4H2NA

Crystal structure of mhpco, y270f mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
total genus 126
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2nA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2nA01
3KLJA 1D4EA 2EQ8A 3AE1A 4JY3A 1GPEA 3OZ2A 3AYJA 3M13A 4P9SA 3II4A 1NHSA 3LADA 3BI4A 2X50A 4LA1A 5FS8A 4C3XA 2AAQA 2YG6A 3KA7A 1K0LA 2O9ZA 1ZP0A 1E1MA 2GRTA 2WS3A 1MXTA 4B1BA 4REKA 1COYA 1JOAA 3UKHA 4BURA 2RGHA 2AR8A 1CJ2A 2YR6A 3AE3A 4DSGA 3DJEA 3G5RA 4K5SA 5J60A 3GSIA 3GRSA 1TRBA 5ER0A 4I58A 2R4EA 1RYIA 3QFBA 4B67A 3BI5A 4OVIA 1IUWA 3COXA 1D5TA 1GRHA 1O94A 4GCMA 4BK3A 1GV4A 4JY2A 4BJYA 3ISHA 4FX9A 1DJQA 5IQ4A 3B6DA 1JRYA 2C73A 2BK3A 3H4KA 1E6EA 2YLZA 5DBJA 4A7AA 1Z6LA 1EL9A 4GF7A 1PJ7A 2V3AA 3NK2X 4TM3A 1GXFA 1REOA 4J36A 4KPRA 3P4RA 2E4GA 5JCNA 3QVPA 4U8OA 1MOKA 3AE9A 3GD4A 3CGDA 3CTYA 1E1NA 5JCIA 4CBQA 3KKJA 1TDNA 2XCGA 3NK1X 1VRQB 4Y4NA 3CPJG 1KNPA 5TR3A 1GTHA 2TMDA 1VDCA 3F8RA 2YR4A 3FIMB 4XXGA 3RP7A 2GB0A 1CC4A 2ZZ0A 1EL5A 2CULA 3WE0A 2APGA 4H4TA 2R0GA 1B37A 3LOVA 4D03A 4YTMA 1B4VA 2WP5A 3AD8B 4Y4LA 1D4CA 1ONFA 2B9YA 1KFYA 5JCMA 4B68A 3O0HA 4H4WA 4KX6A 3AWIA 1BGNA 1VQWA 3NRNA 1H82A 1H86A 1ZKQA 2BACA 3NTAA 5CQFA 4ZCCA 4A65A 2FJEA 4EQWA 2ARDA 3NLCA 1TDFA 3EANA 1E7PA 4H50A 4B63A 2VQ7A 2XVJA 1JNZA 1XANA 3AXBA 4AT2A 1QJDA 2XVIA 2A89A 2C76A 2YAUA 2C65A 1GSNA 4OPTA 4IA5A 4B66A 2OA1A 2BCGG 3BNUA 4U8KA 1H83A 1NAAA 2YG3A 1NDAA 1TDKA 1H6VA 4AP3A 4Z25A 2Z5XA 4YXDA 1EL7A 1CJ3A 4IVOB 2PYXA 2B9WA 3AEBA 1JEHA 5IPYA 2YVFA 5EOWA 1GOSA 2VVLG 2Q7VA 1OJ9A 4H4ZA 5FS9A 4UDQA 1ZMDA 2HQMA 3LZWA 2IIDA 3F8PA 1CJCA 2BS4A 4AOXA 1N4UA 1F3PA 2A8XA 3SFEA 1TDOA 2GR0A 4YSHA 4YT0A 1CHUA 3QSEA 3C4NA 4CY8A 1GEUA 4U8PA 3GYIA 4A5LA 4C74A 2B7RA 5KVHA 4D04A 1N1PA 4FK1C 1GALA 4H4SA 4B69A 3FMWA 3UKKA 3UTFA 3GRTA 1NG4A 1Q9IA 2B7SA 1GERA 2GR2A 1RP0A 2WQYA 3AEGA 3P4QA 2QA1A 1QO8A 1QLBA 2C70A 4NZHA 2Q0KA 3GD3A 1YKJA 2BS3A 3L1RA 4AOSA 4Y4MA 1K0JA 3VQRA 1DODA 1L0VA 2W0HA 2XLPA 1L9EA 1LJ1A 1XHCA 3CGBA 1GT8A 4H4QA 4I59A 3H8IA 4J56A 2YM1A 4U8MA 2WP6A 3FG2P 4Z2TA 2EQ9A 4AT0A 2C3DA 2IVEA 2XYOA 2R0CA 1GRFA 4H2RA 2X8GA 5L46A 4GDPA 2JKCA 5HYMA 2F5ZA 2FJAA 2A87A 3IHGA 2WU5A 1JU2A 3RHAA 1NPXA 3ATRA 4J57A 3CN8A 4YSZA 1CC6A 1PXCA 2XFPA 3D1CA 2C3CA 2XFQA 3DMEA 4GDEA 3T37A 2H88A 1F8WA 4WX1A 3P9UA 4K2XA 3ICTA 1TYPA 1LQTA 2NVKX 2V61A 4TM1A 1S3BA 3RP6A 3R9UA 2GH5A 1K0IA 2WOVA 4JN9A 1GRBA 3UOVA 4EQXA 2BABA 2YR5A 3HZLA 1PJ6A 2WBAA 2WPFA 3AB1A 3V3OA 3GMCA 3LJPA 4YKGA 2BK4A 5BVAA 4YKFA 4XWRA 1PBBA 2BXRA 3P4SA 3LB8A 3OC4A 1CL0A 2QA2A 1H7WA 3I3LA 3SGLA 2GMHA 3UTGA 3M0OA 5JCKA 2YLTA 2GVCA 4Z2RA 1YQZA 2BC0A 3QSSA 1HYUA 1DOBA 1TYTA 4BV6A 4JNAA 4USRA 1PBEA 2YLSA 3DJGX 1NHQA 5KOXA 1XDIA 3EPTA 4EIPA 5BRTA 2V3BA 4A9WA 2R0PA 4FDCB 2UZZA 1LPFA 2XFOA 1S3EA 2Y6RA 5HY5A 2XFNA 1L9CA 2VRMA 4OPIA 1FOHA 3GWFA 4OPLA 1NHRA 2E1MA 2BK5A 2GMJA 3DGHA 4YWOA 2YLXA 3CGEA 3GWDA 2OAMA 1GNDA 1SEZA 3PVCA 1YQ4A 2JK6A 1PBCA 1V59A 3DK8A 1KSSA 4U8NA 4USQA 2GAHB 3ABVA 1ZMCA 4HB9A 3CGCA 5U25A 1ZOVA 4M52A 4NTCA 3UOXA 1P2HA 3ZYXA 1N4WA 3KVEA 4YTPA 4OPCA 2BCPA 2Q6UA 4O5UA 3NK0X 3LXDA 5BULA 3CIRA 4IA6A 4H2PA 2XVHA 3ALMA 2V6OA 3D8XA 2RABA 3SM8A 2B9XA 3CPHG 2X8HA 3AE7A 2YLWA 1ELIA 3ICSA 3NN0X 3ZDNA 4CCRA 1GRTA 3VR8A 4Z26A 2OLOA 2R45A 3NIXA 4RG4A 2AQJA 2GQFA 2XLSA 4J2WA 1IUTA 2WU2A 1DOEA 5M0ZA 1LV0A 3G5QA 3KPFA 1DXLA 3CNPA 4J33A 2NPXA 2B76A 3GDPA 3QSMA 3V3NA 1Q1RA 3URHA 4A99A 1H84A 3ICRA 2H89A 1FEBA 3CNSA 3DA1A 3NTDA 2GR1A 5FMHA 3AE6A 4EIQA 3AE5A 4X9MA 2XVFA 3GMBA 2GR3A 2WOIA 3AEAA 3NYEA 4NTEA 2CVJA 4Z24A 5U63A 4H4VA 4XWZA 3V76A 3P1WA 4OPDA 4ZCDA 3KD9A 2WP9A 2Z5YA 2JB2A 4TM0A 1M6IA 4UDRA 1B8SA 1OJTA 4EQSA 3REDA 1YQ3A 2R9ZA 1W4XA 3NH3X 3ATQA 1D7LA 2VOUA 3FBSA 1FECA 1GRGA 3K7MX 4DGKA 3AD7B 5J7XA 4NTDA 3UP5A 1LVLA 4EMWA 2E5VA 1LQUA 5JCLA 1DNCA 3F8DA 4YSYA 1GTEA 2EQ7A 3RNMA 4K22A 1BF3A 3UTHA 3VRDB 1ZDLA 2WEUA 2YVGA 2YQUA 2BC1A 2ZZCA 3GDNA 4WCTA 5EB4A 4RSLA 2C66A 5HXIA 3P4PA 4HA6A 1H81A 4K8DA 1CJ4A 1KNRA 3DGZA 2GEWA 3NG7X 2VZ2A 3UKAA 1BZLA 1S2YA 2EQ6A 1CC2A 3JSKA 5FS7A 1YY5A 3I6DA 2BS2A 1PXAA 2R4JA 3UKQA 4BK1A 2YLRA 1F8RA 2BYBA 3IWAA 1Y56B 1VG9A 4Z44A 4IV9A 2Q0LA 1PS9A 1ZX9A 1FEAA 3UOYA 2PHHA 3DJJA 2VVMA 4ADWA 1S2QA 5FS6A 1ZK7A 3SFDA 3AEDA 1EBDA 3ITJA 4J34A 3NYFA 4H7UA 3CPIG 2FJBA 3DH9A 3NKSA 4EMJA 4YTNA 3VRAA 1H7XA 4O5QA 4ECHA 1D7YA 1IJHA 3EAOA 2WPCA 2XFUA 1NENA 4APNA 3AE4A 3NGCX 3DK9A 2OALA 4RG3A 1O5WA 4U2LA 5EB5A 5U1OA 4ICYA 4TM4A 1B5QA 5CKUA 4PAAA 1IUUA 1K4QA 1PHHA 3EF6A 4EM4A 2IVDA 2C72A 1PXBA 1Q1WA 2YG7A 3UP4A 5BUKA 3B3RA 1X31B 2JBVA 3M12A 4GRTA 2WDVA 3PO7A 3PS9A 2X3NA 3QFAA 3Q9TA 4JQ9A 3GYJA 4K5RA 4CNKA 1DJNA 2VQBA 1VG0A 4NEWA 1Y56A 3AEFA 1FCDA 1P2EA 1BGJA 4YSXA 1KF6A 3NHOX 4J31A 4H2QA 2GF3A 1OJDA 2WDRA 5M10A 1UKVG 3C96A 2JB1A 2CDUA 5IQ1A 2TPRA 5C2TA 2C75A 3L8KA 4Z2UA 3AE8A 2GV8A 3K7QX 2R46A 2XDOA 2VRLA 1N4VA 3K7TA 2WPEA 3QVRA 3AEEA 2RGJA 1IUSA 3IF9A 4JDRA 4PABA 1TDEA 2WETA 4U2SA 2XLUA 1IUXA 1PBDA 4H4RA 4ZN0A 1PDHA 4N9XA 2C67A 2GQWA 3BNMA 3ADAB 2BXSA 4OPUA 1PBFA 1L9DA 2WHDA 3AD9B 2QAEA 3ALLA 5GSNA 4FK1A 2XLRA 3RP8A 1E1LA 4UP3A 3UKFA 1CF3A 4B65A 4GR1A 4EQRA 3AYLA 3E1TA 2QCUA 4BK2A 3BI2A 4EMIA 1GRAA 3UOZA 3NN6X 4B64A 4C5OA 4CCQA 1NG3A 3S5WA 1OJAA 4K7ZA 5KOWA 1ZY8A 2XVEA 2DKHA 3LZXA 1ZOYA 4U8LA 3QJ4A 1D4DA 5KRQA 3K30A 4CRTA 3NYCA 1GESA 2GAGB 2ZZBA 4H4XA 3CNTA 4CNJA 3UKLA 1BKWA 2CFYA 4X4JA 4A79A 2Y6QA 1IUVA 4DSHA 3CNDA 1E1KA 2X99A 2X8CA 4NEVA 2JAEA 2DKIA 3BHFA 3KU9A 1XPQA 2ACZA 1PJ5A 3NNEA 5HHFA 3VRBA 4OPGA 4DNAA 1F6MA 3AYIA 4OCGA 1OJCA 3S61A 2JB3A 4EM3A 5KXJA 3DJDA 2YWLA 2FBWA 4C77A 3AE2A 4U2TA 4A6NB 2WESA 3IHMA 3AECA 3IC9A 3NT6A 1KDGA 4E0VA 1O95A 2RGOA 4U8IA 2XLTA 4H4YA 5C3JA 2V5ZA 4H4UA 1CBOA 2YVJA 3G5SA 1JRXA 4X9NA 3VR9A 1DOCA 1M64A 2J3NA 3FPZA 4H4PA 1AOGA 3C4AA 2BA9A 4CY6A 1NHPA 1KSUA 4UDPA 4IVMB 4MJWA 2YG5A 4Z43A 1BWCA 2ZBWA 1MO9A 1GREA 5KVIA 2YG4A 1Y0PA 1E39A 3SQPA 1GETA 4H2NA 4U8JA 4JNQA 2I0ZA 1EL8A 4C3YA 4TLZA 1NEKA 2YM2A 3Q6JA 3DK4A 3UKPA 2C7GA 2VVLA 4BJZA 2FJDA 2WDQA 1LTXR 1JRZA 1PN0A 2C64A 4GUVA 4LU6A 5EBKA 3UTEA 3ALJA 3UCLA 1RSGA 2WOWA 4A6NA 3BHKA 2OLNA 5LV9A 5KWFA 1JNRA 3CNJA 3H8LA 4AP1A 4LIIA 1FL2A 1F8SA 2V60A 4TLXA 5GRTA
chains in the Genus database with same CATH superfamily
3KLJA 1D4EA 2EQ8A 3AE1A 4JY3A 3CUKA 1GPEA 3OZ2A 3AYJA 3M13A 4P9SA 3II4A 1NHSA 3LADA 3BI4A 2X50A 4II3A 4LA1A 5FS8A 3ZNPA 4C3XA 2AAQA 2YG6A 3KA7A 1K0LA 2O9ZA 1ZP0A 1E1MA 2GRTA 2WS3A 1MXTA 4B1BA 4REKA 1COYA 1JOAA 3UKHA 4BURA 2RGHA 2AR8A 1CJ2A 2YR6A 5KNLA 3AE3A 4DSGA 3DJEA 3G5RA 4K5SA 5J60A 3GSIA 3GRSA 1TRBA 5ER0A 4I58A 2R4EA 1RYIA 3QFBA 4B67A 3BI5A 4OVIA 1IUWA 3COXA 1D5TA 1GRHA 1O94A 4GCMA 4BK3A 1GV4A 4JY2A 4BJYA 3ISHA 4FX9A 1DJQA 5IQ4A 3B6DA 1JRYA 2C73A 2BK3A 3H4KA 1E6EA 2YLZA 5DBJA 4A7AA 1Z6LA 1EL9A 4GF7A 1PJ7A 2V3AA 3NK2X 4TM3A 1GXFA 1EVIA 1REOA 2BRYA 4J36A 4KPRA 3P4RA 3KPKA 2E4GA 5JCNA 3QVPA 4U8OA 1MOKA 3AE9A 3GD4A 3CGDA 3CTYA 1E1NA 5JCIA 4CBQA 3KKJA 1TDNA 2XCGA 3NK1X 1VRQB 4Y4NA 3CPJG 1KNPA 5TR3A 1GTHA 2TMDA 1VDCA 3RP7A 2YR4A 3F8RA 3FIMB 4XXGA 2GB0A 1CC4A 2ZZ0A 1EL5A 4G6GA 2CULA 3WE0A 2APGA 4H4TA 2R0GA 1B37A 3LOVA 4D03A 4YTMA 1B4VA 2WP5A 3AD8B 4Y4LA 1D4CA 1ONFA 2B9YA 1KFYA 5JCMA 4B68A 3ZNNA 3O0HA 4H4WA 4KX6A 4GAPA 3AWIA 1C0LA 1BGNA 1VQWA 1H82A 1H86A 1ZKQA 2BACA 3NRNA 3NTAA 5CQFA 4ZCCA 4A65A 2FJEA 4EQWA 2ARDA 3NLCA 1TDFA 3EANA 1E7PA 4H50A 4B63A 2VQ7A 2XVJA 3SYIA 1JNZA 1XANA 3AXBA 4AT2A 1QJDA 2XVIA 2A89A 2C76A 3T2KA 2YAUA 2C65A 1GSNA 4OPTA 4IA5A 4B66A 2OA1A 2BCGG 3BNUA 4U8KA 1H83A 1NAAA 2YG3A 1NDAA 1TDKA 1H6VA 4AP3A 4Z25A 2Z5XA 4YXDA 1EL7A 1CJ3A 4IVOB 2PYXA 4G9KA 2B9WA 3AEBA 1JEHA 5IPYA 2YVFA 5EOWA 1GOSA 2VVLG 2Q7VA 1OJ9A 4H4ZA 5FS9A 4UDQA 1ZMDA 2HQMA 3LZWA 2IIDA 3F8PA 1CJCA 2BS4A 4AOXA 1N4UA 1F3PA 2A8XA 3SFEA 1TDOA 4YSHA 2GR0A 4YT0A 1CHUA 3QSEA 3C4NA 4CY8A 1GEUA 4U8PA 3GYIA 4A5LA 4C74A 2B7RA 5KVHA 4D04A 1N1PA 4FK1C 3G3EA 1GALA 4H4SA 4B69A 3FMWA 3UKKA 3UTFA 3GRTA 1NG4A 1Q9IA 2B7SA 1GERA 2GR2A 1RP0A 2WQYA 3AEGA 3P4QA 2QA1A 4YJHB 1QO8A 1QLBA 2C70A 4NZHA 2Q0KA 3GD3A 1YKJA 2BS3A 3L1RA 4AOSA 4Y4MA 1K0JA 3VQRA 1DODA 1L0VA 2W0HA 2XLPA 1L9EA 1LJ1A 1XHCA 3CGBA 1GT8A 4GAVA 4H4QA 3H8IA 4I59A 2YM1A 4U8MA 2WP6A 3W4IA 3FG2P 4Z2TA 2EQ9A 4AT0A 2C3DA 2IVEA 2XYOA 2R0CA 1GRFA 4H2RA 2X8GA 5L46A 4GDPA 2E49A 2JKCA 5HYMA 3WGTA 2F5ZA 2FJAA 2A87A 3IHGA 3ZNQA 2WU5A 3SZWA 1JU2A 3RHAA 1NPXA 3ATRA 4J57A 2E4AA 3CN8A 4YSZA 1CC6A 1PXCA 3DMEA 2XFPA 2C3CA 2XFQA 3D1CA 4GDEA 3T37A 2H88A 1F8WA 5KMPA 4WX1A 3P9UA 4K2XA 3ICTA 1TYPA 1LQTA 2NVKX 2V61A 4TM1A 3HYWA 1S3BA 4YJHA 3RP6A 3R9UA 2GH5A 1K0IA 2WOVA 4JN9A 1GRBA 3UOVA 4EQXA 2BABA 2YR5A 3HZLA 1PJ6A 2WBAA 2WPFA 3AB1A 3V3OA 4YJDA 3GMCA 3LJPA 4YKGA 2BK4A 4G74A 5BVAA 1DAOA 3HYXA 4XWRA 1PBBA 2BXRA 4YKFA 3P4SA 3LB8A 3OC4A 1CL0A 2QA2A 3SGLA 1H7WA 3I3LA 2GMHA 3UTGA 2E82A 3M0OA 5JCKA 1KIFA 2YLTA 2GVCA 4Z2RA 1YQZA 2BC0A 3QSSA 1HYUA 1DOBA 1TYTA 4BV6A 4JNAA 4USRA 1PBEA 2YLSA 3DJGX 1NHQA 5KOXA 1XDIA 3EPTA 4EIPA 5BRTA 2E48A 2V3BA 4A9WA 2R0PA 4FDCB 5KMRA 2UZZA 1LPFA 2XFOA 1S3EA 2Y6RA 5HY5A 2XFNA 1L9CA 2VRMA 4OPIA 3T0KA 1FOHA 3GWFA 4OPLA 1NHRA 2E1MA 2BK5A 2GMJA 3DGHA 4YWOA 2YLXA 3CGEA 3GWDA 2OAMA 1GNDA 3PVCA 1SEZA 1YQ4A 2JK6A 1PBCA 1V59A 3DK8A 1KSSA 4U8NA 4USQA 2GAHB 1C0IA 1DDOA 1ZMCA 3ABVA 3CMMA 4HB9A 3CGCA 5U25A 1ZOVA 4M52A 4NTCA 3UOXA 1P2HA 3ZYXA 1N4WA 3KVEA 4YTPA 4OPCA 2Q6UA 2BCPA 3SY4A 4O5UA 3NK0X 3LXDA 5BULA 3CIRA 4IA6A 4H2PA 2XVHA 3ALMA 2V6OA 3D8XA 3SM8A 2RABA 2B9XA 3CPHG 2X8HA 3AE7A 2YLWA 1ELIA 3ICSA 3NN0X 3ZDNA 4CCRA 1GRTA 3VR8A 4Z26A 2OLOA 2R45A 3NIXA 4RG4A 2AQJA 2GQFA 2XLSA 4J2WA 1IUTA 2WU2A 1DOEA 5M0ZA 1LV0A 3G5QA 3KPFA 1DXLA 3CNPA 4J33A 2NPXA 2B76A 3GDPA 3QSMA 3V3NA 1Q1RA 3URHA 4A99A 1H84A 3ICRA 2H89A 4QFDA 3DA1A 1FEBA 3CNSA 3NTDA 4NNJA 2GR1A 5FMHA 3AE6A 4X9MA 4EIQA 3AE5A 2XVFA 3GMBA 2GR3A 2WOIA 3AEAA 3NYEA 4NTEA 2CVJA 4Z24A 5U63A 4H4VA 4XWZA 3V76A 3P1WA 4OPDA 4ZCDA 3KD9A 2WP9A 2Z5YA 2JB2A 4TM0A 1M6IA 1AN9A 4UDRA 1B8SA 1OJTA 3W4JA 4EQSA 3REDA 1YQ3A 2R9ZA 1W4XA 3NH3X 3ATQA 1D7LA 2VOUA 3FBSA 1FECA 1GRGA 3K7MX 4DGKA 3AD7B 5J7XA 4NTDA 3UP5A 5KMSA 1LVLA 4EMWA 2E5VA 1LQUA 5JCLA 1DNCA 3F8DA 4YSYA 1GTEA 3HYVA 2EQ7A 3RNMA 4K22A 1BF3A 3UTHA 3VRDB 1ZDLA 2WEUA 2YVGA 2YQUA 2BC1A 2ZZCA 4WCTA 3GDNA 5EB4A 4RSLA 2C66A 5HXIA 3P4PA 4HA6A 1H81A 4K8DA 1CJ4A 4NWZA 1KNRA 3DGZA 2GEWA 3NG7X 2VZ2A 3UKAA 1BZLA 1S2YA 2EQ6A 1CC2A 3JSKA 5FS7A 1YY5A 3I6DA 2BS2A 1PXAA 2R4JA 3UKQA 4BK1A 2YLRA 1F8RA 2BYBA 3IWAA 1Y56B 1VG9A 4Z44A 4IV9A 2Q0LA 1PS9A 1ZX9A 1FEAA 3UOYA 2PHHA 3DJJA 2VVMA 4ADWA 1S2QA 5FS6A 1ZK7A 3SFDA 3AEDA 1EBDA 3ITJA 4J34A 3NYFA 4H7UA 3CPIG 2FJBA 3DH9A 3NKSA 4EMJA 4YTNA 3VRAA 1H7XA 4O5QA 4ECHA 1D7YA 1IJHA 3EAOA 2WPCA 2XFUA 1NENA 4APNA 3AE4A 3NGCX 3DK9A 2OALA 4RG3A 1O5WA 4U2LA 5EB5A 2C4CA 5U1OA 4ICYA 4YJGB 1B5QA 4TM4A 4PAAA 1IUUA 1PHHA 4YJFB 1K4QA 3EF6A 5CKUA 4EM4A 2IVDA 2C72A 1PXBA 1Q1WA 2YG7A 3UP4A 5BUKA 3B3RA 1X31B 3M12A 2JBVA 4GRTA 2WDVA 3PS9A 3PO7A 2X3NA 3QFAA 3Q9TA 4JQ9A 3GYJA 4K5RA 4CNKA 1DJNA 2VQBA 1VG0A 4NEWA 1Y56A 3AEFA 1FCDA 1P2EA 1BGJA 4YSXA 1KF6A 3NHOX 4J31A 4H2QA 2GF3A 1C0KA 1OJDA 2WDRA 4J56A 5M10A 1UKVG 3C96A 2JB1A 2CDUA 5IQ1A 2TPRA 5C2TA 2C75A 3L8KA 4Z2UA 3AE8A 2GV8A 3K7QX 2BRAA 2DU8A 2R46A 2XDOA 2VRLA 1N4VA 3K7TA 2WPEA 3QVRA 3AEEA 2RGJA 1IUSA 3IF9A 4G73A 4PABA 1TDEA 2WETA 4YJGA 4JDRA 4U2SA 2XLUA 3SZFA 1IUXA 1PBDA 4YJFA 4H4RA 4ZN0A 1PDHA 4N9XA 2C67A 1VE9A 2GQWA 3BNMA 3ADAB 2BXSA 4OPUA 1PBFA 1L9DA 2WHDA 3SX6A 3AD9B 2QAEA 3ALLA 3RP8A 4FK1A 2XLRA 5GSNA 3T2YA 3T31A 1E1LA 4UP3A 3UKFA 1CF3A 1C0PA 4GR1A 4B65A 4EQRA 3AYLA 3E1TA 2QCUA 4QFCA 4BK2A 3BI2A 4EMIA 1GRAA 3UOZA 3NN6X 4B64A 4C5OA 4CCQA 1NG3A 3S5WA 3T2ZA 1OJAA 4K7ZA 5KOWA 1ZY8A 2XVEA 2DKHA 3LZXA 1ZOYA 4U8LA 3QJ4A 1D4DA 5KRQA 3K30A 4CRTA 3NYCA 1GESA 2GAGB 2ZZBA 4H4XA 3CNTA 4CNJA 3T14A 3UKLA 1BKWA 2CFYA 4X4JA 4A79A 2Y6QA 1IUVA 3ZNOA 4DSHA 3CNDA 1E1KA 2X99A 2X8CA 4NEVA 2JAEA 2DKIA 3BHFA 3KU9A 1XPQA 2ACZA 1PJ5A 3NNEA 5HHFA 3VRBA 4OPGA 4DNAA 1F6MA 3AYIA 4OCGA 1OJCA 3S61A 2JB3A 4EM3A 5KXJA 3DJDA 2YWLA 2FBWA 4C77A 4G6HA 3AE2A 4U2TA 4A6NB 3SXIA 2WESA 3IHMA 3AECA 3IC9A 3NT6A 1KDGA 4E0VA 1O95A 2RGOA 4U8IA 2XLTA 4H4YA 4II2A 5C3JA 2V5ZA 4H4UA 1CBOA 2YVJA 3G5SA 1JRXA 4X9NA 3VR9A 1DOCA 1M64A 2J3NA 3FPZA 4H4PA 1AOGA 3C4AA 5KMQA 2BA9A 4CY6A 1NHPA 1KSUA 4UDPA 4IVMB 4MJWA 2YG5A 4Z43A 1BWCA 2ZBWA 3W4KA 1GREA 1MO9A 5KVIA 2YG4A 1Y0PA 1E39A 3SQPA 1GETA 4H2NA 3SZCA 4U8JA 4JNQA 2I0ZA 1EL8A 4C3YA 4TLZA 1NEKA 2YM2A 3Q6JA 3DK4A 3UKPA 2C7GA 4BJZA 2VVLA 2FJDA 2WDQA 3SZ0A 1PN0A 1JRZA 1LTXR 2C64A 4GUVA 4LU6A 5EBKA 3UTEA 3ALJA 3UCLA 1RSGA 2WOWA 4A6NA 3BHKA 3GYXA 2OLNA 5LV9A 5KWFA 1JNRA 3CNJA 3H8LA 4AP1A 4LIIA 1FL2A 1F8SA 2V60A 4TLXA 5GRTA
chains in the Genus database with same CATH topology
3KLJA 1D4EA 2EQ8A 3AE1A 4JY3A 1GPEA 3OZ2A 3AYJA 3M13A 4P9SA 3II4A 1NHSA 3LADA 3BI4A 2X50A 4II3A 4LA1A 5FS8A 4C3XA 2AAQA 2YG6A 3KA7A 1K0LA 2O9ZA 1ZP0A 1E1MA 2GRTA 2WS3A 1MXTA 4B1BA 4REKA 1COYA 1JOAA 3UKHA 4BURA 2RGHA 2AR8A 1CJ2A 2YR6A 5KNLA 3AE3A 4DSGA 3DJEA 3G5RA 4K5SA 5J60A 3GSIA 3GRSA 1TRBA 5ER0A 4I58A 2R4EA 1RYIA 3QFBA 4B67A 3BI5A 4OVIA 1IUWA 3COXA 1D5TA 1GRHA 1O94A 4GCMA 4BK3A 1GV4A 4JY2A 4BJYA 3ISHA 4FX9A 1DJQA 5IQ4A 3B6DA 1JRYA 2C73A 2BK3A 3H4KA 1E6EA 2YLZA 5DBJA 4A7AA 1Z6LA 1EL9A 4GF7A 1PJ7A 2V3AA 3NK2X 4TM3A 1GXFA 1REOA 2BRYA 4J36A 4KPRA 3P4RA 3KPKA 2E4GA 5JCNA 3QVPA 4U8OA 1MOKA 3AE9A 3GD4A 3CGDA 3CTYA 1E1NA 5JCIA 4CBQA 3KKJA 1TDNA 2XCGA 3NK1X 1VRQB 4Y4NA 3CPJG 1KNPA 5TR3A 1GTHA 2TMDA 1VDCA 3RP7A 2YR4A 3F8RA 3FIMB 4XXGA 2GB0A 1CC4A 2ZZ0A 1EL5A 4G6GA 2CULA 3WE0A 2APGA 4H4TA 2R0GA 1B37A 3LOVA 4D03A 4YTMA 1B4VA 2WP5A 3AD8B 4Y4LA 1D4CA 1ONFA 2B9YA 1KFYA 5JCMA 4B68A 3O0HA 4H4WA 4KX6A 4GAPA 3AWIA 1BGNA 1VQWA 3NRNA 1H82A 1H86A 1ZKQA 2BACA 3NTAA 5CQFA 4ZCCA 4A65A 2FJEA 4EQWA 2ARDA 3NLCA 1TDFA 3EANA 1E7PA 4H50A 4B63A 2VQ7A 2XVJA 3SYIA 1JNZA 1XANA 3AXBA 4AT2A 1QJDA 2XVIA 2A89A 2C76A 3T2KA 2YAUA 2C65A 1GSNA 4OPTA 4IA5A 4B66A 2OA1A 2BCGG 3BNUA 4U8KA 1H83A 1NAAA 2YG3A 1NDAA 1TDKA 1H6VA 4AP3A 4Z25A 2Z5XA 4YXDA 1EL7A 1CJ3A 4IVOB 2PYXA 4G9KA 2B9WA 3AEBA 1JEHA 5IPYA 2YVFA 5EOWA 1GOSA 2VVLG 2Q7VA 1OJ9A 4H4ZA 5FS9A 4UDQA 1ZMDA 2HQMA 3LZWA 2IIDA 3F8PA 1CJCA 2BS4A 4AOXA 1N4UA 1F3PA 2A8XA 3SFEA 1TDOA 2GR0A 4YSHA 4YT0A 1CHUA 3QSEA 3C4NA 4CY8A 1GEUA 4U8PA 3GYIA 4A5LA 4C74A 2B7RA 5KVHA 4D04A 1N1PA 4FK1C 1GALA 4H4SA 4B69A 3FMWA 3UKKA 3UTFA 3GRTA 1NG4A 1Q9IA 2B7SA 1GERA 2GR2A 1RP0A 2WQYA 3AEGA 3P4QA 2QA1A 1QO8A 1QLBA 2C70A 4NZHA 2Q0KA 3GD3A 1YKJA 2BS3A 3L1RA 4AOSA 4Y4MA 1K0JA 3VQRA 1DODA 1L0VA 2W0HA 2XLPA 1L9EA 1LJ1A 1XHCA 3CGBA 1GT8A 4GAVA 4H4QA 3H8IA 4I59A 2YM1A 4U8MA 2WP6A 3FG2P 4Z2TA 2EQ9A 4AT0A 2C3DA 2IVEA 2XYOA 2R0CA 1GRFA 4H2RA 2X8GA 5L46A 4GDPA 2JKCA 5HYMA 2F5ZA 2FJAA 2A87A 3IHGA 3SZWA 2WU5A 1JU2A 3RHAA 1NPXA 3ATRA 4J57A 3CN8A 4YSZA 1CC6A 1PXCA 2XFPA 3D1CA 2C3CA 2XFQA 3DMEA 4GDEA 3T37A 2H88A 1F8WA 5KMPA 4WX1A 3P9UA 4K2XA 3ICTA 1TYPA 1LQTA 2NVKX 2V61A 4TM1A 3HYWA 1S3BA 3RP6A 3R9UA 2GH5A 1K0IA 2WOVA 4JN9A 1GRBA 3UOVA 4EQXA 2BABA 2YR5A 3HZLA 1PJ6A 2WBAA 2WPFA 3AB1A 3V3OA 3GMCA 3LJPA 4YKGA 2BK4A 4G74A 5BVAA 4YKFA 3HYXA 4XWRA 1PBBA 2BXRA 3P4SA 3LB8A 3OC4A 1CL0A 2QA2A 1H7WA 3I3LA 3SGLA 2GMHA 3UTGA 3M0OA 5JCKA 2YLTA 2GVCA 4Z2RA 1YQZA 2BC0A 3QSSA 1HYUA 1DOBA 1TYTA 4BV6A 4JNAA 4USRA 1PBEA 2YLSA 3DJGX 1NHQA 5KOXA 1XDIA 3EPTA 4EIPA 5BRTA 2V3BA 4A9WA 2R0PA 4FDCB 5KMRA 2UZZA 1LPFA 2XFOA 1S3EA 2Y6RA 5HY5A 2XFNA 1L9CA 2VRMA 4OPIA 3T0KA 1FOHA 3GWFA 4OPLA 1NHRA 2E1MA 2BK5A 2GMJA 3DGHA 4YWOA 2YLXA 3CGEA 3GWDA 2OAMA 1GNDA 1SEZA 3PVCA 1YQ4A 2JK6A 1PBCA 1V59A 3DK8A 1KSSA 4U8NA 4USQA 2GAHB 3ABVA 1ZMCA 3CMMA 4HB9A 3CGCA 5U25A 1ZOVA 4M52A 4NTCA 3UOXA 1P2HA 3ZYXA 1N4WA 3KVEA 4YTPA 4OPCA 2BCPA 2Q6UA 3SY4A 4O5UA 3NK0X 3LXDA 5BULA 3CIRA 4IA6A 4H2PA 2XVHA 3ALMA 2V6OA 3D8XA 2RABA 3SM8A 2B9XA 3CPHG 2X8HA 3AE7A 2YLWA 1ELIA 3ICSA 3NN0X 3ZDNA 4CCRA 1GRTA 3VR8A 4Z26A 2OLOA 2R45A 3NIXA 4RG4A 2AQJA 2GQFA 2XLSA 4J2WA 1IUTA 2WU2A 1DOEA 5M0ZA 1LV0A 3G5QA 3KPFA 1DXLA 3CNPA 4J33A 2NPXA 2B76A 3GDPA 3QSMA 3V3NA 1Q1RA 3URHA 4A99A 1H84A 3ICRA 2H89A 1FEBA 3CNSA 3DA1A 3NTDA 4NNJA 2GR1A 5FMHA 3AE6A 4EIQA 3AE5A 4X9MA 2XVFA 3GMBA 2GR3A 2WOIA 3AEAA 3NYEA 4NTEA 2CVJA 4Z24A 5U63A 4H4VA 4XWZA 3V76A 3P1WA 4OPDA 4ZCDA 3KD9A 2WP9A 2Z5YA 2JB2A 4TM0A 1M6IA 4UDRA 1B8SA 1OJTA 4EQSA 3REDA 1YQ3A 2R9ZA 1W4XA 3NH3X 3ATQA 1D7LA 2VOUA 3FBSA 1FECA 1GRGA 3K7MX 4DGKA 3AD7B 5J7XA 4NTDA 3UP5A 5KMSA 1LVLA 4EMWA 2E5VA 1LQUA 5JCLA 1DNCA 3F8DA 4YSYA 1GTEA 3HYVA 2EQ7A 3RNMA 4K22A 1BF3A 3UTHA 3VRDB 1ZDLA 2WEUA 2YVGA 2YQUA 2BC1A 2ZZCA 3GDNA 4WCTA 5EB4A 4RSLA 2C66A 5HXIA 3P4PA 4HA6A 1H81A 4K8DA 1CJ4A 4NWZA 1KNRA 3DGZA 2GEWA 3NG7X 2VZ2A 3UKAA 1BZLA 1S2YA 2EQ6A 1CC2A 3JSKA 5FS7A 1YY5A 3I6DA 2BS2A 1PXAA 2R4JA 3UKQA 4BK1A 2YLRA 1F8RA 2BYBA 3IWAA 1Y56B 1VG9A 4Z44A 4IV9A 2Q0LA 1PS9A 1ZX9A 1FEAA 3UOYA 2PHHA 3DJJA 2VVMA 4ADWA 1S2QA 5FS6A 1ZK7A 3SFDA 3AEDA 1EBDA 3ITJA 4J34A 3NYFA 4H7UA 3CPIG 2FJBA 3DH9A 3NKSA 4EMJA 4YTNA 3VRAA 1H7XA 4O5QA 4ECHA 1D7YA 1IJHA 3EAOA 2WPCA 2XFUA 1NENA 4APNA 3AE4A 3NGCX 3DK9A 2OALA 4RG3A 1O5WA 4U2LA 5EB5A 2C4CA 5U1OA 4ICYA 4TM4A 1B5QA 5CKUA 4PAAA 1IUUA 1K4QA 1PHHA 3EF6A 4EM4A 2IVDA 2C72A 1PXBA 1Q1WA 2YG7A 3UP4A 5BUKA 3B3RA 1X31B 2JBVA 3M12A 4GRTA 2WDVA 3PO7A 3PS9A 2X3NA 3QFAA 3Q9TA 4JQ9A 3GYJA 4K5RA 4CNKA 1DJNA 2VQBA 1VG0A 4NEWA 1Y56A 3AEFA 1FCDA 1P2EA 1BGJA 4YSXA 1KF6A 3NHOX 4J31A 4H2QA 2GF3A 1OJDA 2WDRA 4J56A 5M10A 1UKVG 3C96A 2JB1A 2CDUA 5IQ1A 2TPRA 5C2TA 2C75A 3L8KA 4Z2UA 3AE8A 2GV8A 3K7QX 2BRAA 2R46A 2XDOA 2VRLA 1N4VA 3K7TA 2WPEA 3QVRA 3AEEA 2RGJA 1IUSA 3IF9A 4G73A 4JDRA 1TDEA 2WETA 4PABA 4U2SA 2XLUA 3SZFA 1IUXA 1PBDA 4H4RA 4ZN0A 1PDHA 4N9XA 2C67A 2GQWA 3BNMA 3ADAB 2BXSA 4OPUA 1PBFA 1L9DA 2WHDA 3SX6A 3AD9B 2QAEA 3ALLA 3RP8A 4FK1A 2XLRA 5GSNA 3T2YA 3T31A 1E1LA 4UP3A 3UKFA 1CF3A 4B65A 4GR1A 4EQRA 3AYLA 4BK2A 3E1TA 2QCUA 3BI2A 4EMIA 1GRAA 3UOZA 3NN6X 4B64A 4C5OA 4CCQA 1NG3A 3S5WA 3T2ZA 1OJAA 4K7ZA 5KOWA 1ZY8A 2XVEA 2DKHA 3LZXA 1ZOYA 4U8LA 3QJ4A 1D4DA 5KRQA 3K30A 4CRTA 3NYCA 1GESA 2GAGB 2ZZBA 4H4XA 3CNTA 4CNJA 3T14A 3UKLA 1BKWA 2CFYA 4X4JA 4A79A 2Y6QA 1IUVA 4DSHA 3CNDA 1E1KA 2X99A 2X8CA 4NEVA 2JAEA 2DKIA 3BHFA 3KU9A 1XPQA 2ACZA 1PJ5A 3NNEA 5HHFA 3VRBA 4OPGA 4DNAA 1F6MA 3AYIA 4OCGA 1OJCA 3S61A 2JB3A 4EM3A 5KXJA 3DJDA 2YWLA 2FBWA 4C77A 4G6HA 3AE2A 4U2TA 4A6NB 3SXIA 2WESA 3IHMA 3AECA 3IC9A 3NT6A 1KDGA 4E0VA 1O95A 2RGOA 4U8IA 2XLTA 4H4YA 4II2A 5C3JA 2V5ZA 4H4UA 1CBOA 2YVJA 3G5SA 1JRXA 4X9NA 3VR9A 1DOCA 1M64A 2J3NA 3FPZA 4H4PA 1AOGA 3C4AA 5KMQA 2BA9A 4CY6A 1NHPA 1KSUA 4UDPA 4IVMB 4MJWA 2YG5A 4Z43A 1BWCA 2ZBWA 1MO9A 1GREA 5KVIA 2YG4A 1Y0PA 1E39A 3SQPA 1GETA 4H2NA 3SZCA 4U8JA 4JNQA 2I0ZA 1EL8A 4C3YA 4TLZA 1NEKA 2YM2A 3Q6JA 3DK4A 3UKPA 2C7GA 4BJZA 2VVLA 2FJDA 2WDQA 3SZ0A 1LTXR 1JRZA 1PN0A 2C64A 4GUVA 4LU6A 5EBKA 3UTEA 3ALJA 3UCLA 1RSGA 2WOWA 4A6NA 3BHKA 3GYXA 2OLNA 5LV9A 5KWFA 1JNRA 3CNJA 3H8LA 4AP1A 4LIIA 1FL2A 1F8SA 2V60A 4TLXA 5GRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLJ A;  1D4E A;  2EQ8 A;  3AE1 A;  4JY3 A;  1GPE A;  3OZ2 A;  3AYJ A;  3M13 A;  4P9S A;  3II4 A;  1NHS A;  3LAD A;  3BI4 A;  2X50 A;  4LA1 A;  5FS8 A;  4C3X A;  2AAQ A;  2YG6 A;  3KA7 A;  1K0L A;  2O9Z A;  1ZP0 A;  1E1M A;  2GRT A;  2WS3 A;  1MXT A;  4B1B A;  4REK A;  1COY A;  1JOA A;  3UKH A;  4BUR A;  2RGH A;  2AR8 A;  1CJ2 A;  2YR6 A;  3AE3 A;  4DSG A;  3DJE A;  3G5R A;  4K5S A;  5J60 A;  3GSI A;  3GRS A;  1TRB A;  5ER0 A;  4I58 A;  2R4E A;  1RYI A;  3QFB A;  4B67 A;  3BI5 A;  4OVI A;  1IUW A;  3COX A;  1D5T A;  1GRH A;  1O94 A;  4GCM A;  4BK3 A;  1GV4 A;  4JY2 A;  4BJY A;  3ISH A;  4FX9 A;  1DJQ A;  5IQ4 A;  3B6D A;  1JRY A;  2C73 A;  2BK3 A;  3H4K A;  1E6E A;  2YLZ A;  5DBJ A;  4A7A A;  1Z6L A;  1EL9 A;  4GF7 A;  1PJ7 A;  2V3A A;  3NK2 X;  4TM3 A;  1GXF A;  1REO A;  4J36 A;  4KPR A;  3P4R A;  2E4G A;  5JCN A;  3QVP A;  4U8O A;  1MOK A;  3AE9 A;  3GD4 A;  3CGD A;  3CTY A;  1E1N A;  5JCI A;  4CBQ A;  3KKJ A;  1TDN A;  2XCG A;  3NK1 X;  1VRQ B;  4Y4N A;  3CPJ G;  1KNP A;  5TR3 A;  1GTH A;  2TMD A;  1VDC A;  3F8R A;  2YR4 A;  3FIM B;  4XXG A;  3RP7 A;  2GB0 A;  1CC4 A;  2ZZ0 A;  1EL5 A;  2CUL A;  3WE0 A;  2APG A;  4H4T A;  2R0G A;  1B37 A;  3LOV A;  4D03 A;  4YTM A;  1B4V A;  2WP5 A;  3AD8 B;  4Y4L A;  1D4C A;  1ONF A;  2B9Y A;  1KFY A;  5JCM A;  4B68 A;  3O0H A;  4H4W A;  4KX6 A;  3AWI A;  1BGN A;  1VQW A;  3NRN A;  1H82 A;  1H86 A;  1ZKQ A;  2BAC A;  3NTA A;  5CQF A;  4ZCC A;  4A65 A;  2FJE A;  4EQW A;  2ARD A;  3NLC A;  1TDF A;  3EAN A;  1E7P A;  4H50 A;  4B63 A;  2VQ7 A;  2XVJ A;  1JNZ A;  1XAN A;  3AXB A;  4AT2 A;  1QJD A;  2XVI A;  2A89 A;  2C76 A;  2YAU A;  2C65 A;  1GSN A;  4OPT A;  4IA5 A;  4B66 A;  2OA1 A;  2BCG G;  3BNU A;  4U8K A;  1H83 A;  1NAA A;  2YG3 A;  1NDA A;  1TDK A;  1H6V A;  4AP3 A;  4Z25 A;  2Z5X A;  4YXD A;  1EL7 A;  1CJ3 A;  4IVO B;  2PYX A;  2B9W A;  3AEB A;  1JEH A;  5IPY A;  2YVF A;  5EOW A;  1GOS A;  2VVL G;  2Q7V A;  1OJ9 A;  4H4Z A;  5FS9 A;  4UDQ A;  1ZMD A;  2HQM A;  3LZW A;  2IID A;  3F8P A;  1CJC A;  2BS4 A;  4AOX A;  1N4U A;  1F3P A;  2A8X A;  3SFE A;  1TDO A;  2GR0 A;  4YSH A;  4YT0 A;  1CHU A;  3QSE A;  3C4N A;  4CY8 A;  1GEU A;  4U8P A;  3GYI A;  4A5L A;  4C74 A;  2B7R A;  5KVH A;  4D04 A;  1N1P A;  4FK1 C;  1GAL A;  4H4S A;  4B69 A;  3FMW A;  3UKK A;  3UTF A;  3GRT A;  1NG4 A;  1Q9I A;  2B7S A;  1GER A;  2GR2 A;  1RP0 A;  2WQY A;  3AEG A;  3P4Q A;  2QA1 A;  1QO8 A;  1QLB A;  2C70 A;  4NZH A;  2Q0K A;  3GD3 A;  1YKJ A;  2BS3 A;  3L1R A;  4AOS A;  4Y4M A;  1K0J A;  3VQR A;  1DOD A;  1L0V A;  2W0H A;  2XLP A;  1L9E A;  1LJ1 A;  1XHC A;  3CGB A;  1GT8 A;  4H4Q A;  4I59 A;  3H8I A;  4J56 A;  2YM1 A;  4U8M A;  2WP6 A;  3FG2 P;  4Z2T A;  2EQ9 A;  4AT0 A;  2C3D A;  2IVE A;  2XYO A;  2R0C A;  1GRF A;  4H2R A;  2X8G A;  5L46 A;  4GDP A;  2JKC A;  5HYM A;  2F5Z A;  2FJA A;  2A87 A;  3IHG A;  2WU5 A;  1JU2 A;  3RHA A;  1NPX A;  3ATR A;  4J57 A;  3CN8 A;  4YSZ A;  1CC6 A;  1PXC A;  2XFP A;  3D1C A;  2C3C A;  2XFQ A;  3DME A;  4GDE A;  3T37 A;  2H88 A;  1F8W A;  4WX1 A;  3P9U A;  4K2X A;  3ICT A;  1TYP A;  1LQT A;  2NVK X;  2V61 A;  4TM1 A;  1S3B A;  3RP6 A;  3R9U A;  2GH5 A;  1K0I A;  2WOV A;  4JN9 A;  1GRB A;  3UOV A;  4EQX A;  2BAB A;  2YR5 A;  3HZL A;  1PJ6 A;  2WBA A;  2WPF A;  3AB1 A;  3V3O A;  3GMC A;  3LJP A;  4YKG A;  2BK4 A;  5BVA A;  4YKF A;  4XWR A;  1PBB A;  2BXR A;  3P4S A;  3LB8 A;  3OC4 A;  1CL0 A;  2QA2 A;  1H7W A;  3I3L A;  3SGL A;  2GMH A;  3UTG A;  3M0O A;  5JCK A;  2YLT A;  2GVC A;  4Z2R A;  1YQZ A;  2BC0 A;  3QSS A;  1HYU A;  1DOB A;  1TYT A;  4BV6 A;  4JNA A;  4USR A;  1PBE A;  2YLS A;  3DJG X;  1NHQ A;  5KOX A;  1XDI A;  3EPT A;  4EIP A;  5BRT A;  2V3B A;  4A9W A;  2R0P A;  4FDC B;  2UZZ A;  1LPF A;  2XFO A;  1S3E A;  2Y6R A;  5HY5 A;  2XFN A;  1L9C A;  2VRM A;  4OPI A;  1FOH A;  3GWF A;  4OPL A;  1NHR A;  2E1M A;  2BK5 A;  2GMJ A;  3DGH A;  4YWO A;  2YLX A;  3CGE A;  3GWD A;  2OAM A;  1GND A;  1SEZ A;  3PVC A;  1YQ4 A;  2JK6 A;  1PBC A;  1V59 A;  3DK8 A;  1KSS A;  4U8N A;  4USQ A;  2GAH B;  3ABV A;  1ZMC A;  4HB9 A;  3CGC A;  5U25 A;  1ZOV A;  4M52 A;  4NTC A;  3UOX A;  1P2H A;  3ZYX A;  1N4W A;  3KVE A;  4YTP A;  4OPC A;  2BCP A;  2Q6U A;  4O5U A;  3NK0 X;  3LXD A;  5BUL A;  3CIR A;  4IA6 A;  4H2P A;  2XVH A;  3ALM A;  2V6O A;  3D8X A;  2RAB A;  3SM8 A;  2B9X A;  3CPH G;  2X8H A;  3AE7 A;  2YLW A;  1ELI A;  3ICS A;  3NN0 X;  3ZDN A;  4CCR A;  1GRT A;  3VR8 A;  4Z26 A;  2OLO A;  2R45 A;  3NIX A;  4RG4 A;  2AQJ A;  2GQF A;  2XLS A;  4J2W A;  1IUT A;  2WU2 A;  1DOE A;  5M0Z A;  1LV0 A;  3G5Q A;  3KPF A;  1DXL A;  3CNP A;  4J33 A;  2NPX A;  2B76 A;  3GDP A;  3QSM A;  3V3N A;  1Q1R A;  3URH A;  4A99 A;  1H84 A;  3ICR A;  2H89 A;  1FEB A;  3CNS A;  3DA1 A;  3NTD A;  2GR1 A;  5FMH A;  3AE6 A;  4EIQ A;  3AE5 A;  4X9M A;  2XVF A;  3GMB A;  2GR3 A;  2WOI A;  3AEA A;  3NYE A;  4NTE A;  2CVJ A;  4Z24 A;  5U63 A;  4H4V A;  4XWZ A;  3V76 A;  3P1W A;  4OPD A;  4ZCD A;  3KD9 A;  2WP9 A;  2Z5Y A;  2JB2 A;  4TM0 A;  1M6I A;  4UDR A;  1B8S A;  1OJT A;  4EQS A;  3RED A;  1YQ3 A;  2R9Z A;  1W4X A;  3NH3 X;  3ATQ A;  1D7L A;  2VOU A;  3FBS A;  1FEC A;  1GRG A;  3K7M X;  4DGK A;  3AD7 B;  5J7X A;  4NTD A;  3UP5 A;  1LVL A;  4EMW A;  2E5V A;  1LQU A;  5JCL A;  1DNC A;  3F8D A;  4YSY A;  1GTE A;  2EQ7 A;  3RNM A;  4K22 A;  1BF3 A;  3UTH A;  3VRD B;  1ZDL A;  2WEU A;  2YVG A;  2YQU A;  2BC1 A;  2ZZC A;  3GDN A;  4WCT A;  5EB4 A;  4RSL A;  2C66 A;  5HXI A;  3P4P A;  4HA6 A;  1H81 A;  4K8D A;  1CJ4 A;  1KNR A;  3DGZ A;  2GEW A;  3NG7 X;  2VZ2 A;  3UKA A;  1BZL A;  1S2Y A;  2EQ6 A;  1CC2 A;  3JSK A;  5FS7 A;  1YY5 A;  3I6D A;  2BS2 A;  1PXA A;  2R4J A;  3UKQ A;  4BK1 A;  2YLR A;  1F8R A;  2BYB A;  3IWA A;  1Y56 B;  1VG9 A;  4Z44 A;  4IV9 A;  2Q0L A;  1PS9 A;  1ZX9 A;  1FEA A;  3UOY A;  2PHH A;  3DJJ A;  2VVM A;  4ADW A;  1S2Q A;  5FS6 A;  1ZK7 A;  3SFD A;  3AED A;  1EBD A;  3ITJ A;  4J34 A;  3NYF A;  4H7U A;  3CPI G;  2FJB A;  3DH9 A;  3NKS A;  4EMJ A;  4YTN A;  3VRA A;  1H7X A;  4O5Q A;  4ECH A;  1D7Y A;  1IJH A;  3EAO A;  2WPC A;  2XFU A;  1NEN A;  4APN A;  3AE4 A;  3NGC X;  3DK9 A;  2OAL A;  4RG3 A;  1O5W A;  4U2L A;  5EB5 A;  5U1O A;  4ICY A;  4TM4 A;  1B5Q A;  5CKU A;  4PAA A;  1IUU A;  1K4Q A;  1PHH A;  3EF6 A;  4EM4 A;  2IVD A;  2C72 A;  1PXB A;  1Q1W A;  2YG7 A;  3UP4 A;  5BUK A;  3B3R A;  1X31 B;  2JBV A;  3M12 A;  4GRT A;  2WDV A;  3PO7 A;  3PS9 A;  2X3N A;  3QFA A;  3Q9T A;  4JQ9 A;  3GYJ A;  4K5R A;  4CNK A;  1DJN A;  2VQB A;  1VG0 A;  4NEW A;  1Y56 A;  3AEF A;  1FCD A;  1P2E A;  1BGJ A;  4YSX A;  1KF6 A;  3NHO X;  4J31 A;  4H2Q A;  2GF3 A;  1OJD A;  2WDR A;  5M10 A;  1UKV G;  3C96 A;  2JB1 A;  2CDU A;  5IQ1 A;  2TPR A;  5C2T A;  2C75 A;  3L8K A;  4Z2U A;  3AE8 A;  2GV8 A;  3K7Q X;  2R46 A;  2XDO A;  2VRL A;  1N4V A;  3K7T A;  2WPE A;  3QVR A;  3AEE A;  2RGJ A;  1IUS A;  3IF9 A;  4JDR A;  4PAB A;  1TDE A;  2WET A;  4U2S A;  2XLU A;  1IUX A;  1PBD A;  4H4R A;  4ZN0 A;  1PDH A;  4N9X A;  2C67 A;  2GQW A;  3BNM A;  3ADA B;  2BXS A;  4OPU A;  1PBF A;  1L9D A;  2WHD A;  3AD9 B;  2QAE A;  3ALL A;  5GSN A;  4FK1 A;  2XLR A;  3RP8 A;  1E1L A;  4UP3 A;  3UKF A;  1CF3 A;  4B65 A;  4GR1 A;  4EQR A;  3AYL A;  3E1T A;  2QCU A;  4BK2 A;  3BI2 A;  4EMI A;  1GRA A;  3UOZ A;  3NN6 X;  4B64 A;  4C5O A;  4CCQ A;  1NG3 A;  3S5W A;  1OJA A;  4K7Z A;  5KOW A;  1ZY8 A;  2XVE A;  2DKH A;  3LZX A;  1ZOY A;  4U8L A;  3QJ4 A;  1D4D A;  5KRQ A;  3K30 A;  4CRT A;  3NYC A;  1GES A;  2GAG B;  2ZZB A;  4H4X A;  3CNT A;  4CNJ A;  3UKL A;  1BKW A;  2CFY A;  4X4J A;  4A79 A;  2Y6Q A;  1IUV A;  4DSH A;  3CND A;  1E1K A;  2X99 A;  2X8C A;  4NEV A;  2JAE A;  2DKI A;  3BHF A;  3KU9 A;  1XPQ A;  2ACZ A;  1PJ5 A;  3NNE A;  5HHF A;  3VRB A;  4OPG A;  4DNA A;  1F6M A;  3AYI A;  4OCG A;  1OJC A;  3S61 A;  2JB3 A;  4EM3 A;  5KXJ A;  3DJD A;  2YWL A;  2FBW A;  4C77 A;  3AE2 A;  4U2T A;  4A6N B;  2WES A;  3IHM A;  3AEC A;  3IC9 A;  3NT6 A;  1KDG A;  4E0V A;  1O95 A;  2RGO A;  4U8I A;  2XLT A;  4H4Y A;  5C3J A;  2V5Z A;  4H4U A;  1CBO A;  2YVJ A;  3G5S A;  1JRX A;  4X9N A;  3VR9 A;  1DOC A;  1M64 A;  2J3N A;  3FPZ A;  4H4P A;  1AOG A;  3C4A A;  2BA9 A;  4CY6 A;  1NHP A;  1KSU A;  4UDP A;  4IVM B;  4MJW A;  2YG5 A;  4Z43 A;  1BWC A;  2ZBW A;  1MO9 A;  1GRE A;  5KVI A;  2YG4 A;  1Y0P A;  1E39 A;  3SQP A;  1GET A;  4H2N A;  4U8J A;  4JNQ A;  2I0Z A;  1EL8 A;  4C3Y A;  4TLZ A;  1NEK A;  2YM2 A;  3Q6J A;  3DK4 A;  3UKP A;  2C7G A;  2VVL A;  4BJZ A;  2FJD A;  2WDQ A;  1LTX R;  1JRZ A;  1PN0 A;  2C64 A;  4GUV A;  4LU6 A;  5EBK A;  3UTE A;  3ALJ A;  3UCL A;  1RSG A;  2WOW A;  4A6N A;  3BHK A;  2OLN A;  5LV9 A;  5KWF A;  1JNR A;  3CNJ A;  3H8L A;  4AP1 A;  4LII A;  1FL2 A;  1F8S A;  2V60 A;  4TLX A;  5GRT A; 
#chains in the Genus database with same CATH topology
 3KLJ A;  1D4E A;  2EQ8 A;  3AE1 A;  4JY3 A;  3CUK A;  1GPE A;  3OZ2 A;  3AYJ A;  3M13 A;  4P9S A;  3II4 A;  1NHS A;  3LAD A;  3BI4 A;  2X50 A;  4II3 A;  4LA1 A;  5FS8 A;  3ZNP A;  4C3X A;  2AAQ A;  2YG6 A;  3KA7 A;  1K0L A;  2O9Z A;  1ZP0 A;  1E1M A;  2GRT A;  2WS3 A;  1MXT A;  4B1B A;  4REK A;  1COY A;  1JOA A;  3UKH A;  4BUR A;  2RGH A;  2AR8 A;  1CJ2 A;  2YR6 A;  5KNL A;  3AE3 A;  4DSG A;  3DJE A;  3G5R A;  4K5S A;  5J60 A;  3GSI A;  3GRS A;  1TRB A;  5ER0 A;  4I58 A;  2R4E A;  1RYI A;  3QFB A;  4B67 A;  3BI5 A;  4OVI A;  1IUW A;  3COX A;  1D5T A;  1GRH A;  1O94 A;  4GCM A;  4BK3 A;  1GV4 A;  4JY2 A;  4BJY A;  3ISH A;  4FX9 A;  1DJQ A;  5IQ4 A;  3B6D A;  1JRY A;  2C73 A;  2BK3 A;  3H4K A;  1E6E A;  2YLZ A;  5DBJ A;  4A7A A;  1Z6L A;  1EL9 A;  4GF7 A;  1PJ7 A;  2V3A A;  3NK2 X;  4TM3 A;  1GXF A;  1EVI A;  1REO A;  2BRY A;  4J36 A;  4KPR A;  3P4R A;  3KPK A;  2E4G A;  5JCN A;  3QVP A;  4U8O A;  1MOK A;  3AE9 A;  3GD4 A;  3CGD A;  3CTY A;  1E1N A;  5JCI A;  4CBQ A;  3KKJ A;  1TDN A;  2XCG A;  3NK1 X;  1VRQ B;  4Y4N A;  3CPJ G;  1KNP A;  5TR3 A;  1GTH A;  2TMD A;  1VDC A;  3RP7 A;  2YR4 A;  3F8R A;  3FIM B;  4XXG A;  2GB0 A;  1CC4 A;  2ZZ0 A;  1EL5 A;  4G6G A;  2CUL A;  3WE0 A;  2APG A;  4H4T A;  2R0G A;  1B37 A;  3LOV A;  4D03 A;  4YTM A;  1B4V A;  2WP5 A;  3AD8 B;  4Y4L A;  1D4C A;  1ONF A;  2B9Y A;  1KFY A;  5JCM A;  4B68 A;  3ZNN A;  3O0H A;  4H4W A;  4KX6 A;  4GAP A;  3AWI A;  1C0L A;  1BGN A;  1VQW A;  1H82 A;  1H86 A;  1ZKQ A;  2BAC A;  3NRN A;  3NTA A;  5CQF A;  4ZCC A;  4A65 A;  2FJE A;  4EQW A;  2ARD A;  3NLC A;  1TDF A;  3EAN A;  1E7P A;  4H50 A;  4B63 A;  2VQ7 A;  2XVJ A;  3SYI A;  1JNZ A;  1XAN A;  3AXB A;  4AT2 A;  1QJD A;  2XVI A;  2A89 A;  2C76 A;  3T2K A;  2YAU A;  2C65 A;  1GSN A;  4OPT A;  4IA5 A;  4B66 A;  2OA1 A;  2BCG G;  3BNU A;  4U8K A;  1H83 A;  1NAA A;  2YG3 A;  1NDA A;  1TDK A;  1H6V A;  4AP3 A;  4Z25 A;  2Z5X A;  4YXD A;  1EL7 A;  1CJ3 A;  4IVO B;  2PYX A;  4G9K A;  2B9W A;  3AEB A;  1JEH A;  5IPY A;  2YVF A;  5EOW A;  1GOS A;  2VVL G;  2Q7V A;  1OJ9 A;  4H4Z A;  5FS9 A;  4UDQ A;  1ZMD A;  2HQM A;  3LZW A;  2IID A;  3F8P A;  1CJC A;  2BS4 A;  4AOX A;  1N4U A;  1F3P A;  2A8X A;  3SFE A;  1TDO A;  4YSH A;  2GR0 A;  4YT0 A;  1CHU A;  3QSE A;  3C4N A;  4CY8 A;  1GEU A;  4U8P A;  3GYI A;  4A5L A;  4C74 A;  2B7R A;  5KVH A;  4D04 A;  1N1P A;  4FK1 C;  3G3E A;  1GAL A;  4H4S A;  4B69 A;  3FMW A;  3UKK A;  3UTF A;  3GRT A;  1NG4 A;  1Q9I A;  2B7S A;  1GER A;  2GR2 A;  1RP0 A;  2WQY A;  3AEG A;  3P4Q A;  2QA1 A;  4YJH B;  1QO8 A;  1QLB A;  2C70 A;  4NZH A;  2Q0K A;  3GD3 A;  1YKJ A;  2BS3 A;  3L1R A;  4AOS A;  4Y4M A;  1K0J A;  3VQR A;  1DOD A;  1L0V A;  2W0H A;  2XLP A;  1L9E A;  1LJ1 A;  1XHC A;  3CGB A;  1GT8 A;  4GAV A;  4H4Q A;  3H8I A;  4I59 A;  2YM1 A;  4U8M A;  2WP6 A;  3W4I A;  3FG2 P;  4Z2T A;  2EQ9 A;  4AT0 A;  2C3D A;  2IVE A;  2XYO A;  2R0C A;  1GRF A;  4H2R A;  2X8G A;  5L46 A;  4GDP A;  2E49 A;  2JKC A;  5HYM A;  3WGT A;  2F5Z A;  2FJA A;  2A87 A;  3IHG A;  3ZNQ A;  2WU5 A;  3SZW A;  1JU2 A;  3RHA A;  1NPX A;  3ATR A;  4J57 A;  2E4A A;  3CN8 A;  4YSZ A;  1CC6 A;  1PXC A;  3DME A;  2XFP A;  2C3C A;  2XFQ A;  3D1C A;  4GDE A;  3T37 A;  2H88 A;  1F8W A;  5KMP A;  4WX1 A;  3P9U A;  4K2X A;  3ICT A;  1TYP A;  1LQT A;  2NVK X;  2V61 A;  4TM1 A;  3HYW A;  1S3B A;  4YJH A;  3RP6 A;  3R9U A;  2GH5 A;  1K0I A;  2WOV A;  4JN9 A;  1GRB A;  3UOV A;  4EQX A;  2BAB A;  2YR5 A;  3HZL A;  1PJ6 A;  2WBA A;  2WPF A;  3AB1 A;  3V3O A;  4YJD A;  3GMC A;  3LJP A;  4YKG A;  2BK4 A;  4G74 A;  5BVA A;  1DAO A;  3HYX A;  4XWR A;  1PBB A;  2BXR A;  4YKF A;  3P4S A;  3LB8 A;  3OC4 A;  1CL0 A;  2QA2 A;  3SGL A;  1H7W A;  3I3L A;  2GMH A;  3UTG A;  2E82 A;  3M0O A;  5JCK A;  1KIF A;  2YLT A;  2GVC A;  4Z2R A;  1YQZ A;  2BC0 A;  3QSS A;  1HYU A;  1DOB A;  1TYT A;  4BV6 A;  4JNA A;  4USR A;  1PBE A;  2YLS A;  3DJG X;  1NHQ A;  5KOX A;  1XDI A;  3EPT A;  4EIP A;  5BRT A;  2E48 A;  2V3B A;  4A9W A;  2R0P A;  4FDC B;  5KMR A;  2UZZ A;  1LPF A;  2XFO A;  1S3E A;  2Y6R A;  5HY5 A;  2XFN A;  1L9C A;  2VRM A;  4OPI A;  3T0K A;  1FOH A;  3GWF A;  4OPL A;  1NHR A;  2E1M A;  2BK5 A;  2GMJ A;  3DGH A;  4YWO A;  2YLX A;  3CGE A;  3GWD A;  2OAM A;  1GND A;  3PVC A;  1SEZ A;  1YQ4 A;  2JK6 A;  1PBC A;  1V59 A;  3DK8 A;  1KSS A;  4U8N A;  4USQ A;  2GAH B;  1C0I A;  1DDO A;  1ZMC A;  3ABV A;  3CMM A;  4HB9 A;  3CGC A;  5U25 A;  1ZOV A;  4M52 A;  4NTC A;  3UOX A;  1P2H A;  3ZYX A;  1N4W A;  3KVE A;  4YTP A;  4OPC A;  2Q6U A;  2BCP A;  3SY4 A;  4O5U A;  3NK0 X;  3LXD A;  5BUL A;  3CIR A;  4IA6 A;  4H2P A;  2XVH A;  3ALM A;  2V6O A;  3D8X A;  3SM8 A;  2RAB A;  2B9X A;  3CPH G;  2X8H A;  3AE7 A;  2YLW A;  1ELI A;  3ICS A;  3NN0 X;  3ZDN A;  4CCR A;  1GRT A;  3VR8 A;  4Z26 A;  2OLO A;  2R45 A;  3NIX A;  4RG4 A;  2AQJ A;  2GQF A;  2XLS A;  4J2W A;  1IUT A;  2WU2 A;  1DOE A;  5M0Z A;  1LV0 A;  3G5Q A;  3KPF A;  1DXL A;  3CNP A;  4J33 A;  2NPX A;  2B76 A;  3GDP A;  3QSM A;  3V3N A;  1Q1R A;  3URH A;  4A99 A;  1H84 A;  3ICR A;  2H89 A;  4QFD A;  3DA1 A;  1FEB A;  3CNS A;  3NTD A;  4NNJ A;  2GR1 A;  5FMH A;  3AE6 A;  4X9M A;  4EIQ A;  3AE5 A;  2XVF A;  3GMB A;  2GR3 A;  2WOI A;  3AEA A;  3NYE A;  4NTE A;  2CVJ A;  4Z24 A;  5U63 A;  4H4V A;  4XWZ A;  3V76 A;  3P1W A;  4OPD A;  4ZCD A;  3KD9 A;  2WP9 A;  2Z5Y A;  2JB2 A;  4TM0 A;  1M6I A;  1AN9 A;  4UDR A;  1B8S A;  1OJT A;  3W4J A;  4EQS A;  3RED A;  1YQ3 A;  2R9Z A;  1W4X A;  3NH3 X;  3ATQ A;  1D7L A;  2VOU A;  3FBS A;  1FEC A;  1GRG A;  3K7M X;  4DGK A;  3AD7 B;  5J7X A;  4NTD A;  3UP5 A;  5KMS A;  1LVL A;  4EMW A;  2E5V A;  1LQU A;  5JCL A;  1DNC A;  3F8D A;  4YSY A;  1GTE A;  3HYV A;  2EQ7 A;  3RNM A;  4K22 A;  1BF3 A;  3UTH A;  3VRD B;  1ZDL A;  2WEU A;  2YVG A;  2YQU A;  2BC1 A;  2ZZC A;  4WCT A;  3GDN A;  5EB4 A;  4RSL A;  2C66 A;  5HXI A;  3P4P A;  4HA6 A;  1H81 A;  4K8D A;  1CJ4 A;  4NWZ A;  1KNR A;  3DGZ A;  2GEW A;  3NG7 X;  2VZ2 A;  3UKA A;  1BZL A;  1S2Y A;  2EQ6 A;  1CC2 A;  3JSK A;  5FS7 A;  1YY5 A;  3I6D A;  2BS2 A;  1PXA A;  2R4J A;  3UKQ A;  4BK1 A;  2YLR A;  1F8R A;  2BYB A;  3IWA A;  1Y56 B;  1VG9 A;  4Z44 A;  4IV9 A;  2Q0L A;  1PS9 A;  1ZX9 A;  1FEA A;  3UOY A;  2PHH A;  3DJJ A;  2VVM A;  4ADW A;  1S2Q A;  5FS6 A;  1ZK7 A;  3SFD A;  3AED A;  1EBD A;  3ITJ A;  4J34 A;  3NYF A;  4H7U A;  3CPI G;  2FJB A;  3DH9 A;  3NKS A;  4EMJ A;  4YTN A;  3VRA A;  1H7X A;  4O5Q A;  4ECH A;  1D7Y A;  1IJH A;  3EAO A;  2WPC A;  2XFU A;  1NEN A;  4APN A;  3AE4 A;  3NGC X;  3DK9 A;  2OAL A;  4RG3 A;  1O5W A;  4U2L A;  5EB5 A;  2C4C A;  5U1O A;  4ICY A;  4YJG B;  1B5Q A;  4TM4 A;  4PAA A;  1IUU A;  1PHH A;  4YJF B;  1K4Q A;  3EF6 A;  5CKU A;  4EM4 A;  2IVD A;  2C72 A;  1PXB A;  1Q1W A;  2YG7 A;  3UP4 A;  5BUK A;  3B3R A;  1X31 B;  3M12 A;  2JBV A;  4GRT A;  2WDV A;  3PS9 A;  3PO7 A;  2X3N A;  3QFA A;  3Q9T A;  4JQ9 A;  3GYJ A;  4K5R A;  4CNK A;  1DJN A;  2VQB A;  1VG0 A;  4NEW A;  1Y56 A;  3AEF A;  1FCD A;  1P2E A;  1BGJ A;  4YSX A;  1KF6 A;  3NHO X;  4J31 A;  4H2Q A;  2GF3 A;  1C0K A;  1OJD A;  2WDR A;  4J56 A;  5M10 A;  1UKV G;  3C96 A;  2JB1 A;  2CDU A;  5IQ1 A;  2TPR A;  5C2T A;  2C75 A;  3L8K A;  4Z2U A;  3AE8 A;  2GV8 A;  3K7Q X;  2BRA A;  2DU8 A;  2R46 A;  2XDO A;  2VRL A;  1N4V A;  3K7T A;  2WPE A;  3QVR A;  3AEE A;  2RGJ A;  1IUS A;  3IF9 A;  4G73 A;  4PAB A;  1TDE A;  2WET A;  4YJG A;  4JDR A;  4U2S A;  2XLU A;  3SZF A;  1IUX A;  1PBD A;  4YJF A;  4H4R A;  4ZN0 A;  1PDH A;  4N9X A;  2C67 A;  1VE9 A;  2GQW A;  3BNM A;  3ADA B;  2BXS A;  4OPU A;  1PBF A;  1L9D A;  2WHD A;  3SX6 A;  3AD9 B;  2QAE A;  3ALL A;  3RP8 A;  4FK1 A;  2XLR A;  5GSN A;  3T2Y A;  3T31 A;  1E1L A;  4UP3 A;  3UKF A;  1CF3 A;  1C0P A;  4GR1 A;  4B65 A;  4EQR A;  3AYL A;  3E1T A;  2QCU A;  4QFC A;  4BK2 A;  3BI2 A;  4EMI A;  1GRA A;  3UOZ A;  3NN6 X;  4B64 A;  4C5O A;  4CCQ A;  1NG3 A;  3S5W A;  3T2Z A;  1OJA A;  4K7Z A;  5KOW A;  1ZY8 A;  2XVE A;  2DKH A;  3LZX A;  1ZOY A;  4U8L A;  3QJ4 A;  1D4D A;  5KRQ A;  3K30 A;  4CRT A;  3NYC A;  1GES A;  2GAG B;  2ZZB A;  4H4X A;  3CNT A;  4CNJ A;  3T14 A;  3UKL A;  1BKW A;  2CFY A;  4X4J A;  4A79 A;  2Y6Q A;  1IUV A;  3ZNO A;  4DSH A;  3CND A;  1E1K A;  2X99 A;  2X8C A;  4NEV A;  2JAE A;  2DKI A;  3BHF A;  3KU9 A;  1XPQ A;  2ACZ A;  1PJ5 A;  3NNE A;  5HHF A;  3VRB A;  4OPG A;  4DNA A;  1F6M A;  3AYI A;  4OCG A;  1OJC A;  3S61 A;  2JB3 A;  4EM3 A;  5KXJ A;  3DJD A;  2YWL A;  2FBW A;  4C77 A;  4G6H A;  3AE2 A;  4U2T A;  4A6N B;  3SXI A;  2WES A;  3IHM A;  3AEC A;  3IC9 A;  3NT6 A;  1KDG A;  4E0V A;  1O95 A;  2RGO A;  4U8I A;  2XLT A;  4H4Y A;  4II2 A;  5C3J A;  2V5Z A;  4H4U A;  1CBO A;  2YVJ A;  3G5S A;  1JRX A;  4X9N A;  3VR9 A;  1DOC A;  1M64 A;  2J3N A;  3FPZ A;  4H4P A;  1AOG A;  3C4A A;  5KMQ A;  2BA9 A;  4CY6 A;  1NHP A;  1KSU A;  4UDP A;  4IVM B;  4MJW A;  2YG5 A;  4Z43 A;  1BWC A;  2ZBW A;  3W4K A;  1GRE A;  1MO9 A;  5KVI A;  2YG4 A;  1Y0P A;  1E39 A;  3SQP A;  1GET A;  4H2N A;  3SZC A;  4U8J A;  4JNQ A;  2I0Z A;  1EL8 A;  4C3Y A;  4TLZ A;  1NEK A;  2YM2 A;  3Q6J A;  3DK4 A;  3UKP A;  2C7G A;  4BJZ A;  2VVL A;  2FJD A;  2WDQ A;  3SZ0 A;  1PN0 A;  1JRZ A;  1LTX R;  2C64 A;  4GUV A;  4LU6 A;  5EBK A;  3UTE A;  3ALJ A;  3UCL A;  1RSG A;  2WOW A;  4A6N A;  3BHK A;  3GYX A;  2OLN A;  5LV9 A;  5KWF A;  1JNR A;  3CNJ A;  3H8L A;  4AP1 A;  4LII A;  1FL2 A;  1F8S A;  2V60 A;  4TLX A;  5GRT A; 
#chains in the Genus database with same CATH homology
 3KLJ A;  1D4E A;  2EQ8 A;  3AE1 A;  4JY3 A;  1GPE A;  3OZ2 A;  3AYJ A;  3M13 A;  4P9S A;  3II4 A;  1NHS A;  3LAD A;  3BI4 A;  2X50 A;  4II3 A;  4LA1 A;  5FS8 A;  4C3X A;  2AAQ A;  2YG6 A;  3KA7 A;  1K0L A;  2O9Z A;  1ZP0 A;  1E1M A;  2GRT A;  2WS3 A;  1MXT A;  4B1B A;  4REK A;  1COY A;  1JOA A;  3UKH A;  4BUR A;  2RGH A;  2AR8 A;  1CJ2 A;  2YR6 A;  5KNL A;  3AE3 A;  4DSG A;  3DJE A;  3G5R A;  4K5S A;  5J60 A;  3GSI A;  3GRS A;  1TRB A;  5ER0 A;  4I58 A;  2R4E A;  1RYI A;  3QFB A;  4B67 A;  3BI5 A;  4OVI A;  1IUW A;  3COX A;  1D5T A;  1GRH A;  1O94 A;  4GCM A;  4BK3 A;  1GV4 A;  4JY2 A;  4BJY A;  3ISH A;  4FX9 A;  1DJQ A;  5IQ4 A;  3B6D A;  1JRY A;  2C73 A;  2BK3 A;  3H4K A;  1E6E A;  2YLZ A;  5DBJ A;  4A7A A;  1Z6L A;  1EL9 A;  4GF7 A;  1PJ7 A;  2V3A A;  3NK2 X;  4TM3 A;  1GXF A;  1REO A;  2BRY A;  4J36 A;  4KPR A;  3P4R A;  3KPK A;  2E4G A;  5JCN A;  3QVP A;  4U8O A;  1MOK A;  3AE9 A;  3GD4 A;  3CGD A;  3CTY A;  1E1N A;  5JCI A;  4CBQ A;  3KKJ A;  1TDN A;  2XCG A;  3NK1 X;  1VRQ B;  4Y4N A;  3CPJ G;  1KNP A;  5TR3 A;  1GTH A;  2TMD A;  1VDC A;  3RP7 A;  2YR4 A;  3F8R A;  3FIM B;  4XXG A;  2GB0 A;  1CC4 A;  2ZZ0 A;  1EL5 A;  4G6G A;  2CUL A;  3WE0 A;  2APG A;  4H4T A;  2R0G A;  1B37 A;  3LOV A;  4D03 A;  4YTM A;  1B4V A;  2WP5 A;  3AD8 B;  4Y4L A;  1D4C A;  1ONF A;  2B9Y A;  1KFY A;  5JCM A;  4B68 A;  3O0H A;  4H4W A;  4KX6 A;  4GAP A;  3AWI A;  1BGN A;  1VQW A;  3NRN A;  1H82 A;  1H86 A;  1ZKQ A;  2BAC A;  3NTA A;  5CQF A;  4ZCC A;  4A65 A;  2FJE A;  4EQW A;  2ARD A;  3NLC A;  1TDF A;  3EAN A;  1E7P A;  4H50 A;  4B63 A;  2VQ7 A;  2XVJ A;  3SYI A;  1JNZ A;  1XAN A;  3AXB A;  4AT2 A;  1QJD A;  2XVI A;  2A89 A;  2C76 A;  3T2K A;  2YAU A;  2C65 A;  1GSN A;  4OPT A;  4IA5 A;  4B66 A;  2OA1 A;  2BCG G;  3BNU A;  4U8K A;  1H83 A;  1NAA A;  2YG3 A;  1NDA A;  1TDK A;  1H6V A;  4AP3 A;  4Z25 A;  2Z5X A;  4YXD A;  1EL7 A;  1CJ3 A;  4IVO B;  2PYX A;  4G9K A;  2B9W A;  3AEB A;  1JEH A;  5IPY A;  2YVF A;  5EOW A;  1GOS A;  2VVL G;  2Q7V A;  1OJ9 A;  4H4Z A;  5FS9 A;  4UDQ A;  1ZMD A;  2HQM A;  3LZW A;  2IID A;  3F8P A;  1CJC A;  2BS4 A;  4AOX A;  1N4U A;  1F3P A;  2A8X A;  3SFE A;  1TDO A;  2GR0 A;  4YSH A;  4YT0 A;  1CHU A;  3QSE A;  3C4N A;  4CY8 A;  1GEU A;  4U8P A;  3GYI A;  4A5L A;  4C74 A;  2B7R A;  5KVH A;  4D04 A;  1N1P A;  4FK1 C;  1GAL A;  4H4S A;  4B69 A;  3FMW A;  3UKK A;  3UTF A;  3GRT A;  1NG4 A;  1Q9I A;  2B7S A;  1GER A;  2GR2 A;  1RP0 A;  2WQY A;  3AEG A;  3P4Q A;  2QA1 A;  1QO8 A;  1QLB A;  2C70 A;  4NZH A;  2Q0K A;  3GD3 A;  1YKJ A;  2BS3 A;  3L1R A;  4AOS A;  4Y4M A;  1K0J A;  3VQR A;  1DOD A;  1L0V A;  2W0H A;  2XLP A;  1L9E A;  1LJ1 A;  1XHC A;  3CGB A;  1GT8 A;  4GAV A;  4H4Q A;  3H8I A;  4I59 A;  2YM1 A;  4U8M A;  2WP6 A;  3FG2 P;  4Z2T A;  2EQ9 A;  4AT0 A;  2C3D A;  2IVE A;  2XYO A;  2R0C A;  1GRF A;  4H2R A;  2X8G A;  5L46 A;  4GDP A;  2JKC A;  5HYM A;  2F5Z A;  2FJA A;  2A87 A;  3IHG A;  3SZW A;  2WU5 A;  1JU2 A;  3RHA A;  1NPX A;  3ATR A;  4J57 A;  3CN8 A;  4YSZ A;  1CC6 A;  1PXC A;  2XFP A;  3D1C A;  2C3C A;  2XFQ A;  3DME A;  4GDE A;  3T37 A;  2H88 A;  1F8W A;  5KMP A;  4WX1 A;  3P9U A;  4K2X A;  3ICT A;  1TYP A;  1LQT A;  2NVK X;  2V61 A;  4TM1 A;  3HYW A;  1S3B A;  3RP6 A;  3R9U A;  2GH5 A;  1K0I A;  2WOV A;  4JN9 A;  1GRB A;  3UOV A;  4EQX A;  2BAB A;  2YR5 A;  3HZL A;  1PJ6 A;  2WBA A;  2WPF A;  3AB1 A;  3V3O A;  3GMC A;  3LJP A;  4YKG A;  2BK4 A;  4G74 A;  5BVA A;  4YKF A;  3HYX A;  4XWR A;  1PBB A;  2BXR A;  3P4S A;  3LB8 A;  3OC4 A;  1CL0 A;  2QA2 A;  1H7W A;  3I3L A;  3SGL A;  2GMH A;  3UTG A;  3M0O A;  5JCK A;  2YLT A;  2GVC A;  4Z2R A;  1YQZ A;  2BC0 A;  3QSS A;  1HYU A;  1DOB A;  1TYT A;  4BV6 A;  4JNA A;  4USR A;  1PBE A;  2YLS A;  3DJG X;  1NHQ A;  5KOX A;  1XDI A;  3EPT A;  4EIP A;  5BRT A;  2V3B A;  4A9W A;  2R0P A;  4FDC B;  5KMR A;  2UZZ A;  1LPF A;  2XFO A;  1S3E A;  2Y6R A;  5HY5 A;  2XFN A;  1L9C A;  2VRM A;  4OPI A;  3T0K A;  1FOH A;  3GWF A;  4OPL A;  1NHR A;  2E1M A;  2BK5 A;  2GMJ A;  3DGH A;  4YWO A;  2YLX A;  3CGE A;  3GWD A;  2OAM A;  1GND A;  1SEZ A;  3PVC A;  1YQ4 A;  2JK6 A;  1PBC A;  1V59 A;  3DK8 A;  1KSS A;  4U8N A;  4USQ A;  2GAH B;  3ABV A;  1ZMC A;  3CMM A;  4HB9 A;  3CGC A;  5U25 A;  1ZOV A;  4M52 A;  4NTC A;  3UOX A;  1P2H A;  3ZYX A;  1N4W A;  3KVE A;  4YTP A;  4OPC A;  2BCP A;  2Q6U A;  3SY4 A;  4O5U A;  3NK0 X;  3LXD A;  5BUL A;  3CIR A;  4IA6 A;  4H2P A;  2XVH A;  3ALM A;  2V6O A;  3D8X A;  2RAB A;  3SM8 A;  2B9X A;  3CPH G;  2X8H A;  3AE7 A;  2YLW A;  1ELI A;  3ICS A;  3NN0 X;  3ZDN A;  4CCR A;  1GRT A;  3VR8 A;  4Z26 A;  2OLO A;  2R45 A;  3NIX A;  4RG4 A;  2AQJ A;  2GQF A;  2XLS A;  4J2W A;  1IUT A;  2WU2 A;  1DOE A;  5M0Z A;  1LV0 A;  3G5Q A;  3KPF A;  1DXL A;  3CNP A;  4J33 A;  2NPX A;  2B76 A;  3GDP A;  3QSM A;  3V3N A;  1Q1R A;  3URH A;  4A99 A;  1H84 A;  3ICR A;  2H89 A;  1FEB A;  3CNS A;  3DA1 A;  3NTD A;  4NNJ A;  2GR1 A;  5FMH A;  3AE6 A;  4EIQ A;  3AE5 A;  4X9M A;  2XVF A;  3GMB A;  2GR3 A;  2WOI A;  3AEA A;  3NYE A;  4NTE A;  2CVJ A;  4Z24 A;  5U63 A;  4H4V A;  4XWZ A;  3V76 A;  3P1W A;  4OPD A;  4ZCD A;  3KD9 A;  2WP9 A;  2Z5Y A;  2JB2 A;  4TM0 A;  1M6I A;  4UDR A;  1B8S A;  1OJT A;  4EQS A;  3RED A;  1YQ3 A;  2R9Z A;  1W4X A;  3NH3 X;  3ATQ A;  1D7L A;  2VOU A;  3FBS A;  1FEC A;  1GRG A;  3K7M X;  4DGK A;  3AD7 B;  5J7X A;  4NTD A;  3UP5 A;  5KMS A;  1LVL A;  4EMW A;  2E5V A;  1LQU A;  5JCL A;  1DNC A;  3F8D A;  4YSY A;  1GTE A;  3HYV A;  2EQ7 A;  3RNM A;  4K22 A;  1BF3 A;  3UTH A;  3VRD B;  1ZDL A;  2WEU A;  2YVG A;  2YQU A;  2BC1 A;  2ZZC A;  3GDN A;  4WCT A;  5EB4 A;  4RSL A;  2C66 A;  5HXI A;  3P4P A;  4HA6 A;  1H81 A;  4K8D A;  1CJ4 A;  4NWZ A;  1KNR A;  3DGZ A;  2GEW A;  3NG7 X;  2VZ2 A;  3UKA A;  1BZL A;  1S2Y A;  2EQ6 A;  1CC2 A;  3JSK A;  5FS7 A;  1YY5 A;  3I6D A;  2BS2 A;  1PXA A;  2R4J A;  3UKQ A;  4BK1 A;  2YLR A;  1F8R A;  2BYB A;  3IWA A;  1Y56 B;  1VG9 A;  4Z44 A;  4IV9 A;  2Q0L A;  1PS9 A;  1ZX9 A;  1FEA A;  3UOY A;  2PHH A;  3DJJ A;  2VVM A;  4ADW A;  1S2Q A;  5FS6 A;  1ZK7 A;  3SFD A;  3AED A;  1EBD A;  3ITJ A;  4J34 A;  3NYF A;  4H7U A;  3CPI G;  2FJB A;  3DH9 A;  3NKS A;  4EMJ A;  4YTN A;  3VRA A;  1H7X A;  4O5Q A;  4ECH A;  1D7Y A;  1IJH A;  3EAO A;  2WPC A;  2XFU A;  1NEN A;  4APN A;  3AE4 A;  3NGC X;  3DK9 A;  2OAL A;  4RG3 A;  1O5W A;  4U2L A;  5EB5 A;  2C4C A;  5U1O A;  4ICY A;  4TM4 A;  1B5Q A;  5CKU A;  4PAA A;  1IUU A;  1K4Q A;  1PHH A;  3EF6 A;  4EM4 A;  2IVD A;  2C72 A;  1PXB A;  1Q1W A;  2YG7 A;  3UP4 A;  5BUK A;  3B3R A;  1X31 B;  2JBV A;  3M12 A;  4GRT A;  2WDV A;  3PO7 A;  3PS9 A;  2X3N A;  3QFA A;  3Q9T A;  4JQ9 A;  3GYJ A;  4K5R A;  4CNK A;  1DJN A;  2VQB A;  1VG0 A;  4NEW A;  1Y56 A;  3AEF A;  1FCD A;  1P2E A;  1BGJ A;  4YSX A;  1KF6 A;  3NHO X;  4J31 A;  4H2Q A;  2GF3 A;  1OJD A;  2WDR A;  4J56 A;  5M10 A;  1UKV G;  3C96 A;  2JB1 A;  2CDU A;  5IQ1 A;  2TPR A;  5C2T A;  2C75 A;  3L8K A;  4Z2U A;  3AE8 A;  2GV8 A;  3K7Q X;  2BRA A;  2R46 A;  2XDO A;  2VRL A;  1N4V A;  3K7T A;  2WPE A;  3QVR A;  3AEE A;  2RGJ A;  1IUS A;  3IF9 A;  4G73 A;  4JDR A;  1TDE A;  2WET A;  4PAB A;  4U2S A;  2XLU A;  3SZF A;  1IUX A;  1PBD A;  4H4R A;  4ZN0 A;  1PDH A;  4N9X A;  2C67 A;  2GQW A;  3BNM A;  3ADA B;  2BXS A;  4OPU A;  1PBF A;  1L9D A;  2WHD A;  3SX6 A;  3AD9 B;  2QAE A;  3ALL A;  3RP8 A;  4FK1 A;  2XLR A;  5GSN A;  3T2Y A;  3T31 A;  1E1L A;  4UP3 A;  3UKF A;  1CF3 A;  4B65 A;  4GR1 A;  4EQR A;  3AYL A;  4BK2 A;  3E1T A;  2QCU A;  3BI2 A;  4EMI A;  1GRA A;  3UOZ A;  3NN6 X;  4B64 A;  4C5O A;  4CCQ A;  1NG3 A;  3S5W A;  3T2Z A;  1OJA A;  4K7Z A;  5KOW A;  1ZY8 A;  2XVE A;  2DKH A;  3LZX A;  1ZOY A;  4U8L A;  3QJ4 A;  1D4D A;  5KRQ A;  3K30 A;  4CRT A;  3NYC A;  1GES A;  2GAG B;  2ZZB A;  4H4X A;  3CNT A;  4CNJ A;  3T14 A;  3UKL A;  1BKW A;  2CFY A;  4X4J A;  4A79 A;  2Y6Q A;  1IUV A;  4DSH A;  3CND A;  1E1K A;  2X99 A;  2X8C A;  4NEV A;  2JAE A;  2DKI A;  3BHF A;  3KU9 A;  1XPQ A;  2ACZ A;  1PJ5 A;  3NNE A;  5HHF A;  3VRB A;  4OPG A;  4DNA A;  1F6M A;  3AYI A;  4OCG A;  1OJC A;  3S61 A;  2JB3 A;  4EM3 A;  5KXJ A;  3DJD A;  2YWL A;  2FBW A;  4C77 A;  4G6H A;  3AE2 A;  4U2T A;  4A6N B;  3SXI A;  2WES A;  3IHM A;  3AEC A;  3IC9 A;  3NT6 A;  1KDG A;  4E0V A;  1O95 A;  2RGO A;  4U8I A;  2XLT A;  4H4Y A;  4II2 A;  5C3J A;  2V5Z A;  4H4U A;  1CBO A;  2YVJ A;  3G5S A;  1JRX A;  4X9N A;  3VR9 A;  1DOC A;  1M64 A;  2J3N A;  3FPZ A;  4H4P A;  1AOG A;  3C4A A;  5KMQ A;  2BA9 A;  4CY6 A;  1NHP A;  1KSU A;  4UDP A;  4IVM B;  4MJW A;  2YG5 A;  4Z43 A;  1BWC A;  2ZBW A;  1MO9 A;  1GRE A;  5KVI A;  2YG4 A;  1Y0P A;  1E39 A;  3SQP A;  1GET A;  4H2N A;  3SZC A;  4U8J A;  4JNQ A;  2I0Z A;  1EL8 A;  4C3Y A;  4TLZ A;  1NEK A;  2YM2 A;  3Q6J A;  3DK4 A;  3UKP A;  2C7G A;  4BJZ A;  2VVL A;  2FJD A;  2WDQ A;  3SZ0 A;  1LTX R;  1JRZ A;  1PN0 A;  2C64 A;  4GUV A;  4LU6 A;  5EBK A;  3UTE A;  3ALJ A;  3UCL A;  1RSG A;  2WOW A;  4A6N A;  3BHK A;  3GYX A;  2OLN A;  5LV9 A;  5KWF A;  1JNR A;  3CNJ A;  3H8L A;  4AP1 A;  4LII A;  1FL2 A;  1F8S A;  2V60 A;  4TLX A;  5GRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...