1TDFA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase(flavoenzyme)
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA02
1GETA 4CY8A 1DJNA 3RP7A 5M10A 1VG9A 1DNCA 4APNA 1PDHA 4K5RA 1DOCA 1OJAA 1Y56B 4X9NA 4KX6A 1JNZA 4U8OA 1DOEA 4DNAA 3FMWA 4H2RA 4H4TA 4NTCA 2PYXA 3M12A 4H4PA 1OJDA 3UKPA 3URHA 4D04A 1X31B 2F5ZA 2JAEA 2QA1A 3ATRA 3KPFA 3BNMA 1JU2A 2IVEA 2OALA 3NIXA 3NTDA 3RNMA 4LIIA 3SM8A 1D7LA 3AE4A 4YKGA 1V59A 5FS6A 4BK2A 3QSEA 4U8NA 2VOUA 1LQUA 4B66A 1GRAA 2CDUA 3NH3X 2YLWA 1GESA 4U2TA 2YG6A 4U8PA 3GMBA 4Z2TA 3NTAA 2QAEA 3KLJA 4PAAA 1DJQA 4DSGA 3AE3A 3UCLA 1YQZA 2YG3A 1GXFA 2C76A 1QO8A 3NYFA 2E4GA 2Y6QA 1YKJA 1GERA 4IA5A 2VVMA 2PHHA 3NK0X 3NT6A 2YR4A 2VRMA 3VQRA 1RYIA 2OAMA 3SGLA 1OJ9A 3NNEA 2GR3A 2YM1A 5ER0A 4AP1A 1LV0A 1IUVA 4CRTA 5DBJA 1BZLA 2XVEA 1L0VA 5BVAA 1EL5A 4JQ9A 4WX1A 5IQ4A 2WEUA 2YWLA 3CPJG 2V5ZA 3EPTA 1QLBA 2BCPA 2BK4A 1GRBA 1F3PA 1GV4A 4BJYA 3UP4A 4AT2A 2GAHB 2O9ZA 1NAAA 1KF6A 3M13A 2IIDA 2R45A 3O0HA 4H2PA 4NTEA 1CC2A 1GREA 2WPFA 3AD7B 3DGHA 3P4QA 4XXGA 4CCQA 3L8KA 1GNDA 2Q6UA 2WPEA 3KKJA 4EMWA 3AE2A 4D03A 5BRTA 2R0CA 2VVLG 3G5SA 1N4WA 1EL7A 2GMHA 2JK6A 3NYEA 1VQWA 4EM3A 1NHPA 1ELIA 2H88A 5M0ZA 3SQPA 3UKFA 1VDCA 2GQFA 3PS9A 1RSGA 2V60A 3KVEA 4JY2A 4USRA 5FS8A 2ARDA 5C3JA 4NEVA 4JN9A 2GMJA 1KNPA 1E1LA 2JB3A 1CBOA 1E1KA 2WETA 1GEUA 2XLRA 2XLUA 3AEDA 3ALLA 5KVHA 3P4PA 2BYBA 3BI4A 1P2HA 4U2LA 2B76A 3UKAA 1TDEA 2BK3A 1GRGA 2W0HA 3UTFA 2BC1A 1PBDA 3V3NA 1JOAA 1GRHA 1KSUA 2R0PA 3IHMA 2WQYA 3LXDA 1TDFA 4K8DA 3RP6A 2XFOA 3UOZA 2DKHA 4J36A 1PJ6A 2JKCA 2GRTA 4XWZA 5GSNA 5JCLA 4RG4A 1FCDA 1N1PA 2GVCA 4PABA 2V3BA 1ZK7A 3AEGA 3UP5A 4H4VA 4C5OA 1F6MA 5FS7A 2XVJA 1K0IA 3OC4A 2WDVA 4ADWA 5HXIA 2OLOA 4H4QA 4UP3A 3PO7A 2C70A 4GUVA 5L46A 2X3NA 4ZN0A 2RABA 1H7WA 4U8MA 4BV6A 2V61A 3Q6JA 4A99A 2C3CA 3I6DA 4GRTA 4C77A 1CHUA 4CCRA 4CNJA 3UTGA 1XDIA 4K22A 5J7XA 4ECHA 1B37A 1K0LA 2JB1A 5JCIA 2JBVA 2R4EA 3QFAA 3UKQA 2VVLA 3ABVA 1S2YA 1JEHA 2YG4A 3NHOX 1XHCA 1PXBA 1MOKA 3AD8B 3C4AA 1CJ3A 2YLZA 4DSHA 4FDCB 3B6DA 3ISHA 2X50A 1L9EA 2RGHA 5FS9A 4YSHA 3FG2P 3PVCA 3F8RA 1FL2A 4EIPA 1E6EA 3NGCX 1VRQB 2GAGB 2WP6A 3HZLA 3GYIA 3IHGA 5KXJA 3AYJA 1CJ2A 2EQ8A 3P9UA 2BXRA 3AE9A 1O95A 2X99A 4K7ZA 5KRQA 2R46A 3IF9A 1B4VA 4OCGA 5CQFA 2WOIA 2XDOA 5TR3A 1NPXA 3UOVA 1REOA 4LA1A 1NHSA 2B7SA 4RSLA 5HHFA 1CF3A 1MXTA 1ZKQA 3QSSA 3GRSA 1ZOYA 3AYLA 4YTPA 3BHKA 1S3EA 4GR1A 4LU6A 1GRFA 3AD9B 1ZX9A 3DMEA 4Z44A 3NLCA 3LOVA 3GWDA 3H8LA 2C67A 4XWRA 2XFNA 1FOHA 1M64A 1PBEA 2YAUA 3I3LA 2XFQA 4J56A 4TM1A 2AAQA 2BS3A 2B9WA 3DJDA 3DJJA 1PS9A 3AE1A 4GF7A 1GSNA 3QVRA 4EM4A 1D4EA 3CNSA 3FPZA 2EQ6A 3ZDNA 4GCMA 2XVIA 1BKWA 1NDAA 2C65A 1IUTA 4TLXA 1AOGA 3CNPA 2APGA 3GWFA 3S61A 3CN8A 4OPIA 2B9YA 3SFDA 4ICYA 4A7AA 1FECA 4U2SA 2C72A 1KNRA 2WPCA 3AE7A 3DA1A 4EQRA 3AEFA 2WP9A 4FX9A 1D7YA 2GH5A 3LB8A 2ACZA 3CPIG 4H2QA 4HB9A 2X8GA 5EOWA 4J31A 3F8PA 2FJBA 2C75A 1XPQA 2ZZBA 3DK9A 3CTYA 3KU9A 1O5WA 1JRYA 3CNDA 1LTXR 2YR6A 3AEEA 2GR0A 2BA9A 2XYOA 2XFPA 1CJ4A 2XCGA 4H4ZA 4CBQA 1P2EA 3DGZA 1PXAA 3AECA 2VQBA 3BHFA 3F8DA 4BJZA 4AOSA 2WHDA 1LQTA 2YG5A 1H81A 1BGNA 2A89A 4A9WA 2Z5XA 1EBDA 2YM2A 3UKKA 3CGCA 5IQ1A 3P4SA 1GT8A 4OVIA 1CC6A 1H83A 1PBFA 3NKSA 1PN0A 4HA6A 4YSXA 4OPDA 2GR2A 2Z5YA 4C3YA 1E1NA 4YXDA 2GQWA 1E1MA 2WESA 1B8SA 1LPFA 2V3AA 4TM0A 2BK5A 3D1CA 1GOSA 4A5LA 3LZWA 4UDQA 4EMIA 1PHHA 1F8WA 1BGJA 1S2QA 3DJEA 3AE6A 2WS3A 3ADAB 3G5QA 4AP3A 2QCUA 2R9ZA 1L9CA 3FBSA 1H6VA 3AXBA 2XLPA 4U8JA 1PBBA 2WBAA 4IVOB 3D8XA 4NEWA 2RGOA 2WDQA 1H86A 1GTEA 3OZ2A 1JRZA 3WE0A 1DODA 1N4UA 1TDNA 4YTNA 3ALMA 3NG7X 5EB4A 3AEAA 1FEBA 5JCMA 4UDRA 2B7RA 5EB5A 3P4RA 1Q9IA 4H2NA 5KOXA 1EL9A 2XLTA 2CVJA 1UKVG 1SEZA 2X8CA 1N4VA 3Q9TA 4UDPA 4CY6A 1YQ4A 4H7UA 4E0VA 4GDEA 1YQ3A 3EF6A 4Z26A 4A79A 1GALA 3V3OA 2B9XA 2WDRA 4YWOA 4B67A 4A6NA 4Z2UA 3CGEA 1KFYA 2QA2A 4TLZA 1K4QA 4YTMA 3VRBA 1IUXA 2YG7A 1D4CA 2CFYA 1HYUA 2XFUA 3L1RA 1NG3A 3QFBA 4JNAA 2WU2A 5CKUA 1TDOA 2HQMA 2ZZCA 2C3DA 4JDRA 3UKHA 3QVPA 1TYTA 1TDKA 3AEBA 1RP0A 2BS2A 1PXCA 1JNRA 1D5TA 1W4XA 5J60A 4Y4NA 5LV9A 3P1WA 4C74A 3UKLA 3GD4A 1PJ7A 4OPCA 3H8IA 3VR9A 3GMCA 1OJCA 3ICSA 4IA6A 3CNJA 4Z25A 1NHRA 2R4JA 3UTHA 3ITJA 3QSMA 4OPGA 1CL0A 4P9SA 3RP8A 1FEAA 2UZZA 2YLSA 1H7XA 3T37A 4C3XA 3V76A 2RGJA 3REDA 2OA1A 3GRTA 1NHQA 2GR1A 4OPLA 2WOVA 2X8HA 3COXA 4TM3A 4IVMB 1GPEA 4I59A 5BUKA 3II4A 4JY3A 3UOYA 1TYPA 3JSKA 4EIQA 2XLSA 2Y6RA 1DXLA 1TRBA 2GV8A 4H4UA 2ZZ0A 4FK1A 2JB2A 3DJGX 1LJ1A 4EMJA 2YVJA 3GDPA 1ZDLA 1ZP0A 3DH9A 3LZXA 4YSYA 2BABA 2J3NA 5C2TA 2C7GA 1B5QA 3B3RA 3BI2A 5U1OA 3KA7A 1NG4A 4B64A 1O94A 3KD9A 4B65A 4MJWA 4TM4A 1GRTA 3VRDB 1JRXA 3VR8A 1D4DA 2WOWA 4Y4LA 1BF3A 4O5QA 1IJHA 2IVDA 2I0ZA 3AE8A 2BS4A 2FJDA 2NVKX 4KPRA 2C64A 1F8RA 4Z43A 2YLRA 3BNUA 5JCNA 2BXSA 2DKIA 2YQUA 5U25A 2E1MA 3S5WA 3CPHG 2TMDA 4OPUA 4J57A 2R0GA 5BULA 3K7QX 1Y56A 2C73A 4Y4MA 4M52A 4NZHA 4Z2RA 3R9UA 2ZBWA 4I58A 1IUUA 2WP5A 1KDGA 2EQ7A 2V6OA 4DGKA 4EQWA 4H4SA 1DOBA 1Y0PA 4J2WA 1Z6LA 3ALJA 4H50A 3UOXA 3ICTA 5HY5A 1XANA 3K7MX 3K30A 3CNTA 4EQXA 5KOWA 4H4WA 4B69A 1QJDA 4ZCCA 1CC4A 2Q0LA 4A6NB 2FBWA 4J34A 1E7PA 1IUSA 5IPYA 2XVHA 3EAOA 1L9DA 5GRTA 4EQSA 4Z24A 4B63A 1PBCA 4AOXA 1IUWA 4AT0A 5U63A 2YLTA 1GTHA 2EQ9A 2YVFA 2GB0A 2NPXA 3K7TA 3NN6X 4X4JA 1Q1RA 3GSIA 3E1TA 4J33A 3H4KA 3AE5A 4FK1C 3DK4A 3ATQA 4GDPA 3QJ4A 4U8KA 4U8IA 1S3BA 4U8LA 5JCKA 1NENA 2Q7VA 4K5SA 2Q0KA 4B68A 4CNKA 2FJEA 3GD3A 4OPTA 3VRAA 1ZOVA 3G5RA 1K0JA 3GYJA 2AQJA 2E5VA 4USQA 3SFEA 2BC0A 1KSSA 5FMHA 4YSZA 4ZCDA 3AWIA 1H84A 4H4YA 4BURA 3NK2X 1COYA 3RHAA 2YR5A 5HYMA 2VQ7A 4BK1A 4K2XA 1ZMCA 4IV9A 3FIMB 4YT0A 2H89A 3AYIA 3ICRA 3EANA 2WU5A 5EBKA 1PJ5A 2XVFA 2A8XA 2TPRA 2BACA 3CIRA 1E39A 4X9MA 4BK3A 1ONFA 1VG0A 3BI5A 3NYCA 2A87A 4NTDA 3NRNA 4H4XA 2GEWA 3C4NA 3GDNA 4JNQA 3LJPA 3UTEA 3ZYXA 2VZ2A 2AR8A 4YKFA 1ZMDA 2C66A 4RG3A 3IWAA 5KVIA 1ZY8A 4N9XA 1EL8A 4B1BA 1MO9A 3AB1A 4A65A 3IC9A 2FJAA 1M6IA 1NEKA 1BWCA 4O5UA 1YY5A 3NK1X 2YVGA 1OJTA 3C96A 1CJCA 3DK8A 1Q1WA 4WCTA 1F8SA 3CGDA 3CGBA 3LADA 2VRLA 3NN0X 4H4RA 2YLXA 2CULA 3M0OA 4REKA 2BCGG 5KWFA 1H82A 1LVLA 2GF3A 2OLNA
chains in the Genus database with same CATH superfamily
1GETA 4CY8A 1DJNA 3RP7A 5M10A 1VG9A 1DNCA 4APNA 1PDHA 4K5RA 1DOCA 1OJAA 1Y56B 4X9NA 4KX6A 1JNZA 4U8OA 1DOEA 4DNAA 5KMQA 3FMWA 4H2RA 4H4TA 4NTCA 2PYXA 3M12A 4H4PA 1OJDA 3UKPA 3URHA 4D04A 1X31B 2F5ZA 2JAEA 2QA1A 3ATRA 3KPFA 3BNMA 1JU2A 2IVEA 2OALA 3NIXA 3NTDA 3RNMA 4LIIA 3SM8A 1D7LA 3AE4A 4YKGA 1V59A 5FS6A 4BK2A 3QSEA 4U8NA 2VOUA 1LQUA 4B66A 1GRAA 2CDUA 3NH3X 2YLWA 1GESA 4U2TA 2YG6A 4U8PA 3GMBA 4Z2TA 3NTAA 2QAEA 3KLJA 4PAAA 1DJQA 4DSGA 3AE3A 3UCLA 1YQZA 2YG3A 1GXFA 2C76A 1QO8A 3NYFA 2E4GA 2Y6QA 1YKJA 1GERA 4IA5A 2VVMA 2PHHA 3NK0X 3NT6A 2YR4A 2VRMA 3VQRA 1RYIA 2OAMA 3SGLA 1OJ9A 3NNEA 2GR3A 2YM1A 5ER0A 4AP1A 1LV0A 1IUVA 4CRTA 5DBJA 1BZLA 2XVEA 1L0VA 5BVAA 1EL5A 4JQ9A 4WX1A 5IQ4A 2WEUA 2YWLA 3CPJG 2V5ZA 3EPTA 1QLBA 2BCPA 2BK4A 4G73A 1GRBA 1F3PA 1GV4A 4BJYA 3UP4A 4AT2A 2GAHB 2O9ZA 1NAAA 1KF6A 3M13A 2IIDA 2R45A 3O0HA 4H2PA 4NTEA 1CC2A 1GREA 2WPFA 3AD7B 3DGHA 3P4QA 4XXGA 4CCQA 3L8KA 1GNDA 2Q6UA 2WPEA 3KKJA 3SZ0A 3AE2A 4D03A 4G6HA 4EMWA 5BRTA 2R0CA 2VVLG 3G5SA 1N4WA 1EL7A 2GMHA 2JK6A 3NYEA 1VQWA 4EM3A 1NHPA 1ELIA 2H88A 5M0ZA 3SQPA 3UKFA 1VDCA 2BRYA 2GQFA 3PS9A 1RSGA 2V60A 3KVEA 4JY2A 4USRA 5FS8A 2ARDA 5C3JA 4NEVA 4JN9A 2GMJA 1KNPA 1E1LA 2JB3A 1CBOA 1E1KA 2WETA 1GEUA 2XLRA 2XLUA 3AEDA 3ALLA 5KVHA 3HYWA 2BYBA 3P4PA 3BI4A 1P2HA 4U2LA 2B76A 3UKAA 1TDEA 2BK3A 1GRGA 2W0HA 3UTFA 2BC1A 1PBDA 3V3NA 1JOAA 1GRHA 1KSUA 2R0PA 3IHMA 2WQYA 3LXDA 1TDFA 4K8DA 3RP6A 2XFOA 3UOZA 2DKHA 4J36A 1PJ6A 2JKCA 2GRTA 4XWZA 5GSNA 5JCLA 4RG4A 1FCDA 1N1PA 2GVCA 3SZFA 4II2A 4PABA 2V3BA 1ZK7A 3AEGA 3UP5A 4H4VA 4C5OA 1F6MA 5FS7A 2XVJA 1K0IA 3OC4A 2WDVA 4ADWA 5HXIA 2OLOA 4H4QA 4UP3A 3PO7A 2C70A 4GUVA 5L46A 2X3NA 4ZN0A 2RABA 1H7WA 4U8MA 4BV6A 2V61A 3Q6JA 4A99A 2C3CA 3I6DA 4GRTA 4C77A 1CHUA 4CCRA 4CNJA 3UTGA 1XDIA 4K22A 5J7XA 4ECHA 1B37A 1K0LA 2JB1A 5JCIA 2JBVA 2R4EA 3QFAA 3UKQA 2VVLA 3ABVA 1S2YA 1JEHA 2YG4A 3NHOX 1XHCA 4G6GA 1PXBA 1MOKA 3AD8B 3C4AA 1CJ3A 2YLZA 4DSHA 4FDCB 3B6DA 3ISHA 2X50A 1L9EA 2RGHA 5FS9A 4YSHA 3FG2P 3PVCA 3F8RA 1FL2A 4EIPA 1E6EA 3NGCX 1VRQB 2GAGB 2WP6A 3HZLA 3GYIA 3IHGA 5KXJA 3AYJA 1CJ2A 2EQ8A 3P9UA 2BXRA 3AE9A 3T2KA 1O95A 2X99A 3GYXA 4K7ZA 5KRQA 2R46A 3IF9A 1B4VA 4OCGA 5CQFA 2BRAA 2WOIA 2XDOA 1NPXA 5TR3A 3UOVA 1REOA 4LA1A 1NHSA 2B7SA 4RSLA 5HHFA 4NWZA 1CF3A 1MXTA 1ZKQA 3QSSA 3GRSA 1ZOYA 3AYLA 4YTPA 3BHKA 1S3EA 4GR1A 4LU6A 1GRFA 3AD9B 1ZX9A 3T2ZA 3DMEA 4Z44A 3NLCA 3LOVA 3GWDA 3H8LA 2C67A 3SXIA 4XWRA 2XFNA 1FOHA 1M64A 1PBEA 2YAUA 3I3LA 2XFQA 4J56A 4TM1A 3T31A 2AAQA 2BS3A 2B9WA 3DJDA 3DJJA 1PS9A 3AE1A 4GF7A 1GSNA 3QVRA 4EM4A 1D4EA 3CNSA 3FPZA 2EQ6A 3ZDNA 4GCMA 2XVIA 1BKWA 1NDAA 2C65A 1IUTA 4TLXA 1AOGA 3CNPA 2APGA 3GWFA 3S61A 3CN8A 4OPIA 2B9YA 3SFDA 4ICYA 4A7AA 1FECA 4U2SA 2C72A 1KNRA 2WPCA 3KPKA 3AE7A 3DA1A 4EQRA 3AEFA 2WP9A 4FX9A 1D7YA 2GH5A 3LB8A 2ACZA 3CPIG 4YTNA 4H2QA 4HB9A 2X8GA 5EOWA 4J31A 3F8PA 2FJBA 2C75A 1XPQA 2ZZBA 3DK9A 3CTYA 3KU9A 1O5WA 1JRYA 3SY4A 3CNDA 1LTXR 2YR6A 3AEEA 4II3A 2C4CA 2GR0A 2BA9A 2XYOA 2XFPA 1CJ4A 2XCGA 4H4ZA 4CBQA 1P2EA 3DGZA 1PXAA 3AECA 2VQBA 3BHFA 3F8DA 3SZWA 4AOSA 4BJZA 2WHDA 3CMMA 1LQTA 2YG5A 1H81A 1BGNA 2A89A 4A9WA 5KMSA 2Z5XA 1EBDA 2YM2A 3UKKA 3CGCA 5IQ1A 3P4SA 1GT8A 4OVIA 1CC6A 1H83A 1PBFA 3NKSA 1PN0A 4HA6A 3SZCA 4YSXA 4OPDA 2GR2A 2Z5YA 4G74A 4C3YA 1E1NA 4YXDA 2GQWA 1E1MA 2WESA 1B8SA 1LPFA 2V3AA 4TM0A 2BK5A 3D1CA 1GOSA 4A5LA 3LZWA 4UDQA 4EMIA 1PHHA 1F8WA 1BGJA 1S2QA 3DJEA 3AE6A 2WS3A 3ADAB 3G5QA 4AP3A 2QCUA 2R9ZA 1L9CA 3FBSA 1H6VA 3AXBA 2XLPA 4U8JA 1PBBA 2WBAA 4IVOB 3D8XA 4NEWA 2RGOA 2WDQA 1H86A 1GTEA 3OZ2A 1JRZA 3HYVA 1DODA 1N4UA 1TDNA 3WE0A 3ALMA 3NG7X 5EB4A 3AEAA 1FEBA 5JCMA 4UDRA 2B7RA 4GAPA 5EB5A 3P4RA 1Q9IA 4H2NA 5KOXA 1EL9A 2XLTA 2CVJA 1UKVG 1SEZA 2X8CA 1N4VA 3Q9TA 4UDPA 4CY6A 1YQ4A 4H7UA 4E0VA 4GDEA 1YQ3A 3EF6A 4Z26A 4A79A 1GALA 3V3OA 2B9XA 2WDRA 4YWOA 4B67A 4A6NA 4Z2UA 3CGEA 1KFYA 2QA2A 4TLZA 1K4QA 4YTMA 3VRBA 1IUXA 2YG7A 1D4CA 2CFYA 5KMRA 1HYUA 2XFUA 3L1RA 1NG3A 3QFBA 4JNAA 2WU2A 5CKUA 1TDOA 3HYXA 2HQMA 2ZZCA 2C3DA 4JDRA 3UKHA 3QVPA 1TYTA 1TDKA 3AEBA 1RP0A 2BS2A 1PXCA 1JNRA 1D5TA 1W4XA 5J60A 4Y4NA 5LV9A 3P1WA 4C74A 3UKLA 3GD4A 1PJ7A 4OPCA 3H8IA 3VR9A 3T14A 5KMPA 3GMCA 1OJCA 3ICSA 4IA6A 3CNJA 4Z25A 1NHRA 2R4JA 3UTHA 3ITJA 3QSMA 4OPGA 1CL0A 4P9SA 3RP8A 1FEAA 2UZZA 2YLSA 1H7XA 3T37A 4C3XA 3V76A 2RGJA 3REDA 2OA1A 3GRTA 1NHQA 2GR1A 4OPLA 2WOVA 2X8HA 3COXA 4TM3A 4IVMB 1GPEA 4I59A 5BUKA 3II4A 4JY3A 3UOYA 1TYPA 3JSKA 4EIQA 2XLSA 2Y6RA 1DXLA 1TRBA 2GV8A 4H4UA 2ZZ0A 4FK1A 2JB2A 3DJGX 1LJ1A 4EMJA 2YVJA 3GDPA 1ZDLA 1ZP0A 3DH9A 3LZXA 4YSYA 2BABA 2J3NA 5C2TA 2C7GA 1B5QA 3B3RA 3BI2A 5U1OA 3KA7A 1NG4A 4B64A 1O94A 3KD9A 4B65A 4MJWA 4TM4A 1GRTA 3VRDB 3SYIA 1JRXA 3VR8A 1D4DA 2WOWA 4Y4LA 1BF3A 4O5QA 1IJHA 2IVDA 2I0ZA 3AE8A 2BS4A 2FJDA 2NVKX 4KPRA 4GAVA 2C64A 1F8RA 4Z43A 2YLRA 3BNUA 5JCNA 2BXSA 2DKIA 2YQUA 5U25A 2E1MA 3S5WA 3CPHG 2TMDA 4OPUA 4J57A 2R0GA 5BULA 3K7QX 1Y56A 2C73A 4Y4MA 4M52A 4NZHA 4Z2RA 3R9UA 2ZBWA 4I58A 1IUUA 2WP5A 1KDGA 2EQ7A 2V6OA 4DGKA 4EQWA 4H4SA 3SX6A 1DOBA 1Y0PA 4J2WA 1Z6LA 3ALJA 4H50A 3UOXA 3ICTA 5HY5A 1XANA 3K7MX 3K30A 3CNTA 4EQXA 5KOWA 4H4WA 4B69A 1QJDA 4ZCCA 1CC4A 2Q0LA 4A6NB 2FBWA 4J34A 1E7PA 1IUSA 5IPYA 2XVHA 3EAOA 1L9DA 5GRTA 4EQSA 4Z24A 4B63A 1PBCA 4AOXA 1IUWA 4AT0A 5U63A 2YLTA 1GTHA 2EQ9A 2YVFA 2GB0A 2NPXA 3K7TA 3NN6X 4X4JA 1Q1RA 3GSIA 3E1TA 4J33A 3H4KA 3AE5A 4FK1C 3DK4A 3ATQA 4GDPA 3QJ4A 4U8KA 4U8IA 1S3BA 4U8LA 5JCKA 1NENA 2Q7VA 4K5SA 2Q0KA 4B68A 4CNKA 2FJEA 3GD3A 4OPTA 3VRAA 1ZOVA 3G5RA 1K0JA 3GYJA 2AQJA 2E5VA 4USQA 3SFEA 2BC0A 1KSSA 5FMHA 4YSZA 4ZCDA 3AWIA 1H84A 4H4YA 4BURA 3NK2X 1COYA 3RHAA 2YR5A 5HYMA 2VQ7A 4BK1A 4G9KA 4K2XA 1ZMCA 4IV9A 3FIMB 4YT0A 2H89A 3AYIA 3ICRA 3EANA 2WU5A 5EBKA 1PJ5A 2XVFA 2A8XA 2TPRA 2BACA 5KNLA 3CIRA 4NNJA 1E39A 3T0KA 4X9MA 4BK3A 1ONFA 1VG0A 3BI5A 3NYCA 2A87A 4NTDA 3NRNA 4H4XA 2GEWA 3C4NA 3GDNA 4JNQA 3LJPA 3UTEA 3ZYXA 2VZ2A 2AR8A 4YKFA 1ZMDA 2C66A 4RG3A 3IWAA 5KVIA 1ZY8A 4N9XA 1EL8A 4B1BA 1MO9A 3AB1A 4A65A 3IC9A 2FJAA 1M6IA 1NEKA 3T2YA 1BWCA 4O5UA 1YY5A 3NK1X 2YVGA 1OJTA 3C96A 1CJCA 3DK8A 1Q1WA 4WCTA 1F8SA 3CGDA 3CGBA 3LADA 2VRLA 3NN0X 4H4RA 2YLXA 2CULA 3M0OA 4REKA 2BCGG 5KWFA 1H82A 1LVLA 2GF3A 2OLNA
chains in the Genus database with same CATH topology
1GETA 4CY8A 1DJNA 3RP7A 5M10A 1VG9A 1DNCA 4APNA 1PDHA 4K5RA 1DOCA 1OJAA 1Y56B 4X9NA 4KX6A 1JNZA 4U8OA 1DOEA 4DNAA 5KMQA 3FMWA 4H2RA 4H4TA 4NTCA 2PYXA 3M12A 4H4PA 1OJDA 3UKPA 3URHA 4D04A 1X31B 2F5ZA 2JAEA 2QA1A 3ATRA 3KPFA 3BNMA 1JU2A 2IVEA 2OALA 3NIXA 3NTDA 3RNMA 4LIIA 3SM8A 1D7LA 3AE4A 4YKGA 1V59A 5FS6A 4BK2A 3QSEA 4U8NA 2VOUA 1LQUA 4B66A 1GRAA 2CDUA 3NH3X 2YLWA 1GESA 4U2TA 2YG6A 4U8PA 3GMBA 4Z2TA 3NTAA 2QAEA 3KLJA 4PAAA 1DJQA 4DSGA 3AE3A 3UCLA 1YQZA 2YG3A 1GXFA 2C76A 1QO8A 3NYFA 2E4GA 2Y6QA 1YKJA 1GERA 4IA5A 2VVMA 2PHHA 3NK0X 3NT6A 2YR4A 2VRMA 3VQRA 1RYIA 2OAMA 3SGLA 1OJ9A 3NNEA 2GR3A 2YM1A 5ER0A 4AP1A 1LV0A 1IUVA 4CRTA 5DBJA 1BZLA 2XVEA 1L0VA 5BVAA 1EL5A 4JQ9A 4WX1A 5IQ4A 2WEUA 2YWLA 3CPJG 2V5ZA 3EPTA 1QLBA 2BCPA 2BK4A 4G73A 1GRBA 1F3PA 1GV4A 4BJYA 3UP4A 4AT2A 2GAHB 2O9ZA 1NAAA 1KF6A 3M13A 2IIDA 2R45A 3O0HA 4H2PA 4NTEA 1CC2A 1GREA 2WPFA 3AD7B 3DGHA 3P4QA 4XXGA 4CCQA 3L8KA 1GNDA 2Q6UA 2WPEA 3KKJA 3SZ0A 3AE2A 4D03A 4G6HA 4EMWA 5BRTA 2R0CA 2VVLG 3G5SA 1N4WA 1EL7A 2GMHA 2JK6A 3NYEA 1VQWA 4EM3A 1NHPA 1ELIA 2H88A 5M0ZA 3SQPA 3UKFA 1VDCA 2BRYA 2GQFA 3PS9A 1RSGA 2V60A 3KVEA 4JY2A 4USRA 5FS8A 2ARDA 5C3JA 4NEVA 4JN9A 2GMJA 1KNPA 1E1LA 2JB3A 1CBOA 1E1KA 2WETA 1GEUA 2XLRA 2XLUA 3AEDA 3ALLA 5KVHA 3HYWA 2BYBA 3P4PA 3BI4A 1P2HA 4U2LA 2B76A 3UKAA 1TDEA 2BK3A 1GRGA 2W0HA 3UTFA 2BC1A 1PBDA 3V3NA 1JOAA 1GRHA 1KSUA 2R0PA 3IHMA 2WQYA 3LXDA 1TDFA 4K8DA 3RP6A 2XFOA 3UOZA 2DKHA 4J36A 1PJ6A 2JKCA 2GRTA 4XWZA 5GSNA 5JCLA 4RG4A 1FCDA 1N1PA 2GVCA 3SZFA 4II2A 4PABA 2V3BA 1ZK7A 3AEGA 3UP5A 4H4VA 4C5OA 1F6MA 5FS7A 2XVJA 1K0IA 3OC4A 2WDVA 4ADWA 5HXIA 2OLOA 4H4QA 4UP3A 3PO7A 2C70A 4GUVA 5L46A 2X3NA 4ZN0A 2RABA 1H7WA 4U8MA 4BV6A 2V61A 3Q6JA 4A99A 2C3CA 3I6DA 4GRTA 4C77A 1CHUA 4CCRA 4CNJA 3UTGA 1XDIA 4K22A 5J7XA 4ECHA 1B37A 1K0LA 2JB1A 5JCIA 2JBVA 2R4EA 3QFAA 3UKQA 2VVLA 3ABVA 1S2YA 1JEHA 2YG4A 3NHOX 1XHCA 4G6GA 1PXBA 1MOKA 3AD8B 3C4AA 1CJ3A 2YLZA 4DSHA 4FDCB 3B6DA 3ISHA 2X50A 1L9EA 2RGHA 5FS9A 4YSHA 3FG2P 3PVCA 3F8RA 1FL2A 4EIPA 1E6EA 3NGCX 1VRQB 2GAGB 2WP6A 3HZLA 3GYIA 3IHGA 5KXJA 3AYJA 1CJ2A 2EQ8A 3P9UA 2BXRA 3AE9A 3T2KA 1O95A 2X99A 3GYXA 4K7ZA 5KRQA 2R46A 3IF9A 1B4VA 4OCGA 5CQFA 2BRAA 2WOIA 2XDOA 1NPXA 5TR3A 3UOVA 1REOA 4LA1A 1NHSA 2B7SA 4RSLA 5HHFA 4NWZA 1CF3A 1MXTA 1ZKQA 3QSSA 3GRSA 1ZOYA 3AYLA 4YTPA 3BHKA 1S3EA 4GR1A 4LU6A 1GRFA 3AD9B 1ZX9A 3T2ZA 3DMEA 4Z44A 3NLCA 3LOVA 3GWDA 3H8LA 2C67A 3SXIA 4XWRA 2XFNA 1FOHA 1M64A 1PBEA 2YAUA 3I3LA 2XFQA 4J56A 4TM1A 3T31A 2AAQA 2BS3A 2B9WA 3DJDA 3DJJA 1PS9A 3AE1A 4GF7A 1GSNA 3QVRA 4EM4A 1D4EA 3CNSA 3FPZA 2EQ6A 3ZDNA 4GCMA 2XVIA 1BKWA 1NDAA 2C65A 1IUTA 4TLXA 1AOGA 3CNPA 2APGA 3GWFA 3S61A 3CN8A 4OPIA 2B9YA 3SFDA 4ICYA 4A7AA 1FECA 4U2SA 2C72A 1KNRA 2WPCA 3KPKA 3AE7A 3DA1A 4EQRA 3AEFA 2WP9A 4FX9A 1D7YA 2GH5A 3LB8A 2ACZA 3CPIG 4YTNA 4H2QA 4HB9A 2X8GA 5EOWA 4J31A 3F8PA 2FJBA 2C75A 1XPQA 2ZZBA 3DK9A 3CTYA 3KU9A 1O5WA 1JRYA 3SY4A 3CNDA 1LTXR 2YR6A 3AEEA 4II3A 2C4CA 2GR0A 2BA9A 2XYOA 2XFPA 1CJ4A 2XCGA 4H4ZA 4CBQA 1P2EA 3DGZA 1PXAA 3AECA 2VQBA 3BHFA 3F8DA 3SZWA 4AOSA 4BJZA 2WHDA 3CMMA 1LQTA 2YG5A 1H81A 1BGNA 2A89A 4A9WA 5KMSA 2Z5XA 1EBDA 2YM2A 3UKKA 3CGCA 5IQ1A 3P4SA 1GT8A 4OVIA 1CC6A 1H83A 1PBFA 3NKSA 1PN0A 4HA6A 3SZCA 4YSXA 4OPDA 2GR2A 2Z5YA 4G74A 4C3YA 1E1NA 4YXDA 2GQWA 1E1MA 2WESA 1B8SA 1LPFA 2V3AA 4TM0A 2BK5A 3D1CA 1GOSA 4A5LA 3LZWA 4UDQA 4EMIA 1PHHA 1F8WA 1BGJA 1S2QA 3DJEA 3AE6A 2WS3A 3ADAB 3G5QA 4AP3A 2QCUA 2R9ZA 1L9CA 3FBSA 1H6VA 3AXBA 2XLPA 4U8JA 1PBBA 2WBAA 4IVOB 3D8XA 4NEWA 2RGOA 2WDQA 1H86A 1GTEA 3OZ2A 1JRZA 3HYVA 1DODA 1N4UA 1TDNA 3WE0A 3ALMA 3NG7X 5EB4A 3AEAA 1FEBA 5JCMA 4UDRA 2B7RA 4GAPA 5EB5A 3P4RA 1Q9IA 4H2NA 5KOXA 1EL9A 2XLTA 2CVJA 1UKVG 1SEZA 2X8CA 1N4VA 3Q9TA 4UDPA 4CY6A 1YQ4A 4H7UA 4E0VA 4GDEA 1YQ3A 3EF6A 4Z26A 4A79A 1GALA 3V3OA 2B9XA 2WDRA 4YWOA 4B67A 4A6NA 4Z2UA 3CGEA 1KFYA 2QA2A 4TLZA 1K4QA 4YTMA 3VRBA 1IUXA 2YG7A 1D4CA 2CFYA 5KMRA 1HYUA 2XFUA 3L1RA 1NG3A 3QFBA 4JNAA 2WU2A 5CKUA 1TDOA 3HYXA 2HQMA 2ZZCA 2C3DA 4JDRA 3UKHA 3QVPA 1TYTA 1TDKA 3AEBA 1RP0A 2BS2A 1PXCA 1JNRA 1D5TA 1W4XA 5J60A 4Y4NA 5LV9A 3P1WA 4C74A 3UKLA 3GD4A 1PJ7A 4OPCA 3H8IA 3VR9A 3T14A 5KMPA 3GMCA 1OJCA 3ICSA 4IA6A 3CNJA 4Z25A 1NHRA 2R4JA 3UTHA 3ITJA 3QSMA 4OPGA 1CL0A 4P9SA 3RP8A 1FEAA 2UZZA 2YLSA 1H7XA 3T37A 4C3XA 3V76A 2RGJA 3REDA 2OA1A 3GRTA 1NHQA 2GR1A 4OPLA 2WOVA 2X8HA 3COXA 4TM3A 4IVMB 1GPEA 4I59A 5BUKA 3II4A 4JY3A 3UOYA 1TYPA 3JSKA 4EIQA 2XLSA 2Y6RA 1DXLA 1TRBA 2GV8A 4H4UA 2ZZ0A 4FK1A 2JB2A 3DJGX 1LJ1A 4EMJA 2YVJA 3GDPA 1ZDLA 1ZP0A 3DH9A 3LZXA 4YSYA 2BABA 2J3NA 5C2TA 2C7GA 1B5QA 3B3RA 3BI2A 5U1OA 3KA7A 1NG4A 4B64A 1O94A 3KD9A 4B65A 4MJWA 4TM4A 1GRTA 3VRDB 3SYIA 1JRXA 3VR8A 1D4DA 2WOWA 4Y4LA 1BF3A 4O5QA 1IJHA 2IVDA 2I0ZA 3AE8A 2BS4A 2FJDA 2NVKX 4KPRA 4GAVA 2C64A 1F8RA 4Z43A 2YLRA 3BNUA 5JCNA 2BXSA 2DKIA 2YQUA 5U25A 2E1MA 3S5WA 3CPHG 2TMDA 4OPUA 4J57A 2R0GA 5BULA 3K7QX 1Y56A 2C73A 4Y4MA 4M52A 4NZHA 4Z2RA 3R9UA 2ZBWA 4I58A 1IUUA 2WP5A 1KDGA 2EQ7A 2V6OA 4DGKA 4EQWA 4H4SA 3SX6A 1DOBA 1Y0PA 4J2WA 1Z6LA 3ALJA 4H50A 3UOXA 3ICTA 5HY5A 1XANA 3K7MX 3K30A 3CNTA 4EQXA 5KOWA 4H4WA 4B69A 1QJDA 4ZCCA 1CC4A 2Q0LA 4A6NB 2FBWA 4J34A 1E7PA 1IUSA 5IPYA 2XVHA 3EAOA 1L9DA 5GRTA 4EQSA 4Z24A 4B63A 1PBCA 4AOXA 1IUWA 4AT0A 5U63A 2YLTA 1GTHA 2EQ9A 2YVFA 2GB0A 2NPXA 3K7TA 3NN6X 4X4JA 1Q1RA 3GSIA 3E1TA 4J33A 3H4KA 3AE5A 4FK1C 3DK4A 3ATQA 4GDPA 3QJ4A 4U8KA 4U8IA 1S3BA 4U8LA 5JCKA 1NENA 2Q7VA 4K5SA 2Q0KA 4B68A 4CNKA 2FJEA 3GD3A 4OPTA 3VRAA 1ZOVA 3G5RA 1K0JA 3GYJA 2AQJA 2E5VA 4USQA 3SFEA 2BC0A 1KSSA 5FMHA 4YSZA 4ZCDA 3AWIA 1H84A 4H4YA 4BURA 3NK2X 1COYA 3RHAA 2YR5A 5HYMA 2VQ7A 4BK1A 4G9KA 4K2XA 1ZMCA 4IV9A 3FIMB 4YT0A 2H89A 3AYIA 3ICRA 3EANA 2WU5A 5EBKA 1PJ5A 2XVFA 2A8XA 2TPRA 2BACA 5KNLA 3CIRA 4NNJA 1E39A 3T0KA 4X9MA 4BK3A 1ONFA 1VG0A 3BI5A 3NYCA 2A87A 4NTDA 3NRNA 4H4XA 2GEWA 3C4NA 3GDNA 4JNQA 3LJPA 3UTEA 3ZYXA 2VZ2A 2AR8A 4YKFA 1ZMDA 2C66A 4RG3A 3IWAA 5KVIA 1ZY8A 4N9XA 1EL8A 4B1BA 1MO9A 3AB1A 4A65A 3IC9A 2FJAA 1M6IA 1NEKA 3T2YA 1BWCA 4O5UA 1YY5A 3NK1X 2YVGA 1OJTA 3C96A 1CJCA 3DK8A 1Q1WA 4WCTA 1F8SA 3CGDA 3CGBA 3LADA 2VRLA 3NN0X 4H4RA 2YLXA 2CULA 3M0OA 4REKA 2BCGG 5KWFA 1H82A 1LVLA 2GF3A 2OLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GET A;  4CY8 A;  1DJN A;  3RP7 A;  5M10 A;  1VG9 A;  1DNC A;  4APN A;  1PDH A;  4K5R A;  1DOC A;  1OJA A;  1Y56 B;  4X9N A;  4KX6 A;  1JNZ A;  4U8O A;  1DOE A;  4DNA A;  3FMW A;  4H2R A;  4H4T A;  4NTC A;  2PYX A;  3M12 A;  4H4P A;  1OJD A;  3UKP A;  3URH A;  4D04 A;  1X31 B;  2F5Z A;  2JAE A;  2QA1 A;  3ATR A;  3KPF A;  3BNM A;  1JU2 A;  2IVE A;  2OAL A;  3NIX A;  3NTD A;  3RNM A;  4LII A;  3SM8 A;  1D7L A;  3AE4 A;  4YKG A;  1V59 A;  5FS6 A;  4BK2 A;  3QSE A;  4U8N A;  2VOU A;  1LQU A;  4B66 A;  1GRA A;  2CDU A;  3NH3 X;  2YLW A;  1GES A;  4U2T A;  2YG6 A;  4U8P A;  3GMB A;  4Z2T A;  3NTA A;  2QAE A;  3KLJ A;  4PAA A;  1DJQ A;  4DSG A;  3AE3 A;  3UCL A;  1YQZ A;  2YG3 A;  1GXF A;  2C76 A;  1QO8 A;  3NYF A;  2E4G A;  2Y6Q A;  1YKJ A;  1GER A;  4IA5 A;  2VVM A;  2PHH A;  3NK0 X;  3NT6 A;  2YR4 A;  2VRM A;  3VQR A;  1RYI A;  2OAM A;  3SGL A;  1OJ9 A;  3NNE A;  2GR3 A;  2YM1 A;  5ER0 A;  4AP1 A;  1LV0 A;  1IUV A;  4CRT A;  5DBJ A;  1BZL A;  2XVE A;  1L0V A;  5BVA A;  1EL5 A;  4JQ9 A;  4WX1 A;  5IQ4 A;  2WEU A;  2YWL A;  3CPJ G;  2V5Z A;  3EPT A;  1QLB A;  2BCP A;  2BK4 A;  1GRB A;  1F3P A;  1GV4 A;  4BJY A;  3UP4 A;  4AT2 A;  2GAH B;  2O9Z A;  1NAA A;  1KF6 A;  3M13 A;  2IID A;  2R45 A;  3O0H A;  4H2P A;  4NTE A;  1CC2 A;  1GRE A;  2WPF A;  3AD7 B;  3DGH A;  3P4Q A;  4XXG A;  4CCQ A;  3L8K A;  1GND A;  2Q6U A;  2WPE A;  3KKJ A;  4EMW A;  3AE2 A;  4D03 A;  5BRT A;  2R0C A;  2VVL G;  3G5S A;  1N4W A;  1EL7 A;  2GMH A;  2JK6 A;  3NYE A;  1VQW A;  4EM3 A;  1NHP A;  1ELI A;  2H88 A;  5M0Z A;  3SQP A;  3UKF A;  1VDC A;  2GQF A;  3PS9 A;  1RSG A;  2V60 A;  3KVE A;  4JY2 A;  4USR A;  5FS8 A;  2ARD A;  5C3J A;  4NEV A;  4JN9 A;  2GMJ A;  1KNP A;  1E1L A;  2JB3 A;  1CBO A;  1E1K A;  2WET A;  1GEU A;  2XLR A;  2XLU A;  3AED A;  3ALL A;  5KVH A;  3P4P A;  2BYB A;  3BI4 A;  1P2H A;  4U2L A;  2B76 A;  3UKA A;  1TDE A;  2BK3 A;  1GRG A;  2W0H A;  3UTF A;  2BC1 A;  1PBD A;  3V3N A;  1JOA A;  1GRH A;  1KSU A;  2R0P A;  3IHM A;  2WQY A;  3LXD A;  1TDF A;  4K8D A;  3RP6 A;  2XFO A;  3UOZ A;  2DKH A;  4J36 A;  1PJ6 A;  2JKC A;  2GRT A;  4XWZ A;  5GSN A;  5JCL A;  4RG4 A;  1FCD A;  1N1P A;  2GVC A;  4PAB A;  2V3B A;  1ZK7 A;  3AEG A;  3UP5 A;  4H4V A;  4C5O A;  1F6M A;  5FS7 A;  2XVJ A;  1K0I A;  3OC4 A;  2WDV A;  4ADW A;  5HXI A;  2OLO A;  4H4Q A;  4UP3 A;  3PO7 A;  2C70 A;  4GUV A;  5L46 A;  2X3N A;  4ZN0 A;  2RAB A;  1H7W A;  4U8M A;  4BV6 A;  2V61 A;  3Q6J A;  4A99 A;  2C3C A;  3I6D A;  4GRT A;  4C77 A;  1CHU A;  4CCR A;  4CNJ A;  3UTG A;  1XDI A;  4K22 A;  5J7X A;  4ECH A;  1B37 A;  1K0L A;  2JB1 A;  5JCI A;  2JBV A;  2R4E A;  3QFA A;  3UKQ A;  2VVL A;  3ABV A;  1S2Y A;  1JEH A;  2YG4 A;  3NHO X;  1XHC A;  1PXB A;  1MOK A;  3AD8 B;  3C4A A;  1CJ3 A;  2YLZ A;  4DSH A;  4FDC B;  3B6D A;  3ISH A;  2X50 A;  1L9E A;  2RGH A;  5FS9 A;  4YSH A;  3FG2 P;  3PVC A;  3F8R A;  1FL2 A;  4EIP A;  1E6E A;  3NGC X;  1VRQ B;  2GAG B;  2WP6 A;  3HZL A;  3GYI A;  3IHG A;  5KXJ A;  3AYJ A;  1CJ2 A;  2EQ8 A;  3P9U A;  2BXR A;  3AE9 A;  1O95 A;  2X99 A;  4K7Z A;  5KRQ A;  2R46 A;  3IF9 A;  1B4V A;  4OCG A;  5CQF A;  2WOI A;  2XDO A;  5TR3 A;  1NPX A;  3UOV A;  1REO A;  4LA1 A;  1NHS A;  2B7S A;  4RSL A;  5HHF A;  1CF3 A;  1MXT A;  1ZKQ A;  3QSS A;  3GRS A;  1ZOY A;  3AYL A;  4YTP A;  3BHK A;  1S3E A;  4GR1 A;  4LU6 A;  1GRF A;  3AD9 B;  1ZX9 A;  3DME A;  4Z44 A;  3NLC A;  3LOV A;  3GWD A;  3H8L A;  2C67 A;  4XWR A;  2XFN A;  1FOH A;  1M64 A;  1PBE A;  2YAU A;  3I3L A;  2XFQ A;  4J56 A;  4TM1 A;  2AAQ A;  2BS3 A;  2B9W A;  3DJD A;  3DJJ A;  1PS9 A;  3AE1 A;  4GF7 A;  1GSN A;  3QVR A;  4EM4 A;  1D4E A;  3CNS A;  3FPZ A;  2EQ6 A;  3ZDN A;  4GCM A;  2XVI A;  1BKW A;  1NDA A;  2C65 A;  1IUT A;  4TLX A;  1AOG A;  3CNP A;  2APG A;  3GWF A;  3S61 A;  3CN8 A;  4OPI A;  2B9Y A;  3SFD A;  4ICY A;  4A7A A;  1FEC A;  4U2S A;  2C72 A;  1KNR A;  2WPC A;  3AE7 A;  3DA1 A;  4EQR A;  3AEF A;  2WP9 A;  4FX9 A;  1D7Y A;  2GH5 A;  3LB8 A;  2ACZ A;  3CPI G;  4H2Q A;  4HB9 A;  2X8G A;  5EOW A;  4J31 A;  3F8P A;  2FJB A;  2C75 A;  1XPQ A;  2ZZB A;  3DK9 A;  3CTY A;  3KU9 A;  1O5W A;  1JRY A;  3CND A;  1LTX R;  2YR6 A;  3AEE A;  2GR0 A;  2BA9 A;  2XYO A;  2XFP A;  1CJ4 A;  2XCG A;  4H4Z A;  4CBQ A;  1P2E A;  3DGZ A;  1PXA A;  3AEC A;  2VQB A;  3BHF A;  3F8D A;  4BJZ A;  4AOS A;  2WHD A;  1LQT A;  2YG5 A;  1H81 A;  1BGN A;  2A89 A;  4A9W A;  2Z5X A;  1EBD A;  2YM2 A;  3UKK A;  3CGC A;  5IQ1 A;  3P4S A;  1GT8 A;  4OVI A;  1CC6 A;  1H83 A;  1PBF A;  3NKS A;  1PN0 A;  4HA6 A;  4YSX A;  4OPD A;  2GR2 A;  2Z5Y A;  4C3Y A;  1E1N A;  4YXD A;  2GQW A;  1E1M A;  2WES A;  1B8S A;  1LPF A;  2V3A A;  4TM0 A;  2BK5 A;  3D1C A;  1GOS A;  4A5L A;  3LZW A;  4UDQ A;  4EMI A;  1PHH A;  1F8W A;  1BGJ A;  1S2Q A;  3DJE A;  3AE6 A;  2WS3 A;  3ADA B;  3G5Q A;  4AP3 A;  2QCU A;  2R9Z A;  1L9C A;  3FBS A;  1H6V A;  3AXB A;  2XLP A;  4U8J A;  1PBB A;  2WBA A;  4IVO B;  3D8X A;  4NEW A;  2RGO A;  2WDQ A;  1H86 A;  1GTE A;  3OZ2 A;  1JRZ A;  3WE0 A;  1DOD A;  1N4U A;  1TDN A;  4YTN A;  3ALM A;  3NG7 X;  5EB4 A;  3AEA A;  1FEB A;  5JCM A;  4UDR A;  2B7R A;  5EB5 A;  3P4R A;  1Q9I A;  4H2N A;  5KOX A;  1EL9 A;  2XLT A;  2CVJ A;  1UKV G;  1SEZ A;  2X8C A;  1N4V A;  3Q9T A;  4UDP A;  4CY6 A;  1YQ4 A;  4H7U A;  4E0V A;  4GDE A;  1YQ3 A;  3EF6 A;  4Z26 A;  4A79 A;  1GAL A;  3V3O A;  2B9X A;  2WDR A;  4YWO A;  4B67 A;  4A6N A;  4Z2U A;  3CGE A;  1KFY A;  2QA2 A;  4TLZ A;  1K4Q A;  4YTM A;  3VRB A;  1IUX A;  2YG7 A;  1D4C A;  2CFY A;  1HYU A;  2XFU A;  3L1R A;  1NG3 A;  3QFB A;  4JNA A;  2WU2 A;  5CKU A;  1TDO A;  2HQM A;  2ZZC A;  2C3D A;  4JDR A;  3UKH A;  3QVP A;  1TYT A;  1TDK A;  3AEB A;  1RP0 A;  2BS2 A;  1PXC A;  1JNR A;  1D5T A;  1W4X A;  5J60 A;  4Y4N A;  5LV9 A;  3P1W A;  4C74 A;  3UKL A;  3GD4 A;  1PJ7 A;  4OPC A;  3H8I A;  3VR9 A;  3GMC A;  1OJC A;  3ICS A;  4IA6 A;  3CNJ A;  4Z25 A;  1NHR A;  2R4J A;  3UTH A;  3ITJ A;  3QSM A;  4OPG A;  1CL0 A;  4P9S A;  3RP8 A;  1FEA A;  2UZZ A;  2YLS A;  1H7X A;  3T37 A;  4C3X A;  3V76 A;  2RGJ A;  3RED A;  2OA1 A;  3GRT A;  1NHQ A;  2GR1 A;  4OPL A;  2WOV A;  2X8H A;  3COX A;  4TM3 A;  4IVM B;  1GPE A;  4I59 A;  5BUK A;  3II4 A;  4JY3 A;  3UOY A;  1TYP A;  3JSK A;  4EIQ A;  2XLS A;  2Y6R A;  1DXL A;  1TRB A;  2GV8 A;  4H4U A;  2ZZ0 A;  4FK1 A;  2JB2 A;  3DJG X;  1LJ1 A;  4EMJ A;  2YVJ A;  3GDP A;  1ZDL A;  1ZP0 A;  3DH9 A;  3LZX A;  4YSY A;  2BAB A;  2J3N A;  5C2T A;  2C7G A;  1B5Q A;  3B3R A;  3BI2 A;  5U1O A;  3KA7 A;  1NG4 A;  4B64 A;  1O94 A;  3KD9 A;  4B65 A;  4MJW A;  4TM4 A;  1GRT A;  3VRD B;  1JRX A;  3VR8 A;  1D4D A;  2WOW A;  4Y4L A;  1BF3 A;  4O5Q A;  1IJH A;  2IVD A;  2I0Z A;  3AE8 A;  2BS4 A;  2FJD A;  2NVK X;  4KPR A;  2C64 A;  1F8R A;  4Z43 A;  2YLR A;  3BNU A;  5JCN A;  2BXS A;  2DKI A;  2YQU A;  5U25 A;  2E1M A;  3S5W A;  3CPH G;  2TMD A;  4OPU A;  4J57 A;  2R0G A;  5BUL A;  3K7Q X;  1Y56 A;  2C73 A;  4Y4M A;  4M52 A;  4NZH A;  4Z2R A;  3R9U A;  2ZBW A;  4I58 A;  1IUU A;  2WP5 A;  1KDG A;  2EQ7 A;  2V6O A;  4DGK A;  4EQW A;  4H4S A;  1DOB A;  1Y0P A;  4J2W A;  1Z6L A;  3ALJ A;  4H50 A;  3UOX A;  3ICT A;  5HY5 A;  1XAN A;  3K7M X;  3K30 A;  3CNT A;  4EQX A;  5KOW A;  4H4W A;  4B69 A;  1QJD A;  4ZCC A;  1CC4 A;  2Q0L A;  4A6N B;  2FBW A;  4J34 A;  1E7P A;  1IUS A;  5IPY A;  2XVH A;  3EAO A;  1L9D A;  5GRT A;  4EQS A;  4Z24 A;  4B63 A;  1PBC A;  4AOX A;  1IUW A;  4AT0 A;  5U63 A;  2YLT A;  1GTH A;  2EQ9 A;  2YVF A;  2GB0 A;  2NPX A;  3K7T A;  3NN6 X;  4X4J A;  1Q1R A;  3GSI A;  3E1T A;  4J33 A;  3H4K A;  3AE5 A;  4FK1 C;  3DK4 A;  3ATQ A;  4GDP A;  3QJ4 A;  4U8K A;  4U8I A;  1S3B A;  4U8L A;  5JCK A;  1NEN A;  2Q7V A;  4K5S A;  2Q0K A;  4B68 A;  4CNK A;  2FJE A;  3GD3 A;  4OPT A;  3VRA A;  1ZOV A;  3G5R A;  1K0J A;  3GYJ A;  2AQJ A;  2E5V A;  4USQ A;  3SFE A;  2BC0 A;  1KSS A;  5FMH A;  4YSZ A;  4ZCD A;  3AWI A;  1H84 A;  4H4Y A;  4BUR A;  3NK2 X;  1COY A;  3RHA A;  2YR5 A;  5HYM A;  2VQ7 A;  4BK1 A;  4K2X A;  1ZMC A;  4IV9 A;  3FIM B;  4YT0 A;  2H89 A;  3AYI A;  3ICR A;  3EAN A;  2WU5 A;  5EBK A;  1PJ5 A;  2XVF A;  2A8X A;  2TPR A;  2BAC A;  3CIR A;  1E39 A;  4X9M A;  4BK3 A;  1ONF A;  1VG0 A;  3BI5 A;  3NYC A;  2A87 A;  4NTD A;  3NRN A;  4H4X A;  2GEW A;  3C4N A;  3GDN A;  4JNQ A;  3LJP A;  3UTE A;  3ZYX A;  2VZ2 A;  2AR8 A;  4YKF A;  1ZMD A;  2C66 A;  4RG3 A;  3IWA A;  5KVI A;  1ZY8 A;  4N9X A;  1EL8 A;  4B1B A;  1MO9 A;  3AB1 A;  4A65 A;  3IC9 A;  2FJA A;  1M6I A;  1NEK A;  1BWC A;  4O5U A;  1YY5 A;  3NK1 X;  2YVG A;  1OJT A;  3C96 A;  1CJC A;  3DK8 A;  1Q1W A;  4WCT A;  1F8S A;  3CGD A;  3CGB A;  3LAD A;  2VRL A;  3NN0 X;  4H4R A;  2YLX A;  2CUL A;  3M0O A;  4REK A;  2BCG G;  5KWF A;  1H82 A;  1LVL A;  2GF3 A;  2OLN A; 
#chains in the Genus database with same CATH topology
 1GET A;  4CY8 A;  1DJN A;  3RP7 A;  5M10 A;  1VG9 A;  1DNC A;  4APN A;  1PDH A;  4K5R A;  1DOC A;  1OJA A;  1Y56 B;  4X9N A;  4KX6 A;  1JNZ A;  4U8O A;  1DOE A;  4DNA A;  5KMQ A;  3FMW A;  4H2R A;  4H4T A;  4NTC A;  2PYX A;  3M12 A;  4H4P A;  1OJD A;  3UKP A;  3URH A;  4D04 A;  1X31 B;  2F5Z A;  2JAE A;  2QA1 A;  3ATR A;  3KPF A;  3BNM A;  1JU2 A;  2IVE A;  2OAL A;  3NIX A;  3NTD A;  3RNM A;  4LII A;  3SM8 A;  1D7L A;  3AE4 A;  4YKG A;  1V59 A;  5FS6 A;  4BK2 A;  3QSE A;  4U8N A;  2VOU A;  1LQU A;  4B66 A;  1GRA A;  2CDU A;  3NH3 X;  2YLW A;  1GES A;  4U2T A;  2YG6 A;  4U8P A;  3GMB A;  4Z2T A;  3NTA A;  2QAE A;  3KLJ A;  4PAA A;  1DJQ A;  4DSG A;  3AE3 A;  3UCL A;  1YQZ A;  2YG3 A;  1GXF A;  2C76 A;  1QO8 A;  3NYF A;  2E4G A;  2Y6Q A;  1YKJ A;  1GER A;  4IA5 A;  2VVM A;  2PHH A;  3NK0 X;  3NT6 A;  2YR4 A;  2VRM A;  3VQR A;  1RYI A;  2OAM A;  3SGL A;  1OJ9 A;  3NNE A;  2GR3 A;  2YM1 A;  5ER0 A;  4AP1 A;  1LV0 A;  1IUV A;  4CRT A;  5DBJ A;  1BZL A;  2XVE A;  1L0V A;  5BVA A;  1EL5 A;  4JQ9 A;  4WX1 A;  5IQ4 A;  2WEU A;  2YWL A;  3CPJ G;  2V5Z A;  3EPT A;  1QLB A;  2BCP A;  2BK4 A;  4G73 A;  1GRB A;  1F3P A;  1GV4 A;  4BJY A;  3UP4 A;  4AT2 A;  2GAH B;  2O9Z A;  1NAA A;  1KF6 A;  3M13 A;  2IID A;  2R45 A;  3O0H A;  4H2P A;  4NTE A;  1CC2 A;  1GRE A;  2WPF A;  3AD7 B;  3DGH A;  3P4Q A;  4XXG A;  4CCQ A;  3L8K A;  1GND A;  2Q6U A;  2WPE A;  3KKJ A;  3SZ0 A;  3AE2 A;  4D03 A;  4G6H A;  4EMW A;  5BRT A;  2R0C A;  2VVL G;  3G5S A;  1N4W A;  1EL7 A;  2GMH A;  2JK6 A;  3NYE A;  1VQW A;  4EM3 A;  1NHP A;  1ELI A;  2H88 A;  5M0Z A;  3SQP A;  3UKF A;  1VDC A;  2BRY A;  2GQF A;  3PS9 A;  1RSG A;  2V60 A;  3KVE A;  4JY2 A;  4USR A;  5FS8 A;  2ARD A;  5C3J A;  4NEV A;  4JN9 A;  2GMJ A;  1KNP A;  1E1L A;  2JB3 A;  1CBO A;  1E1K A;  2WET A;  1GEU A;  2XLR A;  2XLU A;  3AED A;  3ALL A;  5KVH A;  3HYW A;  2BYB A;  3P4P A;  3BI4 A;  1P2H A;  4U2L A;  2B76 A;  3UKA A;  1TDE A;  2BK3 A;  1GRG A;  2W0H A;  3UTF A;  2BC1 A;  1PBD A;  3V3N A;  1JOA A;  1GRH A;  1KSU A;  2R0P A;  3IHM A;  2WQY A;  3LXD A;  1TDF A;  4K8D A;  3RP6 A;  2XFO A;  3UOZ A;  2DKH A;  4J36 A;  1PJ6 A;  2JKC A;  2GRT A;  4XWZ A;  5GSN A;  5JCL A;  4RG4 A;  1FCD A;  1N1P A;  2GVC A;  3SZF A;  4II2 A;  4PAB A;  2V3B A;  1ZK7 A;  3AEG A;  3UP5 A;  4H4V A;  4C5O A;  1F6M A;  5FS7 A;  2XVJ A;  1K0I A;  3OC4 A;  2WDV A;  4ADW A;  5HXI A;  2OLO A;  4H4Q A;  4UP3 A;  3PO7 A;  2C70 A;  4GUV A;  5L46 A;  2X3N A;  4ZN0 A;  2RAB A;  1H7W A;  4U8M A;  4BV6 A;  2V61 A;  3Q6J A;  4A99 A;  2C3C A;  3I6D A;  4GRT A;  4C77 A;  1CHU A;  4CCR A;  4CNJ A;  3UTG A;  1XDI A;  4K22 A;  5J7X A;  4ECH A;  1B37 A;  1K0L A;  2JB1 A;  5JCI A;  2JBV A;  2R4E A;  3QFA A;  3UKQ A;  2VVL A;  3ABV A;  1S2Y A;  1JEH A;  2YG4 A;  3NHO X;  1XHC A;  4G6G A;  1PXB A;  1MOK A;  3AD8 B;  3C4A A;  1CJ3 A;  2YLZ A;  4DSH A;  4FDC B;  3B6D A;  3ISH A;  2X50 A;  1L9E A;  2RGH A;  5FS9 A;  4YSH A;  3FG2 P;  3PVC A;  3F8R A;  1FL2 A;  4EIP A;  1E6E A;  3NGC X;  1VRQ B;  2GAG B;  2WP6 A;  3HZL A;  3GYI A;  3IHG A;  5KXJ A;  3AYJ A;  1CJ2 A;  2EQ8 A;  3P9U A;  2BXR A;  3AE9 A;  3T2K A;  1O95 A;  2X99 A;  3GYX A;  4K7Z A;  5KRQ A;  2R46 A;  3IF9 A;  1B4V A;  4OCG A;  5CQF A;  2BRA A;  2WOI A;  2XDO A;  1NPX A;  5TR3 A;  3UOV A;  1REO A;  4LA1 A;  1NHS A;  2B7S A;  4RSL A;  5HHF A;  4NWZ A;  1CF3 A;  1MXT A;  1ZKQ A;  3QSS A;  3GRS A;  1ZOY A;  3AYL A;  4YTP A;  3BHK A;  1S3E A;  4GR1 A;  4LU6 A;  1GRF A;  3AD9 B;  1ZX9 A;  3T2Z A;  3DME A;  4Z44 A;  3NLC A;  3LOV A;  3GWD A;  3H8L A;  2C67 A;  3SXI A;  4XWR A;  2XFN A;  1FOH A;  1M64 A;  1PBE A;  2YAU A;  3I3L A;  2XFQ A;  4J56 A;  4TM1 A;  3T31 A;  2AAQ A;  2BS3 A;  2B9W A;  3DJD A;  3DJJ A;  1PS9 A;  3AE1 A;  4GF7 A;  1GSN A;  3QVR A;  4EM4 A;  1D4E A;  3CNS A;  3FPZ A;  2EQ6 A;  3ZDN A;  4GCM A;  2XVI A;  1BKW A;  1NDA A;  2C65 A;  1IUT A;  4TLX A;  1AOG A;  3CNP A;  2APG A;  3GWF A;  3S61 A;  3CN8 A;  4OPI A;  2B9Y A;  3SFD A;  4ICY A;  4A7A A;  1FEC A;  4U2S A;  2C72 A;  1KNR A;  2WPC A;  3KPK A;  3AE7 A;  3DA1 A;  4EQR A;  3AEF A;  2WP9 A;  4FX9 A;  1D7Y A;  2GH5 A;  3LB8 A;  2ACZ A;  3CPI G;  4YTN A;  4H2Q A;  4HB9 A;  2X8G A;  5EOW A;  4J31 A;  3F8P A;  2FJB A;  2C75 A;  1XPQ A;  2ZZB A;  3DK9 A;  3CTY A;  3KU9 A;  1O5W A;  1JRY A;  3SY4 A;  3CND A;  1LTX R;  2YR6 A;  3AEE A;  4II3 A;  2C4C A;  2GR0 A;  2BA9 A;  2XYO A;  2XFP A;  1CJ4 A;  2XCG A;  4H4Z A;  4CBQ A;  1P2E A;  3DGZ A;  1PXA A;  3AEC A;  2VQB A;  3BHF A;  3F8D A;  3SZW A;  4AOS A;  4BJZ A;  2WHD A;  3CMM A;  1LQT A;  2YG5 A;  1H81 A;  1BGN A;  2A89 A;  4A9W A;  5KMS A;  2Z5X A;  1EBD A;  2YM2 A;  3UKK A;  3CGC A;  5IQ1 A;  3P4S A;  1GT8 A;  4OVI A;  1CC6 A;  1H83 A;  1PBF A;  3NKS A;  1PN0 A;  4HA6 A;  3SZC A;  4YSX A;  4OPD A;  2GR2 A;  2Z5Y A;  4G74 A;  4C3Y A;  1E1N A;  4YXD A;  2GQW A;  1E1M A;  2WES A;  1B8S A;  1LPF A;  2V3A A;  4TM0 A;  2BK5 A;  3D1C A;  1GOS A;  4A5L A;  3LZW A;  4UDQ A;  4EMI A;  1PHH A;  1F8W A;  1BGJ A;  1S2Q A;  3DJE A;  3AE6 A;  2WS3 A;  3ADA B;  3G5Q A;  4AP3 A;  2QCU A;  2R9Z A;  1L9C A;  3FBS A;  1H6V A;  3AXB A;  2XLP A;  4U8J A;  1PBB A;  2WBA A;  4IVO B;  3D8X A;  4NEW A;  2RGO A;  2WDQ A;  1H86 A;  1GTE A;  3OZ2 A;  1JRZ A;  3HYV A;  1DOD A;  1N4U A;  1TDN A;  3WE0 A;  3ALM A;  3NG7 X;  5EB4 A;  3AEA A;  1FEB A;  5JCM A;  4UDR A;  2B7R A;  4GAP A;  5EB5 A;  3P4R A;  1Q9I A;  4H2N A;  5KOX A;  1EL9 A;  2XLT A;  2CVJ A;  1UKV G;  1SEZ A;  2X8C A;  1N4V A;  3Q9T A;  4UDP A;  4CY6 A;  1YQ4 A;  4H7U A;  4E0V A;  4GDE A;  1YQ3 A;  3EF6 A;  4Z26 A;  4A79 A;  1GAL A;  3V3O A;  2B9X A;  2WDR A;  4YWO A;  4B67 A;  4A6N A;  4Z2U A;  3CGE A;  1KFY A;  2QA2 A;  4TLZ A;  1K4Q A;  4YTM A;  3VRB A;  1IUX A;  2YG7 A;  1D4C A;  2CFY A;  5KMR A;  1HYU A;  2XFU A;  3L1R A;  1NG3 A;  3QFB A;  4JNA A;  2WU2 A;  5CKU A;  1TDO A;  3HYX A;  2HQM A;  2ZZC A;  2C3D A;  4JDR A;  3UKH A;  3QVP A;  1TYT A;  1TDK A;  3AEB A;  1RP0 A;  2BS2 A;  1PXC A;  1JNR A;  1D5T A;  1W4X A;  5J60 A;  4Y4N A;  5LV9 A;  3P1W A;  4C74 A;  3UKL A;  3GD4 A;  1PJ7 A;  4OPC A;  3H8I A;  3VR9 A;  3T14 A;  5KMP A;  3GMC A;  1OJC A;  3ICS A;  4IA6 A;  3CNJ A;  4Z25 A;  1NHR A;  2R4J A;  3UTH A;  3ITJ A;  3QSM A;  4OPG A;  1CL0 A;  4P9S A;  3RP8 A;  1FEA A;  2UZZ A;  2YLS A;  1H7X A;  3T37 A;  4C3X A;  3V76 A;  2RGJ A;  3RED A;  2OA1 A;  3GRT A;  1NHQ A;  2GR1 A;  4OPL A;  2WOV A;  2X8H A;  3COX A;  4TM3 A;  4IVM B;  1GPE A;  4I59 A;  5BUK A;  3II4 A;  4JY3 A;  3UOY A;  1TYP A;  3JSK A;  4EIQ A;  2XLS A;  2Y6R A;  1DXL A;  1TRB A;  2GV8 A;  4H4U A;  2ZZ0 A;  4FK1 A;  2JB2 A;  3DJG X;  1LJ1 A;  4EMJ A;  2YVJ A;  3GDP A;  1ZDL A;  1ZP0 A;  3DH9 A;  3LZX A;  4YSY A;  2BAB A;  2J3N A;  5C2T A;  2C7G A;  1B5Q A;  3B3R A;  3BI2 A;  5U1O A;  3KA7 A;  1NG4 A;  4B64 A;  1O94 A;  3KD9 A;  4B65 A;  4MJW A;  4TM4 A;  1GRT A;  3VRD B;  3SYI A;  1JRX A;  3VR8 A;  1D4D A;  2WOW A;  4Y4L A;  1BF3 A;  4O5Q A;  1IJH A;  2IVD A;  2I0Z A;  3AE8 A;  2BS4 A;  2FJD A;  2NVK X;  4KPR A;  4GAV A;  2C64 A;  1F8R A;  4Z43 A;  2YLR A;  3BNU A;  5JCN A;  2BXS A;  2DKI A;  2YQU A;  5U25 A;  2E1M A;  3S5W A;  3CPH G;  2TMD A;  4OPU A;  4J57 A;  2R0G A;  5BUL A;  3K7Q X;  1Y56 A;  2C73 A;  4Y4M A;  4M52 A;  4NZH A;  4Z2R A;  3R9U A;  2ZBW A;  4I58 A;  1IUU A;  2WP5 A;  1KDG A;  2EQ7 A;  2V6O A;  4DGK A;  4EQW A;  4H4S A;  3SX6 A;  1DOB A;  1Y0P A;  4J2W A;  1Z6L A;  3ALJ A;  4H50 A;  3UOX A;  3ICT A;  5HY5 A;  1XAN A;  3K7M X;  3K30 A;  3CNT A;  4EQX A;  5KOW A;  4H4W A;  4B69 A;  1QJD A;  4ZCC A;  1CC4 A;  2Q0L A;  4A6N B;  2FBW A;  4J34 A;  1E7P A;  1IUS A;  5IPY A;  2XVH A;  3EAO A;  1L9D A;  5GRT A;  4EQS A;  4Z24 A;  4B63 A;  1PBC A;  4AOX A;  1IUW A;  4AT0 A;  5U63 A;  2YLT A;  1GTH A;  2EQ9 A;  2YVF A;  2GB0 A;  2NPX A;  3K7T A;  3NN6 X;  4X4J A;  1Q1R A;  3GSI A;  3E1T A;  4J33 A;  3H4K A;  3AE5 A;  4FK1 C;  3DK4 A;  3ATQ A;  4GDP A;  3QJ4 A;  4U8K A;  4U8I A;  1S3B A;  4U8L A;  5JCK A;  1NEN A;  2Q7V A;  4K5S A;  2Q0K A;  4B68 A;  4CNK A;  2FJE A;  3GD3 A;  4OPT A;  3VRA A;  1ZOV A;  3G5R A;  1K0J A;  3GYJ A;  2AQJ A;  2E5V A;  4USQ A;  3SFE A;  2BC0 A;  1KSS A;  5FMH A;  4YSZ A;  4ZCD A;  3AWI A;  1H84 A;  4H4Y A;  4BUR A;  3NK2 X;  1COY A;  3RHA A;  2YR5 A;  5HYM A;  2VQ7 A;  4BK1 A;  4G9K A;  4K2X A;  1ZMC A;  4IV9 A;  3FIM B;  4YT0 A;  2H89 A;  3AYI A;  3ICR A;  3EAN A;  2WU5 A;  5EBK A;  1PJ5 A;  2XVF A;  2A8X A;  2TPR A;  2BAC A;  5KNL A;  3CIR A;  4NNJ A;  1E39 A;  3T0K A;  4X9M A;  4BK3 A;  1ONF A;  1VG0 A;  3BI5 A;  3NYC A;  2A87 A;  4NTD A;  3NRN A;  4H4X A;  2GEW A;  3C4N A;  3GDN A;  4JNQ A;  3LJP A;  3UTE A;  3ZYX A;  2VZ2 A;  2AR8 A;  4YKF A;  1ZMD A;  2C66 A;  4RG3 A;  3IWA A;  5KVI A;  1ZY8 A;  4N9X A;  1EL8 A;  4B1B A;  1MO9 A;  3AB1 A;  4A65 A;  3IC9 A;  2FJA A;  1M6I A;  1NEK A;  3T2Y A;  1BWC A;  4O5U A;  1YY5 A;  3NK1 X;  2YVG A;  1OJT A;  3C96 A;  1CJC A;  3DK8 A;  1Q1W A;  4WCT A;  1F8S A;  3CGD A;  3CGB A;  3LAD A;  2VRL A;  3NN0 X;  4H4R A;  2YLX A;  2CUL A;  3M0O A;  4REK A;  2BCG G;  5KWF A;  1H82 A;  1LVL A;  2GF3 A;  2OLN A; 
#chains in the Genus database with same CATH homology
 1GET A;  4CY8 A;  1DJN A;  3RP7 A;  5M10 A;  1VG9 A;  1DNC A;  4APN A;  1PDH A;  4K5R A;  1DOC A;  1OJA A;  1Y56 B;  4X9N A;  4KX6 A;  1JNZ A;  4U8O A;  1DOE A;  4DNA A;  5KMQ A;  3FMW A;  4H2R A;  4H4T A;  4NTC A;  2PYX A;  3M12 A;  4H4P A;  1OJD A;  3UKP A;  3URH A;  4D04 A;  1X31 B;  2F5Z A;  2JAE A;  2QA1 A;  3ATR A;  3KPF A;  3BNM A;  1JU2 A;  2IVE A;  2OAL A;  3NIX A;  3NTD A;  3RNM A;  4LII A;  3SM8 A;  1D7L A;  3AE4 A;  4YKG A;  1V59 A;  5FS6 A;  4BK2 A;  3QSE A;  4U8N A;  2VOU A;  1LQU A;  4B66 A;  1GRA A;  2CDU A;  3NH3 X;  2YLW A;  1GES A;  4U2T A;  2YG6 A;  4U8P A;  3GMB A;  4Z2T A;  3NTA A;  2QAE A;  3KLJ A;  4PAA A;  1DJQ A;  4DSG A;  3AE3 A;  3UCL A;  1YQZ A;  2YG3 A;  1GXF A;  2C76 A;  1QO8 A;  3NYF A;  2E4G A;  2Y6Q A;  1YKJ A;  1GER A;  4IA5 A;  2VVM A;  2PHH A;  3NK0 X;  3NT6 A;  2YR4 A;  2VRM A;  3VQR A;  1RYI A;  2OAM A;  3SGL A;  1OJ9 A;  3NNE A;  2GR3 A;  2YM1 A;  5ER0 A;  4AP1 A;  1LV0 A;  1IUV A;  4CRT A;  5DBJ A;  1BZL A;  2XVE A;  1L0V A;  5BVA A;  1EL5 A;  4JQ9 A;  4WX1 A;  5IQ4 A;  2WEU A;  2YWL A;  3CPJ G;  2V5Z A;  3EPT A;  1QLB A;  2BCP A;  2BK4 A;  4G73 A;  1GRB A;  1F3P A;  1GV4 A;  4BJY A;  3UP4 A;  4AT2 A;  2GAH B;  2O9Z A;  1NAA A;  1KF6 A;  3M13 A;  2IID A;  2R45 A;  3O0H A;  4H2P A;  4NTE A;  1CC2 A;  1GRE A;  2WPF A;  3AD7 B;  3DGH A;  3P4Q A;  4XXG A;  4CCQ A;  3L8K A;  1GND A;  2Q6U A;  2WPE A;  3KKJ A;  3SZ0 A;  3AE2 A;  4D03 A;  4G6H A;  4EMW A;  5BRT A;  2R0C A;  2VVL G;  3G5S A;  1N4W A;  1EL7 A;  2GMH A;  2JK6 A;  3NYE A;  1VQW A;  4EM3 A;  1NHP A;  1ELI A;  2H88 A;  5M0Z A;  3SQP A;  3UKF A;  1VDC A;  2BRY A;  2GQF A;  3PS9 A;  1RSG A;  2V60 A;  3KVE A;  4JY2 A;  4USR A;  5FS8 A;  2ARD A;  5C3J A;  4NEV A;  4JN9 A;  2GMJ A;  1KNP A;  1E1L A;  2JB3 A;  1CBO A;  1E1K A;  2WET A;  1GEU A;  2XLR A;  2XLU A;  3AED A;  3ALL A;  5KVH A;  3HYW A;  2BYB A;  3P4P A;  3BI4 A;  1P2H A;  4U2L A;  2B76 A;  3UKA A;  1TDE A;  2BK3 A;  1GRG A;  2W0H A;  3UTF A;  2BC1 A;  1PBD A;  3V3N A;  1JOA A;  1GRH A;  1KSU A;  2R0P A;  3IHM A;  2WQY A;  3LXD A;  1TDF A;  4K8D A;  3RP6 A;  2XFO A;  3UOZ A;  2DKH A;  4J36 A;  1PJ6 A;  2JKC A;  2GRT A;  4XWZ A;  5GSN A;  5JCL A;  4RG4 A;  1FCD A;  1N1P A;  2GVC A;  3SZF A;  4II2 A;  4PAB A;  2V3B A;  1ZK7 A;  3AEG A;  3UP5 A;  4H4V A;  4C5O A;  1F6M A;  5FS7 A;  2XVJ A;  1K0I A;  3OC4 A;  2WDV A;  4ADW A;  5HXI A;  2OLO A;  4H4Q A;  4UP3 A;  3PO7 A;  2C70 A;  4GUV A;  5L46 A;  2X3N A;  4ZN0 A;  2RAB A;  1H7W A;  4U8M A;  4BV6 A;  2V61 A;  3Q6J A;  4A99 A;  2C3C A;  3I6D A;  4GRT A;  4C77 A;  1CHU A;  4CCR A;  4CNJ A;  3UTG A;  1XDI A;  4K22 A;  5J7X A;  4ECH A;  1B37 A;  1K0L A;  2JB1 A;  5JCI A;  2JBV A;  2R4E A;  3QFA A;  3UKQ A;  2VVL A;  3ABV A;  1S2Y A;  1JEH A;  2YG4 A;  3NHO X;  1XHC A;  4G6G A;  1PXB A;  1MOK A;  3AD8 B;  3C4A A;  1CJ3 A;  2YLZ A;  4DSH A;  4FDC B;  3B6D A;  3ISH A;  2X50 A;  1L9E A;  2RGH A;  5FS9 A;  4YSH A;  3FG2 P;  3PVC A;  3F8R A;  1FL2 A;  4EIP A;  1E6E A;  3NGC X;  1VRQ B;  2GAG B;  2WP6 A;  3HZL A;  3GYI A;  3IHG A;  5KXJ A;  3AYJ A;  1CJ2 A;  2EQ8 A;  3P9U A;  2BXR A;  3AE9 A;  3T2K A;  1O95 A;  2X99 A;  3GYX A;  4K7Z A;  5KRQ A;  2R46 A;  3IF9 A;  1B4V A;  4OCG A;  5CQF A;  2BRA A;  2WOI A;  2XDO A;  1NPX A;  5TR3 A;  3UOV A;  1REO A;  4LA1 A;  1NHS A;  2B7S A;  4RSL A;  5HHF A;  4NWZ A;  1CF3 A;  1MXT A;  1ZKQ A;  3QSS A;  3GRS A;  1ZOY A;  3AYL A;  4YTP A;  3BHK A;  1S3E A;  4GR1 A;  4LU6 A;  1GRF A;  3AD9 B;  1ZX9 A;  3T2Z A;  3DME A;  4Z44 A;  3NLC A;  3LOV A;  3GWD A;  3H8L A;  2C67 A;  3SXI A;  4XWR A;  2XFN A;  1FOH A;  1M64 A;  1PBE A;  2YAU A;  3I3L A;  2XFQ A;  4J56 A;  4TM1 A;  3T31 A;  2AAQ A;  2BS3 A;  2B9W A;  3DJD A;  3DJJ A;  1PS9 A;  3AE1 A;  4GF7 A;  1GSN A;  3QVR A;  4EM4 A;  1D4E A;  3CNS A;  3FPZ A;  2EQ6 A;  3ZDN A;  4GCM A;  2XVI A;  1BKW A;  1NDA A;  2C65 A;  1IUT A;  4TLX A;  1AOG A;  3CNP A;  2APG A;  3GWF A;  3S61 A;  3CN8 A;  4OPI A;  2B9Y A;  3SFD A;  4ICY A;  4A7A A;  1FEC A;  4U2S A;  2C72 A;  1KNR A;  2WPC A;  3KPK A;  3AE7 A;  3DA1 A;  4EQR A;  3AEF A;  2WP9 A;  4FX9 A;  1D7Y A;  2GH5 A;  3LB8 A;  2ACZ A;  3CPI G;  4YTN A;  4H2Q A;  4HB9 A;  2X8G A;  5EOW A;  4J31 A;  3F8P A;  2FJB A;  2C75 A;  1XPQ A;  2ZZB A;  3DK9 A;  3CTY A;  3KU9 A;  1O5W A;  1JRY A;  3SY4 A;  3CND A;  1LTX R;  2YR6 A;  3AEE A;  4II3 A;  2C4C A;  2GR0 A;  2BA9 A;  2XYO A;  2XFP A;  1CJ4 A;  2XCG A;  4H4Z A;  4CBQ A;  1P2E A;  3DGZ A;  1PXA A;  3AEC A;  2VQB A;  3BHF A;  3F8D A;  3SZW A;  4AOS A;  4BJZ A;  2WHD A;  3CMM A;  1LQT A;  2YG5 A;  1H81 A;  1BGN A;  2A89 A;  4A9W A;  5KMS A;  2Z5X A;  1EBD A;  2YM2 A;  3UKK A;  3CGC A;  5IQ1 A;  3P4S A;  1GT8 A;  4OVI A;  1CC6 A;  1H83 A;  1PBF A;  3NKS A;  1PN0 A;  4HA6 A;  3SZC A;  4YSX A;  4OPD A;  2GR2 A;  2Z5Y A;  4G74 A;  4C3Y A;  1E1N A;  4YXD A;  2GQW A;  1E1M A;  2WES A;  1B8S A;  1LPF A;  2V3A A;  4TM0 A;  2BK5 A;  3D1C A;  1GOS A;  4A5L A;  3LZW A;  4UDQ A;  4EMI A;  1PHH A;  1F8W A;  1BGJ A;  1S2Q A;  3DJE A;  3AE6 A;  2WS3 A;  3ADA B;  3G5Q A;  4AP3 A;  2QCU A;  2R9Z A;  1L9C A;  3FBS A;  1H6V A;  3AXB A;  2XLP A;  4U8J A;  1PBB A;  2WBA A;  4IVO B;  3D8X A;  4NEW A;  2RGO A;  2WDQ A;  1H86 A;  1GTE A;  3OZ2 A;  1JRZ A;  3HYV A;  1DOD A;  1N4U A;  1TDN A;  3WE0 A;  3ALM A;  3NG7 X;  5EB4 A;  3AEA A;  1FEB A;  5JCM A;  4UDR A;  2B7R A;  4GAP A;  5EB5 A;  3P4R A;  1Q9I A;  4H2N A;  5KOX A;  1EL9 A;  2XLT A;  2CVJ A;  1UKV G;  1SEZ A;  2X8C A;  1N4V A;  3Q9T A;  4UDP A;  4CY6 A;  1YQ4 A;  4H7U A;  4E0V A;  4GDE A;  1YQ3 A;  3EF6 A;  4Z26 A;  4A79 A;  1GAL A;  3V3O A;  2B9X A;  2WDR A;  4YWO A;  4B67 A;  4A6N A;  4Z2U A;  3CGE A;  1KFY A;  2QA2 A;  4TLZ A;  1K4Q A;  4YTM A;  3VRB A;  1IUX A;  2YG7 A;  1D4C A;  2CFY A;  5KMR A;  1HYU A;  2XFU A;  3L1R A;  1NG3 A;  3QFB A;  4JNA A;  2WU2 A;  5CKU A;  1TDO A;  3HYX A;  2HQM A;  2ZZC A;  2C3D A;  4JDR A;  3UKH A;  3QVP A;  1TYT A;  1TDK A;  3AEB A;  1RP0 A;  2BS2 A;  1PXC A;  1JNR A;  1D5T A;  1W4X A;  5J60 A;  4Y4N A;  5LV9 A;  3P1W A;  4C74 A;  3UKL A;  3GD4 A;  1PJ7 A;  4OPC A;  3H8I A;  3VR9 A;  3T14 A;  5KMP A;  3GMC A;  1OJC A;  3ICS A;  4IA6 A;  3CNJ A;  4Z25 A;  1NHR A;  2R4J A;  3UTH A;  3ITJ A;  3QSM A;  4OPG A;  1CL0 A;  4P9S A;  3RP8 A;  1FEA A;  2UZZ A;  2YLS A;  1H7X A;  3T37 A;  4C3X A;  3V76 A;  2RGJ A;  3RED A;  2OA1 A;  3GRT A;  1NHQ A;  2GR1 A;  4OPL A;  2WOV A;  2X8H A;  3COX A;  4TM3 A;  4IVM B;  1GPE A;  4I59 A;  5BUK A;  3II4 A;  4JY3 A;  3UOY A;  1TYP A;  3JSK A;  4EIQ A;  2XLS A;  2Y6R A;  1DXL A;  1TRB A;  2GV8 A;  4H4U A;  2ZZ0 A;  4FK1 A;  2JB2 A;  3DJG X;  1LJ1 A;  4EMJ A;  2YVJ A;  3GDP A;  1ZDL A;  1ZP0 A;  3DH9 A;  3LZX A;  4YSY A;  2BAB A;  2J3N A;  5C2T A;  2C7G A;  1B5Q A;  3B3R A;  3BI2 A;  5U1O A;  3KA7 A;  1NG4 A;  4B64 A;  1O94 A;  3KD9 A;  4B65 A;  4MJW A;  4TM4 A;  1GRT A;  3VRD B;  3SYI A;  1JRX A;  3VR8 A;  1D4D A;  2WOW A;  4Y4L A;  1BF3 A;  4O5Q A;  1IJH A;  2IVD A;  2I0Z A;  3AE8 A;  2BS4 A;  2FJD A;  2NVK X;  4KPR A;  4GAV A;  2C64 A;  1F8R A;  4Z43 A;  2YLR A;  3BNU A;  5JCN A;  2BXS A;  2DKI A;  2YQU A;  5U25 A;  2E1M A;  3S5W A;  3CPH G;  2TMD A;  4OPU A;  4J57 A;  2R0G A;  5BUL A;  3K7Q X;  1Y56 A;  2C73 A;  4Y4M A;  4M52 A;  4NZH A;  4Z2R A;  3R9U A;  2ZBW A;  4I58 A;  1IUU A;  2WP5 A;  1KDG A;  2EQ7 A;  2V6O A;  4DGK A;  4EQW A;  4H4S A;  3SX6 A;  1DOB A;  1Y0P A;  4J2W A;  1Z6L A;  3ALJ A;  4H50 A;  3UOX A;  3ICT A;  5HY5 A;  1XAN A;  3K7M X;  3K30 A;  3CNT A;  4EQX A;  5KOW A;  4H4W A;  4B69 A;  1QJD A;  4ZCC A;  1CC4 A;  2Q0L A;  4A6N B;  2FBW A;  4J34 A;  1E7P A;  1IUS A;  5IPY A;  2XVH A;  3EAO A;  1L9D A;  5GRT A;  4EQS A;  4Z24 A;  4B63 A;  1PBC A;  4AOX A;  1IUW A;  4AT0 A;  5U63 A;  2YLT A;  1GTH A;  2EQ9 A;  2YVF A;  2GB0 A;  2NPX A;  3K7T A;  3NN6 X;  4X4J A;  1Q1R A;  3GSI A;  3E1T A;  4J33 A;  3H4K A;  3AE5 A;  4FK1 C;  3DK4 A;  3ATQ A;  4GDP A;  3QJ4 A;  4U8K A;  4U8I A;  1S3B A;  4U8L A;  5JCK A;  1NEN A;  2Q7V A;  4K5S A;  2Q0K A;  4B68 A;  4CNK A;  2FJE A;  3GD3 A;  4OPT A;  3VRA A;  1ZOV A;  3G5R A;  1K0J A;  3GYJ A;  2AQJ A;  2E5V A;  4USQ A;  3SFE A;  2BC0 A;  1KSS A;  5FMH A;  4YSZ A;  4ZCD A;  3AWI A;  1H84 A;  4H4Y A;  4BUR A;  3NK2 X;  1COY A;  3RHA A;  2YR5 A;  5HYM A;  2VQ7 A;  4BK1 A;  4G9K A;  4K2X A;  1ZMC A;  4IV9 A;  3FIM B;  4YT0 A;  2H89 A;  3AYI A;  3ICR A;  3EAN A;  2WU5 A;  5EBK A;  1PJ5 A;  2XVF A;  2A8X A;  2TPR A;  2BAC A;  5KNL A;  3CIR A;  4NNJ A;  1E39 A;  3T0K A;  4X9M A;  4BK3 A;  1ONF A;  1VG0 A;  3BI5 A;  3NYC A;  2A87 A;  4NTD A;  3NRN A;  4H4X A;  2GEW A;  3C4N A;  3GDN A;  4JNQ A;  3LJP A;  3UTE A;  3ZYX A;  2VZ2 A;  2AR8 A;  4YKF A;  1ZMD A;  2C66 A;  4RG3 A;  3IWA A;  5KVI A;  1ZY8 A;  4N9X A;  1EL8 A;  4B1B A;  1MO9 A;  3AB1 A;  4A65 A;  3IC9 A;  2FJA A;  1M6I A;  1NEK A;  3T2Y A;  1BWC A;  4O5U A;  1YY5 A;  3NK1 X;  2YVG A;  1OJT A;  3C96 A;  1CJC A;  3DK8 A;  1Q1W A;  4WCT A;  1F8S A;  3CGD A;  3CGB A;  3LAD A;  2VRL A;  3NN0 X;  4H4R A;  2YLX A;  2CUL A;  3M0O A;  4REK A;  2BCG G;  5KWF A;  1H82 A;  1LVL A;  2GF3 A;  2OLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...