3KVEA

Structure of native l-amino acid oxidase from vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKKTSNPKHVVVVGAGMSGLSAAYVLAGAGHKVTVLEASERAGGRVRTHRNSKEGWYANLGPMRIPEKHRIVREYIRKFGLNLNEFSQENDNAWYFIKNIRKRVGEVNKDPGLLKYPVKPSEEGKSAGQLYEESLGSAVKDLKRTNCSYILNKYDTYSTKEYLIKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDQLPTSMYRAIEEKVKFNARVIKIQQNANQVTVTYQTPEKDTSSNTADYVIVCTTSRAARRIQFEPPLPPKKQHALRSVHYRSGTKIFLTCSSKFWEDDGIHGGKSTTDLPSRFIYYPNHNFSTGVGVIIAYGIGDDANFFQALKFKDCADIVFNDLSLIHQLPKEEIQSFCYPSMIQKWSLDKYAMGAITTFTPYQFQRFSEALTAPQGRIFFAGEYTAEAHGWIDSTIKSGLTAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of native L-amino acid oxidase from Vipera ammodytes ammodytes: stabilization of the quaternary structure by divalent ions and structural changes in the dynamic active site
rcsb
molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
total genus 178
structure length 484
sequence length 484
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 3kveA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kveA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kveA01
2NPXA 1IUSA 2GV8A 5JCIA 1K4QA 2WHDA 1L0VA 3BI2A 1E7PA 1PXBA 5M0ZA 4EM3A 2V3AA 3UOVA 1VG9A 2XFNA 3GWDA 4Z2TA 1TRBA 2YG5A 3GDNA 4WX1A 1LTXR 3LZXA 3RHAA 4H4RA 2YLRA 3CNDA 5BVAA 3F8RA 4OPCA 5FS7A 3ZDNA 3VR8A 3AXBA 5HXIA 3GD3A 2V5ZA 3UKAA 4HA6A 4YXDA 3LXDA 4A99A 2X8CA 5EB4A 4EQXA 4EIQA 2TMDA 4NTEA 2VVLA 3UKHA 3CGBA 3NK0X 4AT0A 3IWAA 1JEHA 3H8LA 1KSSA 5FMHA 5CKUA 1W4XA 4H4YA 1GRGA 2Q7VA 2GEWA 4WCTA 4C74A 1L9EA 4I58A 4YTNA 3K7TA 4Y4NA 4YSHA 3K7MX 3VQRA 3UKFA 3CPIG 3UOYA 3KA7A 1LQUA 4GCMA 2WPEA 2APGA 1NHQA 2UZZA 1ZMDA 3RNMA 3M0OA 4B69A 4H2NA 1NENA 4J2WA 1NG4A 4BV6A 4YTMA 2R0GA 3M13A 4GDPA 1SEZA 4ADWA 4AP3A 3GDPA 1XDIA 2JK6A 4Z25A 2X50A 1K0LA 3UP5A 3ADAB 1CC6A 3PVCA 1LQTA 1TDOA 2WDVA 1GXFA 5DBJA 4I59A 1O94A 1ZK7A 1JRXA 2GR1A 2XLRA 4RSLA 1H6VA 3PO7A 1ZX9A 4E0VA 1H7XA 4U2TA 4EQRA 1YQZA 1LPFA 2BC1A 4U8IA 1N4WA 3OZ2A 2X3NA 2YLTA 3QVRA 1TYPA 2GMHA 3KU9A 5KWFA 3T37A 2OALA 3NH3X 2ZZ0A 4BK3A 3DH9A 1EL5A 2AAQA 4H50A 5ER0A 3AB1A 1JU2A 3EAOA 2GAGB 1EBDA 4H4SA 3KD9A 2DKHA 2YM1A 4K7ZA 1GV4A 4UDRA 2E1MA 3AE1A 3UP4A 1YQ4A 3AEFA 2XLUA 4X9NA 1Y56B 4UDPA 3IHMA 2Z5YA 1BGJA 1PHHA 1P2EA 4JY2A 1KDGA 2F5ZA 4LIIA 4BURA 4OPLA 2XFUA 3NTAA 2ARDA 2XLSA 2YWLA 3NG7X 1PBFA 4BJYA 1EL8A 5FS9A 1S3BA 5C2TA 2OA1A 2X8GA 4X9MA 4IA5A 1O95A 1PJ6A 4PAAA 3UOZA 3NN6X 4H2QA 4U8PA 4NZHA 1Y56A 4C5OA 2JB1A 2NVKX 3S61A 4C77A 4Z44A 3C4NA 2GF3A 3AEGA 3GSIA 1S2YA 1D5TA 1DOCA 2QA1A 2TPRA 3BI4A 3V3OA 2YLZA 4B66A 1NG3A 1GNDA 5IQ4A 3AD7B 5C3JA 3AWIA 5CQFA 5U1OA 4EM4A 4A5LA 2Q6UA 4GR1A 1CC4A 3UTGA 1E1KA 2XDOA 3S5WA 1QO8A 1E1NA 2GRTA 3FBSA 4U2LA 5HYMA 3CNTA 4FK1A 4GRTA 2YR6A 4OPIA 4KX6A 1MO9A 2ZBWA 1FCDA 3VR9A 3KLJA 2BXRA 4H4TA 1D7LA 4X4JA 2XLTA 5JCMA 1GESA 1JOAA 2RGOA 1TDKA 2GQFA 2XLPA 2V6OA 2ZZBA 2XVJA 1JRZA 1YY5A 3CN8A 3DK8A 1E6EA 1H83A 2YVGA 4J36A 1CHUA 1PBCA 3FG2P 4J34A 2R45A 1TDFA 3M12A 4U8KA 4CNKA 5M10A 3K30A 4H2RA 3B6DA 3DJJA 3AE9A 1PBBA 4CCQA 3ICSA 2E4GA 2GB0A 2YM2A 3CGDA 3PS9A 1KSUA 3UCLA 3G5SA 4ZN0A 4NEVA 1H84A 1NHPA 2A8XA 1RSGA 2YAUA 3ATRA 3G5RA 2YG6A 3BNUA 1DOBA 1X31B 1Q1WA 1CBOA 4U8LA 2BYBA 2XVHA 3DJGX 5GRTA 3EF6A 1L9CA 4B67A 2OLOA 4CBQA 1REOA 2WQYA 1L9DA 3FMWA 1QJDA 3I6DA 2EQ7A 2QA2A 1PBEA 3RP8A 4KPRA 3NLCA 2BABA 2YR5A 2EQ9A 1B4VA 4XXGA 4JNAA 1Y0PA 2GR0A 1KF6A 2BCPA 1LJ1A 2WBAA 3AE2A 1GALA 2R4EA 3AECA 5KRQA 2RGJA 1S2QA 1D4DA 3GWFA 1GEUA 3F8PA 3L1RA 4DGKA 3REDA 2XYOA 4HB9A 4A6NB 3ZYXA 2H88A 3CNJA 1ZKQA 3Q6JA 2WP6A 3GRSA 3FIMB 3NT6A 2YG4A 1ZOYA 5J7XA 2V3BA 4IV9A 4A79A 4GUVA 1OJDA 1H82A 2PHHA 1PXCA 3LB8A 1GRFA 4B65A 4Z26A 3EPTA 1IUUA 3UKPA 1VG0A 4J31A 2IIDA 3E1TA 4JNQA 1TYTA 1DJNA 2VZ2A 5HY5A 3AYLA 4AP1A 3V76A 2W0HA 3DA1A 4AOXA 5IPYA 1BZLA 2GH5A 2WP9A 2VVMA 1OJCA 4YKGA 1GERA 3DJDA 4DSGA 3L8KA 3UTFA 1D7YA 4Y4MA 5FS8A 1S3EA 4JN9A 2QCUA 4EMWA 4TLXA 4XWRA 4EQSA 3C96A 5GSNA 1Q9IA 2B7RA 2AQJA 2R46A 1NHRA 1E39A 1Q1RA 2BACA 1F3PA 3II4A 3NYCA 4FX9A 4YT0A 2VQBA 1IUXA 2BK5A 3QSEA 3GYIA 5L46A 2HQMA 4UDQA 2YG7A 2XVEA 3LZWA 1GOSA 2A87A 4K22A 2GQWA 1FECA 2GR2A 2EQ8A 3NN0X 4Z2UA 5BULA 4TM0A 2GAHB 3AEBA 1FEAA 1RYIA 3BHKA 4OPGA 2WS3A 3JSKA 1OJ9A 3SFDA 1XPQA 4K5SA 2XVIA 4YTPA 3UTEA 2C3CA 2C3DA 1PN0A 3C4AA 3GD4A 3UKQA 2JBVA 2WEUA 2V61A 2B9XA 3CPJG 4GF7A 4H4WA 2YVFA 4NTCA 1DODA 3IF9A 3CTYA 4Y4LA 4OCGA 1NHSA 1K0JA 3R9UA 5HHFA 2WOVA 1D4CA 4AOSA 3IC9A 4IVOB 4EQWA 3GRTA 4TM1A 3NRNA 1IUTA 4RG4A 4Z43A 1V59A 4H4PA 2FJDA 2BS3A 4B1BA 2VRMA 3P4PA 4A65A 5JCNA 2XCGA 2IVEA 3UOXA 1E1MA 5EBKA 2Q0LA 1EL9A 4TLZA 4OPTA 4U2SA 4A9WA 4B64A 2XFPA 4H4XA 4YSZA 3QSSA 3NHOX 4USQA 2CULA 3RP7A 4D03A 4B68A 2YLWA 4IA6A 3P1WA 5KXJA 1JNRA 4UP3A 2C7GA 2BXSA 2B9YA 2ACZA 4M52A 4J33A 3AEAA 3GMBA 5IQ1A 1UKVG 1YKJA 2XFQA 2AR8A 3LJPA 1PJ7A 3P4QA 1OJAA 1ZOVA 1PBDA 3KKJA 4USRA 4H7UA 3SGLA 5EB5A 4LA1A 3D8XA 4XWZA 2YR4A 2WESA 1CJ2A 4REKA 3VRDB 2BS2A 1CF3A 1N1PA 1CJ4A 1DXLA 2C65A 4U8MA 1H81A 4K8DA 2C70A 2R9ZA 1Z6LA 3O0HA 1CC2A 3QFBA 4RG3A 2C66A 2IVDA 1AOGA 4OVIA 4DNAA 1LV0A 5BUKA 3VRBA 3AE7A 3NYFA 2BC0A 1LVLA 1XANA 4JDRA 2YVJA 3CGCA 1FEBA 3OC4A 1GRBA 1QLBA 2FJBA 2X8HA 2FBWA 2WU2A 2R0PA 4PABA 4K5RA 1E1LA 1BF3A 1F6MA 2C76A 2EQ6A 2ZZCA 2YQUA 3QSMA 1RP0A 4OPUA 2JAEA 3ICTA 1N4UA 1CL0A 4OPDA 1VRQB 4U8NA 2Z5XA 2WDQA 4EMIA 1D4EA 3ALMA 3B3RA 4MJWA 2BK3A 2WU5A 2CDUA 3ITJA 4O5QA 1GREA 3AYIA 3NK1X 4DSHA 4U8OA 2DKIA 5JCLA 1K0IA 3V3NA 1NEKA 3DGHA 3URHA 2BK4A 4C3XA 3GMCA 1NPXA 5BRTA 2I0ZA 4O5UA 1GRTA 2V60A 1CJ3A 3UTHA 2VQ7A 4FK1C 3Q9TA 2O9ZA 4IVMB 3ISHA 3KPFA 2Y6QA 2OAMA 2OLNA 3ALJA 4H4VA 1PJ5A 5TR3A 2B7SA 4AT2A 5LV9A 3CPHG 4NEWA 3DMEA 1DJQA 2C72A 3VRAA 3UKLA 4B63A 1GETA 1P2HA 1B5QA 4APNA 3CIRA 4JQ9A 4YSYA 2XVFA 2FJAA 2VRLA 2Y6RA 3AEDA 3H8IA 4P9SA 3NNEA 5KVIA 4BK1A 2GVCA 2BCGG 4H4ZA 2GR3A 2YLSA 1VDCA 3QVPA 1PXAA 5J60A 5KOXA 3NTDA 3GYJA 1F8WA 2VVLG 4NTDA 3BI5A 4CY6A 2PYXA 4U8JA 2BA9A 1N4VA 3P4RA 1PS9A 1EL7A 3DK4A 4Z24A 2C67A 2CVJA 1KNRA 4ICYA 2X99A 1ZP0A 3F8DA 1GT8A 2H89A 1GSNA 3SFEA 4JY3A 5EOWA 3SM8A 3ALLA 4CRTA 3P9UA 3AEEA 5KVHA 3NGCX 3ATQA 2B76A 3SQPA 4YSXA 4Z2RA 2JB2A 1M6IA 2WOWA 4ZCCA 4CNJA 5U63A 4H4UA 3NIXA 1B37A 4TM3A 3NKSA 3P4SA 4YKFA 2RABA 3CNPA 1YQ3A 3AE8A 1DOEA 2WPCA 3ABVA 3AD9B 1BKWA 1F8RA 1COYA 1JNZA 1GRAA 1ZY8A 2A89A 1H86A 1JRYA 1MOKA 2QAEA 2WDRA 3AE6A 3AE5A 3AE4A 4CCRA 3AE3A 2YLXA 3I3LA 1O5WA 1KFYA 4K2XA 1IUWA 3H4KA 2BS4A 3DK9A 3HZLA 1M64A 1NDAA 3BHFA 4A6NA 4CY8A 2WETA 1IJHA 4GDEA 3AD8B 3K7QX 4H4QA 1FL2A 1FOHA 5FS6A 1KNPA 4H2PA 1GTEA 4EMJA 2JKCA 1TDEA 3NYEA 3QFAA 2Q0KA 2R4JA 2C75A 3NK2X 3COXA 1GPEA 1VQWA 1IUVA 3WE0A 4YWOA 4BK2A 3DJEA 1HYUA 1F8SA 2GMJA 3FPZA 4J57A 4N9XA 1OJTA 2C73A 1PDHA 1ZDLA 3IHGA 3AYJA 3LOVA 1XHCA 1CJCA 1DNCA 2VOUA 2B9WA 2WPFA 1GTHA 2YG3A 4D04A 3DGZA 2J3NA 3EANA 1TDNA 1NAAA 4FDCB 4TM4A 5KOWA 3BNMA 2RGHA 2WOIA 3LADA 4BJZA 3G5QA 4ZCDA 2E5VA 3RP6A 2R0CA 2JB3A 1BGNA 3KVEA 4A7AA 3CNSA 2FJEA 5U25A 3QJ4A 2C64A 4J56A 3CGEA 4EIPA 1H7WA 3UKKA 4C3YA 1BWCA 3ICRA 5JCKA 4ECHA 1B8SA 1GRHA 3D1CA 1ZMCA 2XFOA 1ELIA 2WP5A 1MXTA 2CFYA 1ONFA 4LU6A
chains in the Genus database with same CATH superfamily
2NPXA 1IUSA 2GV8A 5JCIA 1K4QA 2WHDA 1L0VA 3BI2A 1E7PA 1PXBA 5M0ZA 4EM3A 2V3AA 3HYXA 3UOVA 1VG9A 2XFNA 3GWDA 4Z2TA 1TRBA 2YG5A 3GDNA 4WX1A 1LTXR 3LZXA 3RHAA 4H4RA 2YLRA 3CNDA 5BVAA 3F8RA 4OPCA 5FS7A 3ZDNA 3VR8A 3AXBA 5HXIA 3GD3A 2V5ZA 3UKAA 4HA6A 4YXDA 3LXDA 4A99A 2X8CA 5EB4A 4EQXA 4EIQA 2TMDA 4NTEA 2VVLA 3UKHA 3CGBA 3NK0X 4AT0A 3IWAA 1JEHA 3H8LA 1KSSA 5FMHA 5CKUA 1W4XA 4H4YA 1GRGA 2Q7VA 2GEWA 4WCTA 4C74A 1L9EA 4I58A 3SX6A 4YTNA 3K7TA 4Y4NA 4G74A 4YSHA 3K7MX 3VQRA 3UKFA 3CPIG 3UOYA 3KA7A 1LQUA 4GCMA 2WPEA 2APGA 1NHQA 2UZZA 1ZMDA 3RNMA 3M0OA 4NNJA 4B69A 4H2NA 1NENA 4J2WA 1NG4A 4BV6A 4YTMA 2R0GA 3M13A 4GDPA 1SEZA 4ADWA 4AP3A 3GDPA 1XDIA 2JK6A 4Z25A 2X50A 3HYVA 3CMMA 1K0LA 3UP5A 3ADAB 1CC6A 3PVCA 1LQTA 1TDOA 2WDVA 1GXFA 5DBJA 4I59A 1O94A 1ZK7A 1JRXA 2GR1A 2XLRA 4RSLA 1H6VA 3PO7A 1ZX9A 4E0VA 1H7XA 4U2TA 4EQRA 1YQZA 1LPFA 2BC1A 4U8IA 1N4WA 3OZ2A 2X3NA 2YLTA 3QVRA 1TYPA 2GMHA 3KU9A 5KWFA 3T37A 2OALA 3NH3X 2ZZ0A 4BK3A 3DH9A 1EL5A 2AAQA 4H50A 5ER0A 3AB1A 1JU2A 3EAOA 2GAGB 1EBDA 4H4SA 3KD9A 2DKHA 2YM1A 4K7ZA 1GV4A 4UDRA 2E1MA 3AE1A 3UP4A 1YQ4A 3AEFA 2XLUA 4X9NA 1Y56B 4UDPA 3IHMA 2Z5YA 1BGJA 1PHHA 1P2EA 4JY2A 1KDGA 2F5ZA 4LIIA 4BURA 4OPLA 2XFUA 3NTAA 2ARDA 2XLSA 2YWLA 3NG7X 1PBFA 4BJYA 1EL8A 5FS9A 1S3BA 4G9KA 5C2TA 2OA1A 2X8GA 4X9MA 4IA5A 1O95A 1PJ6A 4PAAA 3T14A 3UOZA 3NN6X 4H2QA 4U8PA 4NZHA 1Y56A 4C5OA 2JB1A 2NVKX 3S61A 4C77A 4Z44A 3C4NA 2GF3A 3AEGA 3GSIA 1S2YA 1D5TA 1DOCA 2QA1A 2TPRA 3BI4A 3V3OA 2YLZA 4B66A 1NG3A 1GNDA 5IQ4A 3AD7B 5C3JA 3AWIA 5CQFA 5U1OA 4EM4A 4A5LA 2Q6UA 4GR1A 1CC4A 3UTGA 1E1KA 2XDOA 3S5WA 1QO8A 1E1NA 2GRTA 3FBSA 4U2LA 5HYMA 3CNTA 4FK1A 4GRTA 2YR6A 4OPIA 4KX6A 1MO9A 2ZBWA 1FCDA 3VR9A 3KLJA 2BXRA 5KMRA 4H4TA 1D7LA 4X4JA 2XLTA 5JCMA 1GESA 1JOAA 2RGOA 1TDKA 2GQFA 2XLPA 2V6OA 2ZZBA 2XVJA 1JRZA 1YY5A 3CN8A 3DK8A 1E6EA 1H83A 2YVGA 4J36A 1CHUA 1PBCA 3FG2P 4J34A 2R45A 1TDFA 3M12A 4U8KA 3SXIA 4CNKA 3K30A 5M10A 4H2RA 3B6DA 3DJJA 3AE9A 1PBBA 4CCQA 3ICSA 2E4GA 2GB0A 2YM2A 3CGDA 3PS9A 1KSUA 3UCLA 3G5SA 4ZN0A 4NEVA 1H84A 1NHPA 2A8XA 1RSGA 2YAUA 3ATRA 3G5RA 2YG6A 3BNUA 1DOBA 1X31B 1Q1WA 1CBOA 4U8LA 2BYBA 2XVHA 3DJGX 5GRTA 3EF6A 1L9CA 4B67A 2OLOA 4CBQA 1REOA 2WQYA 1L9DA 3FMWA 1QJDA 3I6DA 4G6HA 2EQ7A 2QA2A 1PBEA 3RP8A 4KPRA 3NLCA 2BABA 2YR5A 2EQ9A 1B4VA 4XXGA 4JNAA 1Y0PA 2GR0A 1KF6A 2BCPA 1LJ1A 2WBAA 3AE2A 1GALA 2R4EA 3AECA 5KRQA 2RGJA 1S2QA 1D4DA 3GWFA 1GEUA 3F8PA 3L1RA 4II3A 3REDA 4DGKA 2XYOA 4HB9A 3SZWA 4A6NB 3ZYXA 2H88A 3CNJA 1ZKQA 3Q6JA 2WP6A 3GRSA 3FIMB 3NT6A 2YG4A 1ZOYA 5J7XA 2V3BA 5KMQA 4IV9A 3T2ZA 4A79A 4GUVA 1OJDA 1H82A 2PHHA 1PXCA 3LB8A 1GRFA 4B65A 4Z26A 3EPTA 1IUUA 3UKPA 1VG0A 4J31A 2IIDA 3E1TA 4JNQA 1TYTA 1DJNA 2VZ2A 5HY5A 3AYLA 4AP1A 3V76A 2W0HA 3DA1A 4AOXA 5IPYA 1BZLA 2GH5A 2WP9A 2VVMA 1OJCA 4YKGA 1GERA 3DJDA 4DSGA 3L8KA 3UTFA 1D7YA 4Y4MA 5FS8A 1S3EA 4JN9A 2QCUA 4EMWA 4TLXA 4XWRA 4EQSA 3C96A 5GSNA 1Q9IA 2B7RA 2AQJA 2R46A 1NHRA 1E39A 2BACA 1Q1RA 1F3PA 3II4A 3NYCA 4FX9A 4YT0A 2VQBA 1IUXA 2BK5A 3QSEA 3GYIA 3SYIA 2HQMA 4UDQA 2YG7A 5L46A 2XVEA 4NWZA 3LZWA 1GOSA 2A87A 4K22A 2GQWA 1FECA 2GR2A 2EQ8A 3NN0X 4Z2UA 5BULA 4TM0A 2GAHB 3AEBA 1FEAA 1RYIA 3BHKA 4OPGA 2WS3A 3JSKA 1OJ9A 3SFDA 1XPQA 4K5SA 2XVIA 4YTPA 3UTEA 2C3CA 2C3DA 4GAVA 1PN0A 2BRAA 3C4AA 3GD4A 3UKQA 2JBVA 2WEUA 2V61A 2B9XA 3CPJG 4GF7A 4H4WA 2YVFA 4NTCA 1DODA 3IF9A 3CTYA 4Y4LA 4OCGA 1NHSA 1K0JA 3R9UA 5HHFA 2WOVA 1D4CA 4AOSA 3IC9A 4IVOB 4EQWA 3GRTA 4TM1A 3NRNA 1IUTA 4RG4A 4Z43A 1V59A 4H4PA 2FJDA 2BS3A 4B1BA 3T2YA 2VRMA 3P4PA 4A65A 5JCNA 2XCGA 2IVEA 3UOXA 1E1MA 5EBKA 2Q0LA 1EL9A 4TLZA 4OPTA 4U2SA 4A9WA 4B64A 2XFPA 4H4XA 4YSZA 3QSSA 3NHOX 4USQA 2CULA 3RP7A 4D03A 4B68A 2YLWA 4IA6A 3P1WA 5KXJA 1JNRA 4UP3A 2C7GA 2BXSA 2B9YA 2ACZA 2BRYA 4J33A 4M52A 2C4CA 3AEAA 3GMBA 5IQ1A 1UKVG 1YKJA 2XFQA 2AR8A 3LJPA 1PJ7A 3P4QA 1OJAA 1ZOVA 1PBDA 3KKJA 4USRA 4H7UA 3SGLA 5EB5A 4LA1A 3D8XA 5KNLA 4XWZA 3T2KA 2YR4A 2WESA 1CJ2A 4REKA 3VRDB 2BS2A 1CF3A 1N1PA 1CJ4A 1DXLA 2C65A 4U8MA 1H81A 4K8DA 2C70A 2R9ZA 1Z6LA 3O0HA 1CC2A 3QFBA 4RG3A 2C66A 2IVDA 1AOGA 4OVIA 4DNAA 1LV0A 5BUKA 3VRBA 3AE7A 3NYFA 2BC0A 1LVLA 1XANA 4JDRA 2YVJA 3CGCA 1FEBA 3OC4A 1GRBA 3GYXA 1QLBA 2FJBA 2X8HA 2FBWA 2WU2A 2R0PA 4PABA 4K5RA 1E1LA 1BF3A 1F6MA 2C76A 2EQ6A 2ZZCA 2YQUA 3QSMA 1RP0A 4OPUA 2JAEA 3ICTA 1N4UA 1CL0A 4OPDA 1VRQB 4G73A 4U8NA 2Z5XA 2WDQA 4EMIA 1D4EA 3ALMA 3B3RA 4MJWA 2BK3A 2WU5A 2CDUA 3ITJA 4O5QA 1GREA 3AYIA 3NK1X 4DSHA 4U8OA 2DKIA 5JCLA 1K0IA 3V3NA 1NEKA 3DGHA 3URHA 2BK4A 4C3XA 3GMCA 1NPXA 5BRTA 2I0ZA 4O5UA 1GRTA 2V60A 1CJ3A 3UTHA 2VQ7A 4FK1C 3T0KA 3Q9TA 2O9ZA 4IVMB 5KMPA 3ISHA 3KPFA 2Y6QA 2OAMA 2OLNA 3ALJA 4H4VA 1PJ5A 5TR3A 2B7SA 4AT2A 5LV9A 3CPHG 4NEWA 3DMEA 1DJQA 2C72A 3VRAA 3UKLA 4B63A 1GETA 1P2HA 1B5QA 4APNA 3CIRA 4JQ9A 4YSYA 2XVFA 2FJAA 2VRLA 2Y6RA 3AEDA 3H8IA 4P9SA 3NNEA 5KVIA 4BK1A 2GVCA 2BCGG 4H4ZA 2GR3A 2YLSA 1VDCA 3QVPA 1PXAA 5J60A 5KOXA 3NTDA 3GYJA 1F8WA 2VVLG 4NTDA 3BI5A 4CY6A 2PYXA 4U8JA 2BA9A 1N4VA 3P4RA 1PS9A 1EL7A 3DK4A 4Z24A 2C67A 2CVJA 1KNRA 4GAPA 2X99A 4ICYA 1ZP0A 3F8DA 1GT8A 2H89A 1GSNA 3SFEA 4JY3A 5EOWA 3SM8A 3ALLA 4CRTA 3P9UA 3AEEA 5KVHA 3NGCX 3ATQA 2B76A 3SQPA 4YSXA 4Z2RA 2JB2A 1M6IA 2WOWA 4ZCCA 4CNJA 5U63A 4H4UA 3NIXA 1B37A 4TM3A 3NKSA 3P4SA 5KMSA 4YKFA 3SZ0A 2RABA 3CNPA 1YQ3A 3AE8A 1DOEA 2WPCA 3ABVA 3AD9B 1BKWA 1F8RA 1COYA 1JNZA 1GRAA 1ZY8A 2A89A 1H86A 1JRYA 1MOKA 2QAEA 2WDRA 3AE6A 3AE5A 3AE4A 4CCRA 3AE3A 2YLXA 3I3LA 1O5WA 1KFYA 4K2XA 1IUWA 3H4KA 2BS4A 3T31A 3DK9A 3HZLA 1M64A 1NDAA 3BHFA 4A6NA 4CY8A 2WETA 1IJHA 4GDEA 3AD8B 3K7QX 4H4QA 1FL2A 1FOHA 5FS6A 1KNPA 4H2PA 1GTEA 4EMJA 2JKCA 1TDEA 3NYEA 3QFAA 2Q0KA 2R4JA 2C75A 3NK2X 3COXA 4G6GA 1GPEA 1VQWA 1IUVA 3WE0A 4YWOA 4BK2A 3KPKA 3DJEA 1HYUA 1F8SA 2GMJA 3FPZA 4J57A 4N9XA 3SZCA 1OJTA 2C73A 1PDHA 1ZDLA 3IHGA 3AYJA 3LOVA 1XHCA 1CJCA 1DNCA 2VOUA 2B9WA 2WPFA 1GTHA 2YG3A 4D04A 3DGZA 3SY4A 2J3NA 3EANA 1TDNA 1NAAA 4FDCB 4TM4A 5KOWA 3BNMA 2RGHA 2WOIA 3LADA 4BJZA 3G5QA 4ZCDA 2E5VA 3RP6A 2R0CA 2JB3A 1BGNA 3KVEA 4A7AA 3HYWA 3CNSA 2FJEA 5U25A 3SZFA 3QJ4A 2C64A 4J56A 3CGEA 4EIPA 1H7WA 4II2A 3UKKA 4C3YA 1BWCA 3ICRA 5JCKA 4ECHA 1B8SA 1GRHA 3D1CA 1ZMCA 2XFOA 1ELIA 2WP5A 1MXTA 2CFYA 1ONFA 4LU6A
chains in the Genus database with same CATH topology
2NPXA 1IUSA 2GV8A 5JCIA 1K4QA 2WHDA 1L0VA 3BI2A 1E7PA 1PXBA 5M0ZA 4EM3A 2V3AA 3HYXA 3UOVA 1VG9A 2XFNA 3GWDA 4Z2TA 1TRBA 2YG5A 3GDNA 4WX1A 1LTXR 3LZXA 3RHAA 4H4RA 2YLRA 3CNDA 5BVAA 3F8RA 4OPCA 5FS7A 3ZDNA 3VR8A 3AXBA 5HXIA 3GD3A 2V5ZA 3UKAA 4HA6A 4YXDA 3LXDA 4A99A 2X8CA 5EB4A 4EQXA 4EIQA 2TMDA 4NTEA 2VVLA 3UKHA 3CGBA 3NK0X 4AT0A 3IWAA 1JEHA 3H8LA 1KSSA 5FMHA 5CKUA 1W4XA 4H4YA 1GRGA 2Q7VA 2GEWA 4WCTA 4C74A 1L9EA 4I58A 3SX6A 4YTNA 3K7TA 4Y4NA 4G74A 4YSHA 3K7MX 3VQRA 3UKFA 3CPIG 3UOYA 3KA7A 1LQUA 4GCMA 2WPEA 2APGA 1NHQA 2UZZA 1ZMDA 3RNMA 3M0OA 4NNJA 4B69A 4H2NA 1NENA 4J2WA 1NG4A 4BV6A 4YTMA 2R0GA 3M13A 4GDPA 1SEZA 4ADWA 4AP3A 3GDPA 1XDIA 2JK6A 4Z25A 2X50A 3HYVA 3CMMA 1K0LA 3UP5A 3ADAB 1CC6A 3PVCA 1LQTA 1TDOA 2WDVA 1GXFA 5DBJA 4I59A 1O94A 1ZK7A 1JRXA 2GR1A 2XLRA 4RSLA 1H6VA 3PO7A 1ZX9A 4E0VA 1H7XA 4U2TA 4EQRA 1YQZA 1LPFA 2BC1A 4U8IA 1N4WA 3OZ2A 2X3NA 2YLTA 3QVRA 1TYPA 2GMHA 3KU9A 5KWFA 3T37A 2OALA 3NH3X 2ZZ0A 4BK3A 3DH9A 1EL5A 2AAQA 4H50A 5ER0A 3AB1A 1JU2A 3EAOA 2GAGB 1EBDA 4H4SA 3KD9A 2DKHA 2YM1A 4K7ZA 1GV4A 4UDRA 2E1MA 3AE1A 3UP4A 1YQ4A 3AEFA 2XLUA 4X9NA 1Y56B 4UDPA 3IHMA 2Z5YA 1BGJA 1PHHA 1P2EA 4JY2A 1KDGA 2F5ZA 4LIIA 4BURA 4OPLA 2XFUA 3NTAA 2ARDA 2XLSA 2YWLA 3NG7X 1PBFA 4BJYA 1EL8A 5FS9A 1S3BA 4G9KA 5C2TA 2OA1A 2X8GA 4X9MA 4IA5A 1O95A 1PJ6A 4PAAA 3T14A 3UOZA 3NN6X 4H2QA 4U8PA 4NZHA 1Y56A 4C5OA 2JB1A 2NVKX 3S61A 4C77A 4Z44A 3C4NA 2GF3A 3AEGA 3GSIA 1S2YA 1D5TA 1DOCA 2QA1A 2TPRA 3BI4A 3V3OA 2YLZA 4B66A 1NG3A 1GNDA 5IQ4A 3AD7B 5C3JA 3AWIA 5CQFA 5U1OA 4EM4A 4A5LA 2Q6UA 4GR1A 1CC4A 3UTGA 1E1KA 2XDOA 3S5WA 1QO8A 1E1NA 2GRTA 3FBSA 4U2LA 5HYMA 3CNTA 4FK1A 4GRTA 2YR6A 4OPIA 4KX6A 1MO9A 2ZBWA 1FCDA 3VR9A 3KLJA 2BXRA 5KMRA 4H4TA 1D7LA 4X4JA 2XLTA 5JCMA 1GESA 1JOAA 2RGOA 1TDKA 2GQFA 2XLPA 2V6OA 2ZZBA 2XVJA 1JRZA 1YY5A 3CN8A 3DK8A 1E6EA 1H83A 2YVGA 4J36A 1CHUA 1PBCA 3FG2P 4J34A 2R45A 1TDFA 3M12A 4U8KA 3SXIA 4CNKA 3K30A 5M10A 4H2RA 3B6DA 3DJJA 3AE9A 1PBBA 4CCQA 3ICSA 2E4GA 2GB0A 2YM2A 3CGDA 3PS9A 1KSUA 3UCLA 3G5SA 4ZN0A 4NEVA 1H84A 1NHPA 2A8XA 1RSGA 2YAUA 3ATRA 3G5RA 2YG6A 3BNUA 1DOBA 1X31B 1Q1WA 1CBOA 4U8LA 2BYBA 2XVHA 3DJGX 5GRTA 3EF6A 1L9CA 4B67A 2OLOA 4CBQA 1REOA 2WQYA 1L9DA 3FMWA 1QJDA 3I6DA 4G6HA 2EQ7A 2QA2A 1PBEA 3RP8A 4KPRA 3NLCA 2BABA 2YR5A 2EQ9A 1B4VA 4XXGA 4JNAA 1Y0PA 2GR0A 1KF6A 2BCPA 1LJ1A 2WBAA 3AE2A 1GALA 2R4EA 3AECA 5KRQA 2RGJA 1S2QA 1D4DA 3GWFA 1GEUA 3F8PA 3L1RA 4II3A 3REDA 4DGKA 2XYOA 4HB9A 3SZWA 4A6NB 3ZYXA 2H88A 3CNJA 1ZKQA 3Q6JA 2WP6A 3GRSA 3FIMB 3NT6A 2YG4A 1ZOYA 5J7XA 2V3BA 5KMQA 4IV9A 3T2ZA 4A79A 4GUVA 1OJDA 1H82A 2PHHA 1PXCA 3LB8A 1GRFA 4B65A 4Z26A 3EPTA 1IUUA 3UKPA 1VG0A 4J31A 2IIDA 3E1TA 4JNQA 1TYTA 1DJNA 2VZ2A 5HY5A 3AYLA 4AP1A 3V76A 2W0HA 3DA1A 4AOXA 5IPYA 1BZLA 2GH5A 2WP9A 2VVMA 1OJCA 4YKGA 1GERA 3DJDA 4DSGA 3L8KA 3UTFA 1D7YA 4Y4MA 5FS8A 1S3EA 4JN9A 2QCUA 4EMWA 4TLXA 4XWRA 4EQSA 3C96A 5GSNA 1Q9IA 2B7RA 2AQJA 2R46A 1NHRA 1E39A 1Q1RA 2BACA 1F3PA 3II4A 3NYCA 4FX9A 4YT0A 2VQBA 1IUXA 2BK5A 3QSEA 3GYIA 3SYIA 2HQMA 4UDQA 2YG7A 5L46A 2XVEA 4NWZA 3LZWA 1GOSA 2A87A 4K22A 2GQWA 1FECA 2GR2A 2EQ8A 3NN0X 4Z2UA 5BULA 4TM0A 2GAHB 3AEBA 1FEAA 1RYIA 3BHKA 4OPGA 2WS3A 3JSKA 1OJ9A 3SFDA 1XPQA 4K5SA 2XVIA 4YTPA 3UTEA 2C3CA 2C3DA 4GAVA 1PN0A 2BRAA 3C4AA 3GD4A 3UKQA 2JBVA 2WEUA 2V61A 2B9XA 3CPJG 4GF7A 4H4WA 2YVFA 4NTCA 1DODA 3IF9A 3CTYA 4Y4LA 4OCGA 1NHSA 1K0JA 3R9UA 5HHFA 2WOVA 1D4CA 4AOSA 3IC9A 4IVOB 4EQWA 3GRTA 4TM1A 3NRNA 1IUTA 4RG4A 4Z43A 1V59A 4H4PA 2FJDA 2BS3A 4B1BA 3T2YA 2VRMA 3P4PA 4A65A 5JCNA 2XCGA 2IVEA 3UOXA 1E1MA 5EBKA 2Q0LA 1EL9A 4TLZA 4OPTA 4U2SA 4A9WA 4B64A 2XFPA 4H4XA 4YSZA 3QSSA 3NHOX 4USQA 2CULA 3RP7A 4D03A 4B68A 2YLWA 4IA6A 3P1WA 5KXJA 1JNRA 4UP3A 2C7GA 2BXSA 2B9YA 2ACZA 2BRYA 4J33A 4M52A 2C4CA 3AEAA 3GMBA 5IQ1A 1UKVG 1YKJA 2XFQA 2AR8A 3LJPA 1PJ7A 3P4QA 1OJAA 1ZOVA 1PBDA 3KKJA 4USRA 4H7UA 3SGLA 5EB5A 4LA1A 3D8XA 5KNLA 4XWZA 3T2KA 2YR4A 2WESA 1CJ2A 4REKA 3VRDB 2BS2A 1CF3A 1N1PA 1CJ4A 1DXLA 2C65A 4U8MA 1H81A 4K8DA 2C70A 2R9ZA 1Z6LA 3O0HA 1CC2A 3QFBA 4RG3A 2C66A 2IVDA 1AOGA 4OVIA 4DNAA 1LV0A 5BUKA 3VRBA 3AE7A 3NYFA 2BC0A 1LVLA 1XANA 4JDRA 2YVJA 3CGCA 1FEBA 3OC4A 1GRBA 3GYXA 1QLBA 2FJBA 2X8HA 2FBWA 2WU2A 2R0PA 4PABA 4K5RA 1E1LA 1BF3A 1F6MA 2C76A 2EQ6A 2ZZCA 2YQUA 3QSMA 1RP0A 4OPUA 2JAEA 3ICTA 1N4UA 1CL0A 4OPDA 1VRQB 4G73A 4U8NA 2Z5XA 2WDQA 4EMIA 1D4EA 3ALMA 3B3RA 4MJWA 2BK3A 2WU5A 2CDUA 3ITJA 4O5QA 1GREA 3AYIA 3NK1X 4DSHA 4U8OA 2DKIA 5JCLA 1K0IA 3V3NA 1NEKA 3DGHA 3URHA 2BK4A 4C3XA 3GMCA 1NPXA 5BRTA 2I0ZA 4O5UA 1GRTA 2V60A 1CJ3A 3UTHA 2VQ7A 4FK1C 3T0KA 3Q9TA 2O9ZA 4IVMB 5KMPA 3ISHA 3KPFA 2Y6QA 2OAMA 2OLNA 3ALJA 4H4VA 1PJ5A 5TR3A 2B7SA 4AT2A 5LV9A 3CPHG 4NEWA 3DMEA 1DJQA 2C72A 3VRAA 3UKLA 4B63A 1GETA 1P2HA 1B5QA 4APNA 3CIRA 4JQ9A 4YSYA 2XVFA 2FJAA 2VRLA 2Y6RA 3AEDA 3H8IA 4P9SA 3NNEA 5KVIA 4BK1A 2GVCA 2BCGG 4H4ZA 2GR3A 2YLSA 1VDCA 3QVPA 1PXAA 5J60A 5KOXA 3NTDA 3GYJA 1F8WA 2VVLG 4NTDA 3BI5A 4CY6A 2PYXA 4U8JA 2BA9A 1N4VA 3P4RA 1PS9A 1EL7A 3DK4A 4Z24A 2C67A 2CVJA 1KNRA 4GAPA 2X99A 4ICYA 1ZP0A 3F8DA 1GT8A 2H89A 1GSNA 3SFEA 4JY3A 5EOWA 3SM8A 3ALLA 4CRTA 3P9UA 3AEEA 5KVHA 3NGCX 3ATQA 2B76A 3SQPA 4YSXA 4Z2RA 2JB2A 1M6IA 2WOWA 4ZCCA 4CNJA 5U63A 4H4UA 3NIXA 1B37A 4TM3A 3NKSA 3P4SA 5KMSA 4YKFA 3SZ0A 2RABA 3CNPA 1YQ3A 3AE8A 1DOEA 2WPCA 3ABVA 3AD9B 1BKWA 1F8RA 1COYA 1JNZA 1GRAA 1ZY8A 2A89A 1H86A 1JRYA 1MOKA 2QAEA 2WDRA 3AE6A 3AE5A 3AE4A 4CCRA 3AE3A 2YLXA 3I3LA 1O5WA 1KFYA 4K2XA 1IUWA 3H4KA 2BS4A 3T31A 3DK9A 3HZLA 1M64A 1NDAA 3BHFA 4A6NA 4CY8A 2WETA 1IJHA 4GDEA 3AD8B 3K7QX 4H4QA 1FL2A 1FOHA 5FS6A 1KNPA 4H2PA 1GTEA 4EMJA 2JKCA 1TDEA 3NYEA 3QFAA 2Q0KA 2R4JA 2C75A 3NK2X 3COXA 4G6GA 1GPEA 1VQWA 1IUVA 3WE0A 4YWOA 4BK2A 3KPKA 3DJEA 1HYUA 1F8SA 2GMJA 3FPZA 4J57A 4N9XA 3SZCA 1OJTA 2C73A 1PDHA 1ZDLA 3IHGA 3AYJA 3LOVA 1XHCA 1CJCA 1DNCA 2VOUA 2B9WA 2WPFA 1GTHA 2YG3A 4D04A 3DGZA 3SY4A 2J3NA 3EANA 1TDNA 1NAAA 4FDCB 4TM4A 5KOWA 3BNMA 2RGHA 2WOIA 3LADA 4BJZA 3G5QA 4ZCDA 2E5VA 3RP6A 2R0CA 2JB3A 1BGNA 3KVEA 4A7AA 3HYWA 3CNSA 2FJEA 5U25A 3SZFA 3QJ4A 2C64A 4J56A 3CGEA 4EIPA 1H7WA 4II2A 3UKKA 4C3YA 1BWCA 3ICRA 5JCKA 4ECHA 1B8SA 1GRHA 3D1CA 1ZMCA 2XFOA 1ELIA 2WP5A 1MXTA 2CFYA 1ONFA 4LU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPX A;  1IUS A;  2GV8 A;  5JCI A;  1K4Q A;  2WHD A;  1L0V A;  3BI2 A;  1E7P A;  1PXB A;  5M0Z A;  4EM3 A;  2V3A A;  3UOV A;  1VG9 A;  2XFN A;  3GWD A;  4Z2T A;  1TRB A;  2YG5 A;  3GDN A;  4WX1 A;  1LTX R;  3LZX A;  3RHA A;  4H4R A;  2YLR A;  3CND A;  5BVA A;  3F8R A;  4OPC A;  5FS7 A;  3ZDN A;  3VR8 A;  3AXB A;  5HXI A;  3GD3 A;  2V5Z A;  3UKA A;  4HA6 A;  4YXD A;  3LXD A;  4A99 A;  2X8C A;  5EB4 A;  4EQX A;  4EIQ A;  2TMD A;  4NTE A;  2VVL A;  3UKH A;  3CGB A;  3NK0 X;  4AT0 A;  3IWA A;  1JEH A;  3H8L A;  1KSS A;  5FMH A;  5CKU A;  1W4X A;  4H4Y A;  1GRG A;  2Q7V A;  2GEW A;  4WCT A;  4C74 A;  1L9E A;  4I58 A;  4YTN A;  3K7T A;  4Y4N A;  4YSH A;  3K7M X;  3VQR A;  3UKF A;  3CPI G;  3UOY A;  3KA7 A;  1LQU A;  4GCM A;  2WPE A;  2APG A;  1NHQ A;  2UZZ A;  1ZMD A;  3RNM A;  3M0O A;  4B69 A;  4H2N A;  1NEN A;  4J2W A;  1NG4 A;  4BV6 A;  4YTM A;  2R0G A;  3M13 A;  4GDP A;  1SEZ A;  4ADW A;  4AP3 A;  3GDP A;  1XDI A;  2JK6 A;  4Z25 A;  2X50 A;  1K0L A;  3UP5 A;  3ADA B;  1CC6 A;  3PVC A;  1LQT A;  1TDO A;  2WDV A;  1GXF A;  5DBJ A;  4I59 A;  1O94 A;  1ZK7 A;  1JRX A;  2GR1 A;  2XLR A;  4RSL A;  1H6V A;  3PO7 A;  1ZX9 A;  4E0V A;  1H7X A;  4U2T A;  4EQR A;  1YQZ A;  1LPF A;  2BC1 A;  4U8I A;  1N4W A;  3OZ2 A;  2X3N A;  2YLT A;  3QVR A;  1TYP A;  2GMH A;  3KU9 A;  5KWF A;  3T37 A;  2OAL A;  3NH3 X;  2ZZ0 A;  4BK3 A;  3DH9 A;  1EL5 A;  2AAQ A;  4H50 A;  5ER0 A;  3AB1 A;  1JU2 A;  3EAO A;  2GAG B;  1EBD A;  4H4S A;  3KD9 A;  2DKH A;  2YM1 A;  4K7Z A;  1GV4 A;  4UDR A;  2E1M A;  3AE1 A;  3UP4 A;  1YQ4 A;  3AEF A;  2XLU A;  4X9N A;  1Y56 B;  4UDP A;  3IHM A;  2Z5Y A;  1BGJ A;  1PHH A;  1P2E A;  4JY2 A;  1KDG A;  2F5Z A;  4LII A;  4BUR A;  4OPL A;  2XFU A;  3NTA A;  2ARD A;  2XLS A;  2YWL A;  3NG7 X;  1PBF A;  4BJY A;  1EL8 A;  5FS9 A;  1S3B A;  5C2T A;  2OA1 A;  2X8G A;  4X9M A;  4IA5 A;  1O95 A;  1PJ6 A;  4PAA A;  3UOZ A;  3NN6 X;  4H2Q A;  4U8P A;  4NZH A;  1Y56 A;  4C5O A;  2JB1 A;  2NVK X;  3S61 A;  4C77 A;  4Z44 A;  3C4N A;  2GF3 A;  3AEG A;  3GSI A;  1S2Y A;  1D5T A;  1DOC A;  2QA1 A;  2TPR A;  3BI4 A;  3V3O A;  2YLZ A;  4B66 A;  1NG3 A;  1GND A;  5IQ4 A;  3AD7 B;  5C3J A;  3AWI A;  5CQF A;  5U1O A;  4EM4 A;  4A5L A;  2Q6U A;  4GR1 A;  1CC4 A;  3UTG A;  1E1K A;  2XDO A;  3S5W A;  1QO8 A;  1E1N A;  2GRT A;  3FBS A;  4U2L A;  5HYM A;  3CNT A;  4FK1 A;  4GRT A;  2YR6 A;  4OPI A;  4KX6 A;  1MO9 A;  2ZBW A;  1FCD A;  3VR9 A;  3KLJ A;  2BXR A;  4H4T A;  1D7L A;  4X4J A;  2XLT A;  5JCM A;  1GES A;  1JOA A;  2RGO A;  1TDK A;  2GQF A;  2XLP A;  2V6O A;  2ZZB A;  2XVJ A;  1JRZ A;  1YY5 A;  3CN8 A;  3DK8 A;  1E6E A;  1H83 A;  2YVG A;  4J36 A;  1CHU A;  1PBC A;  3FG2 P;  4J34 A;  2R45 A;  1TDF A;  3M12 A;  4U8K A;  4CNK A;  5M10 A;  3K30 A;  4H2R A;  3B6D A;  3DJJ A;  3AE9 A;  1PBB A;  4CCQ A;  3ICS A;  2E4G A;  2GB0 A;  2YM2 A;  3CGD A;  3PS9 A;  1KSU A;  3UCL A;  3G5S A;  4ZN0 A;  4NEV A;  1H84 A;  1NHP A;  2A8X A;  1RSG A;  2YAU A;  3ATR A;  3G5R A;  2YG6 A;  3BNU A;  1DOB A;  1X31 B;  1Q1W A;  1CBO A;  4U8L A;  2BYB A;  2XVH A;  3DJG X;  5GRT A;  3EF6 A;  1L9C A;  4B67 A;  2OLO A;  4CBQ A;  1REO A;  2WQY A;  1L9D A;  3FMW A;  1QJD A;  3I6D A;  2EQ7 A;  2QA2 A;  1PBE A;  3RP8 A;  4KPR A;  3NLC A;  2BAB A;  2YR5 A;  2EQ9 A;  1B4V A;  4XXG A;  4JNA A;  1Y0P A;  2GR0 A;  1KF6 A;  2BCP A;  1LJ1 A;  2WBA A;  3AE2 A;  1GAL A;  2R4E A;  3AEC A;  5KRQ A;  2RGJ A;  1S2Q A;  1D4D A;  3GWF A;  1GEU A;  3F8P A;  3L1R A;  4DGK A;  3RED A;  2XYO A;  4HB9 A;  4A6N B;  3ZYX A;  2H88 A;  3CNJ A;  1ZKQ A;  3Q6J A;  2WP6 A;  3GRS A;  3FIM B;  3NT6 A;  2YG4 A;  1ZOY A;  5J7X A;  2V3B A;  4IV9 A;  4A79 A;  4GUV A;  1OJD A;  1H82 A;  2PHH A;  1PXC A;  3LB8 A;  1GRF A;  4B65 A;  4Z26 A;  3EPT A;  1IUU A;  3UKP A;  1VG0 A;  4J31 A;  2IID A;  3E1T A;  4JNQ A;  1TYT A;  1DJN A;  2VZ2 A;  5HY5 A;  3AYL A;  4AP1 A;  3V76 A;  2W0H A;  3DA1 A;  4AOX A;  5IPY A;  1BZL A;  2GH5 A;  2WP9 A;  2VVM A;  1OJC A;  4YKG A;  1GER A;  3DJD A;  4DSG A;  3L8K A;  3UTF A;  1D7Y A;  4Y4M A;  5FS8 A;  1S3E A;  4JN9 A;  2QCU A;  4EMW A;  4TLX A;  4XWR A;  4EQS A;  3C96 A;  5GSN A;  1Q9I A;  2B7R A;  2AQJ A;  2R46 A;  1NHR A;  1E39 A;  1Q1R A;  2BAC A;  1F3P A;  3II4 A;  3NYC A;  4FX9 A;  4YT0 A;  2VQB A;  1IUX A;  2BK5 A;  3QSE A;  3GYI A;  5L46 A;  2HQM A;  4UDQ A;  2YG7 A;  2XVE A;  3LZW A;  1GOS A;  2A87 A;  4K22 A;  2GQW A;  1FEC A;  2GR2 A;  2EQ8 A;  3NN0 X;  4Z2U A;  5BUL A;  4TM0 A;  2GAH B;  3AEB A;  1FEA A;  1RYI A;  3BHK A;  4OPG A;  2WS3 A;  3JSK A;  1OJ9 A;  3SFD A;  1XPQ A;  4K5S A;  2XVI A;  4YTP A;  3UTE A;  2C3C A;  2C3D A;  1PN0 A;  3C4A A;  3GD4 A;  3UKQ A;  2JBV A;  2WEU A;  2V61 A;  2B9X A;  3CPJ G;  4GF7 A;  4H4W A;  2YVF A;  4NTC A;  1DOD A;  3IF9 A;  3CTY A;  4Y4L A;  4OCG A;  1NHS A;  1K0J A;  3R9U A;  5HHF A;  2WOV A;  1D4C A;  4AOS A;  3IC9 A;  4IVO B;  4EQW A;  3GRT A;  4TM1 A;  3NRN A;  1IUT A;  4RG4 A;  4Z43 A;  1V59 A;  4H4P A;  2FJD A;  2BS3 A;  4B1B A;  2VRM A;  3P4P A;  4A65 A;  5JCN A;  2XCG A;  2IVE A;  3UOX A;  1E1M A;  5EBK A;  2Q0L A;  1EL9 A;  4TLZ A;  4OPT A;  4U2S A;  4A9W A;  4B64 A;  2XFP A;  4H4X A;  4YSZ A;  3QSS A;  3NHO X;  4USQ A;  2CUL A;  3RP7 A;  4D03 A;  4B68 A;  2YLW A;  4IA6 A;  3P1W A;  5KXJ A;  1JNR A;  4UP3 A;  2C7G A;  2BXS A;  2B9Y A;  2ACZ A;  4M52 A;  4J33 A;  3AEA A;  3GMB A;  5IQ1 A;  1UKV G;  1YKJ A;  2XFQ A;  2AR8 A;  3LJP A;  1PJ7 A;  3P4Q A;  1OJA A;  1ZOV A;  1PBD A;  3KKJ A;  4USR A;  4H7U A;  3SGL A;  5EB5 A;  4LA1 A;  3D8X A;  4XWZ A;  2YR4 A;  2WES A;  1CJ2 A;  4REK A;  3VRD B;  2BS2 A;  1CF3 A;  1N1P A;  1CJ4 A;  1DXL A;  2C65 A;  4U8M A;  1H81 A;  4K8D A;  2C70 A;  2R9Z A;  1Z6L A;  3O0H A;  1CC2 A;  3QFB A;  4RG3 A;  2C66 A;  2IVD A;  1AOG A;  4OVI A;  4DNA A;  1LV0 A;  5BUK A;  3VRB A;  3AE7 A;  3NYF A;  2BC0 A;  1LVL A;  1XAN A;  4JDR A;  2YVJ A;  3CGC A;  1FEB A;  3OC4 A;  1GRB A;  1QLB A;  2FJB A;  2X8H A;  2FBW A;  2WU2 A;  2R0P A;  4PAB A;  4K5R A;  1E1L A;  1BF3 A;  1F6M A;  2C76 A;  2EQ6 A;  2ZZC A;  2YQU A;  3QSM A;  1RP0 A;  4OPU A;  2JAE A;  3ICT A;  1N4U A;  1CL0 A;  4OPD A;  1VRQ B;  4U8N A;  2Z5X A;  2WDQ A;  4EMI A;  1D4E A;  3ALM A;  3B3R A;  4MJW A;  2BK3 A;  2WU5 A;  2CDU A;  3ITJ A;  4O5Q A;  1GRE A;  3AYI A;  3NK1 X;  4DSH A;  4U8O A;  2DKI A;  5JCL A;  1K0I A;  3V3N A;  1NEK A;  3DGH A;  3URH A;  2BK4 A;  4C3X A;  3GMC A;  1NPX A;  5BRT A;  2I0Z A;  4O5U A;  1GRT A;  2V60 A;  1CJ3 A;  3UTH A;  2VQ7 A;  4FK1 C;  3Q9T A;  2O9Z A;  4IVM B;  3ISH A;  3KPF A;  2Y6Q A;  2OAM A;  2OLN A;  3ALJ A;  4H4V A;  1PJ5 A;  5TR3 A;  2B7S A;  4AT2 A;  5LV9 A;  3CPH G;  4NEW A;  3DME A;  1DJQ A;  2C72 A;  3VRA A;  3UKL A;  4B63 A;  1GET A;  1P2H A;  1B5Q A;  4APN A;  3CIR A;  4JQ9 A;  4YSY A;  2XVF A;  2FJA A;  2VRL A;  2Y6R A;  3AED A;  3H8I A;  4P9S A;  3NNE A;  5KVI A;  4BK1 A;  2GVC A;  2BCG G;  4H4Z A;  2GR3 A;  2YLS A;  1VDC A;  3QVP A;  1PXA A;  5J60 A;  5KOX A;  3NTD A;  3GYJ A;  1F8W A;  2VVL G;  4NTD A;  3BI5 A;  4CY6 A;  2PYX A;  4U8J A;  2BA9 A;  1N4V A;  3P4R A;  1PS9 A;  1EL7 A;  3DK4 A;  4Z24 A;  2C67 A;  2CVJ A;  1KNR A;  4ICY A;  2X99 A;  1ZP0 A;  3F8D A;  1GT8 A;  2H89 A;  1GSN A;  3SFE A;  4JY3 A;  5EOW A;  3SM8 A;  3ALL A;  4CRT A;  3P9U A;  3AEE A;  5KVH A;  3NGC X;  3ATQ A;  2B76 A;  3SQP A;  4YSX A;  4Z2R A;  2JB2 A;  1M6I A;  2WOW A;  4ZCC A;  4CNJ A;  5U63 A;  4H4U A;  3NIX A;  1B37 A;  4TM3 A;  3NKS A;  3P4S A;  4YKF A;  2RAB A;  3CNP A;  1YQ3 A;  3AE8 A;  1DOE A;  2WPC A;  3ABV A;  3AD9 B;  1BKW A;  1F8R A;  1COY A;  1JNZ A;  1GRA A;  1ZY8 A;  2A89 A;  1H86 A;  1JRY A;  1MOK A;  2QAE A;  2WDR A;  3AE6 A;  3AE5 A;  3AE4 A;  4CCR A;  3AE3 A;  2YLX A;  3I3L A;  1O5W A;  1KFY A;  4K2X A;  1IUW A;  3H4K A;  2BS4 A;  3DK9 A;  3HZL A;  1M64 A;  1NDA A;  3BHF A;  4A6N A;  4CY8 A;  2WET A;  1IJH A;  4GDE A;  3AD8 B;  3K7Q X;  4H4Q A;  1FL2 A;  1FOH A;  5FS6 A;  1KNP A;  4H2P A;  1GTE A;  4EMJ A;  2JKC A;  1TDE A;  3NYE A;  3QFA A;  2Q0K A;  2R4J A;  2C75 A;  3NK2 X;  3COX A;  1GPE A;  1VQW A;  1IUV A;  3WE0 A;  4YWO A;  4BK2 A;  3DJE A;  1HYU A;  1F8S A;  2GMJ A;  3FPZ A;  4J57 A;  4N9X A;  1OJT A;  2C73 A;  1PDH A;  1ZDL A;  3IHG A;  3AYJ A;  3LOV A;  1XHC A;  1CJC A;  1DNC A;  2VOU A;  2B9W A;  2WPF A;  1GTH A;  2YG3 A;  4D04 A;  3DGZ A;  2J3N A;  3EAN A;  1TDN A;  1NAA A;  4FDC B;  4TM4 A;  5KOW A;  3BNM A;  2RGH A;  2WOI A;  3LAD A;  4BJZ A;  3G5Q A;  4ZCD A;  2E5V A;  3RP6 A;  2R0C A;  2JB3 A;  1BGN A;  3KVE A;  4A7A A;  3CNS A;  2FJE A;  5U25 A;  3QJ4 A;  2C64 A;  4J56 A;  3CGE A;  4EIP A;  1H7W A;  3UKK A;  4C3Y A;  1BWC A;  3ICR A;  5JCK A;  4ECH A;  1B8S A;  1GRH A;  3D1C A;  1ZMC A;  2XFO A;  1ELI A;  2WP5 A;  1MXT A;  2CFY A;  1ONF A;  4LU6 A; 
#chains in the Genus database with same CATH topology
 2NPX A;  1IUS A;  2GV8 A;  5JCI A;  1K4Q A;  2WHD A;  1L0V A;  3BI2 A;  1E7P A;  1PXB A;  5M0Z A;  4EM3 A;  2V3A A;  3HYX A;  3UOV A;  1VG9 A;  2XFN A;  3GWD A;  4Z2T A;  1TRB A;  2YG5 A;  3GDN A;  4WX1 A;  1LTX R;  3LZX A;  3RHA A;  4H4R A;  2YLR A;  3CND A;  5BVA A;  3F8R A;  4OPC A;  5FS7 A;  3ZDN A;  3VR8 A;  3AXB A;  5HXI A;  3GD3 A;  2V5Z A;  3UKA A;  4HA6 A;  4YXD A;  3LXD A;  4A99 A;  2X8C A;  5EB4 A;  4EQX A;  4EIQ A;  2TMD A;  4NTE A;  2VVL A;  3UKH A;  3CGB A;  3NK0 X;  4AT0 A;  3IWA A;  1JEH A;  3H8L A;  1KSS A;  5FMH A;  5CKU A;  1W4X A;  4H4Y A;  1GRG A;  2Q7V A;  2GEW A;  4WCT A;  4C74 A;  1L9E A;  4I58 A;  3SX6 A;  4YTN A;  3K7T A;  4Y4N A;  4G74 A;  4YSH A;  3K7M X;  3VQR A;  3UKF A;  3CPI G;  3UOY A;  3KA7 A;  1LQU A;  4GCM A;  2WPE A;  2APG A;  1NHQ A;  2UZZ A;  1ZMD A;  3RNM A;  3M0O A;  4NNJ A;  4B69 A;  4H2N A;  1NEN A;  4J2W A;  1NG4 A;  4BV6 A;  4YTM A;  2R0G A;  3M13 A;  4GDP A;  1SEZ A;  4ADW A;  4AP3 A;  3GDP A;  1XDI A;  2JK6 A;  4Z25 A;  2X50 A;  3HYV A;  3CMM A;  1K0L A;  3UP5 A;  3ADA B;  1CC6 A;  3PVC A;  1LQT A;  1TDO A;  2WDV A;  1GXF A;  5DBJ A;  4I59 A;  1O94 A;  1ZK7 A;  1JRX A;  2GR1 A;  2XLR A;  4RSL A;  1H6V A;  3PO7 A;  1ZX9 A;  4E0V A;  1H7X A;  4U2T A;  4EQR A;  1YQZ A;  1LPF A;  2BC1 A;  4U8I A;  1N4W A;  3OZ2 A;  2X3N A;  2YLT A;  3QVR A;  1TYP A;  2GMH A;  3KU9 A;  5KWF A;  3T37 A;  2OAL A;  3NH3 X;  2ZZ0 A;  4BK3 A;  3DH9 A;  1EL5 A;  2AAQ A;  4H50 A;  5ER0 A;  3AB1 A;  1JU2 A;  3EAO A;  2GAG B;  1EBD A;  4H4S A;  3KD9 A;  2DKH A;  2YM1 A;  4K7Z A;  1GV4 A;  4UDR A;  2E1M A;  3AE1 A;  3UP4 A;  1YQ4 A;  3AEF A;  2XLU A;  4X9N A;  1Y56 B;  4UDP A;  3IHM A;  2Z5Y A;  1BGJ A;  1PHH A;  1P2E A;  4JY2 A;  1KDG A;  2F5Z A;  4LII A;  4BUR A;  4OPL A;  2XFU A;  3NTA A;  2ARD A;  2XLS A;  2YWL A;  3NG7 X;  1PBF A;  4BJY A;  1EL8 A;  5FS9 A;  1S3B A;  4G9K A;  5C2T A;  2OA1 A;  2X8G A;  4X9M A;  4IA5 A;  1O95 A;  1PJ6 A;  4PAA A;  3T14 A;  3UOZ A;  3NN6 X;  4H2Q A;  4U8P A;  4NZH A;  1Y56 A;  4C5O A;  2JB1 A;  2NVK X;  3S61 A;  4C77 A;  4Z44 A;  3C4N A;  2GF3 A;  3AEG A;  3GSI A;  1S2Y A;  1D5T A;  1DOC A;  2QA1 A;  2TPR A;  3BI4 A;  3V3O A;  2YLZ A;  4B66 A;  1NG3 A;  1GND A;  5IQ4 A;  3AD7 B;  5C3J A;  3AWI A;  5CQF A;  5U1O A;  4EM4 A;  4A5L A;  2Q6U A;  4GR1 A;  1CC4 A;  3UTG A;  1E1K A;  2XDO A;  3S5W A;  1QO8 A;  1E1N A;  2GRT A;  3FBS A;  4U2L A;  5HYM A;  3CNT A;  4FK1 A;  4GRT A;  2YR6 A;  4OPI A;  4KX6 A;  1MO9 A;  2ZBW A;  1FCD A;  3VR9 A;  3KLJ A;  2BXR A;  5KMR A;  4H4T A;  1D7L A;  4X4J A;  2XLT A;  5JCM A;  1GES A;  1JOA A;  2RGO A;  1TDK A;  2GQF A;  2XLP A;  2V6O A;  2ZZB A;  2XVJ A;  1JRZ A;  1YY5 A;  3CN8 A;  3DK8 A;  1E6E A;  1H83 A;  2YVG A;  4J36 A;  1CHU A;  1PBC A;  3FG2 P;  4J34 A;  2R45 A;  1TDF A;  3M12 A;  4U8K A;  3SXI A;  4CNK A;  3K30 A;  5M10 A;  4H2R A;  3B6D A;  3DJJ A;  3AE9 A;  1PBB A;  4CCQ A;  3ICS A;  2E4G A;  2GB0 A;  2YM2 A;  3CGD A;  3PS9 A;  1KSU A;  3UCL A;  3G5S A;  4ZN0 A;  4NEV A;  1H84 A;  1NHP A;  2A8X A;  1RSG A;  2YAU A;  3ATR A;  3G5R A;  2YG6 A;  3BNU A;  1DOB A;  1X31 B;  1Q1W A;  1CBO A;  4U8L A;  2BYB A;  2XVH A;  3DJG X;  5GRT A;  3EF6 A;  1L9C A;  4B67 A;  2OLO A;  4CBQ A;  1REO A;  2WQY A;  1L9D A;  3FMW A;  1QJD A;  3I6D A;  4G6H A;  2EQ7 A;  2QA2 A;  1PBE A;  3RP8 A;  4KPR A;  3NLC A;  2BAB A;  2YR5 A;  2EQ9 A;  1B4V A;  4XXG A;  4JNA A;  1Y0P A;  2GR0 A;  1KF6 A;  2BCP A;  1LJ1 A;  2WBA A;  3AE2 A;  1GAL A;  2R4E A;  3AEC A;  5KRQ A;  2RGJ A;  1S2Q A;  1D4D A;  3GWF A;  1GEU A;  3F8P A;  3L1R A;  4II3 A;  3RED A;  4DGK A;  2XYO A;  4HB9 A;  3SZW A;  4A6N B;  3ZYX A;  2H88 A;  3CNJ A;  1ZKQ A;  3Q6J A;  2WP6 A;  3GRS A;  3FIM B;  3NT6 A;  2YG4 A;  1ZOY A;  5J7X A;  2V3B A;  5KMQ A;  4IV9 A;  3T2Z A;  4A79 A;  4GUV A;  1OJD A;  1H82 A;  2PHH A;  1PXC A;  3LB8 A;  1GRF A;  4B65 A;  4Z26 A;  3EPT A;  1IUU A;  3UKP A;  1VG0 A;  4J31 A;  2IID A;  3E1T A;  4JNQ A;  1TYT A;  1DJN A;  2VZ2 A;  5HY5 A;  3AYL A;  4AP1 A;  3V76 A;  2W0H A;  3DA1 A;  4AOX A;  5IPY A;  1BZL A;  2GH5 A;  2WP9 A;  2VVM A;  1OJC A;  4YKG A;  1GER A;  3DJD A;  4DSG A;  3L8K A;  3UTF A;  1D7Y A;  4Y4M A;  5FS8 A;  1S3E A;  4JN9 A;  2QCU A;  4EMW A;  4TLX A;  4XWR A;  4EQS A;  3C96 A;  5GSN A;  1Q9I A;  2B7R A;  2AQJ A;  2R46 A;  1NHR A;  1E39 A;  2BAC A;  1Q1R A;  1F3P A;  3II4 A;  3NYC A;  4FX9 A;  4YT0 A;  2VQB A;  1IUX A;  2BK5 A;  3QSE A;  3GYI A;  3SYI A;  2HQM A;  4UDQ A;  2YG7 A;  5L46 A;  2XVE A;  4NWZ A;  3LZW A;  1GOS A;  2A87 A;  4K22 A;  2GQW A;  1FEC A;  2GR2 A;  2EQ8 A;  3NN0 X;  4Z2U A;  5BUL A;  4TM0 A;  2GAH B;  3AEB A;  1FEA A;  1RYI A;  3BHK A;  4OPG A;  2WS3 A;  3JSK A;  1OJ9 A;  3SFD A;  1XPQ A;  4K5S A;  2XVI A;  4YTP A;  3UTE A;  2C3C A;  2C3D A;  4GAV A;  1PN0 A;  2BRA A;  3C4A A;  3GD4 A;  3UKQ A;  2JBV A;  2WEU A;  2V61 A;  2B9X A;  3CPJ G;  4GF7 A;  4H4W A;  2YVF A;  4NTC A;  1DOD A;  3IF9 A;  3CTY A;  4Y4L A;  4OCG A;  1NHS A;  1K0J A;  3R9U A;  5HHF A;  2WOV A;  1D4C A;  4AOS A;  3IC9 A;  4IVO B;  4EQW A;  3GRT A;  4TM1 A;  3NRN A;  1IUT A;  4RG4 A;  4Z43 A;  1V59 A;  4H4P A;  2FJD A;  2BS3 A;  4B1B A;  3T2Y A;  2VRM A;  3P4P A;  4A65 A;  5JCN A;  2XCG A;  2IVE A;  3UOX A;  1E1M A;  5EBK A;  2Q0L A;  1EL9 A;  4TLZ A;  4OPT A;  4U2S A;  4A9W A;  4B64 A;  2XFP A;  4H4X A;  4YSZ A;  3QSS A;  3NHO X;  4USQ A;  2CUL A;  3RP7 A;  4D03 A;  4B68 A;  2YLW A;  4IA6 A;  3P1W A;  5KXJ A;  1JNR A;  4UP3 A;  2C7G A;  2BXS A;  2B9Y A;  2ACZ A;  2BRY A;  4J33 A;  4M52 A;  2C4C A;  3AEA A;  3GMB A;  5IQ1 A;  1UKV G;  1YKJ A;  2XFQ A;  2AR8 A;  3LJP A;  1PJ7 A;  3P4Q A;  1OJA A;  1ZOV A;  1PBD A;  3KKJ A;  4USR A;  4H7U A;  3SGL A;  5EB5 A;  4LA1 A;  3D8X A;  5KNL A;  4XWZ A;  3T2K A;  2YR4 A;  2WES A;  1CJ2 A;  4REK A;  3VRD B;  2BS2 A;  1CF3 A;  1N1P A;  1CJ4 A;  1DXL A;  2C65 A;  4U8M A;  1H81 A;  4K8D A;  2C70 A;  2R9Z A;  1Z6L A;  3O0H A;  1CC2 A;  3QFB A;  4RG3 A;  2C66 A;  2IVD A;  1AOG A;  4OVI A;  4DNA A;  1LV0 A;  5BUK A;  3VRB A;  3AE7 A;  3NYF A;  2BC0 A;  1LVL A;  1XAN A;  4JDR A;  2YVJ A;  3CGC A;  1FEB A;  3OC4 A;  1GRB A;  3GYX A;  1QLB A;  2FJB A;  2X8H A;  2FBW A;  2WU2 A;  2R0P A;  4PAB A;  4K5R A;  1E1L A;  1BF3 A;  1F6M A;  2C76 A;  2EQ6 A;  2ZZC A;  2YQU A;  3QSM A;  1RP0 A;  4OPU A;  2JAE A;  3ICT A;  1N4U A;  1CL0 A;  4OPD A;  1VRQ B;  4G73 A;  4U8N A;  2Z5X A;  2WDQ A;  4EMI A;  1D4E A;  3ALM A;  3B3R A;  4MJW A;  2BK3 A;  2WU5 A;  2CDU A;  3ITJ A;  4O5Q A;  1GRE A;  3AYI A;  3NK1 X;  4DSH A;  4U8O A;  2DKI A;  5JCL A;  1K0I A;  3V3N A;  1NEK A;  3DGH A;  3URH A;  2BK4 A;  4C3X A;  3GMC A;  1NPX A;  5BRT A;  2I0Z A;  4O5U A;  1GRT A;  2V60 A;  1CJ3 A;  3UTH A;  2VQ7 A;  4FK1 C;  3T0K A;  3Q9T A;  2O9Z A;  4IVM B;  5KMP A;  3ISH A;  3KPF A;  2Y6Q A;  2OAM A;  2OLN A;  3ALJ A;  4H4V A;  1PJ5 A;  5TR3 A;  2B7S A;  4AT2 A;  5LV9 A;  3CPH G;  4NEW A;  3DME A;  1DJQ A;  2C72 A;  3VRA A;  3UKL A;  4B63 A;  1GET A;  1P2H A;  1B5Q A;  4APN A;  3CIR A;  4JQ9 A;  4YSY A;  2XVF A;  2FJA A;  2VRL A;  2Y6R A;  3AED A;  3H8I A;  4P9S A;  3NNE A;  5KVI A;  4BK1 A;  2GVC A;  2BCG G;  4H4Z A;  2GR3 A;  2YLS A;  1VDC A;  3QVP A;  1PXA A;  5J60 A;  5KOX A;  3NTD A;  3GYJ A;  1F8W A;  2VVL G;  4NTD A;  3BI5 A;  4CY6 A;  2PYX A;  4U8J A;  2BA9 A;  1N4V A;  3P4R A;  1PS9 A;  1EL7 A;  3DK4 A;  4Z24 A;  2C67 A;  2CVJ A;  1KNR A;  4GAP A;  2X99 A;  4ICY A;  1ZP0 A;  3F8D A;  1GT8 A;  2H89 A;  1GSN A;  3SFE A;  4JY3 A;  5EOW A;  3SM8 A;  3ALL A;  4CRT A;  3P9U A;  3AEE A;  5KVH A;  3NGC X;  3ATQ A;  2B76 A;  3SQP A;  4YSX A;  4Z2R A;  2JB2 A;  1M6I A;  2WOW A;  4ZCC A;  4CNJ A;  5U63 A;  4H4U A;  3NIX A;  1B37 A;  4TM3 A;  3NKS A;  3P4S A;  5KMS A;  4YKF A;  3SZ0 A;  2RAB A;  3CNP A;  1YQ3 A;  3AE8 A;  1DOE A;  2WPC A;  3ABV A;  3AD9 B;  1BKW A;  1F8R A;  1COY A;  1JNZ A;  1GRA A;  1ZY8 A;  2A89 A;  1H86 A;  1JRY A;  1MOK A;  2QAE A;  2WDR A;  3AE6 A;  3AE5 A;  3AE4 A;  4CCR A;  3AE3 A;  2YLX A;  3I3L A;  1O5W A;  1KFY A;  4K2X A;  1IUW A;  3H4K A;  2BS4 A;  3T31 A;  3DK9 A;  3HZL A;  1M64 A;  1NDA A;  3BHF A;  4A6N A;  4CY8 A;  2WET A;  1IJH A;  4GDE A;  3AD8 B;  3K7Q X;  4H4Q A;  1FL2 A;  1FOH A;  5FS6 A;  1KNP A;  4H2P A;  1GTE A;  4EMJ A;  2JKC A;  1TDE A;  3NYE A;  3QFA A;  2Q0K A;  2R4J A;  2C75 A;  3NK2 X;  3COX A;  4G6G A;  1GPE A;  1VQW A;  1IUV A;  3WE0 A;  4YWO A;  4BK2 A;  3KPK A;  3DJE A;  1HYU A;  1F8S A;  2GMJ A;  3FPZ A;  4J57 A;  4N9X A;  3SZC A;  1OJT A;  2C73 A;  1PDH A;  1ZDL A;  3IHG A;  3AYJ A;  3LOV A;  1XHC A;  1CJC A;  1DNC A;  2VOU A;  2B9W A;  2WPF A;  1GTH A;  2YG3 A;  4D04 A;  3DGZ A;  3SY4 A;  2J3N A;  3EAN A;  1TDN A;  1NAA A;  4FDC B;  4TM4 A;  5KOW A;  3BNM A;  2RGH A;  2WOI A;  3LAD A;  4BJZ A;  3G5Q A;  4ZCD A;  2E5V A;  3RP6 A;  2R0C A;  2JB3 A;  1BGN A;  3KVE A;  4A7A A;  3HYW A;  3CNS A;  2FJE A;  5U25 A;  3SZF A;  3QJ4 A;  2C64 A;  4J56 A;  3CGE A;  4EIP A;  1H7W A;  4II2 A;  3UKK A;  4C3Y A;  1BWC A;  3ICR A;  5JCK A;  4ECH A;  1B8S A;  1GRH A;  3D1C A;  1ZMC A;  2XFO A;  1ELI A;  2WP5 A;  1MXT A;  2CFY A;  1ONF A;  4LU6 A; 
#chains in the Genus database with same CATH homology
 2NPX A;  1IUS A;  2GV8 A;  5JCI A;  1K4Q A;  2WHD A;  1L0V A;  3BI2 A;  1E7P A;  1PXB A;  5M0Z A;  4EM3 A;  2V3A A;  3HYX A;  3UOV A;  1VG9 A;  2XFN A;  3GWD A;  4Z2T A;  1TRB A;  2YG5 A;  3GDN A;  4WX1 A;  1LTX R;  3LZX A;  3RHA A;  4H4R A;  2YLR A;  3CND A;  5BVA A;  3F8R A;  4OPC A;  5FS7 A;  3ZDN A;  3VR8 A;  3AXB A;  5HXI A;  3GD3 A;  2V5Z A;  3UKA A;  4HA6 A;  4YXD A;  3LXD A;  4A99 A;  2X8C A;  5EB4 A;  4EQX A;  4EIQ A;  2TMD A;  4NTE A;  2VVL A;  3UKH A;  3CGB A;  3NK0 X;  4AT0 A;  3IWA A;  1JEH A;  3H8L A;  1KSS A;  5FMH A;  5CKU A;  1W4X A;  4H4Y A;  1GRG A;  2Q7V A;  2GEW A;  4WCT A;  4C74 A;  1L9E A;  4I58 A;  3SX6 A;  4YTN A;  3K7T A;  4Y4N A;  4G74 A;  4YSH A;  3K7M X;  3VQR A;  3UKF A;  3CPI G;  3UOY A;  3KA7 A;  1LQU A;  4GCM A;  2WPE A;  2APG A;  1NHQ A;  2UZZ A;  1ZMD A;  3RNM A;  3M0O A;  4NNJ A;  4B69 A;  4H2N A;  1NEN A;  4J2W A;  1NG4 A;  4BV6 A;  4YTM A;  2R0G A;  3M13 A;  4GDP A;  1SEZ A;  4ADW A;  4AP3 A;  3GDP A;  1XDI A;  2JK6 A;  4Z25 A;  2X50 A;  3HYV A;  3CMM A;  1K0L A;  3UP5 A;  3ADA B;  1CC6 A;  3PVC A;  1LQT A;  1TDO A;  2WDV A;  1GXF A;  5DBJ A;  4I59 A;  1O94 A;  1ZK7 A;  1JRX A;  2GR1 A;  2XLR A;  4RSL A;  1H6V A;  3PO7 A;  1ZX9 A;  4E0V A;  1H7X A;  4U2T A;  4EQR A;  1YQZ A;  1LPF A;  2BC1 A;  4U8I A;  1N4W A;  3OZ2 A;  2X3N A;  2YLT A;  3QVR A;  1TYP A;  2GMH A;  3KU9 A;  5KWF A;  3T37 A;  2OAL A;  3NH3 X;  2ZZ0 A;  4BK3 A;  3DH9 A;  1EL5 A;  2AAQ A;  4H50 A;  5ER0 A;  3AB1 A;  1JU2 A;  3EAO A;  2GAG B;  1EBD A;  4H4S A;  3KD9 A;  2DKH A;  2YM1 A;  4K7Z A;  1GV4 A;  4UDR A;  2E1M A;  3AE1 A;  3UP4 A;  1YQ4 A;  3AEF A;  2XLU A;  4X9N A;  1Y56 B;  4UDP A;  3IHM A;  2Z5Y A;  1BGJ A;  1PHH A;  1P2E A;  4JY2 A;  1KDG A;  2F5Z A;  4LII A;  4BUR A;  4OPL A;  2XFU A;  3NTA A;  2ARD A;  2XLS A;  2YWL A;  3NG7 X;  1PBF A;  4BJY A;  1EL8 A;  5FS9 A;  1S3B A;  4G9K A;  5C2T A;  2OA1 A;  2X8G A;  4X9M A;  4IA5 A;  1O95 A;  1PJ6 A;  4PAA A;  3T14 A;  3UOZ A;  3NN6 X;  4H2Q A;  4U8P A;  4NZH A;  1Y56 A;  4C5O A;  2JB1 A;  2NVK X;  3S61 A;  4C77 A;  4Z44 A;  3C4N A;  2GF3 A;  3AEG A;  3GSI A;  1S2Y A;  1D5T A;  1DOC A;  2QA1 A;  2TPR A;  3BI4 A;  3V3O A;  2YLZ A;  4B66 A;  1NG3 A;  1GND A;  5IQ4 A;  3AD7 B;  5C3J A;  3AWI A;  5CQF A;  5U1O A;  4EM4 A;  4A5L A;  2Q6U A;  4GR1 A;  1CC4 A;  3UTG A;  1E1K A;  2XDO A;  3S5W A;  1QO8 A;  1E1N A;  2GRT A;  3FBS A;  4U2L A;  5HYM A;  3CNT A;  4FK1 A;  4GRT A;  2YR6 A;  4OPI A;  4KX6 A;  1MO9 A;  2ZBW A;  1FCD A;  3VR9 A;  3KLJ A;  2BXR A;  5KMR A;  4H4T A;  1D7L A;  4X4J A;  2XLT A;  5JCM A;  1GES A;  1JOA A;  2RGO A;  1TDK A;  2GQF A;  2XLP A;  2V6O A;  2ZZB A;  2XVJ A;  1JRZ A;  1YY5 A;  3CN8 A;  3DK8 A;  1E6E A;  1H83 A;  2YVG A;  4J36 A;  1CHU A;  1PBC A;  3FG2 P;  4J34 A;  2R45 A;  1TDF A;  3M12 A;  4U8K A;  3SXI A;  4CNK A;  3K30 A;  5M10 A;  4H2R A;  3B6D A;  3DJJ A;  3AE9 A;  1PBB A;  4CCQ A;  3ICS A;  2E4G A;  2GB0 A;  2YM2 A;  3CGD A;  3PS9 A;  1KSU A;  3UCL A;  3G5S A;  4ZN0 A;  4NEV A;  1H84 A;  1NHP A;  2A8X A;  1RSG A;  2YAU A;  3ATR A;  3G5R A;  2YG6 A;  3BNU A;  1DOB A;  1X31 B;  1Q1W A;  1CBO A;  4U8L A;  2BYB A;  2XVH A;  3DJG X;  5GRT A;  3EF6 A;  1L9C A;  4B67 A;  2OLO A;  4CBQ A;  1REO A;  2WQY A;  1L9D A;  3FMW A;  1QJD A;  3I6D A;  4G6H A;  2EQ7 A;  2QA2 A;  1PBE A;  3RP8 A;  4KPR A;  3NLC A;  2BAB A;  2YR5 A;  2EQ9 A;  1B4V A;  4XXG A;  4JNA A;  1Y0P A;  2GR0 A;  1KF6 A;  2BCP A;  1LJ1 A;  2WBA A;  3AE2 A;  1GAL A;  2R4E A;  3AEC A;  5KRQ A;  2RGJ A;  1S2Q A;  1D4D A;  3GWF A;  1GEU A;  3F8P A;  3L1R A;  4II3 A;  3RED A;  4DGK A;  2XYO A;  4HB9 A;  3SZW A;  4A6N B;  3ZYX A;  2H88 A;  3CNJ A;  1ZKQ A;  3Q6J A;  2WP6 A;  3GRS A;  3FIM B;  3NT6 A;  2YG4 A;  1ZOY A;  5J7X A;  2V3B A;  5KMQ A;  4IV9 A;  3T2Z A;  4A79 A;  4GUV A;  1OJD A;  1H82 A;  2PHH A;  1PXC A;  3LB8 A;  1GRF A;  4B65 A;  4Z26 A;  3EPT A;  1IUU A;  3UKP A;  1VG0 A;  4J31 A;  2IID A;  3E1T A;  4JNQ A;  1TYT A;  1DJN A;  2VZ2 A;  5HY5 A;  3AYL A;  4AP1 A;  3V76 A;  2W0H A;  3DA1 A;  4AOX A;  5IPY A;  1BZL A;  2GH5 A;  2WP9 A;  2VVM A;  1OJC A;  4YKG A;  1GER A;  3DJD A;  4DSG A;  3L8K A;  3UTF A;  1D7Y A;  4Y4M A;  5FS8 A;  1S3E A;  4JN9 A;  2QCU A;  4EMW A;  4TLX A;  4XWR A;  4EQS A;  3C96 A;  5GSN A;  1Q9I A;  2B7R A;  2AQJ A;  2R46 A;  1NHR A;  1E39 A;  1Q1R A;  2BAC A;  1F3P A;  3II4 A;  3NYC A;  4FX9 A;  4YT0 A;  2VQB A;  1IUX A;  2BK5 A;  3QSE A;  3GYI A;  3SYI A;  2HQM A;  4UDQ A;  2YG7 A;  5L46 A;  2XVE A;  4NWZ A;  3LZW A;  1GOS A;  2A87 A;  4K22 A;  2GQW A;  1FEC A;  2GR2 A;  2EQ8 A;  3NN0 X;  4Z2U A;  5BUL A;  4TM0 A;  2GAH B;  3AEB A;  1FEA A;  1RYI A;  3BHK A;  4OPG A;  2WS3 A;  3JSK A;  1OJ9 A;  3SFD A;  1XPQ A;  4K5S A;  2XVI A;  4YTP A;  3UTE A;  2C3C A;  2C3D A;  4GAV A;  1PN0 A;  2BRA A;  3C4A A;  3GD4 A;  3UKQ A;  2JBV A;  2WEU A;  2V61 A;  2B9X A;  3CPJ G;  4GF7 A;  4H4W A;  2YVF A;  4NTC A;  1DOD A;  3IF9 A;  3CTY A;  4Y4L A;  4OCG A;  1NHS A;  1K0J A;  3R9U A;  5HHF A;  2WOV A;  1D4C A;  4AOS A;  3IC9 A;  4IVO B;  4EQW A;  3GRT A;  4TM1 A;  3NRN A;  1IUT A;  4RG4 A;  4Z43 A;  1V59 A;  4H4P A;  2FJD A;  2BS3 A;  4B1B A;  3T2Y A;  2VRM A;  3P4P A;  4A65 A;  5JCN A;  2XCG A;  2IVE A;  3UOX A;  1E1M A;  5EBK A;  2Q0L A;  1EL9 A;  4TLZ A;  4OPT A;  4U2S A;  4A9W A;  4B64 A;  2XFP A;  4H4X A;  4YSZ A;  3QSS A;  3NHO X;  4USQ A;  2CUL A;  3RP7 A;  4D03 A;  4B68 A;  2YLW A;  4IA6 A;  3P1W A;  5KXJ A;  1JNR A;  4UP3 A;  2C7G A;  2BXS A;  2B9Y A;  2ACZ A;  2BRY A;  4J33 A;  4M52 A;  2C4C A;  3AEA A;  3GMB A;  5IQ1 A;  1UKV G;  1YKJ A;  2XFQ A;  2AR8 A;  3LJP A;  1PJ7 A;  3P4Q A;  1OJA A;  1ZOV A;  1PBD A;  3KKJ A;  4USR A;  4H7U A;  3SGL A;  5EB5 A;  4LA1 A;  3D8X A;  5KNL A;  4XWZ A;  3T2K A;  2YR4 A;  2WES A;  1CJ2 A;  4REK A;  3VRD B;  2BS2 A;  1CF3 A;  1N1P A;  1CJ4 A;  1DXL A;  2C65 A;  4U8M A;  1H81 A;  4K8D A;  2C70 A;  2R9Z A;  1Z6L A;  3O0H A;  1CC2 A;  3QFB A;  4RG3 A;  2C66 A;  2IVD A;  1AOG A;  4OVI A;  4DNA A;  1LV0 A;  5BUK A;  3VRB A;  3AE7 A;  3NYF A;  2BC0 A;  1LVL A;  1XAN A;  4JDR A;  2YVJ A;  3CGC A;  1FEB A;  3OC4 A;  1GRB A;  3GYX A;  1QLB A;  2FJB A;  2X8H A;  2FBW A;  2WU2 A;  2R0P A;  4PAB A;  4K5R A;  1E1L A;  1BF3 A;  1F6M A;  2C76 A;  2EQ6 A;  2ZZC A;  2YQU A;  3QSM A;  1RP0 A;  4OPU A;  2JAE A;  3ICT A;  1N4U A;  1CL0 A;  4OPD A;  1VRQ B;  4G73 A;  4U8N A;  2Z5X A;  2WDQ A;  4EMI A;  1D4E A;  3ALM A;  3B3R A;  4MJW A;  2BK3 A;  2WU5 A;  2CDU A;  3ITJ A;  4O5Q A;  1GRE A;  3AYI A;  3NK1 X;  4DSH A;  4U8O A;  2DKI A;  5JCL A;  1K0I A;  3V3N A;  1NEK A;  3DGH A;  3URH A;  2BK4 A;  4C3X A;  3GMC A;  1NPX A;  5BRT A;  2I0Z A;  4O5U A;  1GRT A;  2V60 A;  1CJ3 A;  3UTH A;  2VQ7 A;  4FK1 C;  3T0K A;  3Q9T A;  2O9Z A;  4IVM B;  5KMP A;  3ISH A;  3KPF A;  2Y6Q A;  2OAM A;  2OLN A;  3ALJ A;  4H4V A;  1PJ5 A;  5TR3 A;  2B7S A;  4AT2 A;  5LV9 A;  3CPH G;  4NEW A;  3DME A;  1DJQ A;  2C72 A;  3VRA A;  3UKL A;  4B63 A;  1GET A;  1P2H A;  1B5Q A;  4APN A;  3CIR A;  4JQ9 A;  4YSY A;  2XVF A;  2FJA A;  2VRL A;  2Y6R A;  3AED A;  3H8I A;  4P9S A;  3NNE A;  5KVI A;  4BK1 A;  2GVC A;  2BCG G;  4H4Z A;  2GR3 A;  2YLS A;  1VDC A;  3QVP A;  1PXA A;  5J60 A;  5KOX A;  3NTD A;  3GYJ A;  1F8W A;  2VVL G;  4NTD A;  3BI5 A;  4CY6 A;  2PYX A;  4U8J A;  2BA9 A;  1N4V A;  3P4R A;  1PS9 A;  1EL7 A;  3DK4 A;  4Z24 A;  2C67 A;  2CVJ A;  1KNR A;  4GAP A;  2X99 A;  4ICY A;  1ZP0 A;  3F8D A;  1GT8 A;  2H89 A;  1GSN A;  3SFE A;  4JY3 A;  5EOW A;  3SM8 A;  3ALL A;  4CRT A;  3P9U A;  3AEE A;  5KVH A;  3NGC X;  3ATQ A;  2B76 A;  3SQP A;  4YSX A;  4Z2R A;  2JB2 A;  1M6I A;  2WOW A;  4ZCC A;  4CNJ A;  5U63 A;  4H4U A;  3NIX A;  1B37 A;  4TM3 A;  3NKS A;  3P4S A;  5KMS A;  4YKF A;  3SZ0 A;  2RAB A;  3CNP A;  1YQ3 A;  3AE8 A;  1DOE A;  2WPC A;  3ABV A;  3AD9 B;  1BKW A;  1F8R A;  1COY A;  1JNZ A;  1GRA A;  1ZY8 A;  2A89 A;  1H86 A;  1JRY A;  1MOK A;  2QAE A;  2WDR A;  3AE6 A;  3AE5 A;  3AE4 A;  4CCR A;  3AE3 A;  2YLX A;  3I3L A;  1O5W A;  1KFY A;  4K2X A;  1IUW A;  3H4K A;  2BS4 A;  3T31 A;  3DK9 A;  3HZL A;  1M64 A;  1NDA A;  3BHF A;  4A6N A;  4CY8 A;  2WET A;  1IJH A;  4GDE A;  3AD8 B;  3K7Q X;  4H4Q A;  1FL2 A;  1FOH A;  5FS6 A;  1KNP A;  4H2P A;  1GTE A;  4EMJ A;  2JKC A;  1TDE A;  3NYE A;  3QFA A;  2Q0K A;  2R4J A;  2C75 A;  3NK2 X;  3COX A;  4G6G A;  1GPE A;  1VQW A;  1IUV A;  3WE0 A;  4YWO A;  4BK2 A;  3KPK A;  3DJE A;  1HYU A;  1F8S A;  2GMJ A;  3FPZ A;  4J57 A;  4N9X A;  3SZC A;  1OJT A;  2C73 A;  1PDH A;  1ZDL A;  3IHG A;  3AYJ A;  3LOV A;  1XHC A;  1CJC A;  1DNC A;  2VOU A;  2B9W A;  2WPF A;  1GTH A;  2YG3 A;  4D04 A;  3DGZ A;  3SY4 A;  2J3N A;  3EAN A;  1TDN A;  1NAA A;  4FDC B;  4TM4 A;  5KOW A;  3BNM A;  2RGH A;  2WOI A;  3LAD A;  4BJZ A;  3G5Q A;  4ZCD A;  2E5V A;  3RP6 A;  2R0C A;  2JB3 A;  1BGN A;  3KVE A;  4A7A A;  3HYW A;  3CNS A;  2FJE A;  5U25 A;  3SZF A;  3QJ4 A;  2C64 A;  4J56 A;  3CGE A;  4EIP A;  1H7W A;  4II2 A;  3UKK A;  4C3Y A;  1BWC A;  3ICR A;  5JCK A;  4ECH A;  1B8S A;  1GRH A;  3D1C A;  1ZMC A;  2XFO A;  1ELI A;  2WP5 A;  1MXT A;  2CFY A;  1ONF A;  4LU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...