1TDFA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA02
1FEAA 3BHKA 4AT2A 2ZBWA 4C77A 1D7YA 2B9YA 5CQFA 3KLJA 1O94A 3GD4A 1VQWA 2BABA 4EQSA 4TM4A 3IWAA 1PS9A 3QFBA 2RABA 1KF6A 3AD8B 4JY3A 4K7ZA 2XVEA 1F8RA 1KDGA 2ZZBA 4UDPA 1D7LA 4A65A 4YSYA 4I59A 1H83A 4BV6A 3NLCA 4H4SA 1DXLA 1PXCA 3GYIA 2VVMA 3GMCA 4YSXA 4J2WA 4PAAA 4N9XA 4EIQA 1TDNA 5FS8A 2YLSA 3FIMB 3CN8A 4ADWA 4BJYA 3P1WA 1CJ3A 5BVAA 1D4EA 3VR9A 1K0LA 2YLXA 2WOIA 2Q6UA 4Z44A 2FJDA 4FK1C 2HQMA 2YVJA 1NPXA 2WPCA 1NHQA 3JSKA 3VRDB 2GVCA 4H4QA 3DK8A 3Q6JA 2EQ9A 5M10A 2JB1A 2FBWA 4HB9A 2Y6RA 1LPFA 3K30A 4JN9A 2BS4A 1CC6A 1DNCA 2BK4A 3B3RA 5TR3A 1H81A 4JDRA 4C74A 3BHFA 1CJ2A 3CPHG 3GDNA 4H4RA 4CNKA 1ONFA 3NIXA 1MXTA 3AYLA 1IUUA 3V3NA 1JNRA 1ZMCA 2GV8A 3GRTA 1GT8A 5J60A 3BI2A 2YM1A 4CRTA 2XVFA 2YG6A 4EQWA 2OALA 3NGCX 3NTDA 4JNQA 5EOWA 4GCMA 3CGCA 3AE8A 3CNJA 2X8HA 3QVRA 3CPJG 1BZLA 1E1KA 4XWRA 2B9WA 4BK1A 3CGBA 3DMEA 3FBSA 2GR2A 3UOVA 1DOCA 5U1OA 1YQZA 2O9ZA 1GSNA 1PBDA 4Z24A 4CBQA 2BK3A 2C3CA 2A8XA 5FS9A 2NVKX 3RNMA 4Z25A 3Q9TA 2XFPA 3S5WA 1GXFA 2IIDA 1L9DA 1CC2A 4Z43A 4U8OA 3WE0A 1ZK7A 2BK5A 4NZHA 3F8PA 5U25A 4CY6A 2V3BA 1E1MA 4A6NA 3I6DA 1GTHA 3V76A 4CCRA 1PHHA 3GRSA 3L1RA 4IVOB 3VR8A 5IPYA 3KVEA 1GPEA 5L46A 4K2XA 3CNDA 1LJ1A 3NN6X 1CC4A 1XHCA 3CGDA 2Q7VA 3P4RA 4C3YA 4IVMB 3AEFA 2XVHA 3AEEA 2WP6A 3ATRA 3UCLA 5IQ4A 4NTDA 4OPDA 5EB4A 5ER0A 2R0GA 4H2PA 2YG3A 2WDVA 3ABVA 4K5RA 4JQ9A 1GRBA 1K0JA 4EQRA 2FJEA 1GRTA 2H89A 2C67A 1JU2A 4U8NA 2WBAA 3GD3A 1LQTA 5IQ1A 2BS3A 1FEBA 2TMDA 3AD9B 3DA1A 1ZOVA 1MOKA 4O5QA 3CNTA 4TM1A 2XDOA 1IJHA 1CBOA 2WPFA 2AQJA 2YQUA 3P4QA 1GALA 2PYXA 5JCKA 2JB2A 1P2EA 4U8JA 2V5ZA 4UP3A 3SQPA 2R45A 1QLBA 4OPCA 1KFYA 1CJCA 2JAEA 1NG4A 1COYA 1F3PA 4GF7A 3NTAA 4HA6A 1CJ4A 1V59A 1CL0A 5GSNA 3ICRA 2XCGA 3M13A 1H86A 3T37A 4B63A 3AD7B 1OJDA 1KNPA 4U2SA 3ITJA 2FJBA 3PS9A 4REKA 2B9XA 5DBJA 4M52A 1DODA 1PXBA 4J33A 3AB1A 1PN0A 4YKFA 5M0ZA 1NENA 3ISHA 3L8KA 4GDEA 2VZ2A 1X31B 1PJ5A 2VOUA 4AP3A 3EPTA 2XLSA 2RGOA 2WESA 2RGJA 3IF9A 1KNRA 1OJ9A 1TDKA 4YSHA 3NT6A 3NKSA 1FOHA 1REOA 3AEGA 1VRQB 4UDQA 4AOSA 3AE6A 4XXGA 1ZMDA 3QSMA 4GDPA 2YLRA 2GR0A 4WCTA 1GRGA 2AAQA 3AXBA 3V3OA 3UP5A 1PBFA 3IC9A 1EL8A 4GUVA 3KPFA 4OPIA 1NDAA 1H84A 4EM3A 2V6OA 2Y6QA 3CTYA 4DNAA 3D1CA 1KSSA 1ELIA 1GNDA 2X8CA 3ALJA 3NN0X 2CFYA 1JEHA 2TPRA 3AE1A 1XPQA 1FECA 1JRXA 2C65A 3OC4A 5HXIA 2JB3A 4D03A 1D4CA 4PABA 2EQ7A 3BNMA 1NEKA 5LV9A 2YWLA 4KPRA 1D5TA 1B5QA 1GEUA 2VRMA 4FX9A 2J3NA 5JCMA 2CVJA 3UKPA 3BI5A 2GMHA 4H7UA 2ACZA 1ZKQA 2VVLA 2OLNA 3RP6A 3K7QX 1DJQA 1S3EA 1KSUA 2QCUA 3NK0X 1BKWA 3QSSA 1S2QA 4E0VA 3FPZA 1TRBA 3DJDA 1IUWA 4U2TA 4LA1A 2OA1A 3S61A 2GH5A 3M12A 2XLRA 1P2HA 4X9NA 4XWZA 4AOXA 4OPGA 3AE4A 1HYUA 3UOXA 2IVEA 5BRTA 3NRNA 2AR8A 4J31A 2C76A 4H4TA 4P9SA 2WEUA 3UKFA 5EBKA 1Z6LA 4BK3A 5KWFA 1O95A 2YM2A 1AOGA 1PJ6A 2C73A 3F8RA 2BCPA 2C7GA 2I0ZA 4GR1A 4NEVA 4ICYA 1TDEA 1IUSA 2Z5YA 3RP8A 2XFUA 3VQRA 2Q0LA 2R0PA 1YY5A 3M0OA 1GETA 1UKVG 1DOBA 4K8DA 1E39A 1L9EA 2YG5A 4Z2UA 4OPLA 3UTFA 2YG7A 2GR1A 3AEBA 5JCNA 2WS3A 1K4QA 1XDIA 2OLOA 1E7PA 1K0IA 4YSZA 1DJNA 2BYBA 2BXSA 3NH3X 1RSGA 2Z5XA 3SM8A 4H4UA 1Y56A 2APGA 4RG4A 1D4DA 2BCGG 4Y4LA 5HY5A 4B67A 2XFOA 3KD9A 3LZWA 1L0VA 3DJJA 3KU9A 4H50A 4JNAA 4IA5A 2XLTA 4A7AA 1N4WA 1OJCA 4FK1A 2GAGB 5BULA 4CNJA 2BC1A 2YVFA 2B7SA 1RYIA 4B64A 3UOYA 4B65A 3DJEA 4YTPA 2XYOA 2JKCA 4J34A 3GYJA 3IHMA 3QVPA 3UKHA 4O5UA 3B6DA 1LTXR 1BGJA 3PVCA 1GRFA 1W4XA 1N4UA 4Z2RA 1JNZA 3UKAA 2ARDA 1H7XA 3NK1X 1FL2A 2C75A 2FJAA 4RSLA 3EANA 4NTEA 2C66A 3UTHA 3BI4A 3ATQA 3ZDNA 4ZN0A 3VRAA 1Y56B 4AP1A 3CNPA 1B4VA 2A87A 2RGHA 4C3XA 1LV0A 3ALLA 1BGNA 4EQXA 3II4A 4H4VA 1IUXA 5FS7A 2GEWA 4TM0A 5EB5A 3KKJA 2PHHA 1IUVA 3NHOX 2BA9A 1QO8A 3COXA 4Z26A 3HZLA 4Y4MA 2R4JA 1VG9A 2XLUA 2GR3A 2WPEA 1S2YA 2GMJA 1YKJA 4J57A 3ICTA 4GRTA 2C70A 2X8GA 3H8IA 3SFEA 3PO7A 4YTNA 3RP7A 2R9ZA 4LIIA 3AWIA 4YWOA 1H6VA 3G5SA 1L9CA 1TDFA 3O0HA 4NTCA 4USRA 1DOEA 1TDOA 3C4AA 4OPTA 3UKKA 3LZXA 2GB0A 4MJWA 1PJ7A 2BXRA 3ADAB 1QJDA 5GRTA 5FS6A 3C96A 3RHAA 1OJTA 3CIRA 3NG7X 1N4VA 5KRQA 4EMWA 4U8PA 2EQ6A 2X3NA 4H4ZA 4RG3A 1VDCA 3NK2X 2B76A 4EIPA 1GREA 2JBVA 3EF6A 4TM3A 4UDRA 2XFQA 4DSHA 4D04A 2ZZCA 1ZDLA 3AE7A 1ZX9A 2X99A 1PBEA 3K7MX 1BF3A 4B1BA 1GRHA 4DGKA 1BWCA 3SGLA 4BURA 1GRAA 2BC0A 3AYJA 2GF3A 3URHA 4H4XA 4I58A 2VQ7A 4TLZA 3QSEA 3P9UA 1RP0A 2IVDA 2E1MA 4EMIA 4K5SA 2V61A 1GTEA 1PXAA 3LB8A 1EL5A 1NHRA 3DGZA 3H4KA 4J36A 5FMHA 1F6MA 1NHPA 3G5RA 1Q1RA 3AE2A 2GAHB 2XLPA 4Y4NA 3K7TA 3REDA 2YVGA 4H2RA 2YLWA 2BACA 1FCDA 2YR5A 2A89A 2WP9A 3C4NA 2WDRA 5HYMA 2YR4A 2C72A 2E4GA 3UP4A 3D8XA 4J56A 4U8IA 1OJAA 1ZOYA 4APNA 1M6IA 2YAUA 3QJ4A 1GESA 1Y0PA 4C5OA 1XANA 1YQ3A 4EMJA 2ZZ0A 4A5LA 2WU2A 4B68A 2VRLA 4NEWA 3P4SA 5JCLA 3NNEA 3AEAA 4ECHA 1ZY8A 1N1PA 2QA1A 3ICSA 2YLTA 4YKGA 1E1NA 4EM4A 4USQA 3AEDA 2QAEA 5KOWA 3DH9A 1GV4A 1O5WA 5CKUA 2WP5A 4B66A 1GERA 2WOWA 4U8LA 4BJZA 1GOSA 5KVHA 3GDPA 1E1LA 3G5QA 3LOVA 5C3JA 2B7RA 1ZP0A 2VQBA 4TLXA 2UZZA 3NYCA 1EL9A 3LXDA 3AE9A 4IV9A 5KOXA 3GMBA 2R4EA 2EQ8A 1EBDA 2CULA 4KX6A 3FMWA 2DKIA 2E5VA 1LQUA 3DK4A 1JOAA 3LADA 1PBBA 3ZYXA 3GSIA 1CHUA 1EL7A 4JY2A 2GQFA 4A99A 1MO9A 4H2NA 3FG2P 1H7WA 2V3AA 3UKLA 2JK6A 1B8SA 2YR6A 3CGEA 2R46A 4ZCDA 3UTEA 1S3BA 3UTGA 1F8SA 4OVIA 4YT0A 5JCIA 3EAOA 5KXJA 4X4JA 4CY8A 3VRBA 5BUKA 4YTMA 3DJGX 2R0CA 4BK2A 2XVJA 4WX1A 1NAAA 2QA2A 3E1TA 4Z2TA 2DKHA 1PDHA 4IA6A 3H8LA 4B69A 1TYPA 2WETA 1H82A 2WHDA 4H4WA 2XFNA 4X9MA 1F8WA 2BS2A 2V60A 3GWFA 3AECA 3BNUA 4K22A 4H4YA 4DSGA 2NPXA 1JRZA 4A9WA 4U8MA 3SFDA 3AE3A 5U63A 1B37A 3KA7A 5KVIA 2X50A 3F8DA 3AYIA 2WU5A 2WOVA 2F5ZA 4U8KA 4A79A 4H4PA 5J7XA 3NYEA 1M64A 4A6NB 3DK9A 1CF3A 1VG0A 4U2LA 2CDUA 1Q9IA 3LJPA 1LVLA 4FDCB 2W0HA 3AE5A 3OZ2A 4ZCCA 2C64A 4AT0A 2H88A 1NG3A 2YG4A 4LU6A 1YQ4A 3ALMA 2OAMA 3DGHA 1E6EA 3NYFA 3QFAA 4H2QA 1TYTA 2GQWA 3I3LA 1Q1WA 2VVLG 1PBCA 2GRTA 3UOZA 1IUTA 2WQYA 3GWDA 4YXDA 1NHSA 1JRYA 5HHFA 3R9UA 2C3DA 2XVIA 3CPIG 3IHGA 4CCQA 2Q0KA 5C2TA 3UKQA 4OPUA 4OCGA 1SEZA 2WDQA 3P4PA 3CNSA 2YLZA
chains in the Genus database with same CATH superfamily
1FEAA 3BHKA 4AT2A 2ZBWA 4C77A 1D7YA 3SYIA 2B9YA 5CQFA 3KLJA 1O94A 3GD4A 1VQWA 2BABA 3P4PA 4EQSA 4TM4A 3IWAA 1PS9A 3QFBA 2RABA 1KF6A 3AD8B 4JY3A 4K7ZA 2XVEA 1F8RA 1KDGA 2ZZBA 4UDPA 1D7LA 4A65A 4YSYA 4I59A 1H83A 4BV6A 3NLCA 4H4SA 1DXLA 1PXCA 3GYIA 2VVMA 3GMCA 4YSXA 4J2WA 4G6GA 4PAAA 4N9XA 4EIQA 1TDNA 5FS8A 2YLSA 3FIMB 3CN8A 4ADWA 4BJYA 3P1WA 1CJ3A 5BVAA 1D4EA 3T2YA 3VR9A 1K0LA 2YLXA 2WOIA 2Q6UA 4Z44A 2FJDA 4FK1C 2HQMA 2YVJA 1NPXA 2WPCA 1NHQA 3JSKA 3VRDB 2GVCA 4H4QA 3DK8A 3Q6JA 2EQ9A 5M10A 2JB1A 2FBWA 4HB9A 2Y6RA 1LPFA 3K30A 4JN9A 2BS4A 1CC6A 1DNCA 2BK4A 3B3RA 3HYWA 5TR3A 1H81A 4JDRA 4C74A 3BHFA 1CJ2A 3CPHG 3GDNA 4H4RA 4CNKA 1ONFA 3NIXA 1MXTA 3AYLA 1IUUA 3V3NA 1JNRA 1ZMCA 2GV8A 3GRTA 1GT8A 5J60A 3BI2A 2YM1A 4CRTA 2XVFA 2YG6A 4EQWA 2OALA 3NGCX 3NTDA 4JNQA 5EOWA 4GCMA 3CGCA 3AE8A 3CNJA 2X8HA 3QVRA 3CPJG 1BZLA 1E1KA 4XWRA 2B9WA 4BK1A 3CGBA 3DMEA 3FBSA 5KMQA 2GR2A 3UOVA 1DOCA 5U1OA 1YQZA 2O9ZA 1GSNA 1PBDA 4Z24A 4CBQA 2BK3A 2C3CA 2A8XA 5FS9A 2NVKX 3RNMA 4II3A 3Q9TA 4Z25A 2XFPA 3S5WA 1GXFA 2IIDA 1L9DA 1CC2A 4Z43A 4U8OA 3WE0A 1ZK7A 2BK5A 4NZHA 3F8PA 5U25A 4CY6A 2V3BA 4G74A 1E1MA 4A6NA 3I6DA 1GTHA 3V76A 4CCRA 1PHHA 3GRSA 3L1RA 4G9KA 4IVOB 3VR8A 5IPYA 3KVEA 1GPEA 5L46A 4K2XA 3CNDA 1LJ1A 3NN6X 1CC4A 1XHCA 3CGDA 2Q7VA 3P4RA 4C3YA 4IVMB 3AEFA 2XVHA 3AEEA 5KNLA 2WP6A 3ATRA 3UCLA 5IQ4A 4NTDA 4OPDA 3SZCA 5EB4A 5ER0A 2R0GA 4H2PA 2YG3A 2WDVA 3ABVA 4K5RA 4JQ9A 1GRBA 1K0JA 4GAPA 4EQRA 2FJEA 1GRTA 2H89A 2C67A 1JU2A 3T2ZA 4U8NA 2WBAA 3GD3A 1LQTA 5IQ1A 2BS3A 1FEBA 2TMDA 3AD9B 3DA1A 1ZOVA 1MOKA 4O5QA 3CNTA 4TM1A 2XDOA 1IJHA 1CBOA 2WPFA 2AQJA 2YQUA 3P4QA 1GALA 2PYXA 5JCKA 2JB2A 1P2EA 4U8JA 2V5ZA 4UP3A 3SQPA 2R45A 1QLBA 4OPCA 1KFYA 1CJCA 2JAEA 1NG4A 1COYA 1F3PA 4GF7A 3NTAA 4HA6A 1CJ4A 1V59A 1CL0A 5GSNA 3ICRA 2XCGA 3M13A 1H86A 3T37A 4B63A 3AD7B 1OJDA 1KNPA 4U2SA 3ITJA 2FJBA 3PS9A 4REKA 2B9XA 5DBJA 4M52A 1DODA 1PXBA 4J33A 3AB1A 1PN0A 4YKFA 5M0ZA 1NENA 3ISHA 3L8KA 4GDEA 2VZ2A 1X31B 1PJ5A 2VOUA 4AP3A 3EPTA 2XLSA 2RGOA 2WESA 2RGJA 3IF9A 1KNRA 3SZ0A 1OJ9A 1TDKA 4YSHA 3NT6A 3NKSA 1FOHA 1REOA 3AEGA 1VRQB 4UDQA 4AOSA 3AE6A 4XXGA 1ZMDA 3QSMA 4GDPA 2YLRA 3HYVA 2GR0A 4WCTA 1GRGA 2AAQA 3AXBA 3V3OA 3UP5A 1PBFA 3IC9A 1EL8A 4GUVA 3KPFA 4OPIA 1NDAA 1H84A 4EM3A 2V6OA 2Y6QA 3CTYA 4DNAA 3D1CA 1KSSA 1ELIA 1GNDA 2X8CA 3ALJA 3NN0X 2CFYA 1JEHA 2TPRA 3AE1A 1XPQA 1FECA 1JRXA 2C65A 3OC4A 5HXIA 2JB3A 4D03A 1D4CA 4PABA 2EQ7A 3BNMA 1NEKA 5LV9A 2YWLA 4KPRA 1D5TA 1B5QA 1GEUA 2VRMA 4FX9A 2J3NA 5JCMA 2CVJA 3UKPA 3BI5A 2GMHA 4H7UA 2ACZA 1ZKQA 2VVLA 2OLNA 3RP6A 3K7QX 1DJQA 1S3EA 1KSUA 2QCUA 3NK0X 1BKWA 3QSSA 1S2QA 4E0VA 3FPZA 1TRBA 4G6HA 3DJDA 1IUWA 4U2TA 4LA1A 2OA1A 3S61A 2GH5A 3M12A 2XLRA 1P2HA 4X9NA 4XWZA 4AOXA 4OPGA 3AE4A 1HYUA 3UOXA 2IVEA 5BRTA 3NRNA 2AR8A 4J31A 2C76A 4H4TA 4P9SA 2WEUA 3UKFA 5EBKA 1Z6LA 4BK3A 5KMSA 5KWFA 1O95A 2YM2A 1AOGA 1PJ6A 2C73A 3F8RA 2BCPA 2C7GA 2I0ZA 4GR1A 4NEVA 4ICYA 1TDEA 1IUSA 2Z5YA 3RP8A 2BRYA 2XFUA 3VQRA 2Q0LA 2R0PA 1YY5A 3M0OA 1GETA 1UKVG 1DOBA 4K8DA 1E39A 1L9EA 2YG5A 4Z2UA 4OPLA 3UTFA 2YG7A 2GR1A 3AEBA 5JCNA 2WS3A 1K4QA 1XDIA 2OLOA 1E7PA 1K0IA 4YSZA 1DJNA 2BYBA 2BXSA 3NH3X 1RSGA 2Z5XA 3SM8A 4H4UA 1Y56A 2APGA 4RG4A 1D4DA 2BCGG 4Y4LA 5HY5A 4B67A 2XFOA 3KD9A 3LZWA 1L0VA 3DJJA 3KU9A 4H50A 4JNAA 4IA5A 2XLTA 4NNJA 4A7AA 1N4WA 1OJCA 2C4CA 4FK1A 2GAGB 3T2KA 5BULA 4CNJA 2BC1A 2YVFA 2B7SA 1RYIA 4B64A 3UOYA 4B65A 3DJEA 4YTPA 2XYOA 2JKCA 4J34A 3GYJA 3IHMA 3QVPA 3UKHA 4O5UA 3B6DA 1LTXR 1BGJA 3PVCA 1GRFA 1W4XA 1N4UA 4Z2RA 1JNZA 3UKAA 2ARDA 1H7XA 3NK1X 3SXIA 1FL2A 2C75A 2FJAA 4RSLA 3EANA 4NTEA 2C66A 3UTHA 3BI4A 3ATQA 3ZDNA 4ZN0A 3VRAA 1Y56B 4AP1A 3CNPA 1B4VA 2A87A 2RGHA 4C3XA 1LV0A 3ALLA 1BGNA 4EQXA 3SZFA 3II4A 4H4VA 1IUXA 5FS7A 2GEWA 3HYXA 4TM0A 3KKJA 5EB5A 2PHHA 1IUVA 3NHOX 2BA9A 1QO8A 3COXA 4Z26A 3HZLA 4Y4MA 2R4JA 1VG9A 2XLUA 3SZWA 5KMPA 2GR3A 2WPEA 1S2YA 2GMJA 1YKJA 4J57A 3ICTA 4GRTA 2C70A 2X8GA 3H8IA 3SFEA 3PO7A 4YTNA 3RP7A 2R9ZA 4LIIA 3AWIA 4YWOA 1H6VA 3G5SA 1L9CA 1TDFA 3O0HA 4NTCA 4USRA 1DOEA 1TDOA 3C4AA 4OPTA 3UKKA 3LZXA 2GB0A 4MJWA 1PJ7A 2BXRA 3ADAB 1QJDA 5GRTA 5FS6A 3C96A 3RHAA 1OJTA 3CIRA 3NG7X 1N4VA 5KRQA 4EMWA 4U8PA 2EQ6A 2X3NA 4H4ZA 4RG3A 1VDCA 3NK2X 2B76A 4EIPA 1GREA 2JBVA 3EF6A 4TM3A 4UDRA 2XFQA 4DSHA 4D04A 2ZZCA 1ZDLA 3AE7A 1ZX9A 2X99A 1PBEA 3K7MX 1BF3A 4B1BA 1GRHA 4DGKA 1BWCA 3SGLA 4BURA 1GRAA 2BC0A 3AYJA 2GF3A 3URHA 4H4XA 4I58A 2VQ7A 4TLZA 3QSEA 3P9UA 1RP0A 2IVDA 2E1MA 4EMIA 4K5SA 2V61A 1GTEA 1PXAA 3LB8A 1EL5A 1NHRA 3DGZA 3H4KA 4J36A 5FMHA 1F6MA 1NHPA 3G5RA 1Q1RA 3AE2A 3SY4A 2GAHB 2XLPA 4Y4NA 3K7TA 3REDA 2YVGA 4H2RA 2YLWA 2BACA 1FCDA 2YR5A 2A89A 2WP9A 3C4NA 2WDRA 5HYMA 2YR4A 2C72A 2E4GA 3UP4A 3D8XA 4J56A 4U8IA 1OJAA 1ZOYA 4APNA 1M6IA 2YAUA 3QJ4A 1GESA 1Y0PA 4C5OA 1XANA 1YQ3A 3T14A 2ZZ0A 4EMJA 4A5LA 2WU2A 4B68A 2VRLA 4NEWA 3P4SA 5JCLA 3NNEA 3AEAA 4ECHA 1ZY8A 1N1PA 2QA1A 3ICSA 2YLTA 4YKGA 1E1NA 4EM4A 4USQA 3AEDA 2QAEA 5KOWA 3DH9A 1GV4A 1O5WA 5CKUA 2WP5A 4B66A 1GERA 2WOWA 4U8LA 4BJZA 1GOSA 5KVHA 3GDPA 1E1LA 2BRAA 3G5QA 3LOVA 5C3JA 2B7RA 1ZP0A 2VQBA 4TLXA 2UZZA 3NYCA 1EL9A 3LXDA 3AE9A 4IV9A 5KOXA 3GMBA 2R4EA 2EQ8A 1EBDA 2CULA 4KX6A 3FMWA 2DKIA 2E5VA 1LQUA 3DK4A 1JOAA 3LADA 1PBBA 3ZYXA 3GSIA 1CHUA 1EL7A 4JY2A 2GQFA 4NWZA 4A99A 1MO9A 4H2NA 3FG2P 1H7WA 2V3AA 3UKLA 2JK6A 1B8SA 2YR6A 3CGEA 4G73A 2R46A 4II2A 4ZCDA 3UTEA 1S3BA 3UTGA 1F8SA 4OVIA 4YT0A 5JCIA 3EAOA 5KXJA 4X4JA 4CY8A 3VRBA 5BUKA 4YTMA 3DJGX 2R0CA 4BK2A 2XVJA 4WX1A 1NAAA 2QA2A 3E1TA 4Z2TA 2DKHA 1PDHA 4IA6A 3H8LA 3T31A 1TYPA 4B69A 2WETA 1H82A 2WHDA 4H4WA 2XFNA 4GAVA 4X9MA 1F8WA 2BS2A 2V60A 3GWFA 3AECA 3BNUA 4K22A 4H4YA 4DSGA 2NPXA 1JRZA 4A9WA 4U8MA 3SFDA 3AE3A 5U63A 1B37A 3KA7A 5KVIA 2X50A 3F8DA 3T0KA 3AYIA 2WU5A 2WOVA 2F5ZA 4U8KA 4A79A 4H4PA 5J7XA 3KPKA 3NYEA 1M64A 4A6NB 3DK9A 1CF3A 1VG0A 4U2LA 2CDUA 1Q9IA 3LJPA 5KMRA 1LVLA 4FDCB 2W0HA 3AE5A 3OZ2A 4ZCCA 2C64A 4AT0A 2H88A 1NG3A 2YG4A 4LU6A 1YQ4A 3GYXA 3ALMA 2OAMA 3DGHA 1E6EA 3NYFA 3QFAA 4H2QA 1TYTA 2GQWA 3I3LA 1Q1WA 3SX6A 2VVLG 1PBCA 2GRTA 3UOZA 1IUTA 2WQYA 3GWDA 4YXDA 1NHSA 1JRYA 5HHFA 3R9UA 2C3DA 2XVIA 3CPIG 3IHGA 4CCQA 2Q0KA 5C2TA 3UKQA 4OPUA 4OCGA 1SEZA 2WDQA 3CMMA 3CNSA 2YLZA
chains in the Genus database with same CATH topology
1FEAA 3BHKA 4AT2A 2ZBWA 4C77A 1D7YA 3SYIA 2B9YA 5CQFA 3KLJA 1O94A 3GD4A 1VQWA 2BABA 3P4PA 4EQSA 4TM4A 3IWAA 1PS9A 3QFBA 2RABA 1KF6A 3AD8B 4JY3A 4K7ZA 2XVEA 1F8RA 1KDGA 2ZZBA 4UDPA 1D7LA 4A65A 4YSYA 4I59A 1H83A 4BV6A 3NLCA 4H4SA 1DXLA 1PXCA 3GYIA 2VVMA 3GMCA 4YSXA 4J2WA 4G6GA 4PAAA 4N9XA 4EIQA 1TDNA 5FS8A 2YLSA 3FIMB 3CN8A 4ADWA 4BJYA 3P1WA 1CJ3A 5BVAA 1D4EA 3T2YA 3VR9A 1K0LA 2YLXA 2WOIA 2Q6UA 4Z44A 2FJDA 4FK1C 2HQMA 2YVJA 1NPXA 2WPCA 1NHQA 3JSKA 3VRDB 2GVCA 4H4QA 3DK8A 3Q6JA 2EQ9A 5M10A 2JB1A 2FBWA 4HB9A 2Y6RA 1LPFA 3K30A 4JN9A 2BS4A 1CC6A 1DNCA 2BK4A 3B3RA 3HYWA 5TR3A 1H81A 4JDRA 4C74A 3BHFA 1CJ2A 3CPHG 3GDNA 4H4RA 4CNKA 1ONFA 3NIXA 1MXTA 3AYLA 1IUUA 3V3NA 1JNRA 1ZMCA 2GV8A 3GRTA 1GT8A 5J60A 3BI2A 2YM1A 4CRTA 2XVFA 2YG6A 4EQWA 2OALA 3NGCX 3NTDA 4JNQA 5EOWA 4GCMA 3CGCA 3AE8A 3CNJA 2X8HA 3QVRA 3CPJG 1BZLA 1E1KA 4XWRA 2B9WA 4BK1A 3CGBA 3DMEA 3FBSA 5KMQA 2GR2A 3UOVA 1DOCA 5U1OA 1YQZA 2O9ZA 1GSNA 1PBDA 4Z24A 4CBQA 2BK3A 2C3CA 2A8XA 5FS9A 2NVKX 3RNMA 4II3A 3Q9TA 4Z25A 2XFPA 3S5WA 1GXFA 2IIDA 1L9DA 1CC2A 4Z43A 4U8OA 3WE0A 1ZK7A 2BK5A 4NZHA 3F8PA 5U25A 4CY6A 2V3BA 4G74A 1E1MA 4A6NA 3I6DA 1GTHA 3V76A 4CCRA 1PHHA 3GRSA 3L1RA 4G9KA 4IVOB 3VR8A 5IPYA 3KVEA 1GPEA 5L46A 4K2XA 3CNDA 1LJ1A 3NN6X 1CC4A 1XHCA 3CGDA 2Q7VA 3P4RA 4C3YA 4IVMB 3AEFA 2XVHA 3AEEA 5KNLA 2WP6A 3ATRA 3UCLA 5IQ4A 4NTDA 4OPDA 3SZCA 5EB4A 5ER0A 2R0GA 4H2PA 2YG3A 2WDVA 3ABVA 4K5RA 4JQ9A 1GRBA 1K0JA 4GAPA 4EQRA 2FJEA 1GRTA 2H89A 2C67A 1JU2A 3T2ZA 4U8NA 2WBAA 3GD3A 1LQTA 5IQ1A 2BS3A 1FEBA 2TMDA 3AD9B 3DA1A 1ZOVA 1MOKA 4O5QA 3CNTA 4TM1A 2XDOA 1IJHA 1CBOA 2WPFA 2AQJA 2YQUA 3P4QA 1GALA 2PYXA 5JCKA 2JB2A 1P2EA 4U8JA 2V5ZA 4UP3A 3SQPA 2R45A 1QLBA 4OPCA 1KFYA 1CJCA 2JAEA 1NG4A 1COYA 1F3PA 4GF7A 3NTAA 4HA6A 1CJ4A 1V59A 1CL0A 5GSNA 3ICRA 2XCGA 3M13A 1H86A 3T37A 4B63A 3AD7B 1OJDA 1KNPA 4U2SA 3ITJA 2FJBA 3PS9A 4REKA 2B9XA 5DBJA 4M52A 1DODA 1PXBA 4J33A 3AB1A 1PN0A 4YKFA 5M0ZA 1NENA 3ISHA 3L8KA 4GDEA 2VZ2A 1X31B 1PJ5A 2VOUA 4AP3A 3EPTA 2XLSA 2RGOA 2WESA 2RGJA 3IF9A 1KNRA 3SZ0A 1OJ9A 1TDKA 4YSHA 3NT6A 3NKSA 1FOHA 1REOA 3AEGA 1VRQB 4UDQA 4AOSA 3AE6A 4XXGA 1ZMDA 3QSMA 4GDPA 2YLRA 3HYVA 2GR0A 4WCTA 1GRGA 2AAQA 3AXBA 3V3OA 3UP5A 1PBFA 3IC9A 1EL8A 4GUVA 3KPFA 4OPIA 1NDAA 1H84A 4EM3A 2V6OA 2Y6QA 3CTYA 4DNAA 3D1CA 1KSSA 1ELIA 1GNDA 2X8CA 3ALJA 3NN0X 2CFYA 1JEHA 2TPRA 3AE1A 1XPQA 1FECA 1JRXA 2C65A 3OC4A 5HXIA 2JB3A 4D03A 1D4CA 4PABA 2EQ7A 3BNMA 1NEKA 5LV9A 2YWLA 4KPRA 1D5TA 1B5QA 1GEUA 2VRMA 4FX9A 2J3NA 5JCMA 2CVJA 3UKPA 3BI5A 2GMHA 4H7UA 2ACZA 1ZKQA 2VVLA 2OLNA 3RP6A 3K7QX 1DJQA 1S3EA 1KSUA 2QCUA 3NK0X 1BKWA 3QSSA 1S2QA 4E0VA 3FPZA 1TRBA 4G6HA 3DJDA 1IUWA 4U2TA 4LA1A 2OA1A 3S61A 2GH5A 3M12A 2XLRA 1P2HA 4X9NA 4XWZA 4AOXA 4OPGA 3AE4A 1HYUA 3UOXA 2IVEA 5BRTA 3NRNA 2AR8A 4J31A 2C76A 4H4TA 4P9SA 2WEUA 3UKFA 5EBKA 1Z6LA 4BK3A 5KMSA 5KWFA 1O95A 2YM2A 1AOGA 1PJ6A 2C73A 3F8RA 2BCPA 2C7GA 2I0ZA 4GR1A 4NEVA 4ICYA 1TDEA 1IUSA 2Z5YA 3RP8A 2BRYA 2XFUA 3VQRA 2Q0LA 2R0PA 1YY5A 3M0OA 1GETA 1UKVG 1DOBA 4K8DA 1E39A 1L9EA 2YG5A 4Z2UA 4OPLA 3UTFA 2YG7A 2GR1A 3AEBA 5JCNA 2WS3A 1K4QA 1XDIA 2OLOA 1E7PA 1K0IA 4YSZA 1DJNA 2BYBA 2BXSA 3NH3X 1RSGA 2Z5XA 3SM8A 4H4UA 1Y56A 2APGA 4RG4A 1D4DA 2BCGG 4Y4LA 5HY5A 4B67A 2XFOA 3KD9A 3LZWA 1L0VA 3DJJA 3KU9A 4H50A 4JNAA 4IA5A 2XLTA 4NNJA 4A7AA 1N4WA 1OJCA 2C4CA 4FK1A 2GAGB 3T2KA 5BULA 4CNJA 2BC1A 2YVFA 2B7SA 1RYIA 4B64A 3UOYA 4B65A 3DJEA 4YTPA 2XYOA 2JKCA 4J34A 3GYJA 3IHMA 3QVPA 3UKHA 4O5UA 3B6DA 1LTXR 1BGJA 3PVCA 1GRFA 1W4XA 1N4UA 4Z2RA 1JNZA 3UKAA 2ARDA 1H7XA 3NK1X 3SXIA 1FL2A 2C75A 2FJAA 4RSLA 3EANA 4NTEA 2C66A 3UTHA 3BI4A 3ATQA 3ZDNA 4ZN0A 3VRAA 1Y56B 4AP1A 3CNPA 1B4VA 2A87A 2RGHA 4C3XA 1LV0A 3ALLA 1BGNA 4EQXA 3SZFA 3II4A 4H4VA 1IUXA 5FS7A 2GEWA 3HYXA 4TM0A 3KKJA 5EB5A 2PHHA 1IUVA 3NHOX 2BA9A 1QO8A 3COXA 4Z26A 3HZLA 4Y4MA 2R4JA 1VG9A 2XLUA 3SZWA 5KMPA 2GR3A 2WPEA 1S2YA 2GMJA 1YKJA 4J57A 3ICTA 4GRTA 2C70A 2X8GA 3H8IA 3SFEA 3PO7A 4YTNA 3RP7A 2R9ZA 4LIIA 3AWIA 4YWOA 1H6VA 3G5SA 1L9CA 1TDFA 3O0HA 4NTCA 4USRA 1DOEA 1TDOA 3C4AA 4OPTA 3UKKA 3LZXA 2GB0A 4MJWA 1PJ7A 2BXRA 3ADAB 1QJDA 5GRTA 5FS6A 3C96A 3RHAA 1OJTA 3CIRA 3NG7X 1N4VA 5KRQA 4EMWA 4U8PA 2EQ6A 2X3NA 4H4ZA 4RG3A 1VDCA 3NK2X 2B76A 4EIPA 1GREA 2JBVA 3EF6A 4TM3A 4UDRA 2XFQA 4DSHA 4D04A 2ZZCA 1ZDLA 3AE7A 1ZX9A 2X99A 1PBEA 3K7MX 1BF3A 4B1BA 1GRHA 4DGKA 1BWCA 3SGLA 4BURA 1GRAA 2BC0A 3AYJA 2GF3A 3URHA 4H4XA 4I58A 2VQ7A 4TLZA 3QSEA 3P9UA 1RP0A 2IVDA 2E1MA 4EMIA 4K5SA 2V61A 1GTEA 1PXAA 3LB8A 1EL5A 1NHRA 3DGZA 3H4KA 4J36A 5FMHA 1F6MA 1NHPA 3G5RA 1Q1RA 3AE2A 3SY4A 2GAHB 2XLPA 4Y4NA 3K7TA 3REDA 2YVGA 4H2RA 2YLWA 2BACA 1FCDA 2YR5A 2A89A 2WP9A 3C4NA 2WDRA 5HYMA 2YR4A 2C72A 2E4GA 3UP4A 3D8XA 4J56A 4U8IA 1OJAA 1ZOYA 4APNA 1M6IA 2YAUA 3QJ4A 1GESA 1Y0PA 4C5OA 1XANA 1YQ3A 3T14A 2ZZ0A 4EMJA 4A5LA 2WU2A 4B68A 2VRLA 4NEWA 3P4SA 5JCLA 3NNEA 3AEAA 4ECHA 1ZY8A 1N1PA 2QA1A 3ICSA 2YLTA 4YKGA 1E1NA 4EM4A 4USQA 3AEDA 2QAEA 5KOWA 3DH9A 1GV4A 1O5WA 5CKUA 2WP5A 4B66A 1GERA 2WOWA 4U8LA 4BJZA 1GOSA 5KVHA 3GDPA 1E1LA 2BRAA 3G5QA 3LOVA 5C3JA 2B7RA 1ZP0A 2VQBA 4TLXA 2UZZA 3NYCA 1EL9A 3LXDA 3AE9A 4IV9A 5KOXA 3GMBA 2R4EA 2EQ8A 1EBDA 2CULA 4KX6A 3FMWA 2DKIA 2E5VA 1LQUA 3DK4A 1JOAA 3LADA 1PBBA 3ZYXA 3GSIA 1CHUA 1EL7A 4JY2A 2GQFA 4NWZA 4A99A 1MO9A 4H2NA 3FG2P 1H7WA 2V3AA 3UKLA 2JK6A 1B8SA 2YR6A 3CGEA 4G73A 2R46A 4II2A 4ZCDA 3UTEA 1S3BA 3UTGA 1F8SA 4OVIA 4YT0A 5JCIA 3EAOA 5KXJA 4X4JA 4CY8A 3VRBA 5BUKA 4YTMA 3DJGX 2R0CA 4BK2A 2XVJA 4WX1A 1NAAA 2QA2A 3E1TA 4Z2TA 2DKHA 1PDHA 4IA6A 3H8LA 3T31A 1TYPA 4B69A 2WETA 1H82A 2WHDA 4H4WA 2XFNA 4GAVA 4X9MA 1F8WA 2BS2A 2V60A 3GWFA 3AECA 3BNUA 4K22A 4H4YA 4DSGA 2NPXA 1JRZA 4A9WA 4U8MA 3SFDA 3AE3A 5U63A 1B37A 3KA7A 5KVIA 2X50A 3F8DA 3T0KA 3AYIA 2WU5A 2WOVA 2F5ZA 4U8KA 4A79A 4H4PA 5J7XA 3KPKA 3NYEA 1M64A 4A6NB 3DK9A 1CF3A 1VG0A 4U2LA 2CDUA 1Q9IA 3LJPA 5KMRA 1LVLA 4FDCB 2W0HA 3AE5A 3OZ2A 4ZCCA 2C64A 4AT0A 2H88A 1NG3A 2YG4A 4LU6A 1YQ4A 3GYXA 3ALMA 2OAMA 3DGHA 1E6EA 3NYFA 3QFAA 4H2QA 1TYTA 2GQWA 3I3LA 1Q1WA 3SX6A 2VVLG 1PBCA 2GRTA 3UOZA 1IUTA 2WQYA 3GWDA 4YXDA 1NHSA 1JRYA 5HHFA 3R9UA 2C3DA 2XVIA 3CPIG 3IHGA 4CCQA 2Q0KA 5C2TA 3UKQA 4OPUA 4OCGA 1SEZA 2WDQA 3CMMA 3CNSA 2YLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEA A;  3BHK A;  4AT2 A;  2ZBW A;  4C77 A;  1D7Y A;  2B9Y A;  5CQF A;  3KLJ A;  1O94 A;  3GD4 A;  1VQW A;  2BAB A;  4EQS A;  4TM4 A;  3IWA A;  1PS9 A;  3QFB A;  2RAB A;  1KF6 A;  3AD8 B;  4JY3 A;  4K7Z A;  2XVE A;  1F8R A;  1KDG A;  2ZZB A;  4UDP A;  1D7L A;  4A65 A;  4YSY A;  4I59 A;  1H83 A;  4BV6 A;  3NLC A;  4H4S A;  1DXL A;  1PXC A;  3GYI A;  2VVM A;  3GMC A;  4YSX A;  4J2W A;  4PAA A;  4N9X A;  4EIQ A;  1TDN A;  5FS8 A;  2YLS A;  3FIM B;  3CN8 A;  4ADW A;  4BJY A;  3P1W A;  1CJ3 A;  5BVA A;  1D4E A;  3VR9 A;  1K0L A;  2YLX A;  2WOI A;  2Q6U A;  4Z44 A;  2FJD A;  4FK1 C;  2HQM A;  2YVJ A;  1NPX A;  2WPC A;  1NHQ A;  3JSK A;  3VRD B;  2GVC A;  4H4Q A;  3DK8 A;  3Q6J A;  2EQ9 A;  5M10 A;  2JB1 A;  2FBW A;  4HB9 A;  2Y6R A;  1LPF A;  3K30 A;  4JN9 A;  2BS4 A;  1CC6 A;  1DNC A;  2BK4 A;  3B3R A;  5TR3 A;  1H81 A;  4JDR A;  4C74 A;  3BHF A;  1CJ2 A;  3CPH G;  3GDN A;  4H4R A;  4CNK A;  1ONF A;  3NIX A;  1MXT A;  3AYL A;  1IUU A;  3V3N A;  1JNR A;  1ZMC A;  2GV8 A;  3GRT A;  1GT8 A;  5J60 A;  3BI2 A;  2YM1 A;  4CRT A;  2XVF A;  2YG6 A;  4EQW A;  2OAL A;  3NGC X;  3NTD A;  4JNQ A;  5EOW A;  4GCM A;  3CGC A;  3AE8 A;  3CNJ A;  2X8H A;  3QVR A;  3CPJ G;  1BZL A;  1E1K A;  4XWR A;  2B9W A;  4BK1 A;  3CGB A;  3DME A;  3FBS A;  2GR2 A;  3UOV A;  1DOC A;  5U1O A;  1YQZ A;  2O9Z A;  1GSN A;  1PBD A;  4Z24 A;  4CBQ A;  2BK3 A;  2C3C A;  2A8X A;  5FS9 A;  2NVK X;  3RNM A;  4Z25 A;  3Q9T A;  2XFP A;  3S5W A;  1GXF A;  2IID A;  1L9D A;  1CC2 A;  4Z43 A;  4U8O A;  3WE0 A;  1ZK7 A;  2BK5 A;  4NZH A;  3F8P A;  5U25 A;  4CY6 A;  2V3B A;  1E1M A;  4A6N A;  3I6D A;  1GTH A;  3V76 A;  4CCR A;  1PHH A;  3GRS A;  3L1R A;  4IVO B;  3VR8 A;  5IPY A;  3KVE A;  1GPE A;  5L46 A;  4K2X A;  3CND A;  1LJ1 A;  3NN6 X;  1CC4 A;  1XHC A;  3CGD A;  2Q7V A;  3P4R A;  4C3Y A;  4IVM B;  3AEF A;  2XVH A;  3AEE A;  2WP6 A;  3ATR A;  3UCL A;  5IQ4 A;  4NTD A;  4OPD A;  5EB4 A;  5ER0 A;  2R0G A;  4H2P A;  2YG3 A;  2WDV A;  3ABV A;  4K5R A;  4JQ9 A;  1GRB A;  1K0J A;  4EQR A;  2FJE A;  1GRT A;  2H89 A;  2C67 A;  1JU2 A;  4U8N A;  2WBA A;  3GD3 A;  1LQT A;  5IQ1 A;  2BS3 A;  1FEB A;  2TMD A;  3AD9 B;  3DA1 A;  1ZOV A;  1MOK A;  4O5Q A;  3CNT A;  4TM1 A;  2XDO A;  1IJH A;  1CBO A;  2WPF A;  2AQJ A;  2YQU A;  3P4Q A;  1GAL A;  2PYX A;  5JCK A;  2JB2 A;  1P2E A;  4U8J A;  2V5Z A;  4UP3 A;  3SQP A;  2R45 A;  1QLB A;  4OPC A;  1KFY A;  1CJC A;  2JAE A;  1NG4 A;  1COY A;  1F3P A;  4GF7 A;  3NTA A;  4HA6 A;  1CJ4 A;  1V59 A;  1CL0 A;  5GSN A;  3ICR A;  2XCG A;  3M13 A;  1H86 A;  3T37 A;  4B63 A;  3AD7 B;  1OJD A;  1KNP A;  4U2S A;  3ITJ A;  2FJB A;  3PS9 A;  4REK A;  2B9X A;  5DBJ A;  4M52 A;  1DOD A;  1PXB A;  4J33 A;  3AB1 A;  1PN0 A;  4YKF A;  5M0Z A;  1NEN A;  3ISH A;  3L8K A;  4GDE A;  2VZ2 A;  1X31 B;  1PJ5 A;  2VOU A;  4AP3 A;  3EPT A;  2XLS A;  2RGO A;  2WES A;  2RGJ A;  3IF9 A;  1KNR A;  1OJ9 A;  1TDK A;  4YSH A;  3NT6 A;  3NKS A;  1FOH A;  1REO A;  3AEG A;  1VRQ B;  4UDQ A;  4AOS A;  3AE6 A;  4XXG A;  1ZMD A;  3QSM A;  4GDP A;  2YLR A;  2GR0 A;  4WCT A;  1GRG A;  2AAQ A;  3AXB A;  3V3O A;  3UP5 A;  1PBF A;  3IC9 A;  1EL8 A;  4GUV A;  3KPF A;  4OPI A;  1NDA A;  1H84 A;  4EM3 A;  2V6O A;  2Y6Q A;  3CTY A;  4DNA A;  3D1C A;  1KSS A;  1ELI A;  1GND A;  2X8C A;  3ALJ A;  3NN0 X;  2CFY A;  1JEH A;  2TPR A;  3AE1 A;  1XPQ A;  1FEC A;  1JRX A;  2C65 A;  3OC4 A;  5HXI A;  2JB3 A;  4D03 A;  1D4C A;  4PAB A;  2EQ7 A;  3BNM A;  1NEK A;  5LV9 A;  2YWL A;  4KPR A;  1D5T A;  1B5Q A;  1GEU A;  2VRM A;  4FX9 A;  2J3N A;  5JCM A;  2CVJ A;  3UKP A;  3BI5 A;  2GMH A;  4H7U A;  2ACZ A;  1ZKQ A;  2VVL A;  2OLN A;  3RP6 A;  3K7Q X;  1DJQ A;  1S3E A;  1KSU A;  2QCU A;  3NK0 X;  1BKW A;  3QSS A;  1S2Q A;  4E0V A;  3FPZ A;  1TRB A;  3DJD A;  1IUW A;  4U2T A;  4LA1 A;  2OA1 A;  3S61 A;  2GH5 A;  3M12 A;  2XLR A;  1P2H A;  4X9N A;  4XWZ A;  4AOX A;  4OPG A;  3AE4 A;  1HYU A;  3UOX A;  2IVE A;  5BRT A;  3NRN A;  2AR8 A;  4J31 A;  2C76 A;  4H4T A;  4P9S A;  2WEU A;  3UKF A;  5EBK A;  1Z6L A;  4BK3 A;  5KWF A;  1O95 A;  2YM2 A;  1AOG A;  1PJ6 A;  2C73 A;  3F8R A;  2BCP A;  2C7G A;  2I0Z A;  4GR1 A;  4NEV A;  4ICY A;  1TDE A;  1IUS A;  2Z5Y A;  3RP8 A;  2XFU A;  3VQR A;  2Q0L A;  2R0P A;  1YY5 A;  3M0O A;  1GET A;  1UKV G;  1DOB A;  4K8D A;  1E39 A;  1L9E A;  2YG5 A;  4Z2U A;  4OPL A;  3UTF A;  2YG7 A;  2GR1 A;  3AEB A;  5JCN A;  2WS3 A;  1K4Q A;  1XDI A;  2OLO A;  1E7P A;  1K0I A;  4YSZ A;  1DJN A;  2BYB A;  2BXS A;  3NH3 X;  1RSG A;  2Z5X A;  3SM8 A;  4H4U A;  1Y56 A;  2APG A;  4RG4 A;  1D4D A;  2BCG G;  4Y4L A;  5HY5 A;  4B67 A;  2XFO A;  3KD9 A;  3LZW A;  1L0V A;  3DJJ A;  3KU9 A;  4H50 A;  4JNA A;  4IA5 A;  2XLT A;  4A7A A;  1N4W A;  1OJC A;  4FK1 A;  2GAG B;  5BUL A;  4CNJ A;  2BC1 A;  2YVF A;  2B7S A;  1RYI A;  4B64 A;  3UOY A;  4B65 A;  3DJE A;  4YTP A;  2XYO A;  2JKC A;  4J34 A;  3GYJ A;  3IHM A;  3QVP A;  3UKH A;  4O5U A;  3B6D A;  1LTX R;  1BGJ A;  3PVC A;  1GRF A;  1W4X A;  1N4U A;  4Z2R A;  1JNZ A;  3UKA A;  2ARD A;  1H7X A;  3NK1 X;  1FL2 A;  2C75 A;  2FJA A;  4RSL A;  3EAN A;  4NTE A;  2C66 A;  3UTH A;  3BI4 A;  3ATQ A;  3ZDN A;  4ZN0 A;  3VRA A;  1Y56 B;  4AP1 A;  3CNP A;  1B4V A;  2A87 A;  2RGH A;  4C3X A;  1LV0 A;  3ALL A;  1BGN A;  4EQX A;  3II4 A;  4H4V A;  1IUX A;  5FS7 A;  2GEW A;  4TM0 A;  5EB5 A;  3KKJ A;  2PHH A;  1IUV A;  3NHO X;  2BA9 A;  1QO8 A;  3COX A;  4Z26 A;  3HZL A;  4Y4M A;  2R4J A;  1VG9 A;  2XLU A;  2GR3 A;  2WPE A;  1S2Y A;  2GMJ A;  1YKJ A;  4J57 A;  3ICT A;  4GRT A;  2C70 A;  2X8G A;  3H8I A;  3SFE A;  3PO7 A;  4YTN A;  3RP7 A;  2R9Z A;  4LII A;  3AWI A;  4YWO A;  1H6V A;  3G5S A;  1L9C A;  1TDF A;  3O0H A;  4NTC A;  4USR A;  1DOE A;  1TDO A;  3C4A A;  4OPT A;  3UKK A;  3LZX A;  2GB0 A;  4MJW A;  1PJ7 A;  2BXR A;  3ADA B;  1QJD A;  5GRT A;  5FS6 A;  3C96 A;  3RHA A;  1OJT A;  3CIR A;  3NG7 X;  1N4V A;  5KRQ A;  4EMW A;  4U8P A;  2EQ6 A;  2X3N A;  4H4Z A;  4RG3 A;  1VDC A;  3NK2 X;  2B76 A;  4EIP A;  1GRE A;  2JBV A;  3EF6 A;  4TM3 A;  4UDR A;  2XFQ A;  4DSH A;  4D04 A;  2ZZC A;  1ZDL A;  3AE7 A;  1ZX9 A;  2X99 A;  1PBE A;  3K7M X;  1BF3 A;  4B1B A;  1GRH A;  4DGK A;  1BWC A;  3SGL A;  4BUR A;  1GRA A;  2BC0 A;  3AYJ A;  2GF3 A;  3URH A;  4H4X A;  4I58 A;  2VQ7 A;  4TLZ A;  3QSE A;  3P9U A;  1RP0 A;  2IVD A;  2E1M A;  4EMI A;  4K5S A;  2V61 A;  1GTE A;  1PXA A;  3LB8 A;  1EL5 A;  1NHR A;  3DGZ A;  3H4K A;  4J36 A;  5FMH A;  1F6M A;  1NHP A;  3G5R A;  1Q1R A;  3AE2 A;  2GAH B;  2XLP A;  4Y4N A;  3K7T A;  3RED A;  2YVG A;  4H2R A;  2YLW A;  2BAC A;  1FCD A;  2YR5 A;  2A89 A;  2WP9 A;  3C4N A;  2WDR A;  5HYM A;  2YR4 A;  2C72 A;  2E4G A;  3UP4 A;  3D8X A;  4J56 A;  4U8I A;  1OJA A;  1ZOY A;  4APN A;  1M6I A;  2YAU A;  3QJ4 A;  1GES A;  1Y0P A;  4C5O A;  1XAN A;  1YQ3 A;  4EMJ A;  2ZZ0 A;  4A5L A;  2WU2 A;  4B68 A;  2VRL A;  4NEW A;  3P4S A;  5JCL A;  3NNE A;  3AEA A;  4ECH A;  1ZY8 A;  1N1P A;  2QA1 A;  3ICS A;  2YLT A;  4YKG A;  1E1N A;  4EM4 A;  4USQ A;  3AED A;  2QAE A;  5KOW A;  3DH9 A;  1GV4 A;  1O5W A;  5CKU A;  2WP5 A;  4B66 A;  1GER A;  2WOW A;  4U8L A;  4BJZ A;  1GOS A;  5KVH A;  3GDP A;  1E1L A;  3G5Q A;  3LOV A;  5C3J A;  2B7R A;  1ZP0 A;  2VQB A;  4TLX A;  2UZZ A;  3NYC A;  1EL9 A;  3LXD A;  3AE9 A;  4IV9 A;  5KOX A;  3GMB A;  2R4E A;  2EQ8 A;  1EBD A;  2CUL A;  4KX6 A;  3FMW A;  2DKI A;  2E5V A;  1LQU A;  3DK4 A;  1JOA A;  3LAD A;  1PBB A;  3ZYX A;  3GSI A;  1CHU A;  1EL7 A;  4JY2 A;  2GQF A;  4A99 A;  1MO9 A;  4H2N A;  3FG2 P;  1H7W A;  2V3A A;  3UKL A;  2JK6 A;  1B8S A;  2YR6 A;  3CGE A;  2R46 A;  4ZCD A;  3UTE A;  1S3B A;  3UTG A;  1F8S A;  4OVI A;  4YT0 A;  5JCI A;  3EAO A;  5KXJ A;  4X4J A;  4CY8 A;  3VRB A;  5BUK A;  4YTM A;  3DJG X;  2R0C A;  4BK2 A;  2XVJ A;  4WX1 A;  1NAA A;  2QA2 A;  3E1T A;  4Z2T A;  2DKH A;  1PDH A;  4IA6 A;  3H8L A;  4B69 A;  1TYP A;  2WET A;  1H82 A;  2WHD A;  4H4W A;  2XFN A;  4X9M A;  1F8W A;  2BS2 A;  2V60 A;  3GWF A;  3AEC A;  3BNU A;  4K22 A;  4H4Y A;  4DSG A;  2NPX A;  1JRZ A;  4A9W A;  4U8M A;  3SFD A;  3AE3 A;  5U63 A;  1B37 A;  3KA7 A;  5KVI A;  2X50 A;  3F8D A;  3AYI A;  2WU5 A;  2WOV A;  2F5Z A;  4U8K A;  4A79 A;  4H4P A;  5J7X A;  3NYE A;  1M64 A;  4A6N B;  3DK9 A;  1CF3 A;  1VG0 A;  4U2L A;  2CDU A;  1Q9I A;  3LJP A;  1LVL A;  4FDC B;  2W0H A;  3AE5 A;  3OZ2 A;  4ZCC A;  2C64 A;  4AT0 A;  2H88 A;  1NG3 A;  2YG4 A;  4LU6 A;  1YQ4 A;  3ALM A;  2OAM A;  3DGH A;  1E6E A;  3NYF A;  3QFA A;  4H2Q A;  1TYT A;  2GQW A;  3I3L A;  1Q1W A;  2VVL G;  1PBC A;  2GRT A;  3UOZ A;  1IUT A;  2WQY A;  3GWD A;  4YXD A;  1NHS A;  1JRY A;  5HHF A;  3R9U A;  2C3D A;  2XVI A;  3CPI G;  3IHG A;  4CCQ A;  2Q0K A;  5C2T A;  3UKQ A;  4OPU A;  4OCG A;  1SEZ A;  2WDQ A;  3P4P A;  3CNS A;  2YLZ A; 
#chains in the Genus database with same CATH topology
 1FEA A;  3BHK A;  4AT2 A;  2ZBW A;  4C77 A;  1D7Y A;  3SYI A;  2B9Y A;  5CQF A;  3KLJ A;  1O94 A;  3GD4 A;  1VQW A;  2BAB A;  3P4P A;  4EQS A;  4TM4 A;  3IWA A;  1PS9 A;  3QFB A;  2RAB A;  1KF6 A;  3AD8 B;  4JY3 A;  4K7Z A;  2XVE A;  1F8R A;  1KDG A;  2ZZB A;  4UDP A;  1D7L A;  4A65 A;  4YSY A;  4I59 A;  1H83 A;  4BV6 A;  3NLC A;  4H4S A;  1DXL A;  1PXC A;  3GYI A;  2VVM A;  3GMC A;  4YSX A;  4J2W A;  4G6G A;  4PAA A;  4N9X A;  4EIQ A;  1TDN A;  5FS8 A;  2YLS A;  3FIM B;  3CN8 A;  4ADW A;  4BJY A;  3P1W A;  1CJ3 A;  5BVA A;  1D4E A;  3T2Y A;  3VR9 A;  1K0L A;  2YLX A;  2WOI A;  2Q6U A;  4Z44 A;  2FJD A;  4FK1 C;  2HQM A;  2YVJ A;  1NPX A;  2WPC A;  1NHQ A;  3JSK A;  3VRD B;  2GVC A;  4H4Q A;  3DK8 A;  3Q6J A;  2EQ9 A;  5M10 A;  2JB1 A;  2FBW A;  4HB9 A;  2Y6R A;  1LPF A;  3K30 A;  4JN9 A;  2BS4 A;  1CC6 A;  1DNC A;  2BK4 A;  3B3R A;  3HYW A;  5TR3 A;  1H81 A;  4JDR A;  4C74 A;  3BHF A;  1CJ2 A;  3CPH G;  3GDN A;  4H4R A;  4CNK A;  1ONF A;  3NIX A;  1MXT A;  3AYL A;  1IUU A;  3V3N A;  1JNR A;  1ZMC A;  2GV8 A;  3GRT A;  1GT8 A;  5J60 A;  3BI2 A;  2YM1 A;  4CRT A;  2XVF A;  2YG6 A;  4EQW A;  2OAL A;  3NGC X;  3NTD A;  4JNQ A;  5EOW A;  4GCM A;  3CGC A;  3AE8 A;  3CNJ A;  2X8H A;  3QVR A;  3CPJ G;  1BZL A;  1E1K A;  4XWR A;  2B9W A;  4BK1 A;  3CGB A;  3DME A;  3FBS A;  5KMQ A;  2GR2 A;  3UOV A;  1DOC A;  5U1O A;  1YQZ A;  2O9Z A;  1GSN A;  1PBD A;  4Z24 A;  4CBQ A;  2BK3 A;  2C3C A;  2A8X A;  5FS9 A;  2NVK X;  3RNM A;  4II3 A;  3Q9T A;  4Z25 A;  2XFP A;  3S5W A;  1GXF A;  2IID A;  1L9D A;  1CC2 A;  4Z43 A;  4U8O A;  3WE0 A;  1ZK7 A;  2BK5 A;  4NZH A;  3F8P A;  5U25 A;  4CY6 A;  2V3B A;  4G74 A;  1E1M A;  4A6N A;  3I6D A;  1GTH A;  3V76 A;  4CCR A;  1PHH A;  3GRS A;  3L1R A;  4G9K A;  4IVO B;  3VR8 A;  5IPY A;  3KVE A;  1GPE A;  5L46 A;  4K2X A;  3CND A;  1LJ1 A;  3NN6 X;  1CC4 A;  1XHC A;  3CGD A;  2Q7V A;  3P4R A;  4C3Y A;  4IVM B;  3AEF A;  2XVH A;  3AEE A;  5KNL A;  2WP6 A;  3ATR A;  3UCL A;  5IQ4 A;  4NTD A;  4OPD A;  3SZC A;  5EB4 A;  5ER0 A;  2R0G A;  4H2P A;  2YG3 A;  2WDV A;  3ABV A;  4K5R A;  4JQ9 A;  1GRB A;  1K0J A;  4GAP A;  4EQR A;  2FJE A;  1GRT A;  2H89 A;  2C67 A;  1JU2 A;  3T2Z A;  4U8N A;  2WBA A;  3GD3 A;  1LQT A;  5IQ1 A;  2BS3 A;  1FEB A;  2TMD A;  3AD9 B;  3DA1 A;  1ZOV A;  1MOK A;  4O5Q A;  3CNT A;  4TM1 A;  2XDO A;  1IJH A;  1CBO A;  2WPF A;  2AQJ A;  2YQU A;  3P4Q A;  1GAL A;  2PYX A;  5JCK A;  2JB2 A;  1P2E A;  4U8J A;  2V5Z A;  4UP3 A;  3SQP A;  2R45 A;  1QLB A;  4OPC A;  1KFY A;  1CJC A;  2JAE A;  1NG4 A;  1COY A;  1F3P A;  4GF7 A;  3NTA A;  4HA6 A;  1CJ4 A;  1V59 A;  1CL0 A;  5GSN A;  3ICR A;  2XCG A;  3M13 A;  1H86 A;  3T37 A;  4B63 A;  3AD7 B;  1OJD A;  1KNP A;  4U2S A;  3ITJ A;  2FJB A;  3PS9 A;  4REK A;  2B9X A;  5DBJ A;  4M52 A;  1DOD A;  1PXB A;  4J33 A;  3AB1 A;  1PN0 A;  4YKF A;  5M0Z A;  1NEN A;  3ISH A;  3L8K A;  4GDE A;  2VZ2 A;  1X31 B;  1PJ5 A;  2VOU A;  4AP3 A;  3EPT A;  2XLS A;  2RGO A;  2WES A;  2RGJ A;  3IF9 A;  1KNR A;  3SZ0 A;  1OJ9 A;  1TDK A;  4YSH A;  3NT6 A;  3NKS A;  1FOH A;  1REO A;  3AEG A;  1VRQ B;  4UDQ A;  4AOS A;  3AE6 A;  4XXG A;  1ZMD A;  3QSM A;  4GDP A;  2YLR A;  3HYV A;  2GR0 A;  4WCT A;  1GRG A;  2AAQ A;  3AXB A;  3V3O A;  3UP5 A;  1PBF A;  3IC9 A;  1EL8 A;  4GUV A;  3KPF A;  4OPI A;  1NDA A;  1H84 A;  4EM3 A;  2V6O A;  2Y6Q A;  3CTY A;  4DNA A;  3D1C A;  1KSS A;  1ELI A;  1GND A;  2X8C A;  3ALJ A;  3NN0 X;  2CFY A;  1JEH A;  2TPR A;  3AE1 A;  1XPQ A;  1FEC A;  1JRX A;  2C65 A;  3OC4 A;  5HXI A;  2JB3 A;  4D03 A;  1D4C A;  4PAB A;  2EQ7 A;  3BNM A;  1NEK A;  5LV9 A;  2YWL A;  4KPR A;  1D5T A;  1B5Q A;  1GEU A;  2VRM A;  4FX9 A;  2J3N A;  5JCM A;  2CVJ A;  3UKP A;  3BI5 A;  2GMH A;  4H7U A;  2ACZ A;  1ZKQ A;  2VVL A;  2OLN A;  3RP6 A;  3K7Q X;  1DJQ A;  1S3E A;  1KSU A;  2QCU A;  3NK0 X;  1BKW A;  3QSS A;  1S2Q A;  4E0V A;  3FPZ A;  1TRB A;  4G6H A;  3DJD A;  1IUW A;  4U2T A;  4LA1 A;  2OA1 A;  3S61 A;  2GH5 A;  3M12 A;  2XLR A;  1P2H A;  4X9N A;  4XWZ A;  4AOX A;  4OPG A;  3AE4 A;  1HYU A;  3UOX A;  2IVE A;  5BRT A;  3NRN A;  2AR8 A;  4J31 A;  2C76 A;  4H4T A;  4P9S A;  2WEU A;  3UKF A;  5EBK A;  1Z6L A;  4BK3 A;  5KMS A;  5KWF A;  1O95 A;  2YM2 A;  1AOG A;  1PJ6 A;  2C73 A;  3F8R A;  2BCP A;  2C7G A;  2I0Z A;  4GR1 A;  4NEV A;  4ICY A;  1TDE A;  1IUS A;  2Z5Y A;  3RP8 A;  2BRY A;  2XFU A;  3VQR A;  2Q0L A;  2R0P A;  1YY5 A;  3M0O A;  1GET A;  1UKV G;  1DOB A;  4K8D A;  1E39 A;  1L9E A;  2YG5 A;  4Z2U A;  4OPL A;  3UTF A;  2YG7 A;  2GR1 A;  3AEB A;  5JCN A;  2WS3 A;  1K4Q A;  1XDI A;  2OLO A;  1E7P A;  1K0I A;  4YSZ A;  1DJN A;  2BYB A;  2BXS A;  3NH3 X;  1RSG A;  2Z5X A;  3SM8 A;  4H4U A;  1Y56 A;  2APG A;  4RG4 A;  1D4D A;  2BCG G;  4Y4L A;  5HY5 A;  4B67 A;  2XFO A;  3KD9 A;  3LZW A;  1L0V A;  3DJJ A;  3KU9 A;  4H50 A;  4JNA A;  4IA5 A;  2XLT A;  4NNJ A;  4A7A A;  1N4W A;  1OJC A;  2C4C A;  4FK1 A;  2GAG B;  3T2K A;  5BUL A;  4CNJ A;  2BC1 A;  2YVF A;  2B7S A;  1RYI A;  4B64 A;  3UOY A;  4B65 A;  3DJE A;  4YTP A;  2XYO A;  2JKC A;  4J34 A;  3GYJ A;  3IHM A;  3QVP A;  3UKH A;  4O5U A;  3B6D A;  1LTX R;  1BGJ A;  3PVC A;  1GRF A;  1W4X A;  1N4U A;  4Z2R A;  1JNZ A;  3UKA A;  2ARD A;  1H7X A;  3NK1 X;  3SXI A;  1FL2 A;  2C75 A;  2FJA A;  4RSL A;  3EAN A;  4NTE A;  2C66 A;  3UTH A;  3BI4 A;  3ATQ A;  3ZDN A;  4ZN0 A;  3VRA A;  1Y56 B;  4AP1 A;  3CNP A;  1B4V A;  2A87 A;  2RGH A;  4C3X A;  1LV0 A;  3ALL A;  1BGN A;  4EQX A;  3SZF A;  3II4 A;  4H4V A;  1IUX A;  5FS7 A;  2GEW A;  3HYX A;  4TM0 A;  3KKJ A;  5EB5 A;  2PHH A;  1IUV A;  3NHO X;  2BA9 A;  1QO8 A;  3COX A;  4Z26 A;  3HZL A;  4Y4M A;  2R4J A;  1VG9 A;  2XLU A;  3SZW A;  5KMP A;  2GR3 A;  2WPE A;  1S2Y A;  2GMJ A;  1YKJ A;  4J57 A;  3ICT A;  4GRT A;  2C70 A;  2X8G A;  3H8I A;  3SFE A;  3PO7 A;  4YTN A;  3RP7 A;  2R9Z A;  4LII A;  3AWI A;  4YWO A;  1H6V A;  3G5S A;  1L9C A;  1TDF A;  3O0H A;  4NTC A;  4USR A;  1DOE A;  1TDO A;  3C4A A;  4OPT A;  3UKK A;  3LZX A;  2GB0 A;  4MJW A;  1PJ7 A;  2BXR A;  3ADA B;  1QJD A;  5GRT A;  5FS6 A;  3C96 A;  3RHA A;  1OJT A;  3CIR A;  3NG7 X;  1N4V A;  5KRQ A;  4EMW A;  4U8P A;  2EQ6 A;  2X3N A;  4H4Z A;  4RG3 A;  1VDC A;  3NK2 X;  2B76 A;  4EIP A;  1GRE A;  2JBV A;  3EF6 A;  4TM3 A;  4UDR A;  2XFQ A;  4DSH A;  4D04 A;  2ZZC A;  1ZDL A;  3AE7 A;  1ZX9 A;  2X99 A;  1PBE A;  3K7M X;  1BF3 A;  4B1B A;  1GRH A;  4DGK A;  1BWC A;  3SGL A;  4BUR A;  1GRA A;  2BC0 A;  3AYJ A;  2GF3 A;  3URH A;  4H4X A;  4I58 A;  2VQ7 A;  4TLZ A;  3QSE A;  3P9U A;  1RP0 A;  2IVD A;  2E1M A;  4EMI A;  4K5S A;  2V61 A;  1GTE A;  1PXA A;  3LB8 A;  1EL5 A;  1NHR A;  3DGZ A;  3H4K A;  4J36 A;  5FMH A;  1F6M A;  1NHP A;  3G5R A;  1Q1R A;  3AE2 A;  3SY4 A;  2GAH B;  2XLP A;  4Y4N A;  3K7T A;  3RED A;  2YVG A;  4H2R A;  2YLW A;  2BAC A;  1FCD A;  2YR5 A;  2A89 A;  2WP9 A;  3C4N A;  2WDR A;  5HYM A;  2YR4 A;  2C72 A;  2E4G A;  3UP4 A;  3D8X A;  4J56 A;  4U8I A;  1OJA A;  1ZOY A;  4APN A;  1M6I A;  2YAU A;  3QJ4 A;  1GES A;  1Y0P A;  4C5O A;  1XAN A;  1YQ3 A;  3T14 A;  2ZZ0 A;  4EMJ A;  4A5L A;  2WU2 A;  4B68 A;  2VRL A;  4NEW A;  3P4S A;  5JCL A;  3NNE A;  3AEA A;  4ECH A;  1ZY8 A;  1N1P A;  2QA1 A;  3ICS A;  2YLT A;  4YKG A;  1E1N A;  4EM4 A;  4USQ A;  3AED A;  2QAE A;  5KOW A;  3DH9 A;  1GV4 A;  1O5W A;  5CKU A;  2WP5 A;  4B66 A;  1GER A;  2WOW A;  4U8L A;  4BJZ A;  1GOS A;  5KVH A;  3GDP A;  1E1L A;  2BRA A;  3G5Q A;  3LOV A;  5C3J A;  2B7R A;  1ZP0 A;  2VQB A;  4TLX A;  2UZZ A;  3NYC A;  1EL9 A;  3LXD A;  3AE9 A;  4IV9 A;  5KOX A;  3GMB A;  2R4E A;  2EQ8 A;  1EBD A;  2CUL A;  4KX6 A;  3FMW A;  2DKI A;  2E5V A;  1LQU A;  3DK4 A;  1JOA A;  3LAD A;  1PBB A;  3ZYX A;  3GSI A;  1CHU A;  1EL7 A;  4JY2 A;  2GQF A;  4NWZ A;  4A99 A;  1MO9 A;  4H2N A;  3FG2 P;  1H7W A;  2V3A A;  3UKL A;  2JK6 A;  1B8S A;  2YR6 A;  3CGE A;  4G73 A;  2R46 A;  4II2 A;  4ZCD A;  3UTE A;  1S3B A;  3UTG A;  1F8S A;  4OVI A;  4YT0 A;  5JCI A;  3EAO A;  5KXJ A;  4X4J A;  4CY8 A;  3VRB A;  5BUK A;  4YTM A;  3DJG X;  2R0C A;  4BK2 A;  2XVJ A;  4WX1 A;  1NAA A;  2QA2 A;  3E1T A;  4Z2T A;  2DKH A;  1PDH A;  4IA6 A;  3H8L A;  3T31 A;  1TYP A;  4B69 A;  2WET A;  1H82 A;  2WHD A;  4H4W A;  2XFN A;  4GAV A;  4X9M A;  1F8W A;  2BS2 A;  2V60 A;  3GWF A;  3AEC A;  3BNU A;  4K22 A;  4H4Y A;  4DSG A;  2NPX A;  1JRZ A;  4A9W A;  4U8M A;  3SFD A;  3AE3 A;  5U63 A;  1B37 A;  3KA7 A;  5KVI A;  2X50 A;  3F8D A;  3T0K A;  3AYI A;  2WU5 A;  2WOV A;  2F5Z A;  4U8K A;  4A79 A;  4H4P A;  5J7X A;  3KPK A;  3NYE A;  1M64 A;  4A6N B;  3DK9 A;  1CF3 A;  1VG0 A;  4U2L A;  2CDU A;  1Q9I A;  3LJP A;  5KMR A;  1LVL A;  4FDC B;  2W0H A;  3AE5 A;  3OZ2 A;  4ZCC A;  2C64 A;  4AT0 A;  2H88 A;  1NG3 A;  2YG4 A;  4LU6 A;  1YQ4 A;  3GYX A;  3ALM A;  2OAM A;  3DGH A;  1E6E A;  3NYF A;  3QFA A;  4H2Q A;  1TYT A;  2GQW A;  3I3L A;  1Q1W A;  3SX6 A;  2VVL G;  1PBC A;  2GRT A;  3UOZ A;  1IUT A;  2WQY A;  3GWD A;  4YXD A;  1NHS A;  1JRY A;  5HHF A;  3R9U A;  2C3D A;  2XVI A;  3CPI G;  3IHG A;  4CCQ A;  2Q0K A;  5C2T A;  3UKQ A;  4OPU A;  4OCG A;  1SEZ A;  2WDQ A;  3CMM A;  3CNS A;  2YLZ A; 
#chains in the Genus database with same CATH homology
 1FEA A;  3BHK A;  4AT2 A;  2ZBW A;  4C77 A;  1D7Y A;  3SYI A;  2B9Y A;  5CQF A;  3KLJ A;  1O94 A;  3GD4 A;  1VQW A;  2BAB A;  3P4P A;  4EQS A;  4TM4 A;  3IWA A;  1PS9 A;  3QFB A;  2RAB A;  1KF6 A;  3AD8 B;  4JY3 A;  4K7Z A;  2XVE A;  1F8R A;  1KDG A;  2ZZB A;  4UDP A;  1D7L A;  4A65 A;  4YSY A;  4I59 A;  1H83 A;  4BV6 A;  3NLC A;  4H4S A;  1DXL A;  1PXC A;  3GYI A;  2VVM A;  3GMC A;  4YSX A;  4J2W A;  4G6G A;  4PAA A;  4N9X A;  4EIQ A;  1TDN A;  5FS8 A;  2YLS A;  3FIM B;  3CN8 A;  4ADW A;  4BJY A;  3P1W A;  1CJ3 A;  5BVA A;  1D4E A;  3T2Y A;  3VR9 A;  1K0L A;  2YLX A;  2WOI A;  2Q6U A;  4Z44 A;  2FJD A;  4FK1 C;  2HQM A;  2YVJ A;  1NPX A;  2WPC A;  1NHQ A;  3JSK A;  3VRD B;  2GVC A;  4H4Q A;  3DK8 A;  3Q6J A;  2EQ9 A;  5M10 A;  2JB1 A;  2FBW A;  4HB9 A;  2Y6R A;  1LPF A;  3K30 A;  4JN9 A;  2BS4 A;  1CC6 A;  1DNC A;  2BK4 A;  3B3R A;  3HYW A;  5TR3 A;  1H81 A;  4JDR A;  4C74 A;  3BHF A;  1CJ2 A;  3CPH G;  3GDN A;  4H4R A;  4CNK A;  1ONF A;  3NIX A;  1MXT A;  3AYL A;  1IUU A;  3V3N A;  1JNR A;  1ZMC A;  2GV8 A;  3GRT A;  1GT8 A;  5J60 A;  3BI2 A;  2YM1 A;  4CRT A;  2XVF A;  2YG6 A;  4EQW A;  2OAL A;  3NGC X;  3NTD A;  4JNQ A;  5EOW A;  4GCM A;  3CGC A;  3AE8 A;  3CNJ A;  2X8H A;  3QVR A;  3CPJ G;  1BZL A;  1E1K A;  4XWR A;  2B9W A;  4BK1 A;  3CGB A;  3DME A;  3FBS A;  5KMQ A;  2GR2 A;  3UOV A;  1DOC A;  5U1O A;  1YQZ A;  2O9Z A;  1GSN A;  1PBD A;  4Z24 A;  4CBQ A;  2BK3 A;  2C3C A;  2A8X A;  5FS9 A;  2NVK X;  3RNM A;  4II3 A;  3Q9T A;  4Z25 A;  2XFP A;  3S5W A;  1GXF A;  2IID A;  1L9D A;  1CC2 A;  4Z43 A;  4U8O A;  3WE0 A;  1ZK7 A;  2BK5 A;  4NZH A;  3F8P A;  5U25 A;  4CY6 A;  2V3B A;  4G74 A;  1E1M A;  4A6N A;  3I6D A;  1GTH A;  3V76 A;  4CCR A;  1PHH A;  3GRS A;  3L1R A;  4G9K A;  4IVO B;  3VR8 A;  5IPY A;  3KVE A;  1GPE A;  5L46 A;  4K2X A;  3CND A;  1LJ1 A;  3NN6 X;  1CC4 A;  1XHC A;  3CGD A;  2Q7V A;  3P4R A;  4C3Y A;  4IVM B;  3AEF A;  2XVH A;  3AEE A;  5KNL A;  2WP6 A;  3ATR A;  3UCL A;  5IQ4 A;  4NTD A;  4OPD A;  3SZC A;  5EB4 A;  5ER0 A;  2R0G A;  4H2P A;  2YG3 A;  2WDV A;  3ABV A;  4K5R A;  4JQ9 A;  1GRB A;  1K0J A;  4GAP A;  4EQR A;  2FJE A;  1GRT A;  2H89 A;  2C67 A;  1JU2 A;  3T2Z A;  4U8N A;  2WBA A;  3GD3 A;  1LQT A;  5IQ1 A;  2BS3 A;  1FEB A;  2TMD A;  3AD9 B;  3DA1 A;  1ZOV A;  1MOK A;  4O5Q A;  3CNT A;  4TM1 A;  2XDO A;  1IJH A;  1CBO A;  2WPF A;  2AQJ A;  2YQU A;  3P4Q A;  1GAL A;  2PYX A;  5JCK A;  2JB2 A;  1P2E A;  4U8J A;  2V5Z A;  4UP3 A;  3SQP A;  2R45 A;  1QLB A;  4OPC A;  1KFY A;  1CJC A;  2JAE A;  1NG4 A;  1COY A;  1F3P A;  4GF7 A;  3NTA A;  4HA6 A;  1CJ4 A;  1V59 A;  1CL0 A;  5GSN A;  3ICR A;  2XCG A;  3M13 A;  1H86 A;  3T37 A;  4B63 A;  3AD7 B;  1OJD A;  1KNP A;  4U2S A;  3ITJ A;  2FJB A;  3PS9 A;  4REK A;  2B9X A;  5DBJ A;  4M52 A;  1DOD A;  1PXB A;  4J33 A;  3AB1 A;  1PN0 A;  4YKF A;  5M0Z A;  1NEN A;  3ISH A;  3L8K A;  4GDE A;  2VZ2 A;  1X31 B;  1PJ5 A;  2VOU A;  4AP3 A;  3EPT A;  2XLS A;  2RGO A;  2WES A;  2RGJ A;  3IF9 A;  1KNR A;  3SZ0 A;  1OJ9 A;  1TDK A;  4YSH A;  3NT6 A;  3NKS A;  1FOH A;  1REO A;  3AEG A;  1VRQ B;  4UDQ A;  4AOS A;  3AE6 A;  4XXG A;  1ZMD A;  3QSM A;  4GDP A;  2YLR A;  3HYV A;  2GR0 A;  4WCT A;  1GRG A;  2AAQ A;  3AXB A;  3V3O A;  3UP5 A;  1PBF A;  3IC9 A;  1EL8 A;  4GUV A;  3KPF A;  4OPI A;  1NDA A;  1H84 A;  4EM3 A;  2V6O A;  2Y6Q A;  3CTY A;  4DNA A;  3D1C A;  1KSS A;  1ELI A;  1GND A;  2X8C A;  3ALJ A;  3NN0 X;  2CFY A;  1JEH A;  2TPR A;  3AE1 A;  1XPQ A;  1FEC A;  1JRX A;  2C65 A;  3OC4 A;  5HXI A;  2JB3 A;  4D03 A;  1D4C A;  4PAB A;  2EQ7 A;  3BNM A;  1NEK A;  5LV9 A;  2YWL A;  4KPR A;  1D5T A;  1B5Q A;  1GEU A;  2VRM A;  4FX9 A;  2J3N A;  5JCM A;  2CVJ A;  3UKP A;  3BI5 A;  2GMH A;  4H7U A;  2ACZ A;  1ZKQ A;  2VVL A;  2OLN A;  3RP6 A;  3K7Q X;  1DJQ A;  1S3E A;  1KSU A;  2QCU A;  3NK0 X;  1BKW A;  3QSS A;  1S2Q A;  4E0V A;  3FPZ A;  1TRB A;  4G6H A;  3DJD A;  1IUW A;  4U2T A;  4LA1 A;  2OA1 A;  3S61 A;  2GH5 A;  3M12 A;  2XLR A;  1P2H A;  4X9N A;  4XWZ A;  4AOX A;  4OPG A;  3AE4 A;  1HYU A;  3UOX A;  2IVE A;  5BRT A;  3NRN A;  2AR8 A;  4J31 A;  2C76 A;  4H4T A;  4P9S A;  2WEU A;  3UKF A;  5EBK A;  1Z6L A;  4BK3 A;  5KMS A;  5KWF A;  1O95 A;  2YM2 A;  1AOG A;  1PJ6 A;  2C73 A;  3F8R A;  2BCP A;  2C7G A;  2I0Z A;  4GR1 A;  4NEV A;  4ICY A;  1TDE A;  1IUS A;  2Z5Y A;  3RP8 A;  2BRY A;  2XFU A;  3VQR A;  2Q0L A;  2R0P A;  1YY5 A;  3M0O A;  1GET A;  1UKV G;  1DOB A;  4K8D A;  1E39 A;  1L9E A;  2YG5 A;  4Z2U A;  4OPL A;  3UTF A;  2YG7 A;  2GR1 A;  3AEB A;  5JCN A;  2WS3 A;  1K4Q A;  1XDI A;  2OLO A;  1E7P A;  1K0I A;  4YSZ A;  1DJN A;  2BYB A;  2BXS A;  3NH3 X;  1RSG A;  2Z5X A;  3SM8 A;  4H4U A;  1Y56 A;  2APG A;  4RG4 A;  1D4D A;  2BCG G;  4Y4L A;  5HY5 A;  4B67 A;  2XFO A;  3KD9 A;  3LZW A;  1L0V A;  3DJJ A;  3KU9 A;  4H50 A;  4JNA A;  4IA5 A;  2XLT A;  4NNJ A;  4A7A A;  1N4W A;  1OJC A;  2C4C A;  4FK1 A;  2GAG B;  3T2K A;  5BUL A;  4CNJ A;  2BC1 A;  2YVF A;  2B7S A;  1RYI A;  4B64 A;  3UOY A;  4B65 A;  3DJE A;  4YTP A;  2XYO A;  2JKC A;  4J34 A;  3GYJ A;  3IHM A;  3QVP A;  3UKH A;  4O5U A;  3B6D A;  1LTX R;  1BGJ A;  3PVC A;  1GRF A;  1W4X A;  1N4U A;  4Z2R A;  1JNZ A;  3UKA A;  2ARD A;  1H7X A;  3NK1 X;  3SXI A;  1FL2 A;  2C75 A;  2FJA A;  4RSL A;  3EAN A;  4NTE A;  2C66 A;  3UTH A;  3BI4 A;  3ATQ A;  3ZDN A;  4ZN0 A;  3VRA A;  1Y56 B;  4AP1 A;  3CNP A;  1B4V A;  2A87 A;  2RGH A;  4C3X A;  1LV0 A;  3ALL A;  1BGN A;  4EQX A;  3SZF A;  3II4 A;  4H4V A;  1IUX A;  5FS7 A;  2GEW A;  3HYX A;  4TM0 A;  3KKJ A;  5EB5 A;  2PHH A;  1IUV A;  3NHO X;  2BA9 A;  1QO8 A;  3COX A;  4Z26 A;  3HZL A;  4Y4M A;  2R4J A;  1VG9 A;  2XLU A;  3SZW A;  5KMP A;  2GR3 A;  2WPE A;  1S2Y A;  2GMJ A;  1YKJ A;  4J57 A;  3ICT A;  4GRT A;  2C70 A;  2X8G A;  3H8I A;  3SFE A;  3PO7 A;  4YTN A;  3RP7 A;  2R9Z A;  4LII A;  3AWI A;  4YWO A;  1H6V A;  3G5S A;  1L9C A;  1TDF A;  3O0H A;  4NTC A;  4USR A;  1DOE A;  1TDO A;  3C4A A;  4OPT A;  3UKK A;  3LZX A;  2GB0 A;  4MJW A;  1PJ7 A;  2BXR A;  3ADA B;  1QJD A;  5GRT A;  5FS6 A;  3C96 A;  3RHA A;  1OJT A;  3CIR A;  3NG7 X;  1N4V A;  5KRQ A;  4EMW A;  4U8P A;  2EQ6 A;  2X3N A;  4H4Z A;  4RG3 A;  1VDC A;  3NK2 X;  2B76 A;  4EIP A;  1GRE A;  2JBV A;  3EF6 A;  4TM3 A;  4UDR A;  2XFQ A;  4DSH A;  4D04 A;  2ZZC A;  1ZDL A;  3AE7 A;  1ZX9 A;  2X99 A;  1PBE A;  3K7M X;  1BF3 A;  4B1B A;  1GRH A;  4DGK A;  1BWC A;  3SGL A;  4BUR A;  1GRA A;  2BC0 A;  3AYJ A;  2GF3 A;  3URH A;  4H4X A;  4I58 A;  2VQ7 A;  4TLZ A;  3QSE A;  3P9U A;  1RP0 A;  2IVD A;  2E1M A;  4EMI A;  4K5S A;  2V61 A;  1GTE A;  1PXA A;  3LB8 A;  1EL5 A;  1NHR A;  3DGZ A;  3H4K A;  4J36 A;  5FMH A;  1F6M A;  1NHP A;  3G5R A;  1Q1R A;  3AE2 A;  3SY4 A;  2GAH B;  2XLP A;  4Y4N A;  3K7T A;  3RED A;  2YVG A;  4H2R A;  2YLW A;  2BAC A;  1FCD A;  2YR5 A;  2A89 A;  2WP9 A;  3C4N A;  2WDR A;  5HYM A;  2YR4 A;  2C72 A;  2E4G A;  3UP4 A;  3D8X A;  4J56 A;  4U8I A;  1OJA A;  1ZOY A;  4APN A;  1M6I A;  2YAU A;  3QJ4 A;  1GES A;  1Y0P A;  4C5O A;  1XAN A;  1YQ3 A;  3T14 A;  2ZZ0 A;  4EMJ A;  4A5L A;  2WU2 A;  4B68 A;  2VRL A;  4NEW A;  3P4S A;  5JCL A;  3NNE A;  3AEA A;  4ECH A;  1ZY8 A;  1N1P A;  2QA1 A;  3ICS A;  2YLT A;  4YKG A;  1E1N A;  4EM4 A;  4USQ A;  3AED A;  2QAE A;  5KOW A;  3DH9 A;  1GV4 A;  1O5W A;  5CKU A;  2WP5 A;  4B66 A;  1GER A;  2WOW A;  4U8L A;  4BJZ A;  1GOS A;  5KVH A;  3GDP A;  1E1L A;  2BRA A;  3G5Q A;  3LOV A;  5C3J A;  2B7R A;  1ZP0 A;  2VQB A;  4TLX A;  2UZZ A;  3NYC A;  1EL9 A;  3LXD A;  3AE9 A;  4IV9 A;  5KOX A;  3GMB A;  2R4E A;  2EQ8 A;  1EBD A;  2CUL A;  4KX6 A;  3FMW A;  2DKI A;  2E5V A;  1LQU A;  3DK4 A;  1JOA A;  3LAD A;  1PBB A;  3ZYX A;  3GSI A;  1CHU A;  1EL7 A;  4JY2 A;  2GQF A;  4NWZ A;  4A99 A;  1MO9 A;  4H2N A;  3FG2 P;  1H7W A;  2V3A A;  3UKL A;  2JK6 A;  1B8S A;  2YR6 A;  3CGE A;  4G73 A;  2R46 A;  4II2 A;  4ZCD A;  3UTE A;  1S3B A;  3UTG A;  1F8S A;  4OVI A;  4YT0 A;  5JCI A;  3EAO A;  5KXJ A;  4X4J A;  4CY8 A;  3VRB A;  5BUK A;  4YTM A;  3DJG X;  2R0C A;  4BK2 A;  2XVJ A;  4WX1 A;  1NAA A;  2QA2 A;  3E1T A;  4Z2T A;  2DKH A;  1PDH A;  4IA6 A;  3H8L A;  3T31 A;  1TYP A;  4B69 A;  2WET A;  1H82 A;  2WHD A;  4H4W A;  2XFN A;  4GAV A;  4X9M A;  1F8W A;  2BS2 A;  2V60 A;  3GWF A;  3AEC A;  3BNU A;  4K22 A;  4H4Y A;  4DSG A;  2NPX A;  1JRZ A;  4A9W A;  4U8M A;  3SFD A;  3AE3 A;  5U63 A;  1B37 A;  3KA7 A;  5KVI A;  2X50 A;  3F8D A;  3T0K A;  3AYI A;  2WU5 A;  2WOV A;  2F5Z A;  4U8K A;  4A79 A;  4H4P A;  5J7X A;  3KPK A;  3NYE A;  1M64 A;  4A6N B;  3DK9 A;  1CF3 A;  1VG0 A;  4U2L A;  2CDU A;  1Q9I A;  3LJP A;  5KMR A;  1LVL A;  4FDC B;  2W0H A;  3AE5 A;  3OZ2 A;  4ZCC A;  2C64 A;  4AT0 A;  2H88 A;  1NG3 A;  2YG4 A;  4LU6 A;  1YQ4 A;  3GYX A;  3ALM A;  2OAM A;  3DGH A;  1E6E A;  3NYF A;  3QFA A;  4H2Q A;  1TYT A;  2GQW A;  3I3L A;  1Q1W A;  3SX6 A;  2VVL G;  1PBC A;  2GRT A;  3UOZ A;  1IUT A;  2WQY A;  3GWD A;  4YXD A;  1NHS A;  1JRY A;  5HHF A;  3R9U A;  2C3D A;  2XVI A;  3CPI G;  3IHG A;  4CCQ A;  2Q0K A;  5C2T A;  3UKQ A;  4OPU A;  4OCG A;  1SEZ A;  2WDQ A;  3CMM A;  3CNS A;  2YLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...