4H2NA

Crystal structure of mhpco, y270f mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 126
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2nA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2nA01
2R4EA 3QSMA 3UCLA 5JCMA 3FBSA 2AQJA 1IUVA 2B9XA 3GYJA 3C4NA 2NVKX 2RGJA 2ARDA 3AE4A 4NEVA 4ADWA 2RGHA 1IUTA 4J34A 4H50A 1OJTA 3K30A 4KX6A 2VOUA 2DKHA 4TM0A 4DSGA 1KNPA 1Y56B 5HHFA 3NTDA 4K5SA 1H82A 2OLNA 4Z2TA 1W4XA 3SQPA 1JOAA 3E1TA 4CRTA 4YSXA 3UOYA 4U8JA 1YKJA 1LV0A 2ACZA 1L9DA 1CHUA 1D4DA 2FJBA 1YQ4A 3GD4A 1QLBA 3M0OA 4UP3A 3ATRA 4I58A 2PYXA 1F3PA 1ZOYA 1VDCA 3UOVA 1X31B 4I59A 1GV4A 4YSHA 1LVLA 2QA2A 2NPXA 2V61A 2WOVA 1H84A 4GUVA 4J33A 2BS4A 2ZBWA 4K22A 4TM4A 1GRHA 2FJEA 2YLRA 3UOXA 5JCLA 3GWDA 3CGEA 2BYBA 2OALA 4TLXA 4KPRA 3UKFA 2WHDA 1OJDA 2WU2A 2XVEA 1QJDA 2GV8A 1E1KA 2BXRA 4ZCDA 2I0ZA 3GMCA 3UP4A 3ALLA 4GF7A 3NGCX 1D5TA 2E4GA 3ZDNA 1H6VA 3ICRA 3K7MX 1KNRA 5U63A 1XHCA 4FK1A 4BJZA 4EQSA 2E5VA 1ZMCA 4USQA 1S3EA 1P2HA 1NPXA 2AAQA 3AECA 3GWFA 3GDNA 3V76A 4P9SA 4NTDA 1ZOVA 1JRZA 3FPZA 1Q9IA 2JAEA 4J57A 3GSIA 1GREA 4B64A 3NTAA 1ZMDA 3UKLA 1E1NA 1Y56A 1O5WA 2YG5A 3NK0X 4A5LA 4WX1A 4AP3A 4C74A 2WOIA 2YR6A 5DBJA 3H8IA 2YM2A 1FECA 1XANA 2VQ7A 3DJDA 1D7YA 2WPFA 4PAAA 3DK9A 3COXA 4Z2RA 2BACA 3WE0A 4REKA 2XFQA 3KPFA 4X9NA 2GR3A 4YKFA 4A6NA 2TPRA 3UP5A 5HXIA 1PBCA 3F8PA 5GSNA 1HYUA 2CVJA 5U25A 4ECHA 1NDAA 3SGLA 2R0PA 4GCMA 3ADAB 4UDQA 4YSZA 2XVHA 1GPEA 1E7PA 1YY5A 3PS9A 1F6MA 4RSLA 1PJ7A 3R9UA 5BRTA 3I6DA 3LZWA 1TDNA 3CGBA 1TDFA 1XPQA 2GVCA 2C76A 3SFDA 4A99A 1ZP0A 5J60A 1PBBA 3FG2P 3KU9A 4TM3A 2B7SA 1ZDLA 2GEWA 1FCDA 3DGZA 4IVOB 1VG0A 3LB8A 5J7XA 1DJQA 3DA1A 3LJPA 1JU2A 1H81A 2YR5A 4CCQA 2YWLA 1LPFA 1PXAA 2DKIA 1CJ4A 2YLZA 4N9XA 4OPIA 3NH3X 4WCTA 1ZKQA 4J2WA 2XFPA 3NYCA 2JKCA 4USRA 3NG7X 4D03A 1L9EA 4H4TA 1NG4A 3KLJA 5LV9A 4OCGA 3G5SA 2X99A 2XFOA 4J56A 1CC2A 3L1RA 4B68A 1M64A 2GAGB 1VRQB 5C2TA 4K7ZA 2X50A 2YG3A 2XFUA 3AE5A 2CULA 2BC1A 3VRBA 2Q7VA 4H4WA 4NTCA 4O5QA 4OPCA 2JBVA 1S3BA 3NRNA 3AEAA 3AYLA 4LIIA 2IVDA 4B63A 1FOHA 2UZZA 4EM4A 3ZYXA 2C67A 4LU6A 4ZCCA 2CDUA 3DMEA 2C70A 3RP8A 3UTGA 1Z6LA 3D1CA 3L8KA 3Q9TA 1KDGA 2XDOA 1DOCA 3KVEA 4Z43A 3NN0X 3DJEA 2VVLA 4C5OA 3Q6JA 3H4KA 3HZLA 2EQ9A 1H83A 4U8NA 5EBKA 3ATQA 3G5QA 1CJCA 1CC6A 4U8PA 2BABA 3EANA 2WDRA 3NYFA 4OPLA 3LZXA 3IWAA 4HA6A 3RNMA 1ZY8A 3ICTA 4APNA 1S2YA 2C65A 3G5RA 4EMIA 2WP9A 3OZ2A 4H4RA 1K0LA 5IQ1A 4JQ9A 1GRBA 5GRTA 3RP7A 3CIRA 1N4WA 1KF6A 4H4XA 4DNAA 4M52A 4H4SA 2Q0KA 2VZ2A 1BZLA 2C66A 4U8OA 5M0ZA 1PN0A 5HYMA 3LADA 4X4JA 2QAEA 3F8DA 3CNJA 2VVLG 1H7WA 2V5ZA 3DK8A 4U8MA 3UOZA 4B69A 3GYIA 4BK2A 4GDEA 1TDKA 2Y6QA 1VG9A 4GDPA 3B6DA 3CGCA 2JB3A 1LTXR 1MO9A 4EIPA 1CJ2A 1GRAA 3BI2A 3BNMA 2R4JA 1QO8A 2A8XA 1TYPA 2PHHA 2R9ZA 4GR1A 2Q6UA 1EL7A 3BI4A 3EF6A 4B1BA 4CNKA 3AE2A 4H2PA 5C3JA 1RP0A 2WU5A 1PHHA 3T37A 1DOEA 1V59A 4HB9A 1EL8A 4IVMB 4AT2A 1B4VA 1GALA 3FIMB 1F8RA 1PXBA 4C77A 3AEEA 2A89A 2ZZCA 2GR0A 3M12A 2C7GA 2JB2A 3M13A 3AXBA 4K5RA 1F8WA 2WPCA 3AEDA 3AEFA 1GETA 3QFBA 3BHKA 2X8HA 2FBWA 4A79A 4AOXA 3AE8A 1CL0A 4YSYA 2B7RA 4C3XA 4U2TA 1XDIA 2YLTA 3C4AA 1D4CA 3QVRA 4YXDA 4JY2A 1KSSA 3UTFA 1F8SA 5KWFA 4IA6A 5KOWA 1NHSA 2EQ8A 3QSSA 3AD7B 2GMHA 1NHRA 4K2XA 1GESA 2WESA 1ELIA 1GXFA 4NZHA 1PJ5A 3KKJA 1TDOA 4BK3A 4K8DA 2YR4A 3AE7A 4MJWA 3P4SA 3D8XA 1ZK7A 4AP1A 3NK2X 4U8LA 2EQ7A 1JNZA 2OA1A 4CY8A 2XLPA 3DJJA 1L9CA 3NYEA 4U2LA 3URHA 4AOSA 1NG3A 2XLTA 3GRSA 4JNQA 4RG3A 3ALMA 4J36A 1CJ3A 5KXJA 2WETA 4CY6A 1AOGA 1Q1WA 4EIQA 2B9YA 2O9ZA 3DGHA 4A7AA 5FS6A 4NEWA 4Y4NA 2YVJA 2GH5A 1EL9A 4ICYA 2F5ZA 3AEBA 1YQ3A 4BURA 2C64A 3S5WA 2FJDA 3IHGA 3QJ4A 4BK1A 4FDCB 2R45A 4AT0A 5M10A 1IUXA 1H86A 1OJ9A 2BCPA 4EQWA 3BHFA 3ABVA 3PO7A 1GT8A 2J3NA 2XVIA 3GD3A 2BK5A 4JDRA 2CFYA 3CNTA 3O0HA 4O5UA 1GERA 2GAHB 4TM1A 4Y4LA 1CF3A 1N4UA 1O95A 4B66A 3GRTA 2JB1A 2YVFA 2R0CA 1TYTA 1BF3A 3UKAA 1IUWA 3CN8A 3K7TA 1OJAA 4CNJA 1RYIA 3PVCA 1ONFA 2VVMA 3RHAA 1Q1RA 4LA1A 3AWIA 3VRDB 4Y4MA 1FL2A 1SEZA 4YT0A 2XVFA 4X9MA 1B37A 3KA7A 2VRMA 4FX9A 4UDPA 3F8RA 1GSNA 3IF9A 4YWOA 2E1MA 3UKQA 4C3YA 3V3OA 3VR8A 4H4ZA 5L46A 2GQWA 1EL5A 2VRLA 2YG7A 1KSUA 2YLXA 4H4YA 3P4QA 5EB4A 1DOBA 2GF3A 5U1OA 3B3RA 2WDQA 5FS8A 1DJNA 5BUKA 5IPYA 4XWZA 2Z5YA 1B5QA 1GRGA 4Z2UA 3UKHA 1DODA 2C73A 3KD9A 1NENA 2BS3A 2V3BA 4CBQA 2Y6RA 1UKVG 1GNDA 3UKPA 1PJ6A 1D4EA 3EAOA 1IUSA 1PDHA 3CNDA 4GRTA 4YTMA 1E6EA 2OLOA 3NK1X 2C75A 2XCGA 3LOVA 2BCGG 2YAUA 2R46A 2C3DA 1TDEA 1NEKA 1EBDA 2GQFA 2X8GA 3AE1A 4B65A 4EQRA 4Z26A 3CPIG 2QA1A 1N4VA 4BV6A 1L0VA 3QFAA 4JY3A 2WPEA 3FMWA 2OAMA 3VRAA 2X3NA 1M6IA 2GR2A 3SFEA 3NHOX 4UDRA 2WP5A 3UTEA 4EM3A 2FJAA 4JNAA 2AR8A 3NLCA 2YM1A 1CBOA 2GMJA 1K0JA 3NT6A 3AYIA 3P9UA 4H4PA 4XWRA 4A6NB 1ZX9A 5KRQA 2GB0A 3NIXA 2R0GA 2RGOA 1FEBA 1IUUA 3CNSA 2IIDA 4YTNA 1H7XA 3AB1A 1D7LA 3UKKA 2APGA 5KOXA 1JRXA 2WS3A 2W0HA 1RSGA 1GOSA 1GTEA 3OC4A 5IQ4A 2BXSA 4H2RA 2ZZBA 4OPTA 1NHPA 1PS9A 2XFNA 3AEGA 1OJCA 2BC0A 2V3AA 1O94A 1B8SA 3P4PA 4OPGA 2YLWA 3VR9A 2BK4A 3SM8A 4B67A 3AD9B 4A65A 5JCKA 1PBDA 3CPJG 1LJ1A 2X8CA 1FEAA 3DJGX 3ISHA 3II4A 1KFYA 2YG6A 1P2EA 4H4VA 1N1PA 4JN9A 4OVIA 1PBEA 4E0VA 2GRTA 4DSHA 4Z44A 4EMJA 1JEHA 2ZZ0A 3AD8B 1NHQA 3GMBA 2XLRA 1E1LA 5TR3A 4Z25A 1LQUA 4FK1C 5CKUA 1PBFA 3P1WA 4PABA 1GTHA 3IHMA 4BJYA 2WP6A 2A87A 2XLSA 2RABA 5FS7A 2XYOA 5BVAA 4DGKA 2C72A 1CC4A 4H4QA 1GEUA 3QSEA 5KVIA 3ICSA 4YKGA 1GRFA 4H2NA 1VQWA 2WBAA 3BI5A 1JNRA 4EMWA 1REOA 1MOKA 3QVPA 3S61A 5JCNA 3V3NA 2XLUA 2Z5XA 3CNPA 3K7QX 3C96A 3UTHA 2HQMA 2WQYA 4OPDA 3JSKA 4H4UA 4RG4A 5EOWA 1TRBA 4EQXA 3GDPA 2JK6A 1K0IA 1PXCA 5EB5A 2BA9A 1LQTA 2WEUA 4TLZA 5CQFA 3RP6A 3NN6X 1IJHA 1NAAA 2BS2A 2YG4A 3EPTA 1E39A 1DNCA 2V6OA 2V60A 2B76A 1YQZA 1MXTA 2WOWA 3BNUA 1Y0PA 3H8LA 3DH9A 1S2QA 2YLSA 2C3CA 3VQRA 4Z24A 3CTYA 2IVEA 2Q0LA 3LXDA 4U2SA 2VQBA 4H2QA 1BGNA 4J31A 4H7UA 1K4QA 2YVGA 3I3LA 4XXGA 1BWCA 3ITJA 3CGDA 3P4RA 5FS9A 5BULA 3NNEA 1BKWA 5FMHA 1DXLA 4IV9A 2QCUA 4OPUA 1JRYA 4YTPA 2TMDA 3AYJA 4IA5A 3ALJA 2GR1A 4A9WA 3REDA 4U8IA 5JCIA 1E1MA 2B9WA 3AE6A 3NKSA 3IC9A 1BGJA 5KVHA 2BK3A 2H88A 2EQ6A 5HY5A 2WDVA 4U8KA 2XVJA 3CPHG 3DK4A 4NTEA 4ZN0A 2YQUA 3AE9A 5ER0A 2H89A 1GRTA 4D04A 1COYA 4CCRA 3AE3A
chains in the Genus database with same CATH superfamily
2R4EA 3QSMA 3UCLA 5JCMA 3ZNQA 3FBSA 2AQJA 1IUVA 2B9XA 3GYJA 3C4NA 2RGJA 2NVKX 2ARDA 3AE4A 4NEVA 4ADWA 2RGHA 1IUTA 4J34A 4H50A 1OJTA 3K30A 4KX6A 2VOUA 2DKHA 4TM0A 4DSGA 1KNPA 1Y56B 5HHFA 3NTDA 4K5SA 1H82A 2OLNA 4Z2TA 1W4XA 3SQPA 1JOAA 3E1TA 4CRTA 4YSXA 3UOYA 4U8JA 1YKJA 1LV0A 2ACZA 2C4CA 1L9DA 4YJFB 4G6GA 1CHUA 5KMRA 1D4DA 2FJBA 3M0OA 1YQ4A 1QLBA 3GD4A 4UP3A 3ATRA 4I58A 2PYXA 1F3PA 1ZOYA 1VDCA 3UOVA 1X31B 4I59A 4QFDA 1GV4A 4YSHA 1LVLA 2QA2A 2NPXA 2V61A 2WOVA 1H84A 4GUVA 4J33A 1EVIA 2BS4A 2ZBWA 4K22A 4TM4A 1GRHA 2BRAA 2FJEA 2YLRA 3UOXA 5JCLA 3GWDA 3CGEA 2BYBA 3G3EA 2OALA 4YJHA 4TLXA 4KPRA 3UKFA 2WHDA 1OJDA 2WU2A 2XVEA 1QJDA 2GV8A 1E1KA 2BXRA 4ZCDA 2I0ZA 3GMCA 3UP4A 1C0IA 3ALLA 4GF7A 3NGCX 1D5TA 2E4GA 3ZDNA 1H6VA 3ICRA 3K7MX 1KNRA 5U63A 3SX6A 1XHCA 4BJZA 4FK1A 4EQSA 2E5VA 1ZMCA 4USQA 1S3EA 1P2HA 1NPXA 2AAQA 3AECA 3GWFA 3GDNA 3V76A 4P9SA 4NTDA 1ZOVA 1JRZA 3FPZA 1Q9IA 3WGTA 2JAEA 4J57A 3GSIA 1GREA 4B64A 3NTAA 1ZMDA 3UKLA 1E1NA 1Y56A 1O5WA 3ZNNA 2YG5A 3NK0X 4WX1A 4A5LA 4AP3A 2WOIA 4C74A 3HYWA 5KMSA 2BRYA 2YR6A 5DBJA 3H8IA 2YM2A 1FECA 4PAAA 1XANA 3DJDA 1D7YA 2VQ7A 2WPFA 3DK9A 3COXA 4Z2RA 2BACA 3WE0A 4REKA 2XFQA 3KPFA 4X9NA 2GR3A 4YKFA 4A6NA 2TPRA 1AN9A 3UP5A 1PBCA 5HXIA 3F8PA 5GSNA 1HYUA 2CVJA 1C0KA 5U25A 4ECHA 1NDAA 3SGLA 2R0PA 4GCMA 3ADAB 4UDQA 4YSZA 2XVHA 1GPEA 3PS9A 4RSLA 1E7PA 1F6MA 1YY5A 1PJ7A 3R9UA 5BRTA 3I6DA 3LZWA 1TDNA 3CGBA 4G6HA 1TDFA 1XPQA 2GVCA 2C76A 3SFDA 4A99A 1ZP0A 5J60A 3HYVA 1PBBA 3FG2P 3KU9A 2DU8A 4TM3A 2B7SA 1ZDLA 2GEWA 1FCDA 3DGZA 4IVOB 1VG0A 3LB8A 5J7XA 3DA1A 1DJQA 2E48A 1JU2A 1H81A 2YR5A 3LJPA 2YWLA 1LPFA 4CCQA 1PXAA 2DKIA 1CJ4A 2YLZA 1C0PA 4N9XA 4OPIA 3NH3X 4WCTA 1ZKQA 4J2WA 3NYCA 2XFPA 2JKCA 4USRA 3NG7X 4D03A 1L9EA 4H4TA 3KPKA 1NG4A 3KLJA 5LV9A 4OCGA 3G5SA 2X99A 2XFOA 3W4KA 1CC2A 4J56A 3L1RA 4B68A 1M64A 2GAGB 1VRQB 1DDOA 5C2TA 4K7ZA 2X50A 2YG3A 2XFUA 3AE5A 2CULA 2BC1A 3VRBA 2Q7VA 4H4WA 4NTCA 4O5QA 4OPCA 2JBVA 1S3BA 3SYIA 3NRNA 3AEAA 3AYLA 4LIIA 2IVDA 4B63A 1FOHA 2UZZA 4EM4A 3ZYXA 2C67A 4LU6A 4ZCCA 2CDUA 3DMEA 3RP8A 3ZNOA 2C70A 3T2ZA 3UTGA 1Z6LA 3D1CA 3L8KA 2E4AA 3Q9TA 1KDGA 2XDOA 1DOCA 5KNLA 3KVEA 4Z43A 3NN0X 3DJEA 2VVLA 4C5OA 3Q6JA 3T0KA 3HZLA 3H4KA 2EQ9A 1H83A 4U8NA 5EBKA 3ATQA 3G5QA 1CJCA 4YJGB 1CC6A 4U8PA 2BABA 3EANA 2WDRA 3NYFA 4OPLA 3LZXA 3IWAA 4HA6A 3RNMA 1ZY8A 3ICTA 4APNA 1S2YA 2C65A 3G5RA 4EMIA 2WP9A 3OZ2A 4H4RA 1K0LA 5IQ1A 3CMMA 4JQ9A 1GRBA 5GRTA 3RP7A 3CIRA 1N4WA 1KF6A 4H4XA 4DNAA 4M52A 4H4SA 2Q0KA 2VZ2A 1BZLA 2C66A 4U8OA 5M0ZA 1PN0A 5HYMA 3LADA 4X4JA 2QAEA 3F8DA 3CNJA 2VVLG 1H7WA 2V5ZA 3DK8A 4U8MA 3UOZA 4B69A 3GYIA 4BK2A 4GDEA 1TDKA 2Y6QA 1VG9A 4GDPA 3B6DA 3CGCA 2JB3A 4YJDA 1LTXR 1MO9A 1CJ2A 4EIPA 1GRAA 3BI2A 3BNMA 3T2YA 2R4JA 2PHHA 1QO8A 1TYPA 2A8XA 2R9ZA 4GR1A 2Q6UA 1EL7A 3BI4A 3EF6A 4B1BA 4G73A 4CNKA 3AE2A 4H2PA 5C3JA 1RP0A 2WU5A 1PHHA 3T37A 1DOEA 1V59A 4HB9A 1EL8A 4IVMB 4AT2A 3GYXA 1B4VA 1GALA 3HYXA 3FIMB 1F8RA 1PXBA 4C77A 3AEEA 2A89A 2ZZCA 2GR0A 3M12A 2C7GA 3M13A 2JB2A 3AXBA 4K5RA 1F8WA 2WPCA 3AEDA 3AEFA 1GETA 3QFBA 3BHKA 1C0LA 2X8HA 2FBWA 4A79A 4AOXA 3AE8A 1CL0A 4YSYA 2B7RA 4YJGA 4C3XA 4U2TA 1XDIA 3C4AA 2YLTA 3SZCA 1D4CA 3QVRA 4YXDA 4JY2A 1KSSA 3T2KA 4YJFA 1F8SA 3UTFA 5KWFA 4IA6A 5KOWA 2E82A 1NHSA 2EQ8A 3QSSA 3AD7B 2GMHA 1NHRA 4K2XA 1GESA 2WESA 1ELIA 1GXFA 4NZHA 1PJ5A 3KKJA 1TDOA 4BK3A 4K8DA 2YR4A 3AE7A 5KMPA 4MJWA 3P4SA 3D8XA 1ZK7A 4AP1A 3NK2X 4U8LA 2EQ7A 1JNZA 2OA1A 4CY8A 3NYEA 2XLPA 1L9CA 3DJJA 4U2LA 3URHA 4AOSA 1NG3A 2XLTA 3GRSA 4JNQA 4RG3A 3ALMA 4J36A 1CJ3A 4GAPA 5KXJA 2WETA 4CY6A 1AOGA 1Q1WA 4EIQA 2B9YA 2O9ZA 3DGHA 4A7AA 5FS6A 4NEWA 4Y4NA 2YVJA 2GH5A 1EL9A 3SY4A 1KIFA 4ICYA 2F5ZA 3AEBA 1YQ3A 4BURA 2C64A 3S5WA 4BK1A 3IHGA 2FJDA 3QJ4A 4FDCB 2R45A 4AT0A 5M10A 1IUXA 1H86A 1OJ9A 2BCPA 4EQWA 3BHFA 3ABVA 3PO7A 1GT8A 2J3NA 2XVIA 3GD3A 2BK5A 4JDRA 2CFYA 3CNTA 3O0HA 4O5UA 2GAHB 1GERA 4GAVA 4TM1A 4Y4LA 3W4IA 1CF3A 1N4UA 3W4JA 1O95A 4B66A 3GRTA 2JB1A 2YVFA 2R0CA 4G9KA 1TYTA 1BF3A 3UKAA 1IUWA 3CN8A 3K7TA 1OJAA 4CNJA 1RYIA 3PVCA 1ONFA 2VVMA 3RHAA 1Q1RA 4LA1A 3AWIA 3VRDB 4Y4MA 1FL2A 1SEZA 4YT0A 4X9MA 2XVFA 1B37A 3KA7A 2VRMA 4FX9A 4UDPA 3F8RA 1GSNA 3IF9A 4YWOA 2E1MA 3UKQA 4C3YA 3V3OA 3VR8A 4H4ZA 5L46A 2GQWA 1EL5A 2VRLA 2YG7A 1KSUA 2YLXA 4H4YA 3P4QA 5EB4A 3T31A 1DOBA 2GF3A 5U1OA 3B3RA 4YJHB 2WDQA 5FS8A 1DJNA 5BUKA 5IPYA 4XWZA 2Z5YA 1B5QA 1GRGA 4Z2UA 3UKHA 1DODA 2C73A 3KD9A 1NENA 4G74A 2BS3A 2V3BA 4CBQA 2Y6RA 1UKVG 1GNDA 3UKPA 1PJ6A 1D4EA 3EAOA 1IUSA 1PDHA 3CNDA 4GRTA 4YTMA 1E6EA 2OLOA 3NK1X 2C75A 2XCGA 3LOVA 2BCGG 2YAUA 2R46A 1TDEA 2C3DA 1NEKA 1EBDA 2GQFA 2X8GA 3AE1A 4B65A 4EQRA 4Z26A 3CPIG 2QA1A 1N4VA 4BV6A 1L0VA 3QFAA 4JY3A 2WPEA 3FMWA 2OAMA 3VRAA 2X3NA 1M6IA 2GR2A 3SFEA 3NHOX 4UDRA 2WP5A 3UTEA 4EM3A 2FJAA 4JNAA 2AR8A 3NLCA 2YM1A 2GMJA 1CBOA 3CUKA 1K0JA 3NT6A 3AYIA 3P9UA 4H4PA 4XWRA 4A6NB 1ZX9A 5KRQA 2GB0A 3NIXA 2R0GA 2RGOA 1FEBA 1IUUA 3CNSA 2IIDA 4YTNA 1H7XA 3AB1A 1D7LA 3UKKA 2APGA 5KOXA 1JRXA 2WS3A 2W0HA 1RSGA 1GOSA 1GTEA 3OC4A 5IQ4A 2BXSA 4H2RA 3SXIA 2ZZBA 4OPTA 1NHPA 1PS9A 2XFNA 3AEGA 1OJCA 2BC0A 2V3AA 1O94A 1B8SA 3P4PA 4OPGA 2E49A 2YLWA 3VR9A 3SM8A 2BK4A 4B67A 3AD9B 4NWZA 4A65A 1PBDA 5JCKA 3CPJG 1LJ1A 2X8CA 1FEAA 3DJGX 3ISHA 3II4A 1KFYA 2YG6A 1P2EA 4H4VA 1N1PA 4JN9A 4OVIA 1PBEA 3ZNPA 4E0VA 2GRTA 4DSHA 4Z44A 4EMJA 1JEHA 3AD8B 2ZZ0A 1NHQA 3GMBA 4II2A 2XLRA 1VE9A 1E1LA 5TR3A 4Z25A 1LQUA 4FK1C 5CKUA 1PBFA 4PABA 3P1WA 4II3A 1GTHA 3IHMA 4BJYA 2WP6A 2A87A 2XLSA 3SZWA 2RABA 4QFCA 5FS7A 3T14A 2XYOA 5BVAA 4DGKA 2C72A 1CC4A 4H4QA 1GEUA 3QSEA 5KVIA 3ICSA 4YKGA 1GRFA 4H2NA 1VQWA 2WBAA 3BI5A 1JNRA 4EMWA 1REOA 1MOKA 4NNJA 3QVPA 3S61A 5JCNA 3SZ0A 3V3NA 2XLUA 2Z5XA 3CNPA 3K7QX 3C96A 3UTHA 2HQMA 2WQYA 4OPDA 3JSKA 4H4UA 4RG4A 5EOWA 1TRBA 4EQXA 3GDPA 2JK6A 1K0IA 1PXCA 5EB5A 3RP6A 1LQTA 2BA9A 2WEUA 4TLZA 5CQFA 3NN6X 1IJHA 1NAAA 2BS2A 2YG4A 3EPTA 1E39A 1DNCA 2V6OA 1DAOA 2V60A 2B76A 1YQZA 1MXTA 2WOWA 3BNUA 1Y0PA 3H8LA 3DH9A 1S2QA 2YLSA 3VQRA 2C3CA 4Z24A 3CTYA 2IVEA 2Q0LA 3LXDA 4U2SA 2VQBA 4H2QA 1BGNA 4J31A 4H7UA 1K4QA 2YVGA 3I3LA 4XXGA 1BWCA 3ITJA 3CGDA 3P4RA 5FS9A 5BULA 3NNEA 1BKWA 5FMHA 1DXLA 4IV9A 2QCUA 4OPUA 1JRYA 4YTPA 2TMDA 3AYJA 4IA5A 3ALJA 2GR1A 4A9WA 5KMQA 3REDA 4U8IA 5JCIA 1E1MA 2B9WA 3AE6A 3NKSA 3IC9A 1BGJA 5KVHA 2BK3A 2H88A 2EQ6A 5HY5A 2WDVA 4U8KA 3SZFA 2XVJA 3CPHG 3DK4A 4NTEA 4ZN0A 2YQUA 3AE9A 5ER0A 2H89A 1GRTA 4D04A 1COYA 4CCRA 3AE3A
chains in the Genus database with same CATH topology
2R4EA 3QSMA 3UCLA 5JCMA 3FBSA 2AQJA 1IUVA 2B9XA 3GYJA 3C4NA 2RGJA 2NVKX 2ARDA 3AE4A 4NEVA 4ADWA 2RGHA 1IUTA 4J34A 4H50A 1OJTA 3K30A 4KX6A 2VOUA 2DKHA 4TM0A 4DSGA 1KNPA 1Y56B 5HHFA 3NTDA 4K5SA 1H82A 2OLNA 4Z2TA 1W4XA 3SQPA 1JOAA 3E1TA 4CRTA 4YSXA 3UOYA 4U8JA 1YKJA 1LV0A 2ACZA 2C4CA 1L9DA 4G6GA 1CHUA 5KMRA 1D4DA 2FJBA 1YQ4A 3GD4A 1QLBA 3M0OA 4UP3A 3ATRA 4I58A 2PYXA 1F3PA 1ZOYA 1VDCA 3UOVA 1X31B 4I59A 1GV4A 4YSHA 1LVLA 2QA2A 2NPXA 2V61A 2WOVA 1H84A 4GUVA 4J33A 2BS4A 2ZBWA 4K22A 4TM4A 1GRHA 2BRAA 2FJEA 2YLRA 3UOXA 5JCLA 3GWDA 3CGEA 2BYBA 2OALA 4TLXA 4KPRA 3UKFA 2WHDA 1OJDA 2WU2A 2XVEA 1QJDA 2GV8A 1E1KA 2BXRA 4ZCDA 2I0ZA 3GMCA 3UP4A 3ALLA 4GF7A 3NGCX 1D5TA 2E4GA 3ZDNA 1H6VA 3ICRA 3K7MX 1KNRA 5U63A 3SX6A 1XHCA 4BJZA 4FK1A 4EQSA 2E5VA 1ZMCA 4USQA 1S3EA 1P2HA 1NPXA 2AAQA 3AECA 3GWFA 3GDNA 3V76A 4P9SA 4NTDA 1ZOVA 1JRZA 3FPZA 1Q9IA 2JAEA 4J57A 3GSIA 1GREA 4B64A 3NTAA 1ZMDA 3UKLA 1E1NA 1Y56A 1O5WA 2YG5A 3NK0X 4A5LA 4WX1A 4AP3A 4C74A 2WOIA 5KMSA 3HYWA 2BRYA 2YR6A 5DBJA 3H8IA 2YM2A 1FECA 1XANA 2VQ7A 3DJDA 1D7YA 2WPFA 4PAAA 3DK9A 3COXA 4Z2RA 2BACA 3WE0A 4REKA 2XFQA 3KPFA 4X9NA 2GR3A 4YKFA 4A6NA 2TPRA 3UP5A 5HXIA 1PBCA 3F8PA 5GSNA 1HYUA 2CVJA 5U25A 4ECHA 1NDAA 3SGLA 2R0PA 4GCMA 3ADAB 4UDQA 4YSZA 2XVHA 1GPEA 1E7PA 1YY5A 3PS9A 1F6MA 4RSLA 1PJ7A 3R9UA 5BRTA 3I6DA 3LZWA 1TDNA 3CGBA 4G6HA 1TDFA 1XPQA 2GVCA 2C76A 3SFDA 4A99A 1ZP0A 5J60A 3HYVA 1PBBA 3FG2P 3KU9A 4TM3A 2B7SA 1ZDLA 2GEWA 1FCDA 3DGZA 4IVOB 1VG0A 3LB8A 5J7XA 1DJQA 3DA1A 3LJPA 1JU2A 1H81A 2YR5A 4CCQA 2YWLA 1LPFA 1PXAA 2DKIA 1CJ4A 2YLZA 4N9XA 4OPIA 3NH3X 4WCTA 1ZKQA 4J2WA 2XFPA 3NYCA 2JKCA 4USRA 3NG7X 4D03A 1L9EA 4H4TA 3KPKA 1NG4A 3KLJA 5LV9A 4OCGA 3G5SA 2X99A 2XFOA 4J56A 1CC2A 3L1RA 4B68A 1M64A 2GAGB 1VRQB 5C2TA 4K7ZA 2X50A 2YG3A 2XFUA 3AE5A 2CULA 2BC1A 3VRBA 2Q7VA 4H4WA 4NTCA 4O5QA 4OPCA 2JBVA 1S3BA 3SYIA 3NRNA 3AEAA 3AYLA 4LIIA 2IVDA 4B63A 1FOHA 2UZZA 4EM4A 3ZYXA 2C67A 4LU6A 4ZCCA 2CDUA 3DMEA 3RP8A 2C70A 3UTGA 3T2ZA 1Z6LA 3D1CA 3L8KA 3Q9TA 1KDGA 2XDOA 1DOCA 5KNLA 3KVEA 4Z43A 3NN0X 3DJEA 2VVLA 4C5OA 3Q6JA 3T0KA 3H4KA 3HZLA 2EQ9A 1H83A 4U8NA 5EBKA 3ATQA 3G5QA 1CJCA 1CC6A 4U8PA 2BABA 3EANA 2WDRA 3NYFA 4OPLA 3LZXA 3IWAA 4HA6A 3RNMA 1ZY8A 3ICTA 4APNA 1S2YA 2C65A 3G5RA 4EMIA 2WP9A 3OZ2A 4H4RA 1K0LA 5IQ1A 3CMMA 4JQ9A 1GRBA 5GRTA 3RP7A 3CIRA 1N4WA 1KF6A 4H4XA 4DNAA 4M52A 4H4SA 2Q0KA 2VZ2A 1BZLA 2C66A 4U8OA 5M0ZA 5HYMA 1PN0A 3LADA 4X4JA 2QAEA 3F8DA 3CNJA 2VVLG 1H7WA 2V5ZA 3DK8A 4U8MA 3UOZA 4B69A 3GYIA 4BK2A 4GDEA 1TDKA 2Y6QA 1VG9A 4GDPA 3B6DA 3CGCA 2JB3A 1LTXR 1MO9A 4EIPA 1CJ2A 1GRAA 3BI2A 3BNMA 3T2YA 2R4JA 1QO8A 2A8XA 1TYPA 2PHHA 2R9ZA 4GR1A 2Q6UA 1EL7A 3BI4A 3EF6A 4B1BA 4G73A 4CNKA 3AE2A 4H2PA 5C3JA 1RP0A 2WU5A 1PHHA 3T37A 1DOEA 1V59A 4HB9A 1EL8A 4IVMB 4AT2A 3GYXA 1B4VA 1GALA 3HYXA 3FIMB 1F8RA 1PXBA 4C77A 3AEEA 2A89A 2ZZCA 2GR0A 3M12A 2C7GA 2JB2A 3M13A 3AXBA 4K5RA 1F8WA 2WPCA 3AEDA 3AEFA 1GETA 3QFBA 3BHKA 2X8HA 2FBWA 4A79A 4AOXA 3AE8A 1CL0A 4YSYA 2B7RA 4C3XA 4U2TA 1XDIA 3C4AA 2YLTA 3SZCA 1D4CA 3QVRA 4YXDA 4JY2A 1KSSA 3T2KA 3UTFA 1F8SA 5KWFA 4IA6A 5KOWA 1NHSA 2EQ8A 3QSSA 3AD7B 2GMHA 1NHRA 4K2XA 1GESA 2WESA 1ELIA 1GXFA 4NZHA 1PJ5A 3KKJA 1TDOA 4BK3A 4K8DA 2YR4A 3AE7A 5KMPA 4MJWA 3P4SA 3D8XA 1ZK7A 4AP1A 3NK2X 4U8LA 2EQ7A 1JNZA 2OA1A 4CY8A 2XLPA 3DJJA 1L9CA 3NYEA 4U2LA 3URHA 4AOSA 1NG3A 2XLTA 3GRSA 4JNQA 4RG3A 3ALMA 4J36A 1CJ3A 4GAPA 5KXJA 2WETA 4CY6A 1AOGA 1Q1WA 4EIQA 2B9YA 2O9ZA 3DGHA 4A7AA 5FS6A 4NEWA 4Y4NA 2YVJA 2GH5A 1EL9A 3SY4A 4ICYA 2F5ZA 3AEBA 1YQ3A 4BURA 2C64A 3S5WA 4BK1A 3IHGA 2FJDA 3QJ4A 4FDCB 2R45A 4AT0A 5M10A 1IUXA 1H86A 1OJ9A 2BCPA 4EQWA 3BHFA 3ABVA 3PO7A 1GT8A 2J3NA 2XVIA 3GD3A 2BK5A 4JDRA 2CFYA 3CNTA 3O0HA 4O5UA 1GERA 2GAHB 4GAVA 4TM1A 4Y4LA 1CF3A 1N4UA 1O95A 4B66A 3GRTA 2JB1A 2YVFA 2R0CA 4G9KA 1TYTA 1BF3A 3UKAA 1IUWA 3CN8A 3K7TA 1OJAA 4CNJA 1RYIA 3PVCA 1ONFA 2VVMA 3RHAA 1Q1RA 4LA1A 3AWIA 3VRDB 4Y4MA 1FL2A 1SEZA 4YT0A 2XVFA 4X9MA 1B37A 3KA7A 2VRMA 4FX9A 4UDPA 3F8RA 1GSNA 3IF9A 4YWOA 2E1MA 3UKQA 4C3YA 3V3OA 3VR8A 4H4ZA 5L46A 2GQWA 1EL5A 2VRLA 2YG7A 1KSUA 2YLXA 4H4YA 3P4QA 5EB4A 3T31A 1DOBA 2GF3A 5U1OA 3B3RA 2WDQA 5FS8A 1DJNA 5BUKA 5IPYA 4XWZA 2Z5YA 1B5QA 1GRGA 4Z2UA 3UKHA 1DODA 2C73A 3KD9A 1NENA 4G74A 2BS3A 2V3BA 4CBQA 2Y6RA 1UKVG 1GNDA 3UKPA 1PJ6A 1D4EA 3EAOA 1IUSA 1PDHA 3CNDA 4GRTA 4YTMA 1E6EA 2OLOA 3NK1X 2C75A 2XCGA 3LOVA 2BCGG 2YAUA 2R46A 2C3DA 1TDEA 1NEKA 1EBDA 2GQFA 2X8GA 3AE1A 4B65A 4EQRA 4Z26A 3CPIG 2QA1A 1N4VA 4BV6A 1L0VA 3QFAA 4JY3A 2WPEA 3FMWA 2OAMA 3VRAA 2X3NA 1M6IA 2GR2A 3SFEA 3NHOX 4UDRA 2WP5A 3UTEA 4EM3A 2FJAA 4JNAA 2AR8A 3NLCA 2YM1A 2GMJA 1CBOA 1K0JA 3NT6A 3AYIA 3P9UA 4H4PA 4XWRA 4A6NB 1ZX9A 5KRQA 2GB0A 3NIXA 2R0GA 2RGOA 1FEBA 1IUUA 3CNSA 2IIDA 4YTNA 1H7XA 3AB1A 1D7LA 3UKKA 2APGA 5KOXA 1JRXA 2WS3A 2W0HA 1RSGA 1GOSA 1GTEA 3OC4A 5IQ4A 2BXSA 4H2RA 3SXIA 2ZZBA 4OPTA 1NHPA 1PS9A 2XFNA 3AEGA 1OJCA 2BC0A 2V3AA 1O94A 1B8SA 3P4PA 4OPGA 2YLWA 3VR9A 2BK4A 3SM8A 4B67A 3AD9B 4NWZA 4A65A 1PBDA 5JCKA 3CPJG 1LJ1A 2X8CA 1FEAA 3DJGX 3ISHA 3II4A 1KFYA 2YG6A 1P2EA 4H4VA 1N1PA 4JN9A 4OVIA 1PBEA 4E0VA 2GRTA 4DSHA 4Z44A 4EMJA 1JEHA 2ZZ0A 3AD8B 1NHQA 3GMBA 4II2A 2XLRA 1E1LA 5TR3A 4Z25A 1LQUA 4FK1C 5CKUA 1PBFA 3P1WA 4II3A 4PABA 1GTHA 3IHMA 4BJYA 2WP6A 2A87A 2XLSA 3SZWA 2RABA 5FS7A 3T14A 2XYOA 5BVAA 4DGKA 2C72A 1CC4A 4H4QA 1GEUA 3QSEA 5KVIA 3ICSA 4YKGA 1GRFA 4H2NA 1VQWA 2WBAA 3BI5A 1JNRA 4EMWA 1REOA 1MOKA 4NNJA 3QVPA 3S61A 5JCNA 3SZ0A 3V3NA 2XLUA 2Z5XA 3CNPA 3K7QX 3C96A 3UTHA 2HQMA 2WQYA 4OPDA 3JSKA 4H4UA 4RG4A 5EOWA 1TRBA 4EQXA 3GDPA 2JK6A 1K0IA 1PXCA 5EB5A 3RP6A 1LQTA 2BA9A 2WEUA 4TLZA 5CQFA 3NN6X 1IJHA 1NAAA 2BS2A 2YG4A 3EPTA 1E39A 1DNCA 2V6OA 2V60A 2B76A 1YQZA 1MXTA 2WOWA 3BNUA 1Y0PA 3H8LA 3DH9A 1S2QA 2YLSA 2C3CA 3VQRA 4Z24A 3CTYA 2IVEA 2Q0LA 3LXDA 4U2SA 2VQBA 4H2QA 1BGNA 4J31A 4H7UA 1K4QA 2YVGA 3I3LA 4XXGA 1BWCA 3ITJA 3CGDA 3P4RA 5FS9A 5BULA 3NNEA 1BKWA 5FMHA 1DXLA 4IV9A 2QCUA 4OPUA 1JRYA 4YTPA 2TMDA 3AYJA 4IA5A 3ALJA 2GR1A 4A9WA 5KMQA 3REDA 4U8IA 5JCIA 1E1MA 2B9WA 3AE6A 3NKSA 3IC9A 1BGJA 5KVHA 2BK3A 2H88A 2EQ6A 5HY5A 2WDVA 4U8KA 3SZFA 2XVJA 3CPHG 3DK4A 4NTEA 4ZN0A 2YQUA 3AE9A 5ER0A 2H89A 1GRTA 4D04A 1COYA 4CCRA 3AE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4E A;  3QSM A;  3UCL A;  5JCM A;  3FBS A;  2AQJ A;  1IUV A;  2B9X A;  3GYJ A;  3C4N A;  2NVK X;  2RGJ A;  2ARD A;  3AE4 A;  4NEV A;  4ADW A;  2RGH A;  1IUT A;  4J34 A;  4H50 A;  1OJT A;  3K30 A;  4KX6 A;  2VOU A;  2DKH A;  4TM0 A;  4DSG A;  1KNP A;  1Y56 B;  5HHF A;  3NTD A;  4K5S A;  1H82 A;  2OLN A;  4Z2T A;  1W4X A;  3SQP A;  1JOA A;  3E1T A;  4CRT A;  4YSX A;  3UOY A;  4U8J A;  1YKJ A;  1LV0 A;  2ACZ A;  1L9D A;  1CHU A;  1D4D A;  2FJB A;  1YQ4 A;  3GD4 A;  1QLB A;  3M0O A;  4UP3 A;  3ATR A;  4I58 A;  2PYX A;  1F3P A;  1ZOY A;  1VDC A;  3UOV A;  1X31 B;  4I59 A;  1GV4 A;  4YSH A;  1LVL A;  2QA2 A;  2NPX A;  2V61 A;  2WOV A;  1H84 A;  4GUV A;  4J33 A;  2BS4 A;  2ZBW A;  4K22 A;  4TM4 A;  1GRH A;  2FJE A;  2YLR A;  3UOX A;  5JCL A;  3GWD A;  3CGE A;  2BYB A;  2OAL A;  4TLX A;  4KPR A;  3UKF A;  2WHD A;  1OJD A;  2WU2 A;  2XVE A;  1QJD A;  2GV8 A;  1E1K A;  2BXR A;  4ZCD A;  2I0Z A;  3GMC A;  3UP4 A;  3ALL A;  4GF7 A;  3NGC X;  1D5T A;  2E4G A;  3ZDN A;  1H6V A;  3ICR A;  3K7M X;  1KNR A;  5U63 A;  1XHC A;  4FK1 A;  4BJZ A;  4EQS A;  2E5V A;  1ZMC A;  4USQ A;  1S3E A;  1P2H A;  1NPX A;  2AAQ A;  3AEC A;  3GWF A;  3GDN A;  3V76 A;  4P9S A;  4NTD A;  1ZOV A;  1JRZ A;  3FPZ A;  1Q9I A;  2JAE A;  4J57 A;  3GSI A;  1GRE A;  4B64 A;  3NTA A;  1ZMD A;  3UKL A;  1E1N A;  1Y56 A;  1O5W A;  2YG5 A;  3NK0 X;  4A5L A;  4WX1 A;  4AP3 A;  4C74 A;  2WOI A;  2YR6 A;  5DBJ A;  3H8I A;  2YM2 A;  1FEC A;  1XAN A;  2VQ7 A;  3DJD A;  1D7Y A;  2WPF A;  4PAA A;  3DK9 A;  3COX A;  4Z2R A;  2BAC A;  3WE0 A;  4REK A;  2XFQ A;  3KPF A;  4X9N A;  2GR3 A;  4YKF A;  4A6N A;  2TPR A;  3UP5 A;  5HXI A;  1PBC A;  3F8P A;  5GSN A;  1HYU A;  2CVJ A;  5U25 A;  4ECH A;  1NDA A;  3SGL A;  2R0P A;  4GCM A;  3ADA B;  4UDQ A;  4YSZ A;  2XVH A;  1GPE A;  1E7P A;  1YY5 A;  3PS9 A;  1F6M A;  4RSL A;  1PJ7 A;  3R9U A;  5BRT A;  3I6D A;  3LZW A;  1TDN A;  3CGB A;  1TDF A;  1XPQ A;  2GVC A;  2C76 A;  3SFD A;  4A99 A;  1ZP0 A;  5J60 A;  1PBB A;  3FG2 P;  3KU9 A;  4TM3 A;  2B7S A;  1ZDL A;  2GEW A;  1FCD A;  3DGZ A;  4IVO B;  1VG0 A;  3LB8 A;  5J7X A;  1DJQ A;  3DA1 A;  3LJP A;  1JU2 A;  1H81 A;  2YR5 A;  4CCQ A;  2YWL A;  1LPF A;  1PXA A;  2DKI A;  1CJ4 A;  2YLZ A;  4N9X A;  4OPI A;  3NH3 X;  4WCT A;  1ZKQ A;  4J2W A;  2XFP A;  3NYC A;  2JKC A;  4USR A;  3NG7 X;  4D03 A;  1L9E A;  4H4T A;  1NG4 A;  3KLJ A;  5LV9 A;  4OCG A;  3G5S A;  2X99 A;  2XFO A;  4J56 A;  1CC2 A;  3L1R A;  4B68 A;  1M64 A;  2GAG B;  1VRQ B;  5C2T A;  4K7Z A;  2X50 A;  2YG3 A;  2XFU A;  3AE5 A;  2CUL A;  2BC1 A;  3VRB A;  2Q7V A;  4H4W A;  4NTC A;  4O5Q A;  4OPC A;  2JBV A;  1S3B A;  3NRN A;  3AEA A;  3AYL A;  4LII A;  2IVD A;  4B63 A;  1FOH A;  2UZZ A;  4EM4 A;  3ZYX A;  2C67 A;  4LU6 A;  4ZCC A;  2CDU A;  3DME A;  2C70 A;  3RP8 A;  3UTG A;  1Z6L A;  3D1C A;  3L8K A;  3Q9T A;  1KDG A;  2XDO A;  1DOC A;  3KVE A;  4Z43 A;  3NN0 X;  3DJE A;  2VVL A;  4C5O A;  3Q6J A;  3H4K A;  3HZL A;  2EQ9 A;  1H83 A;  4U8N A;  5EBK A;  3ATQ A;  3G5Q A;  1CJC A;  1CC6 A;  4U8P A;  2BAB A;  3EAN A;  2WDR A;  3NYF A;  4OPL A;  3LZX A;  3IWA A;  4HA6 A;  3RNM A;  1ZY8 A;  3ICT A;  4APN A;  1S2Y A;  2C65 A;  3G5R A;  4EMI A;  2WP9 A;  3OZ2 A;  4H4R A;  1K0L A;  5IQ1 A;  4JQ9 A;  1GRB A;  5GRT A;  3RP7 A;  3CIR A;  1N4W A;  1KF6 A;  4H4X A;  4DNA A;  4M52 A;  4H4S A;  2Q0K A;  2VZ2 A;  1BZL A;  2C66 A;  4U8O A;  5M0Z A;  1PN0 A;  5HYM A;  3LAD A;  4X4J A;  2QAE A;  3F8D A;  3CNJ A;  2VVL G;  1H7W A;  2V5Z A;  3DK8 A;  4U8M A;  3UOZ A;  4B69 A;  3GYI A;  4BK2 A;  4GDE A;  1TDK A;  2Y6Q A;  1VG9 A;  4GDP A;  3B6D A;  3CGC A;  2JB3 A;  1LTX R;  1MO9 A;  4EIP A;  1CJ2 A;  1GRA A;  3BI2 A;  3BNM A;  2R4J A;  1QO8 A;  2A8X A;  1TYP A;  2PHH A;  2R9Z A;  4GR1 A;  2Q6U A;  1EL7 A;  3BI4 A;  3EF6 A;  4B1B A;  4CNK A;  3AE2 A;  4H2P A;  5C3J A;  1RP0 A;  2WU5 A;  1PHH A;  3T37 A;  1DOE A;  1V59 A;  4HB9 A;  1EL8 A;  4IVM B;  4AT2 A;  1B4V A;  1GAL A;  3FIM B;  1F8R A;  1PXB A;  4C77 A;  3AEE A;  2A89 A;  2ZZC A;  2GR0 A;  3M12 A;  2C7G A;  2JB2 A;  3M13 A;  3AXB A;  4K5R A;  1F8W A;  2WPC A;  3AED A;  3AEF A;  1GET A;  3QFB A;  3BHK A;  2X8H A;  2FBW A;  4A79 A;  4AOX A;  3AE8 A;  1CL0 A;  4YSY A;  2B7R A;  4C3X A;  4U2T A;  1XDI A;  2YLT A;  3C4A A;  1D4C A;  3QVR A;  4YXD A;  4JY2 A;  1KSS A;  3UTF A;  1F8S A;  5KWF A;  4IA6 A;  5KOW A;  1NHS A;  2EQ8 A;  3QSS A;  3AD7 B;  2GMH A;  1NHR A;  4K2X A;  1GES A;  2WES A;  1ELI A;  1GXF A;  4NZH A;  1PJ5 A;  3KKJ A;  1TDO A;  4BK3 A;  4K8D A;  2YR4 A;  3AE7 A;  4MJW A;  3P4S A;  3D8X A;  1ZK7 A;  4AP1 A;  3NK2 X;  4U8L A;  2EQ7 A;  1JNZ A;  2OA1 A;  4CY8 A;  2XLP A;  3DJJ A;  1L9C A;  3NYE A;  4U2L A;  3URH A;  4AOS A;  1NG3 A;  2XLT A;  3GRS A;  4JNQ A;  4RG3 A;  3ALM A;  4J36 A;  1CJ3 A;  5KXJ A;  2WET A;  4CY6 A;  1AOG A;  1Q1W A;  4EIQ A;  2B9Y A;  2O9Z A;  3DGH A;  4A7A A;  5FS6 A;  4NEW A;  4Y4N A;  2YVJ A;  2GH5 A;  1EL9 A;  4ICY A;  2F5Z A;  3AEB A;  1YQ3 A;  4BUR A;  2C64 A;  3S5W A;  2FJD A;  3IHG A;  3QJ4 A;  4BK1 A;  4FDC B;  2R45 A;  4AT0 A;  5M10 A;  1IUX A;  1H86 A;  1OJ9 A;  2BCP A;  4EQW A;  3BHF A;  3ABV A;  3PO7 A;  1GT8 A;  2J3N A;  2XVI A;  3GD3 A;  2BK5 A;  4JDR A;  2CFY A;  3CNT A;  3O0H A;  4O5U A;  1GER A;  2GAH B;  4TM1 A;  4Y4L A;  1CF3 A;  1N4U A;  1O95 A;  4B66 A;  3GRT A;  2JB1 A;  2YVF A;  2R0C A;  1TYT A;  1BF3 A;  3UKA A;  1IUW A;  3CN8 A;  3K7T A;  1OJA A;  4CNJ A;  1RYI A;  3PVC A;  1ONF A;  2VVM A;  3RHA A;  1Q1R A;  4LA1 A;  3AWI A;  3VRD B;  4Y4M A;  1FL2 A;  1SEZ A;  4YT0 A;  2XVF A;  4X9M A;  1B37 A;  3KA7 A;  2VRM A;  4FX9 A;  4UDP A;  3F8R A;  1GSN A;  3IF9 A;  4YWO A;  2E1M A;  3UKQ A;  4C3Y A;  3V3O A;  3VR8 A;  4H4Z A;  5L46 A;  2GQW A;  1EL5 A;  2VRL A;  2YG7 A;  1KSU A;  2YLX A;  4H4Y A;  3P4Q A;  5EB4 A;  1DOB A;  2GF3 A;  5U1O A;  3B3R A;  2WDQ A;  5FS8 A;  1DJN A;  5BUK A;  5IPY A;  4XWZ A;  2Z5Y A;  1B5Q A;  1GRG A;  4Z2U A;  3UKH A;  1DOD A;  2C73 A;  3KD9 A;  1NEN A;  2BS3 A;  2V3B A;  4CBQ A;  2Y6R A;  1UKV G;  1GND A;  3UKP A;  1PJ6 A;  1D4E A;  3EAO A;  1IUS A;  1PDH A;  3CND A;  4GRT A;  4YTM A;  1E6E A;  2OLO A;  3NK1 X;  2C75 A;  2XCG A;  3LOV A;  2BCG G;  2YAU A;  2R46 A;  2C3D A;  1TDE A;  1NEK A;  1EBD A;  2GQF A;  2X8G A;  3AE1 A;  4B65 A;  4EQR A;  4Z26 A;  3CPI G;  2QA1 A;  1N4V A;  4BV6 A;  1L0V A;  3QFA A;  4JY3 A;  2WPE A;  3FMW A;  2OAM A;  3VRA A;  2X3N A;  1M6I A;  2GR2 A;  3SFE A;  3NHO X;  4UDR A;  2WP5 A;  3UTE A;  4EM3 A;  2FJA A;  4JNA A;  2AR8 A;  3NLC A;  2YM1 A;  1CBO A;  2GMJ A;  1K0J A;  3NT6 A;  3AYI A;  3P9U A;  4H4P A;  4XWR A;  4A6N B;  1ZX9 A;  5KRQ A;  2GB0 A;  3NIX A;  2R0G A;  2RGO A;  1FEB A;  1IUU A;  3CNS A;  2IID A;  4YTN A;  1H7X A;  3AB1 A;  1D7L A;  3UKK A;  2APG A;  5KOX A;  1JRX A;  2WS3 A;  2W0H A;  1RSG A;  1GOS A;  1GTE A;  3OC4 A;  5IQ4 A;  2BXS A;  4H2R A;  2ZZB A;  4OPT A;  1NHP A;  1PS9 A;  2XFN A;  3AEG A;  1OJC A;  2BC0 A;  2V3A A;  1O94 A;  1B8S A;  3P4P A;  4OPG A;  2YLW A;  3VR9 A;  2BK4 A;  3SM8 A;  4B67 A;  3AD9 B;  4A65 A;  5JCK A;  1PBD A;  3CPJ G;  1LJ1 A;  2X8C A;  1FEA A;  3DJG X;  3ISH A;  3II4 A;  1KFY A;  2YG6 A;  1P2E A;  4H4V A;  1N1P A;  4JN9 A;  4OVI A;  1PBE A;  4E0V A;  2GRT A;  4DSH A;  4Z44 A;  4EMJ A;  1JEH A;  2ZZ0 A;  3AD8 B;  1NHQ A;  3GMB A;  2XLR A;  1E1L A;  5TR3 A;  4Z25 A;  1LQU A;  4FK1 C;  5CKU A;  1PBF A;  3P1W A;  4PAB A;  1GTH A;  3IHM A;  4BJY A;  2WP6 A;  2A87 A;  2XLS A;  2RAB A;  5FS7 A;  2XYO A;  5BVA A;  4DGK A;  2C72 A;  1CC4 A;  4H4Q A;  1GEU A;  3QSE A;  5KVI A;  3ICS A;  4YKG A;  1GRF A;  4H2N A;  1VQW A;  2WBA A;  3BI5 A;  1JNR A;  4EMW A;  1REO A;  1MOK A;  3QVP A;  3S61 A;  5JCN A;  3V3N A;  2XLU A;  2Z5X A;  3CNP A;  3K7Q X;  3C96 A;  3UTH A;  2HQM A;  2WQY A;  4OPD A;  3JSK A;  4H4U A;  4RG4 A;  5EOW A;  1TRB A;  4EQX A;  3GDP A;  2JK6 A;  1K0I A;  1PXC A;  5EB5 A;  2BA9 A;  1LQT A;  2WEU A;  4TLZ A;  5CQF A;  3RP6 A;  3NN6 X;  1IJH A;  1NAA A;  2BS2 A;  2YG4 A;  3EPT A;  1E39 A;  1DNC A;  2V6O A;  2V60 A;  2B76 A;  1YQZ A;  1MXT A;  2WOW A;  3BNU A;  1Y0P A;  3H8L A;  3DH9 A;  1S2Q A;  2YLS A;  2C3C A;  3VQR A;  4Z24 A;  3CTY A;  2IVE A;  2Q0L A;  3LXD A;  4U2S A;  2VQB A;  4H2Q A;  1BGN A;  4J31 A;  4H7U A;  1K4Q A;  2YVG A;  3I3L A;  4XXG A;  1BWC A;  3ITJ A;  3CGD A;  3P4R A;  5FS9 A;  5BUL A;  3NNE A;  1BKW A;  5FMH A;  1DXL A;  4IV9 A;  2QCU A;  4OPU A;  1JRY A;  4YTP A;  2TMD A;  3AYJ A;  4IA5 A;  3ALJ A;  2GR1 A;  4A9W A;  3RED A;  4U8I A;  5JCI A;  1E1M A;  2B9W A;  3AE6 A;  3NKS A;  3IC9 A;  1BGJ A;  5KVH A;  2BK3 A;  2H88 A;  2EQ6 A;  5HY5 A;  2WDV A;  4U8K A;  2XVJ A;  3CPH G;  3DK4 A;  4NTE A;  4ZN0 A;  2YQU A;  3AE9 A;  5ER0 A;  2H89 A;  1GRT A;  4D04 A;  1COY A;  4CCR A;  3AE3 A; 
#chains in the Genus database with same CATH topology
 2R4E A;  3QSM A;  3UCL A;  5JCM A;  3ZNQ A;  3FBS A;  2AQJ A;  1IUV A;  2B9X A;  3GYJ A;  3C4N A;  2RGJ A;  2NVK X;  2ARD A;  3AE4 A;  4NEV A;  4ADW A;  2RGH A;  1IUT A;  4J34 A;  4H50 A;  1OJT A;  3K30 A;  4KX6 A;  2VOU A;  2DKH A;  4TM0 A;  4DSG A;  1KNP A;  1Y56 B;  5HHF A;  3NTD A;  4K5S A;  1H82 A;  2OLN A;  4Z2T A;  1W4X A;  3SQP A;  1JOA A;  3E1T A;  4CRT A;  4YSX A;  3UOY A;  4U8J A;  1YKJ A;  1LV0 A;  2ACZ A;  2C4C A;  1L9D A;  4YJF B;  4G6G A;  1CHU A;  5KMR A;  1D4D A;  2FJB A;  3M0O A;  1YQ4 A;  1QLB A;  3GD4 A;  4UP3 A;  3ATR A;  4I58 A;  2PYX A;  1F3P A;  1ZOY A;  1VDC A;  3UOV A;  1X31 B;  4I59 A;  4QFD A;  1GV4 A;  4YSH A;  1LVL A;  2QA2 A;  2NPX A;  2V61 A;  2WOV A;  1H84 A;  4GUV A;  4J33 A;  1EVI A;  2BS4 A;  2ZBW A;  4K22 A;  4TM4 A;  1GRH A;  2BRA A;  2FJE A;  2YLR A;  3UOX A;  5JCL A;  3GWD A;  3CGE A;  2BYB A;  3G3E A;  2OAL A;  4YJH A;  4TLX A;  4KPR A;  3UKF A;  2WHD A;  1OJD A;  2WU2 A;  2XVE A;  1QJD A;  2GV8 A;  1E1K A;  2BXR A;  4ZCD A;  2I0Z A;  3GMC A;  3UP4 A;  1C0I A;  3ALL A;  4GF7 A;  3NGC X;  1D5T A;  2E4G A;  3ZDN A;  1H6V A;  3ICR A;  3K7M X;  1KNR A;  5U63 A;  3SX6 A;  1XHC A;  4BJZ A;  4FK1 A;  4EQS A;  2E5V A;  1ZMC A;  4USQ A;  1S3E A;  1P2H A;  1NPX A;  2AAQ A;  3AEC A;  3GWF A;  3GDN A;  3V76 A;  4P9S A;  4NTD A;  1ZOV A;  1JRZ A;  3FPZ A;  1Q9I A;  3WGT A;  2JAE A;  4J57 A;  3GSI A;  1GRE A;  4B64 A;  3NTA A;  1ZMD A;  3UKL A;  1E1N A;  1Y56 A;  1O5W A;  3ZNN A;  2YG5 A;  3NK0 X;  4WX1 A;  4A5L A;  4AP3 A;  2WOI A;  4C74 A;  3HYW A;  5KMS A;  2BRY A;  2YR6 A;  5DBJ A;  3H8I A;  2YM2 A;  1FEC A;  4PAA A;  1XAN A;  3DJD A;  1D7Y A;  2VQ7 A;  2WPF A;  3DK9 A;  3COX A;  4Z2R A;  2BAC A;  3WE0 A;  4REK A;  2XFQ A;  3KPF A;  4X9N A;  2GR3 A;  4YKF A;  4A6N A;  2TPR A;  1AN9 A;  3UP5 A;  1PBC A;  5HXI A;  3F8P A;  5GSN A;  1HYU A;  2CVJ A;  1C0K A;  5U25 A;  4ECH A;  1NDA A;  3SGL A;  2R0P A;  4GCM A;  3ADA B;  4UDQ A;  4YSZ A;  2XVH A;  1GPE A;  3PS9 A;  4RSL A;  1E7P A;  1F6M A;  1YY5 A;  1PJ7 A;  3R9U A;  5BRT A;  3I6D A;  3LZW A;  1TDN A;  3CGB A;  4G6H A;  1TDF A;  1XPQ A;  2GVC A;  2C76 A;  3SFD A;  4A99 A;  1ZP0 A;  5J60 A;  3HYV A;  1PBB A;  3FG2 P;  3KU9 A;  2DU8 A;  4TM3 A;  2B7S A;  1ZDL A;  2GEW A;  1FCD A;  3DGZ A;  4IVO B;  1VG0 A;  3LB8 A;  5J7X A;  3DA1 A;  1DJQ A;  2E48 A;  1JU2 A;  1H81 A;  2YR5 A;  3LJP A;  2YWL A;  1LPF A;  4CCQ A;  1PXA A;  2DKI A;  1CJ4 A;  2YLZ A;  1C0P A;  4N9X A;  4OPI A;  3NH3 X;  4WCT A;  1ZKQ A;  4J2W A;  3NYC A;  2XFP A;  2JKC A;  4USR A;  3NG7 X;  4D03 A;  1L9E A;  4H4T A;  3KPK A;  1NG4 A;  3KLJ A;  5LV9 A;  4OCG A;  3G5S A;  2X99 A;  2XFO A;  3W4K A;  1CC2 A;  4J56 A;  3L1R A;  4B68 A;  1M64 A;  2GAG B;  1VRQ B;  1DDO A;  5C2T A;  4K7Z A;  2X50 A;  2YG3 A;  2XFU A;  3AE5 A;  2CUL A;  2BC1 A;  3VRB A;  2Q7V A;  4H4W A;  4NTC A;  4O5Q A;  4OPC A;  2JBV A;  1S3B A;  3SYI A;  3NRN A;  3AEA A;  3AYL A;  4LII A;  2IVD A;  4B63 A;  1FOH A;  2UZZ A;  4EM4 A;  3ZYX A;  2C67 A;  4LU6 A;  4ZCC A;  2CDU A;  3DME A;  3RP8 A;  3ZNO A;  2C70 A;  3T2Z A;  3UTG A;  1Z6L A;  3D1C A;  3L8K A;  2E4A A;  3Q9T A;  1KDG A;  2XDO A;  1DOC A;  5KNL A;  3KVE A;  4Z43 A;  3NN0 X;  3DJE A;  2VVL A;  4C5O A;  3Q6J A;  3T0K A;  3HZL A;  3H4K A;  2EQ9 A;  1H83 A;  4U8N A;  5EBK A;  3ATQ A;  3G5Q A;  1CJC A;  4YJG B;  1CC6 A;  4U8P A;  2BAB A;  3EAN A;  2WDR A;  3NYF A;  4OPL A;  3LZX A;  3IWA A;  4HA6 A;  3RNM A;  1ZY8 A;  3ICT A;  4APN A;  1S2Y A;  2C65 A;  3G5R A;  4EMI A;  2WP9 A;  3OZ2 A;  4H4R A;  1K0L A;  5IQ1 A;  3CMM A;  4JQ9 A;  1GRB A;  5GRT A;  3RP7 A;  3CIR A;  1N4W A;  1KF6 A;  4H4X A;  4DNA A;  4M52 A;  4H4S A;  2Q0K A;  2VZ2 A;  1BZL A;  2C66 A;  4U8O A;  5M0Z A;  1PN0 A;  5HYM A;  3LAD A;  4X4J A;  2QAE A;  3F8D A;  3CNJ A;  2VVL G;  1H7W A;  2V5Z A;  3DK8 A;  4U8M A;  3UOZ A;  4B69 A;  3GYI A;  4BK2 A;  4GDE A;  1TDK A;  2Y6Q A;  1VG9 A;  4GDP A;  3B6D A;  3CGC A;  2JB3 A;  4YJD A;  1LTX R;  1MO9 A;  1CJ2 A;  4EIP A;  1GRA A;  3BI2 A;  3BNM A;  3T2Y A;  2R4J A;  2PHH A;  1QO8 A;  1TYP A;  2A8X A;  2R9Z A;  4GR1 A;  2Q6U A;  1EL7 A;  3BI4 A;  3EF6 A;  4B1B A;  4G73 A;  4CNK A;  3AE2 A;  4H2P A;  5C3J A;  1RP0 A;  2WU5 A;  1PHH A;  3T37 A;  1DOE A;  1V59 A;  4HB9 A;  1EL8 A;  4IVM B;  4AT2 A;  3GYX A;  1B4V A;  1GAL A;  3HYX A;  3FIM B;  1F8R A;  1PXB A;  4C77 A;  3AEE A;  2A89 A;  2ZZC A;  2GR0 A;  3M12 A;  2C7G A;  3M13 A;  2JB2 A;  3AXB A;  4K5R A;  1F8W A;  2WPC A;  3AED A;  3AEF A;  1GET A;  3QFB A;  3BHK A;  1C0L A;  2X8H A;  2FBW A;  4A79 A;  4AOX A;  3AE8 A;  1CL0 A;  4YSY A;  2B7R A;  4YJG A;  4C3X A;  4U2T A;  1XDI A;  3C4A A;  2YLT A;  3SZC A;  1D4C A;  3QVR A;  4YXD A;  4JY2 A;  1KSS A;  3T2K A;  4YJF A;  1F8S A;  3UTF A;  5KWF A;  4IA6 A;  5KOW A;  2E82 A;  1NHS A;  2EQ8 A;  3QSS A;  3AD7 B;  2GMH A;  1NHR A;  4K2X A;  1GES A;  2WES A;  1ELI A;  1GXF A;  4NZH A;  1PJ5 A;  3KKJ A;  1TDO A;  4BK3 A;  4K8D A;  2YR4 A;  3AE7 A;  5KMP A;  4MJW A;  3P4S A;  3D8X A;  1ZK7 A;  4AP1 A;  3NK2 X;  4U8L A;  2EQ7 A;  1JNZ A;  2OA1 A;  4CY8 A;  3NYE A;  2XLP A;  1L9C A;  3DJJ A;  4U2L A;  3URH A;  4AOS A;  1NG3 A;  2XLT A;  3GRS A;  4JNQ A;  4RG3 A;  3ALM A;  4J36 A;  1CJ3 A;  4GAP A;  5KXJ A;  2WET A;  4CY6 A;  1AOG A;  1Q1W A;  4EIQ A;  2B9Y A;  2O9Z A;  3DGH A;  4A7A A;  5FS6 A;  4NEW A;  4Y4N A;  2YVJ A;  2GH5 A;  1EL9 A;  3SY4 A;  1KIF A;  4ICY A;  2F5Z A;  3AEB A;  1YQ3 A;  4BUR A;  2C64 A;  3S5W A;  4BK1 A;  3IHG A;  2FJD A;  3QJ4 A;  4FDC B;  2R45 A;  4AT0 A;  5M10 A;  1IUX A;  1H86 A;  1OJ9 A;  2BCP A;  4EQW A;  3BHF A;  3ABV A;  3PO7 A;  1GT8 A;  2J3N A;  2XVI A;  3GD3 A;  2BK5 A;  4JDR A;  2CFY A;  3CNT A;  3O0H A;  4O5U A;  2GAH B;  1GER A;  4GAV A;  4TM1 A;  4Y4L A;  3W4I A;  1CF3 A;  1N4U A;  3W4J A;  1O95 A;  4B66 A;  3GRT A;  2JB1 A;  2YVF A;  2R0C A;  4G9K A;  1TYT A;  1BF3 A;  3UKA A;  1IUW A;  3CN8 A;  3K7T A;  1OJA A;  4CNJ A;  1RYI A;  3PVC A;  1ONF A;  2VVM A;  3RHA A;  1Q1R A;  4LA1 A;  3AWI A;  3VRD B;  4Y4M A;  1FL2 A;  1SEZ A;  4YT0 A;  4X9M A;  2XVF A;  1B37 A;  3KA7 A;  2VRM A;  4FX9 A;  4UDP A;  3F8R A;  1GSN A;  3IF9 A;  4YWO A;  2E1M A;  3UKQ A;  4C3Y A;  3V3O A;  3VR8 A;  4H4Z A;  5L46 A;  2GQW A;  1EL5 A;  2VRL A;  2YG7 A;  1KSU A;  2YLX A;  4H4Y A;  3P4Q A;  5EB4 A;  3T31 A;  1DOB A;  2GF3 A;  5U1O A;  3B3R A;  4YJH B;  2WDQ A;  5FS8 A;  1DJN A;  5BUK A;  5IPY A;  4XWZ A;  2Z5Y A;  1B5Q A;  1GRG A;  4Z2U A;  3UKH A;  1DOD A;  2C73 A;  3KD9 A;  1NEN A;  4G74 A;  2BS3 A;  2V3B A;  4CBQ A;  2Y6R A;  1UKV G;  1GND A;  3UKP A;  1PJ6 A;  1D4E A;  3EAO A;  1IUS A;  1PDH A;  3CND A;  4GRT A;  4YTM A;  1E6E A;  2OLO A;  3NK1 X;  2C75 A;  2XCG A;  3LOV A;  2BCG G;  2YAU A;  2R46 A;  1TDE A;  2C3D A;  1NEK A;  1EBD A;  2GQF A;  2X8G A;  3AE1 A;  4B65 A;  4EQR A;  4Z26 A;  3CPI G;  2QA1 A;  1N4V A;  4BV6 A;  1L0V A;  3QFA A;  4JY3 A;  2WPE A;  3FMW A;  2OAM A;  3VRA A;  2X3N A;  1M6I A;  2GR2 A;  3SFE A;  3NHO X;  4UDR A;  2WP5 A;  3UTE A;  4EM3 A;  2FJA A;  4JNA A;  2AR8 A;  3NLC A;  2YM1 A;  2GMJ A;  1CBO A;  3CUK A;  1K0J A;  3NT6 A;  3AYI A;  3P9U A;  4H4P A;  4XWR A;  4A6N B;  1ZX9 A;  5KRQ A;  2GB0 A;  3NIX A;  2R0G A;  2RGO A;  1FEB A;  1IUU A;  3CNS A;  2IID A;  4YTN A;  1H7X A;  3AB1 A;  1D7L A;  3UKK A;  2APG A;  5KOX A;  1JRX A;  2WS3 A;  2W0H A;  1RSG A;  1GOS A;  1GTE A;  3OC4 A;  5IQ4 A;  2BXS A;  4H2R A;  3SXI A;  2ZZB A;  4OPT A;  1NHP A;  1PS9 A;  2XFN A;  3AEG A;  1OJC A;  2BC0 A;  2V3A A;  1O94 A;  1B8S A;  3P4P A;  4OPG A;  2E49 A;  2YLW A;  3VR9 A;  3SM8 A;  2BK4 A;  4B67 A;  3AD9 B;  4NWZ A;  4A65 A;  1PBD A;  5JCK A;  3CPJ G;  1LJ1 A;  2X8C A;  1FEA A;  3DJG X;  3ISH A;  3II4 A;  1KFY A;  2YG6 A;  1P2E A;  4H4V A;  1N1P A;  4JN9 A;  4OVI A;  1PBE A;  3ZNP A;  4E0V A;  2GRT A;  4DSH A;  4Z44 A;  4EMJ A;  1JEH A;  3AD8 B;  2ZZ0 A;  1NHQ A;  3GMB A;  4II2 A;  2XLR A;  1VE9 A;  1E1L A;  5TR3 A;  4Z25 A;  1LQU A;  4FK1 C;  5CKU A;  1PBF A;  4PAB A;  3P1W A;  4II3 A;  1GTH A;  3IHM A;  4BJY A;  2WP6 A;  2A87 A;  2XLS A;  3SZW A;  2RAB A;  4QFC A;  5FS7 A;  3T14 A;  2XYO A;  5BVA A;  4DGK A;  2C72 A;  1CC4 A;  4H4Q A;  1GEU A;  3QSE A;  5KVI A;  3ICS A;  4YKG A;  1GRF A;  4H2N A;  1VQW A;  2WBA A;  3BI5 A;  1JNR A;  4EMW A;  1REO A;  1MOK A;  4NNJ A;  3QVP A;  3S61 A;  5JCN A;  3SZ0 A;  3V3N A;  2XLU A;  2Z5X A;  3CNP A;  3K7Q X;  3C96 A;  3UTH A;  2HQM A;  2WQY A;  4OPD A;  3JSK A;  4H4U A;  4RG4 A;  5EOW A;  1TRB A;  4EQX A;  3GDP A;  2JK6 A;  1K0I A;  1PXC A;  5EB5 A;  3RP6 A;  1LQT A;  2BA9 A;  2WEU A;  4TLZ A;  5CQF A;  3NN6 X;  1IJH A;  1NAA A;  2BS2 A;  2YG4 A;  3EPT A;  1E39 A;  1DNC A;  2V6O A;  1DAO A;  2V60 A;  2B76 A;  1YQZ A;  1MXT A;  2WOW A;  3BNU A;  1Y0P A;  3H8L A;  3DH9 A;  1S2Q A;  2YLS A;  3VQR A;  2C3C A;  4Z24 A;  3CTY A;  2IVE A;  2Q0L A;  3LXD A;  4U2S A;  2VQB A;  4H2Q A;  1BGN A;  4J31 A;  4H7U A;  1K4Q A;  2YVG A;  3I3L A;  4XXG A;  1BWC A;  3ITJ A;  3CGD A;  3P4R A;  5FS9 A;  5BUL A;  3NNE A;  1BKW A;  5FMH A;  1DXL A;  4IV9 A;  2QCU A;  4OPU A;  1JRY A;  4YTP A;  2TMD A;  3AYJ A;  4IA5 A;  3ALJ A;  2GR1 A;  4A9W A;  5KMQ A;  3RED A;  4U8I A;  5JCI A;  1E1M A;  2B9W A;  3AE6 A;  3NKS A;  3IC9 A;  1BGJ A;  5KVH A;  2BK3 A;  2H88 A;  2EQ6 A;  5HY5 A;  2WDV A;  4U8K A;  3SZF A;  2XVJ A;  3CPH G;  3DK4 A;  4NTE A;  4ZN0 A;  2YQU A;  3AE9 A;  5ER0 A;  2H89 A;  1GRT A;  4D04 A;  1COY A;  4CCR A;  3AE3 A; 
#chains in the Genus database with same CATH homology
 2R4E A;  3QSM A;  3UCL A;  5JCM A;  3FBS A;  2AQJ A;  1IUV A;  2B9X A;  3GYJ A;  3C4N A;  2RGJ A;  2NVK X;  2ARD A;  3AE4 A;  4NEV A;  4ADW A;  2RGH A;  1IUT A;  4J34 A;  4H50 A;  1OJT A;  3K30 A;  4KX6 A;  2VOU A;  2DKH A;  4TM0 A;  4DSG A;  1KNP A;  1Y56 B;  5HHF A;  3NTD A;  4K5S A;  1H82 A;  2OLN A;  4Z2T A;  1W4X A;  3SQP A;  1JOA A;  3E1T A;  4CRT A;  4YSX A;  3UOY A;  4U8J A;  1YKJ A;  1LV0 A;  2ACZ A;  2C4C A;  1L9D A;  4G6G A;  1CHU A;  5KMR A;  1D4D A;  2FJB A;  1YQ4 A;  3GD4 A;  1QLB A;  3M0O A;  4UP3 A;  3ATR A;  4I58 A;  2PYX A;  1F3P A;  1ZOY A;  1VDC A;  3UOV A;  1X31 B;  4I59 A;  1GV4 A;  4YSH A;  1LVL A;  2QA2 A;  2NPX A;  2V61 A;  2WOV A;  1H84 A;  4GUV A;  4J33 A;  2BS4 A;  2ZBW A;  4K22 A;  4TM4 A;  1GRH A;  2BRA A;  2FJE A;  2YLR A;  3UOX A;  5JCL A;  3GWD A;  3CGE A;  2BYB A;  2OAL A;  4TLX A;  4KPR A;  3UKF A;  2WHD A;  1OJD A;  2WU2 A;  2XVE A;  1QJD A;  2GV8 A;  1E1K A;  2BXR A;  4ZCD A;  2I0Z A;  3GMC A;  3UP4 A;  3ALL A;  4GF7 A;  3NGC X;  1D5T A;  2E4G A;  3ZDN A;  1H6V A;  3ICR A;  3K7M X;  1KNR A;  5U63 A;  3SX6 A;  1XHC A;  4BJZ A;  4FK1 A;  4EQS A;  2E5V A;  1ZMC A;  4USQ A;  1S3E A;  1P2H A;  1NPX A;  2AAQ A;  3AEC A;  3GWF A;  3GDN A;  3V76 A;  4P9S A;  4NTD A;  1ZOV A;  1JRZ A;  3FPZ A;  1Q9I A;  2JAE A;  4J57 A;  3GSI A;  1GRE A;  4B64 A;  3NTA A;  1ZMD A;  3UKL A;  1E1N A;  1Y56 A;  1O5W A;  2YG5 A;  3NK0 X;  4A5L A;  4WX1 A;  4AP3 A;  4C74 A;  2WOI A;  5KMS A;  3HYW A;  2BRY A;  2YR6 A;  5DBJ A;  3H8I A;  2YM2 A;  1FEC A;  1XAN A;  2VQ7 A;  3DJD A;  1D7Y A;  2WPF A;  4PAA A;  3DK9 A;  3COX A;  4Z2R A;  2BAC A;  3WE0 A;  4REK A;  2XFQ A;  3KPF A;  4X9N A;  2GR3 A;  4YKF A;  4A6N A;  2TPR A;  3UP5 A;  5HXI A;  1PBC A;  3F8P A;  5GSN A;  1HYU A;  2CVJ A;  5U25 A;  4ECH A;  1NDA A;  3SGL A;  2R0P A;  4GCM A;  3ADA B;  4UDQ A;  4YSZ A;  2XVH A;  1GPE A;  1E7P A;  1YY5 A;  3PS9 A;  1F6M A;  4RSL A;  1PJ7 A;  3R9U A;  5BRT A;  3I6D A;  3LZW A;  1TDN A;  3CGB A;  4G6H A;  1TDF A;  1XPQ A;  2GVC A;  2C76 A;  3SFD A;  4A99 A;  1ZP0 A;  5J60 A;  3HYV A;  1PBB A;  3FG2 P;  3KU9 A;  4TM3 A;  2B7S A;  1ZDL A;  2GEW A;  1FCD A;  3DGZ A;  4IVO B;  1VG0 A;  3LB8 A;  5J7X A;  1DJQ A;  3DA1 A;  3LJP A;  1JU2 A;  1H81 A;  2YR5 A;  4CCQ A;  2YWL A;  1LPF A;  1PXA A;  2DKI A;  1CJ4 A;  2YLZ A;  4N9X A;  4OPI A;  3NH3 X;  4WCT A;  1ZKQ A;  4J2W A;  2XFP A;  3NYC A;  2JKC A;  4USR A;  3NG7 X;  4D03 A;  1L9E A;  4H4T A;  3KPK A;  1NG4 A;  3KLJ A;  5LV9 A;  4OCG A;  3G5S A;  2X99 A;  2XFO A;  4J56 A;  1CC2 A;  3L1R A;  4B68 A;  1M64 A;  2GAG B;  1VRQ B;  5C2T A;  4K7Z A;  2X50 A;  2YG3 A;  2XFU A;  3AE5 A;  2CUL A;  2BC1 A;  3VRB A;  2Q7V A;  4H4W A;  4NTC A;  4O5Q A;  4OPC A;  2JBV A;  1S3B A;  3SYI A;  3NRN A;  3AEA A;  3AYL A;  4LII A;  2IVD A;  4B63 A;  1FOH A;  2UZZ A;  4EM4 A;  3ZYX A;  2C67 A;  4LU6 A;  4ZCC A;  2CDU A;  3DME A;  3RP8 A;  2C70 A;  3UTG A;  3T2Z A;  1Z6L A;  3D1C A;  3L8K A;  3Q9T A;  1KDG A;  2XDO A;  1DOC A;  5KNL A;  3KVE A;  4Z43 A;  3NN0 X;  3DJE A;  2VVL A;  4C5O A;  3Q6J A;  3T0K A;  3H4K A;  3HZL A;  2EQ9 A;  1H83 A;  4U8N A;  5EBK A;  3ATQ A;  3G5Q A;  1CJC A;  1CC6 A;  4U8P A;  2BAB A;  3EAN A;  2WDR A;  3NYF A;  4OPL A;  3LZX A;  3IWA A;  4HA6 A;  3RNM A;  1ZY8 A;  3ICT A;  4APN A;  1S2Y A;  2C65 A;  3G5R A;  4EMI A;  2WP9 A;  3OZ2 A;  4H4R A;  1K0L A;  5IQ1 A;  3CMM A;  4JQ9 A;  1GRB A;  5GRT A;  3RP7 A;  3CIR A;  1N4W A;  1KF6 A;  4H4X A;  4DNA A;  4M52 A;  4H4S A;  2Q0K A;  2VZ2 A;  1BZL A;  2C66 A;  4U8O A;  5M0Z A;  5HYM A;  1PN0 A;  3LAD A;  4X4J A;  2QAE A;  3F8D A;  3CNJ A;  2VVL G;  1H7W A;  2V5Z A;  3DK8 A;  4U8M A;  3UOZ A;  4B69 A;  3GYI A;  4BK2 A;  4GDE A;  1TDK A;  2Y6Q A;  1VG9 A;  4GDP A;  3B6D A;  3CGC A;  2JB3 A;  1LTX R;  1MO9 A;  4EIP A;  1CJ2 A;  1GRA A;  3BI2 A;  3BNM A;  3T2Y A;  2R4J A;  1QO8 A;  2A8X A;  1TYP A;  2PHH A;  2R9Z A;  4GR1 A;  2Q6U A;  1EL7 A;  3BI4 A;  3EF6 A;  4B1B A;  4G73 A;  4CNK A;  3AE2 A;  4H2P A;  5C3J A;  1RP0 A;  2WU5 A;  1PHH A;  3T37 A;  1DOE A;  1V59 A;  4HB9 A;  1EL8 A;  4IVM B;  4AT2 A;  3GYX A;  1B4V A;  1GAL A;  3HYX A;  3FIM B;  1F8R A;  1PXB A;  4C77 A;  3AEE A;  2A89 A;  2ZZC A;  2GR0 A;  3M12 A;  2C7G A;  2JB2 A;  3M13 A;  3AXB A;  4K5R A;  1F8W A;  2WPC A;  3AED A;  3AEF A;  1GET A;  3QFB A;  3BHK A;  2X8H A;  2FBW A;  4A79 A;  4AOX A;  3AE8 A;  1CL0 A;  4YSY A;  2B7R A;  4C3X A;  4U2T A;  1XDI A;  3C4A A;  2YLT A;  3SZC A;  1D4C A;  3QVR A;  4YXD A;  4JY2 A;  1KSS A;  3T2K A;  3UTF A;  1F8S A;  5KWF A;  4IA6 A;  5KOW A;  1NHS A;  2EQ8 A;  3QSS A;  3AD7 B;  2GMH A;  1NHR A;  4K2X A;  1GES A;  2WES A;  1ELI A;  1GXF A;  4NZH A;  1PJ5 A;  3KKJ A;  1TDO A;  4BK3 A;  4K8D A;  2YR4 A;  3AE7 A;  5KMP A;  4MJW A;  3P4S A;  3D8X A;  1ZK7 A;  4AP1 A;  3NK2 X;  4U8L A;  2EQ7 A;  1JNZ A;  2OA1 A;  4CY8 A;  2XLP A;  3DJJ A;  1L9C A;  3NYE A;  4U2L A;  3URH A;  4AOS A;  1NG3 A;  2XLT A;  3GRS A;  4JNQ A;  4RG3 A;  3ALM A;  4J36 A;  1CJ3 A;  4GAP A;  5KXJ A;  2WET A;  4CY6 A;  1AOG A;  1Q1W A;  4EIQ A;  2B9Y A;  2O9Z A;  3DGH A;  4A7A A;  5FS6 A;  4NEW A;  4Y4N A;  2YVJ A;  2GH5 A;  1EL9 A;  3SY4 A;  4ICY A;  2F5Z A;  3AEB A;  1YQ3 A;  4BUR A;  2C64 A;  3S5W A;  4BK1 A;  3IHG A;  2FJD A;  3QJ4 A;  4FDC B;  2R45 A;  4AT0 A;  5M10 A;  1IUX A;  1H86 A;  1OJ9 A;  2BCP A;  4EQW A;  3BHF A;  3ABV A;  3PO7 A;  1GT8 A;  2J3N A;  2XVI A;  3GD3 A;  2BK5 A;  4JDR A;  2CFY A;  3CNT A;  3O0H A;  4O5U A;  1GER A;  2GAH B;  4GAV A;  4TM1 A;  4Y4L A;  1CF3 A;  1N4U A;  1O95 A;  4B66 A;  3GRT A;  2JB1 A;  2YVF A;  2R0C A;  4G9K A;  1TYT A;  1BF3 A;  3UKA A;  1IUW A;  3CN8 A;  3K7T A;  1OJA A;  4CNJ A;  1RYI A;  3PVC A;  1ONF A;  2VVM A;  3RHA A;  1Q1R A;  4LA1 A;  3AWI A;  3VRD B;  4Y4M A;  1FL2 A;  1SEZ A;  4YT0 A;  2XVF A;  4X9M A;  1B37 A;  3KA7 A;  2VRM A;  4FX9 A;  4UDP A;  3F8R A;  1GSN A;  3IF9 A;  4YWO A;  2E1M A;  3UKQ A;  4C3Y A;  3V3O A;  3VR8 A;  4H4Z A;  5L46 A;  2GQW A;  1EL5 A;  2VRL A;  2YG7 A;  1KSU A;  2YLX A;  4H4Y A;  3P4Q A;  5EB4 A;  3T31 A;  1DOB A;  2GF3 A;  5U1O A;  3B3R A;  2WDQ A;  5FS8 A;  1DJN A;  5BUK A;  5IPY A;  4XWZ A;  2Z5Y A;  1B5Q A;  1GRG A;  4Z2U A;  3UKH A;  1DOD A;  2C73 A;  3KD9 A;  1NEN A;  4G74 A;  2BS3 A;  2V3B A;  4CBQ A;  2Y6R A;  1UKV G;  1GND A;  3UKP A;  1PJ6 A;  1D4E A;  3EAO A;  1IUS A;  1PDH A;  3CND A;  4GRT A;  4YTM A;  1E6E A;  2OLO A;  3NK1 X;  2C75 A;  2XCG A;  3LOV A;  2BCG G;  2YAU A;  2R46 A;  2C3D A;  1TDE A;  1NEK A;  1EBD A;  2GQF A;  2X8G A;  3AE1 A;  4B65 A;  4EQR A;  4Z26 A;  3CPI G;  2QA1 A;  1N4V A;  4BV6 A;  1L0V A;  3QFA A;  4JY3 A;  2WPE A;  3FMW A;  2OAM A;  3VRA A;  2X3N A;  1M6I A;  2GR2 A;  3SFE A;  3NHO X;  4UDR A;  2WP5 A;  3UTE A;  4EM3 A;  2FJA A;  4JNA A;  2AR8 A;  3NLC A;  2YM1 A;  2GMJ A;  1CBO A;  1K0J A;  3NT6 A;  3AYI A;  3P9U A;  4H4P A;  4XWR A;  4A6N B;  1ZX9 A;  5KRQ A;  2GB0 A;  3NIX A;  2R0G A;  2RGO A;  1FEB A;  1IUU A;  3CNS A;  2IID A;  4YTN A;  1H7X A;  3AB1 A;  1D7L A;  3UKK A;  2APG A;  5KOX A;  1JRX A;  2WS3 A;  2W0H A;  1RSG A;  1GOS A;  1GTE A;  3OC4 A;  5IQ4 A;  2BXS A;  4H2R A;  3SXI A;  2ZZB A;  4OPT A;  1NHP A;  1PS9 A;  2XFN A;  3AEG A;  1OJC A;  2BC0 A;  2V3A A;  1O94 A;  1B8S A;  3P4P A;  4OPG A;  2YLW A;  3VR9 A;  2BK4 A;  3SM8 A;  4B67 A;  3AD9 B;  4NWZ A;  4A65 A;  1PBD A;  5JCK A;  3CPJ G;  1LJ1 A;  2X8C A;  1FEA A;  3DJG X;  3ISH A;  3II4 A;  1KFY A;  2YG6 A;  1P2E A;  4H4V A;  1N1P A;  4JN9 A;  4OVI A;  1PBE A;  4E0V A;  2GRT A;  4DSH A;  4Z44 A;  4EMJ A;  1JEH A;  2ZZ0 A;  3AD8 B;  1NHQ A;  3GMB A;  4II2 A;  2XLR A;  1E1L A;  5TR3 A;  4Z25 A;  1LQU A;  4FK1 C;  5CKU A;  1PBF A;  3P1W A;  4II3 A;  4PAB A;  1GTH A;  3IHM A;  4BJY A;  2WP6 A;  2A87 A;  2XLS A;  3SZW A;  2RAB A;  5FS7 A;  3T14 A;  2XYO A;  5BVA A;  4DGK A;  2C72 A;  1CC4 A;  4H4Q A;  1GEU A;  3QSE A;  5KVI A;  3ICS A;  4YKG A;  1GRF A;  4H2N A;  1VQW A;  2WBA A;  3BI5 A;  1JNR A;  4EMW A;  1REO A;  1MOK A;  4NNJ A;  3QVP A;  3S61 A;  5JCN A;  3SZ0 A;  3V3N A;  2XLU A;  2Z5X A;  3CNP A;  3K7Q X;  3C96 A;  3UTH A;  2HQM A;  2WQY A;  4OPD A;  3JSK A;  4H4U A;  4RG4 A;  5EOW A;  1TRB A;  4EQX A;  3GDP A;  2JK6 A;  1K0I A;  1PXC A;  5EB5 A;  3RP6 A;  1LQT A;  2BA9 A;  2WEU A;  4TLZ A;  5CQF A;  3NN6 X;  1IJH A;  1NAA A;  2BS2 A;  2YG4 A;  3EPT A;  1E39 A;  1DNC A;  2V6O A;  2V60 A;  2B76 A;  1YQZ A;  1MXT A;  2WOW A;  3BNU A;  1Y0P A;  3H8L A;  3DH9 A;  1S2Q A;  2YLS A;  2C3C A;  3VQR A;  4Z24 A;  3CTY A;  2IVE A;  2Q0L A;  3LXD A;  4U2S A;  2VQB A;  4H2Q A;  1BGN A;  4J31 A;  4H7U A;  1K4Q A;  2YVG A;  3I3L A;  4XXG A;  1BWC A;  3ITJ A;  3CGD A;  3P4R A;  5FS9 A;  5BUL A;  3NNE A;  1BKW A;  5FMH A;  1DXL A;  4IV9 A;  2QCU A;  4OPU A;  1JRY A;  4YTP A;  2TMD A;  3AYJ A;  4IA5 A;  3ALJ A;  2GR1 A;  4A9W A;  5KMQ A;  3RED A;  4U8I A;  5JCI A;  1E1M A;  2B9W A;  3AE6 A;  3NKS A;  3IC9 A;  1BGJ A;  5KVH A;  2BK3 A;  2H88 A;  2EQ6 A;  5HY5 A;  2WDV A;  4U8K A;  3SZF A;  2XVJ A;  3CPH G;  3DK4 A;  4NTE A;  4ZN0 A;  2YQU A;  3AE9 A;  5ER0 A;  2H89 A;  1GRT A;  4D04 A;  1COY A;  4CCR A;  3AE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...