1TDFA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
molecule keywords THIOREDOXIN REDUCTASE
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA02
2XLRA 3AEEA 3VRDB 3AE9A 3AEDA 3URHA 1PBFA 1PJ6A 4PABA 1KNRA 4H4UA 4Z2UA 2ZBWA 4GDEA 1TYPA 1ZMCA 2UZZA 3P4QA 4TLZA 4U2SA 2YQUA 2ZZBA 3SFDA 2FJBA 4YKGA 3OZ2A 4BK1A 4J57A 1F8RA 3UTEA 4JY3A 1QO8A 4Z25A 4A6NA 2YLRA 3F8DA 2IVEA 2BACA 3AXBA 3NK0X 3T37A 4ZCCA 1P2EA 2WDQA 2WDRA 3IF9A 4GF7A 4UDQA 4AOXA 4B66A 1FEAA 4AT0A 1KNPA 4H4ZA 2V6OA 3FIMB 4A65A 2YM2A 1TDKA 3NG7X 1Y56B 2EQ9A 3AYJA 2WP5A 3CIRA 1GRFA 4H4PA 4K2XA 4K8DA 1IUSA 2GQFA 1ZY8A 2AQJA 3FMWA 1JNZA 4KX6A 3REDA 2CFYA 1XHCA 1NPXA 1OJCA 2XFUA 3CNSA 4YTNA 2VRMA 2PYXA 2APGA 1GSNA 1DOBA 1ONFA 4A5LA 1H81A 3FPZA 3NGCX 1PBBA 1QJDA 4C3XA 3D8XA 1D4CA 3FG2P 2GAHB 4X9MA 2E1MA 1TDOA 1XDIA 1KSUA 2X8GA 5BRTA 4ICYA 5EB5A 1GRBA 2GH5A 3IHGA 2JB1A 2QAEA 4LA1A 4N9XA 4J2WA 3SQPA 3CNDA 2VZ2A 2C76A 2X99A 4GDPA 4YTMA 3NN6X 2GR0A 2GF3A 1H82A 1NEKA 2B9WA 2C66A 2OALA 3GDNA 3ICTA 3M13A 5J7XA 2XVJA 4OPLA 1JEHA 2E4GA 1VDCA 2XLUA 2YVFA 4B64A 3AE8A 1QLBA 3DA1A 3RP7A 5U25A 2C7GA 1GEUA 4YXDA 2BXRA 3CNTA 1LV0A 4EM3A 4HB9A 1H84A 2NPXA 2C73A 3P4RA 4HA6A 3RHAA 3BI4A 1RSGA 4U8PA 1BGNA 2GR2A 2XVFA 3OC4A 3NYEA 3AE5A 3DGHA 2WP6A 4OPUA 4RG3A 2GEWA 2ARDA 3SGLA 3C96A 3E1TA 1EBDA 4A9WA 4EMIA 1FECA 3LZWA 1L9EA 4H4YA 1TDEA 1E1NA 5FS7A 3LB8A 1VG0A 3AE1A 3COXA 1TRBA 2C3DA 1JOAA 2V3AA 4H4SA 4FK1C 2VOUA 3CTYA 4TM1A 3UKFA 1GTEA 3BNMA 3NLCA 3RP6A 1P2HA 4B65A 5IPYA 1PDHA 4CCRA 5CQFA 4H2PA 3B6DA 4H2RA 4XWZA 1FL2A 3AYLA 1NHSA 1CJ2A 4YSHA 4Z43A 5JCLA 4CY8A 3R9UA 4P9SA 1M64A 4NTCA 4UDPA 1CC2A 1KDGA 3EAOA 1H83A 1GTHA 4K5SA 4LIIA 3NT6A 4OPIA 5FS8A 3WE0A 4C74A 2BABA 1EL7A 3NNEA 4GRTA 1E39A 4RSLA 3UOVA 2YM1A 2JAEA 4B1BA 2XVEA 4U8IA 5U63A 2VVLG 2C72A 2ACZA 2Q0LA 1YQ4A 2Y6RA 4YWOA 1IUTA 2GRTA 2WPCA 2WU2A 2OA1A 1N1PA 4A7AA 2OLNA 3UCLA 3KU9A 4FDCB 3F8RA 3NTDA 1L9DA 4JNQA 3ZYXA 5BVAA 1JRYA 2R0PA 1DOEA 1PHHA 3UOYA 4IA5A 1IUUA 3UKQA 4BJZA 3K30A 1GXFA 1E7PA 3UOZA 4JN9A 2BYBA 1OJTA 2R4JA 2CDUA 2C75A 4H4TA 4K7ZA 4IVOB 3CGBA 4A99A 4IV9A 2YR5A 1ZP0A 4H2NA 2JBVA 1B5QA 4NTEA 2Q6UA 1CHUA 1H7XA 2TMDA 4KPRA 2ZZ0A 4Z24A 4EQXA 2OLOA 3KLJA 3RNMA 1PXCA 1NENA 2Z5YA 3LADA 4D03A 1HYUA 2O9ZA 2XFNA 4TM4A 5J60A 3UP5A 2QA1A 3H8IA 3L1RA 5JCIA 2RGJA 4U2TA 2YWLA 5KVIA 4CRTA 1DJQA 4J56A 4Y4MA 1E1KA 4K5RA 1S2YA 1VG9A 2A89A 2BK4A 2BCPA 4EMWA 4IA6A 3UOXA 5HHFA 5BULA 3VRAA 1ZKQA 4C5OA 1AOGA 2B76A 5DBJA 1Y0PA 3AB1A 4DNAA 2BC0A 3ALMA 3P4PA 4NTDA 4U2LA 4EMJA 2H89A 2C64A 1REOA 1VQWA 1LQUA 3NRNA 3QFBA 4CY6A 4EQSA 1PJ7A 4EIQA 1BWCA 1JRXA 3UTFA 1CJ4A 4USQA 1GREA 2XFPA 5TR3A 4ZN0A 3EANA 2E5VA 2FJDA 4E0VA 2AR8A 1COYA 3CPJG 2XFQA 5GRTA 2GAGB 3P1WA 3H8LA 3II4A 3AYIA 3NIXA 3VR8A 4O5UA 4U8KA 3PVCA 3P4SA 2IVDA 3CNJA 1F6MA 4GR1A 3AD9B 1ZK7A 1L9CA 2VQBA 3BHKA 3K7TA 5IQ4A 3QSMA 1XPQA 2EQ6A 4XWRA 3GDPA 1W4XA 4ZCDA 1JU2A 3DMEA 1RYIA 3AEBA 2DKIA 2YG6A 2C65A 1S3EA 4YSXA 3PS9A 1NHPA 1B8SA 2BS2A 1H6VA 2XDOA 2XVIA 3UKPA 1TDFA 1GALA 3C4NA 3DK9A 3I3LA 4J36A 4D04A 1CC6A 2XFOA 2BK3A 3ICSA 4ECHA 4Z26A 3NK1X 5KWFA 3QJ4A 3CN8A 4DSHA 2A8XA 1ZMDA 1E1MA 1PN0A 3H4KA 4U8LA 2GR3A 2VRLA 5IQ1A 2CULA 4AP1A 1KFYA 2VQ7A 2R0GA 2VVLA 3KD9A 4APNA 2CVJA 4TM3A 3GSIA 2X3NA 5KOXA 1PBDA 3DJDA 3DK8A 1EL9A 1D4EA 2A87A 4BV6A 4RG4A 2GR1A 5LV9A 2Q7VA 3IC9A 1NHQA 1IJHA 1CBOA 1JRZA 1O94A 3AD8B 3QFAA 1TDNA 3NH3X 1MOKA 1KF6A 1CC4A 3FBSA 2JK6A 2YG3A 1K4QA 1GOSA 1E1LA 2YR6A 3ITJA 1CJCA 3QVRA 4I59A 1GRAA 2GQWA 4M52A 3VQRA 5KXJA 2XCGA 3IHMA 3GYJA 4JQ9A 3AE3A 5BUKA 4BK3A 1D7LA 2EQ8A 3KVEA 3UTHA 2YG7A 3CGEA 3GRSA 2GB0A 3CPHG 1F3PA 2QCUA 4AP3A 2V61A 2PHHA 2R46A 2WOIA 4X9NA 5EB4A 5HYMA 1NDAA 1MXTA 4TLXA 1GRGA 4OPTA 2R0CA 3BHFA 4H2QA 3V3NA 4I58A 4FX9A 3P9UA 1B37A 2Y6QA 4H4QA 3AE2A 4Y4NA 2X50A 4B63A 3DH9A 4K22A 1KSSA 3GWFA 3K7QX 2BCGG 5JCKA 2XLPA 2R4EA 3B3RA 2H88A 2Z5XA 1PBCA 3DJJA 2XYOA 1GPEA 4A79A 3AE7A 1NAAA 1IUXA 2XVHA 4H4WA 5FMHA 3SFEA 1OJDA 1IUVA 2YVGA 1LJ1A 3I6DA 1Q1WA 4O5QA 4U8NA 4JDRA 1CF3A 1K0JA 1N4UA 4OPCA 2WP9A 4B68A 2JB2A 2V3BA 2B9YA 2WDVA 5GSNA 3DJEA 1GV4A 1PS9A 2C70A 1NHRA 3AD7B 1ZX9A 3D1CA 4J34A 4REKA 5FS6A 3L8KA 2JKCA 2YR4A 4FK1A 3HZLA 2WOVA 3K7MX 1YQ3A 1D4DA 2GMJA 2V60A 4UP3A 1OJ9A 2WHDA 1X31B 4JNAA 4OCGA 4Z44A 2BK5A 1NG3A 3KA7A 2YVJA 5M10A 1BKWA 3GMCA 4H4RA 1FEBA 1FCDA 2AAQA 1LPFA 3ALJA 4GUVA 2J3NA 4MJWA 4USRA 4A6NB 3NHOX 3QSSA 4AT2A 4CNJA 2GV8A 4CCQA 3NK2X 3S61A 1IUWA 3BI5A 1DJNA 3M0OA 4WX1A 1MO9A 3ALLA 3V76A 1GRTA 2RGOA 2Q0KA 2NVKX 2XLSA 4PAAA 2BC1A 1PXAA 1PJ5A 3AE6A 5ER0A 1LVLA 2BS4A 4BJYA 4Z2TA 2FJEA 2YG5A 4YKFA 1ZOYA 3ISHA 1O95A 2JB3A 1V59A 2WOWA 1XANA 3LJPA 3UKLA 3NKSA 1K0LA 1M6IA 2WETA 2ZZCA 2EQ7A 2DKHA 4H4VA 4U8MA 1ZDLA 4DGKA 3G5RA 3GD4A 2VVMA 3CGCA 5EOWA 1FOHA 5U1OA 3ATRA 5M0ZA 2X8CA 1YY5A 3LOVA 2XLTA 3GYIA 1B4VA 2C3CA 2OAMA 1YQZA 2TPRA 2X8HA 1EL5A 3BI2A 3GWDA 4H4XA 4OPDA 3CNPA 1D5TA 3BNUA 3ICRA 1L0VA 4EQWA 3VRBA 4DSGA 2RABA 4OVIA 2YLSA 1YKJA 4EIPA 4EM4A 2I0ZA 4X4JA 1GNDA 1K0IA 2FBWA 3RP8A 2WBAA 1JNRA 1N4WA 1F8SA 2C67A 2WPFA 4TM0A 4BK2A 4WCTA 1DODA 2GVCA 1EL8A 1GESA 2QA2A 2YG4A 3UKHA 2RGHA 1GT8A 3AEFA 5L46A 3IWAA 4AOSA 3DK4A 3UP4A 4B69A 4B67A 1F8WA 1PXBA 2B9XA 1Q1RA 3C4AA 5KRQA 2B7RA 3ADAB 3JSKA 4XXGA 1ZOVA 2FJAA 4UDRA 3QSEA 1N4VA 1BGJA 2YAUA 3UKKA 1SEZA 2V5ZA 2HQMA 4YSZA 1O5WA 4H7UA 1ELIA 3G5QA 3GRTA 1PBEA 2GMHA 2BA9A 4J33A 3VR9A 1DOCA 1D7YA 3M12A 1DXLA 3SM8A 4YTPA 3ABVA 3AE4A 1LTXR 1S2QA 2YLWA 3GMBA 1GETA 3NTAA 4Z2RA 4C77A 3DJGX 2IIDA 3Q6JA 4NEVA 2BXSA 1GRHA 2WU5A 1H7WA 1Z6LA 5HXIA 3LXDA 3NYFA 1BZLA 1S3BA 1E6EA 3DGZA 5KOWA 1LQTA 2WS3A 3AECA 2YLTA 5EBKA 3G5SA 1GERA 3AEAA 3GD3A 5HY5A 1TYTA 3ATQA 2BS3A 3CGDA 4GCMA 4BURA 4YT0A 5JCMA 4JY2A 1DNCA 4Y4LA 3KKJA 3NN0X 3AWIA 2R9ZA 3S5WA 5KVHA 5C2TA 3QVPA 5CKUA 4C3YA 1NG4A 3ZDNA 3UKAA 1Q9IA 2F5ZA 4CNKA 5JCNA 1CL0A 3Q9TA 1VRQB 4LU6A 2WEUA 2WQYA 2R45A 4NEWA 2YLXA 1OJAA 3CPIG 4J31A 1H86A 3O0HA 3V3OA 4IVMB 1UKVG 2B7SA 2YLZA 2W0HA 3AEGA 4ADWA 4U8OA 3EF6A 1BF3A 3EPTA 3F8PA 3NYCA 4OPGA 4U8JA 2WPEA 4NZHA 1RP0A 1CJ3A 3KPFA 5C3JA 2WESA 3PO7A 3UTGA 4CBQA 3LZXA 4H50A 4EQRA 4YSYA 1Y56A 5FS9A
chains in the Genus database with same CATH superfamily
2XLRA 3AEEA 3VRDB 3AE9A 3AEDA 3URHA 1PBFA 1PJ6A 4PABA 1KNRA 4H4UA 4Z2UA 2ZBWA 4GDEA 3T2YA 1TYPA 1ZMCA 2UZZA 3P4QA 4TLZA 4U2SA 2YQUA 2ZZBA 3SFDA 2FJBA 4YKGA 3OZ2A 4BK1A 4J57A 3SX6A 1F8RA 3UTEA 4JY3A 1QO8A 4Z25A 4A6NA 2YLRA 5KMRA 3F8DA 2IVEA 2BACA 3AXBA 3NK0X 3T37A 4ZCCA 1P2EA 2WDQA 2WDRA 3IF9A 3HYVA 4GF7A 4UDQA 4AOXA 4B66A 1FEAA 4AT0A 1KNPA 4H4ZA 2V6OA 3FIMB 4A65A 2YM2A 1TDKA 3NG7X 1Y56B 2EQ9A 3AYJA 2WP5A 3CIRA 1GRFA 4H4PA 4K2XA 4K8DA 1IUSA 2GQFA 1ZY8A 2AQJA 3FMWA 1JNZA 4KX6A 3REDA 2CFYA 1XHCA 1NPXA 1OJCA 2XFUA 3CNSA 4YTNA 2VRMA 2PYXA 2APGA 1GSNA 1DOBA 3SZWA 1ONFA 3SZFA 4A5LA 1H81A 3FPZA 3NGCX 1PBBA 1QJDA 4C3XA 3D8XA 1D4CA 3FG2P 2GAHB 4X9MA 2E1MA 1TDOA 1XDIA 1KSUA 2X8GA 5BRTA 4ICYA 5EB5A 1GRBA 2GH5A 3IHGA 2JB1A 2QAEA 4LA1A 4N9XA 4J2WA 3SQPA 3CNDA 5KNLA 2VZ2A 2C76A 2X99A 3T0KA 4GDPA 4YTMA 3NN6X 2GR0A 2GF3A 1H82A 1NEKA 2B9WA 2C66A 2OALA 3GDNA 3ICTA 3M13A 5J7XA 2XVJA 4OPLA 1JEHA 2E4GA 1VDCA 2XLUA 2YVFA 4B64A 3AE8A 1QLBA 3DA1A 3RP7A 5U25A 2C7GA 1GEUA 4YXDA 2BXRA 3CNTA 1LV0A 4EM3A 4HB9A 1H84A 2NPXA 2C73A 2C4CA 3P4RA 4HA6A 3RHAA 3BI4A 1RSGA 4U8PA 1BGNA 2GR2A 2XVFA 3OC4A 3NYEA 3AE5A 3DGHA 2WP6A 4OPUA 4RG3A 2GEWA 2ARDA 3SGLA 3C96A 3E1TA 3HYWA 1EBDA 4A9WA 4EMIA 1FECA 3LZWA 1L9EA 4H4YA 1TDEA 1E1NA 5FS7A 3LB8A 1VG0A 3AE1A 3COXA 1TRBA 2C3DA 1JOAA 2V3AA 4H4SA 4FK1C 2VOUA 3CTYA 4TM1A 3UKFA 1GTEA 3BNMA 3NLCA 3RP6A 1P2HA 4B65A 5IPYA 1PDHA 4CCRA 5CQFA 4H2PA 3B6DA 4H2RA 4XWZA 1FL2A 3AYLA 1NHSA 1CJ2A 4YSHA 4Z43A 5JCLA 4CY8A 3R9UA 4P9SA 1M64A 4NTCA 4UDPA 1CC2A 1KDGA 3EAOA 1H83A 1GTHA 4K5SA 4LIIA 3NT6A 4OPIA 5FS8A 3WE0A 4C74A 2BABA 1EL7A 3NNEA 4GRTA 3SY4A 1E39A 4RSLA 3UOVA 2YM1A 2JAEA 4B1BA 2XVEA 4U8IA 5U63A 2VVLG 2C72A 2ACZA 2Q0LA 1YQ4A 2Y6RA 4YWOA 1IUTA 2GRTA 2WPCA 2WU2A 2OA1A 1N1PA 4A7AA 2OLNA 3UCLA 3KU9A 4FDCB 3F8RA 3NTDA 1L9DA 4JNQA 3ZYXA 5BVAA 1JRYA 2R0PA 1DOEA 1PHHA 3UOYA 4IA5A 1IUUA 3UKQA 4BJZA 3K30A 1GXFA 1E7PA 3UOZA 4II2A 4JN9A 2BYBA 1OJTA 2R4JA 2CDUA 2C75A 4H4TA 4K7ZA 4IVOB 4NWZA 3CGBA 4A99A 4IV9A 2YR5A 1ZP0A 4H2NA 2JBVA 1B5QA 4NTEA 2Q6UA 1CHUA 1H7XA 2TMDA 4KPRA 3SZ0A 2ZZ0A 4Z24A 5KMPA 4EQXA 2OLOA 3KLJA 3RNMA 1PXCA 1NENA 2Z5YA 3LADA 4D03A 1HYUA 2O9ZA 2XFNA 4TM4A 5J60A 3UP5A 2QA1A 3H8IA 3L1RA 5JCIA 2RGJA 4U2TA 2YWLA 5KVIA 4CRTA 1DJQA 4J56A 4Y4MA 1E1KA 4K5RA 1S2YA 1VG9A 2A89A 2BK4A 2BCPA 4EMWA 4IA6A 3UOXA 5HHFA 5BULA 3VRAA 1ZKQA 4C5OA 1AOGA 2B76A 5DBJA 1Y0PA 3AB1A 4DNAA 2BC0A 3ALMA 3P4PA 4NTDA 4U2LA 4EMJA 2H89A 2C64A 1REOA 1VQWA 1LQUA 3NRNA 3QFBA 4CY6A 4EQSA 1PJ7A 4EIQA 1BWCA 1JRXA 3UTFA 1CJ4A 4USQA 1GREA 2XFPA 3T2KA 5TR3A 4ZN0A 4II3A 3EANA 2E5VA 2FJDA 4E0VA 2AR8A 1COYA 3CPJG 2XFQA 5GRTA 2GAGB 3P1WA 3H8LA 3II4A 3AYIA 3NIXA 3VR8A 4O5UA 4U8KA 3PVCA 3P4SA 2IVDA 3CNJA 1F6MA 4GR1A 3AD9B 1ZK7A 1L9CA 2VQBA 3BHKA 3K7TA 5IQ4A 3QSMA 1XPQA 2EQ6A 4XWRA 3GDPA 1W4XA 4ZCDA 1JU2A 3DMEA 1RYIA 3AEBA 2DKIA 2YG6A 2C65A 1S3EA 4YSXA 3PS9A 1NHPA 1B8SA 2BS2A 1H6VA 2XDOA 2XVIA 3UKPA 1TDFA 1GALA 3C4NA 3DK9A 3I3LA 4J36A 4D04A 1CC6A 2XFOA 2BK3A 3ICSA 4ECHA 4Z26A 3NK1X 5KWFA 3QJ4A 3CN8A 4DSHA 2A8XA 1ZMDA 1E1MA 1PN0A 3H4KA 3KPKA 4U8LA 2GR3A 2VRLA 5IQ1A 2CULA 4AP1A 1KFYA 2VQ7A 2R0GA 2VVLA 3KD9A 4APNA 2CVJA 4TM3A 3GSIA 2X3NA 5KOXA 1PBDA 3DJDA 3DK8A 1EL9A 1D4EA 2A87A 4BV6A 4RG4A 2GR1A 5LV9A 2Q7VA 3IC9A 1NHQA 1IJHA 1CBOA 3T14A 1JRZA 1O94A 3AD8B 3QFAA 2BRYA 1TDNA 3NH3X 1MOKA 1KF6A 1CC4A 3FBSA 2JK6A 2YG3A 1K4QA 1GOSA 1E1LA 2YR6A 3ITJA 1CJCA 3QVRA 4I59A 1GRAA 2GQWA 4M52A 3VQRA 5KXJA 2XCGA 3IHMA 3GYJA 4JQ9A 3AE3A 5BUKA 4BK3A 1D7LA 2EQ8A 3KVEA 4G9KA 3UTHA 2YG7A 3CGEA 3GRSA 2GB0A 3CPHG 1F3PA 2QCUA 4AP3A 2V61A 2PHHA 2R46A 2WOIA 4X9NA 5EB4A 5HYMA 1NDAA 1MXTA 4TLXA 1GRGA 4OPTA 3HYXA 2R0CA 3BHFA 4H2QA 3V3NA 4I58A 4FX9A 3P9UA 1B37A 2Y6QA 4H4QA 3AE2A 4Y4NA 2X50A 4NNJA 4B63A 3DH9A 4K22A 3SZCA 1KSSA 3GWFA 3K7QX 2BCGG 5JCKA 2XLPA 2R4EA 3SYIA 3B3RA 2H88A 2Z5XA 1PBCA 5KMQA 3DJJA 2XYOA 1GPEA 4A79A 3AE7A 1NAAA 1IUXA 2XVHA 4H4WA 5FMHA 3SFEA 1OJDA 1IUVA 2YVGA 1LJ1A 3I6DA 1Q1WA 4O5QA 4U8NA 4JDRA 1CF3A 1K0JA 1N4UA 4OPCA 2WP9A 4B68A 2JB2A 2V3BA 2B9YA 2WDVA 5GSNA 3DJEA 1GV4A 1PS9A 2C70A 1NHRA 3AD7B 1ZX9A 3D1CA 4J34A 4REKA 5FS6A 5KMSA 3L8KA 2JKCA 2YR4A 4FK1A 3HZLA 2WOVA 3K7MX 1YQ3A 1D4DA 2GMJA 2V60A 4UP3A 1OJ9A 2WHDA 1X31B 4JNAA 4OCGA 4Z44A 2BK5A 1NG3A 3KA7A 2YVJA 5M10A 1BKWA 4G6GA 3GMCA 4GAPA 1FEBA 1FCDA 2AAQA 1LPFA 3ALJA 4H4RA 4GUVA 2J3NA 4MJWA 4USRA 4A6NB 3NHOX 3QSSA 4AT2A 4CNJA 2GV8A 4CCQA 3NK2X 3S61A 1IUWA 3BI5A 1DJNA 3M0OA 3GYXA 4WX1A 1MO9A 3ALLA 3V76A 1GRTA 2RGOA 2Q0KA 2NVKX 2XLSA 4PAAA 2BC1A 1PXAA 1PJ5A 3AE6A 5ER0A 1LVLA 2BS4A 4BJYA 4Z2TA 2FJEA 2YG5A 4YKFA 1ZOYA 3ISHA 3CMMA 1O95A 2JB3A 1V59A 2WOWA 1XANA 3LJPA 3UKLA 3NKSA 1K0LA 1M6IA 2WETA 2ZZCA 2EQ7A 2DKHA 4H4VA 4U8MA 1ZDLA 4DGKA 3G5RA 3SXIA 3T31A 3GD4A 2VVMA 3CGCA 5EOWA 1FOHA 5U1OA 3ATRA 5M0ZA 2X8CA 1YY5A 3LOVA 2XLTA 3GYIA 1B4VA 2C3CA 2OAMA 1YQZA 2TPRA 2X8HA 1EL5A 3BI2A 3GWDA 4H4XA 4OPDA 3CNPA 1D5TA 3BNUA 3ICRA 1L0VA 4EQWA 3VRBA 4DSGA 2RABA 4OVIA 2YLSA 1YKJA 2BRAA 4EIPA 2I0ZA 4X4JA 4EM4A 1GNDA 1K0IA 2FBWA 3RP8A 2WBAA 1JNRA 1N4WA 1F8SA 2C67A 2WPFA 4TM0A 4BK2A 4WCTA 1DODA 2GVCA 1EL8A 1GESA 2QA2A 2YG4A 3UKHA 2RGHA 1GT8A 3AEFA 5L46A 3IWAA 4AOSA 3DK4A 3UP4A 4B69A 4B67A 1F8WA 1PXBA 2B9XA 1Q1RA 3C4AA 5KRQA 2B7RA 3ADAB 3JSKA 4XXGA 1ZOVA 2FJAA 4UDRA 3QSEA 1N4VA 1BGJA 2YAUA 3UKKA 1SEZA 2V5ZA 2HQMA 4YSZA 1O5WA 4H7UA 1ELIA 3G5QA 3GRTA 1PBEA 2GMHA 2BA9A 4G73A 4J33A 3VR9A 1DOCA 1D7YA 3M12A 1DXLA 3SM8A 4YTPA 4GAVA 3ABVA 3AE4A 1LTXR 1S2QA 2YLWA 3GMBA 1GETA 3NTAA 4Z2RA 4C77A 3DJGX 2IIDA 3Q6JA 4NEVA 2BXSA 1GRHA 2WU5A 1H7WA 1Z6LA 5HXIA 3LXDA 3NYFA 1BZLA 1S3BA 1E6EA 3DGZA 5KOWA 1LQTA 2WS3A 3AECA 2YLTA 5EBKA 3G5SA 1GERA 3AEAA 3GD3A 5HY5A 1TYTA 3ATQA 2BS3A 3CGDA 4GCMA 3T2ZA 4BURA 4YT0A 4JY2A 5JCMA 1DNCA 4Y4LA 3KKJA 3NN0X 3AWIA 2R9ZA 3S5WA 5KVHA 5C2TA 3QVPA 5CKUA 4C3YA 1NG4A 3ZDNA 3UKAA 1Q9IA 2F5ZA 4G6HA 4CNKA 5JCNA 1CL0A 3Q9TA 1VRQB 4LU6A 2WEUA 2WQYA 2R45A 4NEWA 2YLXA 1OJAA 3CPIG 4J31A 4G74A 1H86A 3O0HA 3V3OA 4IVMB 1UKVG 2B7SA 2YLZA 2W0HA 3AEGA 4ADWA 4U8OA 3EF6A 1BF3A 3EPTA 3F8PA 3NYCA 4OPGA 4U8JA 2WPEA 4NZHA 1RP0A 1CJ3A 3KPFA 5C3JA 2WESA 3PO7A 3UTGA 4CBQA 3LZXA 4H50A 4EQRA 4YSYA 1Y56A 5FS9A
chains in the Genus database with same CATH topology
2XLRA 3AEEA 3VRDB 3AE9A 3AEDA 3URHA 1PBFA 1PJ6A 4PABA 1KNRA 4H4UA 4Z2UA 2ZBWA 4GDEA 3T2YA 1TYPA 1ZMCA 2UZZA 3P4QA 4TLZA 4U2SA 2YQUA 2ZZBA 3SFDA 2FJBA 4YKGA 3OZ2A 4BK1A 4J57A 3SX6A 1F8RA 3UTEA 4JY3A 1QO8A 4Z25A 4A6NA 2YLRA 5KMRA 3F8DA 2IVEA 2BACA 3AXBA 3NK0X 3T37A 4ZCCA 1P2EA 2WDQA 2WDRA 3IF9A 3HYVA 4GF7A 4UDQA 4AOXA 4B66A 1FEAA 4AT0A 1KNPA 4H4ZA 2V6OA 3FIMB 4A65A 2YM2A 1TDKA 3NG7X 1Y56B 2EQ9A 3AYJA 2WP5A 3CIRA 1GRFA 4H4PA 4K2XA 4K8DA 1IUSA 2GQFA 1ZY8A 2AQJA 3FMWA 1JNZA 4KX6A 3REDA 2CFYA 1XHCA 1NPXA 1OJCA 2XFUA 3CNSA 4YTNA 2VRMA 2PYXA 2APGA 1GSNA 1DOBA 3SZWA 1ONFA 3SZFA 4A5LA 1H81A 3FPZA 3NGCX 1PBBA 1QJDA 4C3XA 3D8XA 1D4CA 3FG2P 2GAHB 4X9MA 2E1MA 1TDOA 1XDIA 1KSUA 2X8GA 5BRTA 4ICYA 5EB5A 1GRBA 2GH5A 3IHGA 2JB1A 2QAEA 4LA1A 4N9XA 4J2WA 3SQPA 3CNDA 5KNLA 2VZ2A 2C76A 2X99A 3T0KA 4GDPA 4YTMA 3NN6X 2GR0A 2GF3A 1H82A 1NEKA 2B9WA 2C66A 2OALA 3GDNA 3ICTA 3M13A 5J7XA 2XVJA 4OPLA 1JEHA 2E4GA 1VDCA 2XLUA 2YVFA 4B64A 3AE8A 1QLBA 3DA1A 3RP7A 5U25A 2C7GA 1GEUA 4YXDA 2BXRA 3CNTA 1LV0A 4EM3A 4HB9A 1H84A 2NPXA 2C73A 2C4CA 3P4RA 4HA6A 3RHAA 3BI4A 1RSGA 4U8PA 1BGNA 2GR2A 2XVFA 3OC4A 3NYEA 3AE5A 3DGHA 2WP6A 4OPUA 4RG3A 2GEWA 2ARDA 3SGLA 3C96A 3E1TA 3HYWA 1EBDA 4A9WA 4EMIA 1FECA 3LZWA 1L9EA 4H4YA 1TDEA 1E1NA 5FS7A 3LB8A 1VG0A 3AE1A 3COXA 1TRBA 2C3DA 1JOAA 2V3AA 4H4SA 4FK1C 2VOUA 3CTYA 4TM1A 3UKFA 1GTEA 3BNMA 3NLCA 3RP6A 1P2HA 4B65A 5IPYA 1PDHA 4CCRA 5CQFA 4H2PA 3B6DA 4H2RA 4XWZA 1FL2A 3AYLA 1NHSA 1CJ2A 4YSHA 4Z43A 5JCLA 4CY8A 3R9UA 4P9SA 1M64A 4NTCA 4UDPA 1CC2A 1KDGA 3EAOA 1H83A 1GTHA 4K5SA 4LIIA 3NT6A 4OPIA 5FS8A 3WE0A 4C74A 2BABA 1EL7A 3NNEA 4GRTA 3SY4A 1E39A 4RSLA 3UOVA 2YM1A 2JAEA 4B1BA 2XVEA 4U8IA 5U63A 2VVLG 2C72A 2ACZA 2Q0LA 1YQ4A 2Y6RA 4YWOA 1IUTA 2GRTA 2WPCA 2WU2A 2OA1A 1N1PA 4A7AA 2OLNA 3UCLA 3KU9A 4FDCB 3F8RA 3NTDA 1L9DA 4JNQA 3ZYXA 5BVAA 1JRYA 2R0PA 1DOEA 1PHHA 3UOYA 4IA5A 1IUUA 3UKQA 4BJZA 3K30A 1GXFA 1E7PA 3UOZA 4II2A 4JN9A 2BYBA 1OJTA 2R4JA 2CDUA 2C75A 4H4TA 4K7ZA 4IVOB 4NWZA 3CGBA 4A99A 4IV9A 2YR5A 1ZP0A 4H2NA 2JBVA 1B5QA 4NTEA 2Q6UA 1CHUA 1H7XA 2TMDA 4KPRA 3SZ0A 2ZZ0A 4Z24A 5KMPA 4EQXA 2OLOA 3KLJA 3RNMA 1PXCA 1NENA 2Z5YA 3LADA 4D03A 1HYUA 2O9ZA 2XFNA 4TM4A 5J60A 3UP5A 2QA1A 3H8IA 3L1RA 5JCIA 2RGJA 4U2TA 2YWLA 5KVIA 4CRTA 1DJQA 4J56A 4Y4MA 1E1KA 4K5RA 1S2YA 1VG9A 2A89A 2BK4A 2BCPA 4EMWA 4IA6A 3UOXA 5HHFA 5BULA 3VRAA 1ZKQA 4C5OA 1AOGA 2B76A 5DBJA 1Y0PA 3AB1A 4DNAA 2BC0A 3ALMA 3P4PA 4NTDA 4U2LA 4EMJA 2H89A 2C64A 1REOA 1VQWA 1LQUA 3NRNA 3QFBA 4CY6A 4EQSA 1PJ7A 4EIQA 1BWCA 1JRXA 3UTFA 1CJ4A 4USQA 1GREA 2XFPA 3T2KA 5TR3A 4ZN0A 4II3A 3EANA 2E5VA 2FJDA 4E0VA 2AR8A 1COYA 3CPJG 2XFQA 5GRTA 2GAGB 3P1WA 3H8LA 3II4A 3AYIA 3NIXA 3VR8A 4O5UA 4U8KA 3PVCA 3P4SA 2IVDA 3CNJA 1F6MA 4GR1A 3AD9B 1ZK7A 1L9CA 2VQBA 3BHKA 3K7TA 5IQ4A 3QSMA 1XPQA 2EQ6A 4XWRA 3GDPA 1W4XA 4ZCDA 1JU2A 3DMEA 1RYIA 3AEBA 2DKIA 2YG6A 2C65A 1S3EA 4YSXA 3PS9A 1NHPA 1B8SA 2BS2A 1H6VA 2XDOA 2XVIA 3UKPA 1TDFA 1GALA 3C4NA 3DK9A 3I3LA 4J36A 4D04A 1CC6A 2XFOA 2BK3A 3ICSA 4ECHA 4Z26A 3NK1X 5KWFA 3QJ4A 3CN8A 4DSHA 2A8XA 1ZMDA 1E1MA 1PN0A 3H4KA 3KPKA 4U8LA 2GR3A 2VRLA 5IQ1A 2CULA 4AP1A 1KFYA 2VQ7A 2R0GA 2VVLA 3KD9A 4APNA 2CVJA 4TM3A 3GSIA 2X3NA 5KOXA 1PBDA 3DJDA 3DK8A 1EL9A 1D4EA 2A87A 4BV6A 4RG4A 2GR1A 5LV9A 2Q7VA 3IC9A 1NHQA 1IJHA 1CBOA 3T14A 1JRZA 1O94A 3AD8B 3QFAA 2BRYA 1TDNA 3NH3X 1MOKA 1KF6A 1CC4A 3FBSA 2JK6A 2YG3A 1K4QA 1GOSA 1E1LA 2YR6A 3ITJA 1CJCA 3QVRA 4I59A 1GRAA 2GQWA 4M52A 3VQRA 5KXJA 2XCGA 3IHMA 3GYJA 4JQ9A 3AE3A 5BUKA 4BK3A 1D7LA 2EQ8A 3KVEA 4G9KA 3UTHA 2YG7A 3CGEA 3GRSA 2GB0A 3CPHG 1F3PA 2QCUA 4AP3A 2V61A 2PHHA 2R46A 2WOIA 4X9NA 5EB4A 5HYMA 1NDAA 1MXTA 4TLXA 1GRGA 4OPTA 3HYXA 2R0CA 3BHFA 4H2QA 3V3NA 4I58A 4FX9A 3P9UA 1B37A 2Y6QA 4H4QA 3AE2A 4Y4NA 2X50A 4NNJA 4B63A 3DH9A 4K22A 3SZCA 1KSSA 3GWFA 3K7QX 2BCGG 5JCKA 2XLPA 2R4EA 3SYIA 3B3RA 2H88A 2Z5XA 1PBCA 5KMQA 3DJJA 2XYOA 1GPEA 4A79A 3AE7A 1NAAA 1IUXA 2XVHA 4H4WA 5FMHA 3SFEA 1OJDA 1IUVA 2YVGA 1LJ1A 3I6DA 1Q1WA 4O5QA 4U8NA 4JDRA 1CF3A 1K0JA 1N4UA 4OPCA 2WP9A 4B68A 2JB2A 2V3BA 2B9YA 2WDVA 5GSNA 3DJEA 1GV4A 1PS9A 2C70A 1NHRA 3AD7B 1ZX9A 3D1CA 4J34A 4REKA 5FS6A 5KMSA 3L8KA 2JKCA 2YR4A 4FK1A 3HZLA 2WOVA 3K7MX 1YQ3A 1D4DA 2GMJA 2V60A 4UP3A 1OJ9A 2WHDA 1X31B 4JNAA 4OCGA 4Z44A 2BK5A 1NG3A 3KA7A 2YVJA 5M10A 1BKWA 4G6GA 3GMCA 4GAPA 1FEBA 1FCDA 2AAQA 1LPFA 3ALJA 4H4RA 4GUVA 2J3NA 4MJWA 4USRA 4A6NB 3NHOX 3QSSA 4AT2A 4CNJA 2GV8A 4CCQA 3NK2X 3S61A 1IUWA 3BI5A 1DJNA 3M0OA 3GYXA 4WX1A 1MO9A 3ALLA 3V76A 1GRTA 2RGOA 2Q0KA 2NVKX 2XLSA 4PAAA 2BC1A 1PXAA 1PJ5A 3AE6A 5ER0A 1LVLA 2BS4A 4BJYA 4Z2TA 2FJEA 2YG5A 4YKFA 1ZOYA 3ISHA 3CMMA 1O95A 2JB3A 1V59A 2WOWA 1XANA 3LJPA 3UKLA 3NKSA 1K0LA 1M6IA 2WETA 2ZZCA 2EQ7A 2DKHA 4H4VA 4U8MA 1ZDLA 4DGKA 3G5RA 3SXIA 3T31A 3GD4A 2VVMA 3CGCA 5EOWA 1FOHA 5U1OA 3ATRA 5M0ZA 2X8CA 1YY5A 3LOVA 2XLTA 3GYIA 1B4VA 2C3CA 2OAMA 1YQZA 2TPRA 2X8HA 1EL5A 3BI2A 3GWDA 4H4XA 4OPDA 3CNPA 1D5TA 3BNUA 3ICRA 1L0VA 4EQWA 3VRBA 4DSGA 2RABA 4OVIA 2YLSA 1YKJA 2BRAA 4EIPA 2I0ZA 4X4JA 4EM4A 1GNDA 1K0IA 2FBWA 3RP8A 2WBAA 1JNRA 1N4WA 1F8SA 2C67A 2WPFA 4TM0A 4BK2A 4WCTA 1DODA 2GVCA 1EL8A 1GESA 2QA2A 2YG4A 3UKHA 2RGHA 1GT8A 3AEFA 5L46A 3IWAA 4AOSA 3DK4A 3UP4A 4B69A 4B67A 1F8WA 1PXBA 2B9XA 1Q1RA 3C4AA 5KRQA 2B7RA 3ADAB 3JSKA 4XXGA 1ZOVA 2FJAA 4UDRA 3QSEA 1N4VA 1BGJA 2YAUA 3UKKA 1SEZA 2V5ZA 2HQMA 4YSZA 1O5WA 4H7UA 1ELIA 3G5QA 3GRTA 1PBEA 2GMHA 2BA9A 4G73A 4J33A 3VR9A 1DOCA 1D7YA 3M12A 1DXLA 3SM8A 4YTPA 4GAVA 3ABVA 3AE4A 1LTXR 1S2QA 2YLWA 3GMBA 1GETA 3NTAA 4Z2RA 4C77A 3DJGX 2IIDA 3Q6JA 4NEVA 2BXSA 1GRHA 2WU5A 1H7WA 1Z6LA 5HXIA 3LXDA 3NYFA 1BZLA 1S3BA 1E6EA 3DGZA 5KOWA 1LQTA 2WS3A 3AECA 2YLTA 5EBKA 3G5SA 1GERA 3AEAA 3GD3A 5HY5A 1TYTA 3ATQA 2BS3A 3CGDA 4GCMA 3T2ZA 4BURA 4YT0A 4JY2A 5JCMA 1DNCA 4Y4LA 3KKJA 3NN0X 3AWIA 2R9ZA 3S5WA 5KVHA 5C2TA 3QVPA 5CKUA 4C3YA 1NG4A 3ZDNA 3UKAA 1Q9IA 2F5ZA 4G6HA 4CNKA 5JCNA 1CL0A 3Q9TA 1VRQB 4LU6A 2WEUA 2WQYA 2R45A 4NEWA 2YLXA 1OJAA 3CPIG 4J31A 4G74A 1H86A 3O0HA 3V3OA 4IVMB 1UKVG 2B7SA 2YLZA 2W0HA 3AEGA 4ADWA 4U8OA 3EF6A 1BF3A 3EPTA 3F8PA 3NYCA 4OPGA 4U8JA 2WPEA 4NZHA 1RP0A 1CJ3A 3KPFA 5C3JA 2WESA 3PO7A 3UTGA 4CBQA 3LZXA 4H50A 4EQRA 4YSYA 1Y56A 5FS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLR A;  3AEE A;  3VRD B;  3AE9 A;  3AED A;  3URH A;  1PBF A;  1PJ6 A;  4PAB A;  1KNR A;  4H4U A;  4Z2U A;  2ZBW A;  4GDE A;  1TYP A;  1ZMC A;  2UZZ A;  3P4Q A;  4TLZ A;  4U2S A;  2YQU A;  2ZZB A;  3SFD A;  2FJB A;  4YKG A;  3OZ2 A;  4BK1 A;  4J57 A;  1F8R A;  3UTE A;  4JY3 A;  1QO8 A;  4Z25 A;  4A6N A;  2YLR A;  3F8D A;  2IVE A;  2BAC A;  3AXB A;  3NK0 X;  3T37 A;  4ZCC A;  1P2E A;  2WDQ A;  2WDR A;  3IF9 A;  4GF7 A;  4UDQ A;  4AOX A;  4B66 A;  1FEA A;  4AT0 A;  1KNP A;  4H4Z A;  2V6O A;  3FIM B;  4A65 A;  2YM2 A;  1TDK A;  3NG7 X;  1Y56 B;  2EQ9 A;  3AYJ A;  2WP5 A;  3CIR A;  1GRF A;  4H4P A;  4K2X A;  4K8D A;  1IUS A;  2GQF A;  1ZY8 A;  2AQJ A;  3FMW A;  1JNZ A;  4KX6 A;  3RED A;  2CFY A;  1XHC A;  1NPX A;  1OJC A;  2XFU A;  3CNS A;  4YTN A;  2VRM A;  2PYX A;  2APG A;  1GSN A;  1DOB A;  1ONF A;  4A5L A;  1H81 A;  3FPZ A;  3NGC X;  1PBB A;  1QJD A;  4C3X A;  3D8X A;  1D4C A;  3FG2 P;  2GAH B;  4X9M A;  2E1M A;  1TDO A;  1XDI A;  1KSU A;  2X8G A;  5BRT A;  4ICY A;  5EB5 A;  1GRB A;  2GH5 A;  3IHG A;  2JB1 A;  2QAE A;  4LA1 A;  4N9X A;  4J2W A;  3SQP A;  3CND A;  2VZ2 A;  2C76 A;  2X99 A;  4GDP A;  4YTM A;  3NN6 X;  2GR0 A;  2GF3 A;  1H82 A;  1NEK A;  2B9W A;  2C66 A;  2OAL A;  3GDN A;  3ICT A;  3M13 A;  5J7X A;  2XVJ A;  4OPL A;  1JEH A;  2E4G A;  1VDC A;  2XLU A;  2YVF A;  4B64 A;  3AE8 A;  1QLB A;  3DA1 A;  3RP7 A;  5U25 A;  2C7G A;  1GEU A;  4YXD A;  2BXR A;  3CNT A;  1LV0 A;  4EM3 A;  4HB9 A;  1H84 A;  2NPX A;  2C73 A;  3P4R A;  4HA6 A;  3RHA A;  3BI4 A;  1RSG A;  4U8P A;  1BGN A;  2GR2 A;  2XVF A;  3OC4 A;  3NYE A;  3AE5 A;  3DGH A;  2WP6 A;  4OPU A;  4RG3 A;  2GEW A;  2ARD A;  3SGL A;  3C96 A;  3E1T A;  1EBD A;  4A9W A;  4EMI A;  1FEC A;  3LZW A;  1L9E A;  4H4Y A;  1TDE A;  1E1N A;  5FS7 A;  3LB8 A;  1VG0 A;  3AE1 A;  3COX A;  1TRB A;  2C3D A;  1JOA A;  2V3A A;  4H4S A;  4FK1 C;  2VOU A;  3CTY A;  4TM1 A;  3UKF A;  1GTE A;  3BNM A;  3NLC A;  3RP6 A;  1P2H A;  4B65 A;  5IPY A;  1PDH A;  4CCR A;  5CQF A;  4H2P A;  3B6D A;  4H2R A;  4XWZ A;  1FL2 A;  3AYL A;  1NHS A;  1CJ2 A;  4YSH A;  4Z43 A;  5JCL A;  4CY8 A;  3R9U A;  4P9S A;  1M64 A;  4NTC A;  4UDP A;  1CC2 A;  1KDG A;  3EAO A;  1H83 A;  1GTH A;  4K5S A;  4LII A;  3NT6 A;  4OPI A;  5FS8 A;  3WE0 A;  4C74 A;  2BAB A;  1EL7 A;  3NNE A;  4GRT A;  1E39 A;  4RSL A;  3UOV A;  2YM1 A;  2JAE A;  4B1B A;  2XVE A;  4U8I A;  5U63 A;  2VVL G;  2C72 A;  2ACZ A;  2Q0L A;  1YQ4 A;  2Y6R A;  4YWO A;  1IUT A;  2GRT A;  2WPC A;  2WU2 A;  2OA1 A;  1N1P A;  4A7A A;  2OLN A;  3UCL A;  3KU9 A;  4FDC B;  3F8R A;  3NTD A;  1L9D A;  4JNQ A;  3ZYX A;  5BVA A;  1JRY A;  2R0P A;  1DOE A;  1PHH A;  3UOY A;  4IA5 A;  1IUU A;  3UKQ A;  4BJZ A;  3K30 A;  1GXF A;  1E7P A;  3UOZ A;  4JN9 A;  2BYB A;  1OJT A;  2R4J A;  2CDU A;  2C75 A;  4H4T A;  4K7Z A;  4IVO B;  3CGB A;  4A99 A;  4IV9 A;  2YR5 A;  1ZP0 A;  4H2N A;  2JBV A;  1B5Q A;  4NTE A;  2Q6U A;  1CHU A;  1H7X A;  2TMD A;  4KPR A;  2ZZ0 A;  4Z24 A;  4EQX A;  2OLO A;  3KLJ A;  3RNM A;  1PXC A;  1NEN A;  2Z5Y A;  3LAD A;  4D03 A;  1HYU A;  2O9Z A;  2XFN A;  4TM4 A;  5J60 A;  3UP5 A;  2QA1 A;  3H8I A;  3L1R A;  5JCI A;  2RGJ A;  4U2T A;  2YWL A;  5KVI A;  4CRT A;  1DJQ A;  4J56 A;  4Y4M A;  1E1K A;  4K5R A;  1S2Y A;  1VG9 A;  2A89 A;  2BK4 A;  2BCP A;  4EMW A;  4IA6 A;  3UOX A;  5HHF A;  5BUL A;  3VRA A;  1ZKQ A;  4C5O A;  1AOG A;  2B76 A;  5DBJ A;  1Y0P A;  3AB1 A;  4DNA A;  2BC0 A;  3ALM A;  3P4P A;  4NTD A;  4U2L A;  4EMJ A;  2H89 A;  2C64 A;  1REO A;  1VQW A;  1LQU A;  3NRN A;  3QFB A;  4CY6 A;  4EQS A;  1PJ7 A;  4EIQ A;  1BWC A;  1JRX A;  3UTF A;  1CJ4 A;  4USQ A;  1GRE A;  2XFP A;  5TR3 A;  4ZN0 A;  3EAN A;  2E5V A;  2FJD A;  4E0V A;  2AR8 A;  1COY A;  3CPJ G;  2XFQ A;  5GRT A;  2GAG B;  3P1W A;  3H8L A;  3II4 A;  3AYI A;  3NIX A;  3VR8 A;  4O5U A;  4U8K A;  3PVC A;  3P4S A;  2IVD A;  3CNJ A;  1F6M A;  4GR1 A;  3AD9 B;  1ZK7 A;  1L9C A;  2VQB A;  3BHK A;  3K7T A;  5IQ4 A;  3QSM A;  1XPQ A;  2EQ6 A;  4XWR A;  3GDP A;  1W4X A;  4ZCD A;  1JU2 A;  3DME A;  1RYI A;  3AEB A;  2DKI A;  2YG6 A;  2C65 A;  1S3E A;  4YSX A;  3PS9 A;  1NHP A;  1B8S A;  2BS2 A;  1H6V A;  2XDO A;  2XVI A;  3UKP A;  1TDF A;  1GAL A;  3C4N A;  3DK9 A;  3I3L A;  4J36 A;  4D04 A;  1CC6 A;  2XFO A;  2BK3 A;  3ICS A;  4ECH A;  4Z26 A;  3NK1 X;  5KWF A;  3QJ4 A;  3CN8 A;  4DSH A;  2A8X A;  1ZMD A;  1E1M A;  1PN0 A;  3H4K A;  4U8L A;  2GR3 A;  2VRL A;  5IQ1 A;  2CUL A;  4AP1 A;  1KFY A;  2VQ7 A;  2R0G A;  2VVL A;  3KD9 A;  4APN A;  2CVJ A;  4TM3 A;  3GSI A;  2X3N A;  5KOX A;  1PBD A;  3DJD A;  3DK8 A;  1EL9 A;  1D4E A;  2A87 A;  4BV6 A;  4RG4 A;  2GR1 A;  5LV9 A;  2Q7V A;  3IC9 A;  1NHQ A;  1IJH A;  1CBO A;  1JRZ A;  1O94 A;  3AD8 B;  3QFA A;  1TDN A;  3NH3 X;  1MOK A;  1KF6 A;  1CC4 A;  3FBS A;  2JK6 A;  2YG3 A;  1K4Q A;  1GOS A;  1E1L A;  2YR6 A;  3ITJ A;  1CJC A;  3QVR A;  4I59 A;  1GRA A;  2GQW A;  4M52 A;  3VQR A;  5KXJ A;  2XCG A;  3IHM A;  3GYJ A;  4JQ9 A;  3AE3 A;  5BUK A;  4BK3 A;  1D7L A;  2EQ8 A;  3KVE A;  3UTH A;  2YG7 A;  3CGE A;  3GRS A;  2GB0 A;  3CPH G;  1F3P A;  2QCU A;  4AP3 A;  2V61 A;  2PHH A;  2R46 A;  2WOI A;  4X9N A;  5EB4 A;  5HYM A;  1NDA A;  1MXT A;  4TLX A;  1GRG A;  4OPT A;  2R0C A;  3BHF A;  4H2Q A;  3V3N A;  4I58 A;  4FX9 A;  3P9U A;  1B37 A;  2Y6Q A;  4H4Q A;  3AE2 A;  4Y4N A;  2X50 A;  4B63 A;  3DH9 A;  4K22 A;  1KSS A;  3GWF A;  3K7Q X;  2BCG G;  5JCK A;  2XLP A;  2R4E A;  3B3R A;  2H88 A;  2Z5X A;  1PBC A;  3DJJ A;  2XYO A;  1GPE A;  4A79 A;  3AE7 A;  1NAA A;  1IUX A;  2XVH A;  4H4W A;  5FMH A;  3SFE A;  1OJD A;  1IUV A;  2YVG A;  1LJ1 A;  3I6D A;  1Q1W A;  4O5Q A;  4U8N A;  4JDR A;  1CF3 A;  1K0J A;  1N4U A;  4OPC A;  2WP9 A;  4B68 A;  2JB2 A;  2V3B A;  2B9Y A;  2WDV A;  5GSN A;  3DJE A;  1GV4 A;  1PS9 A;  2C70 A;  1NHR A;  3AD7 B;  1ZX9 A;  3D1C A;  4J34 A;  4REK A;  5FS6 A;  3L8K A;  2JKC A;  2YR4 A;  4FK1 A;  3HZL A;  2WOV A;  3K7M X;  1YQ3 A;  1D4D A;  2GMJ A;  2V60 A;  4UP3 A;  1OJ9 A;  2WHD A;  1X31 B;  4JNA A;  4OCG A;  4Z44 A;  2BK5 A;  1NG3 A;  3KA7 A;  2YVJ A;  5M10 A;  1BKW A;  3GMC A;  4H4R A;  1FEB A;  1FCD A;  2AAQ A;  1LPF A;  3ALJ A;  4GUV A;  2J3N A;  4MJW A;  4USR A;  4A6N B;  3NHO X;  3QSS A;  4AT2 A;  4CNJ A;  2GV8 A;  4CCQ A;  3NK2 X;  3S61 A;  1IUW A;  3BI5 A;  1DJN A;  3M0O A;  4WX1 A;  1MO9 A;  3ALL A;  3V76 A;  1GRT A;  2RGO A;  2Q0K A;  2NVK X;  2XLS A;  4PAA A;  2BC1 A;  1PXA A;  1PJ5 A;  3AE6 A;  5ER0 A;  1LVL A;  2BS4 A;  4BJY A;  4Z2T A;  2FJE A;  2YG5 A;  4YKF A;  1ZOY A;  3ISH A;  1O95 A;  2JB3 A;  1V59 A;  2WOW A;  1XAN A;  3LJP A;  3UKL A;  3NKS A;  1K0L A;  1M6I A;  2WET A;  2ZZC A;  2EQ7 A;  2DKH A;  4H4V A;  4U8M A;  1ZDL A;  4DGK A;  3G5R A;  3GD4 A;  2VVM A;  3CGC A;  5EOW A;  1FOH A;  5U1O A;  3ATR A;  5M0Z A;  2X8C A;  1YY5 A;  3LOV A;  2XLT A;  3GYI A;  1B4V A;  2C3C A;  2OAM A;  1YQZ A;  2TPR A;  2X8H A;  1EL5 A;  3BI2 A;  3GWD A;  4H4X A;  4OPD A;  3CNP A;  1D5T A;  3BNU A;  3ICR A;  1L0V A;  4EQW A;  3VRB A;  4DSG A;  2RAB A;  4OVI A;  2YLS A;  1YKJ A;  4EIP A;  4EM4 A;  2I0Z A;  4X4J A;  1GND A;  1K0I A;  2FBW A;  3RP8 A;  2WBA A;  1JNR A;  1N4W A;  1F8S A;  2C67 A;  2WPF A;  4TM0 A;  4BK2 A;  4WCT A;  1DOD A;  2GVC A;  1EL8 A;  1GES A;  2QA2 A;  2YG4 A;  3UKH A;  2RGH A;  1GT8 A;  3AEF A;  5L46 A;  3IWA A;  4AOS A;  3DK4 A;  3UP4 A;  4B69 A;  4B67 A;  1F8W A;  1PXB A;  2B9X A;  1Q1R A;  3C4A A;  5KRQ A;  2B7R A;  3ADA B;  3JSK A;  4XXG A;  1ZOV A;  2FJA A;  4UDR A;  3QSE A;  1N4V A;  1BGJ A;  2YAU A;  3UKK A;  1SEZ A;  2V5Z A;  2HQM A;  4YSZ A;  1O5W A;  4H7U A;  1ELI A;  3G5Q A;  3GRT A;  1PBE A;  2GMH A;  2BA9 A;  4J33 A;  3VR9 A;  1DOC A;  1D7Y A;  3M12 A;  1DXL A;  3SM8 A;  4YTP A;  3ABV A;  3AE4 A;  1LTX R;  1S2Q A;  2YLW A;  3GMB A;  1GET A;  3NTA A;  4Z2R A;  4C77 A;  3DJG X;  2IID A;  3Q6J A;  4NEV A;  2BXS A;  1GRH A;  2WU5 A;  1H7W A;  1Z6L A;  5HXI A;  3LXD A;  3NYF A;  1BZL A;  1S3B A;  1E6E A;  3DGZ A;  5KOW A;  1LQT A;  2WS3 A;  3AEC A;  2YLT A;  5EBK A;  3G5S A;  1GER A;  3AEA A;  3GD3 A;  5HY5 A;  1TYT A;  3ATQ A;  2BS3 A;  3CGD A;  4GCM A;  4BUR A;  4YT0 A;  5JCM A;  4JY2 A;  1DNC A;  4Y4L A;  3KKJ A;  3NN0 X;  3AWI A;  2R9Z A;  3S5W A;  5KVH A;  5C2T A;  3QVP A;  5CKU A;  4C3Y A;  1NG4 A;  3ZDN A;  3UKA A;  1Q9I A;  2F5Z A;  4CNK A;  5JCN A;  1CL0 A;  3Q9T A;  1VRQ B;  4LU6 A;  2WEU A;  2WQY A;  2R45 A;  4NEW A;  2YLX A;  1OJA A;  3CPI G;  4J31 A;  1H86 A;  3O0H A;  3V3O A;  4IVM B;  1UKV G;  2B7S A;  2YLZ A;  2W0H A;  3AEG A;  4ADW A;  4U8O A;  3EF6 A;  1BF3 A;  3EPT A;  3F8P A;  3NYC A;  4OPG A;  4U8J A;  2WPE A;  4NZH A;  1RP0 A;  1CJ3 A;  3KPF A;  5C3J A;  2WES A;  3PO7 A;  3UTG A;  4CBQ A;  3LZX A;  4H50 A;  4EQR A;  4YSY A;  1Y56 A;  5FS9 A; 
#chains in the Genus database with same CATH topology
 2XLR A;  3AEE A;  3VRD B;  3AE9 A;  3AED A;  3URH A;  1PBF A;  1PJ6 A;  4PAB A;  1KNR A;  4H4U A;  4Z2U A;  2ZBW A;  4GDE A;  3T2Y A;  1TYP A;  1ZMC A;  2UZZ A;  3P4Q A;  4TLZ A;  4U2S A;  2YQU A;  2ZZB A;  3SFD A;  2FJB A;  4YKG A;  3OZ2 A;  4BK1 A;  4J57 A;  3SX6 A;  1F8R A;  3UTE A;  4JY3 A;  1QO8 A;  4Z25 A;  4A6N A;  2YLR A;  5KMR A;  3F8D A;  2IVE A;  2BAC A;  3AXB A;  3NK0 X;  3T37 A;  4ZCC A;  1P2E A;  2WDQ A;  2WDR A;  3IF9 A;  3HYV A;  4GF7 A;  4UDQ A;  4AOX A;  4B66 A;  1FEA A;  4AT0 A;  1KNP A;  4H4Z A;  2V6O A;  3FIM B;  4A65 A;  2YM2 A;  1TDK A;  3NG7 X;  1Y56 B;  2EQ9 A;  3AYJ A;  2WP5 A;  3CIR A;  1GRF A;  4H4P A;  4K2X A;  4K8D A;  1IUS A;  2GQF A;  1ZY8 A;  2AQJ A;  3FMW A;  1JNZ A;  4KX6 A;  3RED A;  2CFY A;  1XHC A;  1NPX A;  1OJC A;  2XFU A;  3CNS A;  4YTN A;  2VRM A;  2PYX A;  2APG A;  1GSN A;  1DOB A;  3SZW A;  1ONF A;  3SZF A;  4A5L A;  1H81 A;  3FPZ A;  3NGC X;  1PBB A;  1QJD A;  4C3X A;  3D8X A;  1D4C A;  3FG2 P;  2GAH B;  4X9M A;  2E1M A;  1TDO A;  1XDI A;  1KSU A;  2X8G A;  5BRT A;  4ICY A;  5EB5 A;  1GRB A;  2GH5 A;  3IHG A;  2JB1 A;  2QAE A;  4LA1 A;  4N9X A;  4J2W A;  3SQP A;  3CND A;  5KNL A;  2VZ2 A;  2C76 A;  2X99 A;  3T0K A;  4GDP A;  4YTM A;  3NN6 X;  2GR0 A;  2GF3 A;  1H82 A;  1NEK A;  2B9W A;  2C66 A;  2OAL A;  3GDN A;  3ICT A;  3M13 A;  5J7X A;  2XVJ A;  4OPL A;  1JEH A;  2E4G A;  1VDC A;  2XLU A;  2YVF A;  4B64 A;  3AE8 A;  1QLB A;  3DA1 A;  3RP7 A;  5U25 A;  2C7G A;  1GEU A;  4YXD A;  2BXR A;  3CNT A;  1LV0 A;  4EM3 A;  4HB9 A;  1H84 A;  2NPX A;  2C73 A;  2C4C A;  3P4R A;  4HA6 A;  3RHA A;  3BI4 A;  1RSG A;  4U8P A;  1BGN A;  2GR2 A;  2XVF A;  3OC4 A;  3NYE A;  3AE5 A;  3DGH A;  2WP6 A;  4OPU A;  4RG3 A;  2GEW A;  2ARD A;  3SGL A;  3C96 A;  3E1T A;  3HYW A;  1EBD A;  4A9W A;  4EMI A;  1FEC A;  3LZW A;  1L9E A;  4H4Y A;  1TDE A;  1E1N A;  5FS7 A;  3LB8 A;  1VG0 A;  3AE1 A;  3COX A;  1TRB A;  2C3D A;  1JOA A;  2V3A A;  4H4S A;  4FK1 C;  2VOU A;  3CTY A;  4TM1 A;  3UKF A;  1GTE A;  3BNM A;  3NLC A;  3RP6 A;  1P2H A;  4B65 A;  5IPY A;  1PDH A;  4CCR A;  5CQF A;  4H2P A;  3B6D A;  4H2R A;  4XWZ A;  1FL2 A;  3AYL A;  1NHS A;  1CJ2 A;  4YSH A;  4Z43 A;  5JCL A;  4CY8 A;  3R9U A;  4P9S A;  1M64 A;  4NTC A;  4UDP A;  1CC2 A;  1KDG A;  3EAO A;  1H83 A;  1GTH A;  4K5S A;  4LII A;  3NT6 A;  4OPI A;  5FS8 A;  3WE0 A;  4C74 A;  2BAB A;  1EL7 A;  3NNE A;  4GRT A;  3SY4 A;  1E39 A;  4RSL A;  3UOV A;  2YM1 A;  2JAE A;  4B1B A;  2XVE A;  4U8I A;  5U63 A;  2VVL G;  2C72 A;  2ACZ A;  2Q0L A;  1YQ4 A;  2Y6R A;  4YWO A;  1IUT A;  2GRT A;  2WPC A;  2WU2 A;  2OA1 A;  1N1P A;  4A7A A;  2OLN A;  3UCL A;  3KU9 A;  4FDC B;  3F8R A;  3NTD A;  1L9D A;  4JNQ A;  3ZYX A;  5BVA A;  1JRY A;  2R0P A;  1DOE A;  1PHH A;  3UOY A;  4IA5 A;  1IUU A;  3UKQ A;  4BJZ A;  3K30 A;  1GXF A;  1E7P A;  3UOZ A;  4II2 A;  4JN9 A;  2BYB A;  1OJT A;  2R4J A;  2CDU A;  2C75 A;  4H4T A;  4K7Z A;  4IVO B;  4NWZ A;  3CGB A;  4A99 A;  4IV9 A;  2YR5 A;  1ZP0 A;  4H2N A;  2JBV A;  1B5Q A;  4NTE A;  2Q6U A;  1CHU A;  1H7X A;  2TMD A;  4KPR A;  3SZ0 A;  2ZZ0 A;  4Z24 A;  5KMP A;  4EQX A;  2OLO A;  3KLJ A;  3RNM A;  1PXC A;  1NEN A;  2Z5Y A;  3LAD A;  4D03 A;  1HYU A;  2O9Z A;  2XFN A;  4TM4 A;  5J60 A;  3UP5 A;  2QA1 A;  3H8I A;  3L1R A;  5JCI A;  2RGJ A;  4U2T A;  2YWL A;  5KVI A;  4CRT A;  1DJQ A;  4J56 A;  4Y4M A;  1E1K A;  4K5R A;  1S2Y A;  1VG9 A;  2A89 A;  2BK4 A;  2BCP A;  4EMW A;  4IA6 A;  3UOX A;  5HHF A;  5BUL A;  3VRA A;  1ZKQ A;  4C5O A;  1AOG A;  2B76 A;  5DBJ A;  1Y0P A;  3AB1 A;  4DNA A;  2BC0 A;  3ALM A;  3P4P A;  4NTD A;  4U2L A;  4EMJ A;  2H89 A;  2C64 A;  1REO A;  1VQW A;  1LQU A;  3NRN A;  3QFB A;  4CY6 A;  4EQS A;  1PJ7 A;  4EIQ A;  1BWC A;  1JRX A;  3UTF A;  1CJ4 A;  4USQ A;  1GRE A;  2XFP A;  3T2K A;  5TR3 A;  4ZN0 A;  4II3 A;  3EAN A;  2E5V A;  2FJD A;  4E0V A;  2AR8 A;  1COY A;  3CPJ G;  2XFQ A;  5GRT A;  2GAG B;  3P1W A;  3H8L A;  3II4 A;  3AYI A;  3NIX A;  3VR8 A;  4O5U A;  4U8K A;  3PVC A;  3P4S A;  2IVD A;  3CNJ A;  1F6M A;  4GR1 A;  3AD9 B;  1ZK7 A;  1L9C A;  2VQB A;  3BHK A;  3K7T A;  5IQ4 A;  3QSM A;  1XPQ A;  2EQ6 A;  4XWR A;  3GDP A;  1W4X A;  4ZCD A;  1JU2 A;  3DME A;  1RYI A;  3AEB A;  2DKI A;  2YG6 A;  2C65 A;  1S3E A;  4YSX A;  3PS9 A;  1NHP A;  1B8S A;  2BS2 A;  1H6V A;  2XDO A;  2XVI A;  3UKP A;  1TDF A;  1GAL A;  3C4N A;  3DK9 A;  3I3L A;  4J36 A;  4D04 A;  1CC6 A;  2XFO A;  2BK3 A;  3ICS A;  4ECH A;  4Z26 A;  3NK1 X;  5KWF A;  3QJ4 A;  3CN8 A;  4DSH A;  2A8X A;  1ZMD A;  1E1M A;  1PN0 A;  3H4K A;  3KPK A;  4U8L A;  2GR3 A;  2VRL A;  5IQ1 A;  2CUL A;  4AP1 A;  1KFY A;  2VQ7 A;  2R0G A;  2VVL A;  3KD9 A;  4APN A;  2CVJ A;  4TM3 A;  3GSI A;  2X3N A;  5KOX A;  1PBD A;  3DJD A;  3DK8 A;  1EL9 A;  1D4E A;  2A87 A;  4BV6 A;  4RG4 A;  2GR1 A;  5LV9 A;  2Q7V A;  3IC9 A;  1NHQ A;  1IJH A;  1CBO A;  3T14 A;  1JRZ A;  1O94 A;  3AD8 B;  3QFA A;  2BRY A;  1TDN A;  3NH3 X;  1MOK A;  1KF6 A;  1CC4 A;  3FBS A;  2JK6 A;  2YG3 A;  1K4Q A;  1GOS A;  1E1L A;  2YR6 A;  3ITJ A;  1CJC A;  3QVR A;  4I59 A;  1GRA A;  2GQW A;  4M52 A;  3VQR A;  5KXJ A;  2XCG A;  3IHM A;  3GYJ A;  4JQ9 A;  3AE3 A;  5BUK A;  4BK3 A;  1D7L A;  2EQ8 A;  3KVE A;  4G9K A;  3UTH A;  2YG7 A;  3CGE A;  3GRS A;  2GB0 A;  3CPH G;  1F3P A;  2QCU A;  4AP3 A;  2V61 A;  2PHH A;  2R46 A;  2WOI A;  4X9N A;  5EB4 A;  5HYM A;  1NDA A;  1MXT A;  4TLX A;  1GRG A;  4OPT A;  3HYX A;  2R0C A;  3BHF A;  4H2Q A;  3V3N A;  4I58 A;  4FX9 A;  3P9U A;  1B37 A;  2Y6Q A;  4H4Q A;  3AE2 A;  4Y4N A;  2X50 A;  4NNJ A;  4B63 A;  3DH9 A;  4K22 A;  3SZC A;  1KSS A;  3GWF A;  3K7Q X;  2BCG G;  5JCK A;  2XLP A;  2R4E A;  3SYI A;  3B3R A;  2H88 A;  2Z5X A;  1PBC A;  5KMQ A;  3DJJ A;  2XYO A;  1GPE A;  4A79 A;  3AE7 A;  1NAA A;  1IUX A;  2XVH A;  4H4W A;  5FMH A;  3SFE A;  1OJD A;  1IUV A;  2YVG A;  1LJ1 A;  3I6D A;  1Q1W A;  4O5Q A;  4U8N A;  4JDR A;  1CF3 A;  1K0J A;  1N4U A;  4OPC A;  2WP9 A;  4B68 A;  2JB2 A;  2V3B A;  2B9Y A;  2WDV A;  5GSN A;  3DJE A;  1GV4 A;  1PS9 A;  2C70 A;  1NHR A;  3AD7 B;  1ZX9 A;  3D1C A;  4J34 A;  4REK A;  5FS6 A;  5KMS A;  3L8K A;  2JKC A;  2YR4 A;  4FK1 A;  3HZL A;  2WOV A;  3K7M X;  1YQ3 A;  1D4D A;  2GMJ A;  2V60 A;  4UP3 A;  1OJ9 A;  2WHD A;  1X31 B;  4JNA A;  4OCG A;  4Z44 A;  2BK5 A;  1NG3 A;  3KA7 A;  2YVJ A;  5M10 A;  1BKW A;  4G6G A;  3GMC A;  4GAP A;  1FEB A;  1FCD A;  2AAQ A;  1LPF A;  3ALJ A;  4H4R A;  4GUV A;  2J3N A;  4MJW A;  4USR A;  4A6N B;  3NHO X;  3QSS A;  4AT2 A;  4CNJ A;  2GV8 A;  4CCQ A;  3NK2 X;  3S61 A;  1IUW A;  3BI5 A;  1DJN A;  3M0O A;  3GYX A;  4WX1 A;  1MO9 A;  3ALL A;  3V76 A;  1GRT A;  2RGO A;  2Q0K A;  2NVK X;  2XLS A;  4PAA A;  2BC1 A;  1PXA A;  1PJ5 A;  3AE6 A;  5ER0 A;  1LVL A;  2BS4 A;  4BJY A;  4Z2T A;  2FJE A;  2YG5 A;  4YKF A;  1ZOY A;  3ISH A;  3CMM A;  1O95 A;  2JB3 A;  1V59 A;  2WOW A;  1XAN A;  3LJP A;  3UKL A;  3NKS A;  1K0L A;  1M6I A;  2WET A;  2ZZC A;  2EQ7 A;  2DKH A;  4H4V A;  4U8M A;  1ZDL A;  4DGK A;  3G5R A;  3SXI A;  3T31 A;  3GD4 A;  2VVM A;  3CGC A;  5EOW A;  1FOH A;  5U1O A;  3ATR A;  5M0Z A;  2X8C A;  1YY5 A;  3LOV A;  2XLT A;  3GYI A;  1B4V A;  2C3C A;  2OAM A;  1YQZ A;  2TPR A;  2X8H A;  1EL5 A;  3BI2 A;  3GWD A;  4H4X A;  4OPD A;  3CNP A;  1D5T A;  3BNU A;  3ICR A;  1L0V A;  4EQW A;  3VRB A;  4DSG A;  2RAB A;  4OVI A;  2YLS A;  1YKJ A;  2BRA A;  4EIP A;  2I0Z A;  4X4J A;  4EM4 A;  1GND A;  1K0I A;  2FBW A;  3RP8 A;  2WBA A;  1JNR A;  1N4W A;  1F8S A;  2C67 A;  2WPF A;  4TM0 A;  4BK2 A;  4WCT A;  1DOD A;  2GVC A;  1EL8 A;  1GES A;  2QA2 A;  2YG4 A;  3UKH A;  2RGH A;  1GT8 A;  3AEF A;  5L46 A;  3IWA A;  4AOS A;  3DK4 A;  3UP4 A;  4B69 A;  4B67 A;  1F8W A;  1PXB A;  2B9X A;  1Q1R A;  3C4A A;  5KRQ A;  2B7R A;  3ADA B;  3JSK A;  4XXG A;  1ZOV A;  2FJA A;  4UDR A;  3QSE A;  1N4V A;  1BGJ A;  2YAU A;  3UKK A;  1SEZ A;  2V5Z A;  2HQM A;  4YSZ A;  1O5W A;  4H7U A;  1ELI A;  3G5Q A;  3GRT A;  1PBE A;  2GMH A;  2BA9 A;  4G73 A;  4J33 A;  3VR9 A;  1DOC A;  1D7Y A;  3M12 A;  1DXL A;  3SM8 A;  4YTP A;  4GAV A;  3ABV A;  3AE4 A;  1LTX R;  1S2Q A;  2YLW A;  3GMB A;  1GET A;  3NTA A;  4Z2R A;  4C77 A;  3DJG X;  2IID A;  3Q6J A;  4NEV A;  2BXS A;  1GRH A;  2WU5 A;  1H7W A;  1Z6L A;  5HXI A;  3LXD A;  3NYF A;  1BZL A;  1S3B A;  1E6E A;  3DGZ A;  5KOW A;  1LQT A;  2WS3 A;  3AEC A;  2YLT A;  5EBK A;  3G5S A;  1GER A;  3AEA A;  3GD3 A;  5HY5 A;  1TYT A;  3ATQ A;  2BS3 A;  3CGD A;  4GCM A;  3T2Z A;  4BUR A;  4YT0 A;  4JY2 A;  5JCM A;  1DNC A;  4Y4L A;  3KKJ A;  3NN0 X;  3AWI A;  2R9Z A;  3S5W A;  5KVH A;  5C2T A;  3QVP A;  5CKU A;  4C3Y A;  1NG4 A;  3ZDN A;  3UKA A;  1Q9I A;  2F5Z A;  4G6H A;  4CNK A;  5JCN A;  1CL0 A;  3Q9T A;  1VRQ B;  4LU6 A;  2WEU A;  2WQY A;  2R45 A;  4NEW A;  2YLX A;  1OJA A;  3CPI G;  4J31 A;  4G74 A;  1H86 A;  3O0H A;  3V3O A;  4IVM B;  1UKV G;  2B7S A;  2YLZ A;  2W0H A;  3AEG A;  4ADW A;  4U8O A;  3EF6 A;  1BF3 A;  3EPT A;  3F8P A;  3NYC A;  4OPG A;  4U8J A;  2WPE A;  4NZH A;  1RP0 A;  1CJ3 A;  3KPF A;  5C3J A;  2WES A;  3PO7 A;  3UTG A;  4CBQ A;  3LZX A;  4H50 A;  4EQR A;  4YSY A;  1Y56 A;  5FS9 A; 
#chains in the Genus database with same CATH homology
 2XLR A;  3AEE A;  3VRD B;  3AE9 A;  3AED A;  3URH A;  1PBF A;  1PJ6 A;  4PAB A;  1KNR A;  4H4U A;  4Z2U A;  2ZBW A;  4GDE A;  3T2Y A;  1TYP A;  1ZMC A;  2UZZ A;  3P4Q A;  4TLZ A;  4U2S A;  2YQU A;  2ZZB A;  3SFD A;  2FJB A;  4YKG A;  3OZ2 A;  4BK1 A;  4J57 A;  3SX6 A;  1F8R A;  3UTE A;  4JY3 A;  1QO8 A;  4Z25 A;  4A6N A;  2YLR A;  5KMR A;  3F8D A;  2IVE A;  2BAC A;  3AXB A;  3NK0 X;  3T37 A;  4ZCC A;  1P2E A;  2WDQ A;  2WDR A;  3IF9 A;  3HYV A;  4GF7 A;  4UDQ A;  4AOX A;  4B66 A;  1FEA A;  4AT0 A;  1KNP A;  4H4Z A;  2V6O A;  3FIM B;  4A65 A;  2YM2 A;  1TDK A;  3NG7 X;  1Y56 B;  2EQ9 A;  3AYJ A;  2WP5 A;  3CIR A;  1GRF A;  4H4P A;  4K2X A;  4K8D A;  1IUS A;  2GQF A;  1ZY8 A;  2AQJ A;  3FMW A;  1JNZ A;  4KX6 A;  3RED A;  2CFY A;  1XHC A;  1NPX A;  1OJC A;  2XFU A;  3CNS A;  4YTN A;  2VRM A;  2PYX A;  2APG A;  1GSN A;  1DOB A;  3SZW A;  1ONF A;  3SZF A;  4A5L A;  1H81 A;  3FPZ A;  3NGC X;  1PBB A;  1QJD A;  4C3X A;  3D8X A;  1D4C A;  3FG2 P;  2GAH B;  4X9M A;  2E1M A;  1TDO A;  1XDI A;  1KSU A;  2X8G A;  5BRT A;  4ICY A;  5EB5 A;  1GRB A;  2GH5 A;  3IHG A;  2JB1 A;  2QAE A;  4LA1 A;  4N9X A;  4J2W A;  3SQP A;  3CND A;  5KNL A;  2VZ2 A;  2C76 A;  2X99 A;  3T0K A;  4GDP A;  4YTM A;  3NN6 X;  2GR0 A;  2GF3 A;  1H82 A;  1NEK A;  2B9W A;  2C66 A;  2OAL A;  3GDN A;  3ICT A;  3M13 A;  5J7X A;  2XVJ A;  4OPL A;  1JEH A;  2E4G A;  1VDC A;  2XLU A;  2YVF A;  4B64 A;  3AE8 A;  1QLB A;  3DA1 A;  3RP7 A;  5U25 A;  2C7G A;  1GEU A;  4YXD A;  2BXR A;  3CNT A;  1LV0 A;  4EM3 A;  4HB9 A;  1H84 A;  2NPX A;  2C73 A;  2C4C A;  3P4R A;  4HA6 A;  3RHA A;  3BI4 A;  1RSG A;  4U8P A;  1BGN A;  2GR2 A;  2XVF A;  3OC4 A;  3NYE A;  3AE5 A;  3DGH A;  2WP6 A;  4OPU A;  4RG3 A;  2GEW A;  2ARD A;  3SGL A;  3C96 A;  3E1T A;  3HYW A;  1EBD A;  4A9W A;  4EMI A;  1FEC A;  3LZW A;  1L9E A;  4H4Y A;  1TDE A;  1E1N A;  5FS7 A;  3LB8 A;  1VG0 A;  3AE1 A;  3COX A;  1TRB A;  2C3D A;  1JOA A;  2V3A A;  4H4S A;  4FK1 C;  2VOU A;  3CTY A;  4TM1 A;  3UKF A;  1GTE A;  3BNM A;  3NLC A;  3RP6 A;  1P2H A;  4B65 A;  5IPY A;  1PDH A;  4CCR A;  5CQF A;  4H2P A;  3B6D A;  4H2R A;  4XWZ A;  1FL2 A;  3AYL A;  1NHS A;  1CJ2 A;  4YSH A;  4Z43 A;  5JCL A;  4CY8 A;  3R9U A;  4P9S A;  1M64 A;  4NTC A;  4UDP A;  1CC2 A;  1KDG A;  3EAO A;  1H83 A;  1GTH A;  4K5S A;  4LII A;  3NT6 A;  4OPI A;  5FS8 A;  3WE0 A;  4C74 A;  2BAB A;  1EL7 A;  3NNE A;  4GRT A;  3SY4 A;  1E39 A;  4RSL A;  3UOV A;  2YM1 A;  2JAE A;  4B1B A;  2XVE A;  4U8I A;  5U63 A;  2VVL G;  2C72 A;  2ACZ A;  2Q0L A;  1YQ4 A;  2Y6R A;  4YWO A;  1IUT A;  2GRT A;  2WPC A;  2WU2 A;  2OA1 A;  1N1P A;  4A7A A;  2OLN A;  3UCL A;  3KU9 A;  4FDC B;  3F8R A;  3NTD A;  1L9D A;  4JNQ A;  3ZYX A;  5BVA A;  1JRY A;  2R0P A;  1DOE A;  1PHH A;  3UOY A;  4IA5 A;  1IUU A;  3UKQ A;  4BJZ A;  3K30 A;  1GXF A;  1E7P A;  3UOZ A;  4II2 A;  4JN9 A;  2BYB A;  1OJT A;  2R4J A;  2CDU A;  2C75 A;  4H4T A;  4K7Z A;  4IVO B;  4NWZ A;  3CGB A;  4A99 A;  4IV9 A;  2YR5 A;  1ZP0 A;  4H2N A;  2JBV A;  1B5Q A;  4NTE A;  2Q6U A;  1CHU A;  1H7X A;  2TMD A;  4KPR A;  3SZ0 A;  2ZZ0 A;  4Z24 A;  5KMP A;  4EQX A;  2OLO A;  3KLJ A;  3RNM A;  1PXC A;  1NEN A;  2Z5Y A;  3LAD A;  4D03 A;  1HYU A;  2O9Z A;  2XFN A;  4TM4 A;  5J60 A;  3UP5 A;  2QA1 A;  3H8I A;  3L1R A;  5JCI A;  2RGJ A;  4U2T A;  2YWL A;  5KVI A;  4CRT A;  1DJQ A;  4J56 A;  4Y4M A;  1E1K A;  4K5R A;  1S2Y A;  1VG9 A;  2A89 A;  2BK4 A;  2BCP A;  4EMW A;  4IA6 A;  3UOX A;  5HHF A;  5BUL A;  3VRA A;  1ZKQ A;  4C5O A;  1AOG A;  2B76 A;  5DBJ A;  1Y0P A;  3AB1 A;  4DNA A;  2BC0 A;  3ALM A;  3P4P A;  4NTD A;  4U2L A;  4EMJ A;  2H89 A;  2C64 A;  1REO A;  1VQW A;  1LQU A;  3NRN A;  3QFB A;  4CY6 A;  4EQS A;  1PJ7 A;  4EIQ A;  1BWC A;  1JRX A;  3UTF A;  1CJ4 A;  4USQ A;  1GRE A;  2XFP A;  3T2K A;  5TR3 A;  4ZN0 A;  4II3 A;  3EAN A;  2E5V A;  2FJD A;  4E0V A;  2AR8 A;  1COY A;  3CPJ G;  2XFQ A;  5GRT A;  2GAG B;  3P1W A;  3H8L A;  3II4 A;  3AYI A;  3NIX A;  3VR8 A;  4O5U A;  4U8K A;  3PVC A;  3P4S A;  2IVD A;  3CNJ A;  1F6M A;  4GR1 A;  3AD9 B;  1ZK7 A;  1L9C A;  2VQB A;  3BHK A;  3K7T A;  5IQ4 A;  3QSM A;  1XPQ A;  2EQ6 A;  4XWR A;  3GDP A;  1W4X A;  4ZCD A;  1JU2 A;  3DME A;  1RYI A;  3AEB A;  2DKI A;  2YG6 A;  2C65 A;  1S3E A;  4YSX A;  3PS9 A;  1NHP A;  1B8S A;  2BS2 A;  1H6V A;  2XDO A;  2XVI A;  3UKP A;  1TDF A;  1GAL A;  3C4N A;  3DK9 A;  3I3L A;  4J36 A;  4D04 A;  1CC6 A;  2XFO A;  2BK3 A;  3ICS A;  4ECH A;  4Z26 A;  3NK1 X;  5KWF A;  3QJ4 A;  3CN8 A;  4DSH A;  2A8X A;  1ZMD A;  1E1M A;  1PN0 A;  3H4K A;  3KPK A;  4U8L A;  2GR3 A;  2VRL A;  5IQ1 A;  2CUL A;  4AP1 A;  1KFY A;  2VQ7 A;  2R0G A;  2VVL A;  3KD9 A;  4APN A;  2CVJ A;  4TM3 A;  3GSI A;  2X3N A;  5KOX A;  1PBD A;  3DJD A;  3DK8 A;  1EL9 A;  1D4E A;  2A87 A;  4BV6 A;  4RG4 A;  2GR1 A;  5LV9 A;  2Q7V A;  3IC9 A;  1NHQ A;  1IJH A;  1CBO A;  3T14 A;  1JRZ A;  1O94 A;  3AD8 B;  3QFA A;  2BRY A;  1TDN A;  3NH3 X;  1MOK A;  1KF6 A;  1CC4 A;  3FBS A;  2JK6 A;  2YG3 A;  1K4Q A;  1GOS A;  1E1L A;  2YR6 A;  3ITJ A;  1CJC A;  3QVR A;  4I59 A;  1GRA A;  2GQW A;  4M52 A;  3VQR A;  5KXJ A;  2XCG A;  3IHM A;  3GYJ A;  4JQ9 A;  3AE3 A;  5BUK A;  4BK3 A;  1D7L A;  2EQ8 A;  3KVE A;  4G9K A;  3UTH A;  2YG7 A;  3CGE A;  3GRS A;  2GB0 A;  3CPH G;  1F3P A;  2QCU A;  4AP3 A;  2V61 A;  2PHH A;  2R46 A;  2WOI A;  4X9N A;  5EB4 A;  5HYM A;  1NDA A;  1MXT A;  4TLX A;  1GRG A;  4OPT A;  3HYX A;  2R0C A;  3BHF A;  4H2Q A;  3V3N A;  4I58 A;  4FX9 A;  3P9U A;  1B37 A;  2Y6Q A;  4H4Q A;  3AE2 A;  4Y4N A;  2X50 A;  4NNJ A;  4B63 A;  3DH9 A;  4K22 A;  3SZC A;  1KSS A;  3GWF A;  3K7Q X;  2BCG G;  5JCK A;  2XLP A;  2R4E A;  3SYI A;  3B3R A;  2H88 A;  2Z5X A;  1PBC A;  5KMQ A;  3DJJ A;  2XYO A;  1GPE A;  4A79 A;  3AE7 A;  1NAA A;  1IUX A;  2XVH A;  4H4W A;  5FMH A;  3SFE A;  1OJD A;  1IUV A;  2YVG A;  1LJ1 A;  3I6D A;  1Q1W A;  4O5Q A;  4U8N A;  4JDR A;  1CF3 A;  1K0J A;  1N4U A;  4OPC A;  2WP9 A;  4B68 A;  2JB2 A;  2V3B A;  2B9Y A;  2WDV A;  5GSN A;  3DJE A;  1GV4 A;  1PS9 A;  2C70 A;  1NHR A;  3AD7 B;  1ZX9 A;  3D1C A;  4J34 A;  4REK A;  5FS6 A;  5KMS A;  3L8K A;  2JKC A;  2YR4 A;  4FK1 A;  3HZL A;  2WOV A;  3K7M X;  1YQ3 A;  1D4D A;  2GMJ A;  2V60 A;  4UP3 A;  1OJ9 A;  2WHD A;  1X31 B;  4JNA A;  4OCG A;  4Z44 A;  2BK5 A;  1NG3 A;  3KA7 A;  2YVJ A;  5M10 A;  1BKW A;  4G6G A;  3GMC A;  4GAP A;  1FEB A;  1FCD A;  2AAQ A;  1LPF A;  3ALJ A;  4H4R A;  4GUV A;  2J3N A;  4MJW A;  4USR A;  4A6N B;  3NHO X;  3QSS A;  4AT2 A;  4CNJ A;  2GV8 A;  4CCQ A;  3NK2 X;  3S61 A;  1IUW A;  3BI5 A;  1DJN A;  3M0O A;  3GYX A;  4WX1 A;  1MO9 A;  3ALL A;  3V76 A;  1GRT A;  2RGO A;  2Q0K A;  2NVK X;  2XLS A;  4PAA A;  2BC1 A;  1PXA A;  1PJ5 A;  3AE6 A;  5ER0 A;  1LVL A;  2BS4 A;  4BJY A;  4Z2T A;  2FJE A;  2YG5 A;  4YKF A;  1ZOY A;  3ISH A;  3CMM A;  1O95 A;  2JB3 A;  1V59 A;  2WOW A;  1XAN A;  3LJP A;  3UKL A;  3NKS A;  1K0L A;  1M6I A;  2WET A;  2ZZC A;  2EQ7 A;  2DKH A;  4H4V A;  4U8M A;  1ZDL A;  4DGK A;  3G5R A;  3SXI A;  3T31 A;  3GD4 A;  2VVM A;  3CGC A;  5EOW A;  1FOH A;  5U1O A;  3ATR A;  5M0Z A;  2X8C A;  1YY5 A;  3LOV A;  2XLT A;  3GYI A;  1B4V A;  2C3C A;  2OAM A;  1YQZ A;  2TPR A;  2X8H A;  1EL5 A;  3BI2 A;  3GWD A;  4H4X A;  4OPD A;  3CNP A;  1D5T A;  3BNU A;  3ICR A;  1L0V A;  4EQW A;  3VRB A;  4DSG A;  2RAB A;  4OVI A;  2YLS A;  1YKJ A;  2BRA A;  4EIP A;  2I0Z A;  4X4J A;  4EM4 A;  1GND A;  1K0I A;  2FBW A;  3RP8 A;  2WBA A;  1JNR A;  1N4W A;  1F8S A;  2C67 A;  2WPF A;  4TM0 A;  4BK2 A;  4WCT A;  1DOD A;  2GVC A;  1EL8 A;  1GES A;  2QA2 A;  2YG4 A;  3UKH A;  2RGH A;  1GT8 A;  3AEF A;  5L46 A;  3IWA A;  4AOS A;  3DK4 A;  3UP4 A;  4B69 A;  4B67 A;  1F8W A;  1PXB A;  2B9X A;  1Q1R A;  3C4A A;  5KRQ A;  2B7R A;  3ADA B;  3JSK A;  4XXG A;  1ZOV A;  2FJA A;  4UDR A;  3QSE A;  1N4V A;  1BGJ A;  2YAU A;  3UKK A;  1SEZ A;  2V5Z A;  2HQM A;  4YSZ A;  1O5W A;  4H7U A;  1ELI A;  3G5Q A;  3GRT A;  1PBE A;  2GMH A;  2BA9 A;  4G73 A;  4J33 A;  3VR9 A;  1DOC A;  1D7Y A;  3M12 A;  1DXL A;  3SM8 A;  4YTP A;  4GAV A;  3ABV A;  3AE4 A;  1LTX R;  1S2Q A;  2YLW A;  3GMB A;  1GET A;  3NTA A;  4Z2R A;  4C77 A;  3DJG X;  2IID A;  3Q6J A;  4NEV A;  2BXS A;  1GRH A;  2WU5 A;  1H7W A;  1Z6L A;  5HXI A;  3LXD A;  3NYF A;  1BZL A;  1S3B A;  1E6E A;  3DGZ A;  5KOW A;  1LQT A;  2WS3 A;  3AEC A;  2YLT A;  5EBK A;  3G5S A;  1GER A;  3AEA A;  3GD3 A;  5HY5 A;  1TYT A;  3ATQ A;  2BS3 A;  3CGD A;  4GCM A;  3T2Z A;  4BUR A;  4YT0 A;  4JY2 A;  5JCM A;  1DNC A;  4Y4L A;  3KKJ A;  3NN0 X;  3AWI A;  2R9Z A;  3S5W A;  5KVH A;  5C2T A;  3QVP A;  5CKU A;  4C3Y A;  1NG4 A;  3ZDN A;  3UKA A;  1Q9I A;  2F5Z A;  4G6H A;  4CNK A;  5JCN A;  1CL0 A;  3Q9T A;  1VRQ B;  4LU6 A;  2WEU A;  2WQY A;  2R45 A;  4NEW A;  2YLX A;  1OJA A;  3CPI G;  4J31 A;  4G74 A;  1H86 A;  3O0H A;  3V3O A;  4IVM B;  1UKV G;  2B7S A;  2YLZ A;  2W0H A;  3AEG A;  4ADW A;  4U8O A;  3EF6 A;  1BF3 A;  3EPT A;  3F8P A;  3NYC A;  4OPG A;  4U8J A;  2WPE A;  4NZH A;  1RP0 A;  1CJ3 A;  3KPF A;  5C3J A;  2WES A;  3PO7 A;  3UTG A;  4CBQ A;  3LZX A;  4H50 A;  4EQR A;  4YSY A;  1Y56 A;  5FS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...