAA 1VRQB 1O95A 4H4YA 3BHKA 2GRTA 2RABA 5J7XA 4B64A 2WP5A 2GAGB 3GWDA 2YAUA 1O5WA 1H84A 1L9EA 2YVFA 3BHFA 2R9ZA 5GSNA 3ZYXA 2VQBA 3AE3A 1XPQA 3ICRA 4BK3A 4GDEA 3UTFA 3H8LA 1GRTA 4U8OA 4U2LA 3REDA 3VRBA 4AT2A 4K2XA 4U2TA 4YSYA 2WDVA 1LJ1A 1ZP0A 4NTCA 1JU2A 4N9XA 1TDKA 1CBOA 3UKHA 1BWCA 2JB2A 3IWAA 3LADA 3AECA 4H4PA 3DMEA 3NN0X 4FK1C 1KFYA 3RHAA 2FJEA 2CVJA 2WPFA 3PO7A 1GESA 2XVJA 4G74A 1IUXA 3P9UA 4EIQA 3OZ2A 4TM3A 5JCKA 2C72A 4AOSA 2YWLA 2YLTA 5HXIA 4PAAA 4APNA 2YLSA 4ZCCA 3NT6A 1Y56A 2ZBWA 1H6VA 4GAVA 4II3A 5EOWA 3CGEA 4CCRA 2JB1A 1B8SA 4B68A 4REKA 4C77A 2GR1A 3CIRA 3D8XA 5EB4A 2YG4A 2C75A 1F3PA 1NHPA 2YM1A 4DNAA 3DK9A 1ZKQA 2JKCA 3KPKA 4G73A 3NYCA 3CGDA 2R0PA 3T2ZA 2QA2A 3T14A 3DJDA 2C67A 1TRBA 3ITJA 1TDOA 1E39A 2X50A 3H8IA 2XLPA 3CNTA 3AE2A 4IA5A 3FG2P 2ARDA 1K0LA 3NYEA 1NHQA 4OPDA 1N1PA 4YKGA 1IUTA 1GRHA 4U8IA 1Q1WA 4H4RA 4GRTA 3ALLA 3CTYA 2EQ9A 5KMRA 2B9XA 3ISHA 4G6GA 3CPJG 3B6DA 3SX6A 2GF3A 1LVLA 1DODA 4DSHA 1F8SA 2XVEA 1GT8A 1PBCA 2APGA 4YKFA 3UP4A 1LQTA 4X9NA 1EL5A 1JRXA 2WDQA 3AEBA 3SQPA 2X99A 4BURA 2C73A 2FJDA 1CC6A 2WEUA 1KNRA 2WS3A 4G9KA 4YT0A 2YM2A 1OJDA 4H2NA 2HQMA 4LA1A 3SZFA 3AE5A 4H4SA 1IUSA 4EIPA 1KNPA 5KMPA 2NPXA 4YWOA 1LTXR 3Q9TA 1JNZA 2AQJA 2BXRA 3LZWA 1OJ9A 4DGKA 5KVHA 5IPYA 2BK4A 4EM3A 3PS9A 2C3CA 2C65A 2C4CA 3QSMA 1YY5A 3NHOX 1PBDA 2BA9A 2XLRA 1N4WA 1CJ3A 3F8DA 4WX1A 4C74A 1D7YA 4X9MA 2B9YA 1EL8A 4Y4MA 4XWRA 4DSGA 4I58A 2WP9A 3KD9A 1GTHA 3QFAA 4TM1A 5FMHA 1CC2A 3UP5A 1GV4A 1Z6LA 4B1BA 2ACZA 3GMCA 3EF6A 5EBKA 4H4ZA 1BKWA 4BV6A 1CJ4A 4A65A 3CMMA 3SGLA 1GALA 3AD9B 4H4WA 5TR3A 2VVMA 3ZDNA 3AEDA 3IHMA 4Z43A 2FJBA 3K7MX 3RP7A 1OJCA 2C66A 1NHSA 4A79A 1GPEA 1O94A 5EB5A 1W4XA 3BNMA 3GRSA 3AEFA 3LJPA 3QSSA 4H4QA 3S5WA 3RNMA 1UKVG 2BC0A 1MXTA 2QCUA 1LV0A 1LPFA 3GDNA 2CFYA 4CRTA 4H2PA 4H50A 4KPRA 1GRFA 4KX6A 3GYIA 2X8CA 2E4GA 1GTEA 4CCQA 2QAEA 1H7XA 3T2YA 4D04A 4GAPA 4Z2TA 1DXLA 2H89A 2WDRA 3VR8A 1BF3A 4E0VA 5C3JA 2GV8A 3L1RA 3NRNA 3OC4A 2WHDA 3V3NA 3AYIA 3NTAA 2E1MA 2ZZ0A 3DH9A 3CGCA 4H4VA 1M6IA 4J56A 5JCIA 1D4CA 1NPXA 3P4QA 1XHCA 4TLXA 4K5SA 1Q1RA 1GREA 3LZXA 3C4NA 1P2EA 2PYXA 1KDGA 3URHA 2XCGA 2GH5A 2YG6A 4B66A 2V3AA 3NLCA 2UZZA 3FPZA 4NZHA 1D4DA 2V6OA 3HYXA 3DK4A 2BC1A 3EANA 1P2HA 2Q0KA 4NTEA 3VR9A 5HY5A 4C5OA 4P9SA 1JNRA 2A89A 4TM0A 3VRAA 1L0VA 1S2QA 2BXSA 1AOGA 3I3LA 2ZZBA 4ECHA 2BK3A 2EQ7A 4EMIA 4ADWA 3QVPA 1VG9A 2J3NA 3CGBA 1E1KA 1VG0A 2C76A 2NVKX 5FS7A 3SY4A 4YSXA 4RSLA 1VDCA 3DJGX 4YTPA 4IA6A 4J33A 1EBDA 3C4AA 4Y4NA 3M13A 3GMBA 1K0IA 1NG3A 3IF9A 4Z24A 2C7GA 3KLJA 5KOWA 2BK5A 1Q9IA 4H4TA 3UOYA 3BI4A 1NDAA 2R4EA 3AD7B 3SYIA 2BS2A 2WESA 1JEHA 3K7QX 1GNDA 1H82A 2XYOA 1DOEA 4EM4A 1HYUA 5CQFA 2F5ZA 2VOUA 3IHGA 3CNDA 4K8DA 2XFNA 2EQ8A 3K7TA 5BULA 1TDFA 4OPUA 2AR8A 1ZMCA 4II2A 1E1LA 5FS9A 1COYA 4H7UA 4OVIA 3VQRA 5GRTA 2R0GA 3NIXA 5HYMA 1F8WA 4GCMA 2IIDA 2WQYA 4JY2A 1PDHA 4RG3A 4MJWA 3CPIG 1NHRA 1LQUA 3NTDA 4CNJA 2V5ZA 1H7WA 2A87A 4LU6A 1CL0A 1MO9A 2BACA 1FL2A 2C70A 4Z44A 2XFQA 3QJ4A 2Y6RA 1CJCA 2GAHB 4O5UA 2I0ZA 2YR6A 3GD4A 1ONFA 2JAEA 1FEAA 3F8PA 2YG3A 5U63A 3R9UA 2GB0A 1E1NA 1ZOVA 3O0HA 4FK1A 3NYFA 3COXA 2YVGA 3FIMB 4UDQA 3P4RA 1Y56B 1N4UA 3JSKA 1GOSA 2DKHA 3ALMA 2AAQA 1V59A 3T2KA 2RGOA 3UTHA 1GRGA 3KKJA 1L9DA 1ZMDA 3HYVA 3DK8A 3QVRA 4U2SA 4EQRA 1S3BA 3SZ0A 1H81A 2GQFA 1IUVA 1PXBA 1CHUA 2YLXA 2Z5YA 1TYPA 3H4KA 4G6HA 2C3DA 1PS9A 3UOVA 3ADAB 3G5SA 3P4SA 3NH3X 2VRMA 4C3YA 4B69A 4USQA 1YQ3A 4Z26A 4A9WA 1ZX9A 3UTEA 5FS8A 4UDPA 3AE9A 3GD3A 3ICSA 1X31B 3AWIA 1D5TA 2GR0A 5LV9A 4U8MA 3P1WA 4A7AA 2VVLG 2XFOA 4HB9A 3UKPA 2IVEA 3AD8B 3QSEA 5KVIA 4JQ9A 2E5VA 4RG4A 2C64A 3C96A 3S61A 1GETA 5KMSA 5L46A 1DOCA 1F6MA 5IQ1A 1N4VA 2XFUA 1MOKA 3SFDA 1DJQA 4UP3A 4J36A 3FMWA 4EQWA 5KWFA 2GR2A 1YKJA 1B4VA 1BGJA 2WOIA 3UTGA 3GSIA 4YXDA 1D4EA 3QFBA 4YTMA 3G5RA 5BUKA 2JK6A 4EQSA 2WPCA 1E6EA 2WPEA 4U8PA 4BJZA 1H86A 1H83A 4K22A 2WOWA 3UKLA 2JB3A 4UDRA 3ICTA 3NN6X 1E1MA 1JOAA 2XLSA 4J31A 3CPHG 1GXFA 1DOBA 4H4XA 2BCGG 1E7PA 2BRAA 4U8LA 3NK2X 2CDUA 5JCMA 1GRAA 5KMQA 3LXDA 4B63A 4M52A 2YLWA 4Y4LA 2YR5A 2DKIA 5KOXA 2Z5XA 4LIIA 4O5QA 3CNSA 5J60A 1D7LA 3HZLA 3SZCA 1DJNA 2FBWA 3L8KA 4NEVA 1PHHA 4GDPA 4H4UA 1GRBA 2FJAA 2OLNA 3M12A 4IVOB 2O9ZA 2Q7VA 1GERA 2V3BA 2WBAA 4I59A 2GMHA 3KU9A 1OJTA 3T31A 1TDNA 2XFPA 3F8RA 4PABA 4EMWA 2BABA 2GMJA 2R4JA 1RSGA 3K30A 1BZLA 3PVCA 4HA6A 4A6NB 1YQ4A 2XVFA 2GR3A 4NWZA 1PXAA 4XXGA 4D03A 5KNLA 1GEUA 1NENA 3P4PA 2YG5A 2PHHA 4U8KA 4USRA 4CBQA 2YVJA 4GUVA 3CN8A 3RP8A 3ABVA 4BK2A 3EAOA 1JRYA 1XDIA 3AE1A 1NG4A 2WETA 3UKFA 2XLTA 1NAAA 1PJ6A 3KPFA 4B65A 3AEEA 4OPIA 1QLBA 1FCDA 1FOHA 1IJHA 3AYLA 2YLZA 2XLUA 4ZCDA 5M0ZA 1B37A 2ZZCA 4FDCB 1S3EA 2YLRA 2V61A 2A8XA 4IV9A 1OJAA 2RGHA 2X8GA 1PXCA 4H2QA 4TM4A 4YTNA 5IQ4A 4Z25A 3CNJA 1TYTA 3BNUA 2YG7A 1PBEA 1KSSA 1CC4A 1K4QA 3D1CA 4K5RA 4AP1A 3LOVA 2R45A 4OPTA 4NTDA 3VRDB 4X4JA 3UOZA 4EMJA 4BK1A 2W0HA 3CNPA 2B76A 3Q6JA 4B67A 5JCNA 4A5LA 3NGCX 3T0KA 3AXBA 4YSHA 2OA1A 4BJYA 5KXJA 1VQWA 3AEGA 2JBVA 2VVLA 4H2RA 5M10A 2BCPA 1QJDA 3NK0X 4XWZA 1CJ2A 2VZ2A 3AB1A 3G5QA 2VRLA 1L9CA 2XVHA 5U1OA 2YQUA 4GR1A 3T37A 5KRQA 4WCTA 4JDRA 2OLOA 4C3XA 4JY3A 3I6DA 1EL7A 5FS6A 4EQXA 2X3NA 1EL9A 2EQ6A 3NK1X 1ZY8A 4OPGA 3SXIA 3SZWA 1DNCA 4K7ZA 5U25A 3UKQA 1KF6A 5HHFA 1PJ5A 3DGHA 1PJ7A 1FEBA 2YR4A 2B7SA 3FBSA 1GSNA 2GQWA 2B7RA 2RGJA 1XANA 4JNQA 2CULA 1NEKA 3EPTA 4AOXA 2TPRA 3LB8A 3V76A 1S2YA 3RP6A 4CY6A 4CY8A 3HYWA 3DGZA 1RP0A 2TMDA 1PBFA 1K0JA 2XDOA 4NEWA 2V60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALJ A;  1REO A;  1FEC A;  1M64 A;  3UOX A;  1ZDL A;  2OAL A;  3II4 A;  2GEW A;  3GRT A;  3B3R A;  2R0C A;  3NG7 X;  5JCL A;  1SEZ A;  1JRZ A;  2GVC A;  2X8H A;  5C2T A;  4Z2R A;  1YQZ A;  2Q0L A;  1ZOY A;  4GF7 A;  4OPL A;  3SM8 A;  2BYB A;  3KVE A;  4U8N A;  1CF3 A;  2BS4 A;  3ATR A;  1Y0P A;  3DJE A;  3GDP A;  3DJJ A;  3GYJ A;  3NKS A;  2OAM A;  3SFE A;  3DA1 A;  5BVA A;  1IUW A;  4ZN0 A;  3BI5 A;  3UCL A;  4OPC A;  4J34 A;  5ER0 A;  2VQ7 A;  2XVI A;  3AE4 A;  3E1T A;  3AE6 A;  3GWF A;  3KA7 A;  4JNA A;  3AEA A;  5DBJ A;  1RYI A;  4J2W A;  1QO8 A;  1ELI A;  4FX9 A;  4IVM B;  4ICY A;  4TLZ A;  2BS3 A;  2Y6Q A;  3BI2 A;  4JN9 A;  5CKU A;  4A6N A;  1TDE A;  4A99 A;  2WU5 A;  4OCG A;  3V3O A;  1BGN A;  2R46 A;  5BRT A;  3UKK A;  4AP3 A;  1PN0 A;  1F8R A;  1IUU A;  3AE8 A;  2H88 A;  3ATQ A;  4CNK A;  3AE7 A;  2QA1 A;  3M0O A;  1KSU A;  3WE0 A;  2B9W A;  2IVD A;  4J57 A;  1ZK7 A;  2Q6U A;  3AYJ A;  3IC9 A;  4YSZ A;  2WOV A;  2WP6 A;  4Z2U A;  1B5Q A;  1PBB A;  3NNE A;  4U8J A;  4AT0 A;  2WU2 A;  3UKA A;  1VRQ B;  1O95 A;  4H4Y A;  3BHK A;  2GRT A;  2RAB A;  5J7X A;  4B64 A;  2WP5 A;  2GAG B;  3GWD A;  2YAU A;  1O5W A;  1H84 A;  1L9E A;  2YVF A;  3BHF A;  2R9Z A;  5GSN A;  3ZYX A;  2VQB A;  3AE3 A;  1XPQ A;  3ICR A;  4BK3 A;  4GDE A;  3UTF A;  3H8L A;  1GRT A;  4U8O A;  4U2L A;  3RED A;  3VRB A;  4AT2 A;  4K2X A;  4U2T A;  4YSY A;  2WDV A;  1LJ1 A;  1ZP0 A;  4NTC A;  1JU2 A;  4N9X A;  1TDK A;  1CBO A;  3UKH A;  1BWC A;  2JB2 A;  3IWA A;  3LAD A;  3AEC A;  4H4P A;  3DME A;  3NN0 X;  4FK1 C;  1KFY A;  3RHA A;  2FJE A;  2CVJ A;  2WPF A;  3PO7 A;  1GES A;  2XVJ A;  1IUX A;  3P9U A;  4EIQ A;  3OZ2 A;  4TM3 A;  5JCK A;  2C72 A;  4AOS A;  2YWL A;  2YLT A;  5HXI A;  4PAA A;  4APN A;  2YLS A;  4ZCC A;  3NT6 A;  1Y56 A;  2ZBW A;  1H6V A;  5EOW A;  4CCR A;  3CGE A;  2JB1 A;  1B8S A;  4B68 A;  4REK A;  4C77 A;  2GR1 A;  3CIR A;  3D8X A;  5EB4 A;  2YG4 A;  2C75 A;  1F3P A;  1NHP A;  2YM1 A;  4DNA A;  3DK9 A;  1ZKQ A;  2JKC A;  3NYC A;  3CGD A;  2R0P A;  2QA2 A;  3DJD A;  2C67 A;  1TRB A;  3ITJ A;  1TDO A;  1E39 A;  2X50 A;  3H8I A;  2XLP A;  3CNT A;  3AE2 A;  4IA5 A;  3FG2 P;  2ARD A;  1K0L A;  3NYE A;  1NHQ A;  4OPD A;  1N1P A;  4YKG A;  1IUT A;  1GRH A;  4U8I A;  1Q1W A;  4H4R A;  4GRT A;  3ALL A;  3CTY A;  2EQ9 A;  2B9X A;  3ISH A;  3CPJ G;  3B6D A;  2GF3 A;  1LVL A;  1DOD A;  4DSH A;  1F8S A;  2XVE A;  1GT8 A;  1PBC A;  2APG A;  4YKF A;  3UP4 A;  1LQT A;  4X9N A;  1EL5 A;  1JRX A;  2WDQ A;  3AEB A;  3SQP A;  2X99 A;  4BUR A;  2C73 A;  2FJD A;  1CC6 A;  2WEU A;  1KNR A;  2WS3 A;  4YT0 A;  2YM2 A;  1OJD A;  4H2N A;  2HQM A;  4LA1 A;  3AE5 A;  4H4S A;  1IUS A;  4EIP A;  1KNP A;  2NPX A;  4YWO A;  1LTX R;  3Q9T A;  1JNZ A;  2AQJ A;  2BXR A;  3LZW A;  1OJ9 A;  4DGK A;  5KVH A;  5IPY A;  2BK4 A;  4EM3 A;  3PS9 A;  2C3C A;  2C65 A;  3QSM A;  1YY5 A;  3NHO X;  1PBD A;  2BA9 A;  2XLR A;  1N4W A;  1CJ3 A;  3F8D A;  4WX1 A;  4C74 A;  1D7Y A;  4X9M A;  2B9Y A;  1EL8 A;  4Y4M A;  4XWR A;  4DSG A;  4I58 A;  2WP9 A;  3KD9 A;  1GTH A;  3QFA A;  4TM1 A;  5FMH A;  1CC2 A;  3UP5 A;  1GV4 A;  1Z6L A;  4B1B A;  2ACZ A;  3GMC A;  3EF6 A;  5EBK A;  4H4Z A;  1BKW A;  4BV6 A;  1CJ4 A;  4A65 A;  3SGL A;  1GAL A;  3AD9 B;  4H4W A;  5TR3 A;  2VVM A;  3ZDN A;  3AED A;  3IHM A;  4Z43 A;  2FJB A;  3K7M X;  3RP7 A;  1OJC A;  2C66 A;  1NHS A;  4A79 A;  1GPE A;  1O94 A;  5EB5 A;  1W4X A;  3BNM A;  3GRS A;  3AEF A;  3LJP A;  3QSS A;  4H4Q A;  3S5W A;  3RNM A;  1UKV G;  2BC0 A;  1MXT A;  2QCU A;  1LV0 A;  1LPF A;  3GDN A;  2CFY A;  4CRT A;  4H2P A;  4H50 A;  4KPR A;  1GRF A;  4KX6 A;  3GYI A;  2X8C A;  2E4G A;  1GTE A;  4CCQ A;  2QAE A;  1H7X A;  4D04 A;  4Z2T A;  1DXL A;  2H89 A;  2WDR A;  3VR8 A;  1BF3 A;  4E0V A;  5C3J A;  2GV8 A;  3L1R A;  3NRN A;  3OC4 A;  2WHD A;  3V3N A;  3AYI A;  3NTA A;  2E1M A;  2ZZ0 A;  3DH9 A;  3CGC A;  4H4V A;  1M6I A;  4J56 A;  5JCI A;  1D4C A;  1NPX A;  3P4Q A;  1XHC A;  4TLX A;  4K5S A;  1Q1R A;  1GRE A;  3LZX A;  3C4N A;  1P2E A;  2PYX A;  1KDG A;  3URH A;  2XCG A;  2GH5 A;  2YG6 A;  4B66 A;  2V3A A;  3NLC A;  2UZZ A;  3FPZ A;  4NZH A;  1D4D A;  2V6O A;  3DK4 A;  2BC1 A;  3EAN A;  1P2H A;  2Q0K A;  4NTE A;  3VR9 A;  5HY5 A;  4C5O A;  4P9S A;  1JNR A;  2A89 A;  4TM0 A;  3VRA A;  1L0V A;  1S2Q A;  2BXS A;  1AOG A;  3I3L A;  2ZZB A;  4ECH A;  2BK3 A;  2EQ7 A;  4EMI A;  4ADW A;  3QVP A;  1VG9 A;  2J3N A;  3CGB A;  1E1K A;  1VG0 A;  2C76 A;  2NVK X;  5FS7 A;  4YSX A;  4RSL A;  1VDC A;  3DJG X;  4YTP A;  4IA6 A;  4J33 A;  1EBD A;  3C4A A;  4Y4N A;  3M13 A;  3GMB A;  1K0I A;  1NG3 A;  3IF9 A;  4Z24 A;  2C7G A;  3KLJ A;  5KOW A;  2BK5 A;  1Q9I A;  4H4T A;  3UOY A;  3BI4 A;  1NDA A;  2R4E A;  3AD7 B;  2BS2 A;  2WES A;  1JEH A;  3K7Q X;  1GND A;  1H82 A;  2XYO A;  1DOE A;  4EM4 A;  1HYU A;  5CQF A;  2F5Z A;  2VOU A;  3IHG A;  3CND A;  4K8D A;  2XFN A;  2EQ8 A;  3K7T A;  5BUL A;  1TDF A;  4OPU A;  2AR8 A;  1ZMC A;  1E1L A;  5FS9 A;  1COY A;  4H7U A;  4OVI A;  3VQR A;  5GRT A;  2R0G A;  3NIX A;  5HYM A;  1F8W A;  4GCM A;  2IID A;  2WQY A;  4JY2 A;  1PDH A;  4RG3 A;  4MJW A;  3CPI G;  1NHR A;  1LQU A;  3NTD A;  4CNJ A;  2V5Z A;  1H7W A;  2A87 A;  4LU6 A;  1CL0 A;  1MO9 A;  2BAC A;  1FL2 A;  2C70 A;  4Z44 A;  2XFQ A;  3QJ4 A;  2Y6R A;  1CJC A;  2GAH B;  4O5U A;  2I0Z A;  2YR6 A;  3GD4 A;  1ONF A;  2JAE A;  1FEA A;  3F8P A;  2YG3 A;  5U63 A;  3R9U A;  2GB0 A;  1E1N A;  1ZOV A;  3O0H A;  4FK1 A;  3NYF A;  3COX A;  2YVG A;  3FIM B;  4UDQ A;  3P4R A;  1Y56 B;  1N4U A;  3JSK A;  1GOS A;  2DKH A;  3ALM A;  2AAQ A;  1V59 A;  3UTH A;  2RGO A;  1GRG A;  3KKJ A;  1L9D A;  1ZMD A;  3DK8 A;  3QVR A;  4U2S A;  4EQR A;  1S3B A;  1H81 A;  2GQF A;  1IUV A;  1PXB A;  1CHU A;  2YLX A;  2Z5Y A;  1TYP A;  3H4K A;  2C3D A;  1PS9 A;  3UOV A;  3ADA B;  3G5S A;  3P4S A;  3NH3 X;  2VRM A;  4C3Y A;  4B69 A;  4USQ A;  1YQ3 A;  4Z26 A;  4A9W A;  1ZX9 A;  3UTE A;  5FS8 A;  4UDP A;  3AE9 A;  3GD3 A;  3ICS A;  1X31 B;  3AWI A;  1D5T A;  2GR0 A;  5LV9 A;  4U8M A;  3P1W A;  4A7A A;  2VVL G;  2XFO A;  4HB9 A;  3UKP A;  2IVE A;  3AD8 B;  3QSE A;  5KVI A;  4JQ9 A;  2E5V A;  4RG4 A;  2C64 A;  3C96 A;  3S61 A;  1GET A;  5L46 A;  1DOC A;  1F6M A;  5IQ1 A;  1N4V A;  2XFU A;  1MOK A;  3SFD A;  1DJQ A;  4UP3 A;  4J36 A;  3FMW A;  4EQW A;  5KWF A;  2GR2 A;  1YKJ A;  1B4V A;  1BGJ A;  2WOI A;  3UTG A;  3GSI A;  4YXD A;  1D4E A;  3QFB A;  4YTM A;  3G5R A;  5BUK A;  2JK6 A;  4EQS A;  2WPC A;  1E6E A;  2WPE A;  4U8P A;  4BJZ A;  1H86 A;  1H83 A;  4K22 A;  2WOW A;  3UKL A;  2JB3 A;  4UDR A;  3ICT A;  3NN6 X;  1E1M A;  1JOA A;  2XLS A;  4J31 A;  3CPH G;  1GXF A;  1DOB A;  4H4X A;  2BCG G;  1E7P A;  4U8L A;  3NK2 X;  2CDU A;  5JCM A;  1GRA A;  3LXD A;  4B63 A;  4M52 A;  2YLW A;  4Y4L A;  2YR5 A;  2DKI A;  5KOX A;  2Z5X A;  4LII A;  4O5Q A;  3CNS A;  5J60 A;  1D7L A;  3HZL A;  1DJN A;  2FBW A;  3L8K A;  4NEV A;  1PHH A;  4GDP A;  4H4U A;  1GRB A;  2FJA A;  2OLN A;  3M12 A;  4IVO B;  2O9Z A;  2Q7V A;  1GER A;  2V3B A;  2WBA A;  4I59 A;  2GMH A;  3KU9 A;  1OJT A;  1TDN A;  2XFP A;  3F8R A;  4PAB A;  4EMW A;  2BAB A;  2GMJ A;  2R4J A;  1RSG A;  3K30 A;  1BZL A;  3PVC A;  4HA6 A;  4A6N B;  1YQ4 A;  2XVF A;  2GR3 A;  4XXG A;  1PXA A;  4D03 A;  1GEU A;  1NEN A;  3P4P A;  2YG5 A;  2PHH A;  4U8K A;  4USR A;  4CBQ A;  2YVJ A;  4GUV A;  3CN8 A;  3RP8 A;  3ABV A;  4BK2 A;  3EAO A;  1JRY A;  1XDI A;  3AE1 A;  1NG4 A;  2WET A;  3UKF A;  2XLT A;  1NAA A;  1PJ6 A;  3KPF A;  4B65 A;  3AEE A;  4OPI A;  1QLB A;  1FCD A;  1FOH A;  1IJH A;  3AYL A;  2YLZ A;  2XLU A;  4ZCD A;  5M0Z A;  1B37 A;  2ZZC A;  4FDC B;  1S3E A;  2YLR A;  2V61 A;  2A8X A;  4IV9 A;  1OJA A;  2RGH A;  2X8G A;  1PXC A;  4H2Q A;  4TM4 A;  4YTN A;  5IQ4 A;  4Z25 A;  3CNJ A;  1TYT A;  3BNU A;  2YG7 A;  1PBE A;  1KSS A;  1CC4 A;  1K4Q A;  3D1C A;  4K5R A;  4AP1 A;  3LOV A;  2R45 A;  4OPT A;  4NTD A;  3VRD B;  4X4J A;  3UOZ A;  4EMJ A;  4BK1 A;  2W0H A;  3CNP A;  2B76 A;  3Q6J A;  4B67 A;  5JCN A;  4A5L A;  3NGC X;  3AXB A;  4YSH A;  2OA1 A;  4BJY A;  5KXJ A;  1VQW A;  3AEG A;  2JBV A;  2VVL A;  4H2R A;  5M10 A;  2BCP A;  1QJD A;  3NK0 X;  4XWZ A;  1CJ2 A;  2VZ2 A;  3AB1 A;  3G5Q A;  2VRL A;  1L9C A;  2XVH A;  5U1O A;  2YQU A;  4GR1 A;  3T37 A;  5KRQ A;  4WCT A;  4JDR A;  2OLO A;  4C3X A;  4JY3 A;  3I6D A;  1EL7 A;  5FS6 A;  4EQX A;  2X3N A;  1EL9 A;  2EQ6 A;  3NK1 X;  1ZY8 A;  4OPG A;  1DNC A;  4K7Z A;  5U25 A;  3UKQ A;  1KF6 A;  5HHF A;  1PJ5 A;  3DGH A;  1PJ7 A;  1FEB A;  2YR4 A;  2B7S A;  3FBS A;  1GSN A;  2GQW A;  2B7R A;  2RGJ A;  1XAN A;  4JNQ A;  2CUL A;  1NEK A;  3EPT A;  4AOX A;  2TPR A;  3LB8 A;  3V76 A;  1S2Y A;  3RP6 A;  4CY6 A;  4CY8 A;  3DGZ A;  1RP0 A;  2TMD A;  1PBF A;  1K0J A;  2XDO A;  4NEW A;  2V60 A; 
#chains in the Genus database with same CATH topology
 3ALJ A;  1REO A;  1FEC A;  1M64 A;  3UOX A;  1ZDL A;  2OAL A;  3II4 A;  2GEW A;  3GRT A;  3B3R A;  2R0C A;  3NG7 X;  5JCL A;  1SEZ A;  1JRZ A;  2BRY A;  2GVC A;  2X8H A;  5C2T A;  4Z2R A;  1YQZ A;  2Q0L A;  1ZOY A;  4GF7 A;  4OPL A;  3SM8 A;  2BYB A;  3KVE A;  4U8N A;  1CF3 A;  2BS4 A;  3ATR A;  1Y0P A;  3DJE A;  3GDP A;  3DJJ A;  3GYJ A;  3GYX A;  2OAM A;  3NKS A;  3DA1 A;  3SFE A;  5BVA A;  1IUW A;  4ZN0 A;  3BI5 A;  3UCL A;  4OPC A;  4J34 A;  5ER0 A;  2VQ7 A;  2XVI A;  3AE4 A;  3E1T A;  3AE6 A;  3GWF A;  3KA7 A;  4JNA A;  3AEA A;  5DBJ A;  1RYI A;  4J2W A;  1QO8 A;  1ELI A;  4FX9 A;  4IVM B;  4ICY A;  4TLZ A;  2BS3 A;  2Y6Q A;  3BI2 A;  4JN9 A;  5CKU A;  4A6N A;  1TDE A;  4A99 A;  2WU5 A;  4OCG A;  3V3O A;  1BGN A;  2R46 A;  5BRT A;  3UKK A;  4AP3 A;  1PN0 A;  1F8R A;  1IUU A;  3AE8 A;  2H88 A;  3ATQ A;  4CNK A;  3AE7 A;  2QA1 A;  3M0O A;  1KSU A;  3WE0 A;  2B9W A;  2IVD A;  4J57 A;  1ZK7 A;  2Q6U A;  3AYJ A;  3IC9 A;  4NNJ A;  4YSZ A;  2WOV A;  2WP6 A;  4Z2U A;  1B5Q A;  1PBB A;  3NNE A;  4U8J A;  4AT0 A;  2WU2 A;  3UKA A;  1VRQ B;  1O95 A;  4H4Y A;  3BHK A;  2GRT A;  2RAB A;  5J7X A;  4B64 A;  2WP5 A;  2GAG B;  3GWD A;  2YAU A;  1O5W A;  1H84 A;  1L9E A;  2YVF A;  3BHF A;  2R9Z A;  5GSN A;  3ZYX A;  2VQB A;  3AE3 A;  1XPQ A;  3ICR A;  4BK3 A;  4GDE A;  3UTF A;  3H8L A;  1GRT A;  4U8O A;  4U2L A;  3RED A;  3VRB A;  4AT2 A;  4K2X A;  4U2T A;  4YSY A;  2WDV A;  1LJ1 A;  1ZP0 A;  4NTC A;  1JU2 A;  4N9X A;  1TDK A;  1CBO A;  3UKH A;  1BWC A;  2JB2 A;  3IWA A;  3LAD A;  3AEC A;  4H4P A;  3DME A;  3NN0 X;  4FK1 C;  1KFY A;  3RHA A;  2FJE A;  2CVJ A;  2WPF A;  3PO7 A;  1GES A;  2XVJ A;  4G74 A;  1IUX A;  3P9U A;  4EIQ A;  3OZ2 A;  4TM3 A;  5JCK A;  2C72 A;  4AOS A;  2YWL A;  2YLT A;  5HXI A;  4PAA A;  4APN A;  2YLS A;  4ZCC A;  3NT6 A;  1Y56 A;  2ZBW A;  1H6V A;  4GAV A;  4II3 A;  5EOW A;  3CGE A;  4CCR A;  2JB1 A;  1B8S A;  4B68 A;  4REK A;  4C77 A;  2GR1 A;  3CIR A;  3D8X A;  5EB4 A;  2YG4 A;  2C75 A;  1F3P A;  1NHP A;  2YM1 A;  4DNA A;  3DK9 A;  1ZKQ A;  2JKC A;  3KPK A;  4G73 A;  3NYC A;  3CGD A;  2R0P A;  3T2Z A;  2QA2 A;  3T14 A;  3DJD A;  2C67 A;  1TRB A;  3ITJ A;  1TDO A;  1E39 A;  2X50 A;  3H8I A;  2XLP A;  3CNT A;  3AE2 A;  4IA5 A;  3FG2 P;  2ARD A;  1K0L A;  3NYE A;  1NHQ A;  4OPD A;  1N1P A;  4YKG A;  1IUT A;  1GRH A;  4U8I A;  1Q1W A;  4H4R A;  4GRT A;  3ALL A;  3CTY A;  2EQ9 A;  5KMR A;  2B9X A;  3ISH A;  4G6G A;  3CPJ G;  3B6D A;  3SX6 A;  2GF3 A;  1LVL A;  1DOD A;  4DSH A;  1F8S A;  2XVE A;  1GT8 A;  1PBC A;  2APG A;  4YKF A;  3UP4 A;  1LQT A;  4X9N A;  1EL5 A;  1JRX A;  2WDQ A;  3AEB A;  3SQP A;  2X99 A;  4BUR A;  2C73 A;  2FJD A;  1CC6 A;  2WEU A;  1KNR A;  2WS3 A;  4G9K A;  4YT0 A;  2YM2 A;  1OJD A;  4H2N A;  2HQM A;  4LA1 A;  3SZF A;  3AE5 A;  4H4S A;  1IUS A;  4EIP A;  1KNP A;  5KMP A;  2NPX A;  4YWO A;  1LTX R;  3Q9T A;  1JNZ A;  2AQJ A;  2BXR A;  3LZW A;  1OJ9 A;  4DGK A;  5KVH A;  5IPY A;  2BK4 A;  4EM3 A;  3PS9 A;  2C3C A;  2C65 A;  2C4C A;  3QSM A;  1YY5 A;  3NHO X;  1PBD A;  2BA9 A;  2XLR A;  1N4W A;  1CJ3 A;  3F8D A;  4WX1 A;  4C74 A;  1D7Y A;  4X9M A;  2B9Y A;  1EL8 A;  4Y4M A;  4XWR A;  4DSG A;  4I58 A;  2WP9 A;  3KD9 A;  1GTH A;  3QFA A;  4TM1 A;  5FMH A;  1CC2 A;  3UP5 A;  1GV4 A;  1Z6L A;  4B1B A;  2ACZ A;  3GMC A;  3EF6 A;  5EBK A;  4H4Z A;  1BKW A;  4BV6 A;  1CJ4 A;  4A65 A;  3CMM A;  3SGL A;  1GAL A;  3AD9 B;  4H4W A;  5TR3 A;  2VVM A;  3ZDN A;  3AED A;  3IHM A;  4Z43 A;  2FJB A;  3K7M X;  3RP7 A;  1OJC A;  2C66 A;  1NHS A;  4A79 A;  1GPE A;  1O94 A;  5EB5 A;  1W4X A;  3BNM A;  3GRS A;  3AEF A;  3LJP A;  3QSS A;  4H4Q A;  3S5W A;  3RNM A;  1UKV G;  2BC0 A;  1MXT A;  2QCU A;  1LV0 A;  1LPF A;  3GDN A;  2CFY A;  4CRT A;  4H2P A;  4H50 A;  4KPR A;  1GRF A;  4KX6 A;  3GYI A;  2X8C A;  2E4G A;  1GTE A;  4CCQ A;  2QAE A;  1H7X A;  3T2Y A;  4D04 A;  4GAP A;  4Z2T A;  1DXL A;  2H89 A;  2WDR A;  3VR8 A;  1BF3 A;  4E0V A;  5C3J A;  2GV8 A;  3L1R A;  3NRN A;  3OC4 A;  2WHD A;  3V3N A;  3AYI A;  3NTA A;  2E1M A;  2ZZ0 A;  3DH9 A;  3CGC A;  4H4V A;  1M6I A;  4J56 A;  5JCI A;  1D4C A;  1NPX A;  3P4Q A;  1XHC A;  4TLX A;  4K5S A;  1Q1R A;  1GRE A;  3LZX A;  3C4N A;  1P2E A;  2PYX A;  1KDG A;  3URH A;  2XCG A;  2GH5 A;  2YG6 A;  4B66 A;  2V3A A;  3NLC A;  2UZZ A;  3FPZ A;  4NZH A;  1D4D A;  2V6O A;  3HYX A;  3DK4 A;  2BC1 A;  3EAN A;  1P2H A;  2Q0K A;  4NTE A;  3VR9 A;  5HY5 A;  4C5O A;  4P9S A;  1JNR A;  2A89 A;  4TM0 A;  3VRA A;  1L0V A;  1S2Q A;  2BXS A;  1AOG A;  3I3L A;  2ZZB A;  4ECH A;  2BK3 A;  2EQ7 A;  4EMI A;  4ADW A;  3QVP A;  1VG9 A;  2J3N A;  3CGB A;  1E1K A;  1VG0 A;  2C76 A;  2NVK X;  5FS7 A;  3SY4 A;  4YSX A;  4RSL A;  1VDC A;  3DJG X;  4YTP A;  4IA6 A;  4J33 A;  1EBD A;  3C4A A;  4Y4N A;  3M13 A;  3GMB A;  1K0I A;  1NG3 A;  3IF9 A;  4Z24 A;  2C7G A;  3KLJ A;  5KOW A;  2BK5 A;  1Q9I A;  4H4T A;  3UOY A;  3BI4 A;  1NDA A;  2R4E A;  3AD7 B;  3SYI A;  2BS2 A;  2WES A;  1JEH A;  3K7Q X;  1GND A;  1H82 A;  2XYO A;  1DOE A;  4EM4 A;  1HYU A;  5CQF A;  2F5Z A;  2VOU A;  3IHG A;  3CND A;  4K8D A;  2XFN A;  2EQ8 A;  3K7T A;  5BUL A;  1TDF A;  4OPU A;  2AR8 A;  1ZMC A;  4II2 A;  1E1L A;  5FS9 A;  1COY A;  4H7U A;  4OVI A;  3VQR A;  5GRT A;  2R0G A;  3NIX A;  5HYM A;  1F8W A;  4GCM A;  2IID A;  2WQY A;  4JY2 A;  1PDH A;  4RG3 A;  4MJW A;  3CPI G;  1NHR A;  1LQU A;  3NTD A;  4CNJ A;  2V5Z A;  1H7W A;  2A87 A;  4LU6 A;  1CL0 A;  2BAC A;  1MO9 A;  1FL2 A;  2C70 A;  4Z44 A;  2XFQ A;  3QJ4 A;  2Y6R A;  1CJC A;  2GAH B;  4O5U A;  2I0Z A;  2YR6 A;  3GD4 A;  1ONF A;  2JAE A;  1FEA A;  3F8P A;  2YG3 A;  5U63 A;  3R9U A;  2GB0 A;  1E1N A;  1ZOV A;  3O0H A;  4FK1 A;  3NYF A;  3COX A;  2YVG A;  3FIM B;  4UDQ A;  3P4R A;  1Y56 B;  1N4U A;  3JSK A;  1GOS A;  2DKH A;  3ALM A;  2AAQ A;  1V59 A;  3T2K A;  2RGO A;  3UTH A;  1GRG A;  3KKJ A;  1L9D A;  1ZMD A;  3HYV A;  3DK8 A;  3QVR A;  4U2S A;  4EQR A;  1S3B A;  3SZ0 A;  1H81 A;  2GQF A;  1IUV A;  1PXB A;  1CHU A;  2YLX A;  2Z5Y A;  1TYP A;  3H4K A;  4G6H A;  2C3D A;  1PS9 A;  3UOV A;  3ADA B;  3G5S A;  3P4S A;  3NH3 X;  2VRM A;  4C3Y A;  4B69 A;  4USQ A;  1YQ3 A;  4Z26 A;  4A9W A;  1ZX9 A;  3UTE A;  5FS8 A;  4UDP A;  3AE9 A;  3GD3 A;  3ICS A;  1X31 B;  3AWI A;  1D5T A;  2GR0 A;  5LV9 A;  4U8M A;  3P1W A;  4A7A A;  2VVL G;  2XFO A;  4HB9 A;  3UKP A;  2IVE A;  3AD8 B;  3QSE A;  5KVI A;  4JQ9 A;  2E5V A;  4RG4 A;  2C64 A;  3C96 A;  3S61 A;  1GET A;  5KMS A;  5L46 A;  1DOC A;  1F6M A;  5IQ1 A;  1N4V A;  2XFU A;  1MOK A;  3SFD A;  1DJQ A;  4UP3 A;  4J36 A;  3FMW A;  4EQW A;  5KWF A;  2GR2 A;  1YKJ A;  1B4V A;  1BGJ A;  2WOI A;  3UTG A;  3GSI A;  4YXD A;  1D4E A;  3QFB A;  4YTM A;  3G5R A;  5BUK A;  2JK6 A;  4EQS A;  2WPC A;  1E6E A;  2WPE A;  4U8P A;  4BJZ A;  1H86 A;  1H83 A;  4K22 A;  2WOW A;  3UKL A;  2JB3 A;  4UDR A;  3ICT A;  3NN6 X;  1E1M A;  1JOA A;  2XLS A;  4J31 A;  3CPH G;  1GXF A;  1DOB A;  4H4X A;  2BCG G;  1E7P A;  2BRA A;  4U8L A;  3NK2 X;  2CDU A;  5JCM A;  1GRA A;  5KMQ A;  3LXD A;  4B63 A;  4M52 A;  2YLW A;  4Y4L A;  2YR5 A;  2DKI A;  5KOX A;  2Z5X A;  4LII A;  4O5Q A;  3CNS A;  5J60 A;  1D7L A;  3HZL A;  3SZC A;  1DJN A;  2FBW A;  3L8K A;  4NEV A;  1PHH A;  4GDP A;  4H4U A;  1GRB A;  2FJA A;  2OLN A;  3M12 A;  4IVO B;  2O9Z A;  2Q7V A;  1GER A;  2V3B A;  2WBA A;  4I59 A;  2GMH A;  3KU9 A;  1OJT A;  3T31 A;  1TDN A;  2XFP A;  3F8R A;  4PAB A;  4EMW A;  2BAB A;  2GMJ A;  2R4J A;  1RSG A;  3K30 A;  1BZL A;  3PVC A;  4HA6 A;  4A6N B;  1YQ4 A;  2XVF A;  2GR3 A;  4NWZ A;  1PXA A;  4XXG A;  4D03 A;  5KNL A;  1GEU A;  1NEN A;  3P4P A;  2YG5 A;  2PHH A;  4U8K A;  4USR A;  4CBQ A;  2YVJ A;  4GUV A;  3CN8 A;  3RP8 A;  3ABV A;  4BK2 A;  3EAO A;  1JRY A;  1XDI A;  3AE1 A;  1NG4 A;  2WET A;  3UKF A;  2XLT A;  1NAA A;  1PJ6 A;  3KPF A;  4B65 A;  3AEE A;  4OPI A;  1QLB A;  1FCD A;  1FOH A;  1IJH A;  3AYL A;  2YLZ A;  2XLU A;  4ZCD A;  5M0Z A;  1B37 A;  2ZZC A;  4FDC B;  1S3E A;  2YLR A;  2V61 A;  2A8X A;  4IV9 A;  1OJA A;  2RGH A;  2X8G A;  1PXC A;  4H2Q A;  4TM4 A;  4YTN A;  5IQ4 A;  4Z25 A;  3CNJ A;  1TYT A;  3BNU A;  2YG7 A;  1PBE A;  1KSS A;  1CC4 A;  1K4Q A;  3D1C A;  4K5R A;  4AP1 A;  3LOV A;  2R45 A;  4OPT A;  4NTD A;  3VRD B;  4X4J A;  3UOZ A;  4EMJ A;  4BK1 A;  2W0H A;  3CNP A;  2B76 A;  3Q6J A;  4B67 A;  5JCN A;  4A5L A;  3NGC X;  3T0K A;  3AXB A;  4YSH A;  2OA1 A;  4BJY A;  5KXJ A;  1VQW A;  3AEG A;  2JBV A;  2VVL A;  4H2R A;  5M10 A;  2BCP A;  1QJD A;  3NK0 X;  4XWZ A;  1CJ2 A;  2VZ2 A;  3AB1 A;  3G5Q A;  2VRL A;  1L9C A;  2XVH A;  5U1O A;  2YQU A;  4GR1 A;  3T37 A;  5KRQ A;  4WCT A;  4JDR A;  2OLO A;  4C3X A;  4JY3 A;  3I6D A;  1EL7 A;  5FS6 A;  4EQX A;  2X3N A;  1EL9 A;  2EQ6 A;  3NK1 X;  1ZY8 A;  4OPG A;  3SXI A;  3SZW A;  1DNC A;  4K7Z A;  5U25 A;  3UKQ A;  1KF6 A;  5HHF A;  1PJ5 A;  3DGH A;  1PJ7 A;  1FEB A;  2YR4 A;  2B7S A;  3FBS A;  1GSN A;  2GQW A;  2B7R A;  2RGJ A;  1XAN A;  4JNQ A;  2CUL A;  1NEK A;  3EPT A;  4AOX A;  2TPR A;  3LB8 A;  3V76 A;  1S2Y A;  3RP6 A;  4CY6 A;  4CY8 A;  3HYW A;  3DGZ A;  1RP0 A;  2TMD A;  1PBF A;  1K0J A;  2XDO A;  4NEW A;  2V60 A; 
#chains in the Genus database with same CATH homology
 3ALJ A;  1REO A;  1FEC A;  1M64 A;  3UOX A;  1ZDL A;  2OAL A;  3II4 A;  2GEW A;  3GRT A;  3B3R A;  2R0C A;  3NG7 X;  5JCL A;  1SEZ A;  1JRZ A;  2BRY A;  2GVC A;  2X8H A;  5C2T A;  4Z2R A;  1YQZ A;  2Q0L A;  1ZOY A;  4GF7 A;  4OPL A;  3SM8 A;  2BYB A;  3KVE A;  4U8N A;  1CF3 A;  2BS4 A;  3ATR A;  1Y0P A;  3DJE A;  3GDP A;  3DJJ A;  3GYJ A;  3GYX A;  2OAM A;  3NKS A;  3DA1 A;  3SFE A;  5BVA A;  1IUW A;  4ZN0 A;  3BI5 A;  3UCL A;  4OPC A;  4J34 A;  5ER0 A;  2VQ7 A;  2XVI A;  3AE4 A;  3E1T A;  3AE6 A;  3GWF A;  3KA7 A;  4JNA A;  3AEA A;  5DBJ A;  1RYI A;  4J2W A;  1QO8 A;  1ELI A;  4FX9 A;  4IVM B;  4ICY A;  4TLZ A;  2BS3 A;  2Y6Q A;  3BI2 A;  4JN9 A;  5CKU A;  4A6N A;  1TDE A;  4A99 A;  2WU5 A;  4OCG A;  3V3O A;  1BGN A;  2R46 A;  5BRT A;  3UKK A;  4AP3 A;  1PN0 A;  1F8R A;  1IUU A;  3AE8 A;  2H88 A;  3ATQ A;  4CNK A;  3AE7 A;  2QA1 A;  3M0O A;  1KSU A;  3WE0 A;  2B9W A;  2IVD A;  4J57 A;  1ZK7 A;  2Q6U A;  3AYJ A;  3IC9 A;  4NNJ A;  4YSZ A;  2WOV A;  2WP6 A;  4Z2U A;  1B5Q A;  1PBB A;  3NNE A;  4U8J A;  4AT0 A;  2WU2 A;  3UKA A;  1VRQ B;  1O95 A;  4H4Y A;  3BHK A;  2GRT A;  2RAB A;  5J7X A;  4B64 A;  2WP5 A;  2GAG B;  3GWD A;  2YAU A;  1O5W A;  1H84 A;  1L9E A;  2YVF A;  3BHF A;  2R9Z A;  5GSN A;  3ZYX A;  2VQB A;  3AE3 A;  1XPQ A;  3ICR A;  4BK3 A;  4GDE A;  3UTF A;  3H8L A;  1GRT A;  4U8O A;  4U2L A;  3RED A;  3VRB A;  4AT2 A;  4K2X A;  4U2T A;  4YSY A;  2WDV A;  1LJ1 A;  1ZP0 A;  4NTC A;  1JU2 A;  4N9X A;  1TDK A;  1CBO A;  3UKH A;  1BWC A;  2JB2 A;  3IWA A;  3LAD A;  3AEC A;  4H4P A;  3DME A;  3NN0 X;  4FK1 C;  1KFY A;  3RHA A;  2FJE A;  2CVJ A;  2WPF A;  3PO7 A;  1GES A;  2XVJ A;  4G74 A;  1IUX A;  3P9U A;  4EIQ A;  3OZ2 A;  4TM3 A;  5JCK A;  2C72 A;  4AOS A;  2YWL A;  2YLT A;  5HXI A;  4PAA A;  4APN A;  2YLS A;  4ZCC A;  3NT6 A;  1Y56 A;  2ZBW A;  1H6V A;  4GAV A;  4II3 A;  5EOW A;  3CGE A;  4CCR A;  2JB1 A;  1B8S A;  4B68 A;  4REK A;  4C77 A;  2GR1 A;  3CIR A;  3D8X A;  5EB4 A;  2YG4 A;  2C75 A;  1F3P A;  1NHP A;  2YM1 A;  4DNA A;  3DK9 A;  1ZKQ A;  2JKC A;  3KPK A;  4G73 A;  3NYC A;  3CGD A;  2R0P A;  3T2Z A;  2QA2 A;  3T14 A;  3DJD A;  2C67 A;  1TRB A;  3ITJ A;  1TDO A;  1E39 A;  2X50 A;  3H8I A;  2XLP A;  3CNT A;  3AE2 A;  4IA5 A;  3FG2 P;  2ARD A;  1K0L A;  3NYE A;  1NHQ A;  4OPD A;  1N1P A;  4YKG A;  1IUT A;  1GRH A;  4U8I A;  1Q1W A;  4H4R A;  4GRT A;  3ALL A;  3CTY A;  2EQ9 A;  5KMR A;  2B9X A;  3ISH A;  4G6G A;  3CPJ G;  3B6D A;  3SX6 A;  2GF3 A;  1LVL A;  1DOD A;  4DSH A;  1F8S A;  2XVE A;  1GT8 A;  1PBC A;  2APG A;  4YKF A;  3UP4 A;  1LQT A;  4X9N A;  1EL5 A;  1JRX A;  2WDQ A;  3AEB A;  3SQP A;  2X99 A;  4BUR A;  2C73 A;  2FJD A;  1CC6 A;  2WEU A;  1KNR A;  2WS3 A;  4G9K A;  4YT0 A;  2YM2 A;  1OJD A;  4H2N A;  2HQM A;  4LA1 A;  3SZF A;  3AE5 A;  4H4S A;  1IUS A;  4EIP A;  1KNP A;  5KMP A;  2NPX A;  4YWO A;  1LTX R;  3Q9T A;  1JNZ A;  2AQJ A;  2BXR A;  3LZW A;  1OJ9 A;  4DGK A;  5KVH A;  5IPY A;  2BK4 A;  4EM3 A;  3PS9 A;  2C3C A;  2C65 A;  2C4C A;  3QSM A;  1YY5 A;  3NHO X;  1PBD A;  2BA9 A;  2XLR A;  1N4W A;  1CJ3 A;  3F8D A;  4WX1 A;  4C74 A;  1D7Y A;  4X9M A;  2B9Y A;  1EL8 A;  4Y4M A;  4XWR A;  4DSG A;  4I58 A;  2WP9 A;  3KD9 A;  1GTH A;  3QFA A;  4TM1 A;  5FMH A;  1CC2 A;  3UP5 A;  1GV4 A;  1Z6L A;  4B1B A;  2ACZ A;  3GMC A;  3EF6 A;  5EBK A;  4H4Z A;  1BKW A;  4BV6 A;  1CJ4 A;  4A65 A;  3CMM A;  3SGL A;  1GAL A;  3AD9 B;  4H4W A;  5TR3 A;  2VVM A;  3ZDN A;  3AED A;  3IHM A;  4Z43 A;  2FJB A;  3K7M X;  3RP7 A;  1OJC A;  2C66 A;  1NHS A;  4A79 A;  1GPE A;  1O94 A;  5EB5 A;  1W4X A;  3BNM A;  3GRS A;  3AEF A;  3LJP A;  3QSS A;  4H4Q A;  3S5W A;  3RNM A;  1UKV G;  2BC0 A;  1MXT A;  2QCU A;  1LV0 A;  1LPF A;  3GDN A;  2CFY A;  4CRT A;  4H2P A;  4H50 A;  4KPR A;  1GRF A;  4KX6 A;  3GYI A;  2X8C A;  2E4G A;  1GTE A;  4CCQ A;  2QAE A;  1H7X A;  3T2Y A;  4D04 A;  4GAP A;  4Z2T A;  1DXL A;  2H89 A;  2WDR A;  3VR8 A;  1BF3 A;  4E0V A;  5C3J A;  2GV8 A;  3L1R A;  3NRN A;  3OC4 A;  2WHD A;  3V3N A;  3AYI A;  3NTA A;  2E1M A;  2ZZ0 A;  3DH9 A;  3CGC A;  4H4V A;  1M6I A;  4J56 A;  5JCI A;  1D4C A;  1NPX A;  3P4Q A;  1XHC A;  4TLX A;  4K5S A;  1Q1R A;  1GRE A;  3LZX A;  3C4N A;  1P2E A;  2PYX A;  1KDG A;  3URH A;  2XCG A;  2GH5 A;  2YG6 A;  4B66 A;  2V3A A;  3NLC A;  2UZZ A;  3FPZ A;  4NZH A;  1D4D A;  2V6O A;  3HYX A;  3DK4 A;  2BC1 A;  3EAN A;  1P2H A;  2Q0K A;  4NTE A;  3VR9 A;  5HY5 A;  4C5O A;  4P9S A;  1JNR A;  2A89 A;  4TM0 A;  3VRA A;  1L0V A;  1S2Q A;  2BXS A;  1AOG A;  3I3L A;  2ZZB A;  4ECH A;  2BK3 A;  2EQ7 A;  4EMI A;  4ADW A;  3QVP A;  1VG9 A;  2J3N A;  3CGB A;  1E1K A;  1VG0 A;  2C76 A;  2NVK X;  5FS7 A;  3SY4 A;  4YSX A;  4RSL A;  1VDC A;  3DJG X;  4YTP A;  4IA6 A;  4J33 A;  1EBD A;  3C4A A;  4Y4N A;  3M13 A;  3GMB A;  1K0I A;  1NG3 A;  3IF9 A;  4Z24 A;  2C7G A;  3KLJ A;  5KOW A;  2BK5 A;  1Q9I A;  4H4T A;  3UOY A;  3BI4 A;  1NDA A;  2R4E A;  3AD7 B;  3SYI A;  2BS2 A;  2WES A;  1JEH A;  3K7Q X;  1GND A;  1H82 A;  2XYO A;  1DOE A;  4EM4 A;  1HYU A;  5CQF A;  2F5Z A;  2VOU A;  3IHG A;  3CND A;  4K8D A;  2XFN A;  2EQ8 A;  3K7T A;  5BUL A;  1TDF A;  4OPU A;  2AR8 A;  1ZMC A;  4II2 A;  1E1L A;  5FS9 A;  1COY A;  4H7U A;  4OVI A;  3VQR A;  5GRT A;  2R0G A;  3NIX A;  5HYM A;  1F8W A;  4GCM A;  2IID A;  2WQY A;  4JY2 A;  1PDH A;  4RG3 A;  4MJW A;  3CPI G;  1NHR A;  1LQU A;  3NTD A;  4CNJ A;  2V5Z A;  1H7W A;  2A87 A;  4LU6 A;  1CL0 A;  1MO9 A;  2BAC A;  1FL2 A;  2C70 A;  4Z44 A;  2XFQ A;  3QJ4 A;  2Y6R A;  1CJC A;  2GAH B;  4O5U A;  2I0Z A;  2YR6 A;  3GD4 A;  1ONF A;  2JAE A;  1FEA A;  3F8P A;  2YG3 A;  5U63 A;  3R9U A;  2GB0 A;  1E1N A;  1ZOV A;  3O0H A;  4FK1 A;  3NYF A;  3COX A;  2YVG A;  3FIM B;  4UDQ A;  3P4R A;  1Y56 B;  1N4U A;  3JSK A;  1GOS A;  2DKH A;  3ALM A;  2AAQ A;  1V59 A;  3T2K A;  2RGO A;  3UTH A;  1GRG A;  3KKJ A;  1L9D A;  1ZMD A;  3HYV A;  3DK8 A;  3QVR A;  4U2S A;  4EQR A;  1S3B A;  3SZ0 A;  1H81 A;  2GQF A;  1IUV A;  1PXB A;  1CHU A;  2YLX A;  2Z5Y A;  1TYP A;  3H4K A;  4G6H A;  2C3D A;  1PS9 A;  3UOV A;  3ADA B;  3G5S A;  3P4S A;  3NH3 X;  2VRM A;  4C3Y A;  4B69 A;  4USQ A;  1YQ3 A;  4Z26 A;  4A9W A;  1ZX9 A;  3UTE A;  5FS8 A;  4UDP A;  3AE9 A;  3GD3 A;  3ICS A;  1X31 B;  3AWI A;  1D5T A;  2GR0 A;  5LV9 A;  4U8M A;  3P1W A;  4A7A A;  2VVL G;  2XFO A;  4HB9 A;  3UKP A;  2IVE A;  3AD8 B;  3QSE A;  5KVI A;  4JQ9 A;  2E5V A;  4RG4 A;  2C64 A;  3C96 A;  3S61 A;  1GET A;  5KMS A;  5L46 A;  1DOC A;  1F6M A;  5IQ1 A;  1N4V A;  2XFU A;  1MOK A;  3SFD A;  1DJQ A;  4UP3 A;  4J36 A;  3FMW A;  4EQW A;  5KWF A;  2GR2 A;  1YKJ A;  1B4V A;  1BGJ A;  2WOI A;  3UTG A;  3GSI A;  4YXD A;  1D4E A;  3QFB A;  4YTM A;  3G5R A;  5BUK A;  2JK6 A;  4EQS A;  2WPC A;  1E6E A;  2WPE A;  4U8P A;  4BJZ A;  1H86 A;  1H83 A;  4K22 A;  2WOW A;  3UKL A;  2JB3 A;  4UDR A;  3ICT A;  3NN6 X;  1E1M A;  1JOA A;  2XLS A;  4J31 A;  3CPH G;  1GXF A;  1DOB A;  4H4X A;  2BCG G;  1E7P A;  2BRA A;  4U8L A;  3NK2 X;  2CDU A;  5JCM A;  1GRA A;  5KMQ A;  3LXD A;  4B63 A;  4M52 A;  2YLW A;  4Y4L A;  2YR5 A;  2DKI A;  5KOX A;  2Z5X A;  4LII A;  4O5Q A;  3CNS A;  5J60 A;  1D7L A;  3HZL A;  3SZC A;  1DJN A;  2FBW A;  3L8K A;  4NEV A;  1PHH A;  4GDP A;  4H4U A;  1GRB A;  2FJA A;  2OLN A;  3M12 A;  4IVO B;  2O9Z A;  2Q7V A;  1GER A;  2V3B A;  2WBA A;  4I59 A;  2GMH A;  3KU9 A;  1OJT A;  3T31 A;  1TDN A;  2XFP A;  3F8R A;  4PAB A;  4EMW A;  2BAB A;  2GMJ A;  2R4J A;  1RSG A;  3K30 A;  1BZL A;  3PVC A;  4HA6 A;  4A6N B;  1YQ4 A;  2XVF A;  2GR3 A;  4NWZ A;  1PXA A;  4XXG A;  4D03 A;  5KNL A;  1GEU A;  1NEN A;  3P4P A;  2YG5 A;  2PHH A;  4U8K A;  4USR A;  4CBQ A;  2YVJ A;  4GUV A;  3CN8 A;  3RP8 A;  3ABV A;  4BK2 A;  3EAO A;  1JRY A;  1XDI A;  3AE1 A;  1NG4 A;  2WET A;  3UKF A;  2XLT A;  1NAA A;  1PJ6 A;  3KPF A;  4B65 A;  3AEE A;  4OPI A;  1QLB A;  1FCD A;  1FOH A;  1IJH A;  3AYL A;  2YLZ A;  2XLU A;  4ZCD A;  5M0Z A;  1B37 A;  2ZZC A;  4FDC B;  1S3E A;  2YLR A;  2V61 A;  2A8X A;  4IV9 A;  1OJA A;  2RGH A;  2X8G A;  1PXC A;  4H2Q A;  4TM4 A;  4YTN A;  5IQ4 A;  4Z25 A;  3CNJ A;  1TYT A;  3BNU A;  2YG7 A;  1PBE A;  1KSS A;  1CC4 A;  1K4Q A;  3D1C A;  4K5R A;  4AP1 A;  3LOV A;  2R45 A;  4OPT A;  4NTD A;  3VRD B;  4X4J A;  3UOZ A;  4EMJ A;  4BK1 A;  2W0H A;  3CNP A;  2B76 A;  3Q6J A;  4B67 A;  5JCN A;  4A5L A;  3NGC X;  3T0K A;  3AXB A;  4YSH A;  2OA1 A;  4BJY A;  5KXJ A;  1VQW A;  3AEG A;  2JBV A;  2VVL A;  4H2R A;  5M10 A;  2BCP A;  1QJD A;  3NK0 X;  4XWZ A;  1CJ2 A;  2VZ2 A;  3AB1 A;  3G5Q A;  2VRL A;  1L9C A;  2XVH A;  5U1O A;  2YQU A;  4GR1 A;  3T37 A;  5KRQ A;  4WCT A;  4JDR A;  2OLO A;  4C3X A;  4JY3 A;  3I6D A;  1EL7 A;  5FS6 A;  4EQX A;  2X3N A;  1EL9 A;  2EQ6 A;  3NK1 X;  1ZY8 A;  4OPG A;  3SXI A;  3SZW A;  1DNC A;  4K7Z A;  5U25 A;  3UKQ A;  1KF6 A;  5HHF A;  1PJ5 A;  3DGH A;  1PJ7 A;  1FEB A;  2YR4 A;  2B7S A;  3FBS A;  1GSN A;  2GQW A;  2B7R A;  2RGJ A;  1XAN A;  4JNQ A;  2CUL A;  1NEK A;  3EPT A;  4AOX A;  2TPR A;  3LB8 A;  3V76 A;  1S2Y A;  3RP6 A;  4CY6 A;  4CY8 A;  3HYW A;  3DGZ A;  1RP0 A;  2TMD A;  1PBF A;  1K0J A;  2XDO A;  4NEW A;  2V60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...