3ITJA

Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
317
structure length
317
Chain Sequence
VHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase 1
publication title Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 97
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3itjA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3itjA02
1GESA 1LPFA 2O9ZA 3DJEA 4ZCDA 1F6MA 2WDQA 4Y4LA 4UDRA 1DNCA 3AE2A 1CL0A 3CPHG 3LXDA 4BJYA 1GOSA 5FS8A 2YLTA 1E39A 3DGHA 3WE0A 1H6VA 4B63A 1PN0A 3T37A 4U8OA 4CY6A 1GXFA 2BYBA 3KD9A 3CPJG 5CKUA 1PBDA 5JCIA 3UOYA 1TDEA 2WDRA 2BA9A 3CN8A 4K5SA 3RP6A 2J3NA 2FBWA 2JAEA 5HXIA 3EANA 4WCTA 4A7AA 1GRGA 2IVDA 2RGOA 1B8SA 3UKHA 3AYLA 5U63A 3GDPA 3UOXA 2WP5A 2GH5A 3ATQA 4UP3A 2YWLA 4C3YA 4H4ZA 5HYMA 1Q1RA 3Q6JA 3CNDA 2GAHB 2Q7VA 1KF6A 3IF9A 2R0CA 2GAGB 3CNPA 4U8JA 3CNSA 1D7YA 1L9CA 1V59A 1GRHA 3AD7B 3EAOA 4YXDA 3LOVA 2VQ7A 4J36A 4B69A 2R0GA 2YVJA 4IVMB 1NG3A 3AE4A 3NHOX 4BK1A 2VRMA 5J7XA 1JRXA 1NG4A 1ZKQA 4TLZA 3SM8A 1IUSA 3ALLA 3BI2A 3IHGA 3IWAA 3AXBA 2PHHA 2XDOA 3G5RA 3COXA 2WHDA 4IV9A 4DNAA 4NTEA 4OPIA 4A6NA 2XLRA 3QFAA 2B9XA 2ZZBA 2A89A 2BCGG 2YLXA 1JU2A 3DJGX 4Z2RA 5JCMA 1PJ5A 4J31A 3AEBA 1H82A 4N9XA 4EMWA 2C73A 3CGCA 4Y4NA 5BVAA 4Z2UA 2A8XA 5DBJA 2XFQA 4YWOA 1EL9A 3OC4A 2YG5A 4JN9A 4ZN0A 2ARDA 1JEHA 4EMJA 1P2EA 1VG0A 1VRQB 4O5UA 3UOVA 2XVIA 1H83A 3GMBA 1EBDA 3UKQA 3ADAB 4ICYA 4J34A 2X3NA 5KVIA 3SFEA 4GCMA 1O5WA 3H4KA 1DODA 5EBKA 1REOA 3NKSA 4NEVA 4U8MA 3GWFA 3S5WA 2YLWA 3FMWA 2RABA 2BCPA 3KVEA 1IUXA 1LQTA 1GT8A 3P4QA 4GDPA 3AYIA 2GMJA 4H4SA 1JNZA 1MO9A 3G5QA 2Z5YA 3FPZA 3DJDA 4AP3A 3M0OA 1DJQA 3SFDA 3EF6A 4H7UA 1BGNA 4YTNA 1S3EA 1YQZA 1RYIA 3B3RA 4D03A 2WS3A 2R4JA 2UZZA 1ONFA 4TM3A 2YQUA 4HB9A 2VQBA 3K7QX 2JB2A 4B1BA 1NHQA 4K5RA 3UP4A 1D4DA 4Z2TA 1B5QA 4LA1A 1D5TA 1CC6A 4AP1A 3AD9B 2YG7A 1JRYA 4X4JA 1L9EA 2E1MA 3GD3A 3NG7X 4IVOB 3DK9A 3PS9A 3Q9TA 4H2PA 4XWZA 5GRTA 4H4PA 2YR5A 4FDCB 2GMHA 5C3JA 4KX6A 2XFUA 2X8CA 1TRBA 1E1KA 4FK1A 2AAQA 2C75A 2Y6QA 4U2SA 1OJAA 2ZZCA 3AE5A 3UKLA 5KRQA 1CC4A 1M64A 4BK3A 1YY5A 1FEBA 2R46A 2X99A 3KA7A 4OPCA 1FOHA 3AECA 2XVHA 3P4RA 3QSMA 1EL7A 3CNJA 1IUTA 5M0ZA 2BACA 2OALA 2BK5A 2NPXA 2Y6RA 2YLSA 1N4VA 1TYPA 1KDGA 1COYA 2YLZA 3AE9A 1N4UA 1XDIA 4TM1A 1PJ7A 2WETA 2BK4A 1PXAA 2WQYA 3GSIA 2DKIA 2R0PA 2B9WA 1FL2A 3GDNA 3NN6X 4ECHA 4JDRA 3E1TA 2E4GA 4B66A 1GALA 1PXBA 2GR0A 3UKPA 4I59A 3AEDA 4LIIA 4TM4A 4GUVA 1K0IA 2C3DA 4DGKA 1K4QA 2WBAA 3RNMA 3SQPA 1DOBA 2BABA 1O94A 2ZZ0A 2F5ZA 3CGEA 4XWRA 5JCNA 2FJEA 5J60A 1PJ6A 4CNJA 3VRDB 1YQ4A 4UDQA 4C74A 2RGHA 1PXCA 3DH9A 3UKAA 2QA2A 4FK1C 1FEAA 3V76A 2TPRA 1PBBA 2BC0A 1OJ9A 2XVFA 4USQA 3AE6A 1JRZA 3SGLA 4OPUA 1MOKA 3VRAA 1PBCA 5CQFA 1BF3A 1RSGA 3F8PA 2H89A 3VR9A 4YSZA 3KPFA 2GVCA 1EL5A 4U2TA 3ZDNA 4NTDA 4Y4MA 1DOCA 3AE3A 3LB8A 5ER0A 1FECA 3GYIA 4D04A 4K8DA 1DJNA 1M6IA 2BXSA 3VRBA 1Q1WA 1ZP0A 2WEUA 2GV8A 3AEAA 1YQ3A 4Z25A 1NPXA 4C5OA 2YVGA 1CJ4A 1O95A 2C67A 4J2WA 1NHPA 4RG3A 3UKKA 2EQ9A 2YR4A 4AOXA 1GRTA 4H50A 4EQSA 4OCGA 4APNA 4REKA 3DK4A 1E7PA 1GPEA 2WPEA 2RGJA 3CIRA 3V3NA 1HYUA 5GSNA 3P1WA 1EL8A 5L46A 1H84A 1QLBA 3LZWA 1PBEA 4U8IA 5LV9A 1ZOVA 3HZLA 2C72A 4TM0A 2WPCA 3AE8A 2R45A 1AOGA 3M13A 1OJCA 4J33A 3AWIA 2QAEA 3BHKA 3GRSA 3NNEA 3V3OA 3NYEA 4YKFA 1NHRA 1XHCA 2YR6A 1Z6LA 4H4TA 2XCGA 3GRTA 4B64A 2XLTA 2YM2A 1CHUA 1TDNA 2XLUA 2GQWA 2V6OA 4PAAA 4USRA 4Z44A 3DGZA 3O0HA 3P4PA 1D7LA 3BHFA 4CNKA 2C7GA 2YLRA 3K30A 3CPIG 3PVCA 4I58A 1GETA 1D4CA 3DJJA 4IA5A 2YG4A 4YT0A 2A87A 4K2XA 5HY5A 1CJ2A 3QVPA 5HHFA 3ISHA 1GNDA 2B76A 1CC2A 4IA6A 1B4VA 4A79A 5FMHA 1E1MA 3F8DA 1GTHA 3GMCA 2WU5A 2BXRA 2Q6UA 2NVKX 2WESA 2XFPA 2BC1A 5C2TA 3FG2P 2VVLG 2W0HA 4CBQA 3NK2X 2BS4A 1OJTA 3NK1X 3UCLA 2E5VA 1MXTA 1QO8A 3C96A 4C77A 3QJ4A 2BS3A 1DOEA 4U8KA 4EM4A 3ALJA 1GREA 4ZCCA 1L0VA 1KSSA 1P2HA 3L1RA 3DA1A 2GQFA 5U25A 3UTEA 4Z43A 3D8XA 4H4RA 4A9WA 1GEUA 4U8NA 2OLOA 4AOSA 4EMIA 4DSGA 3CNTA 4OVIA 2VVLA 3DK8A 4YSHA 1GRAA 5FS9A 3QSEA 1NDAA 1S2QA 3QFBA 2VZ2A 2WOWA 2GEWA 3AYJA 2YVFA 4C3XA 4CY8A 5IQ4A 1F8RA 4B65A 1JOAA 1PBFA 4Z26A 5KXJA 1GRBA 3RP8A 4JQ9A 3LZXA 3OZ2A 3NT6A 4JY3A 1KNPA 1NAAA 3UKFA 5U1OA 2WOIA 1IUWA 1L9DA 2Q0LA 1W4XA 2HQMA 2CFYA 4BJZA 4P9SA 3B6DA 3AB1A 2V3AA 2YAUA 1BKWA 3AEEA 5EB4A 4CRTA 3IHMA 1KSUA 4NZHA 1GRFA 2I0ZA 2XFOA 5IQ1A 3NH3X 1GERA 2GB0A 3IC9A 4CCQA 2GR2A 4Z24A 3BNMA 4H2RA 3ITJA 1FCDA 2IIDA 2APGA 2PYXA 2QA1A 3FIMB 4OPLA 4E0VA 1TYTA 2B7SA 2GRTA 1F8SA 1BZLA 4J57A 1KFYA 4KPRA 2EQ8A 3ZYXA 2C3CA 3QSSA 5JCLA 4ADWA 2C65A 2VVMA 1PDHA 4BV6A 2OLNA 3AE1A 3CGBA 5BUKA 3GD4A 1NEKA 2FJAA 3PO7A 4JNAA 1TDFA 1NENA 3AEGA 3D1CA 3URHA 4LU6A 2JKCA 2JB3A 4JNQA 3GYJA 3LJPA 3LADA 2C76A 1Q9IA 2AR8A 4YTMA 1CJ3A 1Y56B 4FX9A 4O5QA 2R4EA 1LJ1A 3ABVA 4UDPA 1TDKA 4OPGA 3R9UA 4GF7A 4OPTA 4X9NA 2GF3A 1N4WA 5EOWA 4EIQA 4U8PA 2EQ6A 1IJHA 2YG3A 4U2LA 2JK6A 1OJDA 3VQRA 3KKJA 5IPYA 4BURA 1F3PA 4K7ZA 2XLSA 4WX1A 1LVLA 1CF3A 3BNUA 5TR3A 2CULA 5KVHA 2JB1A 4J56A 1VQWA 5EB5A 4YSXA 4EM3A 4AT0A 2CVJA 2VOUA 3S61A 2BS2A 5BRTA 1DXLA 4A5LA 1ZK7A 5KOXA 3BI5A 3DMEA 5FS6A 3K7MX 5KOWA 1GV4A 2V3BA 1BWCA 4MJWA 2B7RA 3NIXA 3NLCA 1PS9A 3C4NA 1F8WA 3ICRA 1ZMCA 3NN0X 4NTCA 4XXGA 3KU9A 3ALMA 2V61A 4GRTA 2XVJA 3KLJA 3II4A 1CJCA 1XPQA 5KWFA 2OAMA 2CDUA 5JCKA 1N1PA 2VRLA 1CBOA 1X31B 2WDVA 3FBSA 3RHAA 1IUUA 1ZY8A 4GDEA 1S2YA 3BI4A 3CTYA 3ATRA 1ELIA 2YM1A 2GR3A 3NK0X 4A65A 1E6EA 2X50A 3UTFA 3L8KA 2TMDA 1VDCA 2WU2A 2OA1A 4HA6A 3NYFA 3QVRA 2YG6A 1H7WA 2C70A 1E1LA 1LTXR 2WPFA 1GTEA 3GWDA 3ICSA 4CCRA 4EQRA 2WOVA 2R9ZA 3H8IA 3RP7A 1ZOYA 1LQUA 2JBVA 3F8RA 4YTPA 4A6NB 1IUVA 3NTAA 4H4YA 2ZBWA 3AEFA 1Y0PA 3NYCA 4H2NA 4B68A 4EQWA 3AE7A 4H2QA 1NHSA 4RG4A 4YSYA 1GSNA 1B37A 4H4VA 2X8GA 4X9MA 1UKVG 3C4AA 2X8HA 3H8LA 2BK3A 4B67A 1D4EA 1H7XA 4OPDA 3UTHA 1K0JA 4EIPA 2V5ZA 4U8LA 4JY2A 3I3LA 5BULA 2H88A 3K7TA 4BK2A 1SEZA 1H86A 2QCUA 1H81A 2EQ7A 2XVEA 3NRNA 4K22A 3CGDA 3REDA 3NGCX 3UTGA 1BGJA 3P4SA 3ICTA 1YKJA 3M12A 2C64A 1KNRA 3VR8A 3I6DA 4YKGA 4H4QA 2IVEA 3G5SA 1JNRA 4EQXA 2ACZA 1E1NA 2WP9A 4PABA 1S3BA 1VG9A 3P9UA 1LV0A 4H4UA 2DKHA 4H4XA 4TLXA 3UOZA 4GR1A 2AQJA 3NTDA 2GR1A 4RSLA 1Y56A 1XANA 1PHHA 3AD8B 3EPTA 5FS7A 3JSKA 2C66A 4NEWA 4DSHA 2Q0KA 1ZMDA 1TDOA 2WP6A 4M52A 1RP0A 4H4WA 3UP5A 2XYOA 2V60A 1ZDLA 1QJDA 1ZX9A 2FJBA 2XFNA 4A99A 5M10A 2B9YA 1K0LA 2FJDA 2XLPA 4AT2A 2Z5XA
chains in the Genus database with same CATH superfamily
1GESA 1LPFA 2O9ZA 3DJEA 4ZCDA 1F6MA 2WDQA 4Y4LA 4UDRA 1DNCA 3AE2A 3T2ZA 1CL0A 3CPHG 3LXDA 4BJYA 1GOSA 5FS8A 2YLTA 1E39A 3DGHA 3WE0A 1H6VA 4G73A 4B63A 1PN0A 3T37A 4U8OA 4CY6A 1GXFA 2BYBA 3KD9A 4NNJA 3CPJG 5CKUA 1PBDA 5JCIA 3UOYA 1TDEA 2WDRA 2BA9A 3CN8A 4K5SA 3RP6A 2J3NA 2FBWA 2JAEA 5HXIA 3EANA 4WCTA 4A7AA 1GRGA 2IVDA 2RGOA 4GAVA 1B8SA 3SYIA 3UKHA 3AYLA 5U63A 3GDPA 3UOXA 2WP5A 2GH5A 3ATQA 4UP3A 2YWLA 4C3YA 4H4ZA 5HYMA 1Q1RA 3Q6JA 3CNDA 2GAHB 2Q7VA 1KF6A 3IF9A 2R0CA 2GAGB 3CNPA 4U8JA 3CNSA 1D7YA 1L9CA 1V59A 1GRHA 3AD7B 3EAOA 4YXDA 3LOVA 2VQ7A 4J36A 4B69A 2R0GA 2YVJA 4IVMB 1NG3A 3AE4A 3NHOX 2BRYA 2VRMA 5J7XA 4BK1A 1JRXA 1NG4A 1ZKQA 4TLZA 3SM8A 1IUSA 3ALLA 3BI2A 3IHGA 3IWAA 3AXBA 2PHHA 2XDOA 3G5RA 3COXA 2WHDA 4IV9A 4DNAA 4NTEA 4OPIA 4A6NA 2XLRA 3QFAA 2B9XA 2ZZBA 2A89A 2BCGG 2YLXA 1JU2A 3DJGX 4Z2RA 5JCMA 1PJ5A 4J31A 3AEBA 1H82A 4N9XA 4EMWA 2C73A 3SY4A 3CGCA 4Y4NA 5BVAA 4Z2UA 2A8XA 5DBJA 2XFQA 4YWOA 1EL9A 3OC4A 2YG5A 4G6GA 4JN9A 4ZN0A 2ARDA 1JEHA 4EMJA 1P2EA 1VG0A 1VRQB 4O5UA 3UOVA 2XVIA 1H83A 3GMBA 1EBDA 3UKQA 3ADAB 4ICYA 4J34A 2X3NA 5KVIA 3SFEA 4GCMA 1O5WA 3H4KA 1DODA 5EBKA 1REOA 3NKSA 2C4CA 4NEVA 4U8MA 3GWFA 3S5WA 2YLWA 3FMWA 2RABA 2BCPA 3KVEA 1IUXA 1LQTA 1GT8A 3P4QA 4GDPA 3AYIA 2GMJA 4H4SA 1JNZA 1MO9A 3G5QA 2Z5YA 3FPZA 3DJDA 4AP3A 3M0OA 1DJQA 3SFDA 3EF6A 4H7UA 1BGNA 4YTNA 1S3EA 1YQZA 1RYIA 3B3RA 4D03A 2WS3A 2R4JA 2UZZA 1ONFA 4TM3A 2YQUA 4HB9A 2VQBA 3K7QX 2JB2A 4B1BA 1NHQA 4K5RA 3UP4A 1D4DA 4Z2TA 1B5QA 5KMPA 4LA1A 1D5TA 1CC6A 4AP1A 3AD9B 2YG7A 1JRYA 4X4JA 1L9EA 2E1MA 3GD3A 3NG7X 4IVOB 3DK9A 3PS9A 3Q9TA 4H2PA 4XWZA 5GRTA 4H4PA 2YR5A 3T0KA 4FDCB 2GMHA 5C3JA 4KX6A 2XFUA 2X8CA 1TRBA 1E1KA 4FK1A 2AAQA 2C75A 2Y6QA 4U2SA 1OJAA 2ZZCA 3AE5A 3UKLA 5KRQA 1CC4A 1M64A 4BK3A 1YY5A 1FEBA 2R46A 2X99A 3KA7A 4OPCA 1FOHA 3AECA 2XVHA 3P4RA 3QSMA 1EL7A 3CNJA 1IUTA 5M0ZA 2BACA 2OALA 2BK5A 2NPXA 2Y6RA 2YLSA 1N4VA 1TYPA 1KDGA 1COYA 2YLZA 3AE9A 1N4UA 1XDIA 4TM1A 1PJ7A 2WETA 2BK4A 1PXAA 2WQYA 3GSIA 2DKIA 2R0PA 2B9WA 1FL2A 3GDNA 3NN6X 4ECHA 4JDRA 3E1TA 2E4GA 4B66A 4GAPA 1GALA 1PXBA 2GR0A 3UKPA 4I59A 3AEDA 4LIIA 4TM4A 4GUVA 1K0IA 2C3DA 4DGKA 1K4QA 2WBAA 3RNMA 3SQPA 1DOBA 2BABA 1O94A 2ZZ0A 2F5ZA 3CGEA 4XWRA 5JCNA 2FJEA 5J60A 1PJ6A 4CNJA 3VRDB 1YQ4A 4UDQA 4C74A 2RGHA 1PXCA 3DH9A 3UKAA 2QA2A 4FK1C 1FEAA 3V76A 2TPRA 1PBBA 2BC0A 1OJ9A 2XVFA 4USQA 3T2YA 3AE6A 1JRZA 3SGLA 4OPUA 1MOKA 3VRAA 1PBCA 5CQFA 1BF3A 1RSGA 3F8PA 2H89A 3VR9A 4YSZA 3KPFA 2GVCA 1EL5A 4U2TA 3ZDNA 4NTDA 4G6HA 4Y4MA 1DOCA 3AE3A 3LB8A 5ER0A 1FECA 3GYIA 4D04A 4K8DA 1DJNA 1M6IA 2BXSA 3VRBA 1Q1WA 1ZP0A 2WEUA 2GV8A 3AEAA 1YQ3A 4Z25A 1NPXA 4C5OA 2YVGA 1CJ4A 1O95A 2C67A 4J2WA 1NHPA 4RG3A 3UKKA 2EQ9A 2YR4A 4AOXA 1GRTA 4H50A 4EQSA 4OCGA 4APNA 4REKA 3DK4A 1E7PA 1GPEA 2WPEA 2RGJA 3CIRA 3V3NA 1HYUA 4G74A 5GSNA 3P1WA 1EL8A 2BRAA 5L46A 1H84A 1QLBA 3LZWA 1PBEA 4U8IA 5LV9A 1ZOVA 3HZLA 4II3A 2C72A 4TM0A 2WPCA 3AE8A 2R45A 1AOGA 3M13A 1OJCA 4J33A 3AWIA 2QAEA 3BHKA 3GRSA 3NNEA 3V3OA 3NYEA 4YKFA 1NHRA 1XHCA 2YR6A 1Z6LA 4H4TA 2XCGA 3GRTA 4B64A 2XLTA 2YM2A 1CHUA 1TDNA 2XLUA 2GQWA 2V6OA 4PAAA 4USRA 4Z44A 3DGZA 3O0HA 3P4PA 1D7LA 3BHFA 4CNKA 2C7GA 2YLRA 3K30A 3CPIG 3PVCA 4I58A 1GETA 1D4CA 3DJJA 4IA5A 2YG4A 4YT0A 2A87A 4K2XA 5HY5A 1CJ2A 3QVPA 5HHFA 3ISHA 1GNDA 2B76A 1CC2A 4IA6A 1B4VA 4A79A 5FMHA 1E1MA 3F8DA 1GTHA 3GMCA 2WU5A 2BXRA 2Q6UA 2NVKX 2WESA 2XFPA 2BC1A 5C2TA 3FG2P 2VVLG 2W0HA 3CMMA 3T14A 4CBQA 3NK2X 2BS4A 1OJTA 3NK1X 3UCLA 2E5VA 1MXTA 1QO8A 3C96A 4C77A 3QJ4A 2BS3A 1DOEA 4U8KA 4EM4A 3ALJA 3KPKA 3SX6A 1GREA 4ZCCA 1L0VA 1KSSA 1P2HA 3L1RA 3DA1A 2GQFA 5U25A 3UTEA 4Z43A 3D8XA 4H4RA 4A9WA 1GEUA 4U8NA 2OLOA 4AOSA 4EMIA 4DSGA 3CNTA 4OVIA 2VVLA 4II2A 3DK8A 4YSHA 1GRAA 5FS9A 3QSEA 1NDAA 1S2QA 5KMRA 3QFBA 2VZ2A 2WOWA 2GEWA 3AYJA 2YVFA 4C3XA 4CY8A 5IQ4A 1F8RA 4B65A 1JOAA 1PBFA 4Z26A 5KXJA 1GRBA 3RP8A 4JQ9A 3LZXA 3OZ2A 3NT6A 4JY3A 1KNPA 1NAAA 3UKFA 5U1OA 2WOIA 1IUWA 1L9DA 2Q0LA 1W4XA 2HQMA 2CFYA 4BJZA 4P9SA 3B6DA 3AB1A 2V3AA 2YAUA 1BKWA 3AEEA 5EB4A 4CRTA 3IHMA 1KSUA 4NZHA 1GRFA 2I0ZA 2XFOA 5IQ1A 3NH3X 1GERA 2GB0A 3IC9A 4CCQA 2GR2A 4Z24A 3BNMA 4H2RA 3ITJA 1FCDA 2IIDA 2APGA 2PYXA 2QA1A 3FIMB 4OPLA 4E0VA 1TYTA 2B7SA 2GRTA 1F8SA 1BZLA 4J57A 1KFYA 4KPRA 2EQ8A 3ZYXA 2C3CA 3QSSA 5JCLA 4ADWA 2C65A 2VVMA 1PDHA 4BV6A 2OLNA 3AE1A 3CGBA 5BUKA 3GD4A 1NEKA 2FJAA 3PO7A 4JNAA 1TDFA 1NENA 3AEGA 3D1CA 3URHA 4LU6A 2JKCA 2JB3A 4JNQA 3GYJA 3LJPA 3LADA 2C76A 1Q9IA 2AR8A 4YTMA 1CJ3A 1Y56B 4FX9A 4O5QA 2R4EA 1LJ1A 3ABVA 4UDPA 1TDKA 4OPGA 3R9UA 4GF7A 4OPTA 4X9NA 2GF3A 1N4WA 5EOWA 4EIQA 4U8PA 2EQ6A 3SZCA 1IJHA 2YG3A 4U2LA 2JK6A 1OJDA 3VQRA 3KKJA 5IPYA 4BURA 3SZ0A 1F3PA 4K7ZA 2XLSA 4WX1A 3SZFA 1LVLA 1CF3A 3BNUA 5TR3A 2CULA 5KVHA 2JB1A 4J56A 1VQWA 5EB5A 4YSXA 4EM3A 4AT0A 2CVJA 2VOUA 3S61A 2BS2A 5BRTA 1DXLA 4A5LA 1ZK7A 5KOXA 3BI5A 3DMEA 5FS6A 5KMQA 3HYWA 3K7MX 5KOWA 1GV4A 4NWZA 2V3BA 1BWCA 4MJWA 2B7RA 3NIXA 3NLCA 1PS9A 3C4NA 1F8WA 3ICRA 1ZMCA 3NN0X 4NTCA 4XXGA 3KU9A 3ALMA 2V61A 4GRTA 2XVJA 3KLJA 3II4A 1CJCA 1XPQA 5KWFA 2OAMA 2CDUA 5JCKA 1N1PA 2VRLA 1CBOA 1X31B 2WDVA 3FBSA 3RHAA 1IUUA 1ZY8A 4GDEA 1S2YA 3BI4A 3CTYA 3ATRA 1ELIA 2YM1A 2GR3A 3NK0X 4A65A 1E6EA 2X50A 3UTFA 3L8KA 2TMDA 1VDCA 2WU2A 2OA1A 4HA6A 3NYFA 3QVRA 2YG6A 1H7WA 2C70A 1E1LA 1LTXR 2WPFA 1GTEA 3GWDA 3SZWA 3ICSA 4CCRA 4EQRA 2WOVA 2R9ZA 3H8IA 3RP7A 4G9KA 1ZOYA 1LQUA 2JBVA 3F8RA 3HYVA 4YTPA 4A6NB 1IUVA 3NTAA 4H4YA 2ZBWA 3AEFA 1Y0PA 3NYCA 4H2NA 4B68A 4EQWA 3AE7A 4H2QA 1NHSA 4RG4A 4YSYA 1GSNA 1B37A 4H4VA 2X8GA 4X9MA 1UKVG 3C4AA 2X8HA 3H8LA 2BK3A 4B67A 1D4EA 1H7XA 3T31A 4OPDA 3UTHA 3T2KA 1K0JA 4EIPA 2V5ZA 4U8LA 4JY2A 3I3LA 5BULA 2H88A 3K7TA 4BK2A 1SEZA 1H86A 2QCUA 3SXIA 1H81A 2EQ7A 2XVEA 3NRNA 4K22A 3CGDA 3REDA 3NGCX 3UTGA 1BGJA 3P4SA 3ICTA 1YKJA 3M12A 2C64A 1KNRA 3VR8A 3I6DA 5KNLA 4YKGA 4H4QA 2IVEA 3G5SA 1JNRA 4EQXA 2ACZA 1E1NA 2WP9A 4PABA 1S3BA 1VG9A 3P9UA 5KMSA 1LV0A 4H4UA 2DKHA 4H4XA 4TLXA 3UOZA 4GR1A 2AQJA 3NTDA 2GR1A 4RSLA 1Y56A 3HYXA 1XANA 1PHHA 3AD8B 3EPTA 5FS7A 3JSKA 2C66A 4NEWA 4DSHA 2Q0KA 1ZMDA 1TDOA 2WP6A 4M52A 1RP0A 4H4WA 3UP5A 2XYOA 2V60A 1ZDLA 1QJDA 1ZX9A 2FJBA 2XFNA 3GYXA 4A99A 5M10A 2B9YA 1K0LA 2FJDA 2XLPA 4AT2A 2Z5XA
chains in the Genus database with same CATH topology
1GESA 1LPFA 2O9ZA 3DJEA 4ZCDA 1F6MA 2WDQA 4Y4LA 4UDRA 1DNCA 3AE2A 3T2ZA 1CL0A 3CPHG 3LXDA 4BJYA 1GOSA 5FS8A 2YLTA 1E39A 3DGHA 3WE0A 1H6VA 4G73A 4B63A 1PN0A 3T37A 4U8OA 4CY6A 1GXFA 2BYBA 3KD9A 4NNJA 3CPJG 5CKUA 1PBDA 5JCIA 3UOYA 1TDEA 2WDRA 2BA9A 3CN8A 4K5SA 3RP6A 2J3NA 2FBWA 2JAEA 5HXIA 3EANA 4WCTA 4A7AA 1GRGA 2IVDA 2RGOA 4GAVA 1B8SA 3SYIA 3UKHA 3AYLA 5U63A 3GDPA 3UOXA 2WP5A 2GH5A 3ATQA 4UP3A 2YWLA 4C3YA 4H4ZA 5HYMA 1Q1RA 3Q6JA 3CNDA 2GAHB 2Q7VA 1KF6A 3IF9A 2R0CA 2GAGB 3CNPA 4U8JA 3CNSA 1D7YA 1L9CA 1V59A 1GRHA 3AD7B 3EAOA 4YXDA 3LOVA 2VQ7A 4J36A 4B69A 2R0GA 2YVJA 4IVMB 1NG3A 3AE4A 3NHOX 2BRYA 2VRMA 5J7XA 4BK1A 1JRXA 1NG4A 1ZKQA 4TLZA 3SM8A 1IUSA 3ALLA 3BI2A 3IHGA 3IWAA 3AXBA 2PHHA 2XDOA 3G5RA 3COXA 2WHDA 4IV9A 4DNAA 4NTEA 4OPIA 4A6NA 2XLRA 3QFAA 2B9XA 2ZZBA 2A89A 2BCGG 2YLXA 1JU2A 3DJGX 4Z2RA 5JCMA 1PJ5A 4J31A 3AEBA 1H82A 4N9XA 4EMWA 2C73A 3SY4A 3CGCA 4Y4NA 5BVAA 4Z2UA 2A8XA 5DBJA 2XFQA 4YWOA 1EL9A 3OC4A 2YG5A 4G6GA 4JN9A 4ZN0A 2ARDA 1JEHA 4EMJA 1P2EA 1VG0A 1VRQB 4O5UA 3UOVA 2XVIA 1H83A 3GMBA 1EBDA 3UKQA 3ADAB 4ICYA 4J34A 2X3NA 5KVIA 3SFEA 4GCMA 1O5WA 3H4KA 1DODA 5EBKA 1REOA 3NKSA 2C4CA 4NEVA 4U8MA 3GWFA 3S5WA 2YLWA 3FMWA 2RABA 2BCPA 3KVEA 1IUXA 1LQTA 1GT8A 3P4QA 4GDPA 3AYIA 2GMJA 4H4SA 1JNZA 1MO9A 3G5QA 2Z5YA 3FPZA 3DJDA 4AP3A 3M0OA 1DJQA 3SFDA 3EF6A 4H7UA 1BGNA 4YTNA 1S3EA 1YQZA 1RYIA 3B3RA 4D03A 2WS3A 2R4JA 2UZZA 1ONFA 4TM3A 2YQUA 4HB9A 2VQBA 3K7QX 2JB2A 4B1BA 1NHQA 4K5RA 3UP4A 1D4DA 4Z2TA 1B5QA 5KMPA 4LA1A 1D5TA 1CC6A 4AP1A 3AD9B 2YG7A 1JRYA 4X4JA 1L9EA 2E1MA 3GD3A 3NG7X 4IVOB 3DK9A 3PS9A 3Q9TA 4H2PA 4XWZA 5GRTA 4H4PA 2YR5A 3T0KA 4FDCB 2GMHA 5C3JA 4KX6A 2XFUA 2X8CA 1TRBA 1E1KA 4FK1A 2AAQA 2C75A 2Y6QA 4U2SA 1OJAA 2ZZCA 3AE5A 3UKLA 5KRQA 1CC4A 1M64A 4BK3A 1YY5A 1FEBA 2R46A 2X99A 3KA7A 4OPCA 1FOHA 3AECA 2XVHA 3P4RA 3QSMA 1EL7A 3CNJA 1IUTA 5M0ZA 2BACA 2OALA 2BK5A 2NPXA 2Y6RA 2YLSA 1N4VA 1TYPA 1KDGA 1COYA 2YLZA 3AE9A 1N4UA 1XDIA 4TM1A 1PJ7A 2WETA 2BK4A 1PXAA 2WQYA 3GSIA 2DKIA 2R0PA 2B9WA 1FL2A 3GDNA 3NN6X 4ECHA 4JDRA 3E1TA 2E4GA 4B66A 4GAPA 1GALA 1PXBA 2GR0A 3UKPA 4I59A 3AEDA 4LIIA 4TM4A 4GUVA 1K0IA 2C3DA 4DGKA 1K4QA 2WBAA 3RNMA 3SQPA 1DOBA 2BABA 1O94A 2ZZ0A 2F5ZA 3CGEA 4XWRA 5JCNA 2FJEA 5J60A 1PJ6A 4CNJA 3VRDB 1YQ4A 4UDQA 4C74A 2RGHA 1PXCA 3DH9A 3UKAA 2QA2A 4FK1C 1FEAA 3V76A 2TPRA 1PBBA 2BC0A 1OJ9A 2XVFA 4USQA 3T2YA 3AE6A 1JRZA 3SGLA 4OPUA 1MOKA 3VRAA 1PBCA 5CQFA 1BF3A 1RSGA 3F8PA 2H89A 3VR9A 4YSZA 3KPFA 2GVCA 1EL5A 4U2TA 3ZDNA 4NTDA 4G6HA 4Y4MA 1DOCA 3AE3A 3LB8A 5ER0A 1FECA 3GYIA 4D04A 4K8DA 1DJNA 1M6IA 2BXSA 3VRBA 1Q1WA 1ZP0A 2WEUA 2GV8A 3AEAA 1YQ3A 4Z25A 1NPXA 4C5OA 2YVGA 1CJ4A 1O95A 2C67A 4J2WA 1NHPA 4RG3A 3UKKA 2EQ9A 2YR4A 4AOXA 1GRTA 4H50A 4EQSA 4OCGA 4APNA 4REKA 3DK4A 1E7PA 1GPEA 2WPEA 2RGJA 3CIRA 3V3NA 1HYUA 4G74A 5GSNA 3P1WA 1EL8A 2BRAA 5L46A 1H84A 1QLBA 3LZWA 1PBEA 4U8IA 5LV9A 1ZOVA 3HZLA 4II3A 2C72A 4TM0A 2WPCA 3AE8A 2R45A 1AOGA 3M13A 1OJCA 4J33A 3AWIA 2QAEA 3BHKA 3GRSA 3NNEA 3V3OA 3NYEA 4YKFA 1NHRA 1XHCA 2YR6A 1Z6LA 4H4TA 2XCGA 3GRTA 4B64A 2XLTA 2YM2A 1CHUA 1TDNA 2XLUA 2GQWA 2V6OA 4PAAA 4USRA 4Z44A 3DGZA 3O0HA 3P4PA 1D7LA 3BHFA 4CNKA 2C7GA 2YLRA 3K30A 3CPIG 3PVCA 4I58A 1GETA 1D4CA 3DJJA 4IA5A 2YG4A 4YT0A 2A87A 4K2XA 5HY5A 1CJ2A 3QVPA 5HHFA 3ISHA 1GNDA 2B76A 1CC2A 4IA6A 1B4VA 4A79A 5FMHA 1E1MA 3F8DA 1GTHA 3GMCA 2WU5A 2BXRA 2Q6UA 2NVKX 2WESA 2XFPA 2BC1A 5C2TA 3FG2P 2VVLG 2W0HA 3CMMA 3T14A 4CBQA 3NK2X 2BS4A 1OJTA 3NK1X 3UCLA 2E5VA 1MXTA 1QO8A 3C96A 4C77A 3QJ4A 2BS3A 1DOEA 4U8KA 4EM4A 3ALJA 3KPKA 3SX6A 1GREA 4ZCCA 1L0VA 1KSSA 1P2HA 3L1RA 3DA1A 2GQFA 5U25A 3UTEA 4Z43A 3D8XA 4H4RA 4A9WA 1GEUA 4U8NA 2OLOA 4AOSA 4EMIA 4DSGA 3CNTA 4OVIA 2VVLA 4II2A 3DK8A 4YSHA 1GRAA 5FS9A 3QSEA 1NDAA 1S2QA 5KMRA 3QFBA 2VZ2A 2WOWA 2GEWA 3AYJA 2YVFA 4C3XA 4CY8A 5IQ4A 1F8RA 4B65A 1JOAA 1PBFA 4Z26A 5KXJA 1GRBA 3RP8A 4JQ9A 3LZXA 3OZ2A 3NT6A 4JY3A 1KNPA 1NAAA 3UKFA 5U1OA 2WOIA 1IUWA 1L9DA 2Q0LA 1W4XA 2HQMA 2CFYA 4BJZA 4P9SA 3B6DA 3AB1A 2V3AA 2YAUA 1BKWA 3AEEA 5EB4A 4CRTA 3IHMA 1KSUA 4NZHA 1GRFA 2I0ZA 2XFOA 5IQ1A 3NH3X 1GERA 2GB0A 3IC9A 4CCQA 2GR2A 4Z24A 3BNMA 4H2RA 3ITJA 1FCDA 2IIDA 2APGA 2PYXA 2QA1A 3FIMB 4OPLA 4E0VA 1TYTA 2B7SA 2GRTA 1F8SA 1BZLA 4J57A 1KFYA 4KPRA 2EQ8A 3ZYXA 2C3CA 3QSSA 5JCLA 4ADWA 2C65A 2VVMA 1PDHA 4BV6A 2OLNA 3AE1A 3CGBA 5BUKA 3GD4A 1NEKA 2FJAA 3PO7A 4JNAA 1TDFA 1NENA 3AEGA 3D1CA 3URHA 4LU6A 2JKCA 2JB3A 4JNQA 3GYJA 3LJPA 3LADA 2C76A 1Q9IA 2AR8A 4YTMA 1CJ3A 1Y56B 4FX9A 4O5QA 2R4EA 1LJ1A 3ABVA 4UDPA 1TDKA 4OPGA 3R9UA 4GF7A 4OPTA 4X9NA 2GF3A 1N4WA 5EOWA 4EIQA 4U8PA 2EQ6A 3SZCA 1IJHA 2YG3A 4U2LA 2JK6A 1OJDA 3VQRA 3KKJA 5IPYA 4BURA 3SZ0A 1F3PA 4K7ZA 2XLSA 4WX1A 3SZFA 1LVLA 1CF3A 3BNUA 5TR3A 2CULA 5KVHA 2JB1A 4J56A 1VQWA 5EB5A 4YSXA 4EM3A 4AT0A 2CVJA 2VOUA 3S61A 2BS2A 5BRTA 1DXLA 4A5LA 1ZK7A 5KOXA 3BI5A 3DMEA 5FS6A 5KMQA 3HYWA 3K7MX 5KOWA 1GV4A 4NWZA 2V3BA 1BWCA 4MJWA 2B7RA 3NIXA 3NLCA 1PS9A 3C4NA 1F8WA 3ICRA 1ZMCA 3NN0X 4NTCA 4XXGA 3KU9A 3ALMA 2V61A 4GRTA 2XVJA 3KLJA 3II4A 1CJCA 1XPQA 5KWFA 2OAMA 2CDUA 5JCKA 1N1PA 2VRLA 1CBOA 1X31B 2WDVA 3FBSA 3RHAA 1IUUA 1ZY8A 4GDEA 1S2YA 3BI4A 3CTYA 3ATRA 1ELIA 2YM1A 2GR3A 3NK0X 4A65A 1E6EA 2X50A 3UTFA 3L8KA 2TMDA 1VDCA 2WU2A 2OA1A 4HA6A 3NYFA 3QVRA 2YG6A 1H7WA 2C70A 1E1LA 1LTXR 2WPFA 1GTEA 3GWDA 3SZWA 3ICSA 4CCRA 4EQRA 2WOVA 2R9ZA 3H8IA 3RP7A 4G9KA 1ZOYA 1LQUA 2JBVA 3F8RA 3HYVA 4YTPA 4A6NB 1IUVA 3NTAA 4H4YA 2ZBWA 3AEFA 1Y0PA 3NYCA 4H2NA 4B68A 4EQWA 3AE7A 4H2QA 1NHSA 4RG4A 4YSYA 1GSNA 1B37A 4H4VA 2X8GA 4X9MA 1UKVG 3C4AA 2X8HA 3H8LA 2BK3A 4B67A 1D4EA 1H7XA 3T31A 4OPDA 3UTHA 3T2KA 1K0JA 4EIPA 2V5ZA 4U8LA 4JY2A 3I3LA 5BULA 2H88A 3K7TA 4BK2A 1SEZA 1H86A 2QCUA 3SXIA 1H81A 2EQ7A 2XVEA 3NRNA 4K22A 3CGDA 3REDA 3NGCX 3UTGA 1BGJA 3P4SA 3ICTA 1YKJA 3M12A 2C64A 1KNRA 3VR8A 3I6DA 5KNLA 4YKGA 4H4QA 2IVEA 3G5SA 1JNRA 4EQXA 2ACZA 1E1NA 2WP9A 4PABA 1S3BA 1VG9A 3P9UA 5KMSA 1LV0A 4H4UA 2DKHA 4H4XA 4TLXA 3UOZA 4GR1A 2AQJA 3NTDA 2GR1A 4RSLA 1Y56A 3HYXA 1XANA 1PHHA 3AD8B 3EPTA 5FS7A 3JSKA 2C66A 4NEWA 4DSHA 2Q0KA 1ZMDA 1TDOA 2WP6A 4M52A 1RP0A 4H4WA 3UP5A 2XYOA 2V60A 1ZDLA 1QJDA 1ZX9A 2FJBA 2XFNA 3GYXA 4A99A 5M10A 2B9YA 1K0LA 2FJDA 2XLPA 4AT2A 2Z5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GES A;  1LPF A;  2O9Z A;  3DJE A;  4ZCD A;  1F6M A;  2WDQ A;  4Y4L A;  4UDR A;  1DNC A;  3AE2 A;  1CL0 A;  3CPH G;  3LXD A;  4BJY A;  1GOS A;  5FS8 A;  2YLT A;  1E39 A;  3DGH A;  3WE0 A;  1H6V A;  4B63 A;  1PN0 A;  3T37 A;  4U8O A;  4CY6 A;  1GXF A;  2BYB A;  3KD9 A;  3CPJ G;  5CKU A;  1PBD A;  5JCI A;  3UOY A;  1TDE A;  2WDR A;  2BA9 A;  3CN8 A;  4K5S A;  3RP6 A;  2J3N A;  2FBW A;  2JAE A;  5HXI A;  3EAN A;  4WCT A;  4A7A A;  1GRG A;  2IVD A;  2RGO A;  1B8S A;  3UKH A;  3AYL A;  5U63 A;  3GDP A;  3UOX A;  2WP5 A;  2GH5 A;  3ATQ A;  4UP3 A;  2YWL A;  4C3Y A;  4H4Z A;  5HYM A;  1Q1R A;  3Q6J A;  3CND A;  2GAH B;  2Q7V A;  1KF6 A;  3IF9 A;  2R0C A;  2GAG B;  3CNP A;  4U8J A;  3CNS A;  1D7Y A;  1L9C A;  1V59 A;  1GRH A;  3AD7 B;  3EAO A;  4YXD A;  3LOV A;  2VQ7 A;  4J36 A;  4B69 A;  2R0G A;  2YVJ A;  4IVM B;  1NG3 A;  3AE4 A;  3NHO X;  4BK1 A;  2VRM A;  5J7X A;  1JRX A;  1NG4 A;  1ZKQ A;  4TLZ A;  3SM8 A;  1IUS A;  3ALL A;  3BI2 A;  3IHG A;  3IWA A;  3AXB A;  2PHH A;  2XDO A;  3G5R A;  3COX A;  2WHD A;  4IV9 A;  4DNA A;  4NTE A;  4OPI A;  4A6N A;  2XLR A;  3QFA A;  2B9X A;  2ZZB A;  2A89 A;  2BCG G;  2YLX A;  1JU2 A;  3DJG X;  4Z2R A;  5JCM A;  1PJ5 A;  4J31 A;  3AEB A;  1H82 A;  4N9X A;  4EMW A;  2C73 A;  3CGC A;  4Y4N A;  5BVA A;  4Z2U A;  2A8X A;  5DBJ A;  2XFQ A;  4YWO A;  1EL9 A;  3OC4 A;  2YG5 A;  4JN9 A;  4ZN0 A;  2ARD A;  1JEH A;  4EMJ A;  1P2E A;  1VG0 A;  1VRQ B;  4O5U A;  3UOV A;  2XVI A;  1H83 A;  3GMB A;  1EBD A;  3UKQ A;  3ADA B;  4ICY A;  4J34 A;  2X3N A;  5KVI A;  3SFE A;  4GCM A;  1O5W A;  3H4K A;  1DOD A;  5EBK A;  1REO A;  3NKS A;  4NEV A;  4U8M A;  3GWF A;  3S5W A;  2YLW A;  3FMW A;  2RAB A;  2BCP A;  3KVE A;  1IUX A;  1LQT A;  1GT8 A;  3P4Q A;  4GDP A;  3AYI A;  2GMJ A;  4H4S A;  1JNZ A;  1MO9 A;  3G5Q A;  2Z5Y A;  3FPZ A;  3DJD A;  4AP3 A;  3M0O A;  1DJQ A;  3SFD A;  3EF6 A;  4H7U A;  1BGN A;  4YTN A;  1S3E A;  1YQZ A;  1RYI A;  3B3R A;  4D03 A;  2WS3 A;  2R4J A;  2UZZ A;  1ONF A;  4TM3 A;  2YQU A;  4HB9 A;  2VQB A;  3K7Q X;  2JB2 A;  4B1B A;  1NHQ A;  4K5R A;  3UP4 A;  1D4D A;  4Z2T A;  1B5Q A;  4LA1 A;  1D5T A;  1CC6 A;  4AP1 A;  3AD9 B;  2YG7 A;  1JRY A;  4X4J A;  1L9E A;  2E1M A;  3GD3 A;  3NG7 X;  4IVO B;  3DK9 A;  3PS9 A;  3Q9T A;  4H2P A;  4XWZ A;  5GRT A;  4H4P A;  2YR5 A;  4FDC B;  2GMH A;  5C3J A;  4KX6 A;  2XFU A;  2X8C A;  1TRB A;  1E1K A;  4FK1 A;  2AAQ A;  2C75 A;  2Y6Q A;  4U2S A;  1OJA A;  2ZZC A;  3AE5 A;  3UKL A;  5KRQ A;  1CC4 A;  1M64 A;  4BK3 A;  1YY5 A;  1FEB A;  2R46 A;  2X99 A;  3KA7 A;  4OPC A;  1FOH A;  3AEC A;  2XVH A;  3P4R A;  3QSM A;  1EL7 A;  3CNJ A;  1IUT A;  5M0Z A;  2BAC A;  2OAL A;  2BK5 A;  2NPX A;  2Y6R A;  2YLS A;  1N4V A;  1TYP A;  1KDG A;  1COY A;  2YLZ A;  3AE9 A;  1N4U A;  1XDI A;  4TM1 A;  1PJ7 A;  2WET A;  2BK4 A;  1PXA A;  2WQY A;  3GSI A;  2DKI A;  2R0P A;  2B9W A;  1FL2 A;  3GDN A;  3NN6 X;  4ECH A;  4JDR A;  3E1T A;  2E4G A;  4B66 A;  1GAL A;  1PXB A;  2GR0 A;  3UKP A;  4I59 A;  3AED A;  4LII A;  4TM4 A;  4GUV A;  1K0I A;  2C3D A;  4DGK A;  1K4Q A;  2WBA A;  3RNM A;  3SQP A;  1DOB A;  2BAB A;  1O94 A;  2ZZ0 A;  2F5Z A;  3CGE A;  4XWR A;  5JCN A;  2FJE A;  5J60 A;  1PJ6 A;  4CNJ A;  3VRD B;  1YQ4 A;  4UDQ A;  4C74 A;  2RGH A;  1PXC A;  3DH9 A;  3UKA A;  2QA2 A;  4FK1 C;  1FEA A;  3V76 A;  2TPR A;  1PBB A;  2BC0 A;  1OJ9 A;  2XVF A;  4USQ A;  3AE6 A;  1JRZ A;  3SGL A;  4OPU A;  1MOK A;  3VRA A;  1PBC A;  5CQF A;  1BF3 A;  1RSG A;  3F8P A;  2H89 A;  3VR9 A;  4YSZ A;  3KPF A;  2GVC A;  1EL5 A;  4U2T A;  3ZDN A;  4NTD A;  4Y4M A;  1DOC A;  3AE3 A;  3LB8 A;  5ER0 A;  1FEC A;  3GYI A;  4D04 A;  4K8D A;  1DJN A;  1M6I A;  2BXS A;  3VRB A;  1Q1W A;  1ZP0 A;  2WEU A;  2GV8 A;  3AEA A;  1YQ3 A;  4Z25 A;  1NPX A;  4C5O A;  2YVG A;  1CJ4 A;  1O95 A;  2C67 A;  4J2W A;  1NHP A;  4RG3 A;  3UKK A;  2EQ9 A;  2YR4 A;  4AOX A;  1GRT A;  4H50 A;  4EQS A;  4OCG A;  4APN A;  4REK A;  3DK4 A;  1E7P A;  1GPE A;  2WPE A;  2RGJ A;  3CIR A;  3V3N A;  1HYU A;  5GSN A;  3P1W A;  1EL8 A;  5L46 A;  1H84 A;  1QLB A;  3LZW A;  1PBE A;  4U8I A;  5LV9 A;  1ZOV A;  3HZL A;  2C72 A;  4TM0 A;  2WPC A;  3AE8 A;  2R45 A;  1AOG A;  3M13 A;  1OJC A;  4J33 A;  3AWI A;  2QAE A;  3BHK A;  3GRS A;  3NNE A;  3V3O A;  3NYE A;  4YKF A;  1NHR A;  1XHC A;  2YR6 A;  1Z6L A;  4H4T A;  2XCG A;  3GRT A;  4B64 A;  2XLT A;  2YM2 A;  1CHU A;  1TDN A;  2XLU A;  2GQW A;  2V6O A;  4PAA A;  4USR A;  4Z44 A;  3DGZ A;  3O0H A;  3P4P A;  1D7L A;  3BHF A;  4CNK A;  2C7G A;  2YLR A;  3K30 A;  3CPI G;  3PVC A;  4I58 A;  1GET A;  1D4C A;  3DJJ A;  4IA5 A;  2YG4 A;  4YT0 A;  2A87 A;  4K2X A;  5HY5 A;  1CJ2 A;  3QVP A;  5HHF A;  3ISH A;  1GND A;  2B76 A;  1CC2 A;  4IA6 A;  1B4V A;  4A79 A;  5FMH A;  1E1M A;  3F8D A;  1GTH A;  3GMC A;  2WU5 A;  2BXR A;  2Q6U A;  2NVK X;  2WES A;  2XFP A;  2BC1 A;  5C2T A;  3FG2 P;  2VVL G;  2W0H A;  4CBQ A;  3NK2 X;  2BS4 A;  1OJT A;  3NK1 X;  3UCL A;  2E5V A;  1MXT A;  1QO8 A;  3C96 A;  4C77 A;  3QJ4 A;  2BS3 A;  1DOE A;  4U8K A;  4EM4 A;  3ALJ A;  1GRE A;  4ZCC A;  1L0V A;  1KSS A;  1P2H A;  3L1R A;  3DA1 A;  2GQF A;  5U25 A;  3UTE A;  4Z43 A;  3D8X A;  4H4R A;  4A9W A;  1GEU A;  4U8N A;  2OLO A;  4AOS A;  4EMI A;  4DSG A;  3CNT A;  4OVI A;  2VVL A;  3DK8 A;  4YSH A;  1GRA A;  5FS9 A;  3QSE A;  1NDA A;  1S2Q A;  3QFB A;  2VZ2 A;  2WOW A;  2GEW A;  3AYJ A;  2YVF A;  4C3X A;  4CY8 A;  5IQ4 A;  1F8R A;  4B65 A;  1JOA A;  1PBF A;  4Z26 A;  5KXJ A;  1GRB A;  3RP8 A;  4JQ9 A;  3LZX A;  3OZ2 A;  3NT6 A;  4JY3 A;  1KNP A;  1NAA A;  3UKF A;  5U1O A;  2WOI A;  1IUW A;  1L9D A;  2Q0L A;  1W4X A;  2HQM A;  2CFY A;  4BJZ A;  4P9S A;  3B6D A;  3AB1 A;  2V3A A;  2YAU A;  1BKW A;  3AEE A;  5EB4 A;  4CRT A;  3IHM A;  1KSU A;  4NZH A;  1GRF A;  2I0Z A;  2XFO A;  5IQ1 A;  3NH3 X;  1GER A;  2GB0 A;  3IC9 A;  4CCQ A;  2GR2 A;  4Z24 A;  3BNM A;  4H2R A;  3ITJ A;  1FCD A;  2IID A;  2APG A;  2PYX A;  2QA1 A;  3FIM B;  4OPL A;  4E0V A;  1TYT A;  2B7S A;  2GRT A;  1F8S A;  1BZL A;  4J57 A;  1KFY A;  4KPR A;  2EQ8 A;  3ZYX A;  2C3C A;  3QSS A;  5JCL A;  4ADW A;  2C65 A;  2VVM A;  1PDH A;  4BV6 A;  2OLN A;  3AE1 A;  3CGB A;  5BUK A;  3GD4 A;  1NEK A;  2FJA A;  3PO7 A;  4JNA A;  1TDF A;  1NEN A;  3AEG A;  3D1C A;  3URH A;  4LU6 A;  2JKC A;  2JB3 A;  4JNQ A;  3GYJ A;  3LJP A;  3LAD A;  2C76 A;  1Q9I A;  2AR8 A;  4YTM A;  1CJ3 A;  1Y56 B;  4FX9 A;  4O5Q A;  2R4E A;  1LJ1 A;  3ABV A;  4UDP A;  1TDK A;  4OPG A;  3R9U A;  4GF7 A;  4OPT A;  4X9N A;  2GF3 A;  1N4W A;  5EOW A;  4EIQ A;  4U8P A;  2EQ6 A;  1IJH A;  2YG3 A;  4U2L A;  2JK6 A;  1OJD A;  3VQR A;  3KKJ A;  5IPY A;  4BUR A;  1F3P A;  4K7Z A;  2XLS A;  4WX1 A;  1LVL A;  1CF3 A;  3BNU A;  5TR3 A;  2CUL A;  5KVH A;  2JB1 A;  4J56 A;  1VQW A;  5EB5 A;  4YSX A;  4EM3 A;  4AT0 A;  2CVJ A;  2VOU A;  3S61 A;  2BS2 A;  5BRT A;  1DXL A;  4A5L A;  1ZK7 A;  5KOX A;  3BI5 A;  3DME A;  5FS6 A;  3K7M X;  5KOW A;  1GV4 A;  2V3B A;  1BWC A;  4MJW A;  2B7R A;  3NIX A;  3NLC A;  1PS9 A;  3C4N A;  1F8W A;  3ICR A;  1ZMC A;  3NN0 X;  4NTC A;  4XXG A;  3KU9 A;  3ALM A;  2V61 A;  4GRT A;  2XVJ A;  3KLJ A;  3II4 A;  1CJC A;  1XPQ A;  5KWF A;  2OAM A;  2CDU A;  5JCK A;  1N1P A;  2VRL A;  1CBO A;  1X31 B;  2WDV A;  3FBS A;  3RHA A;  1IUU A;  1ZY8 A;  4GDE A;  1S2Y A;  3BI4 A;  3CTY A;  3ATR A;  1ELI A;  2YM1 A;  2GR3 A;  3NK0 X;  4A65 A;  1E6E A;  2X50 A;  3UTF A;  3L8K A;  2TMD A;  1VDC A;  2WU2 A;  2OA1 A;  4HA6 A;  3NYF A;  3QVR A;  2YG6 A;  1H7W A;  2C70 A;  1E1L A;  1LTX R;  2WPF A;  1GTE A;  3GWD A;  3ICS A;  4CCR A;  4EQR A;  2WOV A;  2R9Z A;  3H8I A;  3RP7 A;  1ZOY A;  1LQU A;  2JBV A;  3F8R A;  4YTP A;  4A6N B;  1IUV A;  3NTA A;  4H4Y A;  2ZBW A;  3AEF A;  1Y0P A;  3NYC A;  4H2N A;  4B68 A;  4EQW A;  3AE7 A;  4H2Q A;  1NHS A;  4RG4 A;  4YSY A;  1GSN A;  1B37 A;  4H4V A;  2X8G A;  4X9M A;  1UKV G;  3C4A A;  2X8H A;  3H8L A;  2BK3 A;  4B67 A;  1D4E A;  1H7X A;  4OPD A;  3UTH A;  1K0J A;  4EIP A;  2V5Z A;  4U8L A;  4JY2 A;  3I3L A;  5BUL A;  2H88 A;  3K7T A;  4BK2 A;  1SEZ A;  1H86 A;  2QCU A;  1H81 A;  2EQ7 A;  2XVE A;  3NRN A;  4K22 A;  3CGD A;  3RED A;  3NGC X;  3UTG A;  1BGJ A;  3P4S A;  3ICT A;  1YKJ A;  3M12 A;  2C64 A;  1KNR A;  3VR8 A;  3I6D A;  4YKG A;  4H4Q A;  2IVE A;  3G5S A;  1JNR A;  4EQX A;  2ACZ A;  1E1N A;  2WP9 A;  4PAB A;  1S3B A;  1VG9 A;  3P9U A;  1LV0 A;  4H4U A;  2DKH A;  4H4X A;  4TLX A;  3UOZ A;  4GR1 A;  2AQJ A;  3NTD A;  2GR1 A;  4RSL A;  1Y56 A;  1XAN A;  1PHH A;  3AD8 B;  3EPT A;  5FS7 A;  3JSK A;  2C66 A;  4NEW A;  4DSH A;  2Q0K A;  1ZMD A;  1TDO A;  2WP6 A;  4M52 A;  1RP0 A;  4H4W A;  3UP5 A;  2XYO A;  2V60 A;  1ZDL A;  1QJD A;  1ZX9 A;  2FJB A;  2XFN A;  4A99 A;  5M10 A;  2B9Y A;  1K0L A;  2FJD A;  2XLP A;  4AT2 A;  2Z5X A; 
#chains in the Genus database with same CATH topology
 1GES A;  1LPF A;  2O9Z A;  3DJE A;  4ZCD A;  1F6M A;  2WDQ A;  4Y4L A;  4UDR A;  1DNC A;  3AE2 A;  3T2Z A;  1CL0 A;  3CPH G;  3LXD A;  4BJY A;  1GOS A;  5FS8 A;  2YLT A;  1E39 A;  3DGH A;  3WE0 A;  1H6V A;  4G73 A;  4B63 A;  1PN0 A;  3T37 A;  4U8O A;  4CY6 A;  1GXF A;  2BYB A;  3KD9 A;  4NNJ A;  3CPJ G;  5CKU A;  1PBD A;  5JCI A;  3UOY A;  1TDE A;  2WDR A;  2BA9 A;  3CN8 A;  4K5S A;  3RP6 A;  2J3N A;  2FBW A;  2JAE A;  5HXI A;  3EAN A;  4WCT A;  4A7A A;  1GRG A;  2IVD A;  2RGO A;  4GAV A;  1B8S A;  3SYI A;  3UKH A;  3AYL A;  5U63 A;  3GDP A;  3UOX A;  2WP5 A;  2GH5 A;  3ATQ A;  4UP3 A;  2YWL A;  4C3Y A;  4H4Z A;  5HYM A;  1Q1R A;  3Q6J A;  3CND A;  2GAH B;  2Q7V A;  1KF6 A;  3IF9 A;  2R0C A;  2GAG B;  3CNP A;  4U8J A;  3CNS A;  1D7Y A;  1L9C A;  1V59 A;  1GRH A;  3AD7 B;  3EAO A;  4YXD A;  3LOV A;  2VQ7 A;  4J36 A;  4B69 A;  2R0G A;  2YVJ A;  4IVM B;  1NG3 A;  3AE4 A;  3NHO X;  2BRY A;  2VRM A;  5J7X A;  4BK1 A;  1JRX A;  1NG4 A;  1ZKQ A;  4TLZ A;  3SM8 A;  1IUS A;  3ALL A;  3BI2 A;  3IHG A;  3IWA A;  3AXB A;  2PHH A;  2XDO A;  3G5R A;  3COX A;  2WHD A;  4IV9 A;  4DNA A;  4NTE A;  4OPI A;  4A6N A;  2XLR A;  3QFA A;  2B9X A;  2ZZB A;  2A89 A;  2BCG G;  2YLX A;  1JU2 A;  3DJG X;  4Z2R A;  5JCM A;  1PJ5 A;  4J31 A;  3AEB A;  1H82 A;  4N9X A;  4EMW A;  2C73 A;  3SY4 A;  3CGC A;  4Y4N A;  5BVA A;  4Z2U A;  2A8X A;  5DBJ A;  2XFQ A;  4YWO A;  1EL9 A;  3OC4 A;  2YG5 A;  4G6G A;  4JN9 A;  4ZN0 A;  2ARD A;  1JEH A;  4EMJ A;  1P2E A;  1VG0 A;  1VRQ B;  4O5U A;  3UOV A;  2XVI A;  1H83 A;  3GMB A;  1EBD A;  3UKQ A;  3ADA B;  4ICY A;  4J34 A;  2X3N A;  5KVI A;  3SFE A;  4GCM A;  1O5W A;  3H4K A;  1DOD A;  5EBK A;  1REO A;  3NKS A;  2C4C A;  4NEV A;  4U8M A;  3GWF A;  3S5W A;  2YLW A;  3FMW A;  2RAB A;  2BCP A;  3KVE A;  1IUX A;  1LQT A;  1GT8 A;  3P4Q A;  4GDP A;  3AYI A;  2GMJ A;  4H4S A;  1JNZ A;  1MO9 A;  3G5Q A;  2Z5Y A;  3FPZ A;  3DJD A;  4AP3 A;  3M0O A;  1DJQ A;  3SFD A;  3EF6 A;  4H7U A;  1BGN A;  4YTN A;  1S3E A;  1YQZ A;  1RYI A;  3B3R A;  4D03 A;  2WS3 A;  2R4J A;  2UZZ A;  1ONF A;  4TM3 A;  2YQU A;  4HB9 A;  2VQB A;  3K7Q X;  2JB2 A;  4B1B A;  1NHQ A;  4K5R A;  3UP4 A;  1D4D A;  4Z2T A;  1B5Q A;  5KMP A;  4LA1 A;  1D5T A;  1CC6 A;  4AP1 A;  3AD9 B;  2YG7 A;  1JRY A;  4X4J A;  1L9E A;  2E1M A;  3GD3 A;  3NG7 X;  4IVO B;  3DK9 A;  3PS9 A;  3Q9T A;  4H2P A;  4XWZ A;  5GRT A;  4H4P A;  2YR5 A;  3T0K A;  4FDC B;  2GMH A;  5C3J A;  4KX6 A;  2XFU A;  2X8C A;  1TRB A;  1E1K A;  4FK1 A;  2AAQ A;  2C75 A;  2Y6Q A;  4U2S A;  1OJA A;  2ZZC A;  3AE5 A;  3UKL A;  5KRQ A;  1CC4 A;  1M64 A;  4BK3 A;  1YY5 A;  1FEB A;  2R46 A;  2X99 A;  3KA7 A;  4OPC A;  1FOH A;  3AEC A;  2XVH A;  3P4R A;  3QSM A;  1EL7 A;  3CNJ A;  1IUT A;  5M0Z A;  2BAC A;  2OAL A;  2BK5 A;  2NPX A;  2Y6R A;  2YLS A;  1N4V A;  1TYP A;  1KDG A;  1COY A;  2YLZ A;  3AE9 A;  1N4U A;  1XDI A;  4TM1 A;  1PJ7 A;  2WET A;  2BK4 A;  1PXA A;  2WQY A;  3GSI A;  2DKI A;  2R0P A;  2B9W A;  1FL2 A;  3GDN A;  3NN6 X;  4ECH A;  4JDR A;  3E1T A;  2E4G A;  4B66 A;  4GAP A;  1GAL A;  1PXB A;  2GR0 A;  3UKP A;  4I59 A;  3AED A;  4LII A;  4TM4 A;  4GUV A;  1K0I A;  2C3D A;  4DGK A;  1K4Q A;  2WBA A;  3RNM A;  3SQP A;  1DOB A;  2BAB A;  1O94 A;  2ZZ0 A;  2F5Z A;  3CGE A;  4XWR A;  5JCN A;  2FJE A;  5J60 A;  1PJ6 A;  4CNJ A;  3VRD B;  1YQ4 A;  4UDQ A;  4C74 A;  2RGH A;  1PXC A;  3DH9 A;  3UKA A;  2QA2 A;  4FK1 C;  1FEA A;  3V76 A;  2TPR A;  1PBB A;  2BC0 A;  1OJ9 A;  2XVF A;  4USQ A;  3T2Y A;  3AE6 A;  1JRZ A;  3SGL A;  4OPU A;  1MOK A;  3VRA A;  1PBC A;  5CQF A;  1BF3 A;  1RSG A;  3F8P A;  2H89 A;  3VR9 A;  4YSZ A;  3KPF A;  2GVC A;  1EL5 A;  4U2T A;  3ZDN A;  4NTD A;  4G6H A;  4Y4M A;  1DOC A;  3AE3 A;  3LB8 A;  5ER0 A;  1FEC A;  3GYI A;  4D04 A;  4K8D A;  1DJN A;  1M6I A;  2BXS A;  3VRB A;  1Q1W A;  1ZP0 A;  2WEU A;  2GV8 A;  3AEA A;  1YQ3 A;  4Z25 A;  1NPX A;  4C5O A;  2YVG A;  1CJ4 A;  1O95 A;  2C67 A;  4J2W A;  1NHP A;  4RG3 A;  3UKK A;  2EQ9 A;  2YR4 A;  4AOX A;  1GRT A;  4H50 A;  4EQS A;  4OCG A;  4APN A;  4REK A;  3DK4 A;  1E7P A;  1GPE A;  2WPE A;  2RGJ A;  3CIR A;  3V3N A;  1HYU A;  4G74 A;  5GSN A;  3P1W A;  1EL8 A;  2BRA A;  5L46 A;  1H84 A;  1QLB A;  3LZW A;  1PBE A;  4U8I A;  5LV9 A;  1ZOV A;  3HZL A;  4II3 A;  2C72 A;  4TM0 A;  2WPC A;  3AE8 A;  2R45 A;  1AOG A;  3M13 A;  1OJC A;  4J33 A;  3AWI A;  2QAE A;  3BHK A;  3GRS A;  3NNE A;  3V3O A;  3NYE A;  4YKF A;  1NHR A;  1XHC A;  2YR6 A;  1Z6L A;  4H4T A;  2XCG A;  3GRT A;  4B64 A;  2XLT A;  2YM2 A;  1CHU A;  1TDN A;  2XLU A;  2GQW A;  2V6O A;  4PAA A;  4USR A;  4Z44 A;  3DGZ A;  3O0H A;  3P4P A;  1D7L A;  3BHF A;  4CNK A;  2C7G A;  2YLR A;  3K30 A;  3CPI G;  3PVC A;  4I58 A;  1GET A;  1D4C A;  3DJJ A;  4IA5 A;  2YG4 A;  4YT0 A;  2A87 A;  4K2X A;  5HY5 A;  1CJ2 A;  3QVP A;  5HHF A;  3ISH A;  1GND A;  2B76 A;  1CC2 A;  4IA6 A;  1B4V A;  4A79 A;  5FMH A;  1E1M A;  3F8D A;  1GTH A;  3GMC A;  2WU5 A;  2BXR A;  2Q6U A;  2NVK X;  2WES A;  2XFP A;  2BC1 A;  5C2T A;  3FG2 P;  2VVL G;  2W0H A;  3CMM A;  3T14 A;  4CBQ A;  3NK2 X;  2BS4 A;  1OJT A;  3NK1 X;  3UCL A;  2E5V A;  1MXT A;  1QO8 A;  3C96 A;  4C77 A;  3QJ4 A;  2BS3 A;  1DOE A;  4U8K A;  4EM4 A;  3ALJ A;  3KPK A;  3SX6 A;  1GRE A;  4ZCC A;  1L0V A;  1KSS A;  1P2H A;  3L1R A;  3DA1 A;  2GQF A;  5U25 A;  3UTE A;  4Z43 A;  3D8X A;  4H4R A;  4A9W A;  1GEU A;  4U8N A;  2OLO A;  4AOS A;  4EMI A;  4DSG A;  3CNT A;  4OVI A;  2VVL A;  4II2 A;  3DK8 A;  4YSH A;  1GRA A;  5FS9 A;  3QSE A;  1NDA A;  1S2Q A;  5KMR A;  3QFB A;  2VZ2 A;  2WOW A;  2GEW A;  3AYJ A;  2YVF A;  4C3X A;  4CY8 A;  5IQ4 A;  1F8R A;  4B65 A;  1JOA A;  1PBF A;  4Z26 A;  5KXJ A;  1GRB A;  3RP8 A;  4JQ9 A;  3LZX A;  3OZ2 A;  3NT6 A;  4JY3 A;  1KNP A;  1NAA A;  3UKF A;  5U1O A;  2WOI A;  1IUW A;  1L9D A;  2Q0L A;  1W4X A;  2HQM A;  2CFY A;  4BJZ A;  4P9S A;  3B6D A;  3AB1 A;  2V3A A;  2YAU A;  1BKW A;  3AEE A;  5EB4 A;  4CRT A;  3IHM A;  1KSU A;  4NZH A;  1GRF A;  2I0Z A;  2XFO A;  5IQ1 A;  3NH3 X;  1GER A;  2GB0 A;  3IC9 A;  4CCQ A;  2GR2 A;  4Z24 A;  3BNM A;  4H2R A;  3ITJ A;  1FCD A;  2IID A;  2APG A;  2PYX A;  2QA1 A;  3FIM B;  4OPL A;  4E0V A;  1TYT A;  2B7S A;  2GRT A;  1F8S A;  1BZL A;  4J57 A;  1KFY A;  4KPR A;  2EQ8 A;  3ZYX A;  2C3C A;  3QSS A;  5JCL A;  4ADW A;  2C65 A;  2VVM A;  1PDH A;  4BV6 A;  2OLN A;  3AE1 A;  3CGB A;  5BUK A;  3GD4 A;  1NEK A;  2FJA A;  3PO7 A;  4JNA A;  1TDF A;  1NEN A;  3AEG A;  3D1C A;  3URH A;  4LU6 A;  2JKC A;  2JB3 A;  4JNQ A;  3GYJ A;  3LJP A;  3LAD A;  2C76 A;  1Q9I A;  2AR8 A;  4YTM A;  1CJ3 A;  1Y56 B;  4FX9 A;  4O5Q A;  2R4E A;  1LJ1 A;  3ABV A;  4UDP A;  1TDK A;  4OPG A;  3R9U A;  4GF7 A;  4OPT A;  4X9N A;  2GF3 A;  1N4W A;  5EOW A;  4EIQ A;  4U8P A;  2EQ6 A;  3SZC A;  1IJH A;  2YG3 A;  4U2L A;  2JK6 A;  1OJD A;  3VQR A;  3KKJ A;  5IPY A;  4BUR A;  3SZ0 A;  1F3P A;  4K7Z A;  2XLS A;  4WX1 A;  3SZF A;  1LVL A;  1CF3 A;  3BNU A;  5TR3 A;  2CUL A;  5KVH A;  2JB1 A;  4J56 A;  1VQW A;  5EB5 A;  4YSX A;  4EM3 A;  4AT0 A;  2CVJ A;  2VOU A;  3S61 A;  2BS2 A;  5BRT A;  1DXL A;  4A5L A;  1ZK7 A;  5KOX A;  3BI5 A;  3DME A;  5FS6 A;  5KMQ A;  3HYW A;  3K7M X;  5KOW A;  1GV4 A;  4NWZ A;  2V3B A;  1BWC A;  4MJW A;  2B7R A;  3NIX A;  3NLC A;  1PS9 A;  3C4N A;  1F8W A;  3ICR A;  1ZMC A;  3NN0 X;  4NTC A;  4XXG A;  3KU9 A;  3ALM A;  2V61 A;  4GRT A;  2XVJ A;  3KLJ A;  3II4 A;  1CJC A;  1XPQ A;  5KWF A;  2OAM A;  2CDU A;  5JCK A;  1N1P A;  2VRL A;  1CBO A;  1X31 B;  2WDV A;  3FBS A;  3RHA A;  1IUU A;  1ZY8 A;  4GDE A;  1S2Y A;  3BI4 A;  3CTY A;  3ATR A;  1ELI A;  2YM1 A;  2GR3 A;  3NK0 X;  4A65 A;  1E6E A;  2X50 A;  3UTF A;  3L8K A;  2TMD A;  1VDC A;  2WU2 A;  2OA1 A;  4HA6 A;  3NYF A;  3QVR A;  2YG6 A;  1H7W A;  2C70 A;  1E1L A;  1LTX R;  2WPF A;  1GTE A;  3GWD A;  3SZW A;  3ICS A;  4CCR A;  4EQR A;  2WOV A;  2R9Z A;  3H8I A;  3RP7 A;  4G9K A;  1ZOY A;  1LQU A;  2JBV A;  3F8R A;  3HYV A;  4YTP A;  4A6N B;  1IUV A;  3NTA A;  4H4Y A;  2ZBW A;  3AEF A;  1Y0P A;  3NYC A;  4H2N A;  4B68 A;  4EQW A;  3AE7 A;  4H2Q A;  1NHS A;  4RG4 A;  4YSY A;  1GSN A;  1B37 A;  4H4V A;  2X8G A;  4X9M A;  1UKV G;  3C4A A;  2X8H A;  3H8L A;  2BK3 A;  4B67 A;  1D4E A;  1H7X A;  3T31 A;  4OPD A;  3UTH A;  3T2K A;  1K0J A;  4EIP A;  2V5Z A;  4U8L A;  4JY2 A;  3I3L A;  5BUL A;  2H88 A;  3K7T A;  4BK2 A;  1SEZ A;  1H86 A;  2QCU A;  3SXI A;  1H81 A;  2EQ7 A;  2XVE A;  3NRN A;  4K22 A;  3CGD A;  3RED A;  3NGC X;  3UTG A;  1BGJ A;  3P4S A;  3ICT A;  1YKJ A;  3M12 A;  2C64 A;  1KNR A;  3VR8 A;  3I6D A;  5KNL A;  4YKG A;  4H4Q A;  2IVE A;  3G5S A;  1JNR A;  4EQX A;  2ACZ A;  1E1N A;  2WP9 A;  4PAB A;  1S3B A;  1VG9 A;  3P9U A;  5KMS A;  1LV0 A;  4H4U A;  2DKH A;  4H4X A;  4TLX A;  3UOZ A;  4GR1 A;  2AQJ A;  3NTD A;  2GR1 A;  4RSL A;  1Y56 A;  3HYX A;  1XAN A;  1PHH A;  3AD8 B;  3EPT A;  5FS7 A;  3JSK A;  2C66 A;  4NEW A;  4DSH A;  2Q0K A;  1ZMD A;  1TDO A;  2WP6 A;  4M52 A;  1RP0 A;  4H4W A;  3UP5 A;  2XYO A;  2V60 A;  1ZDL A;  1QJD A;  1ZX9 A;  2FJB A;  2XFN A;  3GYX A;  4A99 A;  5M10 A;  2B9Y A;  1K0L A;  2FJD A;  2XLP A;  4AT2 A;  2Z5X A; 
#chains in the Genus database with same CATH homology
 1GES A;  1LPF A;  2O9Z A;  3DJE A;  4ZCD A;  1F6M A;  2WDQ A;  4Y4L A;  4UDR A;  1DNC A;  3AE2 A;  3T2Z A;  1CL0 A;  3CPH G;  3LXD A;  4BJY A;  1GOS A;  5FS8 A;  2YLT A;  1E39 A;  3DGH A;  3WE0 A;  1H6V A;  4G73 A;  4B63 A;  1PN0 A;  3T37 A;  4U8O A;  4CY6 A;  1GXF A;  2BYB A;  3KD9 A;  4NNJ A;  3CPJ G;  5CKU A;  1PBD A;  5JCI A;  3UOY A;  1TDE A;  2WDR A;  2BA9 A;  3CN8 A;  4K5S A;  3RP6 A;  2J3N A;  2FBW A;  2JAE A;  5HXI A;  3EAN A;  4WCT A;  4A7A A;  1GRG A;  2IVD A;  2RGO A;  4GAV A;  1B8S A;  3SYI A;  3UKH A;  3AYL A;  5U63 A;  3GDP A;  3UOX A;  2WP5 A;  2GH5 A;  3ATQ A;  4UP3 A;  2YWL A;  4C3Y A;  4H4Z A;  5HYM A;  1Q1R A;  3Q6J A;  3CND A;  2GAH B;  2Q7V A;  1KF6 A;  3IF9 A;  2R0C A;  2GAG B;  3CNP A;  4U8J A;  3CNS A;  1D7Y A;  1L9C A;  1V59 A;  1GRH A;  3AD7 B;  3EAO A;  4YXD A;  3LOV A;  2VQ7 A;  4J36 A;  4B69 A;  2R0G A;  2YVJ A;  4IVM B;  1NG3 A;  3AE4 A;  3NHO X;  2BRY A;  2VRM A;  5J7X A;  4BK1 A;  1JRX A;  1NG4 A;  1ZKQ A;  4TLZ A;  3SM8 A;  1IUS A;  3ALL A;  3BI2 A;  3IHG A;  3IWA A;  3AXB A;  2PHH A;  2XDO A;  3G5R A;  3COX A;  2WHD A;  4IV9 A;  4DNA A;  4NTE A;  4OPI A;  4A6N A;  2XLR A;  3QFA A;  2B9X A;  2ZZB A;  2A89 A;  2BCG G;  2YLX A;  1JU2 A;  3DJG X;  4Z2R A;  5JCM A;  1PJ5 A;  4J31 A;  3AEB A;  1H82 A;  4N9X A;  4EMW A;  2C73 A;  3SY4 A;  3CGC A;  4Y4N A;  5BVA A;  4Z2U A;  2A8X A;  5DBJ A;  2XFQ A;  4YWO A;  1EL9 A;  3OC4 A;  2YG5 A;  4G6G A;  4JN9 A;  4ZN0 A;  2ARD A;  1JEH A;  4EMJ A;  1P2E A;  1VG0 A;  1VRQ B;  4O5U A;  3UOV A;  2XVI A;  1H83 A;  3GMB A;  1EBD A;  3UKQ A;  3ADA B;  4ICY A;  4J34 A;  2X3N A;  5KVI A;  3SFE A;  4GCM A;  1O5W A;  3H4K A;  1DOD A;  5EBK A;  1REO A;  3NKS A;  2C4C A;  4NEV A;  4U8M A;  3GWF A;  3S5W A;  2YLW A;  3FMW A;  2RAB A;  2BCP A;  3KVE A;  1IUX A;  1LQT A;  1GT8 A;  3P4Q A;  4GDP A;  3AYI A;  2GMJ A;  4H4S A;  1JNZ A;  1MO9 A;  3G5Q A;  2Z5Y A;  3FPZ A;  3DJD A;  4AP3 A;  3M0O A;  1DJQ A;  3SFD A;  3EF6 A;  4H7U A;  1BGN A;  4YTN A;  1S3E A;  1YQZ A;  1RYI A;  3B3R A;  4D03 A;  2WS3 A;  2R4J A;  2UZZ A;  1ONF A;  4TM3 A;  2YQU A;  4HB9 A;  2VQB A;  3K7Q X;  2JB2 A;  4B1B A;  1NHQ A;  4K5R A;  3UP4 A;  1D4D A;  4Z2T A;  1B5Q A;  5KMP A;  4LA1 A;  1D5T A;  1CC6 A;  4AP1 A;  3AD9 B;  2YG7 A;  1JRY A;  4X4J A;  1L9E A;  2E1M A;  3GD3 A;  3NG7 X;  4IVO B;  3DK9 A;  3PS9 A;  3Q9T A;  4H2P A;  4XWZ A;  5GRT A;  4H4P A;  2YR5 A;  3T0K A;  4FDC B;  2GMH A;  5C3J A;  4KX6 A;  2XFU A;  2X8C A;  1TRB A;  1E1K A;  4FK1 A;  2AAQ A;  2C75 A;  2Y6Q A;  4U2S A;  1OJA A;  2ZZC A;  3AE5 A;  3UKL A;  5KRQ A;  1CC4 A;  1M64 A;  4BK3 A;  1YY5 A;  1FEB A;  2R46 A;  2X99 A;  3KA7 A;  4OPC A;  1FOH A;  3AEC A;  2XVH A;  3P4R A;  3QSM A;  1EL7 A;  3CNJ A;  1IUT A;  5M0Z A;  2BAC A;  2OAL A;  2BK5 A;  2NPX A;  2Y6R A;  2YLS A;  1N4V A;  1TYP A;  1KDG A;  1COY A;  2YLZ A;  3AE9 A;  1N4U A;  1XDI A;  4TM1 A;  1PJ7 A;  2WET A;  2BK4 A;  1PXA A;  2WQY A;  3GSI A;  2DKI A;  2R0P A;  2B9W A;  1FL2 A;  3GDN A;  3NN6 X;  4ECH A;  4JDR A;  3E1T A;  2E4G A;  4B66 A;  4GAP A;  1GAL A;  1PXB A;  2GR0 A;  3UKP A;  4I59 A;  3AED A;  4LII A;  4TM4 A;  4GUV A;  1K0I A;  2C3D A;  4DGK A;  1K4Q A;  2WBA A;  3RNM A;  3SQP A;  1DOB A;  2BAB A;  1O94 A;  2ZZ0 A;  2F5Z A;  3CGE A;  4XWR A;  5JCN A;  2FJE A;  5J60 A;  1PJ6 A;  4CNJ A;  3VRD B;  1YQ4 A;  4UDQ A;  4C74 A;  2RGH A;  1PXC A;  3DH9 A;  3UKA A;  2QA2 A;  4FK1 C;  1FEA A;  3V76 A;  2TPR A;  1PBB A;  2BC0 A;  1OJ9 A;  2XVF A;  4USQ A;  3T2Y A;  3AE6 A;  1JRZ A;  3SGL A;  4OPU A;  1MOK A;  3VRA A;  1PBC A;  5CQF A;  1BF3 A;  1RSG A;  3F8P A;  2H89 A;  3VR9 A;  4YSZ A;  3KPF A;  2GVC A;  1EL5 A;  4U2T A;  3ZDN A;  4NTD A;  4G6H A;  4Y4M A;  1DOC A;  3AE3 A;  3LB8 A;  5ER0 A;  1FEC A;  3GYI A;  4D04 A;  4K8D A;  1DJN A;  1M6I A;  2BXS A;  3VRB A;  1Q1W A;  1ZP0 A;  2WEU A;  2GV8 A;  3AEA A;  1YQ3 A;  4Z25 A;  1NPX A;  4C5O A;  2YVG A;  1CJ4 A;  1O95 A;  2C67 A;  4J2W A;  1NHP A;  4RG3 A;  3UKK A;  2EQ9 A;  2YR4 A;  4AOX A;  1GRT A;  4H50 A;  4EQS A;  4OCG A;  4APN A;  4REK A;  3DK4 A;  1E7P A;  1GPE A;  2WPE A;  2RGJ A;  3CIR A;  3V3N A;  1HYU A;  4G74 A;  5GSN A;  3P1W A;  1EL8 A;  2BRA A;  5L46 A;  1H84 A;  1QLB A;  3LZW A;  1PBE A;  4U8I A;  5LV9 A;  1ZOV A;  3HZL A;  4II3 A;  2C72 A;  4TM0 A;  2WPC A;  3AE8 A;  2R45 A;  1AOG A;  3M13 A;  1OJC A;  4J33 A;  3AWI A;  2QAE A;  3BHK A;  3GRS A;  3NNE A;  3V3O A;  3NYE A;  4YKF A;  1NHR A;  1XHC A;  2YR6 A;  1Z6L A;  4H4T A;  2XCG A;  3GRT A;  4B64 A;  2XLT A;  2YM2 A;  1CHU A;  1TDN A;  2XLU A;  2GQW A;  2V6O A;  4PAA A;  4USR A;  4Z44 A;  3DGZ A;  3O0H A;  3P4P A;  1D7L A;  3BHF A;  4CNK A;  2C7G A;  2YLR A;  3K30 A;  3CPI G;  3PVC A;  4I58 A;  1GET A;  1D4C A;  3DJJ A;  4IA5 A;  2YG4 A;  4YT0 A;  2A87 A;  4K2X A;  5HY5 A;  1CJ2 A;  3QVP A;  5HHF A;  3ISH A;  1GND A;  2B76 A;  1CC2 A;  4IA6 A;  1B4V A;  4A79 A;  5FMH A;  1E1M A;  3F8D A;  1GTH A;  3GMC A;  2WU5 A;  2BXR A;  2Q6U A;  2NVK X;  2WES A;  2XFP A;  2BC1 A;  5C2T A;  3FG2 P;  2VVL G;  2W0H A;  3CMM A;  3T14 A;  4CBQ A;  3NK2 X;  2BS4 A;  1OJT A;  3NK1 X;  3UCL A;  2E5V A;  1MXT A;  1QO8 A;  3C96 A;  4C77 A;  3QJ4 A;  2BS3 A;  1DOE A;  4U8K A;  4EM4 A;  3ALJ A;  3KPK A;  3SX6 A;  1GRE A;  4ZCC A;  1L0V A;  1KSS A;  1P2H A;  3L1R A;  3DA1 A;  2GQF A;  5U25 A;  3UTE A;  4Z43 A;  3D8X A;  4H4R A;  4A9W A;  1GEU A;  4U8N A;  2OLO A;  4AOS A;  4EMI A;  4DSG A;  3CNT A;  4OVI A;  2VVL A;  4II2 A;  3DK8 A;  4YSH A;  1GRA A;  5FS9 A;  3QSE A;  1NDA A;  1S2Q A;  5KMR A;  3QFB A;  2VZ2 A;  2WOW A;  2GEW A;  3AYJ A;  2YVF A;  4C3X A;  4CY8 A;  5IQ4 A;  1F8R A;  4B65 A;  1JOA A;  1PBF A;  4Z26 A;  5KXJ A;  1GRB A;  3RP8 A;  4JQ9 A;  3LZX A;  3OZ2 A;  3NT6 A;  4JY3 A;  1KNP A;  1NAA A;  3UKF A;  5U1O A;  2WOI A;  1IUW A;  1L9D A;  2Q0L A;  1W4X A;  2HQM A;  2CFY A;  4BJZ A;  4P9S A;  3B6D A;  3AB1 A;  2V3A A;  2YAU A;  1BKW A;  3AEE A;  5EB4 A;  4CRT A;  3IHM A;  1KSU A;  4NZH A;  1GRF A;  2I0Z A;  2XFO A;  5IQ1 A;  3NH3 X;  1GER A;  2GB0 A;  3IC9 A;  4CCQ A;  2GR2 A;  4Z24 A;  3BNM A;  4H2R A;  3ITJ A;  1FCD A;  2IID A;  2APG A;  2PYX A;  2QA1 A;  3FIM B;  4OPL A;  4E0V A;  1TYT A;  2B7S A;  2GRT A;  1F8S A;  1BZL A;  4J57 A;  1KFY A;  4KPR A;  2EQ8 A;  3ZYX A;  2C3C A;  3QSS A;  5JCL A;  4ADW A;  2C65 A;  2VVM A;  1PDH A;  4BV6 A;  2OLN A;  3AE1 A;  3CGB A;  5BUK A;  3GD4 A;  1NEK A;  2FJA A;  3PO7 A;  4JNA A;  1TDF A;  1NEN A;  3AEG A;  3D1C A;  3URH A;  4LU6 A;  2JKC A;  2JB3 A;  4JNQ A;  3GYJ A;  3LJP A;  3LAD A;  2C76 A;  1Q9I A;  2AR8 A;  4YTM A;  1CJ3 A;  1Y56 B;  4FX9 A;  4O5Q A;  2R4E A;  1LJ1 A;  3ABV A;  4UDP A;  1TDK A;  4OPG A;  3R9U A;  4GF7 A;  4OPT A;  4X9N A;  2GF3 A;  1N4W A;  5EOW A;  4EIQ A;  4U8P A;  2EQ6 A;  3SZC A;  1IJH A;  2YG3 A;  4U2L A;  2JK6 A;  1OJD A;  3VQR A;  3KKJ A;  5IPY A;  4BUR A;  3SZ0 A;  1F3P A;  4K7Z A;  2XLS A;  4WX1 A;  3SZF A;  1LVL A;  1CF3 A;  3BNU A;  5TR3 A;  2CUL A;  5KVH A;  2JB1 A;  4J56 A;  1VQW A;  5EB5 A;  4YSX A;  4EM3 A;  4AT0 A;  2CVJ A;  2VOU A;  3S61 A;  2BS2 A;  5BRT A;  1DXL A;  4A5L A;  1ZK7 A;  5KOX A;  3BI5 A;  3DME A;  5FS6 A;  5KMQ A;  3HYW A;  3K7M X;  5KOW A;  1GV4 A;  4NWZ A;  2V3B A;  1BWC A;  4MJW A;  2B7R A;  3NIX A;  3NLC A;  1PS9 A;  3C4N A;  1F8W A;  3ICR A;  1ZMC A;  3NN0 X;  4NTC A;  4XXG A;  3KU9 A;  3ALM A;  2V61 A;  4GRT A;  2XVJ A;  3KLJ A;  3II4 A;  1CJC A;  1XPQ A;  5KWF A;  2OAM A;  2CDU A;  5JCK A;  1N1P A;  2VRL A;  1CBO A;  1X31 B;  2WDV A;  3FBS A;  3RHA A;  1IUU A;  1ZY8 A;  4GDE A;  1S2Y A;  3BI4 A;  3CTY A;  3ATR A;  1ELI A;  2YM1 A;  2GR3 A;  3NK0 X;  4A65 A;  1E6E A;  2X50 A;  3UTF A;  3L8K A;  2TMD A;  1VDC A;  2WU2 A;  2OA1 A;  4HA6 A;  3NYF A;  3QVR A;  2YG6 A;  1H7W A;  2C70 A;  1E1L A;  1LTX R;  2WPF A;  1GTE A;  3GWD A;  3SZW A;  3ICS A;  4CCR A;  4EQR A;  2WOV A;  2R9Z A;  3H8I A;  3RP7 A;  4G9K A;  1ZOY A;  1LQU A;  2JBV A;  3F8R A;  3HYV A;  4YTP A;  4A6N B;  1IUV A;  3NTA A;  4H4Y A;  2ZBW A;  3AEF A;  1Y0P A;  3NYC A;  4H2N A;  4B68 A;  4EQW A;  3AE7 A;  4H2Q A;  1NHS A;  4RG4 A;  4YSY A;  1GSN A;  1B37 A;  4H4V A;  2X8G A;  4X9M A;  1UKV G;  3C4A A;  2X8H A;  3H8L A;  2BK3 A;  4B67 A;  1D4E A;  1H7X A;  3T31 A;  4OPD A;  3UTH A;  3T2K A;  1K0J A;  4EIP A;  2V5Z A;  4U8L A;  4JY2 A;  3I3L A;  5BUL A;  2H88 A;  3K7T A;  4BK2 A;  1SEZ A;  1H86 A;  2QCU A;  3SXI A;  1H81 A;  2EQ7 A;  2XVE A;  3NRN A;  4K22 A;  3CGD A;  3RED A;  3NGC X;  3UTG A;  1BGJ A;  3P4S A;  3ICT A;  1YKJ A;  3M12 A;  2C64 A;  1KNR A;  3VR8 A;  3I6D A;  5KNL A;  4YKG A;  4H4Q A;  2IVE A;  3G5S A;  1JNR A;  4EQX A;  2ACZ A;  1E1N A;  2WP9 A;  4PAB A;  1S3B A;  1VG9 A;  3P9U A;  5KMS A;  1LV0 A;  4H4U A;  2DKH A;  4H4X A;  4TLX A;  3UOZ A;  4GR1 A;  2AQJ A;  3NTD A;  2GR1 A;  4RSL A;  1Y56 A;  3HYX A;  1XAN A;  1PHH A;  3AD8 B;  3EPT A;  5FS7 A;  3JSK A;  2C66 A;  4NEW A;  4DSH A;  2Q0K A;  1ZMD A;  1TDO A;  2WP6 A;  4M52 A;  1RP0 A;  4H4W A;  3UP5 A;  2XYO A;  2V60 A;  1ZDL A;  1QJD A;  1ZX9 A;  2FJB A;  2XFN A;  3GYX A;  4A99 A;  5M10 A;  2B9Y A;  1K0L A;  2FJD A;  2XLP A;  4AT2 A;  2Z5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...