3ITJA

Crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
317
structure length
317
Chain Sequence
VHNKVTIIGSGPAAHTAAIYLARAEIKPILYEGMMANGIAAGGQLTTTTEIENFPGFPDGLTGSELMDRMREQSTKFGTEIITETVSKVDLSSKPFKLWTEFNEDAEPVTTDAIILATGASAKRMHLPGEETYWQKGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRASTIMQKRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPVSGLFYAIGHTPATKIVAGQVDTDEAGYIKTVPGSSLTSVPGFFAAGDVQDSKYRQAITSAGSGCMAALDAEKYLTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase 1
publication title Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 97
structure length 317
sequence length 317
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3itjA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3itjA02
3URHA 4H4UA 1EL5A 4GF7A 3RP7A 4ICYA 1H82A 3CNTA 3BHFA 3P4QA 2F5ZA 2R0GA 2GR1A 2PHHA 1GRFA 2YLSA 1FECA 1OJ9A 3GD4A 1CJ3A 3SGLA 4XWZA 1JEHA 3GDPA 3I3LA 3VRDB 4BK3A 4BK2A 5HY5A 5HYMA 1JNZA 2R0PA 3KU9A 4NTEA 2GF3A 3B6DA 1KNRA 1IJHA 2R4JA 2Z5YA 4OPGA 1YY5A 1L9EA 2XCGA 1GRTA 1PXAA 2XFQA 1CJ2A 1H86A 1L9DA 3GYIA 3IC9A 3KLJA 3OZ2A 3IF9A 4TM1A 4YTNA 3PO7A 4ZCDA 3UKAA 4CY6A 4YSXA 2R9ZA 3DK4A 3CNJA 3PVCA 3PS9A 3C4AA 2E4GA 3UTGA 4AOSA 1Q1WA 3QSSA 3V3NA 4CNJA 2YM2A 2C75A 3Q6JA 4LA1A 2YG4A 4YTPA 3ICTA 5FS7A 1YQ4A 4H4WA 2VRMA 3H4KA 2C3DA 3II4A 1JU2A 1GTEA 1QO8A 1ZOYA 1LVLA 4H4XA 1F8SA 2NVKX 2QA2A 5KOWA 4B66A 3GMBA 2VVLA 3O0HA 4J36A 2Z5XA 4DSGA 2V60A 2B76A 2QA1A 3D8XA 3GWFA 1ZK7A 4EQXA 3VQRA 1FCDA 2ARDA 3AYLA 3GRTA 2XLUA 5JCIA 5GSNA 5JCKA 3QFAA 4H4PA 3CPIG 4B69A 4OVIA 3P9UA 1JRYA 4K8DA 1IUWA 1BGJA 2TMDA 2DKIA 1Y56B 3AWIA 1EL7A 1VQWA 3IHMA 3G5RA 3GWDA 3CNPA 1JRZA 2X3NA 4OPUA 4U8PA 4C3XA 1D4CA 1PBEA 4EM3A 4NEWA 2WOIA 3NN0X 1NG3A 3AYIA 1VG0A 1PJ7A 3NKSA 2VQBA 2XLPA 3CPJG 3M12A 1MXTA 3ALMA 3CGCA 3NHOX 4UDPA 1GETA 1GREA 2C72A 3AYJA 2WDVA 2WQYA 2GAGB 1BF3A 4Y4MA 1D4EA 1D4DA 5IQ4A 2WP6A 3UKQA 3CTYA 2BK3A 2IVDA 2X8GA 1ZOVA 2AQJA 4GUVA 2B9YA 2BABA 4HA6A 2W0HA 4JY3A 2JAEA 2X99A 3UOVA 5EB4A 2BYBA 4GDPA 5EOWA 2WPCA 5KVIA 2VVLG 1FEAA 4J34A 4H4QA 3AE1A 4U8LA 1K0LA 2RABA 1N4VA 2C64A 1CF3A 2XDOA 3CIRA 4Z43A 3HZLA 1OJDA 4YXDA 5HHFA 2GRTA 1XPQA 2YVGA 3UTFA 4EQSA 1MOKA 3EF6A 2HQMA 4FX9A 4KX6A 4DSHA 3NG7X 2YWLA 1HYUA 4CCQA 3CGDA 4H4SA 1KSUA 1KSSA 2BC1A 1E6EA 2ZBWA 1PXCA 1S2YA 1SEZA 4JNAA 3UP4A 4NZHA 5BRTA 1XANA 2BS4A 1EL9A 1REOA 3AE2A 4RG4A 3GD3A 2FJAA 1PJ5A 2JBVA 3NYEA 4PABA 2WDRA 1H6VA 2X8CA 1PBCA 1BWCA 1H84A 1NHSA 3NGCX 3NK1X 2GQFA 3KVEA 1H7WA 4J57A 3QJ4A 1L0VA 4A9WA 4JN9A 2B7RA 5CQFA 2E5VA 2WETA 2B7SA 1BGNA 2CULA 4H4ZA 1YKJA 2ZZBA 3ATQA 3ICSA 5DBJA 4LU6A 3KA7A 1D7YA 4YSHA 1ELIA 3AEBA 4REKA 4Z2RA 4U8JA 4CBQA 3BI4A 1NPXA 2WBAA 3LJPA 4EMIA 2APGA 3BI5A 1IUSA 4ZN0A 1LQUA 1JNRA 2BCGG 3UOXA 1H81A 2XFNA 1DOBA 1OJTA 3K30A 2CDUA 3FPZA 1NHPA 3JSKA 1M64A 4X9MA 1PHHA 4EIPA 1COYA 1JRXA 1CJ4A 4HB9A 2X50A 1F6MA 4IA6A 3DJJA 4X4JA 4XWRA 3DMEA 5J7XA 1S2QA 2WPFA 4EMJA 2GR0A 3GMCA 3RP6A 4J2WA 3NYFA 1OJCA 1GEUA 2VQ7A 2YVFA 4YTMA 4TM4A 3ITJA 1N1PA 1PBBA 3BI2A 4AT0A 1GXFA 2WU5A 4H4YA 4YSYA 3FG2P 4JDRA 4XXGA 1P2HA 4J31A 3UKKA 4WCTA 3UOYA 2XLRA 3COXA 4Z2TA 2BS3A 2XVHA 1LJ1A 2CVJA 5LV9A 1KF6A 1QLBA 4Z44A 2PYXA 2XVIA 1ZY8A 4A99A 4YKFA 4DGKA 3NRNA 4ECHA 1Q9IA 3GYJA 1D5TA 3AEFA 2YAUA 4K5RA 5KOXA 1O95A 2Q0LA 4MJWA 3C4NA 1IUXA 2JKCA 1VDCA 1ZMDA 3AE6A 4Z25A 4NEVA 1DOEA 2C7GA 3DJDA 5EB5A 3RHAA 1LV0A 2XLSA 5KWFA 4BV6A 2EQ6A 1GRAA 3LZXA 3SQPA 1CC6A 1IUTA 3VRAA 3UKLA 3R9UA 2C3CA 2Y6RA 3UP5A 1GTHA 3DGHA 2XVFA 2WESA 3NK0X 4CY8A 3NH3X 3ZYXA 3T37A 3NTAA 2C76A 1PXBA 1ZKQA 3DA1A 4OPDA 4P9SA 1ONFA 3B3RA 3CN8A 4TLXA 4PAAA 1VG9A 4I59A 5U63A 4B1BA 3CNSA 1NENA 1RYIA 2R46A 3E1TA 3VR8A 1GRHA 4IVOB 2UZZA 4A65A 1GPEA 4H2NA 5FS8A 1FEBA 2YG6A 4A6NB 2V5ZA 2YR6A 3NNEA 3K7TA 1E39A 2YM1A 1ZMCA 1RP0A 3P1WA 3ABVA 1L9CA 4U8MA 1B37A 2VOUA 4O5QA 2I0ZA 3KKJA 1NHRA 4APNA 4WX1A 5IPYA 1W4XA 2C70A 2R0CA 3CPHG 1DJQA 4TLZA 4EIQA 3AD8B 3LOVA 1NAAA 2RGHA 5TR3A 2YLXA 1ZP0A 3H8IA 3P4PA 4U8KA 1B4VA 1E1MA 1KDGA 2FJBA 2XFPA 4TM0A 3Q9TA 4U8IA 3QFBA 2VVMA 2YG5A 3AECA 3AXBA 3G5QA 4H7UA 3GRSA 4IVMB 4U2TA 4C3YA 2B9XA 2H88A 1E1NA 3NIXA 3FBSA 1TDOA 1TDKA 1N4WA 3ICRA 1E1LA 3S61A 4J56A 4O5UA 3DK8A 1PBFA 2YLTA 3EAOA 4Z2UA 4Z26A 1DODA 1TYTA 1F8WA 3M13A 4BURA 3F8PA 1UKVG 3P4RA 2XVEA 3NT6A 1GV4A 4NTCA 3RP8A 1MO9A 1TYPA 5BULA 2XLTA 2A87A 3IHGA 2JB3A 1DNCA 5JCLA 3BHKA 4YKGA 2VZ2A 2WOVA 4FK1A 4FK1C 1FL2A 2YLZA 1JOAA 4YSZA 1NEKA 3AD7B 1Z6LA 1CBOA 4U8NA 1Q1RA 5L46A 1BKWA 4H4VA 4C77A 1LTXR 1QJDA 4C5OA 4M52A 4JNQA 1CL0A 4I58A 3OC4A 1TRBA 1VRQB 2GMHA 2Q6UA 1ZX9A 4H2QA 1PJ6A 1NG4A 3D1CA 4K7ZA 2EQ7A 2O9ZA 5FS9A 3F8DA 2CFYA 3L8KA 3M0OA 3H8LA 5FS6A 5M0ZA 2OLNA 2Q0KA 4H2RA 2V6OA 4EM4A 3LXDA 2BC0A 5U25A 4DNAA 4OCGA 3AE8A 3QSMA 4H2PA 2NPXA 4OPIA 4U2LA 3AEDA 2BS2A 2B9WA 5U1OA 3UTHA 4EMWA 2WOWA 3SM8A 1NDAA 3AEEA 1GALA 1LPFA 1RSGA 1F8RA 1GOSA 3F8RA 3AE4A 4EQRA 3FMWA 3CNDA 3KPFA 3NTDA 4BK1A 2JB2A 1GESA 4TM3A 2YG7A 4UDQA 1FOHA 2XFOA 2GH5A 4D03A 2DKHA 2GR3A 3UOZA 2C66A 2C67A 3UKPA 4X9NA 2YQUA 3BNMA 4AP3A 1GSNA 4OPLA 2YLRA 2YVJA 3DJGX 2GV8A 3VRBA 3ALJA 4C74A 5C3JA 4OPTA 1TDEA 3FIMB 4YT0A 3LADA 1F3PA 2VRLA 2WHDA 3LB8A 3DK9A 4Z24A 1X31B 1TDFA 4A5LA 4H4RA 5BVAA 4JY2A 4U2SA 4LIIA 2FJEA 1M6IA 2V3BA 2BK4A 3UCLA 3QVPA 3CGBA 5EBKA 1E7PA 1K0IA 1PN0A 3S5WA 4CRTA 2GEWA 5BUKA 1GRGA 2OA1A 1TDNA 2GMJA 3ATRA 3K7QX 4A7AA 1GNDA 1CC4A 4Y4LA 2IIDA 4Y4NA 4E0VA 1PBDA 1YQ3A 3V76A 2BA9A 2FJDA 3QVRA 4NTDA 3ALLA 2WPEA 1CC2A 1Y56A 5CKUA 5FMHA 1EL8A 3LZWA 1H83A 1LQTA 4KPRA 3ZDNA 1GT8A 4RSLA 1K4QA 3K7MX 4FDCB 2WEUA 3UKFA 1S3BA 3GSIA 3RNMA 2AR8A 1B5QA 4CNKA 3VR9A 1CJCA 2YLWA 5JCMA 3AE7A 3AE5A 1Y0PA 4A6NA 3AEGA 2R45A 2BK5A 2OALA 1IUUA 2Q7VA 4OPCA 2QCUA 2OLOA 1GERA 3NLCA 2WU2A 4BJZA 1YQZA 2C65A 1EBDA 4USRA 3I6DA 5KRQA 2BCPA 1DXLA 2XFUA 2A8XA 1DOCA 4A79A 3WE0A 4K22A 4B65A 2GR2A 3CGEA 1KNPA 2V61A 2RGJA 1AOGA 2J3NA 1NHQA 2C73A 2GAHB 3EANA 4IA5A 5ER0A 1OJAA 4U8OA 1N4UA 3NN6X 4B68A 2YG3A 3G5SA 2AAQA 4H50A 3V3OA 4EQWA 2A89A 4CCRA 5C2TA 2QAEA 3DGZA 3REDA 3AE3A 2H89A 1XDIA 3DJEA 2IVEA 3SFEA 5JCNA 3P4SA 4B64A 1PDHA 1V59A 2EQ8A 5HXIA 3EPTA 5GRTA 1P2EA 4RG3A 2GVCA 1ZDLA 3UTEA 2R4EA 2BACA 3SFDA 4GRTA 1XHCA 1CHUA 4K2XA 3AB1A 3AD9B 2GQWA 3GDNA 3QSEA 5M10A 1S3EA 1BZLA 5KVHA 4GDEA 3L1RA 4ZCCA 2WP5A 4GR1A 4AP1A 2JK6A 2JB1A 2ZZ0A 4K5SA 1O5WA 2E1MA 1O94A 5KXJA 2WDQA 4BJYA 2BXRA 3AE9A 4IV9A 2GB0A 3C96A 4N9XA 4GCMA 4JQ9A 3ISHA 2XYOA 4H4TA 1H7XA 2YR5A 2X8HA 4J33A 4YWOA 4AOXA 3ADAB 3IWAA 3KD9A 5J60A 2EQ9A 3DH9A 2ZZCA 1E1KA 2ACZA 2WS3A 1B8SA 3NK2X 2RGOA 4USQA 1KFYA 1IUVA 4ADWA 2V3AA 2BXSA 1GRBA 4UDRA 2WP9A 1PS9A 1D7LA 3NYCA 4UP3A 2TPRA 2OAMA 2Y6QA 3BNUA 2YR4A 2FBWA 4D04A 3AEAA 1DJNA 1K0JA 4AT2A 3UKHA 4B63A 2XVJA 5IQ1A 4B67A
chains in the Genus database with same CATH superfamily
3URHA 4H4UA 1EL5A 4GF7A 3RP7A 4ICYA 1H82A 3CNTA 3BHFA 3P4QA 2F5ZA 2R0GA 2GR1A 2PHHA 1GRFA 2YLSA 1FECA 5KMRA 1OJ9A 3GD4A 1CJ3A 4G9KA 3SGLA 4XWZA 1JEHA 3GDPA 3I3LA 3VRDB 4BK3A 4BK2A 5HY5A 2BRAA 3T2ZA 5HYMA 1JNZA 2R0PA 3KU9A 4NTEA 2GF3A 3B6DA 1KNRA 1IJHA 2R4JA 2Z5YA 4OPGA 1YY5A 1L9EA 2XCGA 1GRTA 1PXAA 2XFQA 1CJ2A 1H86A 1L9DA 3GYIA 3IC9A 3KLJA 3OZ2A 3IF9A 4TM1A 4YTNA 3PO7A 4ZCDA 3UKAA 4CY6A 4YSXA 2R9ZA 3DK4A 3CNJA 3PVCA 3PS9A 3C4AA 2E4GA 3UTGA 4AOSA 1Q1WA 3QSSA 3V3NA 4CNJA 2YM2A 2C75A 3Q6JA 4LA1A 2YG4A 4YTPA 3ICTA 5FS7A 1YQ4A 4H4WA 2VRMA 3H4KA 2C3DA 3II4A 1JU2A 1GTEA 1QO8A 1ZOYA 1LVLA 4H4XA 1F8SA 2NVKX 2QA2A 5KOWA 4B66A 3GMBA 2VVLA 3O0HA 4J36A 2Z5XA 4DSGA 4GAPA 2V60A 2B76A 2QA1A 3D8XA 3GWFA 1ZK7A 4EQXA 3VQRA 1FCDA 2ARDA 3AYLA 3GRTA 2XLUA 5JCIA 5GSNA 4G73A 5JCKA 3QFAA 4H4PA 3CPIG 4B69A 4OVIA 3SZFA 3P9UA 1JRYA 4K8DA 1IUWA 1BGJA 2TMDA 2DKIA 3SXIA 1Y56B 3AWIA 1EL7A 1VQWA 3IHMA 3G5RA 3GWDA 3CNPA 1JRZA 2X3NA 4OPUA 4U8PA 4C3XA 1D4CA 1PBEA 4EM3A 4NEWA 3HYVA 2WOIA 3NN0X 1NG3A 3AYIA 1VG0A 3HYWA 1PJ7A 3NKSA 2VQBA 2XLPA 3CPJG 3M12A 1MXTA 3ALMA 3CGCA 3NHOX 4UDPA 1GETA 1GREA 2C72A 3AYJA 2WDVA 2WQYA 2GAGB 1BF3A 4Y4MA 1D4EA 1D4DA 5IQ4A 2WP6A 3UKQA 3CTYA 2BK3A 2IVDA 2X8GA 1ZOVA 2AQJA 4GUVA 2B9YA 2BABA 4HA6A 2W0HA 4JY3A 2JAEA 2X99A 3UOVA 5EB4A 2BYBA 4GDPA 5EOWA 2WPCA 5KVIA 2VVLG 1FEAA 4J34A 4H4QA 3AE1A 4U8LA 1K0LA 2RABA 3T2KA 1N4VA 2C64A 1CF3A 2XDOA 3CIRA 4Z43A 3HZLA 1OJDA 4YXDA 5HHFA 2GRTA 1XPQA 2YVGA 3UTFA 4EQSA 1MOKA 3EF6A 2HQMA 4FX9A 4KX6A 3T0KA 4DSHA 3NG7X 2YWLA 1HYUA 4CCQA 3CGDA 4H4SA 1KSUA 1KSSA 2BC1A 1E6EA 2ZBWA 1PXCA 1S2YA 1SEZA 4JNAA 3UP4A 4NZHA 5BRTA 1XANA 2BS4A 1EL9A 1REOA 3AE2A 4RG4A 3GD3A 2FJAA 1PJ5A 2JBVA 3NYEA 4PABA 2WDRA 1H6VA 2X8CA 1PBCA 1BWCA 1H84A 1NHSA 3NGCX 3NK1X 2GQFA 3KVEA 1H7WA 4J57A 3QJ4A 1L0VA 4A9WA 4JN9A 2B7RA 5CQFA 2E5VA 2WETA 2B7SA 1BGNA 2CULA 4H4ZA 1YKJA 2ZZBA 3ATQA 3ICSA 5DBJA 5KMQA 4LU6A 3KA7A 1D7YA 4YSHA 1ELIA 3AEBA 4REKA 4Z2RA 4U8JA 4CBQA 3BI4A 5KNLA 3SZCA 1NPXA 2WBAA 3LJPA 4EMIA 2APGA 3BI5A 1IUSA 4ZN0A 1LQUA 3SZWA 1JNRA 2BCGG 3CMMA 3UOXA 1H81A 2XFNA 1DOBA 1OJTA 3K30A 2CDUA 3FPZA 1NHPA 3JSKA 1M64A 4X9MA 1PHHA 4EIPA 1COYA 1JRXA 1CJ4A 4HB9A 2X50A 1F6MA 4IA6A 3DJJA 4G6HA 4X4JA 3DMEA 4XWRA 5J7XA 1S2QA 2WPFA 4EMJA 2GR0A 3GMCA 3RP6A 4J2WA 3NYFA 1OJCA 1GEUA 2VQ7A 2YVFA 4YTMA 4TM4A 3ITJA 1N1PA 1PBBA 3BI2A 4AT0A 1GXFA 2WU5A 4H4YA 4YSYA 3FG2P 4JDRA 4XXGA 1P2HA 4J31A 3UKKA 4WCTA 3UOYA 2XLRA 3COXA 4Z2TA 2BS3A 2XVHA 1LJ1A 2CVJA 5LV9A 1KF6A 1QLBA 4Z44A 2PYXA 2XVIA 1ZY8A 4A99A 4YKFA 4DGKA 3NRNA 4ECHA 1Q9IA 3GYJA 1D5TA 3AEFA 2YAUA 4K5RA 5KOXA 1O95A 2Q0LA 4MJWA 3C4NA 1IUXA 2JKCA 1VDCA 1ZMDA 3AE6A 4Z25A 4NEVA 1DOEA 2C7GA 3DJDA 5EB5A 3RHAA 1LV0A 2XLSA 5KWFA 4BV6A 2EQ6A 1GRAA 3LZXA 3SQPA 1CC6A 1IUTA 3VRAA 3UKLA 3R9UA 2C3CA 2Y6RA 3UP5A 1GTHA 3DGHA 2XVFA 2WESA 3NK0X 4CY8A 3NH3X 3ZYXA 3T37A 3NTAA 2C76A 1PXBA 1ZKQA 3DA1A 3GYXA 4OPDA 1ONFA 3B3RA 3CN8A 4P9SA 4TLXA 4PAAA 1VG9A 4I59A 5U63A 4B1BA 3CNSA 1NENA 3T31A 1RYIA 2R46A 3E1TA 3VR8A 1GRHA 4IVOB 2UZZA 4A65A 1GPEA 4H2NA 5FS8A 1FEBA 2YG6A 4A6NB 2V5ZA 2YR6A 3NNEA 3K7TA 1E39A 2YM1A 1ZMCA 1RP0A 3P1WA 3ABVA 1L9CA 4U8MA 1B37A 2VOUA 4O5QA 2I0ZA 3KKJA 1NHRA 4APNA 4WX1A 5IPYA 1W4XA 2C70A 2R0CA 3CPHG 1DJQA 4TLZA 5KMSA 4EIQA 3AD8B 3LOVA 1NAAA 2RGHA 5TR3A 2YLXA 1ZP0A 3H8IA 3P4PA 4U8KA 1B4VA 1E1MA 1KDGA 2FJBA 2XFPA 4TM0A 3Q9TA 4U8IA 3QFBA 2VVMA 2YG5A 3AECA 3AXBA 3G5QA 4H7UA 3GRSA 4IVMB 4U2TA 4C3YA 2B9XA 2H88A 1E1NA 3NIXA 3FBSA 1TDOA 1TDKA 1N4WA 3ICRA 1E1LA 3HYXA 3S61A 4J56A 4O5UA 3DK8A 1PBFA 2YLTA 3EAOA 4Z2UA 4Z26A 1DODA 1TYTA 1F8WA 3M13A 4BURA 3F8PA 1UKVG 3P4RA 2XVEA 3NT6A 4G6GA 4NWZA 1GV4A 4NTCA 3RP8A 1MO9A 1TYPA 5BULA 2XLTA 2A87A 3IHGA 2JB3A 1DNCA 5JCLA 3BHKA 4YKGA 2VZ2A 2WOVA 4FK1A 4FK1C 1FL2A 2YLZA 1JOAA 4YSZA 1NEKA 3AD7B 5KMPA 1Z6LA 1CBOA 4U8NA 1Q1RA 5L46A 1BKWA 4G74A 4H4VA 1LTXR 1QJDA 4C5OA 4C77A 4M52A 4JNQA 1CL0A 4I58A 3OC4A 1TRBA 1VRQB 2GMHA 2Q6UA 1ZX9A 4H2QA 1PJ6A 1NG4A 3D1CA 4K7ZA 2EQ7A 2O9ZA 5FS9A 3F8DA 2CFYA 3L8KA 3M0OA 3H8LA 5FS6A 5M0ZA 2OLNA 2Q0KA 4H2RA 2V6OA 4EM4A 3LXDA 2BC0A 5U25A 4DNAA 4OCGA 3AE8A 3QSMA 4H2PA 2NPXA 4OPIA 4U2LA 3AEDA 2BS2A 2B9WA 5U1OA 3UTHA 4EMWA 2WOWA 3SM8A 4GAVA 1NDAA 3AEEA 1GALA 1LPFA 1RSGA 1F8RA 1GOSA 3F8RA 3AE4A 4EQRA 3FMWA 3CNDA 3KPFA 3NTDA 4BK1A 2JB2A 1GESA 4TM3A 2YG7A 4UDQA 1FOHA 2XFOA 2GH5A 4D03A 2DKHA 2GR3A 3UOZA 2C66A 2C67A 3UKPA 4X9NA 2YQUA 3BNMA 4AP3A 1GSNA 4OPLA 3SYIA 2YLRA 2YVJA 3DJGX 2GV8A 3VRBA 3ALJA 4C74A 5C3JA 4OPTA 1TDEA 3FIMB 4NNJA 3SZ0A 3LADA 4YT0A 1F3PA 2VRLA 2WHDA 3LB8A 3T2YA 3DK9A 4Z24A 1X31B 1TDFA 4A5LA 4H4RA 5BVAA 4JY2A 4U2SA 4LIIA 2FJEA 1M6IA 2V3BA 2BK4A 3UCLA 3QVPA 3CGBA 5EBKA 1E7PA 1K0IA 1PN0A 3S5WA 4CRTA 2GEWA 5BUKA 1GRGA 2OA1A 1TDNA 2GMJA 3ATRA 3K7QX 4A7AA 1GNDA 1CC4A 4Y4LA 2IIDA 4Y4NA 4E0VA 1PBDA 1YQ3A 3V76A 2BA9A 2FJDA 3QVRA 4NTDA 3ALLA 2WPEA 1CC2A 1Y56A 5CKUA 5FMHA 1EL8A 3LZWA 1H83A 1LQTA 4KPRA 3ZDNA 1GT8A 4RSLA 1K4QA 3K7MX 4FDCB 2WEUA 3UKFA 1S3BA 3GSIA 3RNMA 2AR8A 1B5QA 4CNKA 3VR9A 4II2A 1CJCA 2YLWA 5JCMA 3AE7A 3AE5A 1Y0PA 3KPKA 4A6NA 3AEGA 2R45A 2BK5A 2OALA 1IUUA 2Q7VA 4OPCA 2QCUA 2OLOA 1GERA 3NLCA 2WU2A 4BJZA 1YQZA 2C65A 1EBDA 4USRA 3I6DA 2C4CA 5KRQA 2BCPA 1DXLA 2XFUA 2A8XA 1DOCA 4A79A 3WE0A 4K22A 4B65A 2GR2A 3CGEA 1KNPA 2V61A 2RGJA 1AOGA 2J3NA 1NHQA 2C73A 2GAHB 3EANA 4IA5A 5ER0A 1OJAA 4U8OA 1N4UA 3NN6X 4B68A 2YG3A 3G5SA 2AAQA 4H50A 3V3OA 4EQWA 2A89A 4CCRA 5C2TA 2QAEA 3DGZA 3REDA 2BRYA 2H89A 1XDIA 3AE3A 2IVEA 3DJEA 3SFEA 3T14A 5JCNA 3P4SA 4B64A 1PDHA 1V59A 2EQ8A 5HXIA 3EPTA 5GRTA 1P2EA 4RG3A 2GVCA 1ZDLA 3UTEA 2R4EA 2BACA 3SFDA 4GRTA 1XHCA 1CHUA 4K2XA 3AB1A 3AD9B 2GQWA 3GDNA 3QSEA 3SX6A 5M10A 1S3EA 1BZLA 5KVHA 4GDEA 3L1RA 4ZCCA 2WP5A 4GR1A 4AP1A 4II3A 2JK6A 2JB1A 2ZZ0A 4K5SA 1O5WA 2E1MA 1O94A 5KXJA 2WDQA 4BJYA 2BXRA 3AE9A 4IV9A 2GB0A 3C96A 4N9XA 4GCMA 4JQ9A 3ISHA 2XYOA 4H4TA 1H7XA 2YR5A 2X8HA 4J33A 4YWOA 4AOXA 3ADAB 3IWAA 3KD9A 5J60A 2EQ9A 3SY4A 3DH9A 2ZZCA 1E1KA 2ACZA 2WS3A 1B8SA 3NK2X 2RGOA 4USQA 1KFYA 1IUVA 4ADWA 2V3AA 2BXSA 1GRBA 4UDRA 2WP9A 1PS9A 1D7LA 3NYCA 4UP3A 2TPRA 2OAMA 2Y6QA 3BNUA 2YR4A 2FBWA 4D04A 3AEAA 1DJNA 1K0JA 4AT2A 3UKHA 4B63A 2XVJA 5IQ1A 4B67A
chains in the Genus database with same CATH topology
3URHA 4H4UA 1EL5A 4GF7A 3RP7A 4ICYA 1H82A 3CNTA 3BHFA 3P4QA 2F5ZA 2R0GA 2GR1A 2PHHA 1GRFA 2YLSA 1FECA 5KMRA 1OJ9A 3GD4A 1CJ3A 4G9KA 3SGLA 4XWZA 1JEHA 3GDPA 3I3LA 3VRDB 4BK3A 4BK2A 5HY5A 2BRAA 3T2ZA 5HYMA 1JNZA 2R0PA 3KU9A 4NTEA 2GF3A 3B6DA 1KNRA 1IJHA 2R4JA 2Z5YA 4OPGA 1YY5A 1L9EA 2XCGA 1GRTA 1PXAA 2XFQA 1CJ2A 1H86A 1L9DA 3GYIA 3IC9A 3KLJA 3OZ2A 3IF9A 4TM1A 4YTNA 3PO7A 4ZCDA 3UKAA 4CY6A 4YSXA 2R9ZA 3DK4A 3CNJA 3PVCA 3PS9A 3C4AA 2E4GA 3UTGA 4AOSA 1Q1WA 3QSSA 3V3NA 4CNJA 2YM2A 2C75A 3Q6JA 4LA1A 2YG4A 4YTPA 3ICTA 5FS7A 1YQ4A 4H4WA 2VRMA 3H4KA 2C3DA 3II4A 1JU2A 1GTEA 1QO8A 1ZOYA 1LVLA 4H4XA 1F8SA 2NVKX 2QA2A 5KOWA 4B66A 3GMBA 2VVLA 3O0HA 4J36A 2Z5XA 4DSGA 4GAPA 2V60A 2B76A 2QA1A 3D8XA 3GWFA 1ZK7A 4EQXA 3VQRA 1FCDA 2ARDA 3AYLA 3GRTA 2XLUA 5JCIA 5GSNA 4G73A 5JCKA 3QFAA 4H4PA 3CPIG 4B69A 4OVIA 3SZFA 3P9UA 1JRYA 4K8DA 1IUWA 1BGJA 2TMDA 2DKIA 3SXIA 1Y56B 3AWIA 1EL7A 1VQWA 3IHMA 3G5RA 3GWDA 3CNPA 1JRZA 2X3NA 4OPUA 4U8PA 4C3XA 1D4CA 1PBEA 4EM3A 4NEWA 3HYVA 2WOIA 3NN0X 1NG3A 3AYIA 1VG0A 3HYWA 1PJ7A 3NKSA 2VQBA 2XLPA 3CPJG 3M12A 1MXTA 3ALMA 3CGCA 3NHOX 4UDPA 1GETA 1GREA 2C72A 3AYJA 2WDVA 2WQYA 2GAGB 1BF3A 4Y4MA 1D4EA 1D4DA 5IQ4A 2WP6A 3UKQA 3CTYA 2BK3A 2IVDA 2X8GA 1ZOVA 2AQJA 4GUVA 2B9YA 2BABA 4HA6A 2W0HA 4JY3A 2JAEA 2X99A 3UOVA 5EB4A 2BYBA 4GDPA 5EOWA 2WPCA 5KVIA 2VVLG 1FEAA 4J34A 4H4QA 3AE1A 4U8LA 1K0LA 2RABA 3T2KA 1N4VA 2C64A 1CF3A 2XDOA 3CIRA 4Z43A 3HZLA 1OJDA 4YXDA 5HHFA 2GRTA 1XPQA 2YVGA 3UTFA 4EQSA 1MOKA 3EF6A 2HQMA 4FX9A 4KX6A 3T0KA 4DSHA 3NG7X 2YWLA 1HYUA 4CCQA 3CGDA 4H4SA 1KSUA 1KSSA 2BC1A 1E6EA 2ZBWA 1PXCA 1S2YA 1SEZA 4JNAA 3UP4A 4NZHA 5BRTA 1XANA 2BS4A 1EL9A 1REOA 3AE2A 4RG4A 3GD3A 2FJAA 1PJ5A 2JBVA 3NYEA 4PABA 2WDRA 1H6VA 2X8CA 1PBCA 1BWCA 1H84A 1NHSA 3NGCX 3NK1X 2GQFA 3KVEA 1H7WA 4J57A 3QJ4A 1L0VA 4A9WA 4JN9A 2B7RA 5CQFA 2E5VA 2WETA 2B7SA 1BGNA 2CULA 4H4ZA 1YKJA 2ZZBA 3ATQA 3ICSA 5DBJA 5KMQA 4LU6A 3KA7A 1D7YA 4YSHA 1ELIA 3AEBA 4REKA 4Z2RA 4U8JA 4CBQA 3BI4A 5KNLA 3SZCA 1NPXA 2WBAA 3LJPA 4EMIA 2APGA 3BI5A 1IUSA 4ZN0A 1LQUA 3SZWA 1JNRA 2BCGG 3CMMA 3UOXA 1H81A 2XFNA 1DOBA 1OJTA 3K30A 2CDUA 3FPZA 1NHPA 3JSKA 1M64A 4X9MA 1PHHA 4EIPA 1COYA 1JRXA 1CJ4A 4HB9A 2X50A 1F6MA 4IA6A 3DJJA 4G6HA 4X4JA 3DMEA 4XWRA 5J7XA 1S2QA 2WPFA 4EMJA 2GR0A 3GMCA 3RP6A 4J2WA 3NYFA 1OJCA 1GEUA 2VQ7A 2YVFA 4YTMA 4TM4A 3ITJA 1N1PA 1PBBA 3BI2A 4AT0A 1GXFA 2WU5A 4H4YA 4YSYA 3FG2P 4JDRA 4XXGA 1P2HA 4J31A 3UKKA 4WCTA 3UOYA 2XLRA 3COXA 4Z2TA 2BS3A 2XVHA 1LJ1A 2CVJA 5LV9A 1KF6A 1QLBA 4Z44A 2PYXA 2XVIA 1ZY8A 4A99A 4YKFA 4DGKA 3NRNA 4ECHA 1Q9IA 3GYJA 1D5TA 3AEFA 2YAUA 4K5RA 5KOXA 1O95A 2Q0LA 4MJWA 3C4NA 1IUXA 2JKCA 1VDCA 1ZMDA 3AE6A 4Z25A 4NEVA 1DOEA 2C7GA 3DJDA 5EB5A 3RHAA 1LV0A 2XLSA 5KWFA 4BV6A 2EQ6A 1GRAA 3LZXA 3SQPA 1CC6A 1IUTA 3VRAA 3UKLA 3R9UA 2C3CA 2Y6RA 3UP5A 1GTHA 3DGHA 2XVFA 2WESA 3NK0X 4CY8A 3NH3X 3ZYXA 3T37A 3NTAA 2C76A 1PXBA 1ZKQA 3DA1A 3GYXA 4OPDA 1ONFA 3B3RA 3CN8A 4P9SA 4TLXA 4PAAA 1VG9A 4I59A 5U63A 4B1BA 3CNSA 1NENA 3T31A 1RYIA 2R46A 3E1TA 3VR8A 1GRHA 4IVOB 2UZZA 4A65A 1GPEA 4H2NA 5FS8A 1FEBA 2YG6A 4A6NB 2V5ZA 2YR6A 3NNEA 3K7TA 1E39A 2YM1A 1ZMCA 1RP0A 3P1WA 3ABVA 1L9CA 4U8MA 1B37A 2VOUA 4O5QA 2I0ZA 3KKJA 1NHRA 4APNA 4WX1A 5IPYA 1W4XA 2C70A 2R0CA 3CPHG 1DJQA 4TLZA 5KMSA 4EIQA 3AD8B 3LOVA 1NAAA 2RGHA 5TR3A 2YLXA 1ZP0A 3H8IA 3P4PA 4U8KA 1B4VA 1E1MA 1KDGA 2FJBA 2XFPA 4TM0A 3Q9TA 4U8IA 3QFBA 2VVMA 2YG5A 3AECA 3AXBA 3G5QA 4H7UA 3GRSA 4IVMB 4U2TA 4C3YA 2B9XA 2H88A 1E1NA 3NIXA 3FBSA 1TDOA 1TDKA 1N4WA 3ICRA 1E1LA 3HYXA 3S61A 4J56A 4O5UA 3DK8A 1PBFA 2YLTA 3EAOA 4Z2UA 4Z26A 1DODA 1TYTA 1F8WA 3M13A 4BURA 3F8PA 1UKVG 3P4RA 2XVEA 3NT6A 4G6GA 4NWZA 1GV4A 4NTCA 3RP8A 1MO9A 1TYPA 5BULA 2XLTA 2A87A 3IHGA 2JB3A 1DNCA 5JCLA 3BHKA 4YKGA 2VZ2A 2WOVA 4FK1A 4FK1C 1FL2A 2YLZA 1JOAA 4YSZA 1NEKA 3AD7B 5KMPA 1Z6LA 1CBOA 4U8NA 1Q1RA 5L46A 1BKWA 4G74A 4H4VA 1LTXR 1QJDA 4C5OA 4C77A 4M52A 4JNQA 1CL0A 4I58A 3OC4A 1TRBA 1VRQB 2GMHA 2Q6UA 1ZX9A 4H2QA 1PJ6A 1NG4A 3D1CA 4K7ZA 2EQ7A 2O9ZA 5FS9A 3F8DA 2CFYA 3L8KA 3M0OA 3H8LA 5FS6A 5M0ZA 2OLNA 2Q0KA 4H2RA 2V6OA 4EM4A 3LXDA 2BC0A 5U25A 4DNAA 4OCGA 3AE8A 3QSMA 4H2PA 2NPXA 4OPIA 4U2LA 3AEDA 2BS2A 2B9WA 5U1OA 3UTHA 4EMWA 2WOWA 3SM8A 4GAVA 1NDAA 3AEEA 1GALA 1LPFA 1RSGA 1F8RA 1GOSA 3F8RA 3AE4A 4EQRA 3FMWA 3CNDA 3KPFA 3NTDA 4BK1A 2JB2A 1GESA 4TM3A 2YG7A 4UDQA 1FOHA 2XFOA 2GH5A 4D03A 2DKHA 2GR3A 3UOZA 2C66A 2C67A 3UKPA 4X9NA 2YQUA 3BNMA 4AP3A 1GSNA 4OPLA 3SYIA 2YLRA 2YVJA 3DJGX 2GV8A 3VRBA 3ALJA 4C74A 5C3JA 4OPTA 1TDEA 3FIMB 4NNJA 3SZ0A 3LADA 4YT0A 1F3PA 2VRLA 2WHDA 3LB8A 3T2YA 3DK9A 4Z24A 1X31B 1TDFA 4A5LA 4H4RA 5BVAA 4JY2A 4U2SA 4LIIA 2FJEA 1M6IA 2V3BA 2BK4A 3UCLA 3QVPA 3CGBA 5EBKA 1E7PA 1K0IA 1PN0A 3S5WA 4CRTA 2GEWA 5BUKA 1GRGA 2OA1A 1TDNA 2GMJA 3ATRA 3K7QX 4A7AA 1GNDA 1CC4A 4Y4LA 2IIDA 4Y4NA 4E0VA 1PBDA 1YQ3A 3V76A 2BA9A 2FJDA 3QVRA 4NTDA 3ALLA 2WPEA 1CC2A 1Y56A 5CKUA 5FMHA 1EL8A 3LZWA 1H83A 1LQTA 4KPRA 3ZDNA 1GT8A 4RSLA 1K4QA 3K7MX 4FDCB 2WEUA 3UKFA 1S3BA 3GSIA 3RNMA 2AR8A 1B5QA 4CNKA 3VR9A 4II2A 1CJCA 2YLWA 5JCMA 3AE7A 3AE5A 1Y0PA 3KPKA 4A6NA 3AEGA 2R45A 2BK5A 2OALA 1IUUA 2Q7VA 4OPCA 2QCUA 2OLOA 1GERA 3NLCA 2WU2A 4BJZA 1YQZA 2C65A 1EBDA 4USRA 3I6DA 2C4CA 5KRQA 2BCPA 1DXLA 2XFUA 2A8XA 1DOCA 4A79A 3WE0A 4K22A 4B65A 2GR2A 3CGEA 1KNPA 2V61A 2RGJA 1AOGA 2J3NA 1NHQA 2C73A 2GAHB 3EANA 4IA5A 5ER0A 1OJAA 4U8OA 1N4UA 3NN6X 4B68A 2YG3A 3G5SA 2AAQA 4H50A 3V3OA 4EQWA 2A89A 4CCRA 5C2TA 2QAEA 3DGZA 3REDA 2BRYA 2H89A 1XDIA 3AE3A 2IVEA 3DJEA 3SFEA 3T14A 5JCNA 3P4SA 4B64A 1PDHA 1V59A 2EQ8A 5HXIA 3EPTA 5GRTA 1P2EA 4RG3A 2GVCA 1ZDLA 3UTEA 2R4EA 2BACA 3SFDA 4GRTA 1XHCA 1CHUA 4K2XA 3AB1A 3AD9B 2GQWA 3GDNA 3QSEA 3SX6A 5M10A 1S3EA 1BZLA 5KVHA 4GDEA 3L1RA 4ZCCA 2WP5A 4GR1A 4AP1A 4II3A 2JK6A 2JB1A 2ZZ0A 4K5SA 1O5WA 2E1MA 1O94A 5KXJA 2WDQA 4BJYA 2BXRA 3AE9A 4IV9A 2GB0A 3C96A 4N9XA 4GCMA 4JQ9A 3ISHA 2XYOA 4H4TA 1H7XA 2YR5A 2X8HA 4J33A 4YWOA 4AOXA 3ADAB 3IWAA 3KD9A 5J60A 2EQ9A 3SY4A 3DH9A 2ZZCA 1E1KA 2ACZA 2WS3A 1B8SA 3NK2X 2RGOA 4USQA 1KFYA 1IUVA 4ADWA 2V3AA 2BXSA 1GRBA 4UDRA 2WP9A 1PS9A 1D7LA 3NYCA 4UP3A 2TPRA 2OAMA 2Y6QA 3BNUA 2YR4A 2FBWA 4D04A 3AEAA 1DJNA 1K0JA 4AT2A 3UKHA 4B63A 2XVJA 5IQ1A 4B67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3URH A;  4H4U A;  1EL5 A;  4GF7 A;  3RP7 A;  4ICY A;  1H82 A;  3CNT A;  3BHF A;  3P4Q A;  2F5Z A;  2R0G A;  2GR1 A;  2PHH A;  1GRF A;  2YLS A;  1FEC A;  1OJ9 A;  3GD4 A;  1CJ3 A;  3SGL A;  4XWZ A;  1JEH A;  3GDP A;  3I3L A;  3VRD B;  4BK3 A;  4BK2 A;  5HY5 A;  5HYM A;  1JNZ A;  2R0P A;  3KU9 A;  4NTE A;  2GF3 A;  3B6D A;  1KNR A;  1IJH A;  2R4J A;  2Z5Y A;  4OPG A;  1YY5 A;  1L9E A;  2XCG A;  1GRT A;  1PXA A;  2XFQ A;  1CJ2 A;  1H86 A;  1L9D A;  3GYI A;  3IC9 A;  3KLJ A;  3OZ2 A;  3IF9 A;  4TM1 A;  4YTN A;  3PO7 A;  4ZCD A;  3UKA A;  4CY6 A;  4YSX A;  2R9Z A;  3DK4 A;  3CNJ A;  3PVC A;  3PS9 A;  3C4A A;  2E4G A;  3UTG A;  4AOS A;  1Q1W A;  3QSS A;  3V3N A;  4CNJ A;  2YM2 A;  2C75 A;  3Q6J A;  4LA1 A;  2YG4 A;  4YTP A;  3ICT A;  5FS7 A;  1YQ4 A;  4H4W A;  2VRM A;  3H4K A;  2C3D A;  3II4 A;  1JU2 A;  1GTE A;  1QO8 A;  1ZOY A;  1LVL A;  4H4X A;  1F8S A;  2NVK X;  2QA2 A;  5KOW A;  4B66 A;  3GMB A;  2VVL A;  3O0H A;  4J36 A;  2Z5X A;  4DSG A;  2V60 A;  2B76 A;  2QA1 A;  3D8X A;  3GWF A;  1ZK7 A;  4EQX A;  3VQR A;  1FCD A;  2ARD A;  3AYL A;  3GRT A;  2XLU A;  5JCI A;  5GSN A;  5JCK A;  3QFA A;  4H4P A;  3CPI G;  4B69 A;  4OVI A;  3P9U A;  1JRY A;  4K8D A;  1IUW A;  1BGJ A;  2TMD A;  2DKI A;  1Y56 B;  3AWI A;  1EL7 A;  1VQW A;  3IHM A;  3G5R A;  3GWD A;  3CNP A;  1JRZ A;  2X3N A;  4OPU A;  4U8P A;  4C3X A;  1D4C A;  1PBE A;  4EM3 A;  4NEW A;  2WOI A;  3NN0 X;  1NG3 A;  3AYI A;  1VG0 A;  1PJ7 A;  3NKS A;  2VQB A;  2XLP A;  3CPJ G;  3M12 A;  1MXT A;  3ALM A;  3CGC A;  3NHO X;  4UDP A;  1GET A;  1GRE A;  2C72 A;  3AYJ A;  2WDV A;  2WQY A;  2GAG B;  1BF3 A;  4Y4M A;  1D4E A;  1D4D A;  5IQ4 A;  2WP6 A;  3UKQ A;  3CTY A;  2BK3 A;  2IVD A;  2X8G A;  1ZOV A;  2AQJ A;  4GUV A;  2B9Y A;  2BAB A;  4HA6 A;  2W0H A;  4JY3 A;  2JAE A;  2X99 A;  3UOV A;  5EB4 A;  2BYB A;  4GDP A;  5EOW A;  2WPC A;  5KVI A;  2VVL G;  1FEA A;  4J34 A;  4H4Q A;  3AE1 A;  4U8L A;  1K0L A;  2RAB A;  1N4V A;  2C64 A;  1CF3 A;  2XDO A;  3CIR A;  4Z43 A;  3HZL A;  1OJD A;  4YXD A;  5HHF A;  2GRT A;  1XPQ A;  2YVG A;  3UTF A;  4EQS A;  1MOK A;  3EF6 A;  2HQM A;  4FX9 A;  4KX6 A;  4DSH A;  3NG7 X;  2YWL A;  1HYU A;  4CCQ A;  3CGD A;  4H4S A;  1KSU A;  1KSS A;  2BC1 A;  1E6E A;  2ZBW A;  1PXC A;  1S2Y A;  1SEZ A;  4JNA A;  3UP4 A;  4NZH A;  5BRT A;  1XAN A;  2BS4 A;  1EL9 A;  1REO A;  3AE2 A;  4RG4 A;  3GD3 A;  2FJA A;  1PJ5 A;  2JBV A;  3NYE A;  4PAB A;  2WDR A;  1H6V A;  2X8C A;  1PBC A;  1BWC A;  1H84 A;  1NHS A;  3NGC X;  3NK1 X;  2GQF A;  3KVE A;  1H7W A;  4J57 A;  3QJ4 A;  1L0V A;  4A9W A;  4JN9 A;  2B7R A;  5CQF A;  2E5V A;  2WET A;  2B7S A;  1BGN A;  2CUL A;  4H4Z A;  1YKJ A;  2ZZB A;  3ATQ A;  3ICS A;  5DBJ A;  4LU6 A;  3KA7 A;  1D7Y A;  4YSH A;  1ELI A;  3AEB A;  4REK A;  4Z2R A;  4U8J A;  4CBQ A;  3BI4 A;  1NPX A;  2WBA A;  3LJP A;  4EMI A;  2APG A;  3BI5 A;  1IUS A;  4ZN0 A;  1LQU A;  1JNR A;  2BCG G;  3UOX A;  1H81 A;  2XFN A;  1DOB A;  1OJT A;  3K30 A;  2CDU A;  3FPZ A;  1NHP A;  3JSK A;  1M64 A;  4X9M A;  1PHH A;  4EIP A;  1COY A;  1JRX A;  1CJ4 A;  4HB9 A;  2X50 A;  1F6M A;  4IA6 A;  3DJJ A;  4X4J A;  4XWR A;  3DME A;  5J7X A;  1S2Q A;  2WPF A;  4EMJ A;  2GR0 A;  3GMC A;  3RP6 A;  4J2W A;  3NYF A;  1OJC A;  1GEU A;  2VQ7 A;  2YVF A;  4YTM A;  4TM4 A;  3ITJ A;  1N1P A;  1PBB A;  3BI2 A;  4AT0 A;  1GXF A;  2WU5 A;  4H4Y A;  4YSY A;  3FG2 P;  4JDR A;  4XXG A;  1P2H A;  4J31 A;  3UKK A;  4WCT A;  3UOY A;  2XLR A;  3COX A;  4Z2T A;  2BS3 A;  2XVH A;  1LJ1 A;  2CVJ A;  5LV9 A;  1KF6 A;  1QLB A;  4Z44 A;  2PYX A;  2XVI A;  1ZY8 A;  4A99 A;  4YKF A;  4DGK A;  3NRN A;  4ECH A;  1Q9I A;  3GYJ A;  1D5T A;  3AEF A;  2YAU A;  4K5R A;  5KOX A;  1O95 A;  2Q0L A;  4MJW A;  3C4N A;  1IUX A;  2JKC A;  1VDC A;  1ZMD A;  3AE6 A;  4Z25 A;  4NEV A;  1DOE A;  2C7G A;  3DJD A;  5EB5 A;  3RHA A;  1LV0 A;  2XLS A;  5KWF A;  4BV6 A;  2EQ6 A;  1GRA A;  3LZX A;  3SQP A;  1CC6 A;  1IUT A;  3VRA A;  3UKL A;  3R9U A;  2C3C A;  2Y6R A;  3UP5 A;  1GTH A;  3DGH A;  2XVF A;  2WES A;  3NK0 X;  4CY8 A;  3NH3 X;  3ZYX A;  3T37 A;  3NTA A;  2C76 A;  1PXB A;  1ZKQ A;  3DA1 A;  4OPD A;  4P9S A;  1ONF A;  3B3R A;  3CN8 A;  4TLX A;  4PAA A;  1VG9 A;  4I59 A;  5U63 A;  4B1B A;  3CNS A;  1NEN A;  1RYI A;  2R46 A;  3E1T A;  3VR8 A;  1GRH A;  4IVO B;  2UZZ A;  4A65 A;  1GPE A;  4H2N A;  5FS8 A;  1FEB A;  2YG6 A;  4A6N B;  2V5Z A;  2YR6 A;  3NNE A;  3K7T A;  1E39 A;  2YM1 A;  1ZMC A;  1RP0 A;  3P1W A;  3ABV A;  1L9C A;  4U8M A;  1B37 A;  2VOU A;  4O5Q A;  2I0Z A;  3KKJ A;  1NHR A;  4APN A;  4WX1 A;  5IPY A;  1W4X A;  2C70 A;  2R0C A;  3CPH G;  1DJQ A;  4TLZ A;  4EIQ A;  3AD8 B;  3LOV A;  1NAA A;  2RGH A;  5TR3 A;  2YLX A;  1ZP0 A;  3H8I A;  3P4P A;  4U8K A;  1B4V A;  1E1M A;  1KDG A;  2FJB A;  2XFP A;  4TM0 A;  3Q9T A;  4U8I A;  3QFB A;  2VVM A;  2YG5 A;  3AEC A;  3AXB A;  3G5Q A;  4H7U A;  3GRS A;  4IVM B;  4U2T A;  4C3Y A;  2B9X A;  2H88 A;  1E1N A;  3NIX A;  3FBS A;  1TDO A;  1TDK A;  1N4W A;  3ICR A;  1E1L A;  3S61 A;  4J56 A;  4O5U A;  3DK8 A;  1PBF A;  2YLT A;  3EAO A;  4Z2U A;  4Z26 A;  1DOD A;  1TYT A;  1F8W A;  3M13 A;  4BUR A;  3F8P A;  1UKV G;  3P4R A;  2XVE A;  3NT6 A;  1GV4 A;  4NTC A;  3RP8 A;  1MO9 A;  1TYP A;  5BUL A;  2XLT A;  2A87 A;  3IHG A;  2JB3 A;  1DNC A;  5JCL A;  3BHK A;  4YKG A;  2VZ2 A;  2WOV A;  4FK1 A;  4FK1 C;  1FL2 A;  2YLZ A;  1JOA A;  4YSZ A;  1NEK A;  3AD7 B;  1Z6L A;  1CBO A;  4U8N A;  1Q1R A;  5L46 A;  1BKW A;  4H4V A;  4C77 A;  1LTX R;  1QJD A;  4C5O A;  4M52 A;  4JNQ A;  1CL0 A;  4I58 A;  3OC4 A;  1TRB A;  1VRQ B;  2GMH A;  2Q6U A;  1ZX9 A;  4H2Q A;  1PJ6 A;  1NG4 A;  3D1C A;  4K7Z A;  2EQ7 A;  2O9Z A;  5FS9 A;  3F8D A;  2CFY A;  3L8K A;  3M0O A;  3H8L A;  5FS6 A;  5M0Z A;  2OLN A;  2Q0K A;  4H2R A;  2V6O A;  4EM4 A;  3LXD A;  2BC0 A;  5U25 A;  4DNA A;  4OCG A;  3AE8 A;  3QSM A;  4H2P A;  2NPX A;  4OPI A;  4U2L A;  3AED A;  2BS2 A;  2B9W A;  5U1O A;  3UTH A;  4EMW A;  2WOW A;  3SM8 A;  1NDA A;  3AEE A;  1GAL A;  1LPF A;  1RSG A;  1F8R A;  1GOS A;  3F8R A;  3AE4 A;  4EQR A;  3FMW A;  3CND A;  3KPF A;  3NTD A;  4BK1 A;  2JB2 A;  1GES A;  4TM3 A;  2YG7 A;  4UDQ A;  1FOH A;  2XFO A;  2GH5 A;  4D03 A;  2DKH A;  2GR3 A;  3UOZ A;  2C66 A;  2C67 A;  3UKP A;  4X9N A;  2YQU A;  3BNM A;  4AP3 A;  1GSN A;  4OPL A;  2YLR A;  2YVJ A;  3DJG X;  2GV8 A;  3VRB A;  3ALJ A;  4C74 A;  5C3J A;  4OPT A;  1TDE A;  3FIM B;  4YT0 A;  3LAD A;  1F3P A;  2VRL A;  2WHD A;  3LB8 A;  3DK9 A;  4Z24 A;  1X31 B;  1TDF A;  4A5L A;  4H4R A;  5BVA A;  4JY2 A;  4U2S A;  4LII A;  2FJE A;  1M6I A;  2V3B A;  2BK4 A;  3UCL A;  3QVP A;  3CGB A;  5EBK A;  1E7P A;  1K0I A;  1PN0 A;  3S5W A;  4CRT A;  2GEW A;  5BUK A;  1GRG A;  2OA1 A;  1TDN A;  2GMJ A;  3ATR A;  3K7Q X;  4A7A A;  1GND A;  1CC4 A;  4Y4L A;  2IID A;  4Y4N A;  4E0V A;  1PBD A;  1YQ3 A;  3V76 A;  2BA9 A;  2FJD A;  3QVR A;  4NTD A;  3ALL A;  2WPE A;  1CC2 A;  1Y56 A;  5CKU A;  5FMH A;  1EL8 A;  3LZW A;  1H83 A;  1LQT A;  4KPR A;  3ZDN A;  1GT8 A;  4RSL A;  1K4Q A;  3K7M X;  4FDC B;  2WEU A;  3UKF A;  1S3B A;  3GSI A;  3RNM A;  2AR8 A;  1B5Q A;  4CNK A;  3VR9 A;  1CJC A;  2YLW A;  5JCM A;  3AE7 A;  3AE5 A;  1Y0P A;  4A6N A;  3AEG A;  2R45 A;  2BK5 A;  2OAL A;  1IUU A;  2Q7V A;  4OPC A;  2QCU A;  2OLO A;  1GER A;  3NLC A;  2WU2 A;  4BJZ A;  1YQZ A;  2C65 A;  1EBD A;  4USR A;  3I6D A;  5KRQ A;  2BCP A;  1DXL A;  2XFU A;  2A8X A;  1DOC A;  4A79 A;  3WE0 A;  4K22 A;  4B65 A;  2GR2 A;  3CGE A;  1KNP A;  2V61 A;  2RGJ A;  1AOG A;  2J3N A;  1NHQ A;  2C73 A;  2GAH B;  3EAN A;  4IA5 A;  5ER0 A;  1OJA A;  4U8O A;  1N4U A;  3NN6 X;  4B68 A;  2YG3 A;  3G5S A;  2AAQ A;  4H50 A;  3V3O A;  4EQW A;  2A89 A;  4CCR A;  5C2T A;  2QAE A;  3DGZ A;  3RED A;  3AE3 A;  2H89 A;  1XDI A;  3DJE A;  2IVE A;  3SFE A;  5JCN A;  3P4S A;  4B64 A;  1PDH A;  1V59 A;  2EQ8 A;  5HXI A;  3EPT A;  5GRT A;  1P2E A;  4RG3 A;  2GVC A;  1ZDL A;  3UTE A;  2R4E A;  2BAC A;  3SFD A;  4GRT A;  1XHC A;  1CHU A;  4K2X A;  3AB1 A;  3AD9 B;  2GQW A;  3GDN A;  3QSE A;  5M10 A;  1S3E A;  1BZL A;  5KVH A;  4GDE A;  3L1R A;  4ZCC A;  2WP5 A;  4GR1 A;  4AP1 A;  2JK6 A;  2JB1 A;  2ZZ0 A;  4K5S A;  1O5W A;  2E1M A;  1O94 A;  5KXJ A;  2WDQ A;  4BJY A;  2BXR A;  3AE9 A;  4IV9 A;  2GB0 A;  3C96 A;  4N9X A;  4GCM A;  4JQ9 A;  3ISH A;  2XYO A;  4H4T A;  1H7X A;  2YR5 A;  2X8H A;  4J33 A;  4YWO A;  4AOX A;  3ADA B;  3IWA A;  3KD9 A;  5J60 A;  2EQ9 A;  3DH9 A;  2ZZC A;  1E1K A;  2ACZ A;  2WS3 A;  1B8S A;  3NK2 X;  2RGO A;  4USQ A;  1KFY A;  1IUV A;  4ADW A;  2V3A A;  2BXS A;  1GRB A;  4UDR A;  2WP9 A;  1PS9 A;  1D7L A;  3NYC A;  4UP3 A;  2TPR A;  2OAM A;  2Y6Q A;  3BNU A;  2YR4 A;  2FBW A;  4D04 A;  3AEA A;  1DJN A;  1K0J A;  4AT2 A;  3UKH A;  4B63 A;  2XVJ A;  5IQ1 A;  4B67 A; 
#chains in the Genus database with same CATH topology
 3URH A;  4H4U A;  1EL5 A;  4GF7 A;  3RP7 A;  4ICY A;  1H82 A;  3CNT A;  3BHF A;  3P4Q A;  2F5Z A;  2R0G A;  2GR1 A;  2PHH A;  1GRF A;  2YLS A;  1FEC A;  5KMR A;  1OJ9 A;  3GD4 A;  1CJ3 A;  4G9K A;  3SGL A;  4XWZ A;  1JEH A;  3GDP A;  3I3L A;  3VRD B;  4BK3 A;  4BK2 A;  5HY5 A;  2BRA A;  3T2Z A;  5HYM A;  1JNZ A;  2R0P A;  3KU9 A;  4NTE A;  2GF3 A;  3B6D A;  1KNR A;  1IJH A;  2R4J A;  2Z5Y A;  4OPG A;  1YY5 A;  1L9E A;  2XCG A;  1GRT A;  1PXA A;  2XFQ A;  1CJ2 A;  1H86 A;  1L9D A;  3GYI A;  3IC9 A;  3KLJ A;  3OZ2 A;  3IF9 A;  4TM1 A;  4YTN A;  3PO7 A;  4ZCD A;  3UKA A;  4CY6 A;  4YSX A;  2R9Z A;  3DK4 A;  3CNJ A;  3PVC A;  3PS9 A;  3C4A A;  2E4G A;  3UTG A;  4AOS A;  1Q1W A;  3QSS A;  3V3N A;  4CNJ A;  2YM2 A;  2C75 A;  3Q6J A;  4LA1 A;  2YG4 A;  4YTP A;  3ICT A;  5FS7 A;  1YQ4 A;  4H4W A;  2VRM A;  3H4K A;  2C3D A;  3II4 A;  1JU2 A;  1GTE A;  1QO8 A;  1ZOY A;  1LVL A;  4H4X A;  1F8S A;  2NVK X;  2QA2 A;  5KOW A;  4B66 A;  3GMB A;  2VVL A;  3O0H A;  4J36 A;  2Z5X A;  4DSG A;  4GAP A;  2V60 A;  2B76 A;  2QA1 A;  3D8X A;  3GWF A;  1ZK7 A;  4EQX A;  3VQR A;  1FCD A;  2ARD A;  3AYL A;  3GRT A;  2XLU A;  5JCI A;  5GSN A;  4G73 A;  5JCK A;  3QFA A;  4H4P A;  3CPI G;  4B69 A;  4OVI A;  3SZF A;  3P9U A;  1JRY A;  4K8D A;  1IUW A;  1BGJ A;  2TMD A;  2DKI A;  3SXI A;  1Y56 B;  3AWI A;  1EL7 A;  1VQW A;  3IHM A;  3G5R A;  3GWD A;  3CNP A;  1JRZ A;  2X3N A;  4OPU A;  4U8P A;  4C3X A;  1D4C A;  1PBE A;  4EM3 A;  4NEW A;  3HYV A;  2WOI A;  3NN0 X;  1NG3 A;  3AYI A;  1VG0 A;  3HYW A;  1PJ7 A;  3NKS A;  2VQB A;  2XLP A;  3CPJ G;  3M12 A;  1MXT A;  3ALM A;  3CGC A;  3NHO X;  4UDP A;  1GET A;  1GRE A;  2C72 A;  3AYJ A;  2WDV A;  2WQY A;  2GAG B;  1BF3 A;  4Y4M A;  1D4E A;  1D4D A;  5IQ4 A;  2WP6 A;  3UKQ A;  3CTY A;  2BK3 A;  2IVD A;  2X8G A;  1ZOV A;  2AQJ A;  4GUV A;  2B9Y A;  2BAB A;  4HA6 A;  2W0H A;  4JY3 A;  2JAE A;  2X99 A;  3UOV A;  5EB4 A;  2BYB A;  4GDP A;  5EOW A;  2WPC A;  5KVI A;  2VVL G;  1FEA A;  4J34 A;  4H4Q A;  3AE1 A;  4U8L A;  1K0L A;  2RAB A;  3T2K A;  1N4V A;  2C64 A;  1CF3 A;  2XDO A;  3CIR A;  4Z43 A;  3HZL A;  1OJD A;  4YXD A;  5HHF A;  2GRT A;  1XPQ A;  2YVG A;  3UTF A;  4EQS A;  1MOK A;  3EF6 A;  2HQM A;  4FX9 A;  4KX6 A;  3T0K A;  4DSH A;  3NG7 X;  2YWL A;  1HYU A;  4CCQ A;  3CGD A;  4H4S A;  1KSU A;  1KSS A;  2BC1 A;  1E6E A;  2ZBW A;  1PXC A;  1S2Y A;  1SEZ A;  4JNA A;  3UP4 A;  4NZH A;  5BRT A;  1XAN A;  2BS4 A;  1EL9 A;  1REO A;  3AE2 A;  4RG4 A;  3GD3 A;  2FJA A;  1PJ5 A;  2JBV A;  3NYE A;  4PAB A;  2WDR A;  1H6V A;  2X8C A;  1PBC A;  1BWC A;  1H84 A;  1NHS A;  3NGC X;  3NK1 X;  2GQF A;  3KVE A;  1H7W A;  4J57 A;  3QJ4 A;  1L0V A;  4A9W A;  4JN9 A;  2B7R A;  5CQF A;  2E5V A;  2WET A;  2B7S A;  1BGN A;  2CUL A;  4H4Z A;  1YKJ A;  2ZZB A;  3ATQ A;  3ICS A;  5DBJ A;  5KMQ A;  4LU6 A;  3KA7 A;  1D7Y A;  4YSH A;  1ELI A;  3AEB A;  4REK A;  4Z2R A;  4U8J A;  4CBQ A;  3BI4 A;  5KNL A;  3SZC A;  1NPX A;  2WBA A;  3LJP A;  4EMI A;  2APG A;  3BI5 A;  1IUS A;  4ZN0 A;  1LQU A;  3SZW A;  1JNR A;  2BCG G;  3CMM A;  3UOX A;  1H81 A;  2XFN A;  1DOB A;  1OJT A;  3K30 A;  2CDU A;  3FPZ A;  1NHP A;  3JSK A;  1M64 A;  4X9M A;  1PHH A;  4EIP A;  1COY A;  1JRX A;  1CJ4 A;  4HB9 A;  2X50 A;  1F6M A;  4IA6 A;  3DJJ A;  4G6H A;  4X4J A;  3DME A;  4XWR A;  5J7X A;  1S2Q A;  2WPF A;  4EMJ A;  2GR0 A;  3GMC A;  3RP6 A;  4J2W A;  3NYF A;  1OJC A;  1GEU A;  2VQ7 A;  2YVF A;  4YTM A;  4TM4 A;  3ITJ A;  1N1P A;  1PBB A;  3BI2 A;  4AT0 A;  1GXF A;  2WU5 A;  4H4Y A;  4YSY A;  3FG2 P;  4JDR A;  4XXG A;  1P2H A;  4J31 A;  3UKK A;  4WCT A;  3UOY A;  2XLR A;  3COX A;  4Z2T A;  2BS3 A;  2XVH A;  1LJ1 A;  2CVJ A;  5LV9 A;  1KF6 A;  1QLB A;  4Z44 A;  2PYX A;  2XVI A;  1ZY8 A;  4A99 A;  4YKF A;  4DGK A;  3NRN A;  4ECH A;  1Q9I A;  3GYJ A;  1D5T A;  3AEF A;  2YAU A;  4K5R A;  5KOX A;  1O95 A;  2Q0L A;  4MJW A;  3C4N A;  1IUX A;  2JKC A;  1VDC A;  1ZMD A;  3AE6 A;  4Z25 A;  4NEV A;  1DOE A;  2C7G A;  3DJD A;  5EB5 A;  3RHA A;  1LV0 A;  2XLS A;  5KWF A;  4BV6 A;  2EQ6 A;  1GRA A;  3LZX A;  3SQP A;  1CC6 A;  1IUT A;  3VRA A;  3UKL A;  3R9U A;  2C3C A;  2Y6R A;  3UP5 A;  1GTH A;  3DGH A;  2XVF A;  2WES A;  3NK0 X;  4CY8 A;  3NH3 X;  3ZYX A;  3T37 A;  3NTA A;  2C76 A;  1PXB A;  1ZKQ A;  3DA1 A;  3GYX A;  4OPD A;  1ONF A;  3B3R A;  3CN8 A;  4P9S A;  4TLX A;  4PAA A;  1VG9 A;  4I59 A;  5U63 A;  4B1B A;  3CNS A;  1NEN A;  3T31 A;  1RYI A;  2R46 A;  3E1T A;  3VR8 A;  1GRH A;  4IVO B;  2UZZ A;  4A65 A;  1GPE A;  4H2N A;  5FS8 A;  1FEB A;  2YG6 A;  4A6N B;  2V5Z A;  2YR6 A;  3NNE A;  3K7T A;  1E39 A;  2YM1 A;  1ZMC A;  1RP0 A;  3P1W A;  3ABV A;  1L9C A;  4U8M A;  1B37 A;  2VOU A;  4O5Q A;  2I0Z A;  3KKJ A;  1NHR A;  4APN A;  4WX1 A;  5IPY A;  1W4X A;  2C70 A;  2R0C A;  3CPH G;  1DJQ A;  4TLZ A;  5KMS A;  4EIQ A;  3AD8 B;  3LOV A;  1NAA A;  2RGH A;  5TR3 A;  2YLX A;  1ZP0 A;  3H8I A;  3P4P A;  4U8K A;  1B4V A;  1E1M A;  1KDG A;  2FJB A;  2XFP A;  4TM0 A;  3Q9T A;  4U8I A;  3QFB A;  2VVM A;  2YG5 A;  3AEC A;  3AXB A;  3G5Q A;  4H7U A;  3GRS A;  4IVM B;  4U2T A;  4C3Y A;  2B9X A;  2H88 A;  1E1N A;  3NIX A;  3FBS A;  1TDO A;  1TDK A;  1N4W A;  3ICR A;  1E1L A;  3HYX A;  3S61 A;  4J56 A;  4O5U A;  3DK8 A;  1PBF A;  2YLT A;  3EAO A;  4Z2U A;  4Z26 A;  1DOD A;  1TYT A;  1F8W A;  3M13 A;  4BUR A;  3F8P A;  1UKV G;  3P4R A;  2XVE A;  3NT6 A;  4G6G A;  4NWZ A;  1GV4 A;  4NTC A;  3RP8 A;  1MO9 A;  1TYP A;  5BUL A;  2XLT A;  2A87 A;  3IHG A;  2JB3 A;  1DNC A;  5JCL A;  3BHK A;  4YKG A;  2VZ2 A;  2WOV A;  4FK1 A;  4FK1 C;  1FL2 A;  2YLZ A;  1JOA A;  4YSZ A;  1NEK A;  3AD7 B;  5KMP A;  1Z6L A;  1CBO A;  4U8N A;  1Q1R A;  5L46 A;  1BKW A;  4G74 A;  4H4V A;  1LTX R;  1QJD A;  4C5O A;  4C77 A;  4M52 A;  4JNQ A;  1CL0 A;  4I58 A;  3OC4 A;  1TRB A;  1VRQ B;  2GMH A;  2Q6U A;  1ZX9 A;  4H2Q A;  1PJ6 A;  1NG4 A;  3D1C A;  4K7Z A;  2EQ7 A;  2O9Z A;  5FS9 A;  3F8D A;  2CFY A;  3L8K A;  3M0O A;  3H8L A;  5FS6 A;  5M0Z A;  2OLN A;  2Q0K A;  4H2R A;  2V6O A;  4EM4 A;  3LXD A;  2BC0 A;  5U25 A;  4DNA A;  4OCG A;  3AE8 A;  3QSM A;  4H2P A;  2NPX A;  4OPI A;  4U2L A;  3AED A;  2BS2 A;  2B9W A;  5U1O A;  3UTH A;  4EMW A;  2WOW A;  3SM8 A;  4GAV A;  1NDA A;  3AEE A;  1GAL A;  1LPF A;  1RSG A;  1F8R A;  1GOS A;  3F8R A;  3AE4 A;  4EQR A;  3FMW A;  3CND A;  3KPF A;  3NTD A;  4BK1 A;  2JB2 A;  1GES A;  4TM3 A;  2YG7 A;  4UDQ A;  1FOH A;  2XFO A;  2GH5 A;  4D03 A;  2DKH A;  2GR3 A;  3UOZ A;  2C66 A;  2C67 A;  3UKP A;  4X9N A;  2YQU A;  3BNM A;  4AP3 A;  1GSN A;  4OPL A;  3SYI A;  2YLR A;  2YVJ A;  3DJG X;  2GV8 A;  3VRB A;  3ALJ A;  4C74 A;  5C3J A;  4OPT A;  1TDE A;  3FIM B;  4NNJ A;  3SZ0 A;  3LAD A;  4YT0 A;  1F3P A;  2VRL A;  2WHD A;  3LB8 A;  3T2Y A;  3DK9 A;  4Z24 A;  1X31 B;  1TDF A;  4A5L A;  4H4R A;  5BVA A;  4JY2 A;  4U2S A;  4LII A;  2FJE A;  1M6I A;  2V3B A;  2BK4 A;  3UCL A;  3QVP A;  3CGB A;  5EBK A;  1E7P A;  1K0I A;  1PN0 A;  3S5W A;  4CRT A;  2GEW A;  5BUK A;  1GRG A;  2OA1 A;  1TDN A;  2GMJ A;  3ATR A;  3K7Q X;  4A7A A;  1GND A;  1CC4 A;  4Y4L A;  2IID A;  4Y4N A;  4E0V A;  1PBD A;  1YQ3 A;  3V76 A;  2BA9 A;  2FJD A;  3QVR A;  4NTD A;  3ALL A;  2WPE A;  1CC2 A;  1Y56 A;  5CKU A;  5FMH A;  1EL8 A;  3LZW A;  1H83 A;  1LQT A;  4KPR A;  3ZDN A;  1GT8 A;  4RSL A;  1K4Q A;  3K7M X;  4FDC B;  2WEU A;  3UKF A;  1S3B A;  3GSI A;  3RNM A;  2AR8 A;  1B5Q A;  4CNK A;  3VR9 A;  4II2 A;  1CJC A;  2YLW A;  5JCM A;  3AE7 A;  3AE5 A;  1Y0P A;  3KPK A;  4A6N A;  3AEG A;  2R45 A;  2BK5 A;  2OAL A;  1IUU A;  2Q7V A;  4OPC A;  2QCU A;  2OLO A;  1GER A;  3NLC A;  2WU2 A;  4BJZ A;  1YQZ A;  2C65 A;  1EBD A;  4USR A;  3I6D A;  2C4C A;  5KRQ A;  2BCP A;  1DXL A;  2XFU A;  2A8X A;  1DOC A;  4A79 A;  3WE0 A;  4K22 A;  4B65 A;  2GR2 A;  3CGE A;  1KNP A;  2V61 A;  2RGJ A;  1AOG A;  2J3N A;  1NHQ A;  2C73 A;  2GAH B;  3EAN A;  4IA5 A;  5ER0 A;  1OJA A;  4U8O A;  1N4U A;  3NN6 X;  4B68 A;  2YG3 A;  3G5S A;  2AAQ A;  4H50 A;  3V3O A;  4EQW A;  2A89 A;  4CCR A;  5C2T A;  2QAE A;  3DGZ A;  3RED A;  2BRY A;  2H89 A;  1XDI A;  3AE3 A;  2IVE A;  3DJE A;  3SFE A;  3T14 A;  5JCN A;  3P4S A;  4B64 A;  1PDH A;  1V59 A;  2EQ8 A;  5HXI A;  3EPT A;  5GRT A;  1P2E A;  4RG3 A;  2GVC A;  1ZDL A;  3UTE A;  2R4E A;  2BAC A;  3SFD A;  4GRT A;  1XHC A;  1CHU A;  4K2X A;  3AB1 A;  3AD9 B;  2GQW A;  3GDN A;  3QSE A;  3SX6 A;  5M10 A;  1S3E A;  1BZL A;  5KVH A;  4GDE A;  3L1R A;  4ZCC A;  2WP5 A;  4GR1 A;  4AP1 A;  4II3 A;  2JK6 A;  2JB1 A;  2ZZ0 A;  4K5S A;  1O5W A;  2E1M A;  1O94 A;  5KXJ A;  2WDQ A;  4BJY A;  2BXR A;  3AE9 A;  4IV9 A;  2GB0 A;  3C96 A;  4N9X A;  4GCM A;  4JQ9 A;  3ISH A;  2XYO A;  4H4T A;  1H7X A;  2YR5 A;  2X8H A;  4J33 A;  4YWO A;  4AOX A;  3ADA B;  3IWA A;  3KD9 A;  5J60 A;  2EQ9 A;  3SY4 A;  3DH9 A;  2ZZC A;  1E1K A;  2ACZ A;  2WS3 A;  1B8S A;  3NK2 X;  2RGO A;  4USQ A;  1KFY A;  1IUV A;  4ADW A;  2V3A A;  2BXS A;  1GRB A;  4UDR A;  2WP9 A;  1PS9 A;  1D7L A;  3NYC A;  4UP3 A;  2TPR A;  2OAM A;  2Y6Q A;  3BNU A;  2YR4 A;  2FBW A;  4D04 A;  3AEA A;  1DJN A;  1K0J A;  4AT2 A;  3UKH A;  4B63 A;  2XVJ A;  5IQ1 A;  4B67 A; 
#chains in the Genus database with same CATH homology
 3URH A;  4H4U A;  1EL5 A;  4GF7 A;  3RP7 A;  4ICY A;  1H82 A;  3CNT A;  3BHF A;  3P4Q A;  2F5Z A;  2R0G A;  2GR1 A;  2PHH A;  1GRF A;  2YLS A;  1FEC A;  5KMR A;  1OJ9 A;  3GD4 A;  1CJ3 A;  4G9K A;  3SGL A;  4XWZ A;  1JEH A;  3GDP A;  3I3L A;  3VRD B;  4BK3 A;  4BK2 A;  5HY5 A;  2BRA A;  3T2Z A;  5HYM A;  1JNZ A;  2R0P A;  3KU9 A;  4NTE A;  2GF3 A;  3B6D A;  1KNR A;  1IJH A;  2R4J A;  2Z5Y A;  4OPG A;  1YY5 A;  1L9E A;  2XCG A;  1GRT A;  1PXA A;  2XFQ A;  1CJ2 A;  1H86 A;  1L9D A;  3GYI A;  3IC9 A;  3KLJ A;  3OZ2 A;  3IF9 A;  4TM1 A;  4YTN A;  3PO7 A;  4ZCD A;  3UKA A;  4CY6 A;  4YSX A;  2R9Z A;  3DK4 A;  3CNJ A;  3PVC A;  3PS9 A;  3C4A A;  2E4G A;  3UTG A;  4AOS A;  1Q1W A;  3QSS A;  3V3N A;  4CNJ A;  2YM2 A;  2C75 A;  3Q6J A;  4LA1 A;  2YG4 A;  4YTP A;  3ICT A;  5FS7 A;  1YQ4 A;  4H4W A;  2VRM A;  3H4K A;  2C3D A;  3II4 A;  1JU2 A;  1GTE A;  1QO8 A;  1ZOY A;  1LVL A;  4H4X A;  1F8S A;  2NVK X;  2QA2 A;  5KOW A;  4B66 A;  3GMB A;  2VVL A;  3O0H A;  4J36 A;  2Z5X A;  4DSG A;  4GAP A;  2V60 A;  2B76 A;  2QA1 A;  3D8X A;  3GWF A;  1ZK7 A;  4EQX A;  3VQR A;  1FCD A;  2ARD A;  3AYL A;  3GRT A;  2XLU A;  5JCI A;  5GSN A;  4G73 A;  5JCK A;  3QFA A;  4H4P A;  3CPI G;  4B69 A;  4OVI A;  3SZF A;  3P9U A;  1JRY A;  4K8D A;  1IUW A;  1BGJ A;  2TMD A;  2DKI A;  3SXI A;  1Y56 B;  3AWI A;  1EL7 A;  1VQW A;  3IHM A;  3G5R A;  3GWD A;  3CNP A;  1JRZ A;  2X3N A;  4OPU A;  4U8P A;  4C3X A;  1D4C A;  1PBE A;  4EM3 A;  4NEW A;  3HYV A;  2WOI A;  3NN0 X;  1NG3 A;  3AYI A;  1VG0 A;  3HYW A;  1PJ7 A;  3NKS A;  2VQB A;  2XLP A;  3CPJ G;  3M12 A;  1MXT A;  3ALM A;  3CGC A;  3NHO X;  4UDP A;  1GET A;  1GRE A;  2C72 A;  3AYJ A;  2WDV A;  2WQY A;  2GAG B;  1BF3 A;  4Y4M A;  1D4E A;  1D4D A;  5IQ4 A;  2WP6 A;  3UKQ A;  3CTY A;  2BK3 A;  2IVD A;  2X8G A;  1ZOV A;  2AQJ A;  4GUV A;  2B9Y A;  2BAB A;  4HA6 A;  2W0H A;  4JY3 A;  2JAE A;  2X99 A;  3UOV A;  5EB4 A;  2BYB A;  4GDP A;  5EOW A;  2WPC A;  5KVI A;  2VVL G;  1FEA A;  4J34 A;  4H4Q A;  3AE1 A;  4U8L A;  1K0L A;  2RAB A;  3T2K A;  1N4V A;  2C64 A;  1CF3 A;  2XDO A;  3CIR A;  4Z43 A;  3HZL A;  1OJD A;  4YXD A;  5HHF A;  2GRT A;  1XPQ A;  2YVG A;  3UTF A;  4EQS A;  1MOK A;  3EF6 A;  2HQM A;  4FX9 A;  4KX6 A;  3T0K A;  4DSH A;  3NG7 X;  2YWL A;  1HYU A;  4CCQ A;  3CGD A;  4H4S A;  1KSU A;  1KSS A;  2BC1 A;  1E6E A;  2ZBW A;  1PXC A;  1S2Y A;  1SEZ A;  4JNA A;  3UP4 A;  4NZH A;  5BRT A;  1XAN A;  2BS4 A;  1EL9 A;  1REO A;  3AE2 A;  4RG4 A;  3GD3 A;  2FJA A;  1PJ5 A;  2JBV A;  3NYE A;  4PAB A;  2WDR A;  1H6V A;  2X8C A;  1PBC A;  1BWC A;  1H84 A;  1NHS A;  3NGC X;  3NK1 X;  2GQF A;  3KVE A;  1H7W A;  4J57 A;  3QJ4 A;  1L0V A;  4A9W A;  4JN9 A;  2B7R A;  5CQF A;  2E5V A;  2WET A;  2B7S A;  1BGN A;  2CUL A;  4H4Z A;  1YKJ A;  2ZZB A;  3ATQ A;  3ICS A;  5DBJ A;  5KMQ A;  4LU6 A;  3KA7 A;  1D7Y A;  4YSH A;  1ELI A;  3AEB A;  4REK A;  4Z2R A;  4U8J A;  4CBQ A;  3BI4 A;  5KNL A;  3SZC A;  1NPX A;  2WBA A;  3LJP A;  4EMI A;  2APG A;  3BI5 A;  1IUS A;  4ZN0 A;  1LQU A;  3SZW A;  1JNR A;  2BCG G;  3CMM A;  3UOX A;  1H81 A;  2XFN A;  1DOB A;  1OJT A;  3K30 A;  2CDU A;  3FPZ A;  1NHP A;  3JSK A;  1M64 A;  4X9M A;  1PHH A;  4EIP A;  1COY A;  1JRX A;  1CJ4 A;  4HB9 A;  2X50 A;  1F6M A;  4IA6 A;  3DJJ A;  4G6H A;  4X4J A;  3DME A;  4XWR A;  5J7X A;  1S2Q A;  2WPF A;  4EMJ A;  2GR0 A;  3GMC A;  3RP6 A;  4J2W A;  3NYF A;  1OJC A;  1GEU A;  2VQ7 A;  2YVF A;  4YTM A;  4TM4 A;  3ITJ A;  1N1P A;  1PBB A;  3BI2 A;  4AT0 A;  1GXF A;  2WU5 A;  4H4Y A;  4YSY A;  3FG2 P;  4JDR A;  4XXG A;  1P2H A;  4J31 A;  3UKK A;  4WCT A;  3UOY A;  2XLR A;  3COX A;  4Z2T A;  2BS3 A;  2XVH A;  1LJ1 A;  2CVJ A;  5LV9 A;  1KF6 A;  1QLB A;  4Z44 A;  2PYX A;  2XVI A;  1ZY8 A;  4A99 A;  4YKF A;  4DGK A;  3NRN A;  4ECH A;  1Q9I A;  3GYJ A;  1D5T A;  3AEF A;  2YAU A;  4K5R A;  5KOX A;  1O95 A;  2Q0L A;  4MJW A;  3C4N A;  1IUX A;  2JKC A;  1VDC A;  1ZMD A;  3AE6 A;  4Z25 A;  4NEV A;  1DOE A;  2C7G A;  3DJD A;  5EB5 A;  3RHA A;  1LV0 A;  2XLS A;  5KWF A;  4BV6 A;  2EQ6 A;  1GRA A;  3LZX A;  3SQP A;  1CC6 A;  1IUT A;  3VRA A;  3UKL A;  3R9U A;  2C3C A;  2Y6R A;  3UP5 A;  1GTH A;  3DGH A;  2XVF A;  2WES A;  3NK0 X;  4CY8 A;  3NH3 X;  3ZYX A;  3T37 A;  3NTA A;  2C76 A;  1PXB A;  1ZKQ A;  3DA1 A;  3GYX A;  4OPD A;  1ONF A;  3B3R A;  3CN8 A;  4P9S A;  4TLX A;  4PAA A;  1VG9 A;  4I59 A;  5U63 A;  4B1B A;  3CNS A;  1NEN A;  3T31 A;  1RYI A;  2R46 A;  3E1T A;  3VR8 A;  1GRH A;  4IVO B;  2UZZ A;  4A65 A;  1GPE A;  4H2N A;  5FS8 A;  1FEB A;  2YG6 A;  4A6N B;  2V5Z A;  2YR6 A;  3NNE A;  3K7T A;  1E39 A;  2YM1 A;  1ZMC A;  1RP0 A;  3P1W A;  3ABV A;  1L9C A;  4U8M A;  1B37 A;  2VOU A;  4O5Q A;  2I0Z A;  3KKJ A;  1NHR A;  4APN A;  4WX1 A;  5IPY A;  1W4X A;  2C70 A;  2R0C A;  3CPH G;  1DJQ A;  4TLZ A;  5KMS A;  4EIQ A;  3AD8 B;  3LOV A;  1NAA A;  2RGH A;  5TR3 A;  2YLX A;  1ZP0 A;  3H8I A;  3P4P A;  4U8K A;  1B4V A;  1E1M A;  1KDG A;  2FJB A;  2XFP A;  4TM0 A;  3Q9T A;  4U8I A;  3QFB A;  2VVM A;  2YG5 A;  3AEC A;  3AXB A;  3G5Q A;  4H7U A;  3GRS A;  4IVM B;  4U2T A;  4C3Y A;  2B9X A;  2H88 A;  1E1N A;  3NIX A;  3FBS A;  1TDO A;  1TDK A;  1N4W A;  3ICR A;  1E1L A;  3HYX A;  3S61 A;  4J56 A;  4O5U A;  3DK8 A;  1PBF A;  2YLT A;  3EAO A;  4Z2U A;  4Z26 A;  1DOD A;  1TYT A;  1F8W A;  3M13 A;  4BUR A;  3F8P A;  1UKV G;  3P4R A;  2XVE A;  3NT6 A;  4G6G A;  4NWZ A;  1GV4 A;  4NTC A;  3RP8 A;  1MO9 A;  1TYP A;  5BUL A;  2XLT A;  2A87 A;  3IHG A;  2JB3 A;  1DNC A;  5JCL A;  3BHK A;  4YKG A;  2VZ2 A;  2WOV A;  4FK1 A;  4FK1 C;  1FL2 A;  2YLZ A;  1JOA A;  4YSZ A;  1NEK A;  3AD7 B;  5KMP A;  1Z6L A;  1CBO A;  4U8N A;  1Q1R A;  5L46 A;  1BKW A;  4G74 A;  4H4V A;  1LTX R;  1QJD A;  4C5O A;  4C77 A;  4M52 A;  4JNQ A;  1CL0 A;  4I58 A;  3OC4 A;  1TRB A;  1VRQ B;  2GMH A;  2Q6U A;  1ZX9 A;  4H2Q A;  1PJ6 A;  1NG4 A;  3D1C A;  4K7Z A;  2EQ7 A;  2O9Z A;  5FS9 A;  3F8D A;  2CFY A;  3L8K A;  3M0O A;  3H8L A;  5FS6 A;  5M0Z A;  2OLN A;  2Q0K A;  4H2R A;  2V6O A;  4EM4 A;  3LXD A;  2BC0 A;  5U25 A;  4DNA A;  4OCG A;  3AE8 A;  3QSM A;  4H2P A;  2NPX A;  4OPI A;  4U2L A;  3AED A;  2BS2 A;  2B9W A;  5U1O A;  3UTH A;  4EMW A;  2WOW A;  3SM8 A;  4GAV A;  1NDA A;  3AEE A;  1GAL A;  1LPF A;  1RSG A;  1F8R A;  1GOS A;  3F8R A;  3AE4 A;  4EQR A;  3FMW A;  3CND A;  3KPF A;  3NTD A;  4BK1 A;  2JB2 A;  1GES A;  4TM3 A;  2YG7 A;  4UDQ A;  1FOH A;  2XFO A;  2GH5 A;  4D03 A;  2DKH A;  2GR3 A;  3UOZ A;  2C66 A;  2C67 A;  3UKP A;  4X9N A;  2YQU A;  3BNM A;  4AP3 A;  1GSN A;  4OPL A;  3SYI A;  2YLR A;  2YVJ A;  3DJG X;  2GV8 A;  3VRB A;  3ALJ A;  4C74 A;  5C3J A;  4OPT A;  1TDE A;  3FIM B;  4NNJ A;  3SZ0 A;  3LAD A;  4YT0 A;  1F3P A;  2VRL A;  2WHD A;  3LB8 A;  3T2Y A;  3DK9 A;  4Z24 A;  1X31 B;  1TDF A;  4A5L A;  4H4R A;  5BVA A;  4JY2 A;  4U2S A;  4LII A;  2FJE A;  1M6I A;  2V3B A;  2BK4 A;  3UCL A;  3QVP A;  3CGB A;  5EBK A;  1E7P A;  1K0I A;  1PN0 A;  3S5W A;  4CRT A;  2GEW A;  5BUK A;  1GRG A;  2OA1 A;  1TDN A;  2GMJ A;  3ATR A;  3K7Q X;  4A7A A;  1GND A;  1CC4 A;  4Y4L A;  2IID A;  4Y4N A;  4E0V A;  1PBD A;  1YQ3 A;  3V76 A;  2BA9 A;  2FJD A;  3QVR A;  4NTD A;  3ALL A;  2WPE A;  1CC2 A;  1Y56 A;  5CKU A;  5FMH A;  1EL8 A;  3LZW A;  1H83 A;  1LQT A;  4KPR A;  3ZDN A;  1GT8 A;  4RSL A;  1K4Q A;  3K7M X;  4FDC B;  2WEU A;  3UKF A;  1S3B A;  3GSI A;  3RNM A;  2AR8 A;  1B5Q A;  4CNK A;  3VR9 A;  4II2 A;  1CJC A;  2YLW A;  5JCM A;  3AE7 A;  3AE5 A;  1Y0P A;  3KPK A;  4A6N A;  3AEG A;  2R45 A;  2BK5 A;  2OAL A;  1IUU A;  2Q7V A;  4OPC A;  2QCU A;  2OLO A;  1GER A;  3NLC A;  2WU2 A;  4BJZ A;  1YQZ A;  2C65 A;  1EBD A;  4USR A;  3I6D A;  2C4C A;  5KRQ A;  2BCP A;  1DXL A;  2XFU A;  2A8X A;  1DOC A;  4A79 A;  3WE0 A;  4K22 A;  4B65 A;  2GR2 A;  3CGE A;  1KNP A;  2V61 A;  2RGJ A;  1AOG A;  2J3N A;  1NHQ A;  2C73 A;  2GAH B;  3EAN A;  4IA5 A;  5ER0 A;  1OJA A;  4U8O A;  1N4U A;  3NN6 X;  4B68 A;  2YG3 A;  3G5S A;  2AAQ A;  4H50 A;  3V3O A;  4EQW A;  2A89 A;  4CCR A;  5C2T A;  2QAE A;  3DGZ A;  3RED A;  2BRY A;  2H89 A;  1XDI A;  3AE3 A;  2IVE A;  3DJE A;  3SFE A;  3T14 A;  5JCN A;  3P4S A;  4B64 A;  1PDH A;  1V59 A;  2EQ8 A;  5HXI A;  3EPT A;  5GRT A;  1P2E A;  4RG3 A;  2GVC A;  1ZDL A;  3UTE A;  2R4E A;  2BAC A;  3SFD A;  4GRT A;  1XHC A;  1CHU A;  4K2X A;  3AB1 A;  3AD9 B;  2GQW A;  3GDN A;  3QSE A;  3SX6 A;  5M10 A;  1S3E A;  1BZL A;  5KVH A;  4GDE A;  3L1R A;  4ZCC A;  2WP5 A;  4GR1 A;  4AP1 A;  4II3 A;  2JK6 A;  2JB1 A;  2ZZ0 A;  4K5S A;  1O5W A;  2E1M A;  1O94 A;  5KXJ A;  2WDQ A;  4BJY A;  2BXR A;  3AE9 A;  4IV9 A;  2GB0 A;  3C96 A;  4N9X A;  4GCM A;  4JQ9 A;  3ISH A;  2XYO A;  4H4T A;  1H7X A;  2YR5 A;  2X8H A;  4J33 A;  4YWO A;  4AOX A;  3ADA B;  3IWA A;  3KD9 A;  5J60 A;  2EQ9 A;  3SY4 A;  3DH9 A;  2ZZC A;  1E1K A;  2ACZ A;  2WS3 A;  1B8S A;  3NK2 X;  2RGO A;  4USQ A;  1KFY A;  1IUV A;  4ADW A;  2V3A A;  2BXS A;  1GRB A;  4UDR A;  2WP9 A;  1PS9 A;  1D7L A;  3NYC A;  4UP3 A;  2TPR A;  2OAM A;  2Y6Q A;  3BNU A;  2YR4 A;  2FBW A;  4D04 A;  3AEA A;  1DJN A;  1K0J A;  4AT2 A;  3UKH A;  4B63 A;  2XVJ A;  5IQ1 A;  4B67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...