4H2NA

Crystal structure of mhpco, y270f mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 126
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2nA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2nA01
1TRBA 3VR8A 1MXTA 2RGJA 3UOXA 4DNAA 4CBQA 2V60A 2FJDA 1ZP0A 1PN0A 2XFNA 3AE5A 2B76A 3O0HA 3ZDNA 3F8RA 2XFPA 3S5WA 1RSGA 1CC4A 1D5TA 3ICRA 5U1OA 2YAUA 2C67A 3P9UA 3GYJA 4USQA 3AD7B 4K7ZA 1GRTA 2YM1A 4AOXA 1PS9A 4A6NB 4CNJA 3DK8A 4CRTA 1D4CA 4BJYA 2TMDA 1E39A 4U8JA 1GRGA 4EIQA 1DOEA 4NEVA 3DGZA 4B66A 4U2LA 2O9ZA 1KSSA 5M10A 1IUVA 3C4NA 1B8SA 1PXBA 3IC9A 4J33A 2R46A 3AYIA 4FK1A 2XVHA 2XLPA 4UDQA 2ZZCA 1N4VA 5HYMA 3D1CA 2Q7VA 1DODA 3DMEA 4JQ9A 2R0CA 2XLSA 4U8OA 4ZCCA 4Z25A 3AECA 1E1KA 3CGBA 4B1BA 5FS9A 4B64A 4N9XA 4X9MA 3II4A 2BABA 3CIRA 2E4GA 3GMCA 2A8XA 1GEUA 1BWCA 3CGCA 3NK1X 2WESA 1D7LA 3AE2A 3KPFA 4J57A 1EL7A 2W0HA 1PJ7A 1P2HA 3OC4A 5FS6A 2BS2A 3DK4A 4C3XA 2EQ9A 2VVMA 2R9ZA 4OPTA 1GERA 1Y56A 3P4RA 3GRSA 4EMIA 2CVJA 4LA1A 2Q0LA 3UTHA 3COXA 4J36A 5C3JA 5JCKA 5BVAA 3AYLA 3SFEA 4FDCB 1H86A 3CNPA 2EQ8A 1B37A 2OA1A 1NHRA 4K22A 3DJJA 1O94A 3AEBA 4X4JA 4TM1A 1CL0A 1OJDA 2C73A 4ZCDA 2AQJA 2RABA 3NYEA 1FL2A 2WS3A 3G5QA 3HZLA 4U8PA 4BV6A 2Z5YA 5C2TA 1TDNA 1LQTA 2DKHA 4YSHA 1PHHA 2PYXA 4AT2A 1PBEA 2X8CA 2XFOA 2FBWA 2F5ZA 4BURA 4EQRA 4DSHA 1PXCA 4OPUA 2XFUA 2GR2A 3VRBA 1OJAA 1ZMCA 3AE6A 1L0VA 3IHGA 1KNPA 5FS8A 3V76A 1EBDA 2YQUA 3SFDA 2GQWA 4TLXA 3GD4A 4IVMB 2FJEA 2WU5A 3K7TA 1JRXA 3AB1A 3REDA 1NHSA 4ZN0A 3NT6A 1ZY8A 1H81A 1KDGA 3GSIA 4H4TA 3G5RA 1F3PA 3QFBA 1XDIA 4NTEA 2V3BA 4YKFA 4CY6A 4H4VA 1COYA 2BCGG 2R4JA 1PJ5A 3GD3A 4OPGA 2Y6RA 3GDPA 3QSMA 2GVCA 4JY2A 3ICTA 3Q9TA 4HA6A 4JN9A 2B9WA 4YSYA 3SGLA 1CF3A 1OJTA 2OLNA 3LXDA 3M13A 3CTYA 3DJDA 3UKPA 3URHA 2XDOA 3NK0X 3I3LA 4XWZA 5KXJA 2JAEA 5LV9A 2CFYA 4B68A 4EQXA 1JNRA 1XPQA 1DJQA 3GRTA 1MO9A 2YLWA 3NYCA 4EQSA 1Q1RA 3UTFA 4Z44A 3KU9A 2J3NA 1S2QA 3CGEA 4OPDA 3F8DA 4PABA 4A6NA 3AEDA 3CNJA 3AEFA 4A5LA 2C66A 2CDUA 2Y6QA 1QO8A 2GAHB 3P4SA 4FX9A 3SQPA 3UTGA 4C5OA 1UKVG 2AR8A 5HHFA 1NG4A 4GCMA 2V5ZA 4BK1A 5U63A 4U2TA 2WU2A 1NHPA 2R0GA 5IQ4A 3QJ4A 3BHFA 2C3CA 2GAGB 1YQ4A 5JCMA 4BJZA 1GPEA 2WOVA 4NTDA 3RP7A 2B7RA 2NPXA 3K7MX 4U8KA 2BYBA 2ACZA 3Q6JA 2WP9A 1H7XA 1PBCA 2XLRA 1H83A 3LOVA 2WOWA 1LTXR 1ZDLA 2XFQA 3F8PA 1GOSA 4AOSA 1LV0A 2JBVA 3UOYA 4AP3A 4NZHA 1NPXA 2VVLG 3BHKA 2OLOA 4EM3A 3QSEA 3UKLA 3B3RA 3C4AA 4Y4NA 3B6DA 2BS3A 2WPFA 4IA5A 4I58A 4JDRA 1K0LA 2H88A 1FEAA 4H7UA 3SM8A 2YVGA 4APNA 2C70A 4UDRA 2R0PA 1MOKA 4NTCA 1V59A 3PO7A 3QVRA 3NN6X 3UP5A 2WPCA 1EL8A 3H4KA 3L1RA 4PAAA 3DK9A 5EBKA 4KPRA 4CY8A 3P1WA 3WE0A 3ISHA 1GETA 3FIMB 1Q1WA 2E5VA 2YR6A 3DJGX 4GDEA 1PXAA 1VDCA 2IVDA 1L9DA 4GR1A 1NDAA 4Y4LA 5IQ1A 5JCLA 3UCLA 4E0VA 1L9EA 3CNTA 4IV9A 2ZZ0A 5EB4A 3BNMA 1B4VA 4AP1A 1K0JA 2OALA 2XVIA 4TM4A 3AE3A 3ITJA 3AEGA 1K0IA 1GSNA 3GWFA 4KX6A 1P2EA 3ALMA 4YXDA 5HY5A 4BK3A 4Z2TA 4GDPA 3ALJA 3NGCX 1JRZA 1E6EA 1AOGA 2V3AA 2Q6UA 2JKCA 5JCIA 2NVKX 2A89A 4Z2UA 1BGNA 3EPTA 4U8NA 1VG9A 2VQ7A 3BI5A 1H82A 2BK3A 2X8HA 3EANA 5J60A 1JOAA 3RNMA 1FEBA 3DJEA 2A87A 1QJDA 2C3DA 2X99A 2C7GA 3P4PA 1YY5A 1JU2A 2RGOA 4TM0A 3NN0X 3UKKA 2QA2A 2GR0A 3PS9A 1M6IA 4H2NA 3NRNA 4Z43A 2YWLA 2WOIA 4GRTA 4USRA 3ALLA 2WP6A 4NEWA 1IUXA 3NTDA 4IA6A 1LPFA 3UOVA 4AT0A 2RGHA 3GMBA 1FECA 2YVFA 1N1PA 4XXGA 4RG4A 2GR3A 1E1MA 1GXFA 1CHUA 4H4RA 4B63A 3ADAB 1CC2A 2WP5A 3M0OA 4WX1A 4K2XA 5FMHA 2V61A 1TDKA 2EQ6A 3VQRA 4B67A 1E1LA 1TYPA 4K5RA 4U2SA 2JB1A 2X50A 3KLJA 2C72A 2BK4A 3IHMA 3LZXA 2VVLA 5KWFA 2YG5A 2BC0A 3ZYXA 3AE8A 1DJNA 1REOA 2UZZA 1XANA 2PHHA 2GB0A 5EB5A 5EOWA 4H2PA 2FJBA 2GF3A 1TDFA 3NYFA 2XVFA 3NTAA 4C77A 1OJ9A 4EQWA 4B69A 3AEEA 2V6OA 4H4YA 4OPIA 4YSXA 4OPLA 2WDRA 1Q9IA 4RSLA 2C64A 2HQMA 2GRTA 1ZKQA 1CBOA 4YTMA 2YVJA 3NKSA 4Z24A 3FG2P 3DA1A 3UKHA 3CPHG 2XLTA 4JY3A 1VG0A 2XVJA 4A79A 3T37A 1DOBA 2YR5A 1H84A 4U8LA 3BI2A 1GTEA 2B7SA 4D03A 4H4WA 5KOXA 1ZOVA 4UP3A 3UP4A 4YKGA 2YG4A 3LB8A 1PDHA 3QFAA 5KRQA 4JNAA 2GEWA 4DSGA 1ZOYA 2VOUA 2WDVA 4X9NA 3LJPA 4YTPA 2BK5A 2CULA 3BI4A 3NH3X 3M12A 2JK6A 3NHOX 4C74A 1GREA 4YT0A 2JB2A 3LADA 3AEAA 2XVEA 1S3EA 4H2RA 1KFYA 1VRQB 3ATRA 1GRHA 1NG3A 1RYIA 4P9SA 4ICYA 1HYUA 1GALA 3EF6A 3EAOA 4WCTA 2JB3A 1GRAA 3KKJA 1YQ3A 3AD8B 1N4UA 1IUSA 1N4WA 2GMJA 1O95A 1D4DA 4H4XA 2YR4A 1PBDA 2DKIA 3KD9A 4TLZA 2XYOA 5CQFA 4YSZA 1F6MA 5TR3A 2C75A 2FJAA 1VQWA 3AE1A 3CNDA 5IPYA 2GH5A 2B9XA 1F8RA 1ZMDA 1GRFA 3VRAA 1NENA 4A9WA 3DGHA 3K30A 3CPJG 1QLBA 2EQ7A 1YKJA 1LVLA 3I6DA 3QVPA 3FBSA 5J7XA 5U25A 2IVEA 3ABVA 3G5SA 5JCNA 4CCRA 2B9YA 4U8MA 2QA1A 3AE4A 4EMJA 4K5SA 5DBJA 2TPRA 4YWOA 3AE9A 3UTEA 4I59A 1X31B 3NIXA 2E1MA 2WETA 3RHAA 2WQYA 3KA7A 2VRMA 3AYJA 1FCDA 4OPCA 2BCPA 2QCUA 5KVIA 2YLSA 2YLXA 5L46A 1Y0PA 2ZBWA 3IWAA 3R9UA 1ZK7A 4O5QA 3P4QA 2Q0KA 5M0ZA 1CC6A 2I0ZA 5GSNA 2GV8A 1RP0A 4H2QA 2YM2A 4H4ZA 1GV4A 1DOCA 5HXIA 2WPEA 4H4PA 1ELIA 3FPZA 1XHCA 4FK1C 1SEZA 3JSKA 1KSUA 1S2YA 3CPIG 4U8IA 2YG6A 3S61A 1H6VA 1BF3A 4C3YA 4ECHA 4GF7A 3VRDB 4IVOB 3BNUA 2ARDA 1DNCA 1GTHA 2YLTA 1OJCA 4B65A 5KOWA 3D8XA 2YLZA 2BXSA 4YTNA 3AWIA 4M52A 1S3BA 3VR9A 4OCGA 4O5UA 1H7WA 2VQBA 1FOHA 2Z5XA 4H4SA 2VRLA 2C76A 3H8IA 1TYTA 4J34A 2AAQA 4UDPA 1PBBA 2BA9A 1Z6LA 4OVIA 5GRTA 2WEUA 3V3NA 1W4XA 1ZX9A 2R45A 3CNSA 4JNQA 2X8GA 2H89A 2VZ2A 1PBFA 4ADWA 5CKUA 3KVEA 2BXRA 3GDNA 3PVCA 2BS4A 4K8DA 1BGJA 1K4QA 3IF9A 5ER0A 3CGDA 1LQUA 1E1NA 3E1TA 1IJHA 2XLUA 4EMWA 3UKAA 3C96A 1D7YA 1GT8A 2WHDA 3AD9B 3GYIA 3UKFA 4H4QA 1KNRA 1F8SA 1PJ6A 2X3NA 4J2WA 4A65A 1BKWA 1NAAA 1TDEA 2IIDA 4A7AA 4CNKA 4D04A 4H50A 3GWDA 3AXBA 2OAMA 2BC1A 3DH9A 1YQZA 1LJ1A 1JRYA 4HB9A 1IUWA 1NHQA 3H8LA 3NNEA 5BRTA 4EM4A 3UOZA 4J56A 3K7QX 1Y56B 2YLRA 2WBAA 3RP6A 2QAEA 4EIPA 1JEHA 4RG3A 3NLCA 5FS7A 1EL9A 3QSSA 2BACA 3V3OA 4H4UA 1JNZA 1EL5A 2GR1A 3AE7A 1M64A 2YG3A 1BZLA 4BK2A 4A99A 1CJ2A 3LZWA 1O5WA 2GQFA 4TM3A 3ICSA 3RP8A 4GUVA 1D4EA 1CJ4A 4LU6A 3ATQA 3UKQA 1DXLA 4J31A 5KVHA 4CCQA 2YG7A 1GRBA 2WDQA 1E7PA 5BULA 1ONFA 4XWRA 1B5QA 3NG7X 1F8WA 4Y4MA 4Z26A 2APGA 4REKA 1CJ3A 3FMWA 1IUTA 1L9CA 2R4EA 3NK2X 4MJWA 2ZZBA 4Z2RA 4DGKA 3OZ2A 4LIIA 1CJCA 1GESA 1TDOA 5BUKA 3L8KA 1GNDA 1IUUA 1NEKA 1KF6A 2GMHA 2XCGA 3CN8A 2C65A
chains in the Genus database with same CATH superfamily
1TRBA 3VR8A 2RGJA 1MXTA 3UOXA 4DNAA 4CBQA 2V60A 2FJDA 1ZP0A 1PN0A 2XFNA 3AE5A 3W4KA 2B76A 3O0HA 3ZDNA 3F8RA 2XFPA 3S5WA 1RSGA 1CC4A 1D5TA 3ICRA 5U1OA 2YAUA 2C67A 3P9UA 3T2YA 3GYJA 3CUKA 4USQA 3AD7B 4K7ZA 1GRTA 2YM1A 4AOXA 1PS9A 4A6NB 4CNJA 3DK8A 4CRTA 1D4CA 4BJYA 2TMDA 1E39A 4U8JA 1GRGA 4EIQA 1DOEA 4NEVA 4G73A 3DGZA 4B66A 4U2LA 2O9ZA 1KSSA 5M10A 1IUVA 3C4NA 1B8SA 1PXBA 3IC9A 3W4IA 4J33A 2R46A 3AYIA 4FK1A 2XVHA 2XLPA 4UDQA 1C0KA 2ZZCA 5HYMA 1N4VA 3D1CA 2Q7VA 1DODA 3DMEA 4JQ9A 2R0CA 2XLSA 4U8OA 4ZCCA 4Z25A 3AECA 1E1KA 3CGBA 4B1BA 5FS9A 4B64A 4N9XA 4X9MA 3II4A 2BABA 3CIRA 2E4GA 3GMCA 2A8XA 1GEUA 1BWCA 3CGCA 3NK1X 2BRYA 2WESA 1D7LA 3AE2A 3KPFA 4J57A 1EL7A 2W0HA 1PJ7A 1P2HA 3OC4A 5FS6A 2BS2A 3DK4A 4C3XA 2EQ9A 2VVMA 2R9ZA 4OPTA 1GERA 1Y56A 3P4RA 3GRSA 4EMIA 2CVJA 4LA1A 2Q0LA 3UTHA 3COXA 4J36A 5C3JA 5JCKA 5BVAA 3AYLA 3SFEA 4FDCB 1H86A 3CNPA 2EQ8A 1B37A 2OA1A 1NHRA 4K22A 3DJJA 1O94A 3AEBA 4X4JA 4TM1A 1CL0A 1OJDA 2C73A 4ZCDA 2AQJA 3NYEA 2RABA 1FL2A 2WS3A 3G5QA 3HZLA 4U8PA 4BV6A 2Z5YA 5C2TA 1TDNA 1LQTA 1EVIA 2DKHA 4YSHA 5KMQA 1PHHA 2PYXA 4YJGB 3WGTA 4AT2A 5KMRA 1PBEA 2X8CA 2XFOA 2FBWA 4QFCA 2F5ZA 4BURA 4EQRA 4DSHA 1PXCA 4OPUA 2XFUA 2GR2A 3VRBA 3KPKA 1OJAA 1ZMCA 3AE6A 1L0VA 3IHGA 1KNPA 5FS8A 3V76A 1EBDA 2YQUA 3SFDA 2GQWA 4TLXA 3GD4A 4IVMB 2FJEA 3ZNPA 2WU5A 1JRXA 3AB1A 3K7TA 1NHSA 3REDA 4ZN0A 3NT6A 1ZY8A 1H81A 4G74A 1KDGA 3GSIA 4H4TA 3G5RA 1F3PA 3QFBA 1XDIA 4NTEA 2V3BA 4YKFA 4CY6A 4H4VA 2R4JA 1COYA 2BCGG 1PJ5A 3GD3A 4OPGA 2Y6RA 3GDPA 3QSMA 3T31A 2GVCA 4JY2A 3ICTA 3Q9TA 4HA6A 4JN9A 2B9WA 4YSYA 3SGLA 1CF3A 1OJTA 2OLNA 3M13A 3LXDA 3CTYA 3DJDA 3UKPA 3URHA 2XDOA 4XWZA 3I3LA 3NK0X 5KXJA 2JAEA 5LV9A 2CFYA 3SZFA 4B68A 4EQXA 1JNRA 1XPQA 2BRAA 1DJQA 3GRTA 1MO9A 2YLWA 3NYCA 5KMPA 2E82A 1Q1RA 3G3EA 3UTFA 4EQSA 4Z44A 3KU9A 4PABA 1S2QA 2J3NA 3CGEA 3F8DA 4OPDA 4A6NA 3W4JA 3AEDA 3AEFA 3CNJA 4A5LA 2C66A 2CDUA 2Y6QA 2GAHB 1QO8A 3P4SA 4FX9A 3SQPA 3UTGA 4C5OA 1UKVG 2AR8A 5HHFA 1NG4A 4GCMA 2V5ZA 1VE9A 4BK1A 4U2TA 5U63A 2WU2A 1NHPA 3T14A 2R0GA 2C4CA 3QJ4A 3BHFA 5IQ4A 4G6HA 2GAGB 2C3CA 1YQ4A 2E48A 5JCMA 4BJZA 1GPEA 2WOVA 4NTDA 3SXIA 3RP7A 2B7RA 2NPXA 3K7MX 4U8KA 2BYBA 2ACZA 3Q6JA 2WP9A 1H7XA 1PBCA 2XLRA 1H83A 3LOVA 2DU8A 2WOWA 1LTXR 1ZDLA 2XFQA 3F8PA 1GOSA 4AOSA 1LV0A 2JBVA 3UOYA 4AP3A 4NZHA 1NPXA 3BHKA 2VVLG 2OLOA 4EM3A 3QSEA 3UKLA 3C4AA 3B3RA 4Y4NA 3B6DA 2BS3A 1KIFA 4IA5A 2WPFA 4I58A 1K0LA 2H88A 1FEAA 3SM8A 3HYXA 4H7UA 4JDRA 2YVGA 4APNA 2C70A 4UDRA 2R0PA 1MOKA 4NTCA 1V59A 3PO7A 3QVRA 3NN6X 3UP5A 4PAAA 1AN9A 1EL8A 3ZNOA 2WPCA 3DK9A 3H4KA 3L1RA 5EBKA 4KPRA 4CY8A 3P1WA 3WE0A 3ISHA 1GETA 3FIMB 1Q1WA 2E5VA 2YR6A 3DJGX 4GDEA 1PXAA 1VDCA 2IVDA 1L9DA 4GR1A 1NDAA 4Y4LA 5IQ1A 5JCLA 3UCLA 4GAPA 1L9EA 3CNTA 4IV9A 4E0VA 2ZZ0A 5EB4A 3BNMA 1B4VA 4AP1A 1K0JA 2OALA 2XVIA 4TM4A 3AE3A 3ITJA 3AEGA 1K0IA 1GSNA 3GWFA 4KX6A 1P2EA 3ALMA 4YXDA 5HY5A 4YJGA 4BK3A 4NNJA 4Z2TA 4GDPA 3ALJA 3NGCX 1JRZA 1E6EA 1AOGA 2V3AA 4GAVA 2Q6UA 2JKCA 5JCIA 2NVKX 2A89A 4Z2UA 5KNLA 1BGNA 3EPTA 4U8NA 1VG9A 2VQ7A 3BI5A 1H82A 2BK3A 2X8HA 3EANA 5J60A 1JOAA 3RNMA 3SZ0A 3DJEA 1FEBA 2A87A 1DDOA 1QJDA 2C3DA 2X99A 2C7GA 3P4PA 1YY5A 3ZNNA 2RGOA 1JU2A 1C0IA 4TM0A 3NN0X 3UKKA 2QA2A 2GR0A 3PS9A 1M6IA 4H2NA 3NRNA 4Z43A 2YWLA 2WOIA 4GRTA 3T2ZA 4USRA 3ALLA 2WP6A 4NEWA 1IUXA 3NTDA 4IA6A 1LPFA 3UOVA 4AT0A 2RGHA 3GMBA 1FECA 2YVFA 1N1PA 4XXGA 4RG4A 4YJDA 1E1MA 1GXFA 1CHUA 2GR3A 4H4RA 4B63A 3ADAB 3VQRA 3M0OA 1CC2A 2WP5A 4K2XA 4WX1A 2V61A 1TDKA 2EQ6A 5FMHA 4B67A 1E1LA 1TYPA 4K5RA 4U2SA 2JB1A 2X50A 3KLJA 2C72A 1C0LA 2BK4A 3IHMA 3LZXA 2VVLA 5KWFA 2YG5A 2BC0A 3ZYXA 3AE8A 1DJNA 2UZZA 1REOA 2PHHA 1XANA 2GB0A 3ZNQA 5EB5A 4H2PA 2FJBA 5EOWA 3SZWA 2GF3A 1TDFA 3NYFA 2XVFA 3NTAA 4C77A 1OJ9A 4EQWA 4B69A 3AEEA 2V6OA 4H4YA 4OPIA 4YSXA 4OPLA 4RSLA 1Q9IA 2WDRA 2C64A 2HQMA 2GRTA 1ZKQA 1CBOA 4YTMA 2YVJA 4YJFB 3NKSA 3FG2P 3DA1A 4Z24A 3UKHA 3CPHG 2XLTA 4JY3A 1VG0A 2XVJA 4A79A 3HYWA 1DOBA 3T37A 2YR5A 4G9KA 1H84A 4U8LA 3BI2A 1GTEA 2B7SA 4D03A 4H4WA 5KOXA 1ZOVA 4UP3A 3UP4A 4YKGA 2YG4A 3LB8A 1PDHA 3QFAA 5KRQA 4JNAA 2GEWA 4DSGA 1ZOYA 2VOUA 2WDVA 4X9NA 3LJPA 4YTPA 2BK5A 2CULA 3BI4A 3NH3X 3M12A 2JK6A 3NHOX 4C74A 1GREA 4YT0A 2JB2A 3LADA 3AEAA 2XVEA 1S3EA 4H2RA 1VRQB 1KFYA 3ATRA 1GRHA 1NG3A 1RYIA 4P9SA 4ICYA 3SX6A 1HYUA 1GALA 5KMSA 4YJHB 3EF6A 3EAOA 4WCTA 2JB3A 1GRAA 3KKJA 1YQ3A 3AD8B 1DAOA 1N4UA 1IUSA 1N4WA 2GMJA 1O95A 1D4DA 4H4XA 2YR4A 1PBDA 2DKIA 3KD9A 4TLZA 2XYOA 5CQFA 4YSZA 1F6MA 5TR3A 3T0KA 2C75A 2FJAA 1VQWA 3AE1A 3CNDA 5IPYA 2GH5A 2B9XA 1F8RA 1ZMDA 1GRFA 3VRAA 1NENA 4A9WA 3DGHA 3K30A 3CPJG 1QLBA 2EQ7A 1YKJA 1LVLA 3I6DA 3QVPA 3FBSA 5J7XA 3SZCA 5U25A 2IVEA 3ABVA 3G5SA 5JCNA 4CCRA 4II2A 2B9YA 4U8MA 2QA1A 3AE4A 4EMJA 4K5SA 5DBJA 3SYIA 2TPRA 4YWOA 3AE9A 3UTEA 4I59A 1X31B 3NIXA 2E1MA 2WETA 3RHAA 2WQYA 3KA7A 2VRMA 3AYJA 1FCDA 3HYVA 4OPCA 2BCPA 2E49A 2QCUA 5KVIA 2YLSA 5L46A 2YLXA 1Y0PA 2ZBWA 3IWAA 3R9UA 1ZK7A 4O5QA 3P4QA 2Q0KA 5M0ZA 1CC6A 2I0ZA 5GSNA 2GV8A 1RP0A 4H2QA 2YM2A 4H4ZA 1GV4A 1DOCA 5HXIA 4II3A 2WPEA 4H4PA 1ELIA 2E4AA 3FPZA 1XHCA 4FK1C 1SEZA 3JSKA 1KSUA 1S2YA 3CPIG 3GYXA 4U8IA 4G6GA 2YG6A 3S61A 1H6VA 1BF3A 4C3YA 4ECHA 4GF7A 3VRDB 4IVOB 3BNUA 2ARDA 1DNCA 1GTHA 2YLTA 1OJCA 4B65A 5KOWA 3D8XA 2YLZA 2BXSA 4YTNA 3AWIA 4M52A 1S3BA 3VR9A 4OCGA 4O5UA 1H7WA 2VQBA 1FOHA 2Z5XA 3T2KA 4H4SA 2VRLA 2C76A 3H8IA 1TYTA 4J34A 4NWZA 2AAQA 4UDPA 1PBBA 2BA9A 1Z6LA 4OVIA 5GRTA 2WEUA 3V3NA 1W4XA 1ZX9A 2R45A 3CNSA 4JNQA 2X8GA 2H89A 2VZ2A 1PBFA 4ADWA 5CKUA 4YJFA 3KVEA 2BXRA 3PVCA 3GDNA 2BS4A 4K8DA 1BGJA 3IF9A 1K4QA 5ER0A 3CGDA 1LQUA 1E1NA 3E1TA 1IJHA 2XLUA 4EMWA 3UKAA 3C96A 1D7YA 1GT8A 3AD9B 2WHDA 3GYIA 3UKFA 4H4QA 1KNRA 1F8SA 1PJ6A 2X3NA 4J2WA 4A65A 1BKWA 1NAAA 1TDEA 2IIDA 4A7AA 4CNKA 4D04A 4H50A 3GWDA 3AXBA 3SY4A 2OAMA 2BC1A 3DH9A 1YQZA 1LJ1A 1JRYA 4HB9A 1IUWA 1NHQA 3H8LA 3NNEA 5BRTA 4EM4A 4YJHA 4J56A 3UOZA 3K7QX 1Y56B 4QFDA 2YLRA 2WBAA 3RP6A 2QAEA 4EIPA 1JEHA 4RG3A 3NLCA 5FS7A 1EL9A 3QSSA 2BACA 3V3OA 4H4UA 1JNZA 1EL5A 2GR1A 3AE7A 1M64A 2YG3A 1BZLA 4BK2A 4A99A 1CJ2A 3LZWA 1O5WA 2GQFA 3RP8A 3ICSA 4TM3A 4GUVA 1D4EA 1CJ4A 3CMMA 4LU6A 3ATQA 3UKQA 1DXLA 4J31A 5KVHA 4CCQA 2YG7A 1GRBA 2WDQA 1E7PA 5BULA 1ONFA 4XWRA 1B5QA 3NG7X 1F8WA 4Y4MA 4Z26A 2APGA 4REKA 1CJ3A 3FMWA 1IUTA 1L9CA 2R4EA 3NK2X 4MJWA 2ZZBA 4Z2RA 1C0PA 4DGKA 3OZ2A 4LIIA 1CJCA 1GESA 1TDOA 5BUKA 3L8KA 1GNDA 1IUUA 1NEKA 1KF6A 2GMHA 2XCGA 3CN8A 2C65A
chains in the Genus database with same CATH topology
1TRBA 3VR8A 2RGJA 1MXTA 3UOXA 4DNAA 4CBQA 2V60A 2FJDA 1ZP0A 1PN0A 2XFNA 3AE5A 2B76A 3O0HA 3ZDNA 3F8RA 2XFPA 3S5WA 1RSGA 1CC4A 1D5TA 3ICRA 5U1OA 2YAUA 2C67A 3P9UA 3T2YA 3GYJA 4USQA 3AD7B 4K7ZA 1GRTA 2YM1A 4AOXA 1PS9A 4A6NB 4CNJA 3DK8A 4CRTA 1D4CA 4BJYA 2TMDA 1E39A 4U8JA 1GRGA 4EIQA 1DOEA 4NEVA 4G73A 3DGZA 4B66A 4U2LA 2O9ZA 1KSSA 5M10A 1IUVA 3C4NA 1B8SA 1PXBA 3IC9A 4J33A 2R46A 3AYIA 4FK1A 2XVHA 2XLPA 4UDQA 2ZZCA 5HYMA 1N4VA 3D1CA 2Q7VA 1DODA 3DMEA 4JQ9A 2R0CA 2XLSA 4U8OA 4ZCCA 4Z25A 3AECA 1E1KA 3CGBA 4B1BA 5FS9A 4B64A 4N9XA 4X9MA 3II4A 2BABA 3CIRA 2E4GA 3GMCA 2A8XA 1GEUA 1BWCA 3CGCA 3NK1X 2BRYA 2WESA 1D7LA 3AE2A 3KPFA 4J57A 1EL7A 2W0HA 1PJ7A 1P2HA 3OC4A 5FS6A 2BS2A 3DK4A 4C3XA 2EQ9A 2VVMA 2R9ZA 4OPTA 1GERA 1Y56A 3P4RA 3GRSA 4EMIA 2CVJA 4LA1A 2Q0LA 3UTHA 3COXA 4J36A 5C3JA 5JCKA 5BVAA 3AYLA 3SFEA 4FDCB 1H86A 3CNPA 2EQ8A 1B37A 2OA1A 1NHRA 4K22A 3DJJA 1O94A 3AEBA 4X4JA 4TM1A 1CL0A 1OJDA 2C73A 4ZCDA 2AQJA 2RABA 3NYEA 1FL2A 2WS3A 3G5QA 3HZLA 4U8PA 4BV6A 2Z5YA 5C2TA 1TDNA 1LQTA 2DKHA 5KMQA 4YSHA 1PHHA 2PYXA 4AT2A 5KMRA 1PBEA 2X8CA 2XFOA 2FBWA 2F5ZA 4BURA 4EQRA 4DSHA 1PXCA 4OPUA 2XFUA 2GR2A 3VRBA 3KPKA 1OJAA 1ZMCA 3AE6A 1L0VA 3IHGA 1KNPA 5FS8A 3V76A 1EBDA 2YQUA 3SFDA 2GQWA 4TLXA 3GD4A 4IVMB 2FJEA 2WU5A 3K7TA 1JRXA 3AB1A 3REDA 1NHSA 4ZN0A 3NT6A 1ZY8A 1H81A 4G74A 1KDGA 3GSIA 4H4TA 3G5RA 1F3PA 3QFBA 1XDIA 4NTEA 2V3BA 4YKFA 4CY6A 4H4VA 1COYA 2BCGG 2R4JA 1PJ5A 3GD3A 4OPGA 2Y6RA 3GDPA 3QSMA 3T31A 2GVCA 4JY2A 3ICTA 3Q9TA 4HA6A 4JN9A 2B9WA 4YSYA 3SGLA 1CF3A 1OJTA 2OLNA 3LXDA 3M13A 3CTYA 3DJDA 3UKPA 3URHA 2XDOA 3NK0X 3I3LA 4XWZA 5KXJA 2JAEA 5LV9A 2CFYA 3SZFA 4B68A 4EQXA 1JNRA 1XPQA 2BRAA 1DJQA 3GRTA 1MO9A 2YLWA 3NYCA 5KMPA 4EQSA 1Q1RA 3UTFA 4Z44A 3KU9A 2J3NA 1S2QA 3CGEA 4OPDA 3F8DA 4PABA 4A6NA 3AEDA 3CNJA 3AEFA 4A5LA 2C66A 2CDUA 2Y6QA 1QO8A 2GAHB 3P4SA 4FX9A 3SQPA 3UTGA 4C5OA 1UKVG 2AR8A 5HHFA 1NG4A 4GCMA 2V5ZA 4BK1A 5U63A 4U2TA 2WU2A 1NHPA 3T14A 2R0GA 2C4CA 3QJ4A 3BHFA 5IQ4A 4G6HA 2C3CA 2GAGB 1YQ4A 5JCMA 4BJZA 1GPEA 2WOVA 4NTDA 3SXIA 3RP7A 2B7RA 2NPXA 3K7MX 4U8KA 2BYBA 2ACZA 3Q6JA 2WP9A 1H7XA 1PBCA 2XLRA 1H83A 3LOVA 2WOWA 1LTXR 1ZDLA 2XFQA 3F8PA 1GOSA 4AOSA 1LV0A 2JBVA 3UOYA 4AP3A 4NZHA 1NPXA 2VVLG 3BHKA 2OLOA 4EM3A 3QSEA 3UKLA 3C4AA 3B3RA 4Y4NA 3B6DA 2BS3A 2WPFA 4IA5A 4I58A 4JDRA 1K0LA 2H88A 1FEAA 3HYXA 4H7UA 3SM8A 2YVGA 4APNA 2C70A 4UDRA 2R0PA 1MOKA 4NTCA 1V59A 3PO7A 3QVRA 3NN6X 3UP5A 2WPCA 1EL8A 3H4KA 3L1RA 4PAAA 3DK9A 5EBKA 4KPRA 4CY8A 3P1WA 3WE0A 3ISHA 1GETA 3FIMB 1Q1WA 2E5VA 2YR6A 3DJGX 4GDEA 1PXAA 1VDCA 2IVDA 1L9DA 4GR1A 1NDAA 4Y4LA 5IQ1A 5JCLA 3UCLA 4GAPA 1L9EA 3CNTA 4IV9A 4E0VA 2ZZ0A 5EB4A 3BNMA 1B4VA 4AP1A 1K0JA 2OALA 2XVIA 4TM4A 3AE3A 3ITJA 3AEGA 1K0IA 1GSNA 3GWFA 4KX6A 1P2EA 3ALMA 4YXDA 5HY5A 4BK3A 4NNJA 4Z2TA 4GDPA 3ALJA 3NGCX 1JRZA 1E6EA 1AOGA 2V3AA 4GAVA 2Q6UA 2JKCA 5JCIA 2NVKX 2A89A 4Z2UA 5KNLA 1BGNA 3EPTA 4U8NA 1VG9A 2VQ7A 3BI5A 1H82A 2BK3A 2X8HA 3EANA 5J60A 1JOAA 3RNMA 3SZ0A 1FEBA 3DJEA 2A87A 1QJDA 2C3DA 2X99A 2C7GA 3P4PA 1YY5A 1JU2A 2RGOA 4TM0A 3NN0X 3UKKA 2QA2A 2GR0A 3PS9A 1M6IA 4H2NA 3NRNA 4Z43A 2YWLA 2WOIA 4GRTA 3T2ZA 4USRA 3ALLA 2WP6A 4NEWA 1IUXA 3NTDA 4IA6A 1LPFA 3UOVA 4AT0A 2RGHA 3GMBA 1FECA 2YVFA 1N1PA 4XXGA 4RG4A 2GR3A 1E1MA 1GXFA 1CHUA 4H4RA 4B63A 3ADAB 1CC2A 2WP5A 3M0OA 4WX1A 4K2XA 5FMHA 2V61A 1TDKA 2EQ6A 3VQRA 4B67A 1E1LA 1TYPA 4K5RA 4U2SA 2JB1A 2X50A 3KLJA 2C72A 2BK4A 3IHMA 3LZXA 2VVLA 5KWFA 2YG5A 2BC0A 3ZYXA 3AE8A 1DJNA 1REOA 2UZZA 1XANA 2PHHA 2GB0A 5EB5A 5EOWA 4H2PA 2FJBA 3SZWA 2GF3A 1TDFA 3NYFA 2XVFA 3NTAA 4C77A 1OJ9A 4EQWA 4B69A 3AEEA 2V6OA 4H4YA 4OPIA 4YSXA 4OPLA 2WDRA 1Q9IA 4RSLA 2C64A 2HQMA 2GRTA 1ZKQA 1CBOA 4YTMA 2YVJA 3NKSA 4Z24A 3FG2P 3DA1A 3UKHA 3CPHG 2XLTA 4JY3A 1VG0A 2XVJA 4A79A 3HYWA 1DOBA 3T37A 2YR5A 4G9KA 1H84A 4U8LA 3BI2A 1GTEA 2B7SA 4D03A 4H4WA 5KOXA 1ZOVA 4UP3A 3UP4A 4YKGA 2YG4A 3LB8A 1PDHA 3QFAA 5KRQA 4JNAA 2GEWA 4DSGA 1ZOYA 2VOUA 2WDVA 4X9NA 3LJPA 4YTPA 2BK5A 2CULA 3BI4A 3NH3X 3M12A 2JK6A 3NHOX 4C74A 1GREA 4YT0A 2JB2A 3LADA 3AEAA 2XVEA 1S3EA 4H2RA 1KFYA 1VRQB 3ATRA 1GRHA 1NG3A 1RYIA 4P9SA 4ICYA 3SX6A 1HYUA 1GALA 5KMSA 3EF6A 3EAOA 4WCTA 2JB3A 1GRAA 3KKJA 1YQ3A 3AD8B 1N4UA 1IUSA 1N4WA 2GMJA 1O95A 1D4DA 4H4XA 2YR4A 1PBDA 2DKIA 3KD9A 4TLZA 2XYOA 5CQFA 4YSZA 1F6MA 5TR3A 3T0KA 2C75A 2FJAA 1VQWA 3AE1A 3CNDA 5IPYA 2GH5A 2B9XA 1F8RA 1ZMDA 1GRFA 3VRAA 1NENA 4A9WA 3DGHA 3K30A 3CPJG 1QLBA 2EQ7A 1YKJA 1LVLA 3I6DA 3QVPA 3FBSA 5J7XA 3SZCA 5U25A 2IVEA 3ABVA 3G5SA 5JCNA 4CCRA 4II2A 2B9YA 4U8MA 2QA1A 3AE4A 4EMJA 4K5SA 5DBJA 3SYIA 2TPRA 4YWOA 3AE9A 3UTEA 4I59A 1X31B 3NIXA 2E1MA 2WETA 3RHAA 2WQYA 3KA7A 2VRMA 3AYJA 1FCDA 3HYVA 4OPCA 2BCPA 2QCUA 5KVIA 2YLSA 2YLXA 5L46A 1Y0PA 2ZBWA 3IWAA 3R9UA 1ZK7A 4O5QA 3P4QA 2Q0KA 5M0ZA 1CC6A 2I0ZA 5GSNA 2GV8A 1RP0A 4H2QA 2YM2A 4H4ZA 1GV4A 1DOCA 5HXIA 4II3A 2WPEA 4H4PA 1ELIA 3FPZA 1XHCA 4FK1C 1SEZA 3JSKA 1KSUA 1S2YA 3CPIG 3GYXA 4U8IA 4G6GA 2YG6A 3S61A 1H6VA 1BF3A 4C3YA 4ECHA 4GF7A 3VRDB 4IVOB 3BNUA 2ARDA 1DNCA 1GTHA 2YLTA 1OJCA 4B65A 5KOWA 3D8XA 2YLZA 2BXSA 4YTNA 3AWIA 4M52A 1S3BA 3VR9A 4OCGA 4O5UA 1H7WA 2VQBA 1FOHA 2Z5XA 3T2KA 4H4SA 2VRLA 2C76A 3H8IA 1TYTA 4J34A 4NWZA 2AAQA 4UDPA 1PBBA 2BA9A 1Z6LA 4OVIA 5GRTA 2WEUA 3V3NA 1W4XA 1ZX9A 2R45A 3CNSA 4JNQA 2X8GA 2H89A 2VZ2A 1PBFA 4ADWA 5CKUA 3KVEA 2BXRA 3GDNA 3PVCA 2BS4A 4K8DA 1BGJA 1K4QA 3IF9A 5ER0A 3CGDA 1LQUA 1E1NA 3E1TA 1IJHA 2XLUA 4EMWA 3UKAA 3C96A 1D7YA 1GT8A 2WHDA 3AD9B 3GYIA 3UKFA 4H4QA 1KNRA 1F8SA 1PJ6A 2X3NA 4J2WA 4A65A 1BKWA 1NAAA 1TDEA 2IIDA 4A7AA 4CNKA 4D04A 4H50A 3GWDA 3AXBA 3SY4A 2OAMA 2BC1A 3DH9A 1YQZA 1LJ1A 1JRYA 4HB9A 1IUWA 1NHQA 3H8LA 3NNEA 5BRTA 4EM4A 3UOZA 4J56A 3K7QX 1Y56B 2YLRA 2WBAA 3RP6A 2QAEA 4EIPA 1JEHA 4RG3A 3NLCA 5FS7A 1EL9A 3QSSA 2BACA 3V3OA 4H4UA 1JNZA 1EL5A 2GR1A 3AE7A 1M64A 2YG3A 1BZLA 4BK2A 4A99A 1CJ2A 3LZWA 1O5WA 2GQFA 3RP8A 3ICSA 4TM3A 4GUVA 1D4EA 1CJ4A 3CMMA 4LU6A 3ATQA 3UKQA 1DXLA 4J31A 5KVHA 4CCQA 2YG7A 1GRBA 2WDQA 1E7PA 5BULA 1ONFA 4XWRA 1B5QA 3NG7X 1F8WA 4Y4MA 4Z26A 2APGA 4REKA 1CJ3A 3FMWA 1IUTA 1L9CA 2R4EA 3NK2X 4MJWA 2ZZBA 4Z2RA 4DGKA 3OZ2A 4LIIA 1CJCA 1GESA 1TDOA 5BUKA 3L8KA 1GNDA 1IUUA 1NEKA 1KF6A 2GMHA 2XCGA 3CN8A 2C65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TRB A;  3VR8 A;  1MXT A;  2RGJ A;  3UOX A;  4DNA A;  4CBQ A;  2V60 A;  2FJD A;  1ZP0 A;  1PN0 A;  2XFN A;  3AE5 A;  2B76 A;  3O0H A;  3ZDN A;  3F8R A;  2XFP A;  3S5W A;  1RSG A;  1CC4 A;  1D5T A;  3ICR A;  5U1O A;  2YAU A;  2C67 A;  3P9U A;  3GYJ A;  4USQ A;  3AD7 B;  4K7Z A;  1GRT A;  2YM1 A;  4AOX A;  1PS9 A;  4A6N B;  4CNJ A;  3DK8 A;  4CRT A;  1D4C A;  4BJY A;  2TMD A;  1E39 A;  4U8J A;  1GRG A;  4EIQ A;  1DOE A;  4NEV A;  3DGZ A;  4B66 A;  4U2L A;  2O9Z A;  1KSS A;  5M10 A;  1IUV A;  3C4N A;  1B8S A;  1PXB A;  3IC9 A;  4J33 A;  2R46 A;  3AYI A;  4FK1 A;  2XVH A;  2XLP A;  4UDQ A;  2ZZC A;  1N4V A;  5HYM A;  3D1C A;  2Q7V A;  1DOD A;  3DME A;  4JQ9 A;  2R0C A;  2XLS A;  4U8O A;  4ZCC A;  4Z25 A;  3AEC A;  1E1K A;  3CGB A;  4B1B A;  5FS9 A;  4B64 A;  4N9X A;  4X9M A;  3II4 A;  2BAB A;  3CIR A;  2E4G A;  3GMC A;  2A8X A;  1GEU A;  1BWC A;  3CGC A;  3NK1 X;  2WES A;  1D7L A;  3AE2 A;  3KPF A;  4J57 A;  1EL7 A;  2W0H A;  1PJ7 A;  1P2H A;  3OC4 A;  5FS6 A;  2BS2 A;  3DK4 A;  4C3X A;  2EQ9 A;  2VVM A;  2R9Z A;  4OPT A;  1GER A;  1Y56 A;  3P4R A;  3GRS A;  4EMI A;  2CVJ A;  4LA1 A;  2Q0L A;  3UTH A;  3COX A;  4J36 A;  5C3J A;  5JCK A;  5BVA A;  3AYL A;  3SFE A;  4FDC B;  1H86 A;  3CNP A;  2EQ8 A;  1B37 A;  2OA1 A;  1NHR A;  4K22 A;  3DJJ A;  1O94 A;  3AEB A;  4X4J A;  4TM1 A;  1CL0 A;  1OJD A;  2C73 A;  4ZCD A;  2AQJ A;  2RAB A;  3NYE A;  1FL2 A;  2WS3 A;  3G5Q A;  3HZL A;  4U8P A;  4BV6 A;  2Z5Y A;  5C2T A;  1TDN A;  1LQT A;  2DKH A;  4YSH A;  1PHH A;  2PYX A;  4AT2 A;  1PBE A;  2X8C A;  2XFO A;  2FBW A;  2F5Z A;  4BUR A;  4EQR A;  4DSH A;  1PXC A;  4OPU A;  2XFU A;  2GR2 A;  3VRB A;  1OJA A;  1ZMC A;  3AE6 A;  1L0V A;  3IHG A;  1KNP A;  5FS8 A;  3V76 A;  1EBD A;  2YQU A;  3SFD A;  2GQW A;  4TLX A;  3GD4 A;  4IVM B;  2FJE A;  2WU5 A;  3K7T A;  1JRX A;  3AB1 A;  3RED A;  1NHS A;  4ZN0 A;  3NT6 A;  1ZY8 A;  1H81 A;  1KDG A;  3GSI A;  4H4T A;  3G5R A;  1F3P A;  3QFB A;  1XDI A;  4NTE A;  2V3B A;  4YKF A;  4CY6 A;  4H4V A;  1COY A;  2BCG G;  2R4J A;  1PJ5 A;  3GD3 A;  4OPG A;  2Y6R A;  3GDP A;  3QSM A;  2GVC A;  4JY2 A;  3ICT A;  3Q9T A;  4HA6 A;  4JN9 A;  2B9W A;  4YSY A;  3SGL A;  1CF3 A;  1OJT A;  2OLN A;  3LXD A;  3M13 A;  3CTY A;  3DJD A;  3UKP A;  3URH A;  2XDO A;  3NK0 X;  3I3L A;  4XWZ A;  5KXJ A;  2JAE A;  5LV9 A;  2CFY A;  4B68 A;  4EQX A;  1JNR A;  1XPQ A;  1DJQ A;  3GRT A;  1MO9 A;  2YLW A;  3NYC A;  4EQS A;  1Q1R A;  3UTF A;  4Z44 A;  3KU9 A;  2J3N A;  1S2Q A;  3CGE A;  4OPD A;  3F8D A;  4PAB A;  4A6N A;  3AED A;  3CNJ A;  3AEF A;  4A5L A;  2C66 A;  2CDU A;  2Y6Q A;  1QO8 A;  2GAH B;  3P4S A;  4FX9 A;  3SQP A;  3UTG A;  4C5O A;  1UKV G;  2AR8 A;  5HHF A;  1NG4 A;  4GCM A;  2V5Z A;  4BK1 A;  5U63 A;  4U2T A;  2WU2 A;  1NHP A;  2R0G A;  5IQ4 A;  3QJ4 A;  3BHF A;  2C3C A;  2GAG B;  1YQ4 A;  5JCM A;  4BJZ A;  1GPE A;  2WOV A;  4NTD A;  3RP7 A;  2B7R A;  2NPX A;  3K7M X;  4U8K A;  2BYB A;  2ACZ A;  3Q6J A;  2WP9 A;  1H7X A;  1PBC A;  2XLR A;  1H83 A;  3LOV A;  2WOW A;  1LTX R;  1ZDL A;  2XFQ A;  3F8P A;  1GOS A;  4AOS A;  1LV0 A;  2JBV A;  3UOY A;  4AP3 A;  4NZH A;  1NPX A;  2VVL G;  3BHK A;  2OLO A;  4EM3 A;  3QSE A;  3UKL A;  3B3R A;  3C4A A;  4Y4N A;  3B6D A;  2BS3 A;  2WPF A;  4IA5 A;  4I58 A;  4JDR A;  1K0L A;  2H88 A;  1FEA A;  4H7U A;  3SM8 A;  2YVG A;  4APN A;  2C70 A;  4UDR A;  2R0P A;  1MOK A;  4NTC A;  1V59 A;  3PO7 A;  3QVR A;  3NN6 X;  3UP5 A;  2WPC A;  1EL8 A;  3H4K A;  3L1R A;  4PAA A;  3DK9 A;  5EBK A;  4KPR A;  4CY8 A;  3P1W A;  3WE0 A;  3ISH A;  1GET A;  3FIM B;  1Q1W A;  2E5V A;  2YR6 A;  3DJG X;  4GDE A;  1PXA A;  1VDC A;  2IVD A;  1L9D A;  4GR1 A;  1NDA A;  4Y4L A;  5IQ1 A;  5JCL A;  3UCL A;  4E0V A;  1L9E A;  3CNT A;  4IV9 A;  2ZZ0 A;  5EB4 A;  3BNM A;  1B4V A;  4AP1 A;  1K0J A;  2OAL A;  2XVI A;  4TM4 A;  3AE3 A;  3ITJ A;  3AEG A;  1K0I A;  1GSN A;  3GWF A;  4KX6 A;  1P2E A;  3ALM A;  4YXD A;  5HY5 A;  4BK3 A;  4Z2T A;  4GDP A;  3ALJ A;  3NGC X;  1JRZ A;  1E6E A;  1AOG A;  2V3A A;  2Q6U A;  2JKC A;  5JCI A;  2NVK X;  2A89 A;  4Z2U A;  1BGN A;  3EPT A;  4U8N A;  1VG9 A;  2VQ7 A;  3BI5 A;  1H82 A;  2BK3 A;  2X8H A;  3EAN A;  5J60 A;  1JOA A;  3RNM A;  1FEB A;  3DJE A;  2A87 A;  1QJD A;  2C3D A;  2X99 A;  2C7G A;  3P4P A;  1YY5 A;  1JU2 A;  2RGO A;  4TM0 A;  3NN0 X;  3UKK A;  2QA2 A;  2GR0 A;  3PS9 A;  1M6I A;  4H2N A;  3NRN A;  4Z43 A;  2YWL A;  2WOI A;  4GRT A;  4USR A;  3ALL A;  2WP6 A;  4NEW A;  1IUX A;  3NTD A;  4IA6 A;  1LPF A;  3UOV A;  4AT0 A;  2RGH A;  3GMB A;  1FEC A;  2YVF A;  1N1P A;  4XXG A;  4RG4 A;  2GR3 A;  1E1M A;  1GXF A;  1CHU A;  4H4R A;  4B63 A;  3ADA B;  1CC2 A;  2WP5 A;  3M0O A;  4WX1 A;  4K2X A;  5FMH A;  2V61 A;  1TDK A;  2EQ6 A;  3VQR A;  4B67 A;  1E1L A;  1TYP A;  4K5R A;  4U2S A;  2JB1 A;  2X50 A;  3KLJ A;  2C72 A;  2BK4 A;  3IHM A;  3LZX A;  2VVL A;  5KWF A;  2YG5 A;  2BC0 A;  3ZYX A;  3AE8 A;  1DJN A;  1REO A;  2UZZ A;  1XAN A;  2PHH A;  2GB0 A;  5EB5 A;  5EOW A;  4H2P A;  2FJB A;  2GF3 A;  1TDF A;  3NYF A;  2XVF A;  3NTA A;  4C77 A;  1OJ9 A;  4EQW A;  4B69 A;  3AEE A;  2V6O A;  4H4Y A;  4OPI A;  4YSX A;  4OPL A;  2WDR A;  1Q9I A;  4RSL A;  2C64 A;  2HQM A;  2GRT A;  1ZKQ A;  1CBO A;  4YTM A;  2YVJ A;  3NKS A;  4Z24 A;  3FG2 P;  3DA1 A;  3UKH A;  3CPH G;  2XLT A;  4JY3 A;  1VG0 A;  2XVJ A;  4A79 A;  3T37 A;  1DOB A;  2YR5 A;  1H84 A;  4U8L A;  3BI2 A;  1GTE A;  2B7S A;  4D03 A;  4H4W A;  5KOX A;  1ZOV A;  4UP3 A;  3UP4 A;  4YKG A;  2YG4 A;  3LB8 A;  1PDH A;  3QFA A;  5KRQ A;  4JNA A;  2GEW A;  4DSG A;  1ZOY A;  2VOU A;  2WDV A;  4X9N A;  3LJP A;  4YTP A;  2BK5 A;  2CUL A;  3BI4 A;  3NH3 X;  3M12 A;  2JK6 A;  3NHO X;  4C74 A;  1GRE A;  4YT0 A;  2JB2 A;  3LAD A;  3AEA A;  2XVE A;  1S3E A;  4H2R A;  1KFY A;  1VRQ B;  3ATR A;  1GRH A;  1NG3 A;  1RYI A;  4P9S A;  4ICY A;  1HYU A;  1GAL A;  3EF6 A;  3EAO A;  4WCT A;  2JB3 A;  1GRA A;  3KKJ A;  1YQ3 A;  3AD8 B;  1N4U A;  1IUS A;  1N4W A;  2GMJ A;  1O95 A;  1D4D A;  4H4X A;  2YR4 A;  1PBD A;  2DKI A;  3KD9 A;  4TLZ A;  2XYO A;  5CQF A;  4YSZ A;  1F6M A;  5TR3 A;  2C75 A;  2FJA A;  1VQW A;  3AE1 A;  3CND A;  5IPY A;  2GH5 A;  2B9X A;  1F8R A;  1ZMD A;  1GRF A;  3VRA A;  1NEN A;  4A9W A;  3DGH A;  3K30 A;  3CPJ G;  1QLB A;  2EQ7 A;  1YKJ A;  1LVL A;  3I6D A;  3QVP A;  3FBS A;  5J7X A;  5U25 A;  2IVE A;  3ABV A;  3G5S A;  5JCN A;  4CCR A;  2B9Y A;  4U8M A;  2QA1 A;  3AE4 A;  4EMJ A;  4K5S A;  5DBJ A;  2TPR A;  4YWO A;  3AE9 A;  3UTE A;  4I59 A;  1X31 B;  3NIX A;  2E1M A;  2WET A;  3RHA A;  2WQY A;  3KA7 A;  2VRM A;  3AYJ A;  1FCD A;  4OPC A;  2BCP A;  2QCU A;  5KVI A;  2YLS A;  2YLX A;  5L46 A;  1Y0P A;  2ZBW A;  3IWA A;  3R9U A;  1ZK7 A;  4O5Q A;  3P4Q A;  2Q0K A;  5M0Z A;  1CC6 A;  2I0Z A;  5GSN A;  2GV8 A;  1RP0 A;  4H2Q A;  2YM2 A;  4H4Z A;  1GV4 A;  1DOC A;  5HXI A;  2WPE A;  4H4P A;  1ELI A;  3FPZ A;  1XHC A;  4FK1 C;  1SEZ A;  3JSK A;  1KSU A;  1S2Y A;  3CPI G;  4U8I A;  2YG6 A;  3S61 A;  1H6V A;  1BF3 A;  4C3Y A;  4ECH A;  4GF7 A;  3VRD B;  4IVO B;  3BNU A;  2ARD A;  1DNC A;  1GTH A;  2YLT A;  1OJC A;  4B65 A;  5KOW A;  3D8X A;  2YLZ A;  2BXS A;  4YTN A;  3AWI A;  4M52 A;  1S3B A;  3VR9 A;  4OCG A;  4O5U A;  1H7W A;  2VQB A;  1FOH A;  2Z5X A;  4H4S A;  2VRL A;  2C76 A;  3H8I A;  1TYT A;  4J34 A;  2AAQ A;  4UDP A;  1PBB A;  2BA9 A;  1Z6L A;  4OVI A;  5GRT A;  2WEU A;  3V3N A;  1W4X A;  1ZX9 A;  2R45 A;  3CNS A;  4JNQ A;  2X8G A;  2H89 A;  2VZ2 A;  1PBF A;  4ADW A;  5CKU A;  3KVE A;  2BXR A;  3GDN A;  3PVC A;  2BS4 A;  4K8D A;  1BGJ A;  1K4Q A;  3IF9 A;  5ER0 A;  3CGD A;  1LQU A;  1E1N A;  3E1T A;  1IJH A;  2XLU A;  4EMW A;  3UKA A;  3C96 A;  1D7Y A;  1GT8 A;  2WHD A;  3AD9 B;  3GYI A;  3UKF A;  4H4Q A;  1KNR A;  1F8S A;  1PJ6 A;  2X3N A;  4J2W A;  4A65 A;  1BKW A;  1NAA A;  1TDE A;  2IID A;  4A7A A;  4CNK A;  4D04 A;  4H50 A;  3GWD A;  3AXB A;  2OAM A;  2BC1 A;  3DH9 A;  1YQZ A;  1LJ1 A;  1JRY A;  4HB9 A;  1IUW A;  1NHQ A;  3H8L A;  3NNE A;  5BRT A;  4EM4 A;  3UOZ A;  4J56 A;  3K7Q X;  1Y56 B;  2YLR A;  2WBA A;  3RP6 A;  2QAE A;  4EIP A;  1JEH A;  4RG3 A;  3NLC A;  5FS7 A;  1EL9 A;  3QSS A;  2BAC A;  3V3O A;  4H4U A;  1JNZ A;  1EL5 A;  2GR1 A;  3AE7 A;  1M64 A;  2YG3 A;  1BZL A;  4BK2 A;  4A99 A;  1CJ2 A;  3LZW A;  1O5W A;  2GQF A;  4TM3 A;  3ICS A;  3RP8 A;  4GUV A;  1D4E A;  1CJ4 A;  4LU6 A;  3ATQ A;  3UKQ A;  1DXL A;  4J31 A;  5KVH A;  4CCQ A;  2YG7 A;  1GRB A;  2WDQ A;  1E7P A;  5BUL A;  1ONF A;  4XWR A;  1B5Q A;  3NG7 X;  1F8W A;  4Y4M A;  4Z26 A;  2APG A;  4REK A;  1CJ3 A;  3FMW A;  1IUT A;  1L9C A;  2R4E A;  3NK2 X;  4MJW A;  2ZZB A;  4Z2R A;  4DGK A;  3OZ2 A;  4LII A;  1CJC A;  1GES A;  1TDO A;  5BUK A;  3L8K A;  1GND A;  1IUU A;  1NEK A;  1KF6 A;  2GMH A;  2XCG A;  3CN8 A;  2C65 A; 
#chains in the Genus database with same CATH topology
 1TRB A;  3VR8 A;  2RGJ A;  1MXT A;  3UOX A;  4DNA A;  4CBQ A;  2V60 A;  2FJD A;  1ZP0 A;  1PN0 A;  2XFN A;  3AE5 A;  3W4K A;  2B76 A;  3O0H A;  3ZDN A;  3F8R A;  2XFP A;  3S5W A;  1RSG A;  1CC4 A;  1D5T A;  3ICR A;  5U1O A;  2YAU A;  2C67 A;  3P9U A;  3T2Y A;  3GYJ A;  3CUK A;  4USQ A;  3AD7 B;  4K7Z A;  1GRT A;  2YM1 A;  4AOX A;  1PS9 A;  4A6N B;  4CNJ A;  3DK8 A;  4CRT A;  1D4C A;  4BJY A;  2TMD A;  1E39 A;  4U8J A;  1GRG A;  4EIQ A;  1DOE A;  4NEV A;  4G73 A;  3DGZ A;  4B66 A;  4U2L A;  2O9Z A;  1KSS A;  5M10 A;  1IUV A;  3C4N A;  1B8S A;  1PXB A;  3IC9 A;  3W4I A;  4J33 A;  2R46 A;  3AYI A;  4FK1 A;  2XVH A;  2XLP A;  4UDQ A;  1C0K A;  2ZZC A;  5HYM A;  1N4V A;  3D1C A;  2Q7V A;  1DOD A;  3DME A;  4JQ9 A;  2R0C A;  2XLS A;  4U8O A;  4ZCC A;  4Z25 A;  3AEC A;  1E1K A;  3CGB A;  4B1B A;  5FS9 A;  4B64 A;  4N9X A;  4X9M A;  3II4 A;  2BAB A;  3CIR A;  2E4G A;  3GMC A;  2A8X A;  1GEU A;  1BWC A;  3CGC A;  3NK1 X;  2BRY A;  2WES A;  1D7L A;  3AE2 A;  3KPF A;  4J57 A;  1EL7 A;  2W0H A;  1PJ7 A;  1P2H A;  3OC4 A;  5FS6 A;  2BS2 A;  3DK4 A;  4C3X A;  2EQ9 A;  2VVM A;  2R9Z A;  4OPT A;  1GER A;  1Y56 A;  3P4R A;  3GRS A;  4EMI A;  2CVJ A;  4LA1 A;  2Q0L A;  3UTH A;  3COX A;  4J36 A;  5C3J A;  5JCK A;  5BVA A;  3AYL A;  3SFE A;  4FDC B;  1H86 A;  3CNP A;  2EQ8 A;  1B37 A;  2OA1 A;  1NHR A;  4K22 A;  3DJJ A;  1O94 A;  3AEB A;  4X4J A;  4TM1 A;  1CL0 A;  1OJD A;  2C73 A;  4ZCD A;  2AQJ A;  3NYE A;  2RAB A;  1FL2 A;  2WS3 A;  3G5Q A;  3HZL A;  4U8P A;  4BV6 A;  2Z5Y A;  5C2T A;  1TDN A;  1LQT A;  1EVI A;  2DKH A;  4YSH A;  5KMQ A;  1PHH A;  2PYX A;  4YJG B;  3WGT A;  4AT2 A;  5KMR A;  1PBE A;  2X8C A;  2XFO A;  2FBW A;  4QFC A;  2F5Z A;  4BUR A;  4EQR A;  4DSH A;  1PXC A;  4OPU A;  2XFU A;  2GR2 A;  3VRB A;  3KPK A;  1OJA A;  1ZMC A;  3AE6 A;  1L0V A;  3IHG A;  1KNP A;  5FS8 A;  3V76 A;  1EBD A;  2YQU A;  3SFD A;  2GQW A;  4TLX A;  3GD4 A;  4IVM B;  2FJE A;  3ZNP A;  2WU5 A;  1JRX A;  3AB1 A;  3K7T A;  1NHS A;  3RED A;  4ZN0 A;  3NT6 A;  1ZY8 A;  1H81 A;  4G74 A;  1KDG A;  3GSI A;  4H4T A;  3G5R A;  1F3P A;  3QFB A;  1XDI A;  4NTE A;  2V3B A;  4YKF A;  4CY6 A;  4H4V A;  2R4J A;  1COY A;  2BCG G;  1PJ5 A;  3GD3 A;  4OPG A;  2Y6R A;  3GDP A;  3QSM A;  3T31 A;  2GVC A;  4JY2 A;  3ICT A;  3Q9T A;  4HA6 A;  4JN9 A;  2B9W A;  4YSY A;  3SGL A;  1CF3 A;  1OJT A;  2OLN A;  3M13 A;  3LXD A;  3CTY A;  3DJD A;  3UKP A;  3URH A;  2XDO A;  4XWZ A;  3I3L A;  3NK0 X;  5KXJ A;  2JAE A;  5LV9 A;  2CFY A;  3SZF A;  4B68 A;  4EQX A;  1JNR A;  1XPQ A;  2BRA A;  1DJQ A;  3GRT A;  1MO9 A;  2YLW A;  3NYC A;  5KMP A;  2E82 A;  1Q1R A;  3G3E A;  3UTF A;  4EQS A;  4Z44 A;  3KU9 A;  4PAB A;  1S2Q A;  2J3N A;  3CGE A;  3F8D A;  4OPD A;  4A6N A;  3W4J A;  3AED A;  3AEF A;  3CNJ A;  4A5L A;  2C66 A;  2CDU A;  2Y6Q A;  2GAH B;  1QO8 A;  3P4S A;  4FX9 A;  3SQP A;  3UTG A;  4C5O A;  1UKV G;  2AR8 A;  5HHF A;  1NG4 A;  4GCM A;  2V5Z A;  1VE9 A;  4BK1 A;  4U2T A;  5U63 A;  2WU2 A;  1NHP A;  3T14 A;  2R0G A;  2C4C A;  3QJ4 A;  3BHF A;  5IQ4 A;  4G6H A;  2GAG B;  2C3C A;  1YQ4 A;  2E48 A;  5JCM A;  4BJZ A;  1GPE A;  2WOV A;  4NTD A;  3SXI A;  3RP7 A;  2B7R A;  2NPX A;  3K7M X;  4U8K A;  2BYB A;  2ACZ A;  3Q6J A;  2WP9 A;  1H7X A;  1PBC A;  2XLR A;  1H83 A;  3LOV A;  2DU8 A;  2WOW A;  1LTX R;  1ZDL A;  2XFQ A;  3F8P A;  1GOS A;  4AOS A;  1LV0 A;  2JBV A;  3UOY A;  4AP3 A;  4NZH A;  1NPX A;  3BHK A;  2VVL G;  2OLO A;  4EM3 A;  3QSE A;  3UKL A;  3C4A A;  3B3R A;  4Y4N A;  3B6D A;  2BS3 A;  1KIF A;  4IA5 A;  2WPF A;  4I58 A;  1K0L A;  2H88 A;  1FEA A;  3SM8 A;  3HYX A;  4H7U A;  4JDR A;  2YVG A;  4APN A;  2C70 A;  4UDR A;  2R0P A;  1MOK A;  4NTC A;  1V59 A;  3PO7 A;  3QVR A;  3NN6 X;  3UP5 A;  4PAA A;  1AN9 A;  1EL8 A;  3ZNO A;  2WPC A;  3DK9 A;  3H4K A;  3L1R A;  5EBK A;  4KPR A;  4CY8 A;  3P1W A;  3WE0 A;  3ISH A;  1GET A;  3FIM B;  1Q1W A;  2E5V A;  2YR6 A;  3DJG X;  4GDE A;  1PXA A;  1VDC A;  2IVD A;  1L9D A;  4GR1 A;  1NDA A;  4Y4L A;  5IQ1 A;  5JCL A;  3UCL A;  4GAP A;  1L9E A;  3CNT A;  4IV9 A;  4E0V A;  2ZZ0 A;  5EB4 A;  3BNM A;  1B4V A;  4AP1 A;  1K0J A;  2OAL A;  2XVI A;  4TM4 A;  3AE3 A;  3ITJ A;  3AEG A;  1K0I A;  1GSN A;  3GWF A;  4KX6 A;  1P2E A;  3ALM A;  4YXD A;  5HY5 A;  4YJG A;  4BK3 A;  4NNJ A;  4Z2T A;  4GDP A;  3ALJ A;  3NGC X;  1JRZ A;  1E6E A;  1AOG A;  2V3A A;  4GAV A;  2Q6U A;  2JKC A;  5JCI A;  2NVK X;  2A89 A;  4Z2U A;  5KNL A;  1BGN A;  3EPT A;  4U8N A;  1VG9 A;  2VQ7 A;  3BI5 A;  1H82 A;  2BK3 A;  2X8H A;  3EAN A;  5J60 A;  1JOA A;  3RNM A;  3SZ0 A;  3DJE A;  1FEB A;  2A87 A;  1DDO A;  1QJD A;  2C3D A;  2X99 A;  2C7G A;  3P4P A;  1YY5 A;  3ZNN A;  2RGO A;  1JU2 A;  1C0I A;  4TM0 A;  3NN0 X;  3UKK A;  2QA2 A;  2GR0 A;  3PS9 A;  1M6I A;  4H2N A;  3NRN A;  4Z43 A;  2YWL A;  2WOI A;  4GRT A;  3T2Z A;  4USR A;  3ALL A;  2WP6 A;  4NEW A;  1IUX A;  3NTD A;  4IA6 A;  1LPF A;  3UOV A;  4AT0 A;  2RGH A;  3GMB A;  1FEC A;  2YVF A;  1N1P A;  4XXG A;  4RG4 A;  4YJD A;  1E1M A;  1GXF A;  1CHU A;  2GR3 A;  4H4R A;  4B63 A;  3ADA B;  3VQR A;  3M0O A;  1CC2 A;  2WP5 A;  4K2X A;  4WX1 A;  2V61 A;  1TDK A;  2EQ6 A;  5FMH A;  4B67 A;  1E1L A;  1TYP A;  4K5R A;  4U2S A;  2JB1 A;  2X50 A;  3KLJ A;  2C72 A;  1C0L A;  2BK4 A;  3IHM A;  3LZX A;  2VVL A;  5KWF A;  2YG5 A;  2BC0 A;  3ZYX A;  3AE8 A;  1DJN A;  2UZZ A;  1REO A;  2PHH A;  1XAN A;  2GB0 A;  3ZNQ A;  5EB5 A;  4H2P A;  2FJB A;  5EOW A;  3SZW A;  2GF3 A;  1TDF A;  3NYF A;  2XVF A;  3NTA A;  4C77 A;  1OJ9 A;  4EQW A;  4B69 A;  3AEE A;  2V6O A;  4H4Y A;  4OPI A;  4YSX A;  4OPL A;  4RSL A;  1Q9I A;  2WDR A;  2C64 A;  2HQM A;  2GRT A;  1ZKQ A;  1CBO A;  4YTM A;  2YVJ A;  4YJF B;  3NKS A;  3FG2 P;  3DA1 A;  4Z24 A;  3UKH A;  3CPH G;  2XLT A;  4JY3 A;  1VG0 A;  2XVJ A;  4A79 A;  3HYW A;  1DOB A;  3T37 A;  2YR5 A;  4G9K A;  1H84 A;  4U8L A;  3BI2 A;  1GTE A;  2B7S A;  4D03 A;  4H4W A;  5KOX A;  1ZOV A;  4UP3 A;  3UP4 A;  4YKG A;  2YG4 A;  3LB8 A;  1PDH A;  3QFA A;  5KRQ A;  4JNA A;  2GEW A;  4DSG A;  1ZOY A;  2VOU A;  2WDV A;  4X9N A;  3LJP A;  4YTP A;  2BK5 A;  2CUL A;  3BI4 A;  3NH3 X;  3M12 A;  2JK6 A;  3NHO X;  4C74 A;  1GRE A;  4YT0 A;  2JB2 A;  3LAD A;  3AEA A;  2XVE A;  1S3E A;  4H2R A;  1VRQ B;  1KFY A;  3ATR A;  1GRH A;  1NG3 A;  1RYI A;  4P9S A;  4ICY A;  3SX6 A;  1HYU A;  1GAL A;  5KMS A;  4YJH B;  3EF6 A;  3EAO A;  4WCT A;  2JB3 A;  1GRA A;  3KKJ A;  1YQ3 A;  3AD8 B;  1DAO A;  1N4U A;  1IUS A;  1N4W A;  2GMJ A;  1O95 A;  1D4D A;  4H4X A;  2YR4 A;  1PBD A;  2DKI A;  3KD9 A;  4TLZ A;  2XYO A;  5CQF A;  4YSZ A;  1F6M A;  5TR3 A;  3T0K A;  2C75 A;  2FJA A;  1VQW A;  3AE1 A;  3CND A;  5IPY A;  2GH5 A;  2B9X A;  1F8R A;  1ZMD A;  1GRF A;  3VRA A;  1NEN A;  4A9W A;  3DGH A;  3K30 A;  3CPJ G;  1QLB A;  2EQ7 A;  1YKJ A;  1LVL A;  3I6D A;  3QVP A;  3FBS A;  5J7X A;  3SZC A;  5U25 A;  2IVE A;  3ABV A;  3G5S A;  5JCN A;  4CCR A;  4II2 A;  2B9Y A;  4U8M A;  2QA1 A;  3AE4 A;  4EMJ A;  4K5S A;  5DBJ A;  3SYI A;  2TPR A;  4YWO A;  3AE9 A;  3UTE A;  4I59 A;  1X31 B;  3NIX A;  2E1M A;  2WET A;  3RHA A;  2WQY A;  3KA7 A;  2VRM A;  3AYJ A;  1FCD A;  3HYV A;  4OPC A;  2BCP A;  2E49 A;  2QCU A;  5KVI A;  2YLS A;  5L46 A;  2YLX A;  1Y0P A;  2ZBW A;  3IWA A;  3R9U A;  1ZK7 A;  4O5Q A;  3P4Q A;  2Q0K A;  5M0Z A;  1CC6 A;  2I0Z A;  5GSN A;  2GV8 A;  1RP0 A;  4H2Q A;  2YM2 A;  4H4Z A;  1GV4 A;  1DOC A;  5HXI A;  4II3 A;  2WPE A;  4H4P A;  1ELI A;  2E4A A;  3FPZ A;  1XHC A;  4FK1 C;  1SEZ A;  3JSK A;  1KSU A;  1S2Y A;  3CPI G;  3GYX A;  4U8I A;  4G6G A;  2YG6 A;  3S61 A;  1H6V A;  1BF3 A;  4C3Y A;  4ECH A;  4GF7 A;  3VRD B;  4IVO B;  3BNU A;  2ARD A;  1DNC A;  1GTH A;  2YLT A;  1OJC A;  4B65 A;  5KOW A;  3D8X A;  2YLZ A;  2BXS A;  4YTN A;  3AWI A;  4M52 A;  1S3B A;  3VR9 A;  4OCG A;  4O5U A;  1H7W A;  2VQB A;  1FOH A;  2Z5X A;  3T2K A;  4H4S A;  2VRL A;  2C76 A;  3H8I A;  1TYT A;  4J34 A;  4NWZ A;  2AAQ A;  4UDP A;  1PBB A;  2BA9 A;  1Z6L A;  4OVI A;  5GRT A;  2WEU A;  3V3N A;  1W4X A;  1ZX9 A;  2R45 A;  3CNS A;  4JNQ A;  2X8G A;  2H89 A;  2VZ2 A;  1PBF A;  4ADW A;  5CKU A;  4YJF A;  3KVE A;  2BXR A;  3PVC A;  3GDN A;  2BS4 A;  4K8D A;  1BGJ A;  3IF9 A;  1K4Q A;  5ER0 A;  3CGD A;  1LQU A;  1E1N A;  3E1T A;  1IJH A;  2XLU A;  4EMW A;  3UKA A;  3C96 A;  1D7Y A;  1GT8 A;  3AD9 B;  2WHD A;  3GYI A;  3UKF A;  4H4Q A;  1KNR A;  1F8S A;  1PJ6 A;  2X3N A;  4J2W A;  4A65 A;  1BKW A;  1NAA A;  1TDE A;  2IID A;  4A7A A;  4CNK A;  4D04 A;  4H50 A;  3GWD A;  3AXB A;  3SY4 A;  2OAM A;  2BC1 A;  3DH9 A;  1YQZ A;  1LJ1 A;  1JRY A;  4HB9 A;  1IUW A;  1NHQ A;  3H8L A;  3NNE A;  5BRT A;  4EM4 A;  4YJH A;  4J56 A;  3UOZ A;  3K7Q X;  1Y56 B;  4QFD A;  2YLR A;  2WBA A;  3RP6 A;  2QAE A;  4EIP A;  1JEH A;  4RG3 A;  3NLC A;  5FS7 A;  1EL9 A;  3QSS A;  2BAC A;  3V3O A;  4H4U A;  1JNZ A;  1EL5 A;  2GR1 A;  3AE7 A;  1M64 A;  2YG3 A;  1BZL A;  4BK2 A;  4A99 A;  1CJ2 A;  3LZW A;  1O5W A;  2GQF A;  3RP8 A;  3ICS A;  4TM3 A;  4GUV A;  1D4E A;  1CJ4 A;  3CMM A;  4LU6 A;  3ATQ A;  3UKQ A;  1DXL A;  4J31 A;  5KVH A;  4CCQ A;  2YG7 A;  1GRB A;  2WDQ A;  1E7P A;  5BUL A;  1ONF A;  4XWR A;  1B5Q A;  3NG7 X;  1F8W A;  4Y4M A;  4Z26 A;  2APG A;  4REK A;  1CJ3 A;  3FMW A;  1IUT A;  1L9C A;  2R4E A;  3NK2 X;  4MJW A;  2ZZB A;  4Z2R A;  1C0P A;  4DGK A;  3OZ2 A;  4LII A;  1CJC A;  1GES A;  1TDO A;  5BUK A;  3L8K A;  1GND A;  1IUU A;  1NEK A;  1KF6 A;  2GMH A;  2XCG A;  3CN8 A;  2C65 A; 
#chains in the Genus database with same CATH homology
 1TRB A;  3VR8 A;  2RGJ A;  1MXT A;  3UOX A;  4DNA A;  4CBQ A;  2V60 A;  2FJD A;  1ZP0 A;  1PN0 A;  2XFN A;  3AE5 A;  2B76 A;  3O0H A;  3ZDN A;  3F8R A;  2XFP A;  3S5W A;  1RSG A;  1CC4 A;  1D5T A;  3ICR A;  5U1O A;  2YAU A;  2C67 A;  3P9U A;  3T2Y A;  3GYJ A;  4USQ A;  3AD7 B;  4K7Z A;  1GRT A;  2YM1 A;  4AOX A;  1PS9 A;  4A6N B;  4CNJ A;  3DK8 A;  4CRT A;  1D4C A;  4BJY A;  2TMD A;  1E39 A;  4U8J A;  1GRG A;  4EIQ A;  1DOE A;  4NEV A;  4G73 A;  3DGZ A;  4B66 A;  4U2L A;  2O9Z A;  1KSS A;  5M10 A;  1IUV A;  3C4N A;  1B8S A;  1PXB A;  3IC9 A;  4J33 A;  2R46 A;  3AYI A;  4FK1 A;  2XVH A;  2XLP A;  4UDQ A;  2ZZC A;  5HYM A;  1N4V A;  3D1C A;  2Q7V A;  1DOD A;  3DME A;  4JQ9 A;  2R0C A;  2XLS A;  4U8O A;  4ZCC A;  4Z25 A;  3AEC A;  1E1K A;  3CGB A;  4B1B A;  5FS9 A;  4B64 A;  4N9X A;  4X9M A;  3II4 A;  2BAB A;  3CIR A;  2E4G A;  3GMC A;  2A8X A;  1GEU A;  1BWC A;  3CGC A;  3NK1 X;  2BRY A;  2WES A;  1D7L A;  3AE2 A;  3KPF A;  4J57 A;  1EL7 A;  2W0H A;  1PJ7 A;  1P2H A;  3OC4 A;  5FS6 A;  2BS2 A;  3DK4 A;  4C3X A;  2EQ9 A;  2VVM A;  2R9Z A;  4OPT A;  1GER A;  1Y56 A;  3P4R A;  3GRS A;  4EMI A;  2CVJ A;  4LA1 A;  2Q0L A;  3UTH A;  3COX A;  4J36 A;  5C3J A;  5JCK A;  5BVA A;  3AYL A;  3SFE A;  4FDC B;  1H86 A;  3CNP A;  2EQ8 A;  1B37 A;  2OA1 A;  1NHR A;  4K22 A;  3DJJ A;  1O94 A;  3AEB A;  4X4J A;  4TM1 A;  1CL0 A;  1OJD A;  2C73 A;  4ZCD A;  2AQJ A;  2RAB A;  3NYE A;  1FL2 A;  2WS3 A;  3G5Q A;  3HZL A;  4U8P A;  4BV6 A;  2Z5Y A;  5C2T A;  1TDN A;  1LQT A;  2DKH A;  5KMQ A;  4YSH A;  1PHH A;  2PYX A;  4AT2 A;  5KMR A;  1PBE A;  2X8C A;  2XFO A;  2FBW A;  2F5Z A;  4BUR A;  4EQR A;  4DSH A;  1PXC A;  4OPU A;  2XFU A;  2GR2 A;  3VRB A;  3KPK A;  1OJA A;  1ZMC A;  3AE6 A;  1L0V A;  3IHG A;  1KNP A;  5FS8 A;  3V76 A;  1EBD A;  2YQU A;  3SFD A;  2GQW A;  4TLX A;  3GD4 A;  4IVM B;  2FJE A;  2WU5 A;  3K7T A;  1JRX A;  3AB1 A;  3RED A;  1NHS A;  4ZN0 A;  3NT6 A;  1ZY8 A;  1H81 A;  4G74 A;  1KDG A;  3GSI A;  4H4T A;  3G5R A;  1F3P A;  3QFB A;  1XDI A;  4NTE A;  2V3B A;  4YKF A;  4CY6 A;  4H4V A;  1COY A;  2BCG G;  2R4J A;  1PJ5 A;  3GD3 A;  4OPG A;  2Y6R A;  3GDP A;  3QSM A;  3T31 A;  2GVC A;  4JY2 A;  3ICT A;  3Q9T A;  4HA6 A;  4JN9 A;  2B9W A;  4YSY A;  3SGL A;  1CF3 A;  1OJT A;  2OLN A;  3LXD A;  3M13 A;  3CTY A;  3DJD A;  3UKP A;  3URH A;  2XDO A;  3NK0 X;  3I3L A;  4XWZ A;  5KXJ A;  2JAE A;  5LV9 A;  2CFY A;  3SZF A;  4B68 A;  4EQX A;  1JNR A;  1XPQ A;  2BRA A;  1DJQ A;  3GRT A;  1MO9 A;  2YLW A;  3NYC A;  5KMP A;  4EQS A;  1Q1R A;  3UTF A;  4Z44 A;  3KU9 A;  2J3N A;  1S2Q A;  3CGE A;  4OPD A;  3F8D A;  4PAB A;  4A6N A;  3AED A;  3CNJ A;  3AEF A;  4A5L A;  2C66 A;  2CDU A;  2Y6Q A;  1QO8 A;  2GAH B;  3P4S A;  4FX9 A;  3SQP A;  3UTG A;  4C5O A;  1UKV G;  2AR8 A;  5HHF A;  1NG4 A;  4GCM A;  2V5Z A;  4BK1 A;  5U63 A;  4U2T A;  2WU2 A;  1NHP A;  3T14 A;  2R0G A;  2C4C A;  3QJ4 A;  3BHF A;  5IQ4 A;  4G6H A;  2C3C A;  2GAG B;  1YQ4 A;  5JCM A;  4BJZ A;  1GPE A;  2WOV A;  4NTD A;  3SXI A;  3RP7 A;  2B7R A;  2NPX A;  3K7M X;  4U8K A;  2BYB A;  2ACZ A;  3Q6J A;  2WP9 A;  1H7X A;  1PBC A;  2XLR A;  1H83 A;  3LOV A;  2WOW A;  1LTX R;  1ZDL A;  2XFQ A;  3F8P A;  1GOS A;  4AOS A;  1LV0 A;  2JBV A;  3UOY A;  4AP3 A;  4NZH A;  1NPX A;  2VVL G;  3BHK A;  2OLO A;  4EM3 A;  3QSE A;  3UKL A;  3C4A A;  3B3R A;  4Y4N A;  3B6D A;  2BS3 A;  2WPF A;  4IA5 A;  4I58 A;  4JDR A;  1K0L A;  2H88 A;  1FEA A;  3HYX A;  4H7U A;  3SM8 A;  2YVG A;  4APN A;  2C70 A;  4UDR A;  2R0P A;  1MOK A;  4NTC A;  1V59 A;  3PO7 A;  3QVR A;  3NN6 X;  3UP5 A;  2WPC A;  1EL8 A;  3H4K A;  3L1R A;  4PAA A;  3DK9 A;  5EBK A;  4KPR A;  4CY8 A;  3P1W A;  3WE0 A;  3ISH A;  1GET A;  3FIM B;  1Q1W A;  2E5V A;  2YR6 A;  3DJG X;  4GDE A;  1PXA A;  1VDC A;  2IVD A;  1L9D A;  4GR1 A;  1NDA A;  4Y4L A;  5IQ1 A;  5JCL A;  3UCL A;  4GAP A;  1L9E A;  3CNT A;  4IV9 A;  4E0V A;  2ZZ0 A;  5EB4 A;  3BNM A;  1B4V A;  4AP1 A;  1K0J A;  2OAL A;  2XVI A;  4TM4 A;  3AE3 A;  3ITJ A;  3AEG A;  1K0I A;  1GSN A;  3GWF A;  4KX6 A;  1P2E A;  3ALM A;  4YXD A;  5HY5 A;  4BK3 A;  4NNJ A;  4Z2T A;  4GDP A;  3ALJ A;  3NGC X;  1JRZ A;  1E6E A;  1AOG A;  2V3A A;  4GAV A;  2Q6U A;  2JKC A;  5JCI A;  2NVK X;  2A89 A;  4Z2U A;  5KNL A;  1BGN A;  3EPT A;  4U8N A;  1VG9 A;  2VQ7 A;  3BI5 A;  1H82 A;  2BK3 A;  2X8H A;  3EAN A;  5J60 A;  1JOA A;  3RNM A;  3SZ0 A;  1FEB A;  3DJE A;  2A87 A;  1QJD A;  2C3D A;  2X99 A;  2C7G A;  3P4P A;  1YY5 A;  1JU2 A;  2RGO A;  4TM0 A;  3NN0 X;  3UKK A;  2QA2 A;  2GR0 A;  3PS9 A;  1M6I A;  4H2N A;  3NRN A;  4Z43 A;  2YWL A;  2WOI A;  4GRT A;  3T2Z A;  4USR A;  3ALL A;  2WP6 A;  4NEW A;  1IUX A;  3NTD A;  4IA6 A;  1LPF A;  3UOV A;  4AT0 A;  2RGH A;  3GMB A;  1FEC A;  2YVF A;  1N1P A;  4XXG A;  4RG4 A;  2GR3 A;  1E1M A;  1GXF A;  1CHU A;  4H4R A;  4B63 A;  3ADA B;  1CC2 A;  2WP5 A;  3M0O A;  4WX1 A;  4K2X A;  5FMH A;  2V61 A;  1TDK A;  2EQ6 A;  3VQR A;  4B67 A;  1E1L A;  1TYP A;  4K5R A;  4U2S A;  2JB1 A;  2X50 A;  3KLJ A;  2C72 A;  2BK4 A;  3IHM A;  3LZX A;  2VVL A;  5KWF A;  2YG5 A;  2BC0 A;  3ZYX A;  3AE8 A;  1DJN A;  1REO A;  2UZZ A;  1XAN A;  2PHH A;  2GB0 A;  5EB5 A;  5EOW A;  4H2P A;  2FJB A;  3SZW A;  2GF3 A;  1TDF A;  3NYF A;  2XVF A;  3NTA A;  4C77 A;  1OJ9 A;  4EQW A;  4B69 A;  3AEE A;  2V6O A;  4H4Y A;  4OPI A;  4YSX A;  4OPL A;  2WDR A;  1Q9I A;  4RSL A;  2C64 A;  2HQM A;  2GRT A;  1ZKQ A;  1CBO A;  4YTM A;  2YVJ A;  3NKS A;  4Z24 A;  3FG2 P;  3DA1 A;  3UKH A;  3CPH G;  2XLT A;  4JY3 A;  1VG0 A;  2XVJ A;  4A79 A;  3HYW A;  1DOB A;  3T37 A;  2YR5 A;  4G9K A;  1H84 A;  4U8L A;  3BI2 A;  1GTE A;  2B7S A;  4D03 A;  4H4W A;  5KOX A;  1ZOV A;  4UP3 A;  3UP4 A;  4YKG A;  2YG4 A;  3LB8 A;  1PDH A;  3QFA A;  5KRQ A;  4JNA A;  2GEW A;  4DSG A;  1ZOY A;  2VOU A;  2WDV A;  4X9N A;  3LJP A;  4YTP A;  2BK5 A;  2CUL A;  3BI4 A;  3NH3 X;  3M12 A;  2JK6 A;  3NHO X;  4C74 A;  1GRE A;  4YT0 A;  2JB2 A;  3LAD A;  3AEA A;  2XVE A;  1S3E A;  4H2R A;  1KFY A;  1VRQ B;  3ATR A;  1GRH A;  1NG3 A;  1RYI A;  4P9S A;  4ICY A;  3SX6 A;  1HYU A;  1GAL A;  5KMS A;  3EF6 A;  3EAO A;  4WCT A;  2JB3 A;  1GRA A;  3KKJ A;  1YQ3 A;  3AD8 B;  1N4U A;  1IUS A;  1N4W A;  2GMJ A;  1O95 A;  1D4D A;  4H4X A;  2YR4 A;  1PBD A;  2DKI A;  3KD9 A;  4TLZ A;  2XYO A;  5CQF A;  4YSZ A;  1F6M A;  5TR3 A;  3T0K A;  2C75 A;  2FJA A;  1VQW A;  3AE1 A;  3CND A;  5IPY A;  2GH5 A;  2B9X A;  1F8R A;  1ZMD A;  1GRF A;  3VRA A;  1NEN A;  4A9W A;  3DGH A;  3K30 A;  3CPJ G;  1QLB A;  2EQ7 A;  1YKJ A;  1LVL A;  3I6D A;  3QVP A;  3FBS A;  5J7X A;  3SZC A;  5U25 A;  2IVE A;  3ABV A;  3G5S A;  5JCN A;  4CCR A;  4II2 A;  2B9Y A;  4U8M A;  2QA1 A;  3AE4 A;  4EMJ A;  4K5S A;  5DBJ A;  3SYI A;  2TPR A;  4YWO A;  3AE9 A;  3UTE A;  4I59 A;  1X31 B;  3NIX A;  2E1M A;  2WET A;  3RHA A;  2WQY A;  3KA7 A;  2VRM A;  3AYJ A;  1FCD A;  3HYV A;  4OPC A;  2BCP A;  2QCU A;  5KVI A;  2YLS A;  2YLX A;  5L46 A;  1Y0P A;  2ZBW A;  3IWA A;  3R9U A;  1ZK7 A;  4O5Q A;  3P4Q A;  2Q0K A;  5M0Z A;  1CC6 A;  2I0Z A;  5GSN A;  2GV8 A;  1RP0 A;  4H2Q A;  2YM2 A;  4H4Z A;  1GV4 A;  1DOC A;  5HXI A;  4II3 A;  2WPE A;  4H4P A;  1ELI A;  3FPZ A;  1XHC A;  4FK1 C;  1SEZ A;  3JSK A;  1KSU A;  1S2Y A;  3CPI G;  3GYX A;  4U8I A;  4G6G A;  2YG6 A;  3S61 A;  1H6V A;  1BF3 A;  4C3Y A;  4ECH A;  4GF7 A;  3VRD B;  4IVO B;  3BNU A;  2ARD A;  1DNC A;  1GTH A;  2YLT A;  1OJC A;  4B65 A;  5KOW A;  3D8X A;  2YLZ A;  2BXS A;  4YTN A;  3AWI A;  4M52 A;  1S3B A;  3VR9 A;  4OCG A;  4O5U A;  1H7W A;  2VQB A;  1FOH A;  2Z5X A;  3T2K A;  4H4S A;  2VRL A;  2C76 A;  3H8I A;  1TYT A;  4J34 A;  4NWZ A;  2AAQ A;  4UDP A;  1PBB A;  2BA9 A;  1Z6L A;  4OVI A;  5GRT A;  2WEU A;  3V3N A;  1W4X A;  1ZX9 A;  2R45 A;  3CNS A;  4JNQ A;  2X8G A;  2H89 A;  2VZ2 A;  1PBF A;  4ADW A;  5CKU A;  3KVE A;  2BXR A;  3GDN A;  3PVC A;  2BS4 A;  4K8D A;  1BGJ A;  1K4Q A;  3IF9 A;  5ER0 A;  3CGD A;  1LQU A;  1E1N A;  3E1T A;  1IJH A;  2XLU A;  4EMW A;  3UKA A;  3C96 A;  1D7Y A;  1GT8 A;  2WHD A;  3AD9 B;  3GYI A;  3UKF A;  4H4Q A;  1KNR A;  1F8S A;  1PJ6 A;  2X3N A;  4J2W A;  4A65 A;  1BKW A;  1NAA A;  1TDE A;  2IID A;  4A7A A;  4CNK A;  4D04 A;  4H50 A;  3GWD A;  3AXB A;  3SY4 A;  2OAM A;  2BC1 A;  3DH9 A;  1YQZ A;  1LJ1 A;  1JRY A;  4HB9 A;  1IUW A;  1NHQ A;  3H8L A;  3NNE A;  5BRT A;  4EM4 A;  3UOZ A;  4J56 A;  3K7Q X;  1Y56 B;  2YLR A;  2WBA A;  3RP6 A;  2QAE A;  4EIP A;  1JEH A;  4RG3 A;  3NLC A;  5FS7 A;  1EL9 A;  3QSS A;  2BAC A;  3V3O A;  4H4U A;  1JNZ A;  1EL5 A;  2GR1 A;  3AE7 A;  1M64 A;  2YG3 A;  1BZL A;  4BK2 A;  4A99 A;  1CJ2 A;  3LZW A;  1O5W A;  2GQF A;  3RP8 A;  3ICS A;  4TM3 A;  4GUV A;  1D4E A;  1CJ4 A;  3CMM A;  4LU6 A;  3ATQ A;  3UKQ A;  1DXL A;  4J31 A;  5KVH A;  4CCQ A;  2YG7 A;  1GRB A;  2WDQ A;  1E7P A;  5BUL A;  1ONF A;  4XWR A;  1B5Q A;  3NG7 X;  1F8W A;  4Y4M A;  4Z26 A;  2APG A;  4REK A;  1CJ3 A;  3FMW A;  1IUT A;  1L9C A;  2R4E A;  3NK2 X;  4MJW A;  2ZZB A;  4Z2R A;  4DGK A;  3OZ2 A;  4LII A;  1CJC A;  1GES A;  1TDO A;  5BUK A;  3L8K A;  1GND A;  1IUU A;  1NEK A;  1KF6 A;  2GMH A;  2XCG A;  3CN8 A;  2C65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...