4H2NA

Crystal structure of mhpco, y270f mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 126
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2nA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2nA01
1Y0PA 2WDQA 3UKAA 3EPTA 4RG4A 3NRNA 4B68A 1LTXR 4IVOB 2YG7A 2X8CA 2GB0A 2R4JA 1ZOYA 3IC9A 3DJJA 4GRTA 4H4XA 4DSGA 3L8KA 4NZHA 2FBWA 3DGHA 1GRGA 2CVJA 5JCNA 4U8LA 1PBCA 2AR8A 2JB3A 1LQTA 3PO7A 4J2WA 4BK2A 3AE8A 3D1CA 3GYIA 4K5RA 3UKFA 3Q9TA 4J31A 4A6NB 1FOHA 3GRTA 3GD3A 1LQUA 4EIPA 4H50A 3NYFA 1X31B 4KPRA 2JKCA 1GTHA 3ALMA 2BC0A 1P2EA 1DOBA 2WETA 5KRQA 2GRTA 2V3AA 3GMCA 5JCIA 5DBJA 4C5OA 5C3JA 1GXFA 2WOVA 2B7SA 2Q7VA 1PXAA 3ADAB 3FPZA 4CY8A 2XLSA 4U2TA 2RGJA 1O5WA 1DODA 4CCQA 4U8PA 2WQYA 2NVKX 3RHAA 4EQWA 3UTFA 1IUUA 1NEKA 1LPFA 1EL7A 4RG3A 5M0ZA 1H6VA 2YR4A 4UP3A 3NTDA 4CCRA 1HYUA 1BWCA 2VRMA 3UOVA 1TRBA 4REKA 4U8KA 2X8HA 3L1RA 3NK0X 4U2LA 2FJBA 1NPXA 1H82A 1H7WA 3DJEA 4NTCA 3AWIA 1GRFA 2BS2A 3AE9A 3UTGA 3P4PA 4CBQA 4XWZA 1B37A 3AYIA 1RYIA 2OLOA 2X3NA 4Y4LA 3NYCA 1TDNA 3CGEA 2AQJA 3ISHA 3FMWA 4UDPA 1BGJA 1E1LA 3AXBA 1GETA 2QA2A 3IWAA 5HHFA 5FS7A 2B9YA 3CTYA 4WX1A 1DOCA 1GRTA 3BI2A 4Z26A 4HA6A 2WU2A 3V3NA 4EM3A 3GSIA 4FDCB 4YXDA 4IA6A 2BK4A 2AAQA 3T37A 2XVFA 4JY3A 1K0JA 4H4ZA 2R4EA 4Y4MA 3F8DA 2RABA 4OPCA 4X9MA 2E4GA 4OPDA 1D7YA 3UKLA 1CJ4A 1QJDA 1DJQA 1IUSA 1GRAA 4LIIA 1TDFA 4DSHA 2DKIA 1RP0A 2C3CA 1FECA 2FJAA 1F8WA 1P2HA 2B76A 3VQRA 2PHHA 4OCGA 1N4WA 2WP5A 3UKQA 4Z25A 2BS4A 1YQ3A 3R9UA 3CIRA 4A5LA 4K7ZA 2GEWA 3WE0A 2CULA 4BK3A 2WP6A 4Z44A 1D4DA 3SQPA 4C77A 1GERA 2TPRA 2Q0KA 2JB1A 3AE5A 1E7PA 1PBBA 4A7AA 2WDRA 1D5TA 4ECHA 2XLTA 1PHHA 1F6MA 3DJDA 4EQSA 4J34A 2XCGA 4U2SA 1H81A 3CPIG 4YSYA 1PN0A 3LB8A 1SEZA 3KVEA 4IVMB 4X9NA 2XLUA 3OC4A 4O5UA 3KD9A 1NHRA 2X99A 3AB1A 2YG3A 2WDVA 2YM1A 4K22A 3NK1X 3S5WA 4CNJA 3QFAA 1M6IA 4A79A 2E5VA 3GYJA 1XPQA 3COXA 4M52A 2YR5A 2WPEA 5GSNA 1ZMCA 2R46A 2X8GA 5ER0A 3KPFA 1LVLA 4Z2TA 1CHUA 4D03A 4YTNA 4C74A 3VR9A 2VQBA 4OVIA 3CGBA 4WCTA 3VRBA 4GUVA 4BJYA 5EOWA 5JCMA 1ZY8A 2FJDA 4C3YA 4YTPA 4EMIA 1S2QA 4U8IA 1JRZA 4H4PA 4ZCCA 4H2QA 2YLSA 3AD7B 4ADWA 1BZLA 1B4VA 1GRHA 3KLJA 2XFOA 3NNEA 3NN6X 4H2NA 2WBAA 3VRDB 4A65A 3AEGA 1NAAA 3ICTA 2R0GA 4Z2RA 3C4NA 1VRQB 2YLXA 2V5ZA 2VZ2A 1K0IA 2GH5A 4JDRA 4BV6A 5KOWA 4NEVA 2GAGB 2GR2A 3CGCA 1E39A 3PVCA 3QSSA 1IUTA 3UOYA 1L9EA 2WP9A 5FS8A 3GWFA 4B65A 1K0LA 3CNPA 5KVHA 1JNRA 3P1WA 2C75A 2BABA 1DNCA 3M13A 2A89A 2ACZA 2C70A 3UTEA 2J3NA 1GESA 4A6NA 4BK1A 4U8OA 3AEEA 1GALA 5LV9A 2OALA 1FEAA 5L46A 3CGDA 3AEAA 4H4WA 5EB5A 4H4VA 1TYTA 2R9ZA 5JCKA 3LADA 4TM4A 5BVAA 2ZZ0A 4H4RA 4DGKA 1PBEA 1REOA 2BCGG 4H4UA 3NHOX 2Z5YA 2BXSA 4LU6A 3BI4A 3NT6A 3ICSA 1F8SA 1CJ2A 1JRYA 4PABA 5C2TA 2YAUA 2VRLA 4CY6A 4JN9A 1PJ7A 3AE1A 5HXIA 1GT8A 3I6DA 3UKHA 4A99A 4A9WA 3CPJG 1ZOVA 2ZZCA 2WHDA 3G5SA 3GDPA 3KKJA 1KSUA 4ZN0A 2BXRA 1PS9A 1EBDA 2YVJA 4N9XA 4YKFA 4NTDA 4YTMA 3G5RA 3II4A 2GMHA 1E1MA 4FK1A 2YLWA 4YKGA 1Y56B 3M12A 1YKJA 3VRAA 2WOWA 3ALJA 4LA1A 3EF6A 3I3LA 3UTHA 4AOXA 4B63A 1D4CA 4B1BA 1KF6A 2A87A 3CNTA 1W4XA 3NKSA 2R0CA 3DA1A 2XDOA 5J7XA 1D4EA 1FL2A 2YLRA 1IUWA 3K30A 3LXDA 3DGZA 5KXJA 2I0ZA 2YWLA 3AYLA 2WPFA 1S2YA 4ZCDA 3ZDNA 2FJEA 4RSLA 1KNPA 2B9XA 2C64A 1GTEA 4P9SA 3NGCX 1MOKA 4HB9A 3NK2X 3UCLA 5FS6A 1Q1WA 1BF3A 4B64A 4I59A 3DK9A 3RP8A 4JY2A 3CNSA 3B6DA 3ZYXA 3UOZA 2ARDA 2V3BA 1Z6LA 2GF3A 3QVPA 3CN8A 2YLTA 3AEDA 2IIDA 4Z2UA 1XANA 3H8IA 2BA9A 1RSGA 4K5SA 3IF9A 2Q0LA 2Z5XA 1KNRA 3AE4A 2E1MA 4GCMA 3EAOA 2JK6A 4OPLA 2BYBA 4B69A 1VDCA 3E1TA 4H2RA 2XFNA 2YLZA 3IHGA 3B3RA 5M10A 3RP6A 2YR6A 1PXCA 1PJ5A 2C76A 4CRTA 4X4JA 4D04A 4E0VA 2B7RA 2ZBWA 3VR8A 1EL9A 2JAEA 2XFQA 3P4RA 2V60A 1GRBA 2BK5A 2QCUA 1ONFA 1ZKQA 1NHQA 2ZZBA 1TDEA 3LZWA 1EL5A 1CC6A 1DXLA 4U8NA 3BHKA 3P9UA 1M64A 3AEBA 5EB4A 2YVGA 3H4KA 1B5QA 1F3PA 4NEWA 4YWOA 4AT2A 2C65A 2YG6A 4UDRA 5U63A 2EQ8A 1TDOA 2EQ6A 1PBFA 2XVEA 2YQUA 2UZZA 2F5ZA 1CJ3A 2XLPA 3F8RA 1E6EA 1COYA 3ICRA 1BKWA 4IA5A 2EQ7A 2WOIA 1N1PA 3GRSA 1MXTA 3QSEA 3REDA 2GR1A 1O94A 2BCPA 3UKKA 3G5QA 3BHFA 1CC4A 3DJGX 2WS3A 4EM4A 1AOGA 2CDUA 1L9DA 4PAAA 3ATQA 1TDKA 2Q6UA 1IJHA 2WU5A 1OJAA 3AYJA 2TMDA 4APNA 4AP3A 3UKPA 4Z43A 4OPGA 2GR0A 2XVJA 2W0HA 3K7QX 4I58A 3SFDA 2BS3A 1GEUA 4K2XA 4AOSA 1ZMDA 1DOEA 2R45A 1FEBA 1OJ9A 3URHA 1K4QA 1NHPA 4GF7A 1QO8A 3OZ2A 4J56A 1E1KA 2R0PA 1YQ4A 1GREA 1B8SA 3LZXA 4H2PA 2VVLG 4U8JA 4TM0A 4AT0A 4J33A 3LJPA 3K7TA 2YG4A 1ZDLA 1S3BA 1Y56A 3RP7A 4EIQA 2XFUA 3D8XA 1MO9A 1TYPA 3IHMA 4GDPA 4BJZA 3P4QA 2H89A 3BI5A 1F8RA 2OLNA 2BACA 3PS9A 2VVLA 4UDQA 1L0VA 1JEHA 4DNAA 3AECA 3NH3X 4CNKA 4YT0A 4NTEA 3QVRA 4JQ9A 2BK3A 1EL8A 3ATRA 1PDHA 2GVCA 3GD4A 5CQFA 5U1OA 1S3EA 2BC1A 5U25A 2RGHA 2VVMA 3NLCA 4USRA 4YSHA 3UOXA 2A8XA 1O95A 3NYEA 2GR3A 1XHCA 2XVIA 2O9ZA 2C3DA 3GWDA 2GAHB 1VG0A 2XYOA 3GMBA 2HQMA 1E1NA 4TM3A 1ZP0A 1XDIA 3UP5A 1GOSA 3C4AA 4FX9A 4H4SA 4AP1A 3BNUA 1JOAA 4TLXA 1IUXA 2EQ9A 4U8MA 3NIXA 4XWRA 2XVHA 3GDNA 3FIMB 4GDEA 3QSMA 3C96A 2GQFA 2VOUA 4MJWA 5EBKA 1ZX9A 2WESA 1H84A 2XLRA 4O5QA 1PBDA 1VQWA 3AE2A 5GRTA 1NG4A 3S61A 4ICYA 5CKUA 5BRTA 1H83A 4EQXA 1D7LA 5JCLA 2WPCA 3EANA 5HYMA 1LV0A 1Q1RA 5KWFA 3AD8B 2RGOA 2APGA 2B9WA 4FK1C 2CFYA 3NTAA 4YSZA 5IPYA 5IQ1A 5J60A 2GMJA 1FCDA 2PYXA 4BURA 4Y4NA 2C7GA 3BNMA 2Y6QA 2V61A 4K8DA 3SGLA 1OJTA 1PJ6A 2QA1A 4H4TA 5FMHA 5KVIA 3AE6A 1UKVG 2GV8A 2OA1A 3AE3A 2IVEA 3FG2P 4IV9A 1OJDA 1IUVA 1QLBA 3HZLA 5KOXA 2C72A 4H7UA 2YM2A 3SFEA 2C73A 1OJCA 2XFPA 3CNDA 3QFBA 1NHSA 1JNZA 1GSNA 3CNJA 3KU9A 2V6OA 3FBSA 4H4QA 1JRXA 4OPIA 1CF3A 3Q6JA 4GR1A 3JSKA 4KX6A 4OPUA 3DH9A 4B66A 1ELIA 3NN0X 3RNMA 5IQ4A 4H4YA 1GPEA 4J57A 3DK4A 4JNQA 3ABVA 1Q9IA 2YVFA 1H7XA 1ZK7A 5BUKA 3SM8A 1KDGA 1NG3A 1NDAA 4C3XA 2X50A 2WEUA 3AE7A 2VQ7A 3ALLA 4TLZA 1KFYA 4EMWA 2NPXA 1BGNA 4EQRA 1KSSA 3KA7A 3P4SA 2GQWA 5HY5A 1YQZA 1GV4A 1H86A 1YY5A 2YG5A 3V76A 1CL0A 4XXGA 1NENA 1LJ1A 3AEFA 3M0OA 1VG9A 1CJCA 3H8LA 3F8PA 3UP4A 4YSXA 1GNDA 4OPTA 1CC2A 1JU2A 3NG7X 1CBOA 2C67A 1N4VA 5FS9A 2Y6RA 3DMEA 3DK8A 2IVDA 3ITJA 3QJ4A 3AD9B 2C66A 4JNAA 2H88A 1N4UA 2OAMA 1V59A 3O0HA 1PXBA 4EMJA 4USQA 2JBVA 1DJNA 3CPHG 1L9CA 4J36A 4TM1A 3V3OA 5BULA 2DKHA 3K7MX 3LOVA 4B67A 4Z24A 2JB2A 2QAEA 5TR3A
chains in the Genus database with same CATH superfamily
1Y0PA 2WDQA 3UKAA 3EPTA 4RG4A 3NRNA 4G9KA 4B68A 1LTXR 4IVOB 3T31A 2YG7A 2X8CA 2GB0A 2R4JA 1ZOYA 3IC9A 3DJJA 4GRTA 4H4XA 4DSGA 3L8KA 4NZHA 2FBWA 3DGHA 1GRGA 2CVJA 5JCNA 4U8LA 1PBCA 4BK2A 2AR8A 1LQTA 2JB3A 3PO7A 4J2WA 3AE8A 3D1CA 3GYIA 4K5RA 3UKFA 3Q9TA 4J31A 4A6NB 1FOHA 3GRTA 3GD3A 1LQUA 4EIPA 4H50A 3NYFA 1X31B 4KPRA 3HYXA 2JKCA 1GTHA 3ALMA 2BC0A 1P2EA 1DOBA 2WETA 5KRQA 1AN9A 2GRTA 2V3AA 3GMCA 5JCIA 5DBJA 4C5OA 5C3JA 3ADAB 1GXFA 2B7SA 2Q7VA 1PXAA 2WOVA 3FPZA 3GYXA 2XLSA 4CY8A 4U2TA 2RGJA 1O5WA 1DODA 4CCQA 4U8PA 2WQYA 2NVKX 3RHAA 4EQWA 3UTFA 1IUUA 1NEKA 1LPFA 1EL7A 4RG3A 5M0ZA 1H6VA 2YR4A 3CMMA 4UP3A 3NTDA 4GAVA 4CCRA 1HYUA 1BWCA 2VRMA 3UOVA 1TRBA 4REKA 4U8KA 2X8HA 3L1RA 3NK0X 4U2LA 2FJBA 1NPXA 1H82A 1H7WA 3DJEA 4NTCA 3AWIA 1GRFA 2BS2A 3AE9A 3UTGA 5KMSA 3P4PA 4CBQA 4XWZA 1B37A 1C0PA 3AYIA 1RYIA 2OLOA 2X3NA 4Y4LA 3NYCA 1TDNA 3CGEA 2AQJA 3ISHA 3FMWA 4UDPA 1BGJA 1E1LA 3AXBA 1GETA 2QA2A 3IWAA 5HHFA 5FS7A 2B9YA 3CTYA 4WX1A 1DOCA 1GRTA 3BI2A 4Z26A 4HA6A 2WU2A 3V3NA 4EM3A 3GSIA 4FDCB 4YXDA 4IA6A 2BK4A 2AAQA 3T37A 2XVFA 4JY3A 1K0JA 4H4ZA 2R4EA 4Y4MA 3F8DA 2RABA 4OPCA 4X9MA 2E4GA 4OPDA 1D7YA 3UKLA 1DAOA 1CJ4A 2BRYA 1QJDA 1DJQA 1IUSA 1GRAA 4LIIA 1TDFA 4DSHA 2DKIA 1RP0A 2C3CA 3SZCA 1FECA 2FJAA 1F8WA 1P2HA 2B76A 3VQRA 2PHHA 4OCGA 1N4WA 2WP5A 3UKQA 4Z25A 2BS4A 2E48A 1YQ3A 3R9UA 3CIRA 4A5LA 4K7ZA 4BK3A 2GEWA 2CULA 3WE0A 2WP6A 4Z44A 1D4DA 3SQPA 4C77A 1GERA 2TPRA 2Q0KA 2JB1A 3AE5A 1PBBA 1E7PA 4A7AA 2WDRA 1D5TA 4ECHA 2XLTA 1PHHA 1F6MA 3DJDA 4EQSA 4J34A 4NWZA 2XCGA 4U2SA 1H81A 3CPIG 4YSYA 1PN0A 3LB8A 1SEZA 4X9NA 3KVEA 4IVMB 2XLUA 3OC4A 4O5UA 3KD9A 1NHRA 2X99A 3AB1A 2YG3A 2WDVA 2YM1A 4K22A 3NK1X 3S5WA 4CNJA 4QFCA 3QFAA 1M6IA 4A79A 2E5VA 2BRAA 3GYJA 1XPQA 3COXA 4M52A 2YR5A 2WPEA 3HYWA 1ZMCA 2R46A 5GSNA 2X8GA 5ER0A 3KPFA 1LVLA 3SZ0A 4Z2TA 1CHUA 4G73A 4D03A 4YTNA 3T0KA 4C74A 3VR9A 2VQBA 4OVIA 3CGBA 4WCTA 4BJYA 4GUVA 3VRBA 3SXIA 5EOWA 5JCMA 1ZY8A 2FJDA 4C3YA 4YTPA 4EMIA 1S2QA 4U8IA 1JRZA 4H4PA 4ZCCA 4H2QA 2YLSA 3AD7B 4ADWA 1BZLA 1B4VA 1GRHA 3KLJA 2XFOA 3NNEA 3NN6X 4H2NA 2WBAA 3VRDB 4A65A 3AEGA 1NAAA 3ICTA 2R0GA 4Z2RA 3C4NA 1VRQB 2YLXA 2V5ZA 2VZ2A 1K0IA 2GH5A 4JDRA 4BV6A 5KOWA 4NEVA 2GAGB 2GR2A 3CGCA 3PVCA 3QSSA 1E39A 1IUTA 3UOYA 1C0LA 1L9EA 2WP9A 5FS8A 3GWFA 4B65A 1K0LA 3CNPA 5KVHA 1JNRA 3P1WA 2C75A 2BABA 1DNCA 3M13A 2A89A 2ACZA 2C70A 3UTEA 2J3NA 1GESA 4BK1A 4A6NA 4U8OA 3AEEA 1GALA 5LV9A 5L46A 1FEAA 2OALA 3ZNNA 3AEAA 3CGDA 4H4WA 5EB5A 4H4VA 1TYTA 2R9ZA 3SZFA 5JCKA 3LADA 4TM4A 5BVAA 2ZZ0A 4H4RA 4DGKA 1PBEA 1REOA 2BCGG 4H4UA 2E82A 3NHOX 2Z5YA 2BXSA 4LU6A 3BI4A 3NT6A 3ICSA 1F8SA 4G74A 3SZWA 1CJ2A 1JRYA 4PABA 5C2TA 2YAUA 2VRLA 4CY6A 2E49A 4JN9A 1PJ7A 3AE1A 5HXIA 1GT8A 3I6DA 3UKHA 4A99A 4A9WA 3CPJG 1ZOVA 2ZZCA 3SYIA 2WHDA 3G5SA 3GDPA 3KKJA 1KSUA 4ZN0A 2BXRA 1PS9A 1EBDA 2YVJA 4N9XA 4NNJA 4NTDA 4YKFA 3G5RA 3II4A 4YTMA 4YJFB 2GMHA 1E1MA 4FK1A 2YLWA 4YKGA 1Y56B 3M12A 1YKJA 3VRAA 2WOWA 4QFDA 3ALJA 4LA1A 3EF6A 3I3LA 3UTHA 4AOXA 4B63A 4YJGA 1D4CA 4B1BA 1KF6A 2A87A 3CNTA 1W4XA 3NKSA 2R0CA 3DA1A 2XDOA 5J7XA 1D4EA 2C4CA 1FL2A 2YLRA 3ZNQA 1IUWA 3K30A 3LXDA 3W4IA 3DGZA 4YJFA 2I0ZA 5KXJA 2YWLA 3AYLA 2WPFA 1S2YA 4ZCDA 3ZDNA 2FJEA 4RSLA 1KNPA 2B9XA 2C64A 1GTEA 4P9SA 3NGCX 1MOKA 4HB9A 3NK2X 3UCLA 5FS6A 1Q1WA 1BF3A 4B64A 4I59A 3DK9A 3RP8A 4JY2A 3CNSA 3B6DA 3ZYXA 3UOZA 2ARDA 2V3BA 1Z6LA 2GF3A 3QVPA 3CN8A 2YLTA 3AEDA 2IIDA 4Z2UA 1XANA 3H8IA 2BA9A 1RSGA 4K5SA 3IF9A 2Q0LA 2QAEA 2Z5XA 1KNRA 3AE4A 2E1MA 4GCMA 3EAOA 2JK6A 4OPLA 2BYBA 4B69A 3E1TA 1VDCA 4H2RA 2XFNA 2YLZA 3IHGA 1C0KA 3B3RA 5M10A 3RP6A 2YR6A 1PXCA 1PJ5A 2C76A 4CRTA 4X4JA 4D04A 4E0VA 2B7RA 2ZBWA 4GAPA 3VR8A 3ZNPA 1EL9A 2JAEA 2XFQA 3P4RA 2V60A 1GRBA 2BK5A 1C0IA 2QCUA 1ONFA 1ZKQA 2DU8A 1NHQA 2ZZBA 1TDEA 3LZWA 1EL5A 1CC6A 1DXLA 4U8NA 3BHKA 4YJHB 3P9UA 3W4JA 1M64A 3AEBA 5EB4A 2YVGA 3H4KA 1B5QA 1F3PA 4NEWA 4YWOA 5IQ4A 4AT2A 2C65A 2YG6A 4UDRA 5U63A 1TDOA 2EQ6A 2EQ8A 1PBFA 2XVEA 2YQUA 2UZZA 2F5ZA 1CJ3A 2XLPA 3F8RA 5KMPA 1E6EA 1COYA 3ICRA 1BKWA 4IA5A 2EQ7A 2WOIA 1N1PA 3GRSA 1MXTA 3QSEA 3REDA 2GR1A 1O94A 2BCPA 3UKKA 3G5QA 3BHFA 1CC4A 3DJGX 2WS3A 4EM4A 1AOGA 2CDUA 1L9DA 4PAAA 3ATQA 3ZNOA 1TDKA 2Q6UA 1IJHA 2WU5A 1OJAA 3AYJA 2TMDA 4YJGB 4APNA 4AP3A 3UKPA 4Z43A 4OPGA 2GR0A 2XVJA 2W0HA 3K7QX 4I58A 3SFDA 2BS3A 1GEUA 4K2XA 4AOSA 2R45A 1DOEA 1ZMDA 1FEBA 1OJ9A 3URHA 1K4QA 1NHPA 4G6HA 4GF7A 1QO8A 3OZ2A 4J56A 2E4AA 1E1KA 2R0PA 1YQ4A 1GREA 1B8SA 3LZXA 4H2PA 2VVLG 4U8JA 4TM0A 4AT0A 4J33A 3T14A 3LJPA 3K7TA 2YG4A 1ZDLA 1S3BA 1Y56A 4G6GA 3RP7A 4EIQA 2XFUA 3D8XA 1MO9A 1TYPA 3IHMA 1VE9A 4BJZA 4GDPA 3P4QA 2H89A 3BI5A 1F8RA 2OLNA 3PS9A 2BACA 2VVLA 4UDQA 1L0VA 1JEHA 4DNAA 3AECA 3NH3X 5KMRA 4CNKA 4YT0A 4NTEA 3QVRA 4JQ9A 2BK3A 1EL8A 3ATRA 1PDHA 2GVCA 3GD4A 5CQFA 5U1OA 1S3EA 2BC1A 5U25A 2RGHA 2VVMA 3NLCA 4USRA 4YSHA 3UOXA 2A8XA 5KNLA 3NYEA 1O95A 2GR3A 1XHCA 2XVIA 4YJHA 2O9ZA 2C3DA 3GWDA 2GAHB 1VG0A 2XYOA 3GMBA 2HQMA 1E1NA 4TM3A 1ZP0A 3W4KA 1XDIA 3UP5A 1GOSA 3C4AA 4FX9A 4H4SA 4AP1A 3BNUA 1JOAA 4TLXA 1IUXA 3CUKA 2EQ9A 4U8MA 3NIXA 4XWRA 2XVHA 3GDNA 3FIMB 4GDEA 3QSMA 3C96A 2VOUA 2GQFA 4MJWA 5EBKA 1ZX9A 2WESA 1H84A 2XLRA 4O5QA 1PBDA 1VQWA 3AE2A 3T2KA 5GRTA 1NG4A 3S61A 4ICYA 5CKUA 5BRTA 3SX6A 1H83A 3SY4A 4EQXA 1D7LA 5JCLA 5HYMA 2WPCA 3EANA 1LV0A 1Q1RA 5KWFA 2RGOA 2APGA 2B9WA 4FK1C 2CFYA 3NTAA 3G3EA 4YSZA 5IPYA 3HYVA 5IQ1A 5J60A 2GMJA 1FCDA 2PYXA 3WGTA 4BURA 4Y4NA 2C7GA 3BNMA 2Y6QA 2V61A 4K8DA 3SGLA 1OJTA 4II2A 1PJ6A 2QA1A 4H4TA 5FMHA 5KVIA 3AE6A 1UKVG 4YJDA 2GV8A 2OA1A 3AE3A 2IVEA 3FG2P 4IV9A 1OJDA 1IUVA 3HZLA 1QLBA 5KOXA 2C72A 4H7UA 2YM2A 3T2ZA 1EVIA 4II3A 3SFEA 2C73A 1OJCA 2XFPA 3CNDA 3QFBA 1NHSA 1JNZA 1GSNA 3CNJA 3KU9A 2V6OA 3FBSA 4H4QA 1JRXA 4OPIA 1CF3A 3Q6JA 4GR1A 3JSKA 4KX6A 4OPUA 3DH9A 4B66A 1ELIA 3NN0X 1DDOA 3RNMA 4H4YA 1GPEA 4J57A 3DK4A 4JNQA 3ABVA 1Q9IA 2YVFA 1H7XA 1ZK7A 5BUKA 3SM8A 1NG3A 1KDGA 1NDAA 4C3XA 2X50A 2WEUA 3AE7A 2VQ7A 3ALLA 4TLZA 1KFYA 4EMWA 2NPXA 1BGNA 4EQRA 1KSSA 3KA7A 3P4SA 2GQWA 5HY5A 1YQZA 1GV4A 1H86A 1YY5A 2YG5A 3V76A 1CL0A 4XXGA 1NENA 1KIFA 1LJ1A 3AEFA 3M0OA 1VG9A 1CJCA 3H8LA 3F8PA 3UP4A 4YSXA 1GNDA 4OPTA 1CC2A 1JU2A 3NG7X 1CBOA 2C67A 3KPKA 3T2YA 1N4VA 5FS9A 3DMEA 2Y6RA 3DK8A 2IVDA 3ITJA 3QJ4A 3AD9B 2C66A 4JNAA 2H88A 1N4UA 2OAMA 1V59A 3O0HA 1PXBA 4EMJA 4USQA 2JBVA 1DJNA 3CPHG 1L9CA 4J36A 4TM1A 3V3OA 5BULA 2DKHA 3K7MX 3LOVA 4B67A 4Z24A 2JB2A 5KMQA 3AD8B 5TR3A
chains in the Genus database with same CATH topology
1Y0PA 2WDQA 3UKAA 3EPTA 4RG4A 3NRNA 4G9KA 4B68A 1LTXR 4IVOB 3T31A 2YG7A 2X8CA 2GB0A 2R4JA 1ZOYA 3IC9A 3DJJA 4GRTA 4H4XA 4DSGA 3L8KA 4NZHA 2FBWA 3DGHA 1GRGA 2CVJA 5JCNA 4U8LA 4BK2A 1PBCA 2AR8A 1LQTA 2JB3A 3PO7A 4J2WA 3AE8A 3D1CA 3GYIA 4K5RA 3UKFA 3Q9TA 4J31A 4A6NB 1FOHA 3GRTA 3GD3A 1LQUA 4EIPA 4H50A 3NYFA 1X31B 4KPRA 3HYXA 2JKCA 1GTHA 3ALMA 2BC0A 1P2EA 1DOBA 2WETA 5KRQA 2GRTA 2V3AA 3GMCA 5JCIA 5DBJA 4C5OA 5C3JA 1GXFA 2WOVA 2B7SA 2Q7VA 1PXAA 3ADAB 3FPZA 3GYXA 2XLSA 4CY8A 4U2TA 2RGJA 1O5WA 1DODA 4CCQA 4U8PA 2WQYA 2NVKX 3RHAA 4EQWA 3UTFA 1IUUA 1NEKA 1LPFA 1EL7A 4RG3A 5M0ZA 1H6VA 2YR4A 3CMMA 4UP3A 3NTDA 4GAVA 4CCRA 1HYUA 1BWCA 2VRMA 3UOVA 1TRBA 4REKA 4U8KA 2X8HA 3L1RA 3NK0X 4U2LA 2FJBA 1NPXA 1H82A 1H7WA 3DJEA 4NTCA 3AWIA 1GRFA 2BS2A 3AE9A 3UTGA 5KMSA 3P4PA 4CBQA 4XWZA 1B37A 3AYIA 1RYIA 2OLOA 2X3NA 4Y4LA 3NYCA 1TDNA 3CGEA 2AQJA 3ISHA 3FMWA 4UDPA 1BGJA 1E1LA 3AXBA 1GETA 2QA2A 3IWAA 5HHFA 5FS7A 2B9YA 3CTYA 4WX1A 1DOCA 1GRTA 3BI2A 4Z26A 4HA6A 2WU2A 3V3NA 4EM3A 3GSIA 4FDCB 4YXDA 4IA6A 2BK4A 2AAQA 3T37A 2XVFA 4JY3A 1K0JA 4H4ZA 2R4EA 4Y4MA 3F8DA 2RABA 4OPCA 4X9MA 2E4GA 4OPDA 1D7YA 3UKLA 1CJ4A 2BRYA 1QJDA 1DJQA 1IUSA 1GRAA 4LIIA 1TDFA 4DSHA 2DKIA 1RP0A 2C3CA 3SZCA 1FECA 2FJAA 1F8WA 1P2HA 2B76A 3VQRA 2PHHA 4OCGA 1N4WA 2WP5A 3UKQA 4Z25A 2BS4A 1YQ3A 3R9UA 3CIRA 4A5LA 4K7ZA 4BK3A 2GEWA 2CULA 3WE0A 2WP6A 4Z44A 1D4DA 3SQPA 4C77A 1GERA 2TPRA 2Q0KA 2JB1A 3AE5A 1E7PA 1PBBA 4A7AA 2WDRA 1D5TA 4ECHA 2XLTA 1PHHA 1F6MA 3DJDA 4EQSA 4J34A 4NWZA 2XCGA 4U2SA 1H81A 3CPIG 4YSYA 1PN0A 3LB8A 1SEZA 3KVEA 4IVMB 4X9NA 2XLUA 3OC4A 4O5UA 3KD9A 1NHRA 2X99A 3AB1A 2YG3A 2WDVA 2YM1A 4K22A 3NK1X 3S5WA 4CNJA 3QFAA 1M6IA 4A79A 2E5VA 2BRAA 3GYJA 1XPQA 3COXA 4M52A 2YR5A 2WPEA 3HYWA 1ZMCA 2R46A 5GSNA 2X8GA 5ER0A 3KPFA 1LVLA 3SZ0A 4Z2TA 1CHUA 4G73A 4D03A 4YTNA 3T0KA 4C74A 3VR9A 2VQBA 4OVIA 3CGBA 4WCTA 4BJYA 4GUVA 3VRBA 3SXIA 5EOWA 5JCMA 1ZY8A 2FJDA 4C3YA 4YTPA 4EMIA 1S2QA 4U8IA 1JRZA 4H4PA 4ZCCA 4H2QA 2YLSA 3AD7B 4ADWA 1BZLA 1B4VA 1GRHA 3KLJA 2XFOA 3NNEA 3NN6X 4H2NA 2WBAA 3VRDB 4A65A 3AEGA 1NAAA 3ICTA 2R0GA 4Z2RA 3C4NA 1VRQB 2YLXA 2V5ZA 2VZ2A 1K0IA 2GH5A 4JDRA 4BV6A 5KOWA 4NEVA 2GAGB 2GR2A 3CGCA 1E39A 3PVCA 3QSSA 1IUTA 3UOYA 1L9EA 2WP9A 5FS8A 3GWFA 4B65A 1K0LA 3CNPA 5KVHA 1JNRA 3P1WA 2C75A 2BABA 1DNCA 3M13A 2A89A 2ACZA 2C70A 3UTEA 2J3NA 1GESA 4BK1A 4A6NA 4U8OA 3AEEA 1GALA 5LV9A 2OALA 1FEAA 5L46A 3CGDA 3AEAA 4H4WA 5EB5A 4H4VA 1TYTA 2R9ZA 3SZFA 5JCKA 3LADA 4TM4A 5BVAA 2ZZ0A 4H4RA 4DGKA 1PBEA 1REOA 2BCGG 4H4UA 3NHOX 2Z5YA 2BXSA 4LU6A 3BI4A 3NT6A 3ICSA 1F8SA 4G74A 3SZWA 1CJ2A 1JRYA 4PABA 5C2TA 2YAUA 2VRLA 4CY6A 4JN9A 1PJ7A 3AE1A 5HXIA 1GT8A 3I6DA 3UKHA 4A99A 4A9WA 3CPJG 1ZOVA 2ZZCA 3SYIA 2WHDA 3G5SA 3GDPA 3KKJA 1KSUA 4ZN0A 2BXRA 1PS9A 1EBDA 2YVJA 4N9XA 4NNJA 4NTDA 4YKFA 3G5RA 3II4A 4YTMA 2GMHA 1E1MA 4FK1A 2YLWA 4YKGA 1Y56B 3M12A 1YKJA 3VRAA 2WOWA 3ALJA 4LA1A 3EF6A 3I3LA 3UTHA 4AOXA 4B63A 1D4CA 4B1BA 1KF6A 2A87A 3CNTA 1W4XA 3NKSA 2R0CA 3DA1A 2XDOA 5J7XA 1D4EA 2C4CA 1FL2A 2YLRA 1IUWA 3K30A 3LXDA 3DGZA 5KXJA 2I0ZA 2YWLA 3AYLA 2WPFA 1S2YA 4ZCDA 3ZDNA 2FJEA 4RSLA 1KNPA 2B9XA 2C64A 1GTEA 4P9SA 3NGCX 1MOKA 4HB9A 3NK2X 3UCLA 5FS6A 1Q1WA 1BF3A 4B64A 4I59A 3DK9A 3RP8A 4JY2A 3CNSA 3B6DA 3ZYXA 3UOZA 2ARDA 2V3BA 1Z6LA 2GF3A 3QVPA 3CN8A 2YLTA 3AEDA 2IIDA 4Z2UA 1XANA 3H8IA 2BA9A 1RSGA 4K5SA 3IF9A 2Q0LA 2Z5XA 1KNRA 3AE4A 2E1MA 4GCMA 3EAOA 2JK6A 4OPLA 2BYBA 4B69A 3E1TA 1VDCA 4H2RA 2XFNA 2YLZA 3IHGA 3B3RA 5M10A 3RP6A 2YR6A 1PXCA 1PJ5A 2C76A 4CRTA 4X4JA 4D04A 4E0VA 2B7RA 2ZBWA 4GAPA 3VR8A 1EL9A 2JAEA 2XFQA 3P4RA 2V60A 1GRBA 2BK5A 2QCUA 1ONFA 1ZKQA 1NHQA 2ZZBA 1TDEA 3LZWA 1EL5A 1CC6A 1DXLA 4U8NA 3BHKA 3P9UA 1M64A 3AEBA 5EB4A 2YVGA 3H4KA 1B5QA 1F3PA 4NEWA 4YWOA 4AT2A 2C65A 2YG6A 4UDRA 5U63A 2EQ8A 1TDOA 2EQ6A 1PBFA 2XVEA 2YQUA 2UZZA 2F5ZA 1CJ3A 2XLPA 3F8RA 5KMPA 1E6EA 1COYA 3ICRA 1BKWA 4IA5A 2EQ7A 2WOIA 1N1PA 3GRSA 1MXTA 3QSEA 3REDA 2GR1A 1O94A 2BCPA 3UKKA 3G5QA 3BHFA 1CC4A 3DJGX 2WS3A 4EM4A 1AOGA 2CDUA 1L9DA 4PAAA 3ATQA 1TDKA 2Q6UA 1IJHA 2WU5A 1OJAA 3AYJA 2TMDA 4APNA 4AP3A 3UKPA 4Z43A 4OPGA 2GR0A 2XVJA 2W0HA 3K7QX 4I58A 3SFDA 2BS3A 1GEUA 4K2XA 4AOSA 1ZMDA 1DOEA 2R45A 1FEBA 1OJ9A 3URHA 1K4QA 1NHPA 4G6HA 4GF7A 1QO8A 3OZ2A 4J56A 1E1KA 2R0PA 1YQ4A 1GREA 1B8SA 3LZXA 4H2PA 2VVLG 4U8JA 4TM0A 4AT0A 4J33A 3T14A 3LJPA 3K7TA 2YG4A 1ZDLA 1S3BA 1Y56A 4G6GA 3RP7A 4EIQA 2XFUA 3D8XA 1MO9A 1TYPA 3IHMA 4BJZA 4GDPA 3P4QA 2H89A 3BI5A 1F8RA 2OLNA 2BACA 3PS9A 2VVLA 4UDQA 1L0VA 1JEHA 4DNAA 3AECA 3NH3X 5KMRA 4CNKA 4YT0A 4NTEA 3QVRA 4JQ9A 2BK3A 1EL8A 3ATRA 1PDHA 2GVCA 3GD4A 5CQFA 5U1OA 1S3EA 2BC1A 5U25A 2RGHA 2VVMA 3NLCA 4USRA 4YSHA 3UOXA 2A8XA 5KNLA 1O95A 3NYEA 2GR3A 1XHCA 2XVIA 2O9ZA 2C3DA 3GWDA 2GAHB 1VG0A 2XYOA 3GMBA 2HQMA 1E1NA 4TM3A 1ZP0A 1XDIA 3UP5A 1GOSA 3C4AA 4FX9A 4H4SA 4AP1A 3BNUA 1JOAA 4TLXA 1IUXA 2EQ9A 4U8MA 3NIXA 4XWRA 2XVHA 3GDNA 3FIMB 4GDEA 3QSMA 3C96A 2VOUA 2GQFA 4MJWA 5EBKA 1ZX9A 2WESA 1H84A 2XLRA 4O5QA 1PBDA 1VQWA 3AE2A 3T2KA 5GRTA 1NG4A 3S61A 4ICYA 5CKUA 5BRTA 3SX6A 1H83A 3SY4A 4EQXA 1D7LA 5JCLA 5HYMA 2WPCA 3EANA 1LV0A 1Q1RA 5KWFA 3AD8B 2RGOA 2APGA 2B9WA 4FK1C 2CFYA 3NTAA 4YSZA 5IPYA 3HYVA 5IQ1A 5J60A 2GMJA 1FCDA 2PYXA 4BURA 4Y4NA 2C7GA 3BNMA 2Y6QA 2V61A 4K8DA 3SGLA 1OJTA 4II2A 1PJ6A 2QA1A 4H4TA 5FMHA 5KVIA 3AE6A 1UKVG 2GV8A 2OA1A 3AE3A 2IVEA 3FG2P 4IV9A 1OJDA 1IUVA 1QLBA 3HZLA 5KOXA 2C72A 4H7UA 2YM2A 3T2ZA 4II3A 3SFEA 2C73A 1OJCA 2XFPA 3CNDA 3QFBA 1NHSA 1JNZA 1GSNA 3CNJA 3KU9A 2V6OA 3FBSA 4H4QA 1JRXA 4OPIA 1CF3A 3Q6JA 4GR1A 3JSKA 4KX6A 4OPUA 3DH9A 4B66A 1ELIA 3NN0X 3RNMA 5IQ4A 4H4YA 1GPEA 4J57A 3DK4A 4JNQA 3ABVA 1Q9IA 2YVFA 1H7XA 1ZK7A 5BUKA 3SM8A 1KDGA 1NG3A 1NDAA 4C3XA 2X50A 2WEUA 3AE7A 2VQ7A 3ALLA 4TLZA 1KFYA 4EMWA 2NPXA 1BGNA 4EQRA 1KSSA 3KA7A 3P4SA 2GQWA 5HY5A 1YQZA 1GV4A 1H86A 1YY5A 2YG5A 3V76A 1CL0A 4XXGA 1NENA 1LJ1A 3AEFA 3M0OA 1VG9A 1CJCA 3H8LA 3F8PA 3UP4A 4YSXA 1GNDA 4OPTA 1CC2A 1JU2A 3NG7X 1CBOA 2C67A 3KPKA 3T2YA 1N4VA 5FS9A 2Y6RA 3DMEA 3DK8A 2IVDA 3ITJA 3QJ4A 3AD9B 2C66A 4JNAA 2H88A 1N4UA 2OAMA 1V59A 3O0HA 1PXBA 4EMJA 4USQA 2JBVA 1DJNA 3CPHG 1L9CA 4J36A 4TM1A 3V3OA 5BULA 2DKHA 3K7MX 3LOVA 4B67A 4Z24A 2JB2A 5KMQA 2QAEA 5TR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0P A;  2WDQ A;  3UKA A;  3EPT A;  4RG4 A;  3NRN A;  4B68 A;  1LTX R;  4IVO B;  2YG7 A;  2X8C A;  2GB0 A;  2R4J A;  1ZOY A;  3IC9 A;  3DJJ A;  4GRT A;  4H4X A;  4DSG A;  3L8K A;  4NZH A;  2FBW A;  3DGH A;  1GRG A;  2CVJ A;  5JCN A;  4U8L A;  1PBC A;  2AR8 A;  2JB3 A;  1LQT A;  3PO7 A;  4J2W A;  4BK2 A;  3AE8 A;  3D1C A;  3GYI A;  4K5R A;  3UKF A;  3Q9T A;  4J31 A;  4A6N B;  1FOH A;  3GRT A;  3GD3 A;  1LQU A;  4EIP A;  4H50 A;  3NYF A;  1X31 B;  4KPR A;  2JKC A;  1GTH A;  3ALM A;  2BC0 A;  1P2E A;  1DOB A;  2WET A;  5KRQ A;  2GRT A;  2V3A A;  3GMC A;  5JCI A;  5DBJ A;  4C5O A;  5C3J A;  1GXF A;  2WOV A;  2B7S A;  2Q7V A;  1PXA A;  3ADA B;  3FPZ A;  4CY8 A;  2XLS A;  4U2T A;  2RGJ A;  1O5W A;  1DOD A;  4CCQ A;  4U8P A;  2WQY A;  2NVK X;  3RHA A;  4EQW A;  3UTF A;  1IUU A;  1NEK A;  1LPF A;  1EL7 A;  4RG3 A;  5M0Z A;  1H6V A;  2YR4 A;  4UP3 A;  3NTD A;  4CCR A;  1HYU A;  1BWC A;  2VRM A;  3UOV A;  1TRB A;  4REK A;  4U8K A;  2X8H A;  3L1R A;  3NK0 X;  4U2L A;  2FJB A;  1NPX A;  1H82 A;  1H7W A;  3DJE A;  4NTC A;  3AWI A;  1GRF A;  2BS2 A;  3AE9 A;  3UTG A;  3P4P A;  4CBQ A;  4XWZ A;  1B37 A;  3AYI A;  1RYI A;  2OLO A;  2X3N A;  4Y4L A;  3NYC A;  1TDN A;  3CGE A;  2AQJ A;  3ISH A;  3FMW A;  4UDP A;  1BGJ A;  1E1L A;  3AXB A;  1GET A;  2QA2 A;  3IWA A;  5HHF A;  5FS7 A;  2B9Y A;  3CTY A;  4WX1 A;  1DOC A;  1GRT A;  3BI2 A;  4Z26 A;  4HA6 A;  2WU2 A;  3V3N A;  4EM3 A;  3GSI A;  4FDC B;  4YXD A;  4IA6 A;  2BK4 A;  2AAQ A;  3T37 A;  2XVF A;  4JY3 A;  1K0J A;  4H4Z A;  2R4E A;  4Y4M A;  3F8D A;  2RAB A;  4OPC A;  4X9M A;  2E4G A;  4OPD A;  1D7Y A;  3UKL A;  1CJ4 A;  1QJD A;  1DJQ A;  1IUS A;  1GRA A;  4LII A;  1TDF A;  4DSH A;  2DKI A;  1RP0 A;  2C3C A;  1FEC A;  2FJA A;  1F8W A;  1P2H A;  2B76 A;  3VQR A;  2PHH A;  4OCG A;  1N4W A;  2WP5 A;  3UKQ A;  4Z25 A;  2BS4 A;  1YQ3 A;  3R9U A;  3CIR A;  4A5L A;  4K7Z A;  2GEW A;  3WE0 A;  2CUL A;  4BK3 A;  2WP6 A;  4Z44 A;  1D4D A;  3SQP A;  4C77 A;  1GER A;  2TPR A;  2Q0K A;  2JB1 A;  3AE5 A;  1E7P A;  1PBB A;  4A7A A;  2WDR A;  1D5T A;  4ECH A;  2XLT A;  1PHH A;  1F6M A;  3DJD A;  4EQS A;  4J34 A;  2XCG A;  4U2S A;  1H81 A;  3CPI G;  4YSY A;  1PN0 A;  3LB8 A;  1SEZ A;  3KVE A;  4IVM B;  4X9N A;  2XLU A;  3OC4 A;  4O5U A;  3KD9 A;  1NHR A;  2X99 A;  3AB1 A;  2YG3 A;  2WDV A;  2YM1 A;  4K22 A;  3NK1 X;  3S5W A;  4CNJ A;  3QFA A;  1M6I A;  4A79 A;  2E5V A;  3GYJ A;  1XPQ A;  3COX A;  4M52 A;  2YR5 A;  2WPE A;  5GSN A;  1ZMC A;  2R46 A;  2X8G A;  5ER0 A;  3KPF A;  1LVL A;  4Z2T A;  1CHU A;  4D03 A;  4YTN A;  4C74 A;  3VR9 A;  2VQB A;  4OVI A;  3CGB A;  4WCT A;  3VRB A;  4GUV A;  4BJY A;  5EOW A;  5JCM A;  1ZY8 A;  2FJD A;  4C3Y A;  4YTP A;  4EMI A;  1S2Q A;  4U8I A;  1JRZ A;  4H4P A;  4ZCC A;  4H2Q A;  2YLS A;  3AD7 B;  4ADW A;  1BZL A;  1B4V A;  1GRH A;  3KLJ A;  2XFO A;  3NNE A;  3NN6 X;  4H2N A;  2WBA A;  3VRD B;  4A65 A;  3AEG A;  1NAA A;  3ICT A;  2R0G A;  4Z2R A;  3C4N A;  1VRQ B;  2YLX A;  2V5Z A;  2VZ2 A;  1K0I A;  2GH5 A;  4JDR A;  4BV6 A;  5KOW A;  4NEV A;  2GAG B;  2GR2 A;  3CGC A;  1E39 A;  3PVC A;  3QSS A;  1IUT A;  3UOY A;  1L9E A;  2WP9 A;  5FS8 A;  3GWF A;  4B65 A;  1K0L A;  3CNP A;  5KVH A;  1JNR A;  3P1W A;  2C75 A;  2BAB A;  1DNC A;  3M13 A;  2A89 A;  2ACZ A;  2C70 A;  3UTE A;  2J3N A;  1GES A;  4A6N A;  4BK1 A;  4U8O A;  3AEE A;  1GAL A;  5LV9 A;  2OAL A;  1FEA A;  5L46 A;  3CGD A;  3AEA A;  4H4W A;  5EB5 A;  4H4V A;  1TYT A;  2R9Z A;  5JCK A;  3LAD A;  4TM4 A;  5BVA A;  2ZZ0 A;  4H4R A;  4DGK A;  1PBE A;  1REO A;  2BCG G;  4H4U A;  3NHO X;  2Z5Y A;  2BXS A;  4LU6 A;  3BI4 A;  3NT6 A;  3ICS A;  1F8S A;  1CJ2 A;  1JRY A;  4PAB A;  5C2T A;  2YAU A;  2VRL A;  4CY6 A;  4JN9 A;  1PJ7 A;  3AE1 A;  5HXI A;  1GT8 A;  3I6D A;  3UKH A;  4A99 A;  4A9W A;  3CPJ G;  1ZOV A;  2ZZC A;  2WHD A;  3G5S A;  3GDP A;  3KKJ A;  1KSU A;  4ZN0 A;  2BXR A;  1PS9 A;  1EBD A;  2YVJ A;  4N9X A;  4YKF A;  4NTD A;  4YTM A;  3G5R A;  3II4 A;  2GMH A;  1E1M A;  4FK1 A;  2YLW A;  4YKG A;  1Y56 B;  3M12 A;  1YKJ A;  3VRA A;  2WOW A;  3ALJ A;  4LA1 A;  3EF6 A;  3I3L A;  3UTH A;  4AOX A;  4B63 A;  1D4C A;  4B1B A;  1KF6 A;  2A87 A;  3CNT A;  1W4X A;  3NKS A;  2R0C A;  3DA1 A;  2XDO A;  5J7X A;  1D4E A;  1FL2 A;  2YLR A;  1IUW A;  3K30 A;  3LXD A;  3DGZ A;  5KXJ A;  2I0Z A;  2YWL A;  3AYL A;  2WPF A;  1S2Y A;  4ZCD A;  3ZDN A;  2FJE A;  4RSL A;  1KNP A;  2B9X A;  2C64 A;  1GTE A;  4P9S A;  3NGC X;  1MOK A;  4HB9 A;  3NK2 X;  3UCL A;  5FS6 A;  1Q1W A;  1BF3 A;  4B64 A;  4I59 A;  3DK9 A;  3RP8 A;  4JY2 A;  3CNS A;  3B6D A;  3ZYX A;  3UOZ A;  2ARD A;  2V3B A;  1Z6L A;  2GF3 A;  3QVP A;  3CN8 A;  2YLT A;  3AED A;  2IID A;  4Z2U A;  1XAN A;  3H8I A;  2BA9 A;  1RSG A;  4K5S A;  3IF9 A;  2Q0L A;  2Z5X A;  1KNR A;  3AE4 A;  2E1M A;  4GCM A;  3EAO A;  2JK6 A;  4OPL A;  2BYB A;  4B69 A;  1VDC A;  3E1T A;  4H2R A;  2XFN A;  2YLZ A;  3IHG A;  3B3R A;  5M10 A;  3RP6 A;  2YR6 A;  1PXC A;  1PJ5 A;  2C76 A;  4CRT A;  4X4J A;  4D04 A;  4E0V A;  2B7R A;  2ZBW A;  3VR8 A;  1EL9 A;  2JAE A;  2XFQ A;  3P4R A;  2V60 A;  1GRB A;  2BK5 A;  2QCU A;  1ONF A;  1ZKQ A;  1NHQ A;  2ZZB A;  1TDE A;  3LZW A;  1EL5 A;  1CC6 A;  1DXL A;  4U8N A;  3BHK A;  3P9U A;  1M64 A;  3AEB A;  5EB4 A;  2YVG A;  3H4K A;  1B5Q A;  1F3P A;  4NEW A;  4YWO A;  4AT2 A;  2C65 A;  2YG6 A;  4UDR A;  5U63 A;  2EQ8 A;  1TDO A;  2EQ6 A;  1PBF A;  2XVE A;  2YQU A;  2UZZ A;  2F5Z A;  1CJ3 A;  2XLP A;  3F8R A;  1E6E A;  1COY A;  3ICR A;  1BKW A;  4IA5 A;  2EQ7 A;  2WOI A;  1N1P A;  3GRS A;  1MXT A;  3QSE A;  3RED A;  2GR1 A;  1O94 A;  2BCP A;  3UKK A;  3G5Q A;  3BHF A;  1CC4 A;  3DJG X;  2WS3 A;  4EM4 A;  1AOG A;  2CDU A;  1L9D A;  4PAA A;  3ATQ A;  1TDK A;  2Q6U A;  1IJH A;  2WU5 A;  1OJA A;  3AYJ A;  2TMD A;  4APN A;  4AP3 A;  3UKP A;  4Z43 A;  4OPG A;  2GR0 A;  2XVJ A;  2W0H A;  3K7Q X;  4I58 A;  3SFD A;  2BS3 A;  1GEU A;  4K2X A;  4AOS A;  1ZMD A;  1DOE A;  2R45 A;  1FEB A;  1OJ9 A;  3URH A;  1K4Q A;  1NHP A;  4GF7 A;  1QO8 A;  3OZ2 A;  4J56 A;  1E1K A;  2R0P A;  1YQ4 A;  1GRE A;  1B8S A;  3LZX A;  4H2P A;  2VVL G;  4U8J A;  4TM0 A;  4AT0 A;  4J33 A;  3LJP A;  3K7T A;  2YG4 A;  1ZDL A;  1S3B A;  1Y56 A;  3RP7 A;  4EIQ A;  2XFU A;  3D8X A;  1MO9 A;  1TYP A;  3IHM A;  4GDP A;  4BJZ A;  3P4Q A;  2H89 A;  3BI5 A;  1F8R A;  2OLN A;  2BAC A;  3PS9 A;  2VVL A;  4UDQ A;  1L0V A;  1JEH A;  4DNA A;  3AEC A;  3NH3 X;  4CNK A;  4YT0 A;  4NTE A;  3QVR A;  4JQ9 A;  2BK3 A;  1EL8 A;  3ATR A;  1PDH A;  2GVC A;  3GD4 A;  5CQF A;  5U1O A;  1S3E A;  2BC1 A;  5U25 A;  2RGH A;  2VVM A;  3NLC A;  4USR A;  4YSH A;  3UOX A;  2A8X A;  1O95 A;  3NYE A;  2GR3 A;  1XHC A;  2XVI A;  2O9Z A;  2C3D A;  3GWD A;  2GAH B;  1VG0 A;  2XYO A;  3GMB A;  2HQM A;  1E1N A;  4TM3 A;  1ZP0 A;  1XDI A;  3UP5 A;  1GOS A;  3C4A A;  4FX9 A;  4H4S A;  4AP1 A;  3BNU A;  1JOA A;  4TLX A;  1IUX A;  2EQ9 A;  4U8M A;  3NIX A;  4XWR A;  2XVH A;  3GDN A;  3FIM B;  4GDE A;  3QSM A;  3C96 A;  2GQF A;  2VOU A;  4MJW A;  5EBK A;  1ZX9 A;  2WES A;  1H84 A;  2XLR A;  4O5Q A;  1PBD A;  1VQW A;  3AE2 A;  5GRT A;  1NG4 A;  3S61 A;  4ICY A;  5CKU A;  5BRT A;  1H83 A;  4EQX A;  1D7L A;  5JCL A;  2WPC A;  3EAN A;  5HYM A;  1LV0 A;  1Q1R A;  5KWF A;  3AD8 B;  2RGO A;  2APG A;  2B9W A;  4FK1 C;  2CFY A;  3NTA A;  4YSZ A;  5IPY A;  5IQ1 A;  5J60 A;  2GMJ A;  1FCD A;  2PYX A;  4BUR A;  4Y4N A;  2C7G A;  3BNM A;  2Y6Q A;  2V61 A;  4K8D A;  3SGL A;  1OJT A;  1PJ6 A;  2QA1 A;  4H4T A;  5FMH A;  5KVI A;  3AE6 A;  1UKV G;  2GV8 A;  2OA1 A;  3AE3 A;  2IVE A;  3FG2 P;  4IV9 A;  1OJD A;  1IUV A;  1QLB A;  3HZL A;  5KOX A;  2C72 A;  4H7U A;  2YM2 A;  3SFE A;  2C73 A;  1OJC A;  2XFP A;  3CND A;  3QFB A;  1NHS A;  1JNZ A;  1GSN A;  3CNJ A;  3KU9 A;  2V6O A;  3FBS A;  4H4Q A;  1JRX A;  4OPI A;  1CF3 A;  3Q6J A;  4GR1 A;  3JSK A;  4KX6 A;  4OPU A;  3DH9 A;  4B66 A;  1ELI A;  3NN0 X;  3RNM A;  5IQ4 A;  4H4Y A;  1GPE A;  4J57 A;  3DK4 A;  4JNQ A;  3ABV A;  1Q9I A;  2YVF A;  1H7X A;  1ZK7 A;  5BUK A;  3SM8 A;  1KDG A;  1NG3 A;  1NDA A;  4C3X A;  2X50 A;  2WEU A;  3AE7 A;  2VQ7 A;  3ALL A;  4TLZ A;  1KFY A;  4EMW A;  2NPX A;  1BGN A;  4EQR A;  1KSS A;  3KA7 A;  3P4S A;  2GQW A;  5HY5 A;  1YQZ A;  1GV4 A;  1H86 A;  1YY5 A;  2YG5 A;  3V76 A;  1CL0 A;  4XXG A;  1NEN A;  1LJ1 A;  3AEF A;  3M0O A;  1VG9 A;  1CJC A;  3H8L A;  3F8P A;  3UP4 A;  4YSX A;  1GND A;  4OPT A;  1CC2 A;  1JU2 A;  3NG7 X;  1CBO A;  2C67 A;  1N4V A;  5FS9 A;  2Y6R A;  3DME A;  3DK8 A;  2IVD A;  3ITJ A;  3QJ4 A;  3AD9 B;  2C66 A;  4JNA A;  2H88 A;  1N4U A;  2OAM A;  1V59 A;  3O0H A;  1PXB A;  4EMJ A;  4USQ A;  2JBV A;  1DJN A;  3CPH G;  1L9C A;  4J36 A;  4TM1 A;  3V3O A;  5BUL A;  2DKH A;  3K7M X;  3LOV A;  4B67 A;  4Z24 A;  2JB2 A;  2QAE A;  5TR3 A; 
#chains in the Genus database with same CATH topology
 1Y0P A;  2WDQ A;  3UKA A;  3EPT A;  4RG4 A;  3NRN A;  4G9K A;  4B68 A;  1LTX R;  4IVO B;  3T31 A;  2YG7 A;  2X8C A;  2GB0 A;  2R4J A;  1ZOY A;  3IC9 A;  3DJJ A;  4GRT A;  4H4X A;  4DSG A;  3L8K A;  4NZH A;  2FBW A;  3DGH A;  1GRG A;  2CVJ A;  5JCN A;  4U8L A;  1PBC A;  4BK2 A;  2AR8 A;  1LQT A;  2JB3 A;  3PO7 A;  4J2W A;  3AE8 A;  3D1C A;  3GYI A;  4K5R A;  3UKF A;  3Q9T A;  4J31 A;  4A6N B;  1FOH A;  3GRT A;  3GD3 A;  1LQU A;  4EIP A;  4H50 A;  3NYF A;  1X31 B;  4KPR A;  3HYX A;  2JKC A;  1GTH A;  3ALM A;  2BC0 A;  1P2E A;  1DOB A;  2WET A;  5KRQ A;  1AN9 A;  2GRT A;  2V3A A;  3GMC A;  5JCI A;  5DBJ A;  4C5O A;  5C3J A;  3ADA B;  1GXF A;  2B7S A;  2Q7V A;  1PXA A;  2WOV A;  3FPZ A;  3GYX A;  2XLS A;  4CY8 A;  4U2T A;  2RGJ A;  1O5W A;  1DOD A;  4CCQ A;  4U8P A;  2WQY A;  2NVK X;  3RHA A;  4EQW A;  3UTF A;  1IUU A;  1NEK A;  1LPF A;  1EL7 A;  4RG3 A;  5M0Z A;  1H6V A;  2YR4 A;  3CMM A;  4UP3 A;  3NTD A;  4GAV A;  4CCR A;  1HYU A;  1BWC A;  2VRM A;  3UOV A;  1TRB A;  4REK A;  4U8K A;  2X8H A;  3L1R A;  3NK0 X;  4U2L A;  2FJB A;  1NPX A;  1H82 A;  1H7W A;  3DJE A;  4NTC A;  3AWI A;  1GRF A;  2BS2 A;  3AE9 A;  3UTG A;  5KMS A;  3P4P A;  4CBQ A;  4XWZ A;  1B37 A;  1C0P A;  3AYI A;  1RYI A;  2OLO A;  2X3N A;  4Y4L A;  3NYC A;  1TDN A;  3CGE A;  2AQJ A;  3ISH A;  3FMW A;  4UDP A;  1BGJ A;  1E1L A;  3AXB A;  1GET A;  2QA2 A;  3IWA A;  5HHF A;  5FS7 A;  2B9Y A;  3CTY A;  4WX1 A;  1DOC A;  1GRT A;  3BI2 A;  4Z26 A;  4HA6 A;  2WU2 A;  3V3N A;  4EM3 A;  3GSI A;  4FDC B;  4YXD A;  4IA6 A;  2BK4 A;  2AAQ A;  3T37 A;  2XVF A;  4JY3 A;  1K0J A;  4H4Z A;  2R4E A;  4Y4M A;  3F8D A;  2RAB A;  4OPC A;  4X9M A;  2E4G A;  4OPD A;  1D7Y A;  3UKL A;  1DAO A;  1CJ4 A;  2BRY A;  1QJD A;  1DJQ A;  1IUS A;  1GRA A;  4LII A;  1TDF A;  4DSH A;  2DKI A;  1RP0 A;  2C3C A;  3SZC A;  1FEC A;  2FJA A;  1F8W A;  1P2H A;  2B76 A;  3VQR A;  2PHH A;  4OCG A;  1N4W A;  2WP5 A;  3UKQ A;  4Z25 A;  2BS4 A;  2E48 A;  1YQ3 A;  3R9U A;  3CIR A;  4A5L A;  4K7Z A;  4BK3 A;  2GEW A;  2CUL A;  3WE0 A;  2WP6 A;  4Z44 A;  1D4D A;  3SQP A;  4C77 A;  1GER A;  2TPR A;  2Q0K A;  2JB1 A;  3AE5 A;  1PBB A;  1E7P A;  4A7A A;  2WDR A;  1D5T A;  4ECH A;  2XLT A;  1PHH A;  1F6M A;  3DJD A;  4EQS A;  4J34 A;  4NWZ A;  2XCG A;  4U2S A;  1H81 A;  3CPI G;  4YSY A;  1PN0 A;  3LB8 A;  1SEZ A;  4X9N A;  3KVE A;  4IVM B;  2XLU A;  3OC4 A;  4O5U A;  3KD9 A;  1NHR A;  2X99 A;  3AB1 A;  2YG3 A;  2WDV A;  2YM1 A;  4K22 A;  3NK1 X;  3S5W A;  4CNJ A;  4QFC A;  3QFA A;  1M6I A;  4A79 A;  2E5V A;  2BRA A;  3GYJ A;  1XPQ A;  3COX A;  4M52 A;  2YR5 A;  2WPE A;  3HYW A;  1ZMC A;  2R46 A;  5GSN A;  2X8G A;  5ER0 A;  3KPF A;  1LVL A;  3SZ0 A;  4Z2T A;  1CHU A;  4G73 A;  4D03 A;  4YTN A;  3T0K A;  4C74 A;  3VR9 A;  2VQB A;  4OVI A;  3CGB A;  4WCT A;  4BJY A;  4GUV A;  3VRB A;  3SXI A;  5EOW A;  5JCM A;  1ZY8 A;  2FJD A;  4C3Y A;  4YTP A;  4EMI A;  1S2Q A;  4U8I A;  1JRZ A;  4H4P A;  4ZCC A;  4H2Q A;  2YLS A;  3AD7 B;  4ADW A;  1BZL A;  1B4V A;  1GRH A;  3KLJ A;  2XFO A;  3NNE A;  3NN6 X;  4H2N A;  2WBA A;  3VRD B;  4A65 A;  3AEG A;  1NAA A;  3ICT A;  2R0G A;  4Z2R A;  3C4N A;  1VRQ B;  2YLX A;  2V5Z A;  2VZ2 A;  1K0I A;  2GH5 A;  4JDR A;  4BV6 A;  5KOW A;  4NEV A;  2GAG B;  2GR2 A;  3CGC A;  3PVC A;  3QSS A;  1E39 A;  1IUT A;  3UOY A;  1C0L A;  1L9E A;  2WP9 A;  5FS8 A;  3GWF A;  4B65 A;  1K0L A;  3CNP A;  5KVH A;  1JNR A;  3P1W A;  2C75 A;  2BAB A;  1DNC A;  3M13 A;  2A89 A;  2ACZ A;  2C70 A;  3UTE A;  2J3N A;  1GES A;  4BK1 A;  4A6N A;  4U8O A;  3AEE A;  1GAL A;  5LV9 A;  5L46 A;  1FEA A;  2OAL A;  3ZNN A;  3AEA A;  3CGD A;  4H4W A;  5EB5 A;  4H4V A;  1TYT A;  2R9Z A;  3SZF A;  5JCK A;  3LAD A;  4TM4 A;  5BVA A;  2ZZ0 A;  4H4R A;  4DGK A;  1PBE A;  1REO A;  2BCG G;  4H4U A;  2E82 A;  3NHO X;  2Z5Y A;  2BXS A;  4LU6 A;  3BI4 A;  3NT6 A;  3ICS A;  1F8S A;  4G74 A;  3SZW A;  1CJ2 A;  1JRY A;  4PAB A;  5C2T A;  2YAU A;  2VRL A;  4CY6 A;  2E49 A;  4JN9 A;  1PJ7 A;  3AE1 A;  5HXI A;  1GT8 A;  3I6D A;  3UKH A;  4A99 A;  4A9W A;  3CPJ G;  1ZOV A;  2ZZC A;  3SYI A;  2WHD A;  3G5S A;  3GDP A;  3KKJ A;  1KSU A;  4ZN0 A;  2BXR A;  1PS9 A;  1EBD A;  2YVJ A;  4N9X A;  4NNJ A;  4NTD A;  4YKF A;  3G5R A;  3II4 A;  4YTM A;  4YJF B;  2GMH A;  1E1M A;  4FK1 A;  2YLW A;  4YKG A;  1Y56 B;  3M12 A;  1YKJ A;  3VRA A;  2WOW A;  4QFD A;  3ALJ A;  4LA1 A;  3EF6 A;  3I3L A;  3UTH A;  4AOX A;  4B63 A;  4YJG A;  1D4C A;  4B1B A;  1KF6 A;  2A87 A;  3CNT A;  1W4X A;  3NKS A;  2R0C A;  3DA1 A;  2XDO A;  5J7X A;  1D4E A;  2C4C A;  1FL2 A;  2YLR A;  3ZNQ A;  1IUW A;  3K30 A;  3LXD A;  3W4I A;  3DGZ A;  4YJF A;  2I0Z A;  5KXJ A;  2YWL A;  3AYL A;  2WPF A;  1S2Y A;  4ZCD A;  3ZDN A;  2FJE A;  4RSL A;  1KNP A;  2B9X A;  2C64 A;  1GTE A;  4P9S A;  3NGC X;  1MOK A;  4HB9 A;  3NK2 X;  3UCL A;  5FS6 A;  1Q1W A;  1BF3 A;  4B64 A;  4I59 A;  3DK9 A;  3RP8 A;  4JY2 A;  3CNS A;  3B6D A;  3ZYX A;  3UOZ A;  2ARD A;  2V3B A;  1Z6L A;  2GF3 A;  3QVP A;  3CN8 A;  2YLT A;  3AED A;  2IID A;  4Z2U A;  1XAN A;  3H8I A;  2BA9 A;  1RSG A;  4K5S A;  3IF9 A;  2Q0L A;  2QAE A;  2Z5X A;  1KNR A;  3AE4 A;  2E1M A;  4GCM A;  3EAO A;  2JK6 A;  4OPL A;  2BYB A;  4B69 A;  3E1T A;  1VDC A;  4H2R A;  2XFN A;  2YLZ A;  3IHG A;  1C0K A;  3B3R A;  5M10 A;  3RP6 A;  2YR6 A;  1PXC A;  1PJ5 A;  2C76 A;  4CRT A;  4X4J A;  4D04 A;  4E0V A;  2B7R A;  2ZBW A;  4GAP A;  3VR8 A;  3ZNP A;  1EL9 A;  2JAE A;  2XFQ A;  3P4R A;  2V60 A;  1GRB A;  2BK5 A;  1C0I A;  2QCU A;  1ONF A;  1ZKQ A;  2DU8 A;  1NHQ A;  2ZZB A;  1TDE A;  3LZW A;  1EL5 A;  1CC6 A;  1DXL A;  4U8N A;  3BHK A;  4YJH B;  3P9U A;  3W4J A;  1M64 A;  3AEB A;  5EB4 A;  2YVG A;  3H4K A;  1B5Q A;  1F3P A;  4NEW A;  4YWO A;  5IQ4 A;  4AT2 A;  2C65 A;  2YG6 A;  4UDR A;  5U63 A;  1TDO A;  2EQ6 A;  2EQ8 A;  1PBF A;  2XVE A;  2YQU A;  2UZZ A;  2F5Z A;  1CJ3 A;  2XLP A;  3F8R A;  5KMP A;  1E6E A;  1COY A;  3ICR A;  1BKW A;  4IA5 A;  2EQ7 A;  2WOI A;  1N1P A;  3GRS A;  1MXT A;  3QSE A;  3RED A;  2GR1 A;  1O94 A;  2BCP A;  3UKK A;  3G5Q A;  3BHF A;  1CC4 A;  3DJG X;  2WS3 A;  4EM4 A;  1AOG A;  2CDU A;  1L9D A;  4PAA A;  3ATQ A;  3ZNO A;  1TDK A;  2Q6U A;  1IJH A;  2WU5 A;  1OJA A;  3AYJ A;  2TMD A;  4YJG B;  4APN A;  4AP3 A;  3UKP A;  4Z43 A;  4OPG A;  2GR0 A;  2XVJ A;  2W0H A;  3K7Q X;  4I58 A;  3SFD A;  2BS3 A;  1GEU A;  4K2X A;  4AOS A;  2R45 A;  1DOE A;  1ZMD A;  1FEB A;  1OJ9 A;  3URH A;  1K4Q A;  1NHP A;  4G6H A;  4GF7 A;  1QO8 A;  3OZ2 A;  4J56 A;  2E4A A;  1E1K A;  2R0P A;  1YQ4 A;  1GRE A;  1B8S A;  3LZX A;  4H2P A;  2VVL G;  4U8J A;  4TM0 A;  4AT0 A;  4J33 A;  3T14 A;  3LJP A;  3K7T A;  2YG4 A;  1ZDL A;  1S3B A;  1Y56 A;  4G6G A;  3RP7 A;  4EIQ A;  2XFU A;  3D8X A;  1MO9 A;  1TYP A;  3IHM A;  1VE9 A;  4BJZ A;  4GDP A;  3P4Q A;  2H89 A;  3BI5 A;  1F8R A;  2OLN A;  3PS9 A;  2BAC A;  2VVL A;  4UDQ A;  1L0V A;  1JEH A;  4DNA A;  3AEC A;  3NH3 X;  5KMR A;  4CNK A;  4YT0 A;  4NTE A;  3QVR A;  4JQ9 A;  2BK3 A;  1EL8 A;  3ATR A;  1PDH A;  2GVC A;  3GD4 A;  5CQF A;  5U1O A;  1S3E A;  2BC1 A;  5U25 A;  2RGH A;  2VVM A;  3NLC A;  4USR A;  4YSH A;  3UOX A;  2A8X A;  5KNL A;  3NYE A;  1O95 A;  2GR3 A;  1XHC A;  2XVI A;  4YJH A;  2O9Z A;  2C3D A;  3GWD A;  2GAH B;  1VG0 A;  2XYO A;  3GMB A;  2HQM A;  1E1N A;  4TM3 A;  1ZP0 A;  3W4K A;  1XDI A;  3UP5 A;  1GOS A;  3C4A A;  4FX9 A;  4H4S A;  4AP1 A;  3BNU A;  1JOA A;  4TLX A;  1IUX A;  3CUK A;  2EQ9 A;  4U8M A;  3NIX A;  4XWR A;  2XVH A;  3GDN A;  3FIM B;  4GDE A;  3QSM A;  3C96 A;  2VOU A;  2GQF A;  4MJW A;  5EBK A;  1ZX9 A;  2WES A;  1H84 A;  2XLR A;  4O5Q A;  1PBD A;  1VQW A;  3AE2 A;  3T2K A;  5GRT A;  1NG4 A;  3S61 A;  4ICY A;  5CKU A;  5BRT A;  3SX6 A;  1H83 A;  3SY4 A;  4EQX A;  1D7L A;  5JCL A;  5HYM A;  2WPC A;  3EAN A;  1LV0 A;  1Q1R A;  5KWF A;  2RGO A;  2APG A;  2B9W A;  4FK1 C;  2CFY A;  3NTA A;  3G3E A;  4YSZ A;  5IPY A;  3HYV A;  5IQ1 A;  5J60 A;  2GMJ A;  1FCD A;  2PYX A;  3WGT A;  4BUR A;  4Y4N A;  2C7G A;  3BNM A;  2Y6Q A;  2V61 A;  4K8D A;  3SGL A;  1OJT A;  4II2 A;  1PJ6 A;  2QA1 A;  4H4T A;  5FMH A;  5KVI A;  3AE6 A;  1UKV G;  4YJD A;  2GV8 A;  2OA1 A;  3AE3 A;  2IVE A;  3FG2 P;  4IV9 A;  1OJD A;  1IUV A;  3HZL A;  1QLB A;  5KOX A;  2C72 A;  4H7U A;  2YM2 A;  3T2Z A;  1EVI A;  4II3 A;  3SFE A;  2C73 A;  1OJC A;  2XFP A;  3CND A;  3QFB A;  1NHS A;  1JNZ A;  1GSN A;  3CNJ A;  3KU9 A;  2V6O A;  3FBS A;  4H4Q A;  1JRX A;  4OPI A;  1CF3 A;  3Q6J A;  4GR1 A;  3JSK A;  4KX6 A;  4OPU A;  3DH9 A;  4B66 A;  1ELI A;  3NN0 X;  1DDO A;  3RNM A;  4H4Y A;  1GPE A;  4J57 A;  3DK4 A;  4JNQ A;  3ABV A;  1Q9I A;  2YVF A;  1H7X A;  1ZK7 A;  5BUK A;  3SM8 A;  1NG3 A;  1KDG A;  1NDA A;  4C3X A;  2X50 A;  2WEU A;  3AE7 A;  2VQ7 A;  3ALL A;  4TLZ A;  1KFY A;  4EMW A;  2NPX A;  1BGN A;  4EQR A;  1KSS A;  3KA7 A;  3P4S A;  2GQW A;  5HY5 A;  1YQZ A;  1GV4 A;  1H86 A;  1YY5 A;  2YG5 A;  3V76 A;  1CL0 A;  4XXG A;  1NEN A;  1KIF A;  1LJ1 A;  3AEF A;  3M0O A;  1VG9 A;  1CJC A;  3H8L A;  3F8P A;  3UP4 A;  4YSX A;  1GND A;  4OPT A;  1CC2 A;  1JU2 A;  3NG7 X;  1CBO A;  2C67 A;  3KPK A;  3T2Y A;  1N4V A;  5FS9 A;  3DME A;  2Y6R A;  3DK8 A;  2IVD A;  3ITJ A;  3QJ4 A;  3AD9 B;  2C66 A;  4JNA A;  2H88 A;  1N4U A;  2OAM A;  1V59 A;  3O0H A;  1PXB A;  4EMJ A;  4USQ A;  2JBV A;  1DJN A;  3CPH G;  1L9C A;  4J36 A;  4TM1 A;  3V3O A;  5BUL A;  2DKH A;  3K7M X;  3LOV A;  4B67 A;  4Z24 A;  2JB2 A;  5KMQ A;  3AD8 B;  5TR3 A; 
#chains in the Genus database with same CATH homology
 1Y0P A;  2WDQ A;  3UKA A;  3EPT A;  4RG4 A;  3NRN A;  4G9K A;  4B68 A;  1LTX R;  4IVO B;  3T31 A;  2YG7 A;  2X8C A;  2GB0 A;  2R4J A;  1ZOY A;  3IC9 A;  3DJJ A;  4GRT A;  4H4X A;  4DSG A;  3L8K A;  4NZH A;  2FBW A;  3DGH A;  1GRG A;  2CVJ A;  5JCN A;  4U8L A;  4BK2 A;  1PBC A;  2AR8 A;  1LQT A;  2JB3 A;  3PO7 A;  4J2W A;  3AE8 A;  3D1C A;  3GYI A;  4K5R A;  3UKF A;  3Q9T A;  4J31 A;  4A6N B;  1FOH A;  3GRT A;  3GD3 A;  1LQU A;  4EIP A;  4H50 A;  3NYF A;  1X31 B;  4KPR A;  3HYX A;  2JKC A;  1GTH A;  3ALM A;  2BC0 A;  1P2E A;  1DOB A;  2WET A;  5KRQ A;  2GRT A;  2V3A A;  3GMC A;  5JCI A;  5DBJ A;  4C5O A;  5C3J A;  1GXF A;  2WOV A;  2B7S A;  2Q7V A;  1PXA A;  3ADA B;  3FPZ A;  3GYX A;  2XLS A;  4CY8 A;  4U2T A;  2RGJ A;  1O5W A;  1DOD A;  4CCQ A;  4U8P A;  2WQY A;  2NVK X;  3RHA A;  4EQW A;  3UTF A;  1IUU A;  1NEK A;  1LPF A;  1EL7 A;  4RG3 A;  5M0Z A;  1H6V A;  2YR4 A;  3CMM A;  4UP3 A;  3NTD A;  4GAV A;  4CCR A;  1HYU A;  1BWC A;  2VRM A;  3UOV A;  1TRB A;  4REK A;  4U8K A;  2X8H A;  3L1R A;  3NK0 X;  4U2L A;  2FJB A;  1NPX A;  1H82 A;  1H7W A;  3DJE A;  4NTC A;  3AWI A;  1GRF A;  2BS2 A;  3AE9 A;  3UTG A;  5KMS A;  3P4P A;  4CBQ A;  4XWZ A;  1B37 A;  3AYI A;  1RYI A;  2OLO A;  2X3N A;  4Y4L A;  3NYC A;  1TDN A;  3CGE A;  2AQJ A;  3ISH A;  3FMW A;  4UDP A;  1BGJ A;  1E1L A;  3AXB A;  1GET A;  2QA2 A;  3IWA A;  5HHF A;  5FS7 A;  2B9Y A;  3CTY A;  4WX1 A;  1DOC A;  1GRT A;  3BI2 A;  4Z26 A;  4HA6 A;  2WU2 A;  3V3N A;  4EM3 A;  3GSI A;  4FDC B;  4YXD A;  4IA6 A;  2BK4 A;  2AAQ A;  3T37 A;  2XVF A;  4JY3 A;  1K0J A;  4H4Z A;  2R4E A;  4Y4M A;  3F8D A;  2RAB A;  4OPC A;  4X9M A;  2E4G A;  4OPD A;  1D7Y A;  3UKL A;  1CJ4 A;  2BRY A;  1QJD A;  1DJQ A;  1IUS A;  1GRA A;  4LII A;  1TDF A;  4DSH A;  2DKI A;  1RP0 A;  2C3C A;  3SZC A;  1FEC A;  2FJA A;  1F8W A;  1P2H A;  2B76 A;  3VQR A;  2PHH A;  4OCG A;  1N4W A;  2WP5 A;  3UKQ A;  4Z25 A;  2BS4 A;  1YQ3 A;  3R9U A;  3CIR A;  4A5L A;  4K7Z A;  4BK3 A;  2GEW A;  2CUL A;  3WE0 A;  2WP6 A;  4Z44 A;  1D4D A;  3SQP A;  4C77 A;  1GER A;  2TPR A;  2Q0K A;  2JB1 A;  3AE5 A;  1E7P A;  1PBB A;  4A7A A;  2WDR A;  1D5T A;  4ECH A;  2XLT A;  1PHH A;  1F6M A;  3DJD A;  4EQS A;  4J34 A;  4NWZ A;  2XCG A;  4U2S A;  1H81 A;  3CPI G;  4YSY A;  1PN0 A;  3LB8 A;  1SEZ A;  3KVE A;  4IVM B;  4X9N A;  2XLU A;  3OC4 A;  4O5U A;  3KD9 A;  1NHR A;  2X99 A;  3AB1 A;  2YG3 A;  2WDV A;  2YM1 A;  4K22 A;  3NK1 X;  3S5W A;  4CNJ A;  3QFA A;  1M6I A;  4A79 A;  2E5V A;  2BRA A;  3GYJ A;  1XPQ A;  3COX A;  4M52 A;  2YR5 A;  2WPE A;  3HYW A;  1ZMC A;  2R46 A;  5GSN A;  2X8G A;  5ER0 A;  3KPF A;  1LVL A;  3SZ0 A;  4Z2T A;  1CHU A;  4G73 A;  4D03 A;  4YTN A;  3T0K A;  4C74 A;  3VR9 A;  2VQB A;  4OVI A;  3CGB A;  4WCT A;  4BJY A;  4GUV A;  3VRB A;  3SXI A;  5EOW A;  5JCM A;  1ZY8 A;  2FJD A;  4C3Y A;  4YTP A;  4EMI A;  1S2Q A;  4U8I A;  1JRZ A;  4H4P A;  4ZCC A;  4H2Q A;  2YLS A;  3AD7 B;  4ADW A;  1BZL A;  1B4V A;  1GRH A;  3KLJ A;  2XFO A;  3NNE A;  3NN6 X;  4H2N A;  2WBA A;  3VRD B;  4A65 A;  3AEG A;  1NAA A;  3ICT A;  2R0G A;  4Z2R A;  3C4N A;  1VRQ B;  2YLX A;  2V5Z A;  2VZ2 A;  1K0I A;  2GH5 A;  4JDR A;  4BV6 A;  5KOW A;  4NEV A;  2GAG B;  2GR2 A;  3CGC A;  1E39 A;  3PVC A;  3QSS A;  1IUT A;  3UOY A;  1L9E A;  2WP9 A;  5FS8 A;  3GWF A;  4B65 A;  1K0L A;  3CNP A;  5KVH A;  1JNR A;  3P1W A;  2C75 A;  2BAB A;  1DNC A;  3M13 A;  2A89 A;  2ACZ A;  2C70 A;  3UTE A;  2J3N A;  1GES A;  4BK1 A;  4A6N A;  4U8O A;  3AEE A;  1GAL A;  5LV9 A;  2OAL A;  1FEA A;  5L46 A;  3CGD A;  3AEA A;  4H4W A;  5EB5 A;  4H4V A;  1TYT A;  2R9Z A;  3SZF A;  5JCK A;  3LAD A;  4TM4 A;  5BVA A;  2ZZ0 A;  4H4R A;  4DGK A;  1PBE A;  1REO A;  2BCG G;  4H4U A;  3NHO X;  2Z5Y A;  2BXS A;  4LU6 A;  3BI4 A;  3NT6 A;  3ICS A;  1F8S A;  4G74 A;  3SZW A;  1CJ2 A;  1JRY A;  4PAB A;  5C2T A;  2YAU A;  2VRL A;  4CY6 A;  4JN9 A;  1PJ7 A;  3AE1 A;  5HXI A;  1GT8 A;  3I6D A;  3UKH A;  4A99 A;  4A9W A;  3CPJ G;  1ZOV A;  2ZZC A;  3SYI A;  2WHD A;  3G5S A;  3GDP A;  3KKJ A;  1KSU A;  4ZN0 A;  2BXR A;  1PS9 A;  1EBD A;  2YVJ A;  4N9X A;  4NNJ A;  4NTD A;  4YKF A;  3G5R A;  3II4 A;  4YTM A;  2GMH A;  1E1M A;  4FK1 A;  2YLW A;  4YKG A;  1Y56 B;  3M12 A;  1YKJ A;  3VRA A;  2WOW A;  3ALJ A;  4LA1 A;  3EF6 A;  3I3L A;  3UTH A;  4AOX A;  4B63 A;  1D4C A;  4B1B A;  1KF6 A;  2A87 A;  3CNT A;  1W4X A;  3NKS A;  2R0C A;  3DA1 A;  2XDO A;  5J7X A;  1D4E A;  2C4C A;  1FL2 A;  2YLR A;  1IUW A;  3K30 A;  3LXD A;  3DGZ A;  5KXJ A;  2I0Z A;  2YWL A;  3AYL A;  2WPF A;  1S2Y A;  4ZCD A;  3ZDN A;  2FJE A;  4RSL A;  1KNP A;  2B9X A;  2C64 A;  1GTE A;  4P9S A;  3NGC X;  1MOK A;  4HB9 A;  3NK2 X;  3UCL A;  5FS6 A;  1Q1W A;  1BF3 A;  4B64 A;  4I59 A;  3DK9 A;  3RP8 A;  4JY2 A;  3CNS A;  3B6D A;  3ZYX A;  3UOZ A;  2ARD A;  2V3B A;  1Z6L A;  2GF3 A;  3QVP A;  3CN8 A;  2YLT A;  3AED A;  2IID A;  4Z2U A;  1XAN A;  3H8I A;  2BA9 A;  1RSG A;  4K5S A;  3IF9 A;  2Q0L A;  2Z5X A;  1KNR A;  3AE4 A;  2E1M A;  4GCM A;  3EAO A;  2JK6 A;  4OPL A;  2BYB A;  4B69 A;  3E1T A;  1VDC A;  4H2R A;  2XFN A;  2YLZ A;  3IHG A;  3B3R A;  5M10 A;  3RP6 A;  2YR6 A;  1PXC A;  1PJ5 A;  2C76 A;  4CRT A;  4X4J A;  4D04 A;  4E0V A;  2B7R A;  2ZBW A;  4GAP A;  3VR8 A;  1EL9 A;  2JAE A;  2XFQ A;  3P4R A;  2V60 A;  1GRB A;  2BK5 A;  2QCU A;  1ONF A;  1ZKQ A;  1NHQ A;  2ZZB A;  1TDE A;  3LZW A;  1EL5 A;  1CC6 A;  1DXL A;  4U8N A;  3BHK A;  3P9U A;  1M64 A;  3AEB A;  5EB4 A;  2YVG A;  3H4K A;  1B5Q A;  1F3P A;  4NEW A;  4YWO A;  4AT2 A;  2C65 A;  2YG6 A;  4UDR A;  5U63 A;  2EQ8 A;  1TDO A;  2EQ6 A;  1PBF A;  2XVE A;  2YQU A;  2UZZ A;  2F5Z A;  1CJ3 A;  2XLP A;  3F8R A;  5KMP A;  1E6E A;  1COY A;  3ICR A;  1BKW A;  4IA5 A;  2EQ7 A;  2WOI A;  1N1P A;  3GRS A;  1MXT A;  3QSE A;  3RED A;  2GR1 A;  1O94 A;  2BCP A;  3UKK A;  3G5Q A;  3BHF A;  1CC4 A;  3DJG X;  2WS3 A;  4EM4 A;  1AOG A;  2CDU A;  1L9D A;  4PAA A;  3ATQ A;  1TDK A;  2Q6U A;  1IJH A;  2WU5 A;  1OJA A;  3AYJ A;  2TMD A;  4APN A;  4AP3 A;  3UKP A;  4Z43 A;  4OPG A;  2GR0 A;  2XVJ A;  2W0H A;  3K7Q X;  4I58 A;  3SFD A;  2BS3 A;  1GEU A;  4K2X A;  4AOS A;  1ZMD A;  1DOE A;  2R45 A;  1FEB A;  1OJ9 A;  3URH A;  1K4Q A;  1NHP A;  4G6H A;  4GF7 A;  1QO8 A;  3OZ2 A;  4J56 A;  1E1K A;  2R0P A;  1YQ4 A;  1GRE A;  1B8S A;  3LZX A;  4H2P A;  2VVL G;  4U8J A;  4TM0 A;  4AT0 A;  4J33 A;  3T14 A;  3LJP A;  3K7T A;  2YG4 A;  1ZDL A;  1S3B A;  1Y56 A;  4G6G A;  3RP7 A;  4EIQ A;  2XFU A;  3D8X A;  1MO9 A;  1TYP A;  3IHM A;  4BJZ A;  4GDP A;  3P4Q A;  2H89 A;  3BI5 A;  1F8R A;  2OLN A;  2BAC A;  3PS9 A;  2VVL A;  4UDQ A;  1L0V A;  1JEH A;  4DNA A;  3AEC A;  3NH3 X;  5KMR A;  4CNK A;  4YT0 A;  4NTE A;  3QVR A;  4JQ9 A;  2BK3 A;  1EL8 A;  3ATR A;  1PDH A;  2GVC A;  3GD4 A;  5CQF A;  5U1O A;  1S3E A;  2BC1 A;  5U25 A;  2RGH A;  2VVM A;  3NLC A;  4USR A;  4YSH A;  3UOX A;  2A8X A;  5KNL A;  1O95 A;  3NYE A;  2GR3 A;  1XHC A;  2XVI A;  2O9Z A;  2C3D A;  3GWD A;  2GAH B;  1VG0 A;  2XYO A;  3GMB A;  2HQM A;  1E1N A;  4TM3 A;  1ZP0 A;  1XDI A;  3UP5 A;  1GOS A;  3C4A A;  4FX9 A;  4H4S A;  4AP1 A;  3BNU A;  1JOA A;  4TLX A;  1IUX A;  2EQ9 A;  4U8M A;  3NIX A;  4XWR A;  2XVH A;  3GDN A;  3FIM B;  4GDE A;  3QSM A;  3C96 A;  2VOU A;  2GQF A;  4MJW A;  5EBK A;  1ZX9 A;  2WES A;  1H84 A;  2XLR A;  4O5Q A;  1PBD A;  1VQW A;  3AE2 A;  3T2K A;  5GRT A;  1NG4 A;  3S61 A;  4ICY A;  5CKU A;  5BRT A;  3SX6 A;  1H83 A;  3SY4 A;  4EQX A;  1D7L A;  5JCL A;  5HYM A;  2WPC A;  3EAN A;  1LV0 A;  1Q1R A;  5KWF A;  3AD8 B;  2RGO A;  2APG A;  2B9W A;  4FK1 C;  2CFY A;  3NTA A;  4YSZ A;  5IPY A;  3HYV A;  5IQ1 A;  5J60 A;  2GMJ A;  1FCD A;  2PYX A;  4BUR A;  4Y4N A;  2C7G A;  3BNM A;  2Y6Q A;  2V61 A;  4K8D A;  3SGL A;  1OJT A;  4II2 A;  1PJ6 A;  2QA1 A;  4H4T A;  5FMH A;  5KVI A;  3AE6 A;  1UKV G;  2GV8 A;  2OA1 A;  3AE3 A;  2IVE A;  3FG2 P;  4IV9 A;  1OJD A;  1IUV A;  1QLB A;  3HZL A;  5KOX A;  2C72 A;  4H7U A;  2YM2 A;  3T2Z A;  4II3 A;  3SFE A;  2C73 A;  1OJC A;  2XFP A;  3CND A;  3QFB A;  1NHS A;  1JNZ A;  1GSN A;  3CNJ A;  3KU9 A;  2V6O A;  3FBS A;  4H4Q A;  1JRX A;  4OPI A;  1CF3 A;  3Q6J A;  4GR1 A;  3JSK A;  4KX6 A;  4OPU A;  3DH9 A;  4B66 A;  1ELI A;  3NN0 X;  3RNM A;  5IQ4 A;  4H4Y A;  1GPE A;  4J57 A;  3DK4 A;  4JNQ A;  3ABV A;  1Q9I A;  2YVF A;  1H7X A;  1ZK7 A;  5BUK A;  3SM8 A;  1KDG A;  1NG3 A;  1NDA A;  4C3X A;  2X50 A;  2WEU A;  3AE7 A;  2VQ7 A;  3ALL A;  4TLZ A;  1KFY A;  4EMW A;  2NPX A;  1BGN A;  4EQR A;  1KSS A;  3KA7 A;  3P4S A;  2GQW A;  5HY5 A;  1YQZ A;  1GV4 A;  1H86 A;  1YY5 A;  2YG5 A;  3V76 A;  1CL0 A;  4XXG A;  1NEN A;  1LJ1 A;  3AEF A;  3M0O A;  1VG9 A;  1CJC A;  3H8L A;  3F8P A;  3UP4 A;  4YSX A;  1GND A;  4OPT A;  1CC2 A;  1JU2 A;  3NG7 X;  1CBO A;  2C67 A;  3KPK A;  3T2Y A;  1N4V A;  5FS9 A;  2Y6R A;  3DME A;  3DK8 A;  2IVD A;  3ITJ A;  3QJ4 A;  3AD9 B;  2C66 A;  4JNA A;  2H88 A;  1N4U A;  2OAM A;  1V59 A;  3O0H A;  1PXB A;  4EMJ A;  4USQ A;  2JBV A;  1DJN A;  3CPH G;  1L9C A;  4J36 A;  4TM1 A;  3V3O A;  5BUL A;  2DKH A;  3K7M X;  3LOV A;  4B67 A;  4Z24 A;  2JB2 A;  5KMQ A;  2QAE A;  5TR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...