1TDFA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
b'GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA02
3UKKA 4CCRA 4EQSA 4H2PA 2O9ZA 4WX1A 1NENA 4TLZA 4A9WA 4EMWA 4TM3A 4XWZA 2VQ7A 4GUVA 3GYIA 3QJ4A 4JY2A 2WPCA 2QAEA 3GYJA 2NPXA 3AECA 1BZLA 4BK3A 3B3RA 1ZY8A 2CVJA 3P4RA 4EMIA 2WP6A 4H2RA 1LJ1A 3BI5A 4RSLA 2OA1A 3CPJG 1IUVA 3LZXA 2WDQA 3IHMA 3AEGA 3SM8A 4X9NA 4C3XA 1DOCA 2C7GA 1CC6A 3NRNA 4YSXA 3C4AA 2FJEA 3NYEA 5ER0A 3D1CA 4DGKA 4BJZA 1OJDA 1W4XA 4LIIA 3V76A 3IHGA 1XPQA 4H4UA 2WHDA 4H4ZA 5KRQA 1FEBA 2YM2A 1GNDA 2YG3A 4OPTA 1JNRA 5BULA 2WESA 3QSEA 1DNCA 2C75A 2YG6A 5J60A 3AYIA 1DOEA 4U8KA 3RP8A 2BXRA 4ZN0A 3H4KA 1GESA 4OPCA 2WPEA 3AEAA 1P2HA 3GSIA 2X3NA 5C2TA 1H86A 1ONFA 4YSZA 1E6EA 5U1OA 2YLTA 3ATRA 3EF6A 3E1TA 3LZWA 3PS9A 3ITJA 4CCQA 4N9XA 1CL0A 2BACA 3Q6JA 2X8GA 4U8LA 2YG4A 5GSNA 1IUWA 4H4RA 1N4UA 4EQRA 2ZZBA 1S2QA 4B66A 2YLWA 5FS6A 3KKJA 1GTHA 1GALA 3H8LA 3B6DA 3LJPA 4A6NB 3FMWA 5L46A 2BS2A 1KNRA 1PJ6A 2YR4A 3LXDA 5IQ4A 1M64A 4XXGA 1IUXA 4U8IA 2ZBWA 3SFDA 3UOVA 3SFEA 3GDNA 1PS9A 1VDCA 1D7LA 1MXTA 4AOXA 3P4SA 5EB4A 3DJDA 3IF9A 4U8PA 4YKFA 4YKGA 2B9YA 4DSGA 3RP7A 2VZ2A 3S5WA 4LA1A 2XFOA 2WPFA 1XANA 1N4WA 2Q0KA 2VOUA 3AYJA 4JY3A 5LV9A 1PHHA 4U8MA 4CNJA 3AE2A 4GDEA 2YG5A 1CBOA 3UTGA 2ZZ0A 2VVLG 4EQXA 5KOXA 4EM4A 5KWFA 3GMCA 5KOWA 3QFAA 3ZYXA 2V60A 2EQ7A 3QVRA 2BS3A 3UKLA 2B9WA 5C3JA 3ICRA 3M12A 1GEUA 2PHHA 1PBCA 1VG9A 2VVMA 4B69A 1N1PA 4CNKA 4B65A 3UOYA 1E39A 2ARDA 5BVAA 4X4JA 4H2NA 4OPIA 4NEWA 5HY5A 2Q6UA 2XCGA 3NKSA 2QA1A 4U2LA 3K30A 1TRBA 3KVEA 3QVPA 1YQ3A 2RGOA 4I59A 4O5QA 2EQ6A 2YG7A 2BCGG 2Y6RA 2BK3A 3CNPA 2C65A 5EBKA 4KPRA 1BF3A 4NTEA 4NTDA 1PDHA 1H7WA 1JRXA 2F5ZA 2JAEA 1KF6A 1GPEA 2IVEA 2XLUA 1OJTA 2WOWA 2C70A 4Z25A 3AE4A 3DK4A 4C77A 1D4DA 4U2SA 3DK8A 3BNMA 4J56A 3GD3A 4K7ZA 2XLSA 3NK2X 4H4SA 1RP0A 1TDNA 2C72A 1CF3A 2WOIA 4C3YA 1PJ5A 3DK9A 3KA7A 1PN0A 2WOVA 4YTNA 3UTEA 1KSUA 2XFNA 2BYBA 1H6VA 1D4EA 2YAUA 1YQZA 3CNTA 2AQJA 4J2WA 4GR1A 4ICYA 1L0VA 2YR6A 2JB1A 1B8SA 4J33A 4Z24A 4Z43A 4EIQA 2V61A 3CIRA 3NN6X 2WU2A 1GETA 1E1LA 4YTMA 2TMDA 4K22A 5FMHA 4AT2A 4Z2RA 5J7XA 1GTEA 2WS3A 2NVKX 5FS9A 4BV6A 5U63A 2A8XA 3GRTA 4ZCDA 1GRBA 1CJ3A 2GB0A 1QO8A 1PBEA 5KVIA 4CRTA 4EQWA 3GDPA 2GQWA 4B67A 1IUSA 4H50A 4IV9A 1B5QA 4C74A 4Z2UA 3BI2A 1CJ4A 2OALA 3AEDA 3UKAA 4UDRA 2XFUA 1M6IA 4J34A 3URHA 1LQTA 4AOSA 3NH3X 2E1MA 1N4VA 3ISHA 1CJ2A 4H4TA 2IIDA 3P4QA 1LV0A 3DJEA 2GR1A 2GQFA 1IJHA 4H4QA 1KDGA 2AR8A 2Q7VA 1ZMDA 2C3DA 3DJGX 3NYCA 4H4VA 3R9UA 4UP3A 1RYIA 4D04A 3I6DA 3NT6A 4U8JA 1D4CA 2C76A 4O5UA 4B63A 1LVLA 2GR3A 2GEWA 1V59A 2GF3A 3AYLA 3CNJA 3AEFA 4NZHA 1FL2A 1YY5A 3KD9A 4TM1A 1NAAA 2XVJA 4YWOA 4REKA 1GRTA 1Y56A 4EMJA 2YVGA 4OPLA 1O94A 2GRTA 2OAMA 3SQPA 1D7YA 1TDOA 1Y56B 3ALJA 3V3NA 3ABVA 3F8DA 2DKHA 2R0PA 2FJAA 4A5LA 1GXFA 2RABA 4H4YA 1KNPA 4NTCA 2BABA 3ADAB 2DKIA 3AEEA 1IUTA 5DBJA 3CN8A 3Q9TA 4LU6A 4B68A 1B37A 1F8SA 4A6NA 2XFPA 1YQ4A 3NN0X 2PYXA 1PBBA 4CBQA 2CFYA 1PXCA 3GMBA 1ZOVA 3AD9B 4JN9A 4CY6A 3C96A 4DNAA 2WEUA 4HB9A 3EAOA 1AOGA 4U2TA 4J31A 5BRTA 1S3BA 4A79A 3PVCA 1DJNA 1H83A 4RG3A 1S2YA 2C73A 3ATQA 4APNA 4BK2A 3RNMA 2EQ9A 2VQBA 3AD7B 4XWRA 3T37A 2B7RA 1K4QA 3DH9A 1IUUA 3BNUA 2B7SA 1GERA 3NTAA 1OJ9A 1KSSA 2J3NA 2WP5A 5EOWA 1NG4A 1VG0A 1H81A 1OJAA 1CHUA 1GV4A 2C66A 2C64A 2TPRA 3L1RA 3G5RA 2GV8A 4TM4A 2JB3A 4P9SA 2I0ZA 3GWDA 1JEHA 1GRGA 2XVHA 2YLZA 5JCIA 1JOAA 1P2EA 3ICTA 3UOZA 2BK5A 2ZZCA 4YTPA 4OPDA 2XLPA 3QFBA 1CC2A 3KU9A 3VR8A 1TYTA 3D8XA 5HXIA 1PXAA 3K7TA 1QLBA 2GR2A 4ZCCA 1E1KA 1BKWA 3DMEA 1ELIA 5JCKA 1FCDA 2Z5YA 4IA5A 2BA9A 3UKPA 3FBSA 1ZKQA 2XLRA 1Q1WA 1LPFA 1KFYA 2FJDA 1K0LA 4JNQA 2RGHA 4BK1A 1TYPA 4FK1A 1NG3A 1MO9A 3SGLA 3UKHA 1DJQA 2WETA 1E1NA 3DGZA 2XFQA 2BK4A 3NNEA 3REDA 5JCMA 1REOA 1CC4A 1PJ7A 3M13A 4NEVA 4YSHA 4A65A 5CQFA 1GOSA 2GAHB 2YWLA 1NHSA 3IWAA 3UKFA 1D5TA 4GDPA 2GVCA 3HZLA 3NHOX 3UKQA 1YKJA 5TR3A 1HYUA 3UCLA 4A99A 1JRZA 4H7UA 3GD4A 2UZZA 3H8IA 3L8KA 1Z6LA 1BWCA 3I3LA 3BHFA 3P1WA 1EL9A 1BGJA 1H82A 1SEZA 2V3AA 3K7MX 1Q9IA 3ALLA 2APGA 4CY8A 3AE9A 2R4EA 2FJBA 5JCNA 3NYFA 4H4XA 2BCPA 4JQ9A 1CJCA 1H7XA 3ICSA 4AP1A 1VRQB 3C4NA 1ZDLA 3NG7X 1NPXA 1ZX9A 1JNZA 3V3OA 2YVFA 5IQ1A 1F6MA 1EL5A 2XDOA 3F8PA 3IC9A 4H4PA 2JK6A 3AE8A 2OLNA 2YQUA 5JCLA 3K7QX 3KLJA 2V6OA 1F8WA 1ZK7A 3UTHA 4J57A 1PXBA 4YT0A 4YSYA 5HYMA 3G5QA 1O5WA 2WP9A 3ZDNA 2B76A 3DJJA 2XVEA 3LADA 3NTDA 2IVDA 4PAAA 2FBWA 4HA6A 2E4GA 1PBDA 1GRHA 1BGNA 3LB8A 1L9CA 1JRYA 2QCUA 2R0CA 2WBAA 3NK1X 2R0GA 1S3EA 2GR0A 3RHAA 3AE3A 3QSMA 2WU5A 4GCMA 4K2XA 4D03A 2YLSA 4JDRA 3P9UA 4YXDA 2BS4A 3EPTA 3NIXA 2C3CA 3P4PA 1XDIA 3KPFA 3AD8B 5M10A 1EBDA 4Z44A 1Y0PA 2V3BA 2Z5XA 4MJWA 4AT0A 5M0ZA 1ZP0A 3RP6A 1VQWA 4TLXA 1NDAA 1LQUA 2V5ZA 4GRTA 2BC0A 3OC4A 4Z2TA 2XLTA 4Y4MA 2R4JA 2YR5A 4FX9A 1GT8A 3AB1A 3AE5A 4IA6A 3DA1A 4BURA 4Z26A 1L9DA 4U8OA 2AAQA 3CPHG 5KVHA 2VVLA 4I58A 3VRBA 3FIMB 3GRSA 4GF7A 4K5SA 1ZMCA 4U8NA 1K0JA 4TM0A 3VRDB 2WDRA 4RG4A 1TDKA 1GSNA 2HQMA 4UDQA 1LTXR 3II4A 1NHQA 4PABA 2B9XA 1E7PA 3CGDA 4H4WA 2VRLA 4OPGA 5U25A 1TDEA 3CPIG 3VRAA 4FDCB 3M0OA 3CGCA 1H84A 1UKVG 1O95A 1XHCA 3CGBA 4K8DA 4IVOB 1E1MA 1JU2A 5BUKA 2WQYA 1FEAA 3BHKA 4ECHA 5KXJA 4E0VA 3AEBA 2JB2A 2YLRA 4K5RA 4B64A 4M52A 2Q0LA 1ZOYA 2C67A 2VRMA 3FPZA 2ACZA 3LOVA 3CTYA 4USRA 3UTFA 3NLCA 4OCGA 4OPUA 4AP3A 2XYOA 3QSSA 3UP5A 2JBVA 2GMHA 5EB5A 3EANA 3FG2P 3GWFA 3VQRA 3NGCX 2YLXA 4IVMB 5IPYA 4J36A 4FK1C 3PO7A 2OLOA 2H88A 1FOHA 2W0HA 5FS8A 2R9ZA 3S61A 3O0HA 1FECA 3BI4A 3CNSA 3UOXA 4ADWA 1GREA 5HHFA 4C5OA 2H89A 1B4VA 1NHPA 2BC1A 2GH5A 4UDPA 3AE1A 1DXLA 4OVIA 1X31B 1GRAA 2RGJA 1F3PA 1Q1RA 4WCTA 3COXA 5FS7A 2WDVA 1K0IA 2X8HA 3AE6A 2A87A 1F8RA 1L9EA 2X8CA 3DGHA 4EM3A 1NEKA 1RSGA 3CNDA 5GRTA 1DOBA 3JSKA 4KX6A 3UP4A 3AWIA 4USQA 2CDUA 2X99A 2R45A 4Y4LA 1TDFA 4JNAA 4Y4NA 1NHRA 3G5SA 2XVFA 2YM1A 2JKCA 1PBFA 2GAGB 3NK0X 2GMJA 2R46A 1DODA 2EQ8A 4B1BA 3ALMA 2YVJA 2A89A 4A7AA 3AE7A 4DSHA 2CULA 1EL7A 3AXBA 1EL8A 2X50A 4BJYA 3F8RA 3VR9A 1GRFA 1OJCA 2Y6QA 1QJDA 2E5VA 4X9MA 5CKUA 3CGEA 1COYA 1MOKA 2XVIA 3OZ2A 4H2QA 3WE0A 4EIPA 2QA2A 2BXSA
chains in the Genus database with same CATH superfamily
3UKKA 4CCRA 4EQSA 4H2PA 2O9ZA 4WX1A 1NENA 4TLZA 4A9WA 4EMWA 4TM3A 4XWZA 2VQ7A 4GUVA 3GYIA 3CMMA 3QJ4A 4JY2A 3SX6A 2WPCA 2QAEA 3GYJA 2NPXA 3AECA 1BZLA 4BK3A 3B3RA 1ZY8A 2CVJA 3P4RA 4EMIA 2WP6A 4H2RA 1LJ1A 3BI5A 4RSLA 2OA1A 3CPJG 1IUVA 3LZXA 2WDQA 3IHMA 3AEGA 3SM8A 4X9NA 4G9KA 4C3XA 1DOCA 2C7GA 1CC6A 3NRNA 4YSXA 2BRAA 3C4AA 2FJEA 3NYEA 5ER0A 3D1CA 4DGKA 4BJZA 1OJDA 1W4XA 4LIIA 3V76A 3IHGA 1XPQA 4H4UA 2WHDA 4H4ZA 5KRQA 1FEBA 2YM2A 1GNDA 2YG3A 4OPTA 3T31A 1JNRA 5BULA 2WESA 3QSEA 1DNCA 2C75A 2YG6A 5J60A 3AYIA 1DOEA 4U8KA 3RP8A 2BXRA 4ZN0A 3H4KA 1GESA 4OPCA 2WPEA 3AEAA 1P2HA 3GSIA 2X3NA 5C2TA 1H86A 1ONFA 4YSZA 1E6EA 5U1OA 2YLTA 3ATRA 3EF6A 3E1TA 3LZWA 3PS9A 3ITJA 4CCQA 4N9XA 1CL0A 2BACA 3Q6JA 2X8GA 4U8LA 2YG4A 5GSNA 1IUWA 4H4RA 1N4UA 4EQRA 2ZZBA 1S2QA 4B66A 2YLWA 5FS6A 3KKJA 3SXIA 1GTHA 1GALA 3H8LA 3B6DA 3LJPA 4A6NB 3FMWA 5L46A 2BS2A 1KNRA 1PJ6A 2YR4A 3LXDA 5IQ4A 1M64A 4XXGA 1IUXA 4U8IA 2ZBWA 3SFDA 3UOVA 3SFEA 3GDNA 1PS9A 1VDCA 1D7LA 1MXTA 4AOXA 3P4SA 5EB4A 3DJDA 3IF9A 4U8PA 4YKFA 4YKGA 2B9YA 4DSGA 4G74A 2VZ2A 3RP7A 3S5WA 4LA1A 2XFOA 2WPFA 1XANA 1N4WA 2Q0KA 2VOUA 3AYJA 4JY3A 5LV9A 3T0KA 1PHHA 4U8MA 4CNJA 3AE2A 4GDEA 2YG5A 1CBOA 3UTGA 2ZZ0A 2VVLG 4EQXA 5KOXA 4EM4A 5KWFA 3GMCA 5KOWA 3QFAA 3ZYXA 2V60A 2EQ7A 3QVRA 3T2ZA 2BS3A 3HYWA 3UKLA 2B9WA 5C3JA 3SZCA 3ICRA 3M12A 1GEUA 2PHHA 1PBCA 1VG9A 2VVMA 4B69A 1N1PA 3SY4A 4CNKA 4B65A 3UOYA 1E39A 2ARDA 5BVAA 4X4JA 4H2NA 4OPIA 4NEWA 5HY5A 2Q6UA 2XCGA 3NKSA 3GYXA 2QA1A 4U2LA 3K30A 1TRBA 3KVEA 3QVPA 1YQ3A 2RGOA 4I59A 4O5QA 2EQ6A 2YG7A 2BCGG 2Y6RA 2BK3A 3CNPA 2C65A 5EBKA 4KPRA 1BF3A 4NTEA 4NTDA 1PDHA 1H7WA 1JRXA 2F5ZA 2JAEA 1KF6A 1GPEA 2IVEA 2XLUA 1OJTA 2WOWA 2C70A 4Z25A 3AE4A 3DK4A 4C77A 1D4DA 4U2SA 3DK8A 3BNMA 4J56A 3GD3A 4K7ZA 2XLSA 3NK2X 4H4SA 1RP0A 1TDNA 2C72A 1CF3A 2WOIA 4C3YA 1PJ5A 3DK9A 3KA7A 1PN0A 4II2A 2WOVA 4YTNA 3UTEA 1KSUA 2XFNA 2BYBA 1H6VA 1D4EA 2YAUA 1YQZA 3CNTA 2AQJA 4J2WA 4GR1A 4ICYA 1L0VA 2YR6A 2JB1A 1B8SA 4J33A 4Z24A 4Z43A 4EIQA 2V61A 3CIRA 3NN6X 2WU2A 1GETA 1E1LA 4YTMA 2TMDA 4K22A 5FMHA 3SZFA 4AT2A 4Z2RA 5J7XA 1GTEA 2WS3A 2NVKX 5FS9A 4BV6A 5U63A 2A8XA 3GRTA 4ZCDA 1GRBA 1CJ3A 2GB0A 1QO8A 1PBEA 5KVIA 4CRTA 4EQWA 3GDPA 2GQWA 4B67A 1IUSA 4H50A 4IV9A 1B5QA 5KNLA 4C74A 4Z2UA 3BI2A 1CJ4A 2OALA 3AEDA 3UKAA 4UDRA 2XFUA 1M6IA 4J34A 3URHA 1LQTA 4AOSA 3NH3X 2E1MA 1N4VA 3ISHA 1CJ2A 4H4TA 2IIDA 3P4QA 1LV0A 3DJEA 2GR1A 2GQFA 1IJHA 4H4QA 1KDGA 2AR8A 2Q7VA 1ZMDA 2C3DA 3DJGX 3NYCA 4H4VA 4NWZA 4UP3A 1RYIA 3R9UA 4D04A 3I6DA 3NT6A 4U8JA 1D4CA 2C76A 4O5UA 4B63A 1LVLA 2GR3A 2GEWA 1V59A 2GF3A 3AYLA 3CNJA 3AEFA 4NZHA 1FL2A 1YY5A 3KD9A 4TM1A 1NAAA 2XVJA 4YWOA 4REKA 5KMPA 1GRTA 1Y56A 4EMJA 2YVGA 4OPLA 1O94A 2GRTA 4G73A 2OAMA 3SQPA 1D7YA 1TDOA 1Y56B 3ALJA 3V3NA 3ABVA 3F8DA 2DKHA 2R0PA 2FJAA 4A5LA 1GXFA 2RABA 4H4YA 1KNPA 4NTCA 2BABA 3ADAB 2DKIA 3AEEA 1IUTA 5DBJA 3CN8A 3KPKA 3Q9TA 4LU6A 4B68A 1B37A 1F8SA 4A6NA 2XFPA 1YQ4A 3NN0X 2PYXA 1PBBA 4CBQA 2CFYA 1PXCA 3GMBA 1ZOVA 3AD9B 4JN9A 4CY6A 3C96A 4DNAA 2WEUA 4HB9A 3EAOA 1AOGA 4U2TA 4J31A 5BRTA 1S3BA 4A79A 3PVCA 1DJNA 1H83A 4RG3A 1S2YA 2C73A 3ATQA 4APNA 4BK2A 5KMQA 3RNMA 2EQ9A 2VQBA 3AD7B 4XWRA 3T37A 2B7RA 1K4QA 3DH9A 1IUUA 3BNUA 2B7SA 1GERA 3NTAA 1OJ9A 1KSSA 2J3NA 2WP5A 5EOWA 1NG4A 1VG0A 1H81A 1OJAA 1CHUA 1GV4A 2C66A 2C64A 2TPRA 3L1RA 3G5RA 2GV8A 4TM4A 2JB3A 4P9SA 2I0ZA 3GWDA 1JEHA 1GRGA 2XVHA 2YLZA 5JCIA 1JOAA 1P2EA 3ICTA 3UOZA 2BK5A 2ZZCA 4YTPA 4OPDA 2XLPA 3HYXA 3QFBA 1CC2A 3KU9A 3VR8A 1TYTA 3D8XA 5HXIA 3T2YA 1PXAA 3K7TA 1QLBA 2GR2A 4ZCCA 1E1KA 1BKWA 3DMEA 1ELIA 5JCKA 1FCDA 2Z5YA 4IA5A 2BA9A 3UKPA 3FBSA 1ZKQA 2XLRA 1Q1WA 1LPFA 1KFYA 2FJDA 1K0LA 4JNQA 2RGHA 4BK1A 1TYPA 4FK1A 1NG3A 1MO9A 3SGLA 3UKHA 1DJQA 2WETA 1E1NA 3DGZA 2XFQA 2BK4A 3NNEA 3REDA 5JCMA 1REOA 1CC4A 1PJ7A 3M13A 4NEVA 4YSHA 4A65A 5CQFA 1GOSA 2GAHB 2YWLA 1NHSA 3IWAA 3UKFA 1D5TA 4GDPA 2GVCA 3HZLA 3NHOX 3UKQA 1YKJA 5TR3A 5KMRA 1HYUA 3UCLA 4A99A 1JRZA 4H7UA 3GD4A 2UZZA 3H8IA 3L8KA 1Z6LA 1BWCA 3I3LA 3BHFA 3P1WA 1EL9A 1BGJA 1H82A 1SEZA 2V3AA 3K7MX 1Q9IA 3ALLA 2APGA 4CY8A 3AE9A 2R4EA 2FJBA 5JCNA 3NYFA 4H4XA 2BCPA 4JQ9A 3SZ0A 1CJCA 1H7XA 3ICSA 4AP1A 1VRQB 3C4NA 1ZDLA 3NG7X 1NPXA 1ZX9A 4GAVA 1JNZA 3V3OA 2YVFA 5IQ1A 1F6MA 3T2KA 1EL5A 2XDOA 3F8PA 3IC9A 4H4PA 2JK6A 3AE8A 2OLNA 2YQUA 5JCLA 3K7QX 3KLJA 2V6OA 1F8WA 1ZK7A 3UTHA 4J57A 1PXBA 4YT0A 4YSYA 5HYMA 3G5QA 1O5WA 2WP9A 3ZDNA 2B76A 3DJJA 2XVEA 3LADA 3NTDA 2IVDA 4PAAA 2FBWA 4HA6A 2E4GA 1PBDA 1GRHA 1BGNA 3LB8A 1L9CA 1JRYA 2QCUA 3HYVA 2R0CA 2WBAA 3NK1X 2R0GA 1S3EA 2GR0A 3RHAA 3AE3A 3QSMA 2WU5A 4GCMA 4K2XA 3T14A 2YLSA 4JDRA 3P9UA 4NNJA 2BS4A 4D03A 3EPTA 3NIXA 2C3CA 4YXDA 3P4PA 1XDIA 3KPFA 3AD8B 5M10A 1EBDA 4Z44A 1Y0PA 2V3BA 2Z5XA 4MJWA 4AT0A 5M0ZA 1ZP0A 3RP6A 1VQWA 4TLXA 1NDAA 1LQUA 2V5ZA 4GRTA 2BC0A 3OC4A 4Z2TA 2XLTA 4Y4MA 2R4JA 2YR5A 4FX9A 1GT8A 3AB1A 3AE5A 4IA6A 3DA1A 4BURA 4Z26A 1L9DA 4U8OA 2AAQA 3CPHG 5KVHA 2VVLA 4I58A 3VRBA 3FIMB 3GRSA 4GF7A 4K5SA 1ZMCA 4U8NA 1K0JA 4TM0A 3VRDB 2C4CA 2WDRA 4RG4A 1TDKA 1GSNA 2HQMA 4UDQA 1LTXR 3II4A 4G6GA 1NHQA 4PABA 2B9XA 1E7PA 3CGDA 4H4WA 2VRLA 4OPGA 5U25A 1TDEA 3CPIG 3VRAA 4FDCB 3M0OA 3CGCA 1H84A 1UKVG 1O95A 1XHCA 3CGBA 4K8DA 4IVOB 1E1MA 1JU2A 5BUKA 2WQYA 1FEAA 3BHKA 4ECHA 5KXJA 3SZWA 4E0VA 3AEBA 2JB2A 2YLRA 4K5RA 4B64A 4M52A 2Q0LA 1ZOYA 2C67A 2VRMA 3FPZA 4II3A 2ACZA 3LOVA 3CTYA 4USRA 3UTFA 3NLCA 5KMSA 4OCGA 4OPUA 4AP3A 2XYOA 3QSSA 3UP5A 2JBVA 2GMHA 4G6HA 5EB5A 3EANA 3FG2P 3GWFA 3VQRA 3NGCX 3SYIA 2YLXA 4IVMB 5IPYA 4J36A 4FK1C 3PO7A 2OLOA 2H88A 1FOHA 2W0HA 5FS8A 2R9ZA 3S61A 3O0HA 1FECA 3BI4A 3CNSA 3UOXA 4ADWA 1GREA 5HHFA 4C5OA 2H89A 1B4VA 1NHPA 2BC1A 2GH5A 4UDPA 3AE1A 1DXLA 4OVIA 1X31B 1GRAA 2RGJA 1F3PA 1Q1RA 4WCTA 3COXA 5FS7A 2WDVA 1K0IA 2X8HA 3AE6A 2A87A 1F8RA 1L9EA 2X8CA 3DGHA 4EM3A 1NEKA 1RSGA 2BRYA 3CNDA 5GRTA 1DOBA 3JSKA 4KX6A 3UP4A 3AWIA 4USQA 2CDUA 2X99A 2R45A 4Y4LA 1TDFA 4JNAA 4Y4NA 1NHRA 3G5SA 2XVFA 2YM1A 2JKCA 1PBFA 4GAPA 2GAGB 3NK0X 2GMJA 2R46A 1DODA 2EQ8A 4B1BA 3ALMA 2YVJA 2A89A 4A7AA 3AE7A 4DSHA 2CULA 1EL7A 3AXBA 1EL8A 2X50A 4BJYA 3F8RA 3VR9A 1GRFA 1OJCA 2Y6QA 1QJDA 2E5VA 4X9MA 5CKUA 3CGEA 1COYA 1MOKA 2XVIA 3OZ2A 4H2QA 3WE0A 4EIPA 2QA2A 2BXSA
chains in the Genus database with same CATH topology
3UKKA 4CCRA 4EQSA 4H2PA 2O9ZA 4WX1A 1NENA 4TLZA 4A9WA 4EMWA 4TM3A 4XWZA 2VQ7A 4GUVA 3GYIA 3CMMA 3QJ4A 4JY2A 3SX6A 2WPCA 2QAEA 3GYJA 2NPXA 3AECA 1BZLA 4BK3A 3B3RA 1ZY8A 2CVJA 3P4RA 4EMIA 2WP6A 4H2RA 1LJ1A 3BI5A 4RSLA 2OA1A 3CPJG 1IUVA 3LZXA 2WDQA 3IHMA 3AEGA 3SM8A 4X9NA 4G9KA 4C3XA 1DOCA 2C7GA 1CC6A 3NRNA 4YSXA 2BRAA 3C4AA 2FJEA 3NYEA 5ER0A 3D1CA 4DGKA 4BJZA 1OJDA 1W4XA 4LIIA 3V76A 3IHGA 1XPQA 4H4UA 2WHDA 4H4ZA 5KRQA 1FEBA 2YM2A 1GNDA 2YG3A 4OPTA 3T31A 1JNRA 5BULA 2WESA 3QSEA 1DNCA 2C75A 2YG6A 5J60A 3AYIA 1DOEA 4U8KA 3RP8A 2BXRA 4ZN0A 3H4KA 1GESA 4OPCA 2WPEA 3AEAA 1P2HA 3GSIA 2X3NA 5C2TA 1H86A 1ONFA 4YSZA 1E6EA 5U1OA 2YLTA 3ATRA 3EF6A 3E1TA 3LZWA 3PS9A 3ITJA 4CCQA 4N9XA 1CL0A 2BACA 3Q6JA 2X8GA 4U8LA 2YG4A 5GSNA 1IUWA 4H4RA 1N4UA 4EQRA 2ZZBA 1S2QA 4B66A 2YLWA 5FS6A 3KKJA 3SXIA 1GTHA 1GALA 3H8LA 3B6DA 3LJPA 4A6NB 3FMWA 5L46A 2BS2A 1KNRA 1PJ6A 2YR4A 3LXDA 5IQ4A 1M64A 4XXGA 1IUXA 4U8IA 2ZBWA 3SFDA 3UOVA 3SFEA 3GDNA 1PS9A 1VDCA 1D7LA 1MXTA 4AOXA 3P4SA 5EB4A 3DJDA 3IF9A 4U8PA 4YKFA 4YKGA 2B9YA 4DSGA 4G74A 2VZ2A 3RP7A 3S5WA 4LA1A 2XFOA 2WPFA 1XANA 1N4WA 2Q0KA 2VOUA 3AYJA 4JY3A 5LV9A 3T0KA 1PHHA 4U8MA 4CNJA 3AE2A 4GDEA 2YG5A 1CBOA 3UTGA 2ZZ0A 2VVLG 4EQXA 5KOXA 4EM4A 5KWFA 3GMCA 5KOWA 3QFAA 3ZYXA 2V60A 2EQ7A 3QVRA 3T2ZA 2BS3A 3HYWA 3UKLA 2B9WA 5C3JA 3SZCA 3ICRA 3M12A 1GEUA 2PHHA 1PBCA 1VG9A 2VVMA 4B69A 1N1PA 3SY4A 4CNKA 4B65A 3UOYA 1E39A 2ARDA 5BVAA 4X4JA 4H2NA 4OPIA 4NEWA 5HY5A 2Q6UA 2XCGA 3NKSA 3GYXA 2QA1A 4U2LA 3K30A 1TRBA 3KVEA 3QVPA 1YQ3A 2RGOA 4I59A 4O5QA 2EQ6A 2YG7A 2BCGG 2Y6RA 2BK3A 3CNPA 2C65A 5EBKA 4KPRA 1BF3A 4NTEA 4NTDA 1PDHA 1H7WA 1JRXA 2F5ZA 2JAEA 1KF6A 1GPEA 2IVEA 2XLUA 1OJTA 2WOWA 2C70A 4Z25A 3AE4A 3DK4A 4C77A 1D4DA 4U2SA 3DK8A 3BNMA 4J56A 3GD3A 4K7ZA 2XLSA 3NK2X 4H4SA 1RP0A 1TDNA 2C72A 1CF3A 2WOIA 4C3YA 1PJ5A 3DK9A 3KA7A 1PN0A 4II2A 2WOVA 4YTNA 3UTEA 1KSUA 2XFNA 2BYBA 1H6VA 1D4EA 2YAUA 1YQZA 3CNTA 2AQJA 4J2WA 4GR1A 4ICYA 1L0VA 2YR6A 2JB1A 1B8SA 4J33A 4Z24A 4Z43A 4EIQA 2V61A 3CIRA 3NN6X 2WU2A 1GETA 1E1LA 4YTMA 2TMDA 4K22A 5FMHA 3SZFA 4AT2A 4Z2RA 5J7XA 1GTEA 2WS3A 2NVKX 5FS9A 4BV6A 5U63A 2A8XA 3GRTA 4ZCDA 1GRBA 1CJ3A 2GB0A 1QO8A 1PBEA 5KVIA 4CRTA 4EQWA 3GDPA 2GQWA 4B67A 1IUSA 4H50A 4IV9A 1B5QA 5KNLA 4C74A 4Z2UA 3BI2A 1CJ4A 2OALA 3AEDA 3UKAA 4UDRA 2XFUA 1M6IA 4J34A 3URHA 1LQTA 4AOSA 3NH3X 2E1MA 1N4VA 3ISHA 1CJ2A 4H4TA 2IIDA 3P4QA 1LV0A 3DJEA 2GR1A 2GQFA 1IJHA 4H4QA 1KDGA 2AR8A 2Q7VA 1ZMDA 2C3DA 3DJGX 3NYCA 4H4VA 4NWZA 4UP3A 1RYIA 3R9UA 4D04A 3I6DA 3NT6A 4U8JA 1D4CA 2C76A 4O5UA 4B63A 1LVLA 2GR3A 2GEWA 1V59A 2GF3A 3AYLA 3CNJA 3AEFA 4NZHA 1FL2A 1YY5A 3KD9A 4TM1A 1NAAA 2XVJA 4YWOA 4REKA 5KMPA 1GRTA 1Y56A 4EMJA 2YVGA 4OPLA 1O94A 2GRTA 4G73A 2OAMA 3SQPA 1D7YA 1TDOA 1Y56B 3ALJA 3V3NA 3ABVA 3F8DA 2DKHA 2R0PA 2FJAA 4A5LA 1GXFA 2RABA 4H4YA 1KNPA 4NTCA 2BABA 3ADAB 2DKIA 3AEEA 1IUTA 5DBJA 3CN8A 3KPKA 3Q9TA 4LU6A 4B68A 1B37A 1F8SA 4A6NA 2XFPA 1YQ4A 3NN0X 2PYXA 1PBBA 4CBQA 2CFYA 1PXCA 3GMBA 1ZOVA 3AD9B 4JN9A 4CY6A 3C96A 4DNAA 2WEUA 4HB9A 3EAOA 1AOGA 4U2TA 4J31A 5BRTA 1S3BA 4A79A 3PVCA 1DJNA 1H83A 4RG3A 1S2YA 2C73A 3ATQA 4APNA 4BK2A 5KMQA 3RNMA 2EQ9A 2VQBA 3AD7B 4XWRA 3T37A 2B7RA 1K4QA 3DH9A 1IUUA 3BNUA 2B7SA 1GERA 3NTAA 1OJ9A 1KSSA 2J3NA 2WP5A 5EOWA 1NG4A 1VG0A 1H81A 1OJAA 1CHUA 1GV4A 2C66A 2C64A 2TPRA 3L1RA 3G5RA 2GV8A 4TM4A 2JB3A 4P9SA 2I0ZA 3GWDA 1JEHA 1GRGA 2XVHA 2YLZA 5JCIA 1JOAA 1P2EA 3ICTA 3UOZA 2BK5A 2ZZCA 4YTPA 4OPDA 2XLPA 3HYXA 3QFBA 1CC2A 3KU9A 3VR8A 1TYTA 3D8XA 5HXIA 3T2YA 1PXAA 3K7TA 1QLBA 2GR2A 4ZCCA 1E1KA 1BKWA 3DMEA 1ELIA 5JCKA 1FCDA 2Z5YA 4IA5A 2BA9A 3UKPA 3FBSA 1ZKQA 2XLRA 1Q1WA 1LPFA 1KFYA 2FJDA 1K0LA 4JNQA 2RGHA 4BK1A 1TYPA 4FK1A 1NG3A 1MO9A 3SGLA 3UKHA 1DJQA 2WETA 1E1NA 3DGZA 2XFQA 2BK4A 3NNEA 3REDA 5JCMA 1REOA 1CC4A 1PJ7A 3M13A 4NEVA 4YSHA 4A65A 5CQFA 1GOSA 2GAHB 2YWLA 1NHSA 3IWAA 3UKFA 1D5TA 4GDPA 2GVCA 3HZLA 3NHOX 3UKQA 1YKJA 5TR3A 5KMRA 1HYUA 3UCLA 4A99A 1JRZA 4H7UA 3GD4A 2UZZA 3H8IA 3L8KA 1Z6LA 1BWCA 3I3LA 3BHFA 3P1WA 1EL9A 1BGJA 1H82A 1SEZA 2V3AA 3K7MX 1Q9IA 3ALLA 2APGA 4CY8A 3AE9A 2R4EA 2FJBA 5JCNA 3NYFA 4H4XA 2BCPA 4JQ9A 3SZ0A 1CJCA 1H7XA 3ICSA 4AP1A 1VRQB 3C4NA 1ZDLA 3NG7X 1NPXA 1ZX9A 4GAVA 1JNZA 3V3OA 2YVFA 5IQ1A 1F6MA 3T2KA 1EL5A 2XDOA 3F8PA 3IC9A 4H4PA 2JK6A 3AE8A 2OLNA 2YQUA 5JCLA 3K7QX 3KLJA 2V6OA 1F8WA 1ZK7A 3UTHA 4J57A 1PXBA 4YT0A 4YSYA 5HYMA 3G5QA 1O5WA 2WP9A 3ZDNA 2B76A 3DJJA 2XVEA 3LADA 3NTDA 2IVDA 4PAAA 2FBWA 4HA6A 2E4GA 1PBDA 1GRHA 1BGNA 3LB8A 1L9CA 1JRYA 2QCUA 3HYVA 2R0CA 2WBAA 3NK1X 2R0GA 1S3EA 2GR0A 3RHAA 3AE3A 3QSMA 2WU5A 4GCMA 4K2XA 3T14A 2YLSA 4JDRA 3P9UA 4NNJA 2BS4A 4D03A 3EPTA 3NIXA 2C3CA 4YXDA 3P4PA 1XDIA 3KPFA 3AD8B 5M10A 1EBDA 4Z44A 1Y0PA 2V3BA 2Z5XA 4MJWA 4AT0A 5M0ZA 1ZP0A 3RP6A 1VQWA 4TLXA 1NDAA 1LQUA 2V5ZA 4GRTA 2BC0A 3OC4A 4Z2TA 2XLTA 4Y4MA 2R4JA 2YR5A 4FX9A 1GT8A 3AB1A 3AE5A 4IA6A 3DA1A 4BURA 4Z26A 1L9DA 4U8OA 2AAQA 3CPHG 5KVHA 2VVLA 4I58A 3VRBA 3FIMB 3GRSA 4GF7A 4K5SA 1ZMCA 4U8NA 1K0JA 4TM0A 3VRDB 2C4CA 2WDRA 4RG4A 1TDKA 1GSNA 2HQMA 4UDQA 1LTXR 3II4A 4G6GA 1NHQA 4PABA 2B9XA 1E7PA 3CGDA 4H4WA 2VRLA 4OPGA 5U25A 1TDEA 3CPIG 3VRAA 4FDCB 3M0OA 3CGCA 1H84A 1UKVG 1O95A 1XHCA 3CGBA 4K8DA 4IVOB 1E1MA 1JU2A 5BUKA 2WQYA 1FEAA 3BHKA 4ECHA 5KXJA 3SZWA 4E0VA 3AEBA 2JB2A 2YLRA 4K5RA 4B64A 4M52A 2Q0LA 1ZOYA 2C67A 2VRMA 3FPZA 4II3A 2ACZA 3LOVA 3CTYA 4USRA 3UTFA 3NLCA 5KMSA 4OCGA 4OPUA 4AP3A 2XYOA 3QSSA 3UP5A 2JBVA 2GMHA 4G6HA 5EB5A 3EANA 3FG2P 3GWFA 3VQRA 3NGCX 3SYIA 2YLXA 4IVMB 5IPYA 4J36A 4FK1C 3PO7A 2OLOA 2H88A 1FOHA 2W0HA 5FS8A 2R9ZA 3S61A 3O0HA 1FECA 3BI4A 3CNSA 3UOXA 4ADWA 1GREA 5HHFA 4C5OA 2H89A 1B4VA 1NHPA 2BC1A 2GH5A 4UDPA 3AE1A 1DXLA 4OVIA 1X31B 1GRAA 2RGJA 1F3PA 1Q1RA 4WCTA 3COXA 5FS7A 2WDVA 1K0IA 2X8HA 3AE6A 2A87A 1F8RA 1L9EA 2X8CA 3DGHA 4EM3A 1NEKA 1RSGA 2BRYA 3CNDA 5GRTA 1DOBA 3JSKA 4KX6A 3UP4A 3AWIA 4USQA 2CDUA 2X99A 2R45A 4Y4LA 1TDFA 4JNAA 4Y4NA 1NHRA 3G5SA 2XVFA 2YM1A 2JKCA 1PBFA 4GAPA 2GAGB 3NK0X 2GMJA 2R46A 1DODA 2EQ8A 4B1BA 3ALMA 2YVJA 2A89A 4A7AA 3AE7A 4DSHA 2CULA 1EL7A 3AXBA 1EL8A 2X50A 4BJYA 3F8RA 3VR9A 1GRFA 1OJCA 2Y6QA 1QJDA 2E5VA 4X9MA 5CKUA 3CGEA 1COYA 1MOKA 2XVIA 3OZ2A 4H2QA 3WE0A 4EIPA 2QA2A 2BXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKK A;  4CCR A;  4EQS A;  4H2P A;  2O9Z A;  4WX1 A;  1NEN A;  4TLZ A;  4A9W A;  4EMW A;  4TM3 A;  4XWZ A;  2VQ7 A;  4GUV A;  3GYI A;  3QJ4 A;  4JY2 A;  2WPC A;  2QAE A;  3GYJ A;  2NPX A;  3AEC A;  1BZL A;  4BK3 A;  3B3R A;  1ZY8 A;  2CVJ A;  3P4R A;  4EMI A;  2WP6 A;  4H2R A;  1LJ1 A;  3BI5 A;  4RSL A;  2OA1 A;  3CPJ G;  1IUV A;  3LZX A;  2WDQ A;  3IHM A;  3AEG A;  3SM8 A;  4X9N A;  4C3X A;  1DOC A;  2C7G A;  1CC6 A;  3NRN A;  4YSX A;  3C4A A;  2FJE A;  3NYE A;  5ER0 A;  3D1C A;  4DGK A;  4BJZ A;  1OJD A;  1W4X A;  4LII A;  3V76 A;  3IHG A;  1XPQ A;  4H4U A;  2WHD A;  4H4Z A;  5KRQ A;  1FEB A;  2YM2 A;  1GND A;  2YG3 A;  4OPT A;  1JNR A;  5BUL A;  2WES A;  3QSE A;  1DNC A;  2C75 A;  2YG6 A;  5J60 A;  3AYI A;  1DOE A;  4U8K A;  3RP8 A;  2BXR A;  4ZN0 A;  3H4K A;  1GES A;  4OPC A;  2WPE A;  3AEA A;  1P2H A;  3GSI A;  2X3N A;  5C2T A;  1H86 A;  1ONF A;  4YSZ A;  1E6E A;  5U1O A;  2YLT A;  3ATR A;  3EF6 A;  3E1T A;  3LZW A;  3PS9 A;  3ITJ A;  4CCQ A;  4N9X A;  1CL0 A;  2BAC A;  3Q6J A;  2X8G A;  4U8L A;  2YG4 A;  5GSN A;  1IUW A;  4H4R A;  1N4U A;  4EQR A;  2ZZB A;  1S2Q A;  4B66 A;  2YLW A;  5FS6 A;  3KKJ A;  1GTH A;  1GAL A;  3H8L A;  3B6D A;  3LJP A;  4A6N B;  3FMW A;  5L46 A;  2BS2 A;  1KNR A;  1PJ6 A;  2YR4 A;  3LXD A;  5IQ4 A;  1M64 A;  4XXG A;  1IUX A;  4U8I A;  2ZBW A;  3SFD A;  3UOV A;  3SFE A;  3GDN A;  1PS9 A;  1VDC A;  1D7L A;  1MXT A;  4AOX A;  3P4S A;  5EB4 A;  3DJD A;  3IF9 A;  4U8P A;  4YKF A;  4YKG A;  2B9Y A;  4DSG A;  3RP7 A;  2VZ2 A;  3S5W A;  4LA1 A;  2XFO A;  2WPF A;  1XAN A;  1N4W A;  2Q0K A;  2VOU A;  3AYJ A;  4JY3 A;  5LV9 A;  1PHH A;  4U8M A;  4CNJ A;  3AE2 A;  4GDE A;  2YG5 A;  1CBO A;  3UTG A;  2ZZ0 A;  2VVL G;  4EQX A;  5KOX A;  4EM4 A;  5KWF A;  3GMC A;  5KOW A;  3QFA A;  3ZYX A;  2V60 A;  2EQ7 A;  3QVR A;  2BS3 A;  3UKL A;  2B9W A;  5C3J A;  3ICR A;  3M12 A;  1GEU A;  2PHH A;  1PBC A;  1VG9 A;  2VVM A;  4B69 A;  1N1P A;  4CNK A;  4B65 A;  3UOY A;  1E39 A;  2ARD A;  5BVA A;  4X4J A;  4H2N A;  4OPI A;  4NEW A;  5HY5 A;  2Q6U A;  2XCG A;  3NKS A;  2QA1 A;  4U2L A;  3K30 A;  1TRB A;  3KVE A;  3QVP A;  1YQ3 A;  2RGO A;  4I59 A;  4O5Q A;  2EQ6 A;  2YG7 A;  2BCG G;  2Y6R A;  2BK3 A;  3CNP A;  2C65 A;  5EBK A;  4KPR A;  1BF3 A;  4NTE A;  4NTD A;  1PDH A;  1H7W A;  1JRX A;  2F5Z A;  2JAE A;  1KF6 A;  1GPE A;  2IVE A;  2XLU A;  1OJT A;  2WOW A;  2C70 A;  4Z25 A;  3AE4 A;  3DK4 A;  4C77 A;  1D4D A;  4U2S A;  3DK8 A;  3BNM A;  4J56 A;  3GD3 A;  4K7Z A;  2XLS A;  3NK2 X;  4H4S A;  1RP0 A;  1TDN A;  2C72 A;  1CF3 A;  2WOI A;  4C3Y A;  1PJ5 A;  3DK9 A;  3KA7 A;  1PN0 A;  2WOV A;  4YTN A;  3UTE A;  1KSU A;  2XFN A;  2BYB A;  1H6V A;  1D4E A;  2YAU A;  1YQZ A;  3CNT A;  2AQJ A;  4J2W A;  4GR1 A;  4ICY A;  1L0V A;  2YR6 A;  2JB1 A;  1B8S A;  4J33 A;  4Z24 A;  4Z43 A;  4EIQ A;  2V61 A;  3CIR A;  3NN6 X;  2WU2 A;  1GET A;  1E1L A;  4YTM A;  2TMD A;  4K22 A;  5FMH A;  4AT2 A;  4Z2R A;  5J7X A;  1GTE A;  2WS3 A;  2NVK X;  5FS9 A;  4BV6 A;  5U63 A;  2A8X A;  3GRT A;  4ZCD A;  1GRB A;  1CJ3 A;  2GB0 A;  1QO8 A;  1PBE A;  5KVI A;  4CRT A;  4EQW A;  3GDP A;  2GQW A;  4B67 A;  1IUS A;  4H50 A;  4IV9 A;  1B5Q A;  4C74 A;  4Z2U A;  3BI2 A;  1CJ4 A;  2OAL A;  3AED A;  3UKA A;  4UDR A;  2XFU A;  1M6I A;  4J34 A;  3URH A;  1LQT A;  4AOS A;  3NH3 X;  2E1M A;  1N4V A;  3ISH A;  1CJ2 A;  4H4T A;  2IID A;  3P4Q A;  1LV0 A;  3DJE A;  2GR1 A;  2GQF A;  1IJH A;  4H4Q A;  1KDG A;  2AR8 A;  2Q7V A;  1ZMD A;  2C3D A;  3DJG X;  3NYC A;  4H4V A;  3R9U A;  4UP3 A;  1RYI A;  4D04 A;  3I6D A;  3NT6 A;  4U8J A;  1D4C A;  2C76 A;  4O5U A;  4B63 A;  1LVL A;  2GR3 A;  2GEW A;  1V59 A;  2GF3 A;  3AYL A;  3CNJ A;  3AEF A;  4NZH A;  1FL2 A;  1YY5 A;  3KD9 A;  4TM1 A;  1NAA A;  2XVJ A;  4YWO A;  4REK A;  1GRT A;  1Y56 A;  4EMJ A;  2YVG A;  4OPL A;  1O94 A;  2GRT A;  2OAM A;  3SQP A;  1D7Y A;  1TDO A;  1Y56 B;  3ALJ A;  3V3N A;  3ABV A;  3F8D A;  2DKH A;  2R0P A;  2FJA A;  4A5L A;  1GXF A;  2RAB A;  4H4Y A;  1KNP A;  4NTC A;  2BAB A;  3ADA B;  2DKI A;  3AEE A;  1IUT A;  5DBJ A;  3CN8 A;  3Q9T A;  4LU6 A;  4B68 A;  1B37 A;  1F8S A;  4A6N A;  2XFP A;  1YQ4 A;  3NN0 X;  2PYX A;  1PBB A;  4CBQ A;  2CFY A;  1PXC A;  3GMB A;  1ZOV A;  3AD9 B;  4JN9 A;  4CY6 A;  3C96 A;  4DNA A;  2WEU A;  4HB9 A;  3EAO A;  1AOG A;  4U2T A;  4J31 A;  5BRT A;  1S3B A;  4A79 A;  3PVC A;  1DJN A;  1H83 A;  4RG3 A;  1S2Y A;  2C73 A;  3ATQ A;  4APN A;  4BK2 A;  3RNM A;  2EQ9 A;  2VQB A;  3AD7 B;  4XWR A;  3T37 A;  2B7R A;  1K4Q A;  3DH9 A;  1IUU A;  3BNU A;  2B7S A;  1GER A;  3NTA A;  1OJ9 A;  1KSS A;  2J3N A;  2WP5 A;  5EOW A;  1NG4 A;  1VG0 A;  1H81 A;  1OJA A;  1CHU A;  1GV4 A;  2C66 A;  2C64 A;  2TPR A;  3L1R A;  3G5R A;  2GV8 A;  4TM4 A;  2JB3 A;  4P9S A;  2I0Z A;  3GWD A;  1JEH A;  1GRG A;  2XVH A;  2YLZ A;  5JCI A;  1JOA A;  1P2E A;  3ICT A;  3UOZ A;  2BK5 A;  2ZZC A;  4YTP A;  4OPD A;  2XLP A;  3QFB A;  1CC2 A;  3KU9 A;  3VR8 A;  1TYT A;  3D8X A;  5HXI A;  1PXA A;  3K7T A;  1QLB A;  2GR2 A;  4ZCC A;  1E1K A;  1BKW A;  3DME A;  1ELI A;  5JCK A;  1FCD A;  2Z5Y A;  4IA5 A;  2BA9 A;  3UKP A;  3FBS A;  1ZKQ A;  2XLR A;  1Q1W A;  1LPF A;  1KFY A;  2FJD A;  1K0L A;  4JNQ A;  2RGH A;  4BK1 A;  1TYP A;  4FK1 A;  1NG3 A;  1MO9 A;  3SGL A;  3UKH A;  1DJQ A;  2WET A;  1E1N A;  3DGZ A;  2XFQ A;  2BK4 A;  3NNE A;  3RED A;  5JCM A;  1REO A;  1CC4 A;  1PJ7 A;  3M13 A;  4NEV A;  4YSH A;  4A65 A;  5CQF A;  1GOS A;  2GAH B;  2YWL A;  1NHS A;  3IWA A;  3UKF A;  1D5T A;  4GDP A;  2GVC A;  3HZL A;  3NHO X;  3UKQ A;  1YKJ A;  5TR3 A;  1HYU A;  3UCL A;  4A99 A;  1JRZ A;  4H7U A;  3GD4 A;  2UZZ A;  3H8I A;  3L8K A;  1Z6L A;  1BWC A;  3I3L A;  3BHF A;  3P1W A;  1EL9 A;  1BGJ A;  1H82 A;  1SEZ A;  2V3A A;  3K7M X;  1Q9I A;  3ALL A;  2APG A;  4CY8 A;  3AE9 A;  2R4E A;  2FJB A;  5JCN A;  3NYF A;  4H4X A;  2BCP A;  4JQ9 A;  1CJC A;  1H7X A;  3ICS A;  4AP1 A;  1VRQ B;  3C4N A;  1ZDL A;  3NG7 X;  1NPX A;  1ZX9 A;  1JNZ A;  3V3O A;  2YVF A;  5IQ1 A;  1F6M A;  1EL5 A;  2XDO A;  3F8P A;  3IC9 A;  4H4P A;  2JK6 A;  3AE8 A;  2OLN A;  2YQU A;  5JCL A;  3K7Q X;  3KLJ A;  2V6O A;  1F8W A;  1ZK7 A;  3UTH A;  4J57 A;  1PXB A;  4YT0 A;  4YSY A;  5HYM A;  3G5Q A;  1O5W A;  2WP9 A;  3ZDN A;  2B76 A;  3DJJ A;  2XVE A;  3LAD A;  3NTD A;  2IVD A;  4PAA A;  2FBW A;  4HA6 A;  2E4G A;  1PBD A;  1GRH A;  1BGN A;  3LB8 A;  1L9C A;  1JRY A;  2QCU A;  2R0C A;  2WBA A;  3NK1 X;  2R0G A;  1S3E A;  2GR0 A;  3RHA A;  3AE3 A;  3QSM A;  2WU5 A;  4GCM A;  4K2X A;  4D03 A;  2YLS A;  4JDR A;  3P9U A;  4YXD A;  2BS4 A;  3EPT A;  3NIX A;  2C3C A;  3P4P A;  1XDI A;  3KPF A;  3AD8 B;  5M10 A;  1EBD A;  4Z44 A;  1Y0P A;  2V3B A;  2Z5X A;  4MJW A;  4AT0 A;  5M0Z A;  1ZP0 A;  3RP6 A;  1VQW A;  4TLX A;  1NDA A;  1LQU A;  2V5Z A;  4GRT A;  2BC0 A;  3OC4 A;  4Z2T A;  2XLT A;  4Y4M A;  2R4J A;  2YR5 A;  4FX9 A;  1GT8 A;  3AB1 A;  3AE5 A;  4IA6 A;  3DA1 A;  4BUR A;  4Z26 A;  1L9D A;  4U8O A;  2AAQ A;  3CPH G;  5KVH A;  2VVL A;  4I58 A;  3VRB A;  3FIM B;  3GRS A;  4GF7 A;  4K5S A;  1ZMC A;  4U8N A;  1K0J A;  4TM0 A;  3VRD B;  2WDR A;  4RG4 A;  1TDK A;  1GSN A;  2HQM A;  4UDQ A;  1LTX R;  3II4 A;  1NHQ A;  4PAB A;  2B9X A;  1E7P A;  3CGD A;  4H4W A;  2VRL A;  4OPG A;  5U25 A;  1TDE A;  3CPI G;  3VRA A;  4FDC B;  3M0O A;  3CGC A;  1H84 A;  1UKV G;  1O95 A;  1XHC A;  3CGB A;  4K8D A;  4IVO B;  1E1M A;  1JU2 A;  5BUK A;  2WQY A;  1FEA A;  3BHK A;  4ECH A;  5KXJ A;  4E0V A;  3AEB A;  2JB2 A;  2YLR A;  4K5R A;  4B64 A;  4M52 A;  2Q0L A;  1ZOY A;  2C67 A;  2VRM A;  3FPZ A;  2ACZ A;  3LOV A;  3CTY A;  4USR A;  3UTF A;  3NLC A;  4OCG A;  4OPU A;  4AP3 A;  2XYO A;  3QSS A;  3UP5 A;  2JBV A;  2GMH A;  5EB5 A;  3EAN A;  3FG2 P;  3GWF A;  3VQR A;  3NGC X;  2YLX A;  4IVM B;  5IPY A;  4J36 A;  4FK1 C;  3PO7 A;  2OLO A;  2H88 A;  1FOH A;  2W0H A;  5FS8 A;  2R9Z A;  3S61 A;  3O0H A;  1FEC A;  3BI4 A;  3CNS A;  3UOX A;  4ADW A;  1GRE A;  5HHF A;  4C5O A;  2H89 A;  1B4V A;  1NHP A;  2BC1 A;  2GH5 A;  4UDP A;  3AE1 A;  1DXL A;  4OVI A;  1X31 B;  1GRA A;  2RGJ A;  1F3P A;  1Q1R A;  4WCT A;  3COX A;  5FS7 A;  2WDV A;  1K0I A;  2X8H A;  3AE6 A;  2A87 A;  1F8R A;  1L9E A;  2X8C A;  3DGH A;  4EM3 A;  1NEK A;  1RSG A;  3CND A;  5GRT A;  1DOB A;  3JSK A;  4KX6 A;  3UP4 A;  3AWI A;  4USQ A;  2CDU A;  2X99 A;  2R45 A;  4Y4L A;  1TDF A;  4JNA A;  4Y4N A;  1NHR A;  3G5S A;  2XVF A;  2YM1 A;  2JKC A;  1PBF A;  2GAG B;  3NK0 X;  2GMJ A;  2R46 A;  1DOD A;  2EQ8 A;  4B1B A;  3ALM A;  2YVJ A;  2A89 A;  4A7A A;  3AE7 A;  4DSH A;  2CUL A;  1EL7 A;  3AXB A;  1EL8 A;  2X50 A;  4BJY A;  3F8R A;  3VR9 A;  1GRF A;  1OJC A;  2Y6Q A;  1QJD A;  2E5V A;  4X9M A;  5CKU A;  3CGE A;  1COY A;  1MOK A;  2XVI A;  3OZ2 A;  4H2Q A;  3WE0 A;  4EIP A;  2QA2 A;  2BXS A; 
#chains in the Genus database with same CATH topology
 3UKK A;  4CCR A;  4EQS A;  4H2P A;  2O9Z A;  4WX1 A;  1NEN A;  4TLZ A;  4A9W A;  4EMW A;  4TM3 A;  4XWZ A;  2VQ7 A;  4GUV A;  3GYI A;  3CMM A;  3QJ4 A;  4JY2 A;  3SX6 A;  2WPC A;  2QAE A;  3GYJ A;  2NPX A;  3AEC A;  1BZL A;  4BK3 A;  3B3R A;  1ZY8 A;  2CVJ A;  3P4R A;  4EMI A;  2WP6 A;  4H2R A;  1LJ1 A;  3BI5 A;  4RSL A;  2OA1 A;  3CPJ G;  1IUV A;  3LZX A;  2WDQ A;  3IHM A;  3AEG A;  3SM8 A;  4X9N A;  4G9K A;  4C3X A;  1DOC A;  2C7G A;  1CC6 A;  3NRN A;  4YSX A;  2BRA A;  3C4A A;  2FJE A;  3NYE A;  5ER0 A;  3D1C A;  4DGK A;  4BJZ A;  1OJD A;  1W4X A;  4LII A;  3V76 A;  3IHG A;  1XPQ A;  4H4U A;  2WHD A;  4H4Z A;  5KRQ A;  1FEB A;  2YM2 A;  1GND A;  2YG3 A;  4OPT A;  3T31 A;  1JNR A;  5BUL A;  2WES A;  3QSE A;  1DNC A;  2C75 A;  2YG6 A;  5J60 A;  3AYI A;  1DOE A;  4U8K A;  3RP8 A;  2BXR A;  4ZN0 A;  3H4K A;  1GES A;  4OPC A;  2WPE A;  3AEA A;  1P2H A;  3GSI A;  2X3N A;  5C2T A;  1H86 A;  1ONF A;  4YSZ A;  1E6E A;  5U1O A;  2YLT A;  3ATR A;  3EF6 A;  3E1T A;  3LZW A;  3PS9 A;  3ITJ A;  4CCQ A;  4N9X A;  1CL0 A;  2BAC A;  3Q6J A;  2X8G A;  4U8L A;  2YG4 A;  5GSN A;  1IUW A;  4H4R A;  1N4U A;  4EQR A;  2ZZB A;  1S2Q A;  4B66 A;  2YLW A;  5FS6 A;  3KKJ A;  3SXI A;  1GTH A;  1GAL A;  3H8L A;  3B6D A;  3LJP A;  4A6N B;  3FMW A;  5L46 A;  2BS2 A;  1KNR A;  1PJ6 A;  2YR4 A;  3LXD A;  5IQ4 A;  1M64 A;  4XXG A;  1IUX A;  4U8I A;  2ZBW A;  3SFD A;  3UOV A;  3SFE A;  3GDN A;  1PS9 A;  1VDC A;  1D7L A;  1MXT A;  4AOX A;  3P4S A;  5EB4 A;  3DJD A;  3IF9 A;  4U8P A;  4YKF A;  4YKG A;  2B9Y A;  4DSG A;  4G74 A;  2VZ2 A;  3RP7 A;  3S5W A;  4LA1 A;  2XFO A;  2WPF A;  1XAN A;  1N4W A;  2Q0K A;  2VOU A;  3AYJ A;  4JY3 A;  5LV9 A;  3T0K A;  1PHH A;  4U8M A;  4CNJ A;  3AE2 A;  4GDE A;  2YG5 A;  1CBO A;  3UTG A;  2ZZ0 A;  2VVL G;  4EQX A;  5KOX A;  4EM4 A;  5KWF A;  3GMC A;  5KOW A;  3QFA A;  3ZYX A;  2V60 A;  2EQ7 A;  3QVR A;  3T2Z A;  2BS3 A;  3HYW A;  3UKL A;  2B9W A;  5C3J A;  3SZC A;  3ICR A;  3M12 A;  1GEU A;  2PHH A;  1PBC A;  1VG9 A;  2VVM A;  4B69 A;  1N1P A;  3SY4 A;  4CNK A;  4B65 A;  3UOY A;  1E39 A;  2ARD A;  5BVA A;  4X4J A;  4H2N A;  4OPI A;  4NEW A;  5HY5 A;  2Q6U A;  2XCG A;  3NKS A;  3GYX A;  2QA1 A;  4U2L A;  3K30 A;  1TRB A;  3KVE A;  3QVP A;  1YQ3 A;  2RGO A;  4I59 A;  4O5Q A;  2EQ6 A;  2YG7 A;  2BCG G;  2Y6R A;  2BK3 A;  3CNP A;  2C65 A;  5EBK A;  4KPR A;  1BF3 A;  4NTE A;  4NTD A;  1PDH A;  1H7W A;  1JRX A;  2F5Z A;  2JAE A;  1KF6 A;  1GPE A;  2IVE A;  2XLU A;  1OJT A;  2WOW A;  2C70 A;  4Z25 A;  3AE4 A;  3DK4 A;  4C77 A;  1D4D A;  4U2S A;  3DK8 A;  3BNM A;  4J56 A;  3GD3 A;  4K7Z A;  2XLS A;  3NK2 X;  4H4S A;  1RP0 A;  1TDN A;  2C72 A;  1CF3 A;  2WOI A;  4C3Y A;  1PJ5 A;  3DK9 A;  3KA7 A;  1PN0 A;  4II2 A;  2WOV A;  4YTN A;  3UTE A;  1KSU A;  2XFN A;  2BYB A;  1H6V A;  1D4E A;  2YAU A;  1YQZ A;  3CNT A;  2AQJ A;  4J2W A;  4GR1 A;  4ICY A;  1L0V A;  2YR6 A;  2JB1 A;  1B8S A;  4J33 A;  4Z24 A;  4Z43 A;  4EIQ A;  2V61 A;  3CIR A;  3NN6 X;  2WU2 A;  1GET A;  1E1L A;  4YTM A;  2TMD A;  4K22 A;  5FMH A;  3SZF A;  4AT2 A;  4Z2R A;  5J7X A;  1GTE A;  2WS3 A;  2NVK X;  5FS9 A;  4BV6 A;  5U63 A;  2A8X A;  3GRT A;  4ZCD A;  1GRB A;  1CJ3 A;  2GB0 A;  1QO8 A;  1PBE A;  5KVI A;  4CRT A;  4EQW A;  3GDP A;  2GQW A;  4B67 A;  1IUS A;  4H50 A;  4IV9 A;  1B5Q A;  5KNL A;  4C74 A;  4Z2U A;  3BI2 A;  1CJ4 A;  2OAL A;  3AED A;  3UKA A;  4UDR A;  2XFU A;  1M6I A;  4J34 A;  3URH A;  1LQT A;  4AOS A;  3NH3 X;  2E1M A;  1N4V A;  3ISH A;  1CJ2 A;  4H4T A;  2IID A;  3P4Q A;  1LV0 A;  3DJE A;  2GR1 A;  2GQF A;  1IJH A;  4H4Q A;  1KDG A;  2AR8 A;  2Q7V A;  1ZMD A;  2C3D A;  3DJG X;  3NYC A;  4H4V A;  4NWZ A;  4UP3 A;  1RYI A;  3R9U A;  4D04 A;  3I6D A;  3NT6 A;  4U8J A;  1D4C A;  2C76 A;  4O5U A;  4B63 A;  1LVL A;  2GR3 A;  2GEW A;  1V59 A;  2GF3 A;  3AYL A;  3CNJ A;  3AEF A;  4NZH A;  1FL2 A;  1YY5 A;  3KD9 A;  4TM1 A;  1NAA A;  2XVJ A;  4YWO A;  4REK A;  5KMP A;  1GRT A;  1Y56 A;  4EMJ A;  2YVG A;  4OPL A;  1O94 A;  2GRT A;  4G73 A;  2OAM A;  3SQP A;  1D7Y A;  1TDO A;  1Y56 B;  3ALJ A;  3V3N A;  3ABV A;  3F8D A;  2DKH A;  2R0P A;  2FJA A;  4A5L A;  1GXF A;  2RAB A;  4H4Y A;  1KNP A;  4NTC A;  2BAB A;  3ADA B;  2DKI A;  3AEE A;  1IUT A;  5DBJ A;  3CN8 A;  3KPK A;  3Q9T A;  4LU6 A;  4B68 A;  1B37 A;  1F8S A;  4A6N A;  2XFP A;  1YQ4 A;  3NN0 X;  2PYX A;  1PBB A;  4CBQ A;  2CFY A;  1PXC A;  3GMB A;  1ZOV A;  3AD9 B;  4JN9 A;  4CY6 A;  3C96 A;  4DNA A;  2WEU A;  4HB9 A;  3EAO A;  1AOG A;  4U2T A;  4J31 A;  5BRT A;  1S3B A;  4A79 A;  3PVC A;  1DJN A;  1H83 A;  4RG3 A;  1S2Y A;  2C73 A;  3ATQ A;  4APN A;  4BK2 A;  5KMQ A;  3RNM A;  2EQ9 A;  2VQB A;  3AD7 B;  4XWR A;  3T37 A;  2B7R A;  1K4Q A;  3DH9 A;  1IUU A;  3BNU A;  2B7S A;  1GER A;  3NTA A;  1OJ9 A;  1KSS A;  2J3N A;  2WP5 A;  5EOW A;  1NG4 A;  1VG0 A;  1H81 A;  1OJA A;  1CHU A;  1GV4 A;  2C66 A;  2C64 A;  2TPR A;  3L1R A;  3G5R A;  2GV8 A;  4TM4 A;  2JB3 A;  4P9S A;  2I0Z A;  3GWD A;  1JEH A;  1GRG A;  2XVH A;  2YLZ A;  5JCI A;  1JOA A;  1P2E A;  3ICT A;  3UOZ A;  2BK5 A;  2ZZC A;  4YTP A;  4OPD A;  2XLP A;  3HYX A;  3QFB A;  1CC2 A;  3KU9 A;  3VR8 A;  1TYT A;  3D8X A;  5HXI A;  3T2Y A;  1PXA A;  3K7T A;  1QLB A;  2GR2 A;  4ZCC A;  1E1K A;  1BKW A;  3DME A;  1ELI A;  5JCK A;  1FCD A;  2Z5Y A;  4IA5 A;  2BA9 A;  3UKP A;  3FBS A;  1ZKQ A;  2XLR A;  1Q1W A;  1LPF A;  1KFY A;  2FJD A;  1K0L A;  4JNQ A;  2RGH A;  4BK1 A;  1TYP A;  4FK1 A;  1NG3 A;  1MO9 A;  3SGL A;  3UKH A;  1DJQ A;  2WET A;  1E1N A;  3DGZ A;  2XFQ A;  2BK4 A;  3NNE A;  3RED A;  5JCM A;  1REO A;  1CC4 A;  1PJ7 A;  3M13 A;  4NEV A;  4YSH A;  4A65 A;  5CQF A;  1GOS A;  2GAH B;  2YWL A;  1NHS A;  3IWA A;  3UKF A;  1D5T A;  4GDP A;  2GVC A;  3HZL A;  3NHO X;  3UKQ A;  1YKJ A;  5TR3 A;  5KMR A;  1HYU A;  3UCL A;  4A99 A;  1JRZ A;  4H7U A;  3GD4 A;  2UZZ A;  3H8I A;  3L8K A;  1Z6L A;  1BWC A;  3I3L A;  3BHF A;  3P1W A;  1EL9 A;  1BGJ A;  1H82 A;  1SEZ A;  2V3A A;  3K7M X;  1Q9I A;  3ALL A;  2APG A;  4CY8 A;  3AE9 A;  2R4E A;  2FJB A;  5JCN A;  3NYF A;  4H4X A;  2BCP A;  4JQ9 A;  3SZ0 A;  1CJC A;  1H7X A;  3ICS A;  4AP1 A;  1VRQ B;  3C4N A;  1ZDL A;  3NG7 X;  1NPX A;  1ZX9 A;  4GAV A;  1JNZ A;  3V3O A;  2YVF A;  5IQ1 A;  1F6M A;  3T2K A;  1EL5 A;  2XDO A;  3F8P A;  3IC9 A;  4H4P A;  2JK6 A;  3AE8 A;  2OLN A;  2YQU A;  5JCL A;  3K7Q X;  3KLJ A;  2V6O A;  1F8W A;  1ZK7 A;  3UTH A;  4J57 A;  1PXB A;  4YT0 A;  4YSY A;  5HYM A;  3G5Q A;  1O5W A;  2WP9 A;  3ZDN A;  2B76 A;  3DJJ A;  2XVE A;  3LAD A;  3NTD A;  2IVD A;  4PAA A;  2FBW A;  4HA6 A;  2E4G A;  1PBD A;  1GRH A;  1BGN A;  3LB8 A;  1L9C A;  1JRY A;  2QCU A;  3HYV A;  2R0C A;  2WBA A;  3NK1 X;  2R0G A;  1S3E A;  2GR0 A;  3RHA A;  3AE3 A;  3QSM A;  2WU5 A;  4GCM A;  4K2X A;  3T14 A;  2YLS A;  4JDR A;  3P9U A;  4NNJ A;  2BS4 A;  4D03 A;  3EPT A;  3NIX A;  2C3C A;  4YXD A;  3P4P A;  1XDI A;  3KPF A;  3AD8 B;  5M10 A;  1EBD A;  4Z44 A;  1Y0P A;  2V3B A;  2Z5X A;  4MJW A;  4AT0 A;  5M0Z A;  1ZP0 A;  3RP6 A;  1VQW A;  4TLX A;  1NDA A;  1LQU A;  2V5Z A;  4GRT A;  2BC0 A;  3OC4 A;  4Z2T A;  2XLT A;  4Y4M A;  2R4J A;  2YR5 A;  4FX9 A;  1GT8 A;  3AB1 A;  3AE5 A;  4IA6 A;  3DA1 A;  4BUR A;  4Z26 A;  1L9D A;  4U8O A;  2AAQ A;  3CPH G;  5KVH A;  2VVL A;  4I58 A;  3VRB A;  3FIM B;  3GRS A;  4GF7 A;  4K5S A;  1ZMC A;  4U8N A;  1K0J A;  4TM0 A;  3VRD B;  2C4C A;  2WDR A;  4RG4 A;  1TDK A;  1GSN A;  2HQM A;  4UDQ A;  1LTX R;  3II4 A;  4G6G A;  1NHQ A;  4PAB A;  2B9X A;  1E7P A;  3CGD A;  4H4W A;  2VRL A;  4OPG A;  5U25 A;  1TDE A;  3CPI G;  3VRA A;  4FDC B;  3M0O A;  3CGC A;  1H84 A;  1UKV G;  1O95 A;  1XHC A;  3CGB A;  4K8D A;  4IVO B;  1E1M A;  1JU2 A;  5BUK A;  2WQY A;  1FEA A;  3BHK A;  4ECH A;  5KXJ A;  3SZW A;  4E0V A;  3AEB A;  2JB2 A;  2YLR A;  4K5R A;  4B64 A;  4M52 A;  2Q0L A;  1ZOY A;  2C67 A;  2VRM A;  3FPZ A;  4II3 A;  2ACZ A;  3LOV A;  3CTY A;  4USR A;  3UTF A;  3NLC A;  5KMS A;  4OCG A;  4OPU A;  4AP3 A;  2XYO A;  3QSS A;  3UP5 A;  2JBV A;  2GMH A;  4G6H A;  5EB5 A;  3EAN A;  3FG2 P;  3GWF A;  3VQR A;  3NGC X;  3SYI A;  2YLX A;  4IVM B;  5IPY A;  4J36 A;  4FK1 C;  3PO7 A;  2OLO A;  2H88 A;  1FOH A;  2W0H A;  5FS8 A;  2R9Z A;  3S61 A;  3O0H A;  1FEC A;  3BI4 A;  3CNS A;  3UOX A;  4ADW A;  1GRE A;  5HHF A;  4C5O A;  2H89 A;  1B4V A;  1NHP A;  2BC1 A;  2GH5 A;  4UDP A;  3AE1 A;  1DXL A;  4OVI A;  1X31 B;  1GRA A;  2RGJ A;  1F3P A;  1Q1R A;  4WCT A;  3COX A;  5FS7 A;  2WDV A;  1K0I A;  2X8H A;  3AE6 A;  2A87 A;  1F8R A;  1L9E A;  2X8C A;  3DGH A;  4EM3 A;  1NEK A;  1RSG A;  2BRY A;  3CND A;  5GRT A;  1DOB A;  3JSK A;  4KX6 A;  3UP4 A;  3AWI A;  4USQ A;  2CDU A;  2X99 A;  2R45 A;  4Y4L A;  1TDF A;  4JNA A;  4Y4N A;  1NHR A;  3G5S A;  2XVF A;  2YM1 A;  2JKC A;  1PBF A;  4GAP A;  2GAG B;  3NK0 X;  2GMJ A;  2R46 A;  1DOD A;  2EQ8 A;  4B1B A;  3ALM A;  2YVJ A;  2A89 A;  4A7A A;  3AE7 A;  4DSH A;  2CUL A;  1EL7 A;  3AXB A;  1EL8 A;  2X50 A;  4BJY A;  3F8R A;  3VR9 A;  1GRF A;  1OJC A;  2Y6Q A;  1QJD A;  2E5V A;  4X9M A;  5CKU A;  3CGE A;  1COY A;  1MOK A;  2XVI A;  3OZ2 A;  4H2Q A;  3WE0 A;  4EIP A;  2QA2 A;  2BXS A; 
#chains in the Genus database with same CATH homology
 3UKK A;  4CCR A;  4EQS A;  4H2P A;  2O9Z A;  4WX1 A;  1NEN A;  4TLZ A;  4A9W A;  4EMW A;  4TM3 A;  4XWZ A;  2VQ7 A;  4GUV A;  3GYI A;  3CMM A;  3QJ4 A;  4JY2 A;  3SX6 A;  2WPC A;  2QAE A;  3GYJ A;  2NPX A;  3AEC A;  1BZL A;  4BK3 A;  3B3R A;  1ZY8 A;  2CVJ A;  3P4R A;  4EMI A;  2WP6 A;  4H2R A;  1LJ1 A;  3BI5 A;  4RSL A;  2OA1 A;  3CPJ G;  1IUV A;  3LZX A;  2WDQ A;  3IHM A;  3AEG A;  3SM8 A;  4X9N A;  4G9K A;  4C3X A;  1DOC A;  2C7G A;  1CC6 A;  3NRN A;  4YSX A;  2BRA A;  3C4A A;  2FJE A;  3NYE A;  5ER0 A;  3D1C A;  4DGK A;  4BJZ A;  1OJD A;  1W4X A;  4LII A;  3V76 A;  3IHG A;  1XPQ A;  4H4U A;  2WHD A;  4H4Z A;  5KRQ A;  1FEB A;  2YM2 A;  1GND A;  2YG3 A;  4OPT A;  3T31 A;  1JNR A;  5BUL A;  2WES A;  3QSE A;  1DNC A;  2C75 A;  2YG6 A;  5J60 A;  3AYI A;  1DOE A;  4U8K A;  3RP8 A;  2BXR A;  4ZN0 A;  3H4K A;  1GES A;  4OPC A;  2WPE A;  3AEA A;  1P2H A;  3GSI A;  2X3N A;  5C2T A;  1H86 A;  1ONF A;  4YSZ A;  1E6E A;  5U1O A;  2YLT A;  3ATR A;  3EF6 A;  3E1T A;  3LZW A;  3PS9 A;  3ITJ A;  4CCQ A;  4N9X A;  1CL0 A;  2BAC A;  3Q6J A;  2X8G A;  4U8L A;  2YG4 A;  5GSN A;  1IUW A;  4H4R A;  1N4U A;  4EQR A;  2ZZB A;  1S2Q A;  4B66 A;  2YLW A;  5FS6 A;  3KKJ A;  3SXI A;  1GTH A;  1GAL A;  3H8L A;  3B6D A;  3LJP A;  4A6N B;  3FMW A;  5L46 A;  2BS2 A;  1KNR A;  1PJ6 A;  2YR4 A;  3LXD A;  5IQ4 A;  1M64 A;  4XXG A;  1IUX A;  4U8I A;  2ZBW A;  3SFD A;  3UOV A;  3SFE A;  3GDN A;  1PS9 A;  1VDC A;  1D7L A;  1MXT A;  4AOX A;  3P4S A;  5EB4 A;  3DJD A;  3IF9 A;  4U8P A;  4YKF A;  4YKG A;  2B9Y A;  4DSG A;  4G74 A;  2VZ2 A;  3RP7 A;  3S5W A;  4LA1 A;  2XFO A;  2WPF A;  1XAN A;  1N4W A;  2Q0K A;  2VOU A;  3AYJ A;  4JY3 A;  5LV9 A;  3T0K A;  1PHH A;  4U8M A;  4CNJ A;  3AE2 A;  4GDE A;  2YG5 A;  1CBO A;  3UTG A;  2ZZ0 A;  2VVL G;  4EQX A;  5KOX A;  4EM4 A;  5KWF A;  3GMC A;  5KOW A;  3QFA A;  3ZYX A;  2V60 A;  2EQ7 A;  3QVR A;  3T2Z A;  2BS3 A;  3HYW A;  3UKL A;  2B9W A;  5C3J A;  3SZC A;  3ICR A;  3M12 A;  1GEU A;  2PHH A;  1PBC A;  1VG9 A;  2VVM A;  4B69 A;  1N1P A;  3SY4 A;  4CNK A;  4B65 A;  3UOY A;  1E39 A;  2ARD A;  5BVA A;  4X4J A;  4H2N A;  4OPI A;  4NEW A;  5HY5 A;  2Q6U A;  2XCG A;  3NKS A;  3GYX A;  2QA1 A;  4U2L A;  3K30 A;  1TRB A;  3KVE A;  3QVP A;  1YQ3 A;  2RGO A;  4I59 A;  4O5Q A;  2EQ6 A;  2YG7 A;  2BCG G;  2Y6R A;  2BK3 A;  3CNP A;  2C65 A;  5EBK A;  4KPR A;  1BF3 A;  4NTE A;  4NTD A;  1PDH A;  1H7W A;  1JRX A;  2F5Z A;  2JAE A;  1KF6 A;  1GPE A;  2IVE A;  2XLU A;  1OJT A;  2WOW A;  2C70 A;  4Z25 A;  3AE4 A;  3DK4 A;  4C77 A;  1D4D A;  4U2S A;  3DK8 A;  3BNM A;  4J56 A;  3GD3 A;  4K7Z A;  2XLS A;  3NK2 X;  4H4S A;  1RP0 A;  1TDN A;  2C72 A;  1CF3 A;  2WOI A;  4C3Y A;  1PJ5 A;  3DK9 A;  3KA7 A;  1PN0 A;  4II2 A;  2WOV A;  4YTN A;  3UTE A;  1KSU A;  2XFN A;  2BYB A;  1H6V A;  1D4E A;  2YAU A;  1YQZ A;  3CNT A;  2AQJ A;  4J2W A;  4GR1 A;  4ICY A;  1L0V A;  2YR6 A;  2JB1 A;  1B8S A;  4J33 A;  4Z24 A;  4Z43 A;  4EIQ A;  2V61 A;  3CIR A;  3NN6 X;  2WU2 A;  1GET A;  1E1L A;  4YTM A;  2TMD A;  4K22 A;  5FMH A;  3SZF A;  4AT2 A;  4Z2R A;  5J7X A;  1GTE A;  2WS3 A;  2NVK X;  5FS9 A;  4BV6 A;  5U63 A;  2A8X A;  3GRT A;  4ZCD A;  1GRB A;  1CJ3 A;  2GB0 A;  1QO8 A;  1PBE A;  5KVI A;  4CRT A;  4EQW A;  3GDP A;  2GQW A;  4B67 A;  1IUS A;  4H50 A;  4IV9 A;  1B5Q A;  5KNL A;  4C74 A;  4Z2U A;  3BI2 A;  1CJ4 A;  2OAL A;  3AED A;  3UKA A;  4UDR A;  2XFU A;  1M6I A;  4J34 A;  3URH A;  1LQT A;  4AOS A;  3NH3 X;  2E1M A;  1N4V A;  3ISH A;  1CJ2 A;  4H4T A;  2IID A;  3P4Q A;  1LV0 A;  3DJE A;  2GR1 A;  2GQF A;  1IJH A;  4H4Q A;  1KDG A;  2AR8 A;  2Q7V A;  1ZMD A;  2C3D A;  3DJG X;  3NYC A;  4H4V A;  4NWZ A;  4UP3 A;  1RYI A;  3R9U A;  4D04 A;  3I6D A;  3NT6 A;  4U8J A;  1D4C A;  2C76 A;  4O5U A;  4B63 A;  1LVL A;  2GR3 A;  2GEW A;  1V59 A;  2GF3 A;  3AYL A;  3CNJ A;  3AEF A;  4NZH A;  1FL2 A;  1YY5 A;  3KD9 A;  4TM1 A;  1NAA A;  2XVJ A;  4YWO A;  4REK A;  5KMP A;  1GRT A;  1Y56 A;  4EMJ A;  2YVG A;  4OPL A;  1O94 A;  2GRT A;  4G73 A;  2OAM A;  3SQP A;  1D7Y A;  1TDO A;  1Y56 B;  3ALJ A;  3V3N A;  3ABV A;  3F8D A;  2DKH A;  2R0P A;  2FJA A;  4A5L A;  1GXF A;  2RAB A;  4H4Y A;  1KNP A;  4NTC A;  2BAB A;  3ADA B;  2DKI A;  3AEE A;  1IUT A;  5DBJ A;  3CN8 A;  3KPK A;  3Q9T A;  4LU6 A;  4B68 A;  1B37 A;  1F8S A;  4A6N A;  2XFP A;  1YQ4 A;  3NN0 X;  2PYX A;  1PBB A;  4CBQ A;  2CFY A;  1PXC A;  3GMB A;  1ZOV A;  3AD9 B;  4JN9 A;  4CY6 A;  3C96 A;  4DNA A;  2WEU A;  4HB9 A;  3EAO A;  1AOG A;  4U2T A;  4J31 A;  5BRT A;  1S3B A;  4A79 A;  3PVC A;  1DJN A;  1H83 A;  4RG3 A;  1S2Y A;  2C73 A;  3ATQ A;  4APN A;  4BK2 A;  5KMQ A;  3RNM A;  2EQ9 A;  2VQB A;  3AD7 B;  4XWR A;  3T37 A;  2B7R A;  1K4Q A;  3DH9 A;  1IUU A;  3BNU A;  2B7S A;  1GER A;  3NTA A;  1OJ9 A;  1KSS A;  2J3N A;  2WP5 A;  5EOW A;  1NG4 A;  1VG0 A;  1H81 A;  1OJA A;  1CHU A;  1GV4 A;  2C66 A;  2C64 A;  2TPR A;  3L1R A;  3G5R A;  2GV8 A;  4TM4 A;  2JB3 A;  4P9S A;  2I0Z A;  3GWD A;  1JEH A;  1GRG A;  2XVH A;  2YLZ A;  5JCI A;  1JOA A;  1P2E A;  3ICT A;  3UOZ A;  2BK5 A;  2ZZC A;  4YTP A;  4OPD A;  2XLP A;  3HYX A;  3QFB A;  1CC2 A;  3KU9 A;  3VR8 A;  1TYT A;  3D8X A;  5HXI A;  3T2Y A;  1PXA A;  3K7T A;  1QLB A;  2GR2 A;  4ZCC A;  1E1K A;  1BKW A;  3DME A;  1ELI A;  5JCK A;  1FCD A;  2Z5Y A;  4IA5 A;  2BA9 A;  3UKP A;  3FBS A;  1ZKQ A;  2XLR A;  1Q1W A;  1LPF A;  1KFY A;  2FJD A;  1K0L A;  4JNQ A;  2RGH A;  4BK1 A;  1TYP A;  4FK1 A;  1NG3 A;  1MO9 A;  3SGL A;  3UKH A;  1DJQ A;  2WET A;  1E1N A;  3DGZ A;  2XFQ A;  2BK4 A;  3NNE A;  3RED A;  5JCM A;  1REO A;  1CC4 A;  1PJ7 A;  3M13 A;  4NEV A;  4YSH A;  4A65 A;  5CQF A;  1GOS A;  2GAH B;  2YWL A;  1NHS A;  3IWA A;  3UKF A;  1D5T A;  4GDP A;  2GVC A;  3HZL A;  3NHO X;  3UKQ A;  1YKJ A;  5TR3 A;  5KMR A;  1HYU A;  3UCL A;  4A99 A;  1JRZ A;  4H7U A;  3GD4 A;  2UZZ A;  3H8I A;  3L8K A;  1Z6L A;  1BWC A;  3I3L A;  3BHF A;  3P1W A;  1EL9 A;  1BGJ A;  1H82 A;  1SEZ A;  2V3A A;  3K7M X;  1Q9I A;  3ALL A;  2APG A;  4CY8 A;  3AE9 A;  2R4E A;  2FJB A;  5JCN A;  3NYF A;  4H4X A;  2BCP A;  4JQ9 A;  3SZ0 A;  1CJC A;  1H7X A;  3ICS A;  4AP1 A;  1VRQ B;  3C4N A;  1ZDL A;  3NG7 X;  1NPX A;  1ZX9 A;  4GAV A;  1JNZ A;  3V3O A;  2YVF A;  5IQ1 A;  1F6M A;  3T2K A;  1EL5 A;  2XDO A;  3F8P A;  3IC9 A;  4H4P A;  2JK6 A;  3AE8 A;  2OLN A;  2YQU A;  5JCL A;  3K7Q X;  3KLJ A;  2V6O A;  1F8W A;  1ZK7 A;  3UTH A;  4J57 A;  1PXB A;  4YT0 A;  4YSY A;  5HYM A;  3G5Q A;  1O5W A;  2WP9 A;  3ZDN A;  2B76 A;  3DJJ A;  2XVE A;  3LAD A;  3NTD A;  2IVD A;  4PAA A;  2FBW A;  4HA6 A;  2E4G A;  1PBD A;  1GRH A;  1BGN A;  3LB8 A;  1L9C A;  1JRY A;  2QCU A;  3HYV A;  2R0C A;  2WBA A;  3NK1 X;  2R0G A;  1S3E A;  2GR0 A;  3RHA A;  3AE3 A;  3QSM A;  2WU5 A;  4GCM A;  4K2X A;  3T14 A;  2YLS A;  4JDR A;  3P9U A;  4NNJ A;  2BS4 A;  4D03 A;  3EPT A;  3NIX A;  2C3C A;  4YXD A;  3P4P A;  1XDI A;  3KPF A;  3AD8 B;  5M10 A;  1EBD A;  4Z44 A;  1Y0P A;  2V3B A;  2Z5X A;  4MJW A;  4AT0 A;  5M0Z A;  1ZP0 A;  3RP6 A;  1VQW A;  4TLX A;  1NDA A;  1LQU A;  2V5Z A;  4GRT A;  2BC0 A;  3OC4 A;  4Z2T A;  2XLT A;  4Y4M A;  2R4J A;  2YR5 A;  4FX9 A;  1GT8 A;  3AB1 A;  3AE5 A;  4IA6 A;  3DA1 A;  4BUR A;  4Z26 A;  1L9D A;  4U8O A;  2AAQ A;  3CPH G;  5KVH A;  2VVL A;  4I58 A;  3VRB A;  3FIM B;  3GRS A;  4GF7 A;  4K5S A;  1ZMC A;  4U8N A;  1K0J A;  4TM0 A;  3VRD B;  2C4C A;  2WDR A;  4RG4 A;  1TDK A;  1GSN A;  2HQM A;  4UDQ A;  1LTX R;  3II4 A;  4G6G A;  1NHQ A;  4PAB A;  2B9X A;  1E7P A;  3CGD A;  4H4W A;  2VRL A;  4OPG A;  5U25 A;  1TDE A;  3CPI G;  3VRA A;  4FDC B;  3M0O A;  3CGC A;  1H84 A;  1UKV G;  1O95 A;  1XHC A;  3CGB A;  4K8D A;  4IVO B;  1E1M A;  1JU2 A;  5BUK A;  2WQY A;  1FEA A;  3BHK A;  4ECH A;  5KXJ A;  3SZW A;  4E0V A;  3AEB A;  2JB2 A;  2YLR A;  4K5R A;  4B64 A;  4M52 A;  2Q0L A;  1ZOY A;  2C67 A;  2VRM A;  3FPZ A;  4II3 A;  2ACZ A;  3LOV A;  3CTY A;  4USR A;  3UTF A;  3NLC A;  5KMS A;  4OCG A;  4OPU A;  4AP3 A;  2XYO A;  3QSS A;  3UP5 A;  2JBV A;  2GMH A;  4G6H A;  5EB5 A;  3EAN A;  3FG2 P;  3GWF A;  3VQR A;  3NGC X;  3SYI A;  2YLX A;  4IVM B;  5IPY A;  4J36 A;  4FK1 C;  3PO7 A;  2OLO A;  2H88 A;  1FOH A;  2W0H A;  5FS8 A;  2R9Z A;  3S61 A;  3O0H A;  1FEC A;  3BI4 A;  3CNS A;  3UOX A;  4ADW A;  1GRE A;  5HHF A;  4C5O A;  2H89 A;  1B4V A;  1NHP A;  2BC1 A;  2GH5 A;  4UDP A;  3AE1 A;  1DXL A;  4OVI A;  1X31 B;  1GRA A;  2RGJ A;  1F3P A;  1Q1R A;  4WCT A;  3COX A;  5FS7 A;  2WDV A;  1K0I A;  2X8H A;  3AE6 A;  2A87 A;  1F8R A;  1L9E A;  2X8C A;  3DGH A;  4EM3 A;  1NEK A;  1RSG A;  2BRY A;  3CND A;  5GRT A;  1DOB A;  3JSK A;  4KX6 A;  3UP4 A;  3AWI A;  4USQ A;  2CDU A;  2X99 A;  2R45 A;  4Y4L A;  1TDF A;  4JNA A;  4Y4N A;  1NHR A;  3G5S A;  2XVF A;  2YM1 A;  2JKC A;  1PBF A;  4GAP A;  2GAG B;  3NK0 X;  2GMJ A;  2R46 A;  1DOD A;  2EQ8 A;  4B1B A;  3ALM A;  2YVJ A;  2A89 A;  4A7A A;  3AE7 A;  4DSH A;  2CUL A;  1EL7 A;  3AXB A;  1EL8 A;  2X50 A;  4BJY A;  3F8R A;  3VR9 A;  1GRF A;  1OJC A;  2Y6Q A;  1QJD A;  2E5V A;  4X9M A;  5CKU A;  3CGE A;  1COY A;  1MOK A;  2XVI A;  3OZ2 A;  4H2Q A;  3WE0 A;  4EIP A;  2QA2 A;  2BXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...