3KVEA

Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
484
structure length
484
Chain Sequence
b'DRNPLEECFRETDYEEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNSKEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRTNCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEKDTSSNTADYVIVCTTSRAARRIQFEPPLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNFSTGVGVIIAYGIGDDANFFQALKFKDCADIVFNDLSLIHQLPKEEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNRASEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structure of native L-amino acid oxidase from Vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
rcsb
molecule tags Oxidoreductase
total genus 178
structure length 484
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3kveA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kveA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kveA01
1ZDLA 1D5TA 2Q0LA 3EF6A 4XWZA 5IPYA 2GV8A 2YG5A 4Z43A 4I59A 4IVMB 2YAUA 1RP0A 1PDHA 4BURA 2YLWA 1E39A 4U8LA 3UTFA 3JSKA 4AP3A 2E5VA 3NNEA 3R9UA 3SQPA 1BGJA 3II4A 2BC1A 2YVGA 5EOWA 5KRQA 4TM0A 1IUTA 1GEUA 2BXSA 3V76A 3LXDA 2C64A 4UDPA 2ZZ0A 1TDKA 2JAEA 3DK8A 3FBSA 4GCMA 3UKHA 4NZHA 4J34A 2EQ7A 3WE0A 1MXTA 3GYIA 2BXRA 4Y4LA 3SGLA 3UOYA 3QVRA 2EQ6A 4NTCA 2XYOA 4O5QA 1COYA 4JY2A 3NG7X 1IJHA 1CJ3A 4H4YA 4YWOA 2ARDA 3FPZA 3P1WA 4C5OA 1E1LA 1HYUA 1GV4A 4U8NA 4PAAA 2CVJA 4USRA 4NEWA 1OJAA 4ICYA 5GSNA 1S3EA 4CCRA 1NHSA 3NIXA 2I0ZA 2Q0KA 4H4PA 4OPTA 2XVIA 1D4DA 2HQMA 3ALLA 3SFDA 2WOWA 2YLZA 4BJYA 4J2WA 4TLZA 1PXCA 1KSUA 1NDAA 4U2SA 3COXA 1E1NA 1VG9A 4H2QA 4A99A 2FJDA 5FS6A 2YLTA 3P4QA 1CHUA 1NG4A 3VRDB 4KX6A 4U8MA 2FBWA 5M0ZA 1GRGA 1H81A 1FEBA 2A89A 3V3OA 2CULA 4YKFA 1CJ2A 1GRTA 1JNZA 4APNA 4C74A 2WU2A 2WS3A 3HZLA 3NN0X 3NTAA 4AOXA 4YSZA 1E6EA 3AD7B 3UKLA 1E1KA 1IUVA 2JB2A 1F8SA 3QSSA 3GMBA 1GALA 4IV9A 2JB1A 2BACA 4EQRA 1EL5A 5FS7A 4K5SA 4NTDA 3AEEA 5KVIA 3GDPA 4LIIA 4Z2UA 4HA6A 2WU5A 1IUWA 3H8IA 3ATRA 5HXIA 1KF6A 4AOSA 4D03A 1GNDA 1ONFA 2C75A 2YLSA 3ISHA 4BK3A 4PABA 2RGJA 2WETA 1H83A 3UKKA 3BHFA 2BK5A 2YG3A 1LPFA 3VR9A 2B76A 5KWFA 3RP7A 4OPUA 1BF3A 1BZLA 1S2QA 3AEDA 3BI2A 3DGZA 1P2HA 2VQ7A 4J57A 4OPDA 3AD9B 4YSYA 2WP6A 1VQWA 3D1CA 4X9NA 4B64A 2TMDA 2VZ2A 2VQBA 4EQWA 4M52A 5M10A 5DBJA 2ZBWA 1ZOVA 5CKUA 3LJPA 2ZZCA 2VRMA 5BVAA 1O94A 4C3YA 1GSNA 4GDPA 2WBAA 1O5WA 3AE9A 4YT0A 2YLXA 3UP5A 4MJWA 1YKJA 4C77A 1W4XA 3UCLA 3AE2A 2RABA 2A87A 5HYMA 1B4VA 4H4XA 1AOGA 2WOVA 3B3RA 1RYIA 5EBKA 2WQYA 3ABVA 1NENA 2VVLG 2VVLA 2TPRA 4GDEA 1EBDA 1NHQA 2BS4A 2GMJA 2Q7VA 2XLPA 3G5SA 3QJ4A 3RHAA 4A65A 4YTPA 2C76A 1M64A 3NTDA 1Q1WA 2IIDA 1B37A 1VG0A 2GVCA 1ZOYA 3M12A 3O0HA 3BHKA 1N4UA 2YM1A 1N1PA 1GPEA 2WEUA 3CNTA 1ZX9A 2YLRA 1V59A 2JB3A 1B8SA 4USQA 3GD4A 3UP4A 3GMCA 4B65A 2NPXA 4CNKA 3GWFA 1DOBA 1NHPA 2VVMA 4NEVA 3CNJA 3AE5A 2GMHA 2E4GA 1GT8A 3ITJA 4JDRA 2V3AA 4IVOB 4B68A 2DKIA 3DJGX 2GR2A 2XVJA 3IHMA 2BK4A 1CC4A 3IF9A 4BJZA 3K30A 2BABA 2GQWA 3NRNA 5JCIA 1TRBA 1Z6LA 1XANA 1ZP0A 1D4EA 2YG6A 1ZMDA 3BNUA 3CGDA 4OVIA 5BUKA 3C4NA 1QLBA 2EQ8A 2R9ZA 3NGCX 4CY8A 1CJ4A 2NVKX 3GYJA 2Q6UA 3AXBA 1ZK7A 4JQ9A 3S5WA 3SFEA 1FOHA 4ZCDA 2WDQA 2YR5A 1PHHA 3EAOA 3H8LA 3F8RA 1NEKA 1JRYA 4P9SA 2JKCA 4X9MA 1LQTA 4YXDA 3ALMA 4U8IA 3BI5A 3CGBA 4RG3A 1PS9A 4Z24A 5JCKA 1CC2A 5EB5A 1F8WA 3L1RA 2YWLA 3DMEA 3AE3A 4GUVA 4H2NA 1TYPA 1Q1RA 2YVFA 3I6DA 1SEZA 2GAGB 2GAHB 1OJDA 3LADA 3AYJA 4FK1C 4UDQA 4FX9A 1BWCA 1E1MA 2GH5A 1PBEA 2GR0A 1PBFA 1JU2A 4OPGA 2C65A 1NPXA 4X4JA 4B69A 2XFUA 4H4QA 4K5RA 5KOWA 2XFNA 4Y4MA 4UP3A 2R46A 1ELIA 3QVPA 4A6NB 2H89A 4IA5A 1TDNA 3QSMA 3CGCA 1DNCA 3UKAA 1Y0PA 2OLNA 3CNSA 4JY3A 3NLCA 2C72A 1JRXA 3FIMB 2X99A 4Z2RA 3REDA 1TDOA 4EQXA 1GESA 5J7XA 3KPFA 1GREA 1B5QA 2WP5A 2C66A 2AR8A 2YR4A 4H4RA 4U2TA 2WESA 2CDUA 1GTEA 1K0LA 2WPCA 3DJJA 4NTEA 2F5ZA 4A6NA 4EMWA 4YSXA 3E1TA 3ICSA 3UKQA 4YTNA 2GR1A 4TM3A 3UOXA 2GQFA 4K7ZA 3DH9A 4EMIA 2BC0A 1F6MA 3VRBA 2B9XA 4CCQA 2AAQA 2Y6QA 3NK2X 1FL2A 4A9WA 3AEBA 4UDRA 3G5QA 4JNQA 4OPLA 4Z44A 4OCGA 1MOKA 2EQ9A 2QA2A 1H86A 1S2YA 2V61A 1CF3A 3P4PA 4LU6A 5HHFA 4DGKA 1H84A 2XFOA 1X31B 4IA6A 3SM8A 1GOSA 1IUSA 4I58A 3RP6A 3CPIG 4FK1A 2BYBA 1D7LA 4D04A 1LJ1A 2R45A 2BK3A 3GSIA 3OZ2A 1YY5A 3NYEA 4H2RA 4GF7A 3RP8A 1CBOA 2GB0A 4GRTA 4EM4A 3EPTA 1DXLA 3NN6X 1YQ4A 2WP9A 1Y56A 4U8KA 5KVHA 4CRTA 2H88A 1KFYA 3URHA 2X8CA 3V3NA 1EL8A 3CPHG 2GF3A 3IC9A 5C2TA 1FECA 1TDEA 1D7YA 4C3XA 2ACZA 1JRZA 2C7GA 3AYIA 4EMJA 1NG3A 2YR6A 1H82A 3G5RA 5BRTA 2OA1A 4K8DA 4H4UA 4TLXA 5FMHA 5C3JA 2XLUA 2E1MA 3H4KA 1XPQA 4RSLA 3C4AA 3ZYXA 3CTYA 3ICTA 3S61A 5IQ1A 2QCUA 3GRSA 1PBDA 3AE8A 4H4VA 3I3LA 3B6DA 1N4VA 4GR1A 1CL0A 3QFBA 3BI4A 1DOCA 3CN8A 2WOIA 4J36A 4AT0A 2V3BA 1N4WA 2VOUA 3PVCA 4TM4A 2AQJA 3LB8A 1VRQB 1YQZA 3KA7A 1VDCA 4JNAA 1KSSA 1K0IA 2XVFA 4LA1A 3GD3A 1PJ6A 3GDNA 4H4WA 2C3CA 3UOVA 1H7XA 5JCMA 4U8PA 5LV9A 1F3PA 4ADWA 3P9UA 3QFAA 2QAEA 3KVEA 1PXAA 2R4JA 3KLJA 3KU9A 3M0OA 4FDCB 3CNPA 2RGHA 2CFYA 2ZZBA 2PHHA 5GRTA 5JCNA 2FJAA 2XLSA 3NT6A 1PXBA 4OPIA 3IHGA 3UKPA 4H7UA 3DJEA 1PN0A 2X8HA 3L8KA 2YQUA 1CC6A 2FJBA 1KNPA 2W0HA 4H4TA 3DA1A 3LZXA 4DNAA 2C3DA 2XLTA 2GR3A 1ZY8A 2V60A 3NKSA 2V6OA 3C96A 1GTHA 2YM2A 1K4QA 2WPEA 2X50A 5ER0A 3UTGA 5U1OA 2J3NA 3AECA 3AE7A 2B7SA 3Q6JA 2X8GA 5CQFA 4WCTA 2C70A 2VRLA 3PO7A 4CNJA 1NAAA 1Q9IA 3OC4A 4B67A 3ZDNA 2IVEA 2XVEA 3IWAA 4EQSA 1FCDA 2XDOA 1LV0A 2GEWA 3UTEA 3P4RA 3NYCA 4CBQA 4H4SA 1GETA 3D8XA 3K7MX 3AEGA 2YG7A 3AYLA 1FEAA 1H7WA 2BS2A 1JEHA 2QA1A 1PJ7A 1ZKQA 3PS9A 4DSHA 1OJTA 3EANA 4ZN0A 1JNRA 2PYXA 2V5ZA 4YKGA 1S3BA 4CY6A 4WX1A 2B9WA 4H4ZA 2XFQA 3BNMA 2WPFA 3ATQA 1DODA 4REKA 3RNMA 1GRAA 1DJNA 2Y6RA 2GRTA 4A7AA 4EIQA 3AE4A 4EIPA 3AWIA 1JOAA 4U8JA 3T37A 1KDGA 1L0VA 4AP1A 1YQ3A 3DK9A 5KXJA 4Z2TA 4O5UA 3GRTA 4B1BA 2XFPA 1NHRA 4ECHA 1BKWA 1OJCA 3K7QX 2C67A 1E7PA 4OPCA 1L9CA 2R0GA 2RGOA 1OJ9A 2A8XA 1P2EA 3NHOX 1F8RA 2DKHA 5U25A 3GWDA 3AB1A 1GRFA 1GXFA 4B63A 4H50A 5IQ4A 1LQUA 3ADAB 1Y56B 1GERA 4XWRA 2JK6A 3NK1X 5EB4A 4BK1A 4Z26A 4K2XA 1TYTA 3KD9A 4U8OA 2UZZA 3NH3X 1GRBA 1LVLA 3CPJG 1GRHA 1QJDA 3UOZA 2XVHA 2FJEA 2BCGG 3LZWA 4DSGA 1PBBA 1D4CA 2B9YA 3DK4A 1KNRA 5L46A 4EM3A 3UKFA 4JN9A 4YTMA 4B66A 3AE6A 3F8DA 3ALJA 4YSHA 1IUXA 2IVDA 2BCPA 3LOVA 2R4EA 1L9EA 4TM1A 2APGA 5HY5A 4XXGA 2OLOA 4A5LA 1EL7A 2Z5YA 3VQRA 2XCGA 3FG2P 2OAMA 3CNDA 1QO8A 1PBCA 4N9XA 1XHCA 1MO9A 4ZCCA 5KOXA 2OALA 3K7TA 2C73A 5TR3A 1L9DA 2Z5XA 1BGNA 3NK0X 4Z25A 4HB9A 2R0CA 5JCLA 3P4SA 3AEAA 1EL9A 3M13A 2WHDA 2X3NA 4J56A 1XDIA 4BK2A 3KKJA 1H6VA 3VR8A 4BV6A 2O9ZA 3AE1A 5FS9A 1DOEA 3AEFA 2BS3A 3ICRA 4A79A 1RSGA 4J31A 4RG4A 1TDFA 1IUUA 4U2LA 5U63A 2R0PA 3QSEA 1DJQA 3Q9TA 5BULA 2WDRA 5J60A 1CJCA 2XLRA 1LTXR 4H2PA 3AD8B 1K0JA 1REOA 2B7RA 1M6IA 1O95A 3NYFA 4J33A 3DJDA 2YG4A 3F8PA 1PJ5A 2BA9A 2YVJA 3VRAA 3DGHA 4Y4NA 2JBVA 3CGEA 4K22A 4AT2A 4E0VA 3FMWA 1UKVG 4KPRA 2WDVA 5FS8A 3UTHA 3CIRA 1ZMCA
chains in the Genus database with same CATH superfamily
1ZDLA 1D5TA 2Q0LA 3EF6A 3HYVA 4XWZA 5IPYA 2GV8A 2YG5A 3GYXA 4Z43A 4I59A 4IVMB 2YAUA 1RP0A 1PDHA 4BURA 3CMMA 2YLWA 1E39A 4U8LA 3UTFA 3JSKA 4AP3A 2E5VA 3NNEA 3R9UA 3SQPA 1BGJA 3II4A 2BC1A 2YVGA 5EOWA 3HYXA 5KRQA 4TM0A 1IUTA 1GEUA 2BXSA 3V76A 3LXDA 2C64A 4UDPA 2ZZ0A 1TDKA 2JAEA 3DK8A 3FBSA 4GCMA 3UKHA 4NZHA 4J34A 2EQ7A 3WE0A 1MXTA 3GYIA 2BXRA 4Y4LA 3SGLA 3UOYA 3QVRA 2EQ6A 3SZCA 4NTCA 2XYOA 4O5QA 1COYA 4JY2A 3NG7X 1IJHA 1CJ3A 4H4YA 4YWOA 2ARDA 3FPZA 3P1WA 4C5OA 1E1LA 1HYUA 1GV4A 4NNJA 4U8NA 4PAAA 3SX6A 2CVJA 4USRA 4NEWA 1OJAA 4ICYA 5GSNA 1S3EA 3SZ0A 1NHSA 3NIXA 2I0ZA 4CCRA 2Q0KA 4H4PA 4OPTA 2XVIA 1D4DA 2HQMA 3ALLA 3SFDA 2WOWA 3SXIA 2YLZA 4BJYA 4J2WA 4TLZA 1PXCA 1KSUA 1NDAA 4U2SA 3COXA 1E1NA 1VG9A 4H2QA 4A99A 2FJDA 5KMPA 5FS6A 2YLTA 3P4QA 1CHUA 1NG4A 3VRDB 4KX6A 3T2YA 4U8MA 2FBWA 5M0ZA 1GRGA 1H81A 1FEBA 2A89A 3V3OA 4GAVA 2CULA 4YKFA 1CJ2A 1GRTA 1JNZA 4APNA 4C74A 2WU2A 2WS3A 3HZLA 3NN0X 3NTAA 4AOXA 4YSZA 1E6EA 3AD7B 3UKLA 1E1KA 1IUVA 2JB2A 1F8SA 3QSSA 3GMBA 4IV9A 1GALA 2JB1A 2BACA 4EQRA 1EL5A 5FS7A 4K5SA 4NTDA 3AEEA 5KVIA 3GDPA 4LIIA 4Z2UA 4HA6A 2WU5A 1IUWA 3H8IA 3ATRA 5HXIA 3SZWA 1KF6A 4AOSA 4D03A 1GNDA 1ONFA 2C75A 2YLSA 3ISHA 4BK3A 4G74A 4PABA 2RGJA 2WETA 1H83A 3UKKA 3BHFA 2BK5A 2YG3A 1LPFA 3VR9A 2B76A 5KWFA 3RP7A 4OPUA 1BF3A 1BZLA 1S2QA 3AEDA 3BI2A 3DGZA 1P2HA 2VQ7A 4J57A 4OPDA 3AD9B 4BK2A 4YSYA 2WP6A 1VQWA 3D1CA 4X9NA 4B64A 2TMDA 2VZ2A 2VQBA 4EQWA 4M52A 5M10A 5DBJA 2ZBWA 1ZOVA 5CKUA 3LJPA 2ZZCA 2VRMA 5BVAA 1O94A 4C3YA 1GSNA 4GDPA 2WBAA 1O5WA 3AE9A 4YT0A 2YLXA 3UP5A 4MJWA 1YKJA 4C77A 1W4XA 3UCLA 3AE2A 2RABA 2A87A 5HYMA 1B4VA 4H4XA 1AOGA 2WOVA 3B3RA 1RYIA 4G73A 5EBKA 2WQYA 3ABVA 1NENA 2VVLG 2VVLA 2TPRA 4GDEA 1EBDA 1NHQA 2BS4A 2GMJA 2Q7VA 2XLPA 3G5SA 3QJ4A 3RHAA 4A65A 4YTPA 2C76A 1M64A 3NTDA 1Q1WA 5KMQA 2IIDA 1B37A 1VG0A 2GVCA 1ZOYA 3M12A 3O0HA 3BHKA 1N4UA 2YM1A 1N1PA 1GPEA 2WEUA 3CNTA 1ZX9A 2YLRA 1V59A 2JB3A 1B8SA 4USQA 3GD4A 3KPKA 3UP4A 3GMCA 4B65A 2NPXA 4CNKA 3GWFA 1DOBA 1NHPA 2VVMA 4NEVA 3CNJA 3AE5A 2GMHA 2E4GA 1GT8A 3ITJA 4JDRA 2V3AA 4IVOB 4B68A 2DKIA 3DJGX 2GR2A 2XVJA 3IHMA 2BK4A 1CC4A 3IF9A 4BJZA 3HYWA 2BABA 3K30A 2GQWA 3NRNA 5JCIA 1TRBA 1Z6LA 1XANA 1ZP0A 1D4EA 2YG6A 1ZMDA 3BNUA 3CGDA 4OVIA 5BUKA 3C4NA 1QLBA 2EQ8A 2R9ZA 3NGCX 4G6HA 1CJ4A 4CY8A 2NVKX 3GYJA 2Q6UA 3AXBA 1ZK7A 4JQ9A 3S5WA 3SFEA 1FOHA 4ZCDA 2WDQA 2YR5A 1PHHA 3EAOA 3H8LA 3F8RA 1NEKA 1JRYA 4P9SA 2JKCA 4X9MA 1LQTA 4YXDA 3ALMA 4U8IA 4NWZA 3BI5A 3CGBA 4RG3A 1PS9A 4Z24A 5JCKA 1CC2A 5EB5A 1F8WA 3L1RA 2YWLA 3DMEA 3AE3A 4GUVA 4H2NA 1TYPA 1Q1RA 2YVFA 3I6DA 1SEZA 2GAGB 2GAHB 1OJDA 3LADA 3AYJA 4FK1C 4UDQA 4FX9A 1BWCA 1E1MA 2GH5A 1PBEA 2GR0A 1PBFA 1JU2A 4II2A 4OPGA 2C65A 1NPXA 4X4JA 4B69A 2XFUA 4H4QA 4K5RA 5KOWA 2XFNA 3T31A 4Y4MA 4UP3A 2R46A 1ELIA 3QVPA 4A6NB 2H89A 4IA5A 1TDNA 3QSMA 3CGCA 1DNCA 3UKAA 1Y0PA 2OLNA 3CNSA 4JY3A 3NLCA 2C72A 3T2KA 1JRXA 3FIMB 2X99A 4Z2RA 3REDA 1TDOA 4EQXA 1GESA 5J7XA 3KPFA 1GREA 1B5QA 2WP5A 2C66A 2AR8A 2YR4A 4H4RA 4U2TA 2WESA 2CDUA 1GTEA 1K0LA 2WPCA 3DJJA 4NTEA 2F5ZA 4A6NA 4EMWA 4YSXA 3E1TA 3ICSA 3UKQA 4YTNA 2GR1A 4TM3A 3UOXA 2GQFA 4K7ZA 2BRAA 3DH9A 4EMIA 2BC0A 1F6MA 3VRBA 2B9XA 4CCQA 2AAQA 2Y6QA 3NK2X 1FL2A 4A9WA 3AEBA 4UDRA 3G5QA 4JNQA 4OPLA 4Z44A 4OCGA 1MOKA 2EQ9A 2QA2A 1H86A 1S2YA 2V61A 1CF3A 3P4PA 4LU6A 5HHFA 4DGKA 1H84A 2XFOA 1X31B 4IA6A 3SM8A 1GOSA 1IUSA 4I58A 3RP6A 3CPIG 4FK1A 2BYBA 1D7LA 4D04A 1LJ1A 2R45A 2BK3A 3GSIA 3OZ2A 1YY5A 3NYEA 4H2RA 4GF7A 3RP8A 1CBOA 2GB0A 4GRTA 4EM4A 3EPTA 1DXLA 3NN6X 1YQ4A 2WP9A 1Y56A 4U8KA 5KVHA 4CRTA 2H88A 1KFYA 3URHA 2X8CA 3V3NA 1EL8A 3CPHG 2GF3A 3IC9A 5C2TA 1FECA 1TDEA 1D7YA 4C3XA 2ACZA 1JRZA 2C7GA 3AYIA 4EMJA 1NG3A 2YR6A 1H82A 4II3A 3G5RA 5BRTA 2OA1A 4K8DA 4H4UA 4TLXA 5FMHA 5C3JA 2XLUA 2E1MA 3H4KA 1XPQA 4RSLA 3C4AA 3ZYXA 3CTYA 3ICTA 3S61A 5IQ1A 2QCUA 3GRSA 1PBDA 3AE8A 4H4VA 3I3LA 3B6DA 1N4VA 4GR1A 1CL0A 3QFBA 3BI4A 1DOCA 3CN8A 2WOIA 4J36A 4AT0A 2V3BA 1N4WA 2VOUA 3PVCA 4TM4A 2AQJA 3LB8A 1VRQB 1YQZA 3KA7A 1VDCA 4JNAA 1KSSA 1K0IA 4G6GA 2XVFA 4LA1A 3GD3A 1PJ6A 3GDNA 4H4WA 2C3CA 3UOVA 1H7XA 5JCMA 4U8PA 5KMSA 5LV9A 1F3PA 4ADWA 3P9UA 3QFAA 2QAEA 3KVEA 1PXAA 2R4JA 3KLJA 3KU9A 3M0OA 4FDCB 3CNPA 2RGHA 2CFYA 2ZZBA 2PHHA 5GRTA 5JCNA 2FJAA 2XLSA 3NT6A 1PXBA 4OPIA 3IHGA 3UKPA 4H7UA 3DJEA 1PN0A 2X8HA 3L8KA 2YQUA 1CC6A 2FJBA 1KNPA 2W0HA 4H4TA 3DA1A 3LZXA 4DNAA 2C3DA 2XLTA 2GR3A 1ZY8A 2V60A 3NKSA 2V6OA 3C96A 1GTHA 2YM2A 1K4QA 2WPEA 2X50A 5ER0A 3UTGA 5U1OA 2J3NA 3AECA 3AE7A 4GAPA 2B7SA 3Q6JA 2X8GA 5CQFA 4WCTA 3SZFA 2C70A 2VRLA 3PO7A 4CNJA 1NAAA 1Q9IA 3OC4A 4B67A 3ZDNA 2IVEA 2XVEA 3IWAA 4EQSA 1FCDA 2XDOA 1LV0A 2GEWA 3UTEA 3P4RA 3NYCA 4CBQA 4H4SA 1GETA 3D8XA 3K7MX 3AEGA 2YG7A 3AYLA 1FEAA 1H7WA 2BS2A 1JEHA 2QA1A 1PJ7A 1ZKQA 3PS9A 4DSHA 1OJTA 3EANA 4ZN0A 1JNRA 2PYXA 2V5ZA 4YKGA 1S3BA 4CY6A 4WX1A 2B9WA 4H4ZA 2XFQA 3BNMA 2WPFA 3ATQA 1DODA 4REKA 3RNMA 1GRAA 1DJNA 2Y6RA 3SYIA 2GRTA 4A7AA 4EIQA 3AE4A 4EIPA 3AWIA 1JOAA 4U8JA 3T37A 1KDGA 1L0VA 4AP1A 1YQ3A 3DK9A 5KXJA 4Z2TA 4O5UA 3GRTA 3SY4A 4B1BA 2XFPA 1NHRA 4ECHA 1BKWA 1OJCA 3K7QX 2C67A 1E7PA 4OPCA 1L9CA 2R0GA 2RGOA 1OJ9A 2A8XA 1P2EA 5KMRA 2BRYA 3NHOX 1F8RA 2DKHA 5U25A 3GWDA 3AB1A 1GRFA 1GXFA 4B63A 4H50A 5IQ4A 1LQUA 3ADAB 1Y56B 1GERA 4XWRA 2JK6A 3NK1X 5EB4A 4BK1A 4Z26A 4K2XA 1TYTA 3KD9A 4U8OA 2UZZA 3NH3X 1GRBA 1LVLA 3CPJG 1GRHA 1QJDA 3UOZA 2XVHA 2FJEA 2BCGG 3LZWA 4DSGA 1PBBA 2B9YA 1D4CA 3DK4A 1KNRA 5L46A 4EM3A 3UKFA 4JN9A 4YTMA 4G9KA 4B66A 3AE6A 3F8DA 3ALJA 4YSHA 1IUXA 2IVDA 2BCPA 3LOVA 2R4EA 1L9EA 4TM1A 2APGA 5HY5A 4XXGA 2OLOA 4A5LA 1EL7A 2Z5YA 3VQRA 2XCGA 3FG2P 2OAMA 3CNDA 1QO8A 1PBCA 4N9XA 1XHCA 1MO9A 4ZCCA 5KOXA 2OALA 3K7TA 2C73A 5TR3A 1L9DA 2Z5XA 5KNLA 1BGNA 3NK0X 4Z25A 4HB9A 2R0CA 5JCLA 3P4SA 3AEAA 1EL9A 3M13A 2WHDA 2X3NA 4J56A 1XDIA 2C4CA 3KKJA 1H6VA 3T0KA 3T2ZA 3VR8A 4BV6A 2O9ZA 3AE1A 5FS9A 1DOEA 3AEFA 2BS3A 3ICRA 4A79A 1RSGA 4J31A 4RG4A 1TDFA 1IUUA 4U2LA 5U63A 2R0PA 3QSEA 1DJQA 3Q9TA 3T14A 5BULA 2WDRA 5J60A 1CJCA 2XLRA 1LTXR 4H2PA 3AD8B 1K0JA 1REOA 2B7RA 1M6IA 1O95A 3NYFA 4J33A 3DJDA 2YG4A 3F8PA 1PJ5A 2BA9A 2YVJA 3VRAA 3DGHA 4Y4NA 2JBVA 3CGEA 4K22A 4AT2A 4E0VA 3FMWA 1UKVG 4KPRA 2WDVA 5FS8A 3UTHA 3CIRA 1ZMCA
chains in the Genus database with same CATH topology
1ZDLA 1D5TA 2Q0LA 3EF6A 3HYVA 4XWZA 5IPYA 2GV8A 2YG5A 3GYXA 4Z43A 4I59A 4IVMB 2YAUA 1RP0A 1PDHA 4BURA 3CMMA 2YLWA 1E39A 4U8LA 3UTFA 3JSKA 4AP3A 2E5VA 3NNEA 3R9UA 3SQPA 1BGJA 3II4A 2BC1A 2YVGA 5EOWA 3HYXA 5KRQA 4TM0A 1IUTA 1GEUA 2BXSA 3V76A 3LXDA 2C64A 4UDPA 2ZZ0A 1TDKA 2JAEA 3DK8A 3FBSA 4GCMA 3UKHA 4NZHA 4J34A 2EQ7A 3WE0A 1MXTA 3GYIA 2BXRA 4Y4LA 3SGLA 3UOYA 3QVRA 2EQ6A 3SZCA 4NTCA 2XYOA 4O5QA 1COYA 4JY2A 3NG7X 1IJHA 1CJ3A 4H4YA 4YWOA 2ARDA 3FPZA 3P1WA 4C5OA 1E1LA 1HYUA 1GV4A 4NNJA 4U8NA 4PAAA 3SX6A 2CVJA 4USRA 4NEWA 1OJAA 4ICYA 5GSNA 1S3EA 3SZ0A 1NHSA 3NIXA 2I0ZA 4CCRA 2Q0KA 4H4PA 4OPTA 2XVIA 1D4DA 2HQMA 3ALLA 3SFDA 2WOWA 3SXIA 2YLZA 4BJYA 4J2WA 4TLZA 1PXCA 1KSUA 1NDAA 4U2SA 3COXA 1E1NA 1VG9A 4H2QA 4A99A 2FJDA 5KMPA 5FS6A 2YLTA 3P4QA 1CHUA 1NG4A 3VRDB 4KX6A 3T2YA 4U8MA 2FBWA 5M0ZA 1GRGA 1H81A 1FEBA 2A89A 3V3OA 4GAVA 2CULA 4YKFA 1CJ2A 1GRTA 1JNZA 4APNA 4C74A 2WU2A 2WS3A 3HZLA 3NN0X 3NTAA 4AOXA 4YSZA 1E6EA 3AD7B 3UKLA 1E1KA 1IUVA 2JB2A 1F8SA 3QSSA 3GMBA 1GALA 4IV9A 2JB1A 2BACA 4EQRA 1EL5A 5FS7A 4K5SA 4NTDA 3AEEA 5KVIA 3GDPA 4LIIA 4Z2UA 4HA6A 2WU5A 1IUWA 3H8IA 3ATRA 5HXIA 3SZWA 1KF6A 4AOSA 4D03A 1GNDA 1ONFA 2C75A 2YLSA 3ISHA 4BK3A 4G74A 4PABA 2RGJA 2WETA 1H83A 3UKKA 3BHFA 2BK5A 2YG3A 1LPFA 3VR9A 2B76A 5KWFA 3RP7A 4OPUA 1BF3A 1BZLA 1S2QA 3AEDA 3BI2A 3DGZA 1P2HA 2VQ7A 4J57A 4OPDA 3AD9B 4BK2A 4YSYA 2WP6A 1VQWA 3D1CA 4X9NA 4B64A 2TMDA 2VZ2A 2VQBA 4EQWA 4M52A 5M10A 5DBJA 2ZBWA 1ZOVA 5CKUA 3LJPA 2ZZCA 2VRMA 5BVAA 1O94A 4C3YA 1GSNA 4GDPA 2WBAA 1O5WA 3AE9A 4YT0A 2YLXA 3UP5A 4MJWA 1YKJA 4C77A 1W4XA 3UCLA 3AE2A 2RABA 2A87A 5HYMA 1B4VA 4H4XA 1AOGA 2WOVA 3B3RA 1RYIA 4G73A 5EBKA 2WQYA 3ABVA 1NENA 2VVLG 2VVLA 2TPRA 4GDEA 1EBDA 1NHQA 2BS4A 2GMJA 2Q7VA 2XLPA 3G5SA 3QJ4A 3RHAA 4A65A 4YTPA 2C76A 1M64A 3NTDA 1Q1WA 5KMQA 2IIDA 1B37A 1VG0A 2GVCA 1ZOYA 3M12A 3O0HA 3BHKA 1N4UA 2YM1A 1N1PA 1GPEA 2WEUA 3CNTA 1ZX9A 2YLRA 1V59A 2JB3A 1B8SA 4USQA 3GD4A 3KPKA 3UP4A 3GMCA 4B65A 2NPXA 4CNKA 3GWFA 1DOBA 1NHPA 2VVMA 4NEVA 3CNJA 3AE5A 2GMHA 2E4GA 1GT8A 3ITJA 4JDRA 2V3AA 4IVOB 4B68A 2DKIA 3DJGX 2GR2A 2XVJA 3IHMA 2BK4A 1CC4A 3IF9A 4BJZA 3HYWA 2BABA 3K30A 2GQWA 3NRNA 5JCIA 1TRBA 1Z6LA 1XANA 1ZP0A 1D4EA 2YG6A 1ZMDA 3BNUA 3CGDA 4OVIA 5BUKA 3C4NA 1QLBA 2EQ8A 2R9ZA 3NGCX 4G6HA 1CJ4A 4CY8A 2NVKX 3GYJA 2Q6UA 3AXBA 1ZK7A 4JQ9A 3S5WA 3SFEA 1FOHA 4ZCDA 2WDQA 2YR5A 1PHHA 3EAOA 3H8LA 3F8RA 1NEKA 1JRYA 4P9SA 2JKCA 4X9MA 1LQTA 4YXDA 3ALMA 4U8IA 4NWZA 3BI5A 3CGBA 4RG3A 1PS9A 4Z24A 5JCKA 1CC2A 5EB5A 1F8WA 3L1RA 2YWLA 3DMEA 3AE3A 4GUVA 4H2NA 1TYPA 1Q1RA 2YVFA 3I6DA 1SEZA 2GAGB 2GAHB 1OJDA 3LADA 3AYJA 4FK1C 4UDQA 4FX9A 1BWCA 1E1MA 2GH5A 1PBEA 2GR0A 1PBFA 1JU2A 4II2A 4OPGA 2C65A 1NPXA 4X4JA 4B69A 2XFUA 4H4QA 4K5RA 5KOWA 2XFNA 3T31A 4Y4MA 4UP3A 2R46A 1ELIA 3QVPA 4A6NB 2H89A 4IA5A 1TDNA 3QSMA 3CGCA 1DNCA 3UKAA 1Y0PA 2OLNA 3CNSA 4JY3A 3NLCA 2C72A 3T2KA 1JRXA 3FIMB 2X99A 4Z2RA 3REDA 1TDOA 4EQXA 1GESA 5J7XA 3KPFA 1GREA 1B5QA 2WP5A 2C66A 2AR8A 2YR4A 4H4RA 4U2TA 2WESA 2CDUA 1GTEA 1K0LA 2WPCA 3DJJA 4NTEA 2F5ZA 4A6NA 4EMWA 4YSXA 3E1TA 3ICSA 3UKQA 4YTNA 2GR1A 4TM3A 3UOXA 2GQFA 4K7ZA 2BRAA 3DH9A 4EMIA 2BC0A 1F6MA 3VRBA 2B9XA 4CCQA 2AAQA 2Y6QA 3NK2X 1FL2A 4A9WA 3AEBA 4UDRA 3G5QA 4JNQA 4OPLA 4Z44A 4OCGA 1MOKA 2EQ9A 2QA2A 1H86A 1S2YA 2V61A 1CF3A 3P4PA 4LU6A 5HHFA 4DGKA 1H84A 2XFOA 1X31B 4IA6A 3SM8A 1GOSA 1IUSA 4I58A 3RP6A 3CPIG 4FK1A 2BYBA 1D7LA 4D04A 1LJ1A 2R45A 2BK3A 3GSIA 3OZ2A 1YY5A 3NYEA 4H2RA 4GF7A 3RP8A 1CBOA 2GB0A 4GRTA 4EM4A 3EPTA 1DXLA 3NN6X 1YQ4A 2WP9A 1Y56A 4U8KA 5KVHA 4CRTA 2H88A 1KFYA 3URHA 2X8CA 3V3NA 1EL8A 3CPHG 2GF3A 3IC9A 5C2TA 1FECA 1TDEA 1D7YA 4C3XA 2ACZA 1JRZA 2C7GA 3AYIA 4EMJA 1NG3A 2YR6A 1H82A 4II3A 3G5RA 5BRTA 2OA1A 4K8DA 4H4UA 4TLXA 5FMHA 5C3JA 2XLUA 2E1MA 3H4KA 1XPQA 4RSLA 3C4AA 3ZYXA 3CTYA 3ICTA 3S61A 5IQ1A 2QCUA 3GRSA 1PBDA 3AE8A 4H4VA 3I3LA 3B6DA 1N4VA 4GR1A 1CL0A 3QFBA 3BI4A 1DOCA 3CN8A 2WOIA 4J36A 4AT0A 2V3BA 1N4WA 2VOUA 3PVCA 4TM4A 2AQJA 3LB8A 1VRQB 1YQZA 3KA7A 1VDCA 4JNAA 1KSSA 1K0IA 4G6GA 2XVFA 4LA1A 3GD3A 1PJ6A 3GDNA 4H4WA 2C3CA 3UOVA 1H7XA 5JCMA 4U8PA 5KMSA 5LV9A 1F3PA 4ADWA 3P9UA 3QFAA 2QAEA 3KVEA 1PXAA 2R4JA 3KLJA 3KU9A 3M0OA 4FDCB 3CNPA 2RGHA 2CFYA 2ZZBA 2PHHA 5GRTA 5JCNA 2FJAA 2XLSA 3NT6A 1PXBA 4OPIA 3IHGA 3UKPA 4H7UA 3DJEA 1PN0A 2X8HA 3L8KA 2YQUA 1CC6A 2FJBA 1KNPA 2W0HA 4H4TA 3DA1A 3LZXA 4DNAA 2C3DA 2XLTA 2GR3A 1ZY8A 2V60A 3NKSA 2V6OA 3C96A 1GTHA 2YM2A 1K4QA 2WPEA 2X50A 5ER0A 3UTGA 5U1OA 2J3NA 3AECA 3AE7A 4GAPA 2B7SA 3Q6JA 2X8GA 5CQFA 4WCTA 3SZFA 2C70A 2VRLA 3PO7A 4CNJA 1NAAA 1Q9IA 3OC4A 4B67A 3ZDNA 2IVEA 2XVEA 3IWAA 4EQSA 1FCDA 2XDOA 1LV0A 2GEWA 3UTEA 3P4RA 3NYCA 4CBQA 4H4SA 1GETA 3D8XA 3K7MX 3AEGA 2YG7A 3AYLA 1FEAA 1H7WA 2BS2A 1JEHA 2QA1A 1PJ7A 1ZKQA 3PS9A 4DSHA 1OJTA 3EANA 4ZN0A 1JNRA 2PYXA 2V5ZA 4YKGA 1S3BA 4CY6A 4WX1A 2B9WA 4H4ZA 2XFQA 3BNMA 2WPFA 3ATQA 1DODA 4REKA 3RNMA 1GRAA 1DJNA 2Y6RA 3SYIA 2GRTA 4A7AA 4EIQA 3AE4A 4EIPA 3AWIA 1JOAA 4U8JA 3T37A 1KDGA 1L0VA 4AP1A 1YQ3A 3DK9A 5KXJA 4Z2TA 4O5UA 3GRTA 3SY4A 4B1BA 2XFPA 1NHRA 4ECHA 1BKWA 1OJCA 3K7QX 2C67A 1E7PA 4OPCA 1L9CA 2R0GA 2RGOA 1OJ9A 2A8XA 1P2EA 5KMRA 2BRYA 3NHOX 1F8RA 2DKHA 5U25A 3GWDA 3AB1A 1GRFA 1GXFA 4B63A 4H50A 5IQ4A 1LQUA 3ADAB 1Y56B 1GERA 4XWRA 2JK6A 3NK1X 5EB4A 4BK1A 4Z26A 4K2XA 1TYTA 3KD9A 4U8OA 2UZZA 3NH3X 1GRBA 1LVLA 3CPJG 1GRHA 1QJDA 3UOZA 2XVHA 2FJEA 2BCGG 3LZWA 4DSGA 1PBBA 1D4CA 2B9YA 3DK4A 1KNRA 5L46A 4EM3A 3UKFA 4JN9A 4YTMA 4G9KA 4B66A 3AE6A 3F8DA 3ALJA 4YSHA 1IUXA 2IVDA 2BCPA 3LOVA 2R4EA 1L9EA 4TM1A 2APGA 5HY5A 4XXGA 2OLOA 4A5LA 1EL7A 2Z5YA 3VQRA 2XCGA 3FG2P 2OAMA 3CNDA 1QO8A 1PBCA 4N9XA 1XHCA 1MO9A 4ZCCA 5KOXA 2OALA 3K7TA 2C73A 5TR3A 1L9DA 2Z5XA 5KNLA 1BGNA 3NK0X 4Z25A 4HB9A 2R0CA 5JCLA 3P4SA 3AEAA 1EL9A 3M13A 2WHDA 2X3NA 4J56A 1XDIA 2C4CA 3KKJA 1H6VA 3T0KA 3T2ZA 3VR8A 4BV6A 2O9ZA 3AE1A 5FS9A 1DOEA 3AEFA 2BS3A 3ICRA 4A79A 1RSGA 4J31A 4RG4A 1TDFA 1IUUA 4U2LA 5U63A 2R0PA 3QSEA 1DJQA 3Q9TA 3T14A 5BULA 2WDRA 5J60A 1CJCA 2XLRA 1LTXR 4H2PA 3AD8B 1K0JA 1REOA 2B7RA 1M6IA 1O95A 3NYFA 4J33A 3DJDA 2YG4A 3F8PA 1PJ5A 2BA9A 2YVJA 3VRAA 3DGHA 4Y4NA 2JBVA 3CGEA 4K22A 4AT2A 4E0VA 3FMWA 1UKVG 4KPRA 2WDVA 5FS8A 3UTHA 3CIRA 1ZMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDL A;  1D5T A;  2Q0L A;  3EF6 A;  4XWZ A;  5IPY A;  2GV8 A;  2YG5 A;  4Z43 A;  4I59 A;  4IVM B;  2YAU A;  1RP0 A;  1PDH A;  4BUR A;  2YLW A;  1E39 A;  4U8L A;  3UTF A;  3JSK A;  4AP3 A;  2E5V A;  3NNE A;  3R9U A;  3SQP A;  1BGJ A;  3II4 A;  2BC1 A;  2YVG A;  5EOW A;  5KRQ A;  4TM0 A;  1IUT A;  1GEU A;  2BXS A;  3V76 A;  3LXD A;  2C64 A;  4UDP A;  2ZZ0 A;  1TDK A;  2JAE A;  3DK8 A;  3FBS A;  4GCM A;  3UKH A;  4NZH A;  4J34 A;  2EQ7 A;  3WE0 A;  1MXT A;  3GYI A;  2BXR A;  4Y4L A;  3SGL A;  3UOY A;  3QVR A;  2EQ6 A;  4NTC A;  2XYO A;  4O5Q A;  1COY A;  4JY2 A;  3NG7 X;  1IJH A;  1CJ3 A;  4H4Y A;  4YWO A;  2ARD A;  3FPZ A;  3P1W A;  4C5O A;  1E1L A;  1HYU A;  1GV4 A;  4U8N A;  4PAA A;  2CVJ A;  4USR A;  4NEW A;  1OJA A;  4ICY A;  5GSN A;  1S3E A;  4CCR A;  1NHS A;  3NIX A;  2I0Z A;  2Q0K A;  4H4P A;  4OPT A;  2XVI A;  1D4D A;  2HQM A;  3ALL A;  3SFD A;  2WOW A;  2YLZ A;  4BJY A;  4J2W A;  4TLZ A;  1PXC A;  1KSU A;  1NDA A;  4U2S A;  3COX A;  1E1N A;  1VG9 A;  4H2Q A;  4A99 A;  2FJD A;  5FS6 A;  2YLT A;  3P4Q A;  1CHU A;  1NG4 A;  3VRD B;  4KX6 A;  4U8M A;  2FBW A;  5M0Z A;  1GRG A;  1H81 A;  1FEB A;  2A89 A;  3V3O A;  2CUL A;  4YKF A;  1CJ2 A;  1GRT A;  1JNZ A;  4APN A;  4C74 A;  2WU2 A;  2WS3 A;  3HZL A;  3NN0 X;  3NTA A;  4AOX A;  4YSZ A;  1E6E A;  3AD7 B;  3UKL A;  1E1K A;  1IUV A;  2JB2 A;  1F8S A;  3QSS A;  3GMB A;  1GAL A;  4IV9 A;  2JB1 A;  2BAC A;  4EQR A;  1EL5 A;  5FS7 A;  4K5S A;  4NTD A;  3AEE A;  5KVI A;  3GDP A;  4LII A;  4Z2U A;  4HA6 A;  2WU5 A;  1IUW A;  3H8I A;  3ATR A;  5HXI A;  1KF6 A;  4AOS A;  4D03 A;  1GND A;  1ONF A;  2C75 A;  2YLS A;  3ISH A;  4BK3 A;  4PAB A;  2RGJ A;  2WET A;  1H83 A;  3UKK A;  3BHF A;  2BK5 A;  2YG3 A;  1LPF A;  3VR9 A;  2B76 A;  5KWF A;  3RP7 A;  4OPU A;  1BF3 A;  1BZL A;  1S2Q A;  3AED A;  3BI2 A;  3DGZ A;  1P2H A;  2VQ7 A;  4J57 A;  4OPD A;  3AD9 B;  4YSY A;  2WP6 A;  1VQW A;  3D1C A;  4X9N A;  4B64 A;  2TMD A;  2VZ2 A;  2VQB A;  4EQW A;  4M52 A;  5M10 A;  5DBJ A;  2ZBW A;  1ZOV A;  5CKU A;  3LJP A;  2ZZC A;  2VRM A;  5BVA A;  1O94 A;  4C3Y A;  1GSN A;  4GDP A;  2WBA A;  1O5W A;  3AE9 A;  4YT0 A;  2YLX A;  3UP5 A;  4MJW A;  1YKJ A;  4C77 A;  1W4X A;  3UCL A;  3AE2 A;  2RAB A;  2A87 A;  5HYM A;  1B4V A;  4H4X A;  1AOG A;  2WOV A;  3B3R A;  1RYI A;  5EBK A;  2WQY A;  3ABV A;  1NEN A;  2VVL G;  2VVL A;  2TPR A;  4GDE A;  1EBD A;  1NHQ A;  2BS4 A;  2GMJ A;  2Q7V A;  2XLP A;  3G5S A;  3QJ4 A;  3RHA A;  4A65 A;  4YTP A;  2C76 A;  1M64 A;  3NTD A;  1Q1W A;  2IID A;  1B37 A;  1VG0 A;  2GVC A;  1ZOY A;  3M12 A;  3O0H A;  3BHK A;  1N4U A;  2YM1 A;  1N1P A;  1GPE A;  2WEU A;  3CNT A;  1ZX9 A;  2YLR A;  1V59 A;  2JB3 A;  1B8S A;  4USQ A;  3GD4 A;  3UP4 A;  3GMC A;  4B65 A;  2NPX A;  4CNK A;  3GWF A;  1DOB A;  1NHP A;  2VVM A;  4NEV A;  3CNJ A;  3AE5 A;  2GMH A;  2E4G A;  1GT8 A;  3ITJ A;  4JDR A;  2V3A A;  4IVO B;  4B68 A;  2DKI A;  3DJG X;  2GR2 A;  2XVJ A;  3IHM A;  2BK4 A;  1CC4 A;  3IF9 A;  4BJZ A;  3K30 A;  2BAB A;  2GQW A;  3NRN A;  5JCI A;  1TRB A;  1Z6L A;  1XAN A;  1ZP0 A;  1D4E A;  2YG6 A;  1ZMD A;  3BNU A;  3CGD A;  4OVI A;  5BUK A;  3C4N A;  1QLB A;  2EQ8 A;  2R9Z A;  3NGC X;  4CY8 A;  1CJ4 A;  2NVK X;  3GYJ A;  2Q6U A;  3AXB A;  1ZK7 A;  4JQ9 A;  3S5W A;  3SFE A;  1FOH A;  4ZCD A;  2WDQ A;  2YR5 A;  1PHH A;  3EAO A;  3H8L A;  3F8R A;  1NEK A;  1JRY A;  4P9S A;  2JKC A;  4X9M A;  1LQT A;  4YXD A;  3ALM A;  4U8I A;  3BI5 A;  3CGB A;  4RG3 A;  1PS9 A;  4Z24 A;  5JCK A;  1CC2 A;  5EB5 A;  1F8W A;  3L1R A;  2YWL A;  3DME A;  3AE3 A;  4GUV A;  4H2N A;  1TYP A;  1Q1R A;  2YVF A;  3I6D A;  1SEZ A;  2GAG B;  2GAH B;  1OJD A;  3LAD A;  3AYJ A;  4FK1 C;  4UDQ A;  4FX9 A;  1BWC A;  1E1M A;  2GH5 A;  1PBE A;  2GR0 A;  1PBF A;  1JU2 A;  4OPG A;  2C65 A;  1NPX A;  4X4J A;  4B69 A;  2XFU A;  4H4Q A;  4K5R A;  5KOW A;  2XFN A;  4Y4M A;  4UP3 A;  2R46 A;  1ELI A;  3QVP A;  4A6N B;  2H89 A;  4IA5 A;  1TDN A;  3QSM A;  3CGC A;  1DNC A;  3UKA A;  1Y0P A;  2OLN A;  3CNS A;  4JY3 A;  3NLC A;  2C72 A;  1JRX A;  3FIM B;  2X99 A;  4Z2R A;  3RED A;  1TDO A;  4EQX A;  1GES A;  5J7X A;  3KPF A;  1GRE A;  1B5Q A;  2WP5 A;  2C66 A;  2AR8 A;  2YR4 A;  4H4R A;  4U2T A;  2WES A;  2CDU A;  1GTE A;  1K0L A;  2WPC A;  3DJJ A;  4NTE A;  2F5Z A;  4A6N A;  4EMW A;  4YSX A;  3E1T A;  3ICS A;  3UKQ A;  4YTN A;  2GR1 A;  4TM3 A;  3UOX A;  2GQF A;  4K7Z A;  3DH9 A;  4EMI A;  2BC0 A;  1F6M A;  3VRB A;  2B9X A;  4CCQ A;  2AAQ A;  2Y6Q A;  3NK2 X;  1FL2 A;  4A9W A;  3AEB A;  4UDR A;  3G5Q A;  4JNQ A;  4OPL A;  4Z44 A;  4OCG A;  1MOK A;  2EQ9 A;  2QA2 A;  1H86 A;  1S2Y A;  2V61 A;  1CF3 A;  3P4P A;  4LU6 A;  5HHF A;  4DGK A;  1H84 A;  2XFO A;  1X31 B;  4IA6 A;  3SM8 A;  1GOS A;  1IUS A;  4I58 A;  3RP6 A;  3CPI G;  4FK1 A;  2BYB A;  1D7L A;  4D04 A;  1LJ1 A;  2R45 A;  2BK3 A;  3GSI A;  3OZ2 A;  1YY5 A;  3NYE A;  4H2R A;  4GF7 A;  3RP8 A;  1CBO A;  2GB0 A;  4GRT A;  4EM4 A;  3EPT A;  1DXL A;  3NN6 X;  1YQ4 A;  2WP9 A;  1Y56 A;  4U8K A;  5KVH A;  4CRT A;  2H88 A;  1KFY A;  3URH A;  2X8C A;  3V3N A;  1EL8 A;  3CPH G;  2GF3 A;  3IC9 A;  5C2T A;  1FEC A;  1TDE A;  1D7Y A;  4C3X A;  2ACZ A;  1JRZ A;  2C7G A;  3AYI A;  4EMJ A;  1NG3 A;  2YR6 A;  1H82 A;  3G5R A;  5BRT A;  2OA1 A;  4K8D A;  4H4U A;  4TLX A;  5FMH A;  5C3J A;  2XLU A;  2E1M A;  3H4K A;  1XPQ A;  4RSL A;  3C4A A;  3ZYX A;  3CTY A;  3ICT A;  3S61 A;  5IQ1 A;  2QCU A;  3GRS A;  1PBD A;  3AE8 A;  4H4V A;  3I3L A;  3B6D A;  1N4V A;  4GR1 A;  1CL0 A;  3QFB A;  3BI4 A;  1DOC A;  3CN8 A;  2WOI A;  4J36 A;  4AT0 A;  2V3B A;  1N4W A;  2VOU A;  3PVC A;  4TM4 A;  2AQJ A;  3LB8 A;  1VRQ B;  1YQZ A;  3KA7 A;  1VDC A;  4JNA A;  1KSS A;  1K0I A;  2XVF A;  4LA1 A;  3GD3 A;  1PJ6 A;  3GDN A;  4H4W A;  2C3C A;  3UOV A;  1H7X A;  5JCM A;  4U8P A;  5LV9 A;  1F3P A;  4ADW A;  3P9U A;  3QFA A;  2QAE A;  3KVE A;  1PXA A;  2R4J A;  3KLJ A;  3KU9 A;  3M0O A;  4FDC B;  3CNP A;  2RGH A;  2CFY A;  2ZZB A;  2PHH A;  5GRT A;  5JCN A;  2FJA A;  2XLS A;  3NT6 A;  1PXB A;  4OPI A;  3IHG A;  3UKP A;  4H7U A;  3DJE A;  1PN0 A;  2X8H A;  3L8K A;  2YQU A;  1CC6 A;  2FJB A;  1KNP A;  2W0H A;  4H4T A;  3DA1 A;  3LZX A;  4DNA A;  2C3D A;  2XLT A;  2GR3 A;  1ZY8 A;  2V60 A;  3NKS A;  2V6O A;  3C96 A;  1GTH A;  2YM2 A;  1K4Q A;  2WPE A;  2X50 A;  5ER0 A;  3UTG A;  5U1O A;  2J3N A;  3AEC A;  3AE7 A;  2B7S A;  3Q6J A;  2X8G A;  5CQF A;  4WCT A;  2C70 A;  2VRL A;  3PO7 A;  4CNJ A;  1NAA A;  1Q9I A;  3OC4 A;  4B67 A;  3ZDN A;  2IVE A;  2XVE A;  3IWA A;  4EQS A;  1FCD A;  2XDO A;  1LV0 A;  2GEW A;  3UTE A;  3P4R A;  3NYC A;  4CBQ A;  4H4S A;  1GET A;  3D8X A;  3K7M X;  3AEG A;  2YG7 A;  3AYL A;  1FEA A;  1H7W A;  2BS2 A;  1JEH A;  2QA1 A;  1PJ7 A;  1ZKQ A;  3PS9 A;  4DSH A;  1OJT A;  3EAN A;  4ZN0 A;  1JNR A;  2PYX A;  2V5Z A;  4YKG A;  1S3B A;  4CY6 A;  4WX1 A;  2B9W A;  4H4Z A;  2XFQ A;  3BNM A;  2WPF A;  3ATQ A;  1DOD A;  4REK A;  3RNM A;  1GRA A;  1DJN A;  2Y6R A;  2GRT A;  4A7A A;  4EIQ A;  3AE4 A;  4EIP A;  3AWI A;  1JOA A;  4U8J A;  3T37 A;  1KDG A;  1L0V A;  4AP1 A;  1YQ3 A;  3DK9 A;  5KXJ A;  4Z2T A;  4O5U A;  3GRT A;  4B1B A;  2XFP A;  1NHR A;  4ECH A;  1BKW A;  1OJC A;  3K7Q X;  2C67 A;  1E7P A;  4OPC A;  1L9C A;  2R0G A;  2RGO A;  1OJ9 A;  2A8X A;  1P2E A;  3NHO X;  1F8R A;  2DKH A;  5U25 A;  3GWD A;  3AB1 A;  1GRF A;  1GXF A;  4B63 A;  4H50 A;  5IQ4 A;  1LQU A;  3ADA B;  1Y56 B;  1GER A;  4XWR A;  2JK6 A;  3NK1 X;  5EB4 A;  4BK1 A;  4Z26 A;  4K2X A;  1TYT A;  3KD9 A;  4U8O A;  2UZZ A;  3NH3 X;  1GRB A;  1LVL A;  3CPJ G;  1GRH A;  1QJD A;  3UOZ A;  2XVH A;  2FJE A;  2BCG G;  3LZW A;  4DSG A;  1PBB A;  1D4C A;  2B9Y A;  3DK4 A;  1KNR A;  5L46 A;  4EM3 A;  3UKF A;  4JN9 A;  4YTM A;  4B66 A;  3AE6 A;  3F8D A;  3ALJ A;  4YSH A;  1IUX A;  2IVD A;  2BCP A;  3LOV A;  2R4E A;  1L9E A;  4TM1 A;  2APG A;  5HY5 A;  4XXG A;  2OLO A;  4A5L A;  1EL7 A;  2Z5Y A;  3VQR A;  2XCG A;  3FG2 P;  2OAM A;  3CND A;  1QO8 A;  1PBC A;  4N9X A;  1XHC A;  1MO9 A;  4ZCC A;  5KOX A;  2OAL A;  3K7T A;  2C73 A;  5TR3 A;  1L9D A;  2Z5X A;  1BGN A;  3NK0 X;  4Z25 A;  4HB9 A;  2R0C A;  5JCL A;  3P4S A;  3AEA A;  1EL9 A;  3M13 A;  2WHD A;  2X3N A;  4J56 A;  1XDI A;  4BK2 A;  3KKJ A;  1H6V A;  3VR8 A;  4BV6 A;  2O9Z A;  3AE1 A;  5FS9 A;  1DOE A;  3AEF A;  2BS3 A;  3ICR A;  4A79 A;  1RSG A;  4J31 A;  4RG4 A;  1TDF A;  1IUU A;  4U2L A;  5U63 A;  2R0P A;  3QSE A;  1DJQ A;  3Q9T A;  5BUL A;  2WDR A;  5J60 A;  1CJC A;  2XLR A;  1LTX R;  4H2P A;  3AD8 B;  1K0J A;  1REO A;  2B7R A;  1M6I A;  1O95 A;  3NYF A;  4J33 A;  3DJD A;  2YG4 A;  3F8P A;  1PJ5 A;  2BA9 A;  2YVJ A;  3VRA A;  3DGH A;  4Y4N A;  2JBV A;  3CGE A;  4K22 A;  4AT2 A;  4E0V A;  3FMW A;  1UKV G;  4KPR A;  2WDV A;  5FS8 A;  3UTH A;  3CIR A;  1ZMC A; 
#chains in the Genus database with same CATH topology
 1ZDL A;  1D5T A;  2Q0L A;  3EF6 A;  3HYV A;  4XWZ A;  5IPY A;  2GV8 A;  2YG5 A;  3GYX A;  4Z43 A;  4I59 A;  4IVM B;  2YAU A;  1RP0 A;  1PDH A;  4BUR A;  3CMM A;  2YLW A;  1E39 A;  4U8L A;  3UTF A;  3JSK A;  4AP3 A;  2E5V A;  3NNE A;  3R9U A;  3SQP A;  1BGJ A;  3II4 A;  2BC1 A;  2YVG A;  5EOW A;  3HYX A;  5KRQ A;  4TM0 A;  1IUT A;  1GEU A;  2BXS A;  3V76 A;  3LXD A;  2C64 A;  4UDP A;  2ZZ0 A;  1TDK A;  2JAE A;  3DK8 A;  3FBS A;  4GCM A;  3UKH A;  4NZH A;  4J34 A;  2EQ7 A;  3WE0 A;  1MXT A;  3GYI A;  2BXR A;  4Y4L A;  3SGL A;  3UOY A;  3QVR A;  2EQ6 A;  3SZC A;  4NTC A;  2XYO A;  4O5Q A;  1COY A;  4JY2 A;  3NG7 X;  1IJH A;  1CJ3 A;  4H4Y A;  4YWO A;  2ARD A;  3FPZ A;  3P1W A;  4C5O A;  1E1L A;  1HYU A;  1GV4 A;  4NNJ A;  4U8N A;  4PAA A;  3SX6 A;  2CVJ A;  4USR A;  4NEW A;  1OJA A;  4ICY A;  5GSN A;  1S3E A;  3SZ0 A;  1NHS A;  3NIX A;  2I0Z A;  4CCR A;  2Q0K A;  4H4P A;  4OPT A;  2XVI A;  1D4D A;  2HQM A;  3ALL A;  3SFD A;  2WOW A;  3SXI A;  2YLZ A;  4BJY A;  4J2W A;  4TLZ A;  1PXC A;  1KSU A;  1NDA A;  4U2S A;  3COX A;  1E1N A;  1VG9 A;  4H2Q A;  4A99 A;  2FJD A;  5KMP A;  5FS6 A;  2YLT A;  3P4Q A;  1CHU A;  1NG4 A;  3VRD B;  4KX6 A;  3T2Y A;  4U8M A;  2FBW A;  5M0Z A;  1GRG A;  1H81 A;  1FEB A;  2A89 A;  3V3O A;  4GAV A;  2CUL A;  4YKF A;  1CJ2 A;  1GRT A;  1JNZ A;  4APN A;  4C74 A;  2WU2 A;  2WS3 A;  3HZL A;  3NN0 X;  3NTA A;  4AOX A;  4YSZ A;  1E6E A;  3AD7 B;  3UKL A;  1E1K A;  1IUV A;  2JB2 A;  1F8S A;  3QSS A;  3GMB A;  4IV9 A;  1GAL A;  2JB1 A;  2BAC A;  4EQR A;  1EL5 A;  5FS7 A;  4K5S A;  4NTD A;  3AEE A;  5KVI A;  3GDP A;  4LII A;  4Z2U A;  4HA6 A;  2WU5 A;  1IUW A;  3H8I A;  3ATR A;  5HXI A;  3SZW A;  1KF6 A;  4AOS A;  4D03 A;  1GND A;  1ONF A;  2C75 A;  2YLS A;  3ISH A;  4BK3 A;  4G74 A;  4PAB A;  2RGJ A;  2WET A;  1H83 A;  3UKK A;  3BHF A;  2BK5 A;  2YG3 A;  1LPF A;  3VR9 A;  2B76 A;  5KWF A;  3RP7 A;  4OPU A;  1BF3 A;  1BZL A;  1S2Q A;  3AED A;  3BI2 A;  3DGZ A;  1P2H A;  2VQ7 A;  4J57 A;  4OPD A;  3AD9 B;  4BK2 A;  4YSY A;  2WP6 A;  1VQW A;  3D1C A;  4X9N A;  4B64 A;  2TMD A;  2VZ2 A;  2VQB A;  4EQW A;  4M52 A;  5M10 A;  5DBJ A;  2ZBW A;  1ZOV A;  5CKU A;  3LJP A;  2ZZC A;  2VRM A;  5BVA A;  1O94 A;  4C3Y A;  1GSN A;  4GDP A;  2WBA A;  1O5W A;  3AE9 A;  4YT0 A;  2YLX A;  3UP5 A;  4MJW A;  1YKJ A;  4C77 A;  1W4X A;  3UCL A;  3AE2 A;  2RAB A;  2A87 A;  5HYM A;  1B4V A;  4H4X A;  1AOG A;  2WOV A;  3B3R A;  1RYI A;  4G73 A;  5EBK A;  2WQY A;  3ABV A;  1NEN A;  2VVL G;  2VVL A;  2TPR A;  4GDE A;  1EBD A;  1NHQ A;  2BS4 A;  2GMJ A;  2Q7V A;  2XLP A;  3G5S A;  3QJ4 A;  3RHA A;  4A65 A;  4YTP A;  2C76 A;  1M64 A;  3NTD A;  1Q1W A;  5KMQ A;  2IID A;  1B37 A;  1VG0 A;  2GVC A;  1ZOY A;  3M12 A;  3O0H A;  3BHK A;  1N4U A;  2YM1 A;  1N1P A;  1GPE A;  2WEU A;  3CNT A;  1ZX9 A;  2YLR A;  1V59 A;  2JB3 A;  1B8S A;  4USQ A;  3GD4 A;  3KPK A;  3UP4 A;  3GMC A;  4B65 A;  2NPX A;  4CNK A;  3GWF A;  1DOB A;  1NHP A;  2VVM A;  4NEV A;  3CNJ A;  3AE5 A;  2GMH A;  2E4G A;  1GT8 A;  3ITJ A;  4JDR A;  2V3A A;  4IVO B;  4B68 A;  2DKI A;  3DJG X;  2GR2 A;  2XVJ A;  3IHM A;  2BK4 A;  1CC4 A;  3IF9 A;  4BJZ A;  3HYW A;  2BAB A;  3K30 A;  2GQW A;  3NRN A;  5JCI A;  1TRB A;  1Z6L A;  1XAN A;  1ZP0 A;  1D4E A;  2YG6 A;  1ZMD A;  3BNU A;  3CGD A;  4OVI A;  5BUK A;  3C4N A;  1QLB A;  2EQ8 A;  2R9Z A;  3NGC X;  4G6H A;  1CJ4 A;  4CY8 A;  2NVK X;  3GYJ A;  2Q6U A;  3AXB A;  1ZK7 A;  4JQ9 A;  3S5W A;  3SFE A;  1FOH A;  4ZCD A;  2WDQ A;  2YR5 A;  1PHH A;  3EAO A;  3H8L A;  3F8R A;  1NEK A;  1JRY A;  4P9S A;  2JKC A;  4X9M A;  1LQT A;  4YXD A;  3ALM A;  4U8I A;  4NWZ A;  3BI5 A;  3CGB A;  4RG3 A;  1PS9 A;  4Z24 A;  5JCK A;  1CC2 A;  5EB5 A;  1F8W A;  3L1R A;  2YWL A;  3DME A;  3AE3 A;  4GUV A;  4H2N A;  1TYP A;  1Q1R A;  2YVF A;  3I6D A;  1SEZ A;  2GAG B;  2GAH B;  1OJD A;  3LAD A;  3AYJ A;  4FK1 C;  4UDQ A;  4FX9 A;  1BWC A;  1E1M A;  2GH5 A;  1PBE A;  2GR0 A;  1PBF A;  1JU2 A;  4II2 A;  4OPG A;  2C65 A;  1NPX A;  4X4J A;  4B69 A;  2XFU A;  4H4Q A;  4K5R A;  5KOW A;  2XFN A;  3T31 A;  4Y4M A;  4UP3 A;  2R46 A;  1ELI A;  3QVP A;  4A6N B;  2H89 A;  4IA5 A;  1TDN A;  3QSM A;  3CGC A;  1DNC A;  3UKA A;  1Y0P A;  2OLN A;  3CNS A;  4JY3 A;  3NLC A;  2C72 A;  3T2K A;  1JRX A;  3FIM B;  2X99 A;  4Z2R A;  3RED A;  1TDO A;  4EQX A;  1GES A;  5J7X A;  3KPF A;  1GRE A;  1B5Q A;  2WP5 A;  2C66 A;  2AR8 A;  2YR4 A;  4H4R A;  4U2T A;  2WES A;  2CDU A;  1GTE A;  1K0L A;  2WPC A;  3DJJ A;  4NTE A;  2F5Z A;  4A6N A;  4EMW A;  4YSX A;  3E1T A;  3ICS A;  3UKQ A;  4YTN A;  2GR1 A;  4TM3 A;  3UOX A;  2GQF A;  4K7Z A;  2BRA A;  3DH9 A;  4EMI A;  2BC0 A;  1F6M A;  3VRB A;  2B9X A;  4CCQ A;  2AAQ A;  2Y6Q A;  3NK2 X;  1FL2 A;  4A9W A;  3AEB A;  4UDR A;  3G5Q A;  4JNQ A;  4OPL A;  4Z44 A;  4OCG A;  1MOK A;  2EQ9 A;  2QA2 A;  1H86 A;  1S2Y A;  2V61 A;  1CF3 A;  3P4P A;  4LU6 A;  5HHF A;  4DGK A;  1H84 A;  2XFO A;  1X31 B;  4IA6 A;  3SM8 A;  1GOS A;  1IUS A;  4I58 A;  3RP6 A;  3CPI G;  4FK1 A;  2BYB A;  1D7L A;  4D04 A;  1LJ1 A;  2R45 A;  2BK3 A;  3GSI A;  3OZ2 A;  1YY5 A;  3NYE A;  4H2R A;  4GF7 A;  3RP8 A;  1CBO A;  2GB0 A;  4GRT A;  4EM4 A;  3EPT A;  1DXL A;  3NN6 X;  1YQ4 A;  2WP9 A;  1Y56 A;  4U8K A;  5KVH A;  4CRT A;  2H88 A;  1KFY A;  3URH A;  2X8C A;  3V3N A;  1EL8 A;  3CPH G;  2GF3 A;  3IC9 A;  5C2T A;  1FEC A;  1TDE A;  1D7Y A;  4C3X A;  2ACZ A;  1JRZ A;  2C7G A;  3AYI A;  4EMJ A;  1NG3 A;  2YR6 A;  1H82 A;  4II3 A;  3G5R A;  5BRT A;  2OA1 A;  4K8D A;  4H4U A;  4TLX A;  5FMH A;  5C3J A;  2XLU A;  2E1M A;  3H4K A;  1XPQ A;  4RSL A;  3C4A A;  3ZYX A;  3CTY A;  3ICT A;  3S61 A;  5IQ1 A;  2QCU A;  3GRS A;  1PBD A;  3AE8 A;  4H4V A;  3I3L A;  3B6D A;  1N4V A;  4GR1 A;  1CL0 A;  3QFB A;  3BI4 A;  1DOC A;  3CN8 A;  2WOI A;  4J36 A;  4AT0 A;  2V3B A;  1N4W A;  2VOU A;  3PVC A;  4TM4 A;  2AQJ A;  3LB8 A;  1VRQ B;  1YQZ A;  3KA7 A;  1VDC A;  4JNA A;  1KSS A;  1K0I A;  4G6G A;  2XVF A;  4LA1 A;  3GD3 A;  1PJ6 A;  3GDN A;  4H4W A;  2C3C A;  3UOV A;  1H7X A;  5JCM A;  4U8P A;  5KMS A;  5LV9 A;  1F3P A;  4ADW A;  3P9U A;  3QFA A;  2QAE A;  3KVE A;  1PXA A;  2R4J A;  3KLJ A;  3KU9 A;  3M0O A;  4FDC B;  3CNP A;  2RGH A;  2CFY A;  2ZZB A;  2PHH A;  5GRT A;  5JCN A;  2FJA A;  2XLS A;  3NT6 A;  1PXB A;  4OPI A;  3IHG A;  3UKP A;  4H7U A;  3DJE A;  1PN0 A;  2X8H A;  3L8K A;  2YQU A;  1CC6 A;  2FJB A;  1KNP A;  2W0H A;  4H4T A;  3DA1 A;  3LZX A;  4DNA A;  2C3D A;  2XLT A;  2GR3 A;  1ZY8 A;  2V60 A;  3NKS A;  2V6O A;  3C96 A;  1GTH A;  2YM2 A;  1K4Q A;  2WPE A;  2X50 A;  5ER0 A;  3UTG A;  5U1O A;  2J3N A;  3AEC A;  3AE7 A;  4GAP A;  2B7S A;  3Q6J A;  2X8G A;  5CQF A;  4WCT A;  3SZF A;  2C70 A;  2VRL A;  3PO7 A;  4CNJ A;  1NAA A;  1Q9I A;  3OC4 A;  4B67 A;  3ZDN A;  2IVE A;  2XVE A;  3IWA A;  4EQS A;  1FCD A;  2XDO A;  1LV0 A;  2GEW A;  3UTE A;  3P4R A;  3NYC A;  4CBQ A;  4H4S A;  1GET A;  3D8X A;  3K7M X;  3AEG A;  2YG7 A;  3AYL A;  1FEA A;  1H7W A;  2BS2 A;  1JEH A;  2QA1 A;  1PJ7 A;  1ZKQ A;  3PS9 A;  4DSH A;  1OJT A;  3EAN A;  4ZN0 A;  1JNR A;  2PYX A;  2V5Z A;  4YKG A;  1S3B A;  4CY6 A;  4WX1 A;  2B9W A;  4H4Z A;  2XFQ A;  3BNM A;  2WPF A;  3ATQ A;  1DOD A;  4REK A;  3RNM A;  1GRA A;  1DJN A;  2Y6R A;  3SYI A;  2GRT A;  4A7A A;  4EIQ A;  3AE4 A;  4EIP A;  3AWI A;  1JOA A;  4U8J A;  3T37 A;  1KDG A;  1L0V A;  4AP1 A;  1YQ3 A;  3DK9 A;  5KXJ A;  4Z2T A;  4O5U A;  3GRT A;  3SY4 A;  4B1B A;  2XFP A;  1NHR A;  4ECH A;  1BKW A;  1OJC A;  3K7Q X;  2C67 A;  1E7P A;  4OPC A;  1L9C A;  2R0G A;  2RGO A;  1OJ9 A;  2A8X A;  1P2E A;  5KMR A;  2BRY A;  3NHO X;  1F8R A;  2DKH A;  5U25 A;  3GWD A;  3AB1 A;  1GRF A;  1GXF A;  4B63 A;  4H50 A;  5IQ4 A;  1LQU A;  3ADA B;  1Y56 B;  1GER A;  4XWR A;  2JK6 A;  3NK1 X;  5EB4 A;  4BK1 A;  4Z26 A;  4K2X A;  1TYT A;  3KD9 A;  4U8O A;  2UZZ A;  3NH3 X;  1GRB A;  1LVL A;  3CPJ G;  1GRH A;  1QJD A;  3UOZ A;  2XVH A;  2FJE A;  2BCG G;  3LZW A;  4DSG A;  1PBB A;  2B9Y A;  1D4C A;  3DK4 A;  1KNR A;  5L46 A;  4EM3 A;  3UKF A;  4JN9 A;  4YTM A;  4G9K A;  4B66 A;  3AE6 A;  3F8D A;  3ALJ A;  4YSH A;  1IUX A;  2IVD A;  2BCP A;  3LOV A;  2R4E A;  1L9E A;  4TM1 A;  2APG A;  5HY5 A;  4XXG A;  2OLO A;  4A5L A;  1EL7 A;  2Z5Y A;  3VQR A;  2XCG A;  3FG2 P;  2OAM A;  3CND A;  1QO8 A;  1PBC A;  4N9X A;  1XHC A;  1MO9 A;  4ZCC A;  5KOX A;  2OAL A;  3K7T A;  2C73 A;  5TR3 A;  1L9D A;  2Z5X A;  5KNL A;  1BGN A;  3NK0 X;  4Z25 A;  4HB9 A;  2R0C A;  5JCL A;  3P4S A;  3AEA A;  1EL9 A;  3M13 A;  2WHD A;  2X3N A;  4J56 A;  1XDI A;  2C4C A;  3KKJ A;  1H6V A;  3T0K A;  3T2Z A;  3VR8 A;  4BV6 A;  2O9Z A;  3AE1 A;  5FS9 A;  1DOE A;  3AEF A;  2BS3 A;  3ICR A;  4A79 A;  1RSG A;  4J31 A;  4RG4 A;  1TDF A;  1IUU A;  4U2L A;  5U63 A;  2R0P A;  3QSE A;  1DJQ A;  3Q9T A;  3T14 A;  5BUL A;  2WDR A;  5J60 A;  1CJC A;  2XLR A;  1LTX R;  4H2P A;  3AD8 B;  1K0J A;  1REO A;  2B7R A;  1M6I A;  1O95 A;  3NYF A;  4J33 A;  3DJD A;  2YG4 A;  3F8P A;  1PJ5 A;  2BA9 A;  2YVJ A;  3VRA A;  3DGH A;  4Y4N A;  2JBV A;  3CGE A;  4K22 A;  4AT2 A;  4E0V A;  3FMW A;  1UKV G;  4KPR A;  2WDV A;  5FS8 A;  3UTH A;  3CIR A;  1ZMC A; 
#chains in the Genus database with same CATH homology
 1ZDL A;  1D5T A;  2Q0L A;  3EF6 A;  3HYV A;  4XWZ A;  5IPY A;  2GV8 A;  2YG5 A;  3GYX A;  4Z43 A;  4I59 A;  4IVM B;  2YAU A;  1RP0 A;  1PDH A;  4BUR A;  3CMM A;  2YLW A;  1E39 A;  4U8L A;  3UTF A;  3JSK A;  4AP3 A;  2E5V A;  3NNE A;  3R9U A;  3SQP A;  1BGJ A;  3II4 A;  2BC1 A;  2YVG A;  5EOW A;  3HYX A;  5KRQ A;  4TM0 A;  1IUT A;  1GEU A;  2BXS A;  3V76 A;  3LXD A;  2C64 A;  4UDP A;  2ZZ0 A;  1TDK A;  2JAE A;  3DK8 A;  3FBS A;  4GCM A;  3UKH A;  4NZH A;  4J34 A;  2EQ7 A;  3WE0 A;  1MXT A;  3GYI A;  2BXR A;  4Y4L A;  3SGL A;  3UOY A;  3QVR A;  2EQ6 A;  3SZC A;  4NTC A;  2XYO A;  4O5Q A;  1COY A;  4JY2 A;  3NG7 X;  1IJH A;  1CJ3 A;  4H4Y A;  4YWO A;  2ARD A;  3FPZ A;  3P1W A;  4C5O A;  1E1L A;  1HYU A;  1GV4 A;  4NNJ A;  4U8N A;  4PAA A;  3SX6 A;  2CVJ A;  4USR A;  4NEW A;  1OJA A;  4ICY A;  5GSN A;  1S3E A;  3SZ0 A;  1NHS A;  3NIX A;  2I0Z A;  4CCR A;  2Q0K A;  4H4P A;  4OPT A;  2XVI A;  1D4D A;  2HQM A;  3ALL A;  3SFD A;  2WOW A;  3SXI A;  2YLZ A;  4BJY A;  4J2W A;  4TLZ A;  1PXC A;  1KSU A;  1NDA A;  4U2S A;  3COX A;  1E1N A;  1VG9 A;  4H2Q A;  4A99 A;  2FJD A;  5KMP A;  5FS6 A;  2YLT A;  3P4Q A;  1CHU A;  1NG4 A;  3VRD B;  4KX6 A;  3T2Y A;  4U8M A;  2FBW A;  5M0Z A;  1GRG A;  1H81 A;  1FEB A;  2A89 A;  3V3O A;  4GAV A;  2CUL A;  4YKF A;  1CJ2 A;  1GRT A;  1JNZ A;  4APN A;  4C74 A;  2WU2 A;  2WS3 A;  3HZL A;  3NN0 X;  3NTA A;  4AOX A;  4YSZ A;  1E6E A;  3AD7 B;  3UKL A;  1E1K A;  1IUV A;  2JB2 A;  1F8S A;  3QSS A;  3GMB A;  1GAL A;  4IV9 A;  2JB1 A;  2BAC A;  4EQR A;  1EL5 A;  5FS7 A;  4K5S A;  4NTD A;  3AEE A;  5KVI A;  3GDP A;  4LII A;  4Z2U A;  4HA6 A;  2WU5 A;  1IUW A;  3H8I A;  3ATR A;  5HXI A;  3SZW A;  1KF6 A;  4AOS A;  4D03 A;  1GND A;  1ONF A;  2C75 A;  2YLS A;  3ISH A;  4BK3 A;  4G74 A;  4PAB A;  2RGJ A;  2WET A;  1H83 A;  3UKK A;  3BHF A;  2BK5 A;  2YG3 A;  1LPF A;  3VR9 A;  2B76 A;  5KWF A;  3RP7 A;  4OPU A;  1BF3 A;  1BZL A;  1S2Q A;  3AED A;  3BI2 A;  3DGZ A;  1P2H A;  2VQ7 A;  4J57 A;  4OPD A;  3AD9 B;  4BK2 A;  4YSY A;  2WP6 A;  1VQW A;  3D1C A;  4X9N A;  4B64 A;  2TMD A;  2VZ2 A;  2VQB A;  4EQW A;  4M52 A;  5M10 A;  5DBJ A;  2ZBW A;  1ZOV A;  5CKU A;  3LJP A;  2ZZC A;  2VRM A;  5BVA A;  1O94 A;  4C3Y A;  1GSN A;  4GDP A;  2WBA A;  1O5W A;  3AE9 A;  4YT0 A;  2YLX A;  3UP5 A;  4MJW A;  1YKJ A;  4C77 A;  1W4X A;  3UCL A;  3AE2 A;  2RAB A;  2A87 A;  5HYM A;  1B4V A;  4H4X A;  1AOG A;  2WOV A;  3B3R A;  1RYI A;  4G73 A;  5EBK A;  2WQY A;  3ABV A;  1NEN A;  2VVL G;  2VVL A;  2TPR A;  4GDE A;  1EBD A;  1NHQ A;  2BS4 A;  2GMJ A;  2Q7V A;  2XLP A;  3G5S A;  3QJ4 A;  3RHA A;  4A65 A;  4YTP A;  2C76 A;  1M64 A;  3NTD A;  1Q1W A;  5KMQ A;  2IID A;  1B37 A;  1VG0 A;  2GVC A;  1ZOY A;  3M12 A;  3O0H A;  3BHK A;  1N4U A;  2YM1 A;  1N1P A;  1GPE A;  2WEU A;  3CNT A;  1ZX9 A;  2YLR A;  1V59 A;  2JB3 A;  1B8S A;  4USQ A;  3GD4 A;  3KPK A;  3UP4 A;  3GMC A;  4B65 A;  2NPX A;  4CNK A;  3GWF A;  1DOB A;  1NHP A;  2VVM A;  4NEV A;  3CNJ A;  3AE5 A;  2GMH A;  2E4G A;  1GT8 A;  3ITJ A;  4JDR A;  2V3A A;  4IVO B;  4B68 A;  2DKI A;  3DJG X;  2GR2 A;  2XVJ A;  3IHM A;  2BK4 A;  1CC4 A;  3IF9 A;  4BJZ A;  3HYW A;  2BAB A;  3K30 A;  2GQW A;  3NRN A;  5JCI A;  1TRB A;  1Z6L A;  1XAN A;  1ZP0 A;  1D4E A;  2YG6 A;  1ZMD A;  3BNU A;  3CGD A;  4OVI A;  5BUK A;  3C4N A;  1QLB A;  2EQ8 A;  2R9Z A;  3NGC X;  4G6H A;  1CJ4 A;  4CY8 A;  2NVK X;  3GYJ A;  2Q6U A;  3AXB A;  1ZK7 A;  4JQ9 A;  3S5W A;  3SFE A;  1FOH A;  4ZCD A;  2WDQ A;  2YR5 A;  1PHH A;  3EAO A;  3H8L A;  3F8R A;  1NEK A;  1JRY A;  4P9S A;  2JKC A;  4X9M A;  1LQT A;  4YXD A;  3ALM A;  4U8I A;  4NWZ A;  3BI5 A;  3CGB A;  4RG3 A;  1PS9 A;  4Z24 A;  5JCK A;  1CC2 A;  5EB5 A;  1F8W A;  3L1R A;  2YWL A;  3DME A;  3AE3 A;  4GUV A;  4H2N A;  1TYP A;  1Q1R A;  2YVF A;  3I6D A;  1SEZ A;  2GAG B;  2GAH B;  1OJD A;  3LAD A;  3AYJ A;  4FK1 C;  4UDQ A;  4FX9 A;  1BWC A;  1E1M A;  2GH5 A;  1PBE A;  2GR0 A;  1PBF A;  1JU2 A;  4II2 A;  4OPG A;  2C65 A;  1NPX A;  4X4J A;  4B69 A;  2XFU A;  4H4Q A;  4K5R A;  5KOW A;  2XFN A;  3T31 A;  4Y4M A;  4UP3 A;  2R46 A;  1ELI A;  3QVP A;  4A6N B;  2H89 A;  4IA5 A;  1TDN A;  3QSM A;  3CGC A;  1DNC A;  3UKA A;  1Y0P A;  2OLN A;  3CNS A;  4JY3 A;  3NLC A;  2C72 A;  3T2K A;  1JRX A;  3FIM B;  2X99 A;  4Z2R A;  3RED A;  1TDO A;  4EQX A;  1GES A;  5J7X A;  3KPF A;  1GRE A;  1B5Q A;  2WP5 A;  2C66 A;  2AR8 A;  2YR4 A;  4H4R A;  4U2T A;  2WES A;  2CDU A;  1GTE A;  1K0L A;  2WPC A;  3DJJ A;  4NTE A;  2F5Z A;  4A6N A;  4EMW A;  4YSX A;  3E1T A;  3ICS A;  3UKQ A;  4YTN A;  2GR1 A;  4TM3 A;  3UOX A;  2GQF A;  4K7Z A;  2BRA A;  3DH9 A;  4EMI A;  2BC0 A;  1F6M A;  3VRB A;  2B9X A;  4CCQ A;  2AAQ A;  2Y6Q A;  3NK2 X;  1FL2 A;  4A9W A;  3AEB A;  4UDR A;  3G5Q A;  4JNQ A;  4OPL A;  4Z44 A;  4OCG A;  1MOK A;  2EQ9 A;  2QA2 A;  1H86 A;  1S2Y A;  2V61 A;  1CF3 A;  3P4P A;  4LU6 A;  5HHF A;  4DGK A;  1H84 A;  2XFO A;  1X31 B;  4IA6 A;  3SM8 A;  1GOS A;  1IUS A;  4I58 A;  3RP6 A;  3CPI G;  4FK1 A;  2BYB A;  1D7L A;  4D04 A;  1LJ1 A;  2R45 A;  2BK3 A;  3GSI A;  3OZ2 A;  1YY5 A;  3NYE A;  4H2R A;  4GF7 A;  3RP8 A;  1CBO A;  2GB0 A;  4GRT A;  4EM4 A;  3EPT A;  1DXL A;  3NN6 X;  1YQ4 A;  2WP9 A;  1Y56 A;  4U8K A;  5KVH A;  4CRT A;  2H88 A;  1KFY A;  3URH A;  2X8C A;  3V3N A;  1EL8 A;  3CPH G;  2GF3 A;  3IC9 A;  5C2T A;  1FEC A;  1TDE A;  1D7Y A;  4C3X A;  2ACZ A;  1JRZ A;  2C7G A;  3AYI A;  4EMJ A;  1NG3 A;  2YR6 A;  1H82 A;  4II3 A;  3G5R A;  5BRT A;  2OA1 A;  4K8D A;  4H4U A;  4TLX A;  5FMH A;  5C3J A;  2XLU A;  2E1M A;  3H4K A;  1XPQ A;  4RSL A;  3C4A A;  3ZYX A;  3CTY A;  3ICT A;  3S61 A;  5IQ1 A;  2QCU A;  3GRS A;  1PBD A;  3AE8 A;  4H4V A;  3I3L A;  3B6D A;  1N4V A;  4GR1 A;  1CL0 A;  3QFB A;  3BI4 A;  1DOC A;  3CN8 A;  2WOI A;  4J36 A;  4AT0 A;  2V3B A;  1N4W A;  2VOU A;  3PVC A;  4TM4 A;  2AQJ A;  3LB8 A;  1VRQ B;  1YQZ A;  3KA7 A;  1VDC A;  4JNA A;  1KSS A;  1K0I A;  4G6G A;  2XVF A;  4LA1 A;  3GD3 A;  1PJ6 A;  3GDN A;  4H4W A;  2C3C A;  3UOV A;  1H7X A;  5JCM A;  4U8P A;  5KMS A;  5LV9 A;  1F3P A;  4ADW A;  3P9U A;  3QFA A;  2QAE A;  3KVE A;  1PXA A;  2R4J A;  3KLJ A;  3KU9 A;  3M0O A;  4FDC B;  3CNP A;  2RGH A;  2CFY A;  2ZZB A;  2PHH A;  5GRT A;  5JCN A;  2FJA A;  2XLS A;  3NT6 A;  1PXB A;  4OPI A;  3IHG A;  3UKP A;  4H7U A;  3DJE A;  1PN0 A;  2X8H A;  3L8K A;  2YQU A;  1CC6 A;  2FJB A;  1KNP A;  2W0H A;  4H4T A;  3DA1 A;  3LZX A;  4DNA A;  2C3D A;  2XLT A;  2GR3 A;  1ZY8 A;  2V60 A;  3NKS A;  2V6O A;  3C96 A;  1GTH A;  2YM2 A;  1K4Q A;  2WPE A;  2X50 A;  5ER0 A;  3UTG A;  5U1O A;  2J3N A;  3AEC A;  3AE7 A;  4GAP A;  2B7S A;  3Q6J A;  2X8G A;  5CQF A;  4WCT A;  3SZF A;  2C70 A;  2VRL A;  3PO7 A;  4CNJ A;  1NAA A;  1Q9I A;  3OC4 A;  4B67 A;  3ZDN A;  2IVE A;  2XVE A;  3IWA A;  4EQS A;  1FCD A;  2XDO A;  1LV0 A;  2GEW A;  3UTE A;  3P4R A;  3NYC A;  4CBQ A;  4H4S A;  1GET A;  3D8X A;  3K7M X;  3AEG A;  2YG7 A;  3AYL A;  1FEA A;  1H7W A;  2BS2 A;  1JEH A;  2QA1 A;  1PJ7 A;  1ZKQ A;  3PS9 A;  4DSH A;  1OJT A;  3EAN A;  4ZN0 A;  1JNR A;  2PYX A;  2V5Z A;  4YKG A;  1S3B A;  4CY6 A;  4WX1 A;  2B9W A;  4H4Z A;  2XFQ A;  3BNM A;  2WPF A;  3ATQ A;  1DOD A;  4REK A;  3RNM A;  1GRA A;  1DJN A;  2Y6R A;  3SYI A;  2GRT A;  4A7A A;  4EIQ A;  3AE4 A;  4EIP A;  3AWI A;  1JOA A;  4U8J A;  3T37 A;  1KDG A;  1L0V A;  4AP1 A;  1YQ3 A;  3DK9 A;  5KXJ A;  4Z2T A;  4O5U A;  3GRT A;  3SY4 A;  4B1B A;  2XFP A;  1NHR A;  4ECH A;  1BKW A;  1OJC A;  3K7Q X;  2C67 A;  1E7P A;  4OPC A;  1L9C A;  2R0G A;  2RGO A;  1OJ9 A;  2A8X A;  1P2E A;  5KMR A;  2BRY A;  3NHO X;  1F8R A;  2DKH A;  5U25 A;  3GWD A;  3AB1 A;  1GRF A;  1GXF A;  4B63 A;  4H50 A;  5IQ4 A;  1LQU A;  3ADA B;  1Y56 B;  1GER A;  4XWR A;  2JK6 A;  3NK1 X;  5EB4 A;  4BK1 A;  4Z26 A;  4K2X A;  1TYT A;  3KD9 A;  4U8O A;  2UZZ A;  3NH3 X;  1GRB A;  1LVL A;  3CPJ G;  1GRH A;  1QJD A;  3UOZ A;  2XVH A;  2FJE A;  2BCG G;  3LZW A;  4DSG A;  1PBB A;  1D4C A;  2B9Y A;  3DK4 A;  1KNR A;  5L46 A;  4EM3 A;  3UKF A;  4JN9 A;  4YTM A;  4G9K A;  4B66 A;  3AE6 A;  3F8D A;  3ALJ A;  4YSH A;  1IUX A;  2IVD A;  2BCP A;  3LOV A;  2R4E A;  1L9E A;  4TM1 A;  2APG A;  5HY5 A;  4XXG A;  2OLO A;  4A5L A;  1EL7 A;  2Z5Y A;  3VQR A;  2XCG A;  3FG2 P;  2OAM A;  3CND A;  1QO8 A;  1PBC A;  4N9X A;  1XHC A;  1MO9 A;  4ZCC A;  5KOX A;  2OAL A;  3K7T A;  2C73 A;  5TR3 A;  1L9D A;  2Z5X A;  5KNL A;  1BGN A;  3NK0 X;  4Z25 A;  4HB9 A;  2R0C A;  5JCL A;  3P4S A;  3AEA A;  1EL9 A;  3M13 A;  2WHD A;  2X3N A;  4J56 A;  1XDI A;  2C4C A;  3KKJ A;  1H6V A;  3T0K A;  3T2Z A;  3VR8 A;  4BV6 A;  2O9Z A;  3AE1 A;  5FS9 A;  1DOE A;  3AEF A;  2BS3 A;  3ICR A;  4A79 A;  1RSG A;  4J31 A;  4RG4 A;  1TDF A;  1IUU A;  4U2L A;  5U63 A;  2R0P A;  3QSE A;  1DJQ A;  3Q9T A;  3T14 A;  5BUL A;  2WDR A;  5J60 A;  1CJC A;  2XLR A;  1LTX R;  4H2P A;  3AD8 B;  1K0J A;  1REO A;  2B7R A;  1M6I A;  1O95 A;  3NYF A;  4J33 A;  3DJD A;  2YG4 A;  3F8P A;  1PJ5 A;  2BA9 A;  2YVJ A;  3VRA A;  3DGH A;  4Y4N A;  2JBV A;  3CGE A;  4K22 A;  4AT2 A;  4E0V A;  3FMW A;  1UKV G;  4KPR A;  2WDV A;  5FS8 A;  3UTH A;  3CIR A;  1ZMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...