1TDFA

Crystal structure of escherichia coli thioredoxin reductase refined at 2 angstrom resolution: implications for a large conformational change during catalysis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of Escherichia coli thioredoxin reductase refined at 2 A resolution. Implications for a large conformational change during catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase(flavoenzyme)
total genus 92
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1994-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdfA02
2QA1A 4Y4NA 5BULA 1MOKA 2JAEA 2JB3A 4H4RA 3AE4A 3DJGX 1CL0A 1XHCA 1IUTA 4EIPA 5FS6A 1OJDA 2DKHA 2R9ZA 3AE3A 1F8WA 3AD8B 1RYIA 1GRTA 3DK8A 3DGZA 3IC9A 5EBKA 3AE1A 4PAAA 1GT8A 3AE9A 4JQ9A 2XFOA 2GR0A 2UZZA 1FOHA 2WDVA 1KNRA 1RP0A 5KOWA 4P9SA 2OLOA 2XVIA 3LOVA 1FEBA 2YG5A 4YWOA 4D03A 1FCDA 1EL8A 4C3XA 1RSGA 2CULA 1NHQA 4H50A 2WP5A 1Y0PA 3AEFA 4FK1A 1L9EA 1LQUA 2QAEA 3LZWA 3KLJA 5KVHA 3NHOX 1YQ4A 2E4GA 3FPZA 1GRFA 1NEKA 2C64A 1S3BA 1GERA 2ZZCA 3NRNA 4IVOB 4JNQA 2WESA 4X9NA 4H4QA 1ZY8A 5IPYA 1X31B 5HY5A 4YTMA 2BS3A 2R45A 2XVEA 3AWIA 3M12A 3F8PA 3PS9A 2V3AA 1D5TA 2JBVA 2BK5A 1PBEA 1PXBA 2WPFA 3ATRA 4O5UA 3I3LA 1PBCA 4H2QA 4OPDA 3UKHA 4A9WA 4EIQA 2GAHB 1REOA 3P4SA 2YVJA 1DJQA 2JB1A 2B76A 3AE2A 4GR1A 3K30A 5DBJA 4YXDA 4NTCA 3F8RA 1D4CA 5FS7A 3COXA 4EMWA 2VQ7A 1ZMDA 2C7GA 3QSSA 3NK0X 3RP8A 3UKFA 4AP1A 4A79A 4H4PA 2V60A 2GF3A 4WX1A 3CNDA 1H83A 2X8GA 3CNPA 2WOWA 5HXIA 3R9UA 3GD4A 1KSUA 4GDPA 4FDCB 1H84A 1PN0A 2XLPA 1PJ5A 3AD9B 3P9UA 2GQFA 2ACZA 4D04A 1GRGA 4WCTA 3O0HA 2XLSA 2YG7A 2IVEA 4YTPA 2WU2A 1DNCA 4K8DA 2RGJA 2WP6A 4ZN0A 5JCMA 1ZOVA 3OC4A 3QFAA 2XFQA 4NEWA 2JKCA 1KSSA 1CJ4A 3DMEA 2W0HA 1H7XA 4O5QA 4EM3A 2C76A 2FJEA 3GMCA 1K4QA 4JNAA 2XVJA 3CGEA 4J36A 3AYJA 1FL2A 4UDPA 4B64A 3QSEA 4H4SA 1DOEA 1H86A 1B37A 4EM4A 1TDKA 3NLCA 3AYLA 4U8LA 2HQMA 5U63A 1HYUA 1IUWA 1SEZA 2APGA 2RGHA 3CNSA 2C65A 2I0ZA 2AAQA 1QLBA 1M64A 1TDOA 1PXAA 1NHSA 3II4A 1GEUA 2YG3A 3CGCA 4CNJA 1E1MA 4U2LA 1YY5A 4Y4LA 1GV4A 1DOCA 2B9WA 2R0GA 2WP9A 3C4AA 4AOXA 1NDAA 4NZHA 4ZCCA 2YVGA 1UKVG 2VOUA 2Z5XA 2BA9A 2YR6A 3QJ4A 1ZOYA 4CY8A 2H88A 5HYMA 4ZCDA 3CIRA 2GEWA 1OJTA 1E1LA 2V61A 3GRTA 1KFYA 1LVLA 4Z2TA 1YQ3A 2WBAA 1LPFA 2XFNA 3Q9TA 4Y4MA 1IUXA 5EOWA 4CRTA 2TMDA 3S61A 4AOSA 4IV9A 3KA7A 5ER0A 1F3PA 2OLNA 2WOIA 4K2XA 4HB9A 1PDHA 3UP5A 3GSIA 4GUVA 4UDQA 3VQRA 4C5OA 3KVEA 1TDNA 4PABA 1GTEA 4M52A 3UKLA 1LTXR 2YLWA 4EMIA 2WOVA 3NH3X 4CNKA 2BACA 3NYEA 4J33A 4A5LA 4B63A 2QCUA 1B4VA 2BS2A 1O5WA 4K5SA 5TR3A 1NPXA 2B9YA 2Q0LA 5CQFA 2R0PA 3DA1A 3CNJA 2R46A 4YSZA 3CPIG 2V3BA 3DK9A 4N9XA 5L46A 4I59A 3SFEA 2WPCA 2BXRA 2TPRA 2IIDA 4U8MA 4J31A 3PVCA 4YKFA 1VRQB 5LV9A 2QA2A 2RGOA 1O95A 4A6NA 2YVFA 3G5QA 2R4EA 1XDIA 2A87A 2YLTA 3FG2P 3URHA 4ICYA 2VVMA 2FBWA 4B67A 3GDPA 5KWFA 3SFDA 3F8DA 1VG9A 4BV6A 4K22A 1GRHA 1Q1WA 1EL5A 4RG3A 1KF6A 3AEAA 3K7MX 4YKGA 2ZBWA 1S3EA 2Y6QA 1S2QA 2B7SA 4TLZA 3SM8A 4Z2UA 1K0JA 1Q9IA 5CKUA 4FK1C 3ALLA 1PJ6A 1YKJA 2BS4A 1PHHA 4K5RA 4XXGA 4ECHA 1DODA 3RNMA 4NTDA 2F5ZA 2EQ6A 5JCNA 2YG4A 2YM1A 4U8OA 1W4XA 1KNPA 2ARDA 4Z26A 1LJ1A 3ICTA 1P2EA 5HHFA 3B3RA 3JSKA 1Q1RA 1ZMCA 4GF7A 2O9ZA 4OPGA 2R4JA 3LZXA 3NIXA 4H2NA 1E7PA 2NVKX 3OZ2A 3T37A 4BK3A 5BVAA 2YLXA 2C67A 1NENA 3DJEA 1F6MA 4GCMA 3LB8A 1TYTA 1L9DA 2CFYA 1NG3A 3NGCX 2H89A 1JNRA 2WEUA 3DH9A 2GMHA 2OAMA 2BXSA 3GWDA 3VRAA 4NTEA 3IHGA 2YWLA 3BNMA 2PYXA 4YSXA 2X3NA 1PXCA 4TM4A 4H4UA 2Q6UA 4USQA 3ZDNA 4BK1A 2EQ7A 5KRQA 1B8SA 3NYFA 5BRTA 4TLXA 2WDRA 2C75A 4U2TA 3UOZA 3V3NA 4OCGA 2X8CA 2XVFA 3M13A 1GPEA 4Z43A 3BHFA 2BABA 3AB1A 1ZX9A 3NNEA 5M10A 3EANA 1E39A 3ALJA 4Z25A 1O94A 1Y56A 3PO7A 2WQYA 2VQBA 4J57A 3BHKA 3Q6JA 3AD7B 3SQPA 2GVCA 4CCQA 4U8PA 1K0IA 3GRSA 1CJ2A 2Q0KA 4YSHA 1ZP0A 1BZLA 3L8KA 5J7XA 2CVJA 1V59A 3G5SA 2NPXA 3CPJG 3GMBA 2YLSA 4A7AA 1JRYA 4BK2A 2GAGB 1L0VA 4H2PA 4J2WA 2C73A 1ONFA 3IHMA 3GYIA 1IUUA 3H8IA 2C3DA 4C74A 3CPHG 4XWRA 1QO8A 2BCGG 1JEHA 1DJNA 1FEAA 2BC0A 2E5VA 4H4VA 4AT0A 1IUVA 3QVRA 4JN9A 1AOGA 3UOXA 4J34A 4DSGA 2VVLA 3BI5A 1OJCA 4RG4A 2BK4A 5GRTA 3DK4A 5EB4A 3H4KA 3LJPA 5JCKA 3AE7A 4OPIA 4H4WA 1GREA 3HZLA 4U2SA 1CJ3A 1LQTA 2GH5A 5M0ZA 3GWFA 1GSNA 1E6EA 3B6DA 4EQXA 2BC1A 1TDEA 2AR8A 2YLZA 2BK3A 1PJ7A 1ZKQA 2RABA 3ITJA 3LXDA 1BWCA 3CNTA 4J56A 3BI4A 2WPEA 2A8XA 2GB0A 3UTGA 4B66A 1IUSA 1E1NA 1ELIA 3AEEA 2B9XA 1CF3A 3CGDA 4XWZA 3UTEA 5EB5A 2VVLG 1L9CA 2GR2A 1LV0A 4I58A 4A6NB 4GDEA 4B68A 4JDRA 1JNZA 4A65A 2OA1A 1FECA 4H4TA 3RP6A 2YR4A 1DXLA 4OPCA 1PBDA 2VZ2A 3UOVA 1B5QA 3QFBA 3EPTA 2OALA 1IJHA 1GESA 1GTHA 2V6OA 2Y6RA 1S2YA 2C3CA 4EQWA 3BNUA 4OPTA 1GNDA 1N1PA 5J60A 3DGHA 2JB2A 2AQJA 2J3NA 2XFUA 4LA1A 4EQSA 3UOYA 4IVMB 2WS3A 1D4DA 1PBBA 1NAAA 1EBDA 2YG6A 1BGNA 1VDCA 3ADAB 4DGKA 3AEGA 2XDOA 2YQUA 3KPFA 3ATQA 4BJZA 3QVPA 4CBQA 2EQ8A 1F8RA 2VRLA 2GQWA 3AXBA 2YAUA 2EQ9A 4BURA 4CCRA 2XYOA 1OJ9A 1H6VA 3VRBA 4A99A 2PHHA 3K7QX 1KDGA 3AEBA 1NHPA 4HA6A 4Z44A 3EF6A 1EL9A 3FBSA 4TM0A 2B7RA 4REKA 3UKKA 3G5RA 1BF3A 1NG4A 3FMWA 2ZZBA 1CHUA 1QJDA 3CTYA 1CC2A 2GR3A 1P2HA 1H82A 3NTDA 3AECA 1M6IA 5KXJA 1K0LA 3VR8A 5FS8A 4YT0A 3UCLA 2X99A 4BJYA 1E1KA 5KOXA 5IQ4A 1TDFA 3UKQA 3L1RA 2YLRA 1N4UA 3UKPA 3AE6A 5JCIA 1N4VA 3FIMB 3NK1X 4OVIA 4U8JA 4FX9A 2Q7VA 3GD3A 1CBOA 4H4ZA 1BGJA 4Z2RA 3UTFA 2Z5YA 3RP7A 4YTNA 3ICRA 1Y56B 2IVDA 3IWAA 3D8XA 5FS9A 3DJJA 2YM2A 4X9MA 1CC4A 5KVIA 3WE0A 4AT2A 2WHDA 4H4XA 3NN6X 3CN8A 3V76A 3P1WA 4H7UA 3GYJA 4OPUA 4ADWA 2CDUA 5U1OA 4B65A 3AE5A 3ALMA 3C96A 3AEDA 3P4QA 1N4WA 2FJBA 1PS9A 3DJDA 1GRBA 2FJDA 2WU5A 3VRDB 2C70A 2XLTA 1D7LA 4U8IA 4LIIA 1H81A 2BYBA 3ABVA 3VR9A 4USRA 4RSLA 4E0VA 4GRTA 3V3OA 3H8LA 2R0CA 3I6DA 4U8KA 2VRMA 3EAOA 1OJAA 4EMJA 1MXTA 2GMJA 2XCGA 1F8SA 2XLRA 3UKAA 3S5WA 1DOBA 1EL7A 4YSYA 5JCLA 3D1CA 3P4RA 4UP3A 5C2TA 4UDRA 5BUKA 2YR5A 2A89A 3E1TA 1ZK7A 4U8NA 4MJWA 1BKWA 2BCPA 3GDNA 4KX6A 1CJCA 4AP3A 2E1MA 2WDQA 3NT6A 4Z24A 1MO9A 3ICSA 3NKSA 4C77A 3ZYXA 4APNA 3CGBA 2WETA 4TM1A 1TRBA 4JY3A 2C72A 3KD9A 3KKJA 2XLUA 3K7TA 3NYCA 1GALA 4DNAA 1YQZA 3KU9A 3IF9A 3NTAA 3UP4A 4TM3A 2ZZ0A 4CY6A 3AYIA 3C4NA 1NHRA 1GRAA 1CC6A 1GXFA 1TYPA 1H7WA 1VQWA 1COYA 4IA5A 3LADA 3NK2X 1VG0A 5IQ1A 2FJAA 3QSMA 2GV8A 4X4JA 1JRXA 5FMHA 3RHAA 5C3JA 1D7YA 2GRTA 2DKIA 4KPRA 3REDA 4H4YA 3SGLA 2XVHA 1Z6LA 1XPQA 4IA6A 1GETA 1GOSA 2JK6A 2GR1A 1ZDLA 2C66A 3ISHA 1XANA 1D4EA 4K7ZA 4B1BA 2V5ZA 3BI2A 3M0OA 4LU6A 2XFPA 1JU2A 4JY2A 4OPLA 3AE8A 3UTHA 4B69A 1JOAA 2X8HA 4DSHA 4C3YA 5GSNA 3NG7X 4H2RA 4EQRA 5U25A 1PBFA 3P4PA 1JRZA 4NEVA 3NN0X 2X50A
chains in the Genus database with same CATH superfamily
2QA1A 4Y4NA 5BULA 1MOKA 2JAEA 2JB3A 4H4RA 3AE4A 3DJGX 1CL0A 1XHCA 1IUTA 4EIPA 5FS6A 1OJDA 2DKHA 2R9ZA 3AE3A 1F8WA 3AD8B 1RYIA 1GRTA 3DK8A 3DGZA 3IC9A 5EBKA 3AE1A 4PAAA 1GT8A 3AE9A 4JQ9A 2XFOA 2GR0A 2UZZA 1FOHA 2WDVA 1KNRA 1RP0A 3GYXA 5KOWA 4P9SA 2OLOA 2XVIA 3LOVA 1FEBA 2YG5A 4YWOA 4D03A 1FCDA 4NNJA 1EL8A 4C3XA 1RSGA 2CULA 1NHQA 4H50A 2WP5A 1Y0PA 3CMMA 3AEFA 4FK1A 1L9EA 1LQUA 2QAEA 3LZWA 2C4CA 3KLJA 5KVHA 3NHOX 1YQ4A 2E4GA 3FPZA 1GRFA 1NEKA 2C64A 1S3BA 1GERA 2ZZCA 3NRNA 4IVOB 4JNQA 2WESA 4X9NA 4H4QA 1ZY8A 5IPYA 1X31B 5HY5A 4YTMA 2BS3A 2R45A 2XVEA 3AWIA 3M12A 3F8PA 3PS9A 2V3AA 1D5TA 2JBVA 4GAPA 2BK5A 1PBEA 1PXBA 2WPFA 3ATRA 4O5UA 3I3LA 1PBCA 4H2QA 4OPDA 3UKHA 4A9WA 4EIQA 2GAHB 1REOA 3P4SA 2YVJA 1DJQA 2JB1A 2B76A 3AE2A 4GR1A 3K30A 5DBJA 4YXDA 4NTCA 3F8RA 1D4CA 5FS7A 3COXA 4EMWA 2VQ7A 1ZMDA 2C7GA 3QSSA 3NK0X 3RP8A 3UKFA 4AP1A 4A79A 3T14A 4H4PA 3SZ0A 2V60A 2GF3A 3KPKA 4WX1A 3CNDA 1H83A 2X8GA 3CNPA 2WOWA 5HXIA 3R9UA 3GD4A 1KSUA 4GDPA 4FDCB 1H84A 1PN0A 2XLPA 1PJ5A 3AD9B 3P9UA 2GQFA 2ACZA 4D04A 1GRGA 4WCTA 3O0HA 2XLSA 2YG7A 2IVEA 4YTPA 2WU2A 1DNCA 4K8DA 2RGJA 2WP6A 4ZN0A 5JCMA 1ZOVA 3OC4A 3QFAA 2XFQA 4NEWA 5KMRA 2JKCA 1KSSA 1CJ4A 3DMEA 2W0HA 1H7XA 4O5QA 4EM3A 2C76A 2FJEA 3GMCA 1K4QA 4JNAA 2XVJA 3CGEA 4J36A 3AYJA 1FL2A 4UDPA 4B64A 3QSEA 4H4SA 1DOEA 1H86A 1B37A 4EM4A 1TDKA 3NLCA 3AYLA 4U8LA 2HQMA 3T2YA 5U63A 1HYUA 1IUWA 1SEZA 2APGA 2RGHA 3CNSA 2C65A 2I0ZA 2AAQA 1QLBA 1M64A 1TDOA 3T2KA 1PXAA 1NHSA 3II4A 1GEUA 2YG3A 3CGCA 4CNJA 1E1MA 4U2LA 1YY5A 4Y4LA 1GV4A 1DOCA 2B9WA 2R0GA 2WP9A 3T31A 3C4AA 4AOXA 1NDAA 4NZHA 4ZCCA 2YVGA 1UKVG 2VOUA 5KNLA 2Z5XA 2BA9A 2YR6A 3QJ4A 1ZOYA 4CY8A 2H88A 3SZWA 5HYMA 4ZCDA 3CIRA 2GEWA 1OJTA 1E1LA 2V61A 4G9KA 3GRTA 1KFYA 1LVLA 4Z2TA 1YQ3A 2WBAA 1LPFA 2XFNA 3Q9TA 4Y4MA 1IUXA 5EOWA 4CRTA 2TMDA 3S61A 4AOSA 4IV9A 3KA7A 5ER0A 1F3PA 2OLNA 2WOIA 4K2XA 4HB9A 1PDHA 3UP5A 3GSIA 4GUVA 4UDQA 3VQRA 4C5OA 3KVEA 1TDNA 4PABA 1GTEA 4M52A 3UKLA 1LTXR 2YLWA 4EMIA 2WOVA 3NH3X 4CNKA 2BACA 3NYEA 4J33A 4A5LA 4B63A 2QCUA 1B4VA 2BS2A 1O5WA 4K5SA 5TR3A 1NPXA 2B9YA 2Q0LA 5CQFA 2R0PA 3DA1A 3CNJA 2R46A 4YSZA 3CPIG 2V3BA 3DK9A 4N9XA 5L46A 4I59A 3SFEA 2WPCA 2BXRA 2TPRA 2IIDA 4U8MA 4J31A 3PVCA 4YKFA 1VRQB 5LV9A 2QA2A 2RGOA 1O95A 4A6NA 3SXIA 2YVFA 3G5QA 2R4EA 1XDIA 2A87A 2YLTA 3FG2P 3URHA 4ICYA 2VVMA 2FBWA 4B67A 3GDPA 5KWFA 3SFDA 3F8DA 1VG9A 4BV6A 4K22A 1GRHA 1Q1WA 1EL5A 4RG3A 1KF6A 3AEAA 3K7MX 4YKGA 2ZBWA 1S3EA 2Y6QA 1S2QA 2B7SA 4TLZA 3SM8A 4Z2UA 1K0JA 1Q9IA 5CKUA 4FK1C 3ALLA 1PJ6A 1YKJA 2BS4A 1PHHA 4K5RA 4XXGA 4ECHA 1DODA 3RNMA 4NTDA 2F5ZA 2EQ6A 5JCNA 2YG4A 2YM1A 4U8OA 1W4XA 1KNPA 2ARDA 4Z26A 1LJ1A 3ICTA 1P2EA 5HHFA 3B3RA 3JSKA 1Q1RA 1ZMCA 4GF7A 2O9ZA 4OPGA 2R4JA 3LZXA 3NIXA 4H2NA 3HYVA 1E7PA 2NVKX 3OZ2A 3T37A 4BK3A 5BVAA 2YLXA 2C67A 1NENA 3DJEA 1F6MA 4GCMA 3LB8A 1TYTA 1L9DA 3SZFA 2CFYA 1NG3A 3NGCX 2H89A 1JNRA 2WEUA 3DH9A 2GMHA 2OAMA 2BXSA 3GWDA 3VRAA 4NTEA 3IHGA 2YWLA 3BNMA 2PYXA 5KMPA 4YSXA 2X3NA 1PXCA 4TM4A 4H4UA 2Q6UA 4USQA 3ZDNA 4BK1A 2EQ7A 5KRQA 1B8SA 3NYFA 5BRTA 4TLXA 2WDRA 2C75A 4U2TA 3UOZA 3V3NA 4OCGA 2X8CA 2XVFA 3M13A 1GPEA 4Z43A 3BHFA 2BABA 3AB1A 1ZX9A 3NNEA 5M10A 3EANA 1E39A 3ALJA 4Z25A 1O94A 1Y56A 3PO7A 2WQYA 2VQBA 4J57A 3BHKA 3Q6JA 3AD7B 3SQPA 2GVCA 4CCQA 4U8PA 1K0IA 3GRSA 1CJ2A 4II3A 2Q0KA 4YSHA 1ZP0A 1BZLA 3L8KA 5J7XA 2CVJA 1V59A 3G5SA 2NPXA 3CPJG 3GMBA 2YLSA 4A7AA 1JRYA 4BK2A 2GAGB 1L0VA 4H2PA 4J2WA 2C73A 1ONFA 3IHMA 3GYIA 1IUUA 3H8IA 2C3DA 4C74A 3CPHG 4XWRA 1QO8A 2BCGG 1JEHA 1DJNA 1FEAA 2BC0A 2E5VA 4H4VA 4AT0A 1IUVA 3QVRA 4JN9A 1AOGA 3UOXA 4J34A 4DSGA 2VVLA 3BI5A 4G6HA 1OJCA 4RG4A 3T2ZA 2BK4A 5GRTA 3DK4A 5EB4A 3H4KA 3LJPA 5JCKA 3AE7A 4OPIA 4H4WA 1GREA 3HZLA 4U2SA 1CJ3A 1LQTA 2GH5A 5M0ZA 3GWFA 1GSNA 1E6EA 5KMQA 3B6DA 4EQXA 2BC1A 1TDEA 2AR8A 4G74A 2YLZA 2BK3A 1PJ7A 1ZKQA 2RABA 3ITJA 3LXDA 1BWCA 3CNTA 4J56A 3BI4A 2WPEA 2A8XA 2GB0A 3UTGA 4B66A 1IUSA 1E1NA 1ELIA 3AEEA 2B9XA 1CF3A 3CGDA 4XWZA 3UTEA 3SY4A 5EB5A 2VVLG 1L9CA 2GR2A 1LV0A 4I58A 4A6NB 4GDEA 4B68A 4GAVA 4JDRA 1JNZA 4A65A 2OA1A 1FECA 4H4TA 3RP6A 2BRAA 2YR4A 1DXLA 4OPCA 1PBDA 2VZ2A 3UOVA 1B5QA 3QFBA 3EPTA 2OALA 1IJHA 1GESA 3T0KA 1GTHA 2V6OA 2Y6RA 1S2YA 2C3CA 4EQWA 3BNUA 4OPTA 1GNDA 1N1PA 5J60A 3DGHA 2JB2A 2AQJA 2J3NA 2XFUA 4LA1A 4EQSA 3UOYA 4IVMB 2WS3A 1D4DA 1PBBA 1NAAA 1EBDA 2YG6A 1BGNA 1VDCA 3ADAB 4DGKA 3AEGA 2XDOA 2YQUA 3KPFA 3ATQA 4BJZA 5KMSA 3QVPA 4CBQA 2EQ8A 1F8RA 2VRLA 2GQWA 3AXBA 2YAUA 2EQ9A 4BURA 4CCRA 2XYOA 1OJ9A 1H6VA 2BRYA 3VRBA 2PHHA 3K7QX 4A99A 1KDGA 3AEBA 1NHPA 4HA6A 4Z44A 3EF6A 1EL9A 3FBSA 4TM0A 2B7RA 4REKA 3UKKA 3G5RA 1BF3A 1NG4A 3FMWA 2ZZBA 1CHUA 1QJDA 3CTYA 1CC2A 2GR3A 4NWZA 1P2HA 1H82A 3NTDA 3AECA 1M6IA 5KXJA 1K0LA 3VR8A 5FS8A 4YT0A 3UCLA 2X99A 4BJYA 1E1KA 5KOXA 5IQ4A 1TDFA 3UKQA 3L1RA 2YLRA 1N4UA 3UKPA 3AE6A 5JCIA 1N4VA 3FIMB 3NK1X 4OVIA 4U8JA 4FX9A 2Q7VA 3GD3A 1CBOA 4H4ZA 1BGJA 4Z2RA 3UTFA 2Z5YA 3RP7A 4YTNA 3ICRA 1Y56B 2IVDA 3IWAA 3D8XA 5FS9A 3DJJA 2YM2A 3HYWA 4X9MA 1CC4A 5KVIA 3WE0A 4AT2A 2WHDA 4H4XA 3NN6X 3CN8A 3V76A 3P1WA 4H7UA 3GYJA 4OPUA 4ADWA 2CDUA 5U1OA 4B65A 3AE5A 3ALMA 3C96A 3AEDA 3P4QA 1N4WA 2FJBA 1PS9A 3DJDA 1GRBA 2FJDA 2WU5A 3VRDB 2C70A 3SZCA 2XLTA 1D7LA 4U8IA 4LIIA 1H81A 2BYBA 3ABVA 3SYIA 4USRA 4RSLA 3VR9A 4E0VA 4GRTA 3V3OA 3H8LA 2R0CA 3I6DA 4U8KA 2VRMA 3EAOA 1OJAA 4EMJA 1MXTA 2GMJA 2XCGA 1F8SA 2XLRA 3UKAA 3S5WA 1DOBA 1EL7A 4YSYA 5JCLA 3D1CA 3P4RA 4UP3A 5C2TA 4UDRA 5BUKA 2YR5A 2A89A 3E1TA 1ZK7A 4U8NA 4MJWA 1BKWA 2BCPA 3GDNA 4KX6A 1CJCA 4AP3A 2E1MA 2WDQA 3NT6A 4Z24A 1MO9A 3ICSA 3NKSA 4C77A 3ZYXA 4APNA 3CGBA 2WETA 4TM1A 1TRBA 4G73A 4JY3A 2C72A 3KD9A 3HYXA 3KKJA 2XLUA 3K7TA 3NYCA 1GALA 4DNAA 1YQZA 3KU9A 3IF9A 3NTAA 3UP4A 4TM3A 2ZZ0A 4CY6A 3AYIA 3C4NA 1NHRA 1GRAA 1CC6A 1GXFA 1TYPA 1H7WA 1VQWA 1COYA 4IA5A 3LADA 3NK2X 1VG0A 5IQ1A 2FJAA 3SX6A 3QSMA 2GV8A 4X4JA 1JRXA 5FMHA 3RHAA 5C3JA 1D7YA 2GRTA 2DKIA 4KPRA 3REDA 4H4YA 3SGLA 2XVHA 1Z6LA 1XPQA 4II2A 4IA6A 1GETA 1GOSA 2JK6A 2GR1A 1ZDLA 4G6GA 2C66A 3ISHA 1XANA 1D4EA 4K7ZA 4B1BA 2V5ZA 3BI2A 3M0OA 4LU6A 2XFPA 1JU2A 4JY2A 4OPLA 3AE8A 3UTHA 4B69A 1JOAA 2X8HA 4DSHA 4C3YA 5GSNA 3NG7X 4H2RA 4EQRA 5U25A 1PBFA 3P4PA 1JRZA 4NEVA 3NN0X 2X50A
chains in the Genus database with same CATH topology
2QA1A 4Y4NA 5BULA 1MOKA 2JAEA 2JB3A 4H4RA 3AE4A 3DJGX 1CL0A 1XHCA 1IUTA 4EIPA 5FS6A 1OJDA 2DKHA 2R9ZA 3AE3A 1F8WA 3AD8B 1RYIA 1GRTA 3DK8A 3DGZA 3IC9A 5EBKA 3AE1A 4PAAA 1GT8A 3AE9A 4JQ9A 2XFOA 2GR0A 2UZZA 1FOHA 2WDVA 1KNRA 1RP0A 3GYXA 5KOWA 4P9SA 2OLOA 2XVIA 3LOVA 1FEBA 2YG5A 4YWOA 4D03A 1FCDA 4NNJA 1EL8A 4C3XA 1RSGA 2CULA 1NHQA 4H50A 2WP5A 1Y0PA 3CMMA 3AEFA 4FK1A 1L9EA 1LQUA 2QAEA 3LZWA 2C4CA 3KLJA 5KVHA 3NHOX 1YQ4A 2E4GA 3FPZA 1GRFA 1NEKA 2C64A 1S3BA 1GERA 2ZZCA 3NRNA 4IVOB 4JNQA 2WESA 4X9NA 4H4QA 1ZY8A 5IPYA 1X31B 5HY5A 4YTMA 2BS3A 2R45A 2XVEA 3AWIA 3M12A 3F8PA 3PS9A 2V3AA 1D5TA 2JBVA 4GAPA 2BK5A 1PBEA 1PXBA 2WPFA 3ATRA 4O5UA 3I3LA 1PBCA 4H2QA 4OPDA 3UKHA 4A9WA 4EIQA 2GAHB 1REOA 3P4SA 2YVJA 1DJQA 2JB1A 2B76A 3AE2A 4GR1A 3K30A 5DBJA 4YXDA 4NTCA 3F8RA 1D4CA 5FS7A 3COXA 4EMWA 2VQ7A 1ZMDA 2C7GA 3QSSA 3NK0X 3RP8A 3UKFA 4AP1A 4A79A 3T14A 4H4PA 3SZ0A 2V60A 2GF3A 3KPKA 4WX1A 3CNDA 1H83A 2X8GA 3CNPA 2WOWA 5HXIA 3R9UA 3GD4A 1KSUA 4GDPA 4FDCB 1H84A 1PN0A 2XLPA 1PJ5A 3AD9B 3P9UA 2GQFA 2ACZA 4D04A 1GRGA 4WCTA 3O0HA 2XLSA 2YG7A 2IVEA 4YTPA 2WU2A 1DNCA 4K8DA 2RGJA 2WP6A 4ZN0A 5JCMA 1ZOVA 3OC4A 3QFAA 2XFQA 4NEWA 5KMRA 2JKCA 1KSSA 1CJ4A 3DMEA 2W0HA 1H7XA 4O5QA 4EM3A 2C76A 2FJEA 3GMCA 1K4QA 4JNAA 2XVJA 3CGEA 4J36A 3AYJA 1FL2A 4UDPA 4B64A 3QSEA 4H4SA 1DOEA 1H86A 1B37A 4EM4A 1TDKA 3NLCA 3AYLA 4U8LA 2HQMA 3T2YA 5U63A 1HYUA 1IUWA 1SEZA 2APGA 2RGHA 3CNSA 2C65A 2I0ZA 2AAQA 1QLBA 1M64A 1TDOA 3T2KA 1PXAA 1NHSA 3II4A 1GEUA 2YG3A 3CGCA 4CNJA 1E1MA 4U2LA 1YY5A 4Y4LA 1GV4A 1DOCA 2B9WA 2R0GA 2WP9A 3T31A 3C4AA 4AOXA 1NDAA 4NZHA 4ZCCA 2YVGA 1UKVG 2VOUA 5KNLA 2Z5XA 2BA9A 2YR6A 3QJ4A 1ZOYA 4CY8A 2H88A 3SZWA 5HYMA 4ZCDA 3CIRA 2GEWA 1OJTA 1E1LA 2V61A 4G9KA 3GRTA 1KFYA 1LVLA 4Z2TA 1YQ3A 2WBAA 1LPFA 2XFNA 3Q9TA 4Y4MA 1IUXA 5EOWA 4CRTA 2TMDA 3S61A 4AOSA 4IV9A 3KA7A 5ER0A 1F3PA 2OLNA 2WOIA 4K2XA 4HB9A 1PDHA 3UP5A 3GSIA 4GUVA 4UDQA 3VQRA 4C5OA 3KVEA 1TDNA 4PABA 1GTEA 4M52A 3UKLA 1LTXR 2YLWA 4EMIA 2WOVA 3NH3X 4CNKA 2BACA 3NYEA 4J33A 4A5LA 4B63A 2QCUA 1B4VA 2BS2A 1O5WA 4K5SA 5TR3A 1NPXA 2B9YA 2Q0LA 5CQFA 2R0PA 3DA1A 3CNJA 2R46A 4YSZA 3CPIG 2V3BA 3DK9A 4N9XA 5L46A 4I59A 3SFEA 2WPCA 2BXRA 2TPRA 2IIDA 4U8MA 4J31A 3PVCA 4YKFA 1VRQB 5LV9A 2QA2A 2RGOA 1O95A 4A6NA 3SXIA 2YVFA 3G5QA 2R4EA 1XDIA 2A87A 2YLTA 3FG2P 3URHA 4ICYA 2VVMA 2FBWA 4B67A 3GDPA 5KWFA 3SFDA 3F8DA 1VG9A 4BV6A 4K22A 1GRHA 1Q1WA 1EL5A 4RG3A 1KF6A 3AEAA 3K7MX 4YKGA 2ZBWA 1S3EA 2Y6QA 1S2QA 2B7SA 4TLZA 3SM8A 4Z2UA 1K0JA 1Q9IA 5CKUA 4FK1C 3ALLA 1PJ6A 1YKJA 2BS4A 1PHHA 4K5RA 4XXGA 4ECHA 1DODA 3RNMA 4NTDA 2F5ZA 2EQ6A 5JCNA 2YG4A 2YM1A 4U8OA 1W4XA 1KNPA 2ARDA 4Z26A 1LJ1A 3ICTA 1P2EA 5HHFA 3B3RA 3JSKA 1Q1RA 1ZMCA 4GF7A 2O9ZA 4OPGA 2R4JA 3LZXA 3NIXA 4H2NA 3HYVA 1E7PA 2NVKX 3OZ2A 3T37A 4BK3A 5BVAA 2YLXA 2C67A 1NENA 3DJEA 1F6MA 4GCMA 3LB8A 1TYTA 1L9DA 3SZFA 2CFYA 1NG3A 3NGCX 2H89A 1JNRA 2WEUA 3DH9A 2GMHA 2OAMA 2BXSA 3GWDA 3VRAA 4NTEA 3IHGA 2YWLA 3BNMA 2PYXA 5KMPA 4YSXA 2X3NA 1PXCA 4TM4A 4H4UA 2Q6UA 4USQA 3ZDNA 4BK1A 2EQ7A 5KRQA 1B8SA 3NYFA 5BRTA 4TLXA 2WDRA 2C75A 4U2TA 3UOZA 3V3NA 4OCGA 2X8CA 2XVFA 3M13A 1GPEA 4Z43A 3BHFA 2BABA 3AB1A 1ZX9A 3NNEA 5M10A 3EANA 1E39A 3ALJA 4Z25A 1O94A 1Y56A 3PO7A 2WQYA 2VQBA 4J57A 3BHKA 3Q6JA 3AD7B 3SQPA 2GVCA 4CCQA 4U8PA 1K0IA 3GRSA 1CJ2A 4II3A 2Q0KA 4YSHA 1ZP0A 1BZLA 3L8KA 5J7XA 2CVJA 1V59A 3G5SA 2NPXA 3CPJG 3GMBA 2YLSA 4A7AA 1JRYA 4BK2A 2GAGB 1L0VA 4H2PA 4J2WA 2C73A 1ONFA 3IHMA 3GYIA 1IUUA 3H8IA 2C3DA 4C74A 3CPHG 4XWRA 1QO8A 2BCGG 1JEHA 1DJNA 1FEAA 2BC0A 2E5VA 4H4VA 4AT0A 1IUVA 3QVRA 4JN9A 1AOGA 3UOXA 4J34A 4DSGA 2VVLA 3BI5A 4G6HA 1OJCA 4RG4A 3T2ZA 2BK4A 5GRTA 3DK4A 5EB4A 3H4KA 3LJPA 5JCKA 3AE7A 4OPIA 4H4WA 1GREA 3HZLA 4U2SA 1CJ3A 1LQTA 2GH5A 5M0ZA 3GWFA 1GSNA 1E6EA 5KMQA 3B6DA 4EQXA 2BC1A 1TDEA 2AR8A 4G74A 2YLZA 2BK3A 1PJ7A 1ZKQA 2RABA 3ITJA 3LXDA 1BWCA 3CNTA 4J56A 3BI4A 2WPEA 2A8XA 2GB0A 3UTGA 4B66A 1IUSA 1E1NA 1ELIA 3AEEA 2B9XA 1CF3A 3CGDA 4XWZA 3UTEA 3SY4A 5EB5A 2VVLG 1L9CA 2GR2A 1LV0A 4I58A 4A6NB 4GDEA 4B68A 4GAVA 4JDRA 1JNZA 4A65A 2OA1A 1FECA 4H4TA 3RP6A 2BRAA 2YR4A 1DXLA 4OPCA 1PBDA 2VZ2A 3UOVA 1B5QA 3QFBA 3EPTA 2OALA 1IJHA 1GESA 3T0KA 1GTHA 2V6OA 2Y6RA 1S2YA 2C3CA 4EQWA 3BNUA 4OPTA 1GNDA 1N1PA 5J60A 3DGHA 2JB2A 2AQJA 2J3NA 2XFUA 4LA1A 4EQSA 3UOYA 4IVMB 2WS3A 1D4DA 1PBBA 1NAAA 1EBDA 2YG6A 1BGNA 1VDCA 3ADAB 4DGKA 3AEGA 2XDOA 2YQUA 3KPFA 3ATQA 4BJZA 5KMSA 3QVPA 4CBQA 2EQ8A 1F8RA 2VRLA 2GQWA 3AXBA 2YAUA 2EQ9A 4BURA 4CCRA 2XYOA 1OJ9A 1H6VA 2BRYA 3VRBA 2PHHA 3K7QX 4A99A 1KDGA 3AEBA 1NHPA 4HA6A 4Z44A 3EF6A 1EL9A 3FBSA 4TM0A 2B7RA 4REKA 3UKKA 3G5RA 1BF3A 1NG4A 3FMWA 2ZZBA 1CHUA 1QJDA 3CTYA 1CC2A 2GR3A 4NWZA 1P2HA 1H82A 3NTDA 3AECA 1M6IA 5KXJA 1K0LA 3VR8A 5FS8A 4YT0A 3UCLA 2X99A 4BJYA 1E1KA 5KOXA 5IQ4A 1TDFA 3UKQA 3L1RA 2YLRA 1N4UA 3UKPA 3AE6A 5JCIA 1N4VA 3FIMB 3NK1X 4OVIA 4U8JA 4FX9A 2Q7VA 3GD3A 1CBOA 4H4ZA 1BGJA 4Z2RA 3UTFA 2Z5YA 3RP7A 4YTNA 3ICRA 1Y56B 2IVDA 3IWAA 3D8XA 5FS9A 3DJJA 2YM2A 3HYWA 4X9MA 1CC4A 5KVIA 3WE0A 4AT2A 2WHDA 4H4XA 3NN6X 3CN8A 3V76A 3P1WA 4H7UA 3GYJA 4OPUA 4ADWA 2CDUA 5U1OA 4B65A 3AE5A 3ALMA 3C96A 3AEDA 3P4QA 1N4WA 2FJBA 1PS9A 3DJDA 1GRBA 2FJDA 2WU5A 3VRDB 2C70A 3SZCA 2XLTA 1D7LA 4U8IA 4LIIA 1H81A 2BYBA 3ABVA 3SYIA 4USRA 4RSLA 3VR9A 4E0VA 4GRTA 3V3OA 3H8LA 2R0CA 3I6DA 4U8KA 2VRMA 3EAOA 1OJAA 4EMJA 1MXTA 2GMJA 2XCGA 1F8SA 2XLRA 3UKAA 3S5WA 1DOBA 1EL7A 4YSYA 5JCLA 3D1CA 3P4RA 4UP3A 5C2TA 4UDRA 5BUKA 2YR5A 2A89A 3E1TA 1ZK7A 4U8NA 4MJWA 1BKWA 2BCPA 3GDNA 4KX6A 1CJCA 4AP3A 2E1MA 2WDQA 3NT6A 4Z24A 1MO9A 3ICSA 3NKSA 4C77A 3ZYXA 4APNA 3CGBA 2WETA 4TM1A 1TRBA 4G73A 4JY3A 2C72A 3KD9A 3HYXA 3KKJA 2XLUA 3K7TA 3NYCA 1GALA 4DNAA 1YQZA 3KU9A 3IF9A 3NTAA 3UP4A 4TM3A 2ZZ0A 4CY6A 3AYIA 3C4NA 1NHRA 1GRAA 1CC6A 1GXFA 1TYPA 1H7WA 1VQWA 1COYA 4IA5A 3LADA 3NK2X 1VG0A 5IQ1A 2FJAA 3SX6A 3QSMA 2GV8A 4X4JA 1JRXA 5FMHA 3RHAA 5C3JA 1D7YA 2GRTA 2DKIA 4KPRA 3REDA 4H4YA 3SGLA 2XVHA 1Z6LA 1XPQA 4II2A 4IA6A 1GETA 1GOSA 2JK6A 2GR1A 1ZDLA 4G6GA 2C66A 3ISHA 1XANA 1D4EA 4K7ZA 4B1BA 2V5ZA 3BI2A 3M0OA 4LU6A 2XFPA 1JU2A 4JY2A 4OPLA 3AE8A 3UTHA 4B69A 1JOAA 2X8HA 4DSHA 4C3YA 5GSNA 3NG7X 4H2RA 4EQRA 5U25A 1PBFA 3P4PA 1JRZA 4NEVA 3NN0X 2X50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA1 A;  4Y4N A;  5BUL A;  1MOK A;  2JAE A;  2JB3 A;  4H4R A;  3AE4 A;  3DJG X;  1CL0 A;  1XHC A;  1IUT A;  4EIP A;  5FS6 A;  1OJD A;  2DKH A;  2R9Z A;  3AE3 A;  1F8W A;  3AD8 B;  1RYI A;  1GRT A;  3DK8 A;  3DGZ A;  3IC9 A;  5EBK A;  3AE1 A;  4PAA A;  1GT8 A;  3AE9 A;  4JQ9 A;  2XFO A;  2GR0 A;  2UZZ A;  1FOH A;  2WDV A;  1KNR A;  1RP0 A;  5KOW A;  4P9S A;  2OLO A;  2XVI A;  3LOV A;  1FEB A;  2YG5 A;  4YWO A;  4D03 A;  1FCD A;  1EL8 A;  4C3X A;  1RSG A;  2CUL A;  1NHQ A;  4H50 A;  2WP5 A;  1Y0P A;  3AEF A;  4FK1 A;  1L9E A;  1LQU A;  2QAE A;  3LZW A;  3KLJ A;  5KVH A;  3NHO X;  1YQ4 A;  2E4G A;  3FPZ A;  1GRF A;  1NEK A;  2C64 A;  1S3B A;  1GER A;  2ZZC A;  3NRN A;  4IVO B;  4JNQ A;  2WES A;  4X9N A;  4H4Q A;  1ZY8 A;  5IPY A;  1X31 B;  5HY5 A;  4YTM A;  2BS3 A;  2R45 A;  2XVE A;  3AWI A;  3M12 A;  3F8P A;  3PS9 A;  2V3A A;  1D5T A;  2JBV A;  2BK5 A;  1PBE A;  1PXB A;  2WPF A;  3ATR A;  4O5U A;  3I3L A;  1PBC A;  4H2Q A;  4OPD A;  3UKH A;  4A9W A;  4EIQ A;  2GAH B;  1REO A;  3P4S A;  2YVJ A;  1DJQ A;  2JB1 A;  2B76 A;  3AE2 A;  4GR1 A;  3K30 A;  5DBJ A;  4YXD A;  4NTC A;  3F8R A;  1D4C A;  5FS7 A;  3COX A;  4EMW A;  2VQ7 A;  1ZMD A;  2C7G A;  3QSS A;  3NK0 X;  3RP8 A;  3UKF A;  4AP1 A;  4A79 A;  4H4P A;  2V60 A;  2GF3 A;  4WX1 A;  3CND A;  1H83 A;  2X8G A;  3CNP A;  2WOW A;  5HXI A;  3R9U A;  3GD4 A;  1KSU A;  4GDP A;  4FDC B;  1H84 A;  1PN0 A;  2XLP A;  1PJ5 A;  3AD9 B;  3P9U A;  2GQF A;  2ACZ A;  4D04 A;  1GRG A;  4WCT A;  3O0H A;  2XLS A;  2YG7 A;  2IVE A;  4YTP A;  2WU2 A;  1DNC A;  4K8D A;  2RGJ A;  2WP6 A;  4ZN0 A;  5JCM A;  1ZOV A;  3OC4 A;  3QFA A;  2XFQ A;  4NEW A;  2JKC A;  1KSS A;  1CJ4 A;  3DME A;  2W0H A;  1H7X A;  4O5Q A;  4EM3 A;  2C76 A;  2FJE A;  3GMC A;  1K4Q A;  4JNA A;  2XVJ A;  3CGE A;  4J36 A;  3AYJ A;  1FL2 A;  4UDP A;  4B64 A;  3QSE A;  4H4S A;  1DOE A;  1H86 A;  1B37 A;  4EM4 A;  1TDK A;  3NLC A;  3AYL A;  4U8L A;  2HQM A;  5U63 A;  1HYU A;  1IUW A;  1SEZ A;  2APG A;  2RGH A;  3CNS A;  2C65 A;  2I0Z A;  2AAQ A;  1QLB A;  1M64 A;  1TDO A;  1PXA A;  1NHS A;  3II4 A;  1GEU A;  2YG3 A;  3CGC A;  4CNJ A;  1E1M A;  4U2L A;  1YY5 A;  4Y4L A;  1GV4 A;  1DOC A;  2B9W A;  2R0G A;  2WP9 A;  3C4A A;  4AOX A;  1NDA A;  4NZH A;  4ZCC A;  2YVG A;  1UKV G;  2VOU A;  2Z5X A;  2BA9 A;  2YR6 A;  3QJ4 A;  1ZOY A;  4CY8 A;  2H88 A;  5HYM A;  4ZCD A;  3CIR A;  2GEW A;  1OJT A;  1E1L A;  2V61 A;  3GRT A;  1KFY A;  1LVL A;  4Z2T A;  1YQ3 A;  2WBA A;  1LPF A;  2XFN A;  3Q9T A;  4Y4M A;  1IUX A;  5EOW A;  4CRT A;  2TMD A;  3S61 A;  4AOS A;  4IV9 A;  3KA7 A;  5ER0 A;  1F3P A;  2OLN A;  2WOI A;  4K2X A;  4HB9 A;  1PDH A;  3UP5 A;  3GSI A;  4GUV A;  4UDQ A;  3VQR A;  4C5O A;  3KVE A;  1TDN A;  4PAB A;  1GTE A;  4M52 A;  3UKL A;  1LTX R;  2YLW A;  4EMI A;  2WOV A;  3NH3 X;  4CNK A;  2BAC A;  3NYE A;  4J33 A;  4A5L A;  4B63 A;  2QCU A;  1B4V A;  2BS2 A;  1O5W A;  4K5S A;  5TR3 A;  1NPX A;  2B9Y A;  2Q0L A;  5CQF A;  2R0P A;  3DA1 A;  3CNJ A;  2R46 A;  4YSZ A;  3CPI G;  2V3B A;  3DK9 A;  4N9X A;  5L46 A;  4I59 A;  3SFE A;  2WPC A;  2BXR A;  2TPR A;  2IID A;  4U8M A;  4J31 A;  3PVC A;  4YKF A;  1VRQ B;  5LV9 A;  2QA2 A;  2RGO A;  1O95 A;  4A6N A;  2YVF A;  3G5Q A;  2R4E A;  1XDI A;  2A87 A;  2YLT A;  3FG2 P;  3URH A;  4ICY A;  2VVM A;  2FBW A;  4B67 A;  3GDP A;  5KWF A;  3SFD A;  3F8D A;  1VG9 A;  4BV6 A;  4K22 A;  1GRH A;  1Q1W A;  1EL5 A;  4RG3 A;  1KF6 A;  3AEA A;  3K7M X;  4YKG A;  2ZBW A;  1S3E A;  2Y6Q A;  1S2Q A;  2B7S A;  4TLZ A;  3SM8 A;  4Z2U A;  1K0J A;  1Q9I A;  5CKU A;  4FK1 C;  3ALL A;  1PJ6 A;  1YKJ A;  2BS4 A;  1PHH A;  4K5R A;  4XXG A;  4ECH A;  1DOD A;  3RNM A;  4NTD A;  2F5Z A;  2EQ6 A;  5JCN A;  2YG4 A;  2YM1 A;  4U8O A;  1W4X A;  1KNP A;  2ARD A;  4Z26 A;  1LJ1 A;  3ICT A;  1P2E A;  5HHF A;  3B3R A;  3JSK A;  1Q1R A;  1ZMC A;  4GF7 A;  2O9Z A;  4OPG A;  2R4J A;  3LZX A;  3NIX A;  4H2N A;  1E7P A;  2NVK X;  3OZ2 A;  3T37 A;  4BK3 A;  5BVA A;  2YLX A;  2C67 A;  1NEN A;  3DJE A;  1F6M A;  4GCM A;  3LB8 A;  1TYT A;  1L9D A;  2CFY A;  1NG3 A;  3NGC X;  2H89 A;  1JNR A;  2WEU A;  3DH9 A;  2GMH A;  2OAM A;  2BXS A;  3GWD A;  3VRA A;  4NTE A;  3IHG A;  2YWL A;  3BNM A;  2PYX A;  4YSX A;  2X3N A;  1PXC A;  4TM4 A;  4H4U A;  2Q6U A;  4USQ A;  3ZDN A;  4BK1 A;  2EQ7 A;  5KRQ A;  1B8S A;  3NYF A;  5BRT A;  4TLX A;  2WDR A;  2C75 A;  4U2T A;  3UOZ A;  3V3N A;  4OCG A;  2X8C A;  2XVF A;  3M13 A;  1GPE A;  4Z43 A;  3BHF A;  2BAB A;  3AB1 A;  1ZX9 A;  3NNE A;  5M10 A;  3EAN A;  1E39 A;  3ALJ A;  4Z25 A;  1O94 A;  1Y56 A;  3PO7 A;  2WQY A;  2VQB A;  4J57 A;  3BHK A;  3Q6J A;  3AD7 B;  3SQP A;  2GVC A;  4CCQ A;  4U8P A;  1K0I A;  3GRS A;  1CJ2 A;  2Q0K A;  4YSH A;  1ZP0 A;  1BZL A;  3L8K A;  5J7X A;  2CVJ A;  1V59 A;  3G5S A;  2NPX A;  3CPJ G;  3GMB A;  2YLS A;  4A7A A;  1JRY A;  4BK2 A;  2GAG B;  1L0V A;  4H2P A;  4J2W A;  2C73 A;  1ONF A;  3IHM A;  3GYI A;  1IUU A;  3H8I A;  2C3D A;  4C74 A;  3CPH G;  4XWR A;  1QO8 A;  2BCG G;  1JEH A;  1DJN A;  1FEA A;  2BC0 A;  2E5V A;  4H4V A;  4AT0 A;  1IUV A;  3QVR A;  4JN9 A;  1AOG A;  3UOX A;  4J34 A;  4DSG A;  2VVL A;  3BI5 A;  1OJC A;  4RG4 A;  2BK4 A;  5GRT A;  3DK4 A;  5EB4 A;  3H4K A;  3LJP A;  5JCK A;  3AE7 A;  4OPI A;  4H4W A;  1GRE A;  3HZL A;  4U2S A;  1CJ3 A;  1LQT A;  2GH5 A;  5M0Z A;  3GWF A;  1GSN A;  1E6E A;  3B6D A;  4EQX A;  2BC1 A;  1TDE A;  2AR8 A;  2YLZ A;  2BK3 A;  1PJ7 A;  1ZKQ A;  2RAB A;  3ITJ A;  3LXD A;  1BWC A;  3CNT A;  4J56 A;  3BI4 A;  2WPE A;  2A8X A;  2GB0 A;  3UTG A;  4B66 A;  1IUS A;  1E1N A;  1ELI A;  3AEE A;  2B9X A;  1CF3 A;  3CGD A;  4XWZ A;  3UTE A;  5EB5 A;  2VVL G;  1L9C A;  2GR2 A;  1LV0 A;  4I58 A;  4A6N B;  4GDE A;  4B68 A;  4JDR A;  1JNZ A;  4A65 A;  2OA1 A;  1FEC A;  4H4T A;  3RP6 A;  2YR4 A;  1DXL A;  4OPC A;  1PBD A;  2VZ2 A;  3UOV A;  1B5Q A;  3QFB A;  3EPT A;  2OAL A;  1IJH A;  1GES A;  1GTH A;  2V6O A;  2Y6R A;  1S2Y A;  2C3C A;  4EQW A;  3BNU A;  4OPT A;  1GND A;  1N1P A;  5J60 A;  3DGH A;  2JB2 A;  2AQJ A;  2J3N A;  2XFU A;  4LA1 A;  4EQS A;  3UOY A;  4IVM B;  2WS3 A;  1D4D A;  1PBB A;  1NAA A;  1EBD A;  2YG6 A;  1BGN A;  1VDC A;  3ADA B;  4DGK A;  3AEG A;  2XDO A;  2YQU A;  3KPF A;  3ATQ A;  4BJZ A;  3QVP A;  4CBQ A;  2EQ8 A;  1F8R A;  2VRL A;  2GQW A;  3AXB A;  2YAU A;  2EQ9 A;  4BUR A;  4CCR A;  2XYO A;  1OJ9 A;  1H6V A;  3VRB A;  4A99 A;  2PHH A;  3K7Q X;  1KDG A;  3AEB A;  1NHP A;  4HA6 A;  4Z44 A;  3EF6 A;  1EL9 A;  3FBS A;  4TM0 A;  2B7R A;  4REK A;  3UKK A;  3G5R A;  1BF3 A;  1NG4 A;  3FMW A;  2ZZB A;  1CHU A;  1QJD A;  3CTY A;  1CC2 A;  2GR3 A;  1P2H A;  1H82 A;  3NTD A;  3AEC A;  1M6I A;  5KXJ A;  1K0L A;  3VR8 A;  5FS8 A;  4YT0 A;  3UCL A;  2X99 A;  4BJY A;  1E1K A;  5KOX A;  5IQ4 A;  1TDF A;  3UKQ A;  3L1R A;  2YLR A;  1N4U A;  3UKP A;  3AE6 A;  5JCI A;  1N4V A;  3FIM B;  3NK1 X;  4OVI A;  4U8J A;  4FX9 A;  2Q7V A;  3GD3 A;  1CBO A;  4H4Z A;  1BGJ A;  4Z2R A;  3UTF A;  2Z5Y A;  3RP7 A;  4YTN A;  3ICR A;  1Y56 B;  2IVD A;  3IWA A;  3D8X A;  5FS9 A;  3DJJ A;  2YM2 A;  4X9M A;  1CC4 A;  5KVI A;  3WE0 A;  4AT2 A;  2WHD A;  4H4X A;  3NN6 X;  3CN8 A;  3V76 A;  3P1W A;  4H7U A;  3GYJ A;  4OPU A;  4ADW A;  2CDU A;  5U1O A;  4B65 A;  3AE5 A;  3ALM A;  3C96 A;  3AED A;  3P4Q A;  1N4W A;  2FJB A;  1PS9 A;  3DJD A;  1GRB A;  2FJD A;  2WU5 A;  3VRD B;  2C70 A;  2XLT A;  1D7L A;  4U8I A;  4LII A;  1H81 A;  2BYB A;  3ABV A;  3VR9 A;  4USR A;  4RSL A;  4E0V A;  4GRT A;  3V3O A;  3H8L A;  2R0C A;  3I6D A;  4U8K A;  2VRM A;  3EAO A;  1OJA A;  4EMJ A;  1MXT A;  2GMJ A;  2XCG A;  1F8S A;  2XLR A;  3UKA A;  3S5W A;  1DOB A;  1EL7 A;  4YSY A;  5JCL A;  3D1C A;  3P4R A;  4UP3 A;  5C2T A;  4UDR A;  5BUK A;  2YR5 A;  2A89 A;  3E1T A;  1ZK7 A;  4U8N A;  4MJW A;  1BKW A;  2BCP A;  3GDN A;  4KX6 A;  1CJC A;  4AP3 A;  2E1M A;  2WDQ A;  3NT6 A;  4Z24 A;  1MO9 A;  3ICS A;  3NKS A;  4C77 A;  3ZYX A;  4APN A;  3CGB A;  2WET A;  4TM1 A;  1TRB A;  4JY3 A;  2C72 A;  3KD9 A;  3KKJ A;  2XLU A;  3K7T A;  3NYC A;  1GAL A;  4DNA A;  1YQZ A;  3KU9 A;  3IF9 A;  3NTA A;  3UP4 A;  4TM3 A;  2ZZ0 A;  4CY6 A;  3AYI A;  3C4N A;  1NHR A;  1GRA A;  1CC6 A;  1GXF A;  1TYP A;  1H7W A;  1VQW A;  1COY A;  4IA5 A;  3LAD A;  3NK2 X;  1VG0 A;  5IQ1 A;  2FJA A;  3QSM A;  2GV8 A;  4X4J A;  1JRX A;  5FMH A;  3RHA A;  5C3J A;  1D7Y A;  2GRT A;  2DKI A;  4KPR A;  3RED A;  4H4Y A;  3SGL A;  2XVH A;  1Z6L A;  1XPQ A;  4IA6 A;  1GET A;  1GOS A;  2JK6 A;  2GR1 A;  1ZDL A;  2C66 A;  3ISH A;  1XAN A;  1D4E A;  4K7Z A;  4B1B A;  2V5Z A;  3BI2 A;  3M0O A;  4LU6 A;  2XFP A;  1JU2 A;  4JY2 A;  4OPL A;  3AE8 A;  3UTH A;  4B69 A;  1JOA A;  2X8H A;  4DSH A;  4C3Y A;  5GSN A;  3NG7 X;  4H2R A;  4EQR A;  5U25 A;  1PBF A;  3P4P A;  1JRZ A;  4NEV A;  3NN0 X;  2X50 A; 
#chains in the Genus database with same CATH topology
 2QA1 A;  4Y4N A;  5BUL A;  1MOK A;  2JAE A;  2JB3 A;  4H4R A;  3AE4 A;  3DJG X;  1CL0 A;  1XHC A;  1IUT A;  4EIP A;  5FS6 A;  1OJD A;  2DKH A;  2R9Z A;  3AE3 A;  1F8W A;  3AD8 B;  1RYI A;  1GRT A;  3DK8 A;  3DGZ A;  3IC9 A;  5EBK A;  3AE1 A;  4PAA A;  1GT8 A;  3AE9 A;  4JQ9 A;  2XFO A;  2GR0 A;  2UZZ A;  1FOH A;  2WDV A;  1KNR A;  1RP0 A;  3GYX A;  5KOW A;  4P9S A;  2OLO A;  2XVI A;  3LOV A;  1FEB A;  2YG5 A;  4YWO A;  4D03 A;  1FCD A;  4NNJ A;  1EL8 A;  4C3X A;  1RSG A;  2CUL A;  1NHQ A;  4H50 A;  2WP5 A;  1Y0P A;  3CMM A;  3AEF A;  4FK1 A;  1L9E A;  1LQU A;  2QAE A;  3LZW A;  2C4C A;  3KLJ A;  5KVH A;  3NHO X;  1YQ4 A;  2E4G A;  3FPZ A;  1GRF A;  1NEK A;  2C64 A;  1S3B A;  1GER A;  2ZZC A;  3NRN A;  4IVO B;  4JNQ A;  2WES A;  4X9N A;  4H4Q A;  1ZY8 A;  5IPY A;  1X31 B;  5HY5 A;  4YTM A;  2BS3 A;  2R45 A;  2XVE A;  3AWI A;  3M12 A;  3F8P A;  3PS9 A;  2V3A A;  1D5T A;  2JBV A;  4GAP A;  2BK5 A;  1PBE A;  1PXB A;  2WPF A;  3ATR A;  4O5U A;  3I3L A;  1PBC A;  4H2Q A;  4OPD A;  3UKH A;  4A9W A;  4EIQ A;  2GAH B;  1REO A;  3P4S A;  2YVJ A;  1DJQ A;  2JB1 A;  2B76 A;  3AE2 A;  4GR1 A;  3K30 A;  5DBJ A;  4YXD A;  4NTC A;  3F8R A;  1D4C A;  5FS7 A;  3COX A;  4EMW A;  2VQ7 A;  1ZMD A;  2C7G A;  3QSS A;  3NK0 X;  3RP8 A;  3UKF A;  4AP1 A;  4A79 A;  3T14 A;  4H4P A;  3SZ0 A;  2V60 A;  2GF3 A;  3KPK A;  4WX1 A;  3CND A;  1H83 A;  2X8G A;  3CNP A;  2WOW A;  5HXI A;  3R9U A;  3GD4 A;  1KSU A;  4GDP A;  4FDC B;  1H84 A;  1PN0 A;  2XLP A;  1PJ5 A;  3AD9 B;  3P9U A;  2GQF A;  2ACZ A;  4D04 A;  1GRG A;  4WCT A;  3O0H A;  2XLS A;  2YG7 A;  2IVE A;  4YTP A;  2WU2 A;  1DNC A;  4K8D A;  2RGJ A;  2WP6 A;  4ZN0 A;  5JCM A;  1ZOV A;  3OC4 A;  3QFA A;  2XFQ A;  4NEW A;  5KMR A;  2JKC A;  1KSS A;  1CJ4 A;  3DME A;  2W0H A;  1H7X A;  4O5Q A;  4EM3 A;  2C76 A;  2FJE A;  3GMC A;  1K4Q A;  4JNA A;  2XVJ A;  3CGE A;  4J36 A;  3AYJ A;  1FL2 A;  4UDP A;  4B64 A;  3QSE A;  4H4S A;  1DOE A;  1H86 A;  1B37 A;  4EM4 A;  1TDK A;  3NLC A;  3AYL A;  4U8L A;  2HQM A;  3T2Y A;  5U63 A;  1HYU A;  1IUW A;  1SEZ A;  2APG A;  2RGH A;  3CNS A;  2C65 A;  2I0Z A;  2AAQ A;  1QLB A;  1M64 A;  1TDO A;  3T2K A;  1PXA A;  1NHS A;  3II4 A;  1GEU A;  2YG3 A;  3CGC A;  4CNJ A;  1E1M A;  4U2L A;  1YY5 A;  4Y4L A;  1GV4 A;  1DOC A;  2B9W A;  2R0G A;  2WP9 A;  3T31 A;  3C4A A;  4AOX A;  1NDA A;  4NZH A;  4ZCC A;  2YVG A;  1UKV G;  2VOU A;  5KNL A;  2Z5X A;  2BA9 A;  2YR6 A;  3QJ4 A;  1ZOY A;  4CY8 A;  2H88 A;  3SZW A;  5HYM A;  4ZCD A;  3CIR A;  2GEW A;  1OJT A;  1E1L A;  2V61 A;  4G9K A;  3GRT A;  1KFY A;  1LVL A;  4Z2T A;  1YQ3 A;  2WBA A;  1LPF A;  2XFN A;  3Q9T A;  4Y4M A;  1IUX A;  5EOW A;  4CRT A;  2TMD A;  3S61 A;  4AOS A;  4IV9 A;  3KA7 A;  5ER0 A;  1F3P A;  2OLN A;  2WOI A;  4K2X A;  4HB9 A;  1PDH A;  3UP5 A;  3GSI A;  4GUV A;  4UDQ A;  3VQR A;  4C5O A;  3KVE A;  1TDN A;  4PAB A;  1GTE A;  4M52 A;  3UKL A;  1LTX R;  2YLW A;  4EMI A;  2WOV A;  3NH3 X;  4CNK A;  2BAC A;  3NYE A;  4J33 A;  4A5L A;  4B63 A;  2QCU A;  1B4V A;  2BS2 A;  1O5W A;  4K5S A;  5TR3 A;  1NPX A;  2B9Y A;  2Q0L A;  5CQF A;  2R0P A;  3DA1 A;  3CNJ A;  2R46 A;  4YSZ A;  3CPI G;  2V3B A;  3DK9 A;  4N9X A;  5L46 A;  4I59 A;  3SFE A;  2WPC A;  2BXR A;  2TPR A;  2IID A;  4U8M A;  4J31 A;  3PVC A;  4YKF A;  1VRQ B;  5LV9 A;  2QA2 A;  2RGO A;  1O95 A;  4A6N A;  3SXI A;  2YVF A;  3G5Q A;  2R4E A;  1XDI A;  2A87 A;  2YLT A;  3FG2 P;  3URH A;  4ICY A;  2VVM A;  2FBW A;  4B67 A;  3GDP A;  5KWF A;  3SFD A;  3F8D A;  1VG9 A;  4BV6 A;  4K22 A;  1GRH A;  1Q1W A;  1EL5 A;  4RG3 A;  1KF6 A;  3AEA A;  3K7M X;  4YKG A;  2ZBW A;  1S3E A;  2Y6Q A;  1S2Q A;  2B7S A;  4TLZ A;  3SM8 A;  4Z2U A;  1K0J A;  1Q9I A;  5CKU A;  4FK1 C;  3ALL A;  1PJ6 A;  1YKJ A;  2BS4 A;  1PHH A;  4K5R A;  4XXG A;  4ECH A;  1DOD A;  3RNM A;  4NTD A;  2F5Z A;  2EQ6 A;  5JCN A;  2YG4 A;  2YM1 A;  4U8O A;  1W4X A;  1KNP A;  2ARD A;  4Z26 A;  1LJ1 A;  3ICT A;  1P2E A;  5HHF A;  3B3R A;  3JSK A;  1Q1R A;  1ZMC A;  4GF7 A;  2O9Z A;  4OPG A;  2R4J A;  3LZX A;  3NIX A;  4H2N A;  3HYV A;  1E7P A;  2NVK X;  3OZ2 A;  3T37 A;  4BK3 A;  5BVA A;  2YLX A;  2C67 A;  1NEN A;  3DJE A;  1F6M A;  4GCM A;  3LB8 A;  1TYT A;  1L9D A;  3SZF A;  2CFY A;  1NG3 A;  3NGC X;  2H89 A;  1JNR A;  2WEU A;  3DH9 A;  2GMH A;  2OAM A;  2BXS A;  3GWD A;  3VRA A;  4NTE A;  3IHG A;  2YWL A;  3BNM A;  2PYX A;  5KMP A;  4YSX A;  2X3N A;  1PXC A;  4TM4 A;  4H4U A;  2Q6U A;  4USQ A;  3ZDN A;  4BK1 A;  2EQ7 A;  5KRQ A;  1B8S A;  3NYF A;  5BRT A;  4TLX A;  2WDR A;  2C75 A;  4U2T A;  3UOZ A;  3V3N A;  4OCG A;  2X8C A;  2XVF A;  3M13 A;  1GPE A;  4Z43 A;  3BHF A;  2BAB A;  3AB1 A;  1ZX9 A;  3NNE A;  5M10 A;  3EAN A;  1E39 A;  3ALJ A;  4Z25 A;  1O94 A;  1Y56 A;  3PO7 A;  2WQY A;  2VQB A;  4J57 A;  3BHK A;  3Q6J A;  3AD7 B;  3SQP A;  2GVC A;  4CCQ A;  4U8P A;  1K0I A;  3GRS A;  1CJ2 A;  4II3 A;  2Q0K A;  4YSH A;  1ZP0 A;  1BZL A;  3L8K A;  5J7X A;  2CVJ A;  1V59 A;  3G5S A;  2NPX A;  3CPJ G;  3GMB A;  2YLS A;  4A7A A;  1JRY A;  4BK2 A;  2GAG B;  1L0V A;  4H2P A;  4J2W A;  2C73 A;  1ONF A;  3IHM A;  3GYI A;  1IUU A;  3H8I A;  2C3D A;  4C74 A;  3CPH G;  4XWR A;  1QO8 A;  2BCG G;  1JEH A;  1DJN A;  1FEA A;  2BC0 A;  2E5V A;  4H4V A;  4AT0 A;  1IUV A;  3QVR A;  4JN9 A;  1AOG A;  3UOX A;  4J34 A;  4DSG A;  2VVL A;  3BI5 A;  4G6H A;  1OJC A;  4RG4 A;  3T2Z A;  2BK4 A;  5GRT A;  3DK4 A;  5EB4 A;  3H4K A;  3LJP A;  5JCK A;  3AE7 A;  4OPI A;  4H4W A;  1GRE A;  3HZL A;  4U2S A;  1CJ3 A;  1LQT A;  2GH5 A;  5M0Z A;  3GWF A;  1GSN A;  1E6E A;  5KMQ A;  3B6D A;  4EQX A;  2BC1 A;  1TDE A;  2AR8 A;  4G74 A;  2YLZ A;  2BK3 A;  1PJ7 A;  1ZKQ A;  2RAB A;  3ITJ A;  3LXD A;  1BWC A;  3CNT A;  4J56 A;  3BI4 A;  2WPE A;  2A8X A;  2GB0 A;  3UTG A;  4B66 A;  1IUS A;  1E1N A;  1ELI A;  3AEE A;  2B9X A;  1CF3 A;  3CGD A;  4XWZ A;  3UTE A;  3SY4 A;  5EB5 A;  2VVL G;  1L9C A;  2GR2 A;  1LV0 A;  4I58 A;  4A6N B;  4GDE A;  4B68 A;  4GAV A;  4JDR A;  1JNZ A;  4A65 A;  2OA1 A;  1FEC A;  4H4T A;  3RP6 A;  2BRA A;  2YR4 A;  1DXL A;  4OPC A;  1PBD A;  2VZ2 A;  3UOV A;  1B5Q A;  3QFB A;  3EPT A;  2OAL A;  1IJH A;  1GES A;  3T0K A;  1GTH A;  2V6O A;  2Y6R A;  1S2Y A;  2C3C A;  4EQW A;  3BNU A;  4OPT A;  1GND A;  1N1P A;  5J60 A;  3DGH A;  2JB2 A;  2AQJ A;  2J3N A;  2XFU A;  4LA1 A;  4EQS A;  3UOY A;  4IVM B;  2WS3 A;  1D4D A;  1PBB A;  1NAA A;  1EBD A;  2YG6 A;  1BGN A;  1VDC A;  3ADA B;  4DGK A;  3AEG A;  2XDO A;  2YQU A;  3KPF A;  3ATQ A;  4BJZ A;  5KMS A;  3QVP A;  4CBQ A;  2EQ8 A;  1F8R A;  2VRL A;  2GQW A;  3AXB A;  2YAU A;  2EQ9 A;  4BUR A;  4CCR A;  2XYO A;  1OJ9 A;  1H6V A;  2BRY A;  3VRB A;  2PHH A;  3K7Q X;  4A99 A;  1KDG A;  3AEB A;  1NHP A;  4HA6 A;  4Z44 A;  3EF6 A;  1EL9 A;  3FBS A;  4TM0 A;  2B7R A;  4REK A;  3UKK A;  3G5R A;  1BF3 A;  1NG4 A;  3FMW A;  2ZZB A;  1CHU A;  1QJD A;  3CTY A;  1CC2 A;  2GR3 A;  4NWZ A;  1P2H A;  1H82 A;  3NTD A;  3AEC A;  1M6I A;  5KXJ A;  1K0L A;  3VR8 A;  5FS8 A;  4YT0 A;  3UCL A;  2X99 A;  4BJY A;  1E1K A;  5KOX A;  5IQ4 A;  1TDF A;  3UKQ A;  3L1R A;  2YLR A;  1N4U A;  3UKP A;  3AE6 A;  5JCI A;  1N4V A;  3FIM B;  3NK1 X;  4OVI A;  4U8J A;  4FX9 A;  2Q7V A;  3GD3 A;  1CBO A;  4H4Z A;  1BGJ A;  4Z2R A;  3UTF A;  2Z5Y A;  3RP7 A;  4YTN A;  3ICR A;  1Y56 B;  2IVD A;  3IWA A;  3D8X A;  5FS9 A;  3DJJ A;  2YM2 A;  3HYW A;  4X9M A;  1CC4 A;  5KVI A;  3WE0 A;  4AT2 A;  2WHD A;  4H4X A;  3NN6 X;  3CN8 A;  3V76 A;  3P1W A;  4H7U A;  3GYJ A;  4OPU A;  4ADW A;  2CDU A;  5U1O A;  4B65 A;  3AE5 A;  3ALM A;  3C96 A;  3AED A;  3P4Q A;  1N4W A;  2FJB A;  1PS9 A;  3DJD A;  1GRB A;  2FJD A;  2WU5 A;  3VRD B;  2C70 A;  3SZC A;  2XLT A;  1D7L A;  4U8I A;  4LII A;  1H81 A;  2BYB A;  3ABV A;  3SYI A;  4USR A;  4RSL A;  3VR9 A;  4E0V A;  4GRT A;  3V3O A;  3H8L A;  2R0C A;  3I6D A;  4U8K A;  2VRM A;  3EAO A;  1OJA A;  4EMJ A;  1MXT A;  2GMJ A;  2XCG A;  1F8S A;  2XLR A;  3UKA A;  3S5W A;  1DOB A;  1EL7 A;  4YSY A;  5JCL A;  3D1C A;  3P4R A;  4UP3 A;  5C2T A;  4UDR A;  5BUK A;  2YR5 A;  2A89 A;  3E1T A;  1ZK7 A;  4U8N A;  4MJW A;  1BKW A;  2BCP A;  3GDN A;  4KX6 A;  1CJC A;  4AP3 A;  2E1M A;  2WDQ A;  3NT6 A;  4Z24 A;  1MO9 A;  3ICS A;  3NKS A;  4C77 A;  3ZYX A;  4APN A;  3CGB A;  2WET A;  4TM1 A;  1TRB A;  4G73 A;  4JY3 A;  2C72 A;  3KD9 A;  3HYX A;  3KKJ A;  2XLU A;  3K7T A;  3NYC A;  1GAL A;  4DNA A;  1YQZ A;  3KU9 A;  3IF9 A;  3NTA A;  3UP4 A;  4TM3 A;  2ZZ0 A;  4CY6 A;  3AYI A;  3C4N A;  1NHR A;  1GRA A;  1CC6 A;  1GXF A;  1TYP A;  1H7W A;  1VQW A;  1COY A;  4IA5 A;  3LAD A;  3NK2 X;  1VG0 A;  5IQ1 A;  2FJA A;  3SX6 A;  3QSM A;  2GV8 A;  4X4J A;  1JRX A;  5FMH A;  3RHA A;  5C3J A;  1D7Y A;  2GRT A;  2DKI A;  4KPR A;  3RED A;  4H4Y A;  3SGL A;  2XVH A;  1Z6L A;  1XPQ A;  4II2 A;  4IA6 A;  1GET A;  1GOS A;  2JK6 A;  2GR1 A;  1ZDL A;  4G6G A;  2C66 A;  3ISH A;  1XAN A;  1D4E A;  4K7Z A;  4B1B A;  2V5Z A;  3BI2 A;  3M0O A;  4LU6 A;  2XFP A;  1JU2 A;  4JY2 A;  4OPL A;  3AE8 A;  3UTH A;  4B69 A;  1JOA A;  2X8H A;  4DSH A;  4C3Y A;  5GSN A;  3NG7 X;  4H2R A;  4EQR A;  5U25 A;  1PBF A;  3P4P A;  1JRZ A;  4NEV A;  3NN0 X;  2X50 A; 
#chains in the Genus database with same CATH homology
 2QA1 A;  4Y4N A;  5BUL A;  1MOK A;  2JAE A;  2JB3 A;  4H4R A;  3AE4 A;  3DJG X;  1CL0 A;  1XHC A;  1IUT A;  4EIP A;  5FS6 A;  1OJD A;  2DKH A;  2R9Z A;  3AE3 A;  1F8W A;  3AD8 B;  1RYI A;  1GRT A;  3DK8 A;  3DGZ A;  3IC9 A;  5EBK A;  3AE1 A;  4PAA A;  1GT8 A;  3AE9 A;  4JQ9 A;  2XFO A;  2GR0 A;  2UZZ A;  1FOH A;  2WDV A;  1KNR A;  1RP0 A;  3GYX A;  5KOW A;  4P9S A;  2OLO A;  2XVI A;  3LOV A;  1FEB A;  2YG5 A;  4YWO A;  4D03 A;  1FCD A;  4NNJ A;  1EL8 A;  4C3X A;  1RSG A;  2CUL A;  1NHQ A;  4H50 A;  2WP5 A;  1Y0P A;  3CMM A;  3AEF A;  4FK1 A;  1L9E A;  1LQU A;  2QAE A;  3LZW A;  2C4C A;  3KLJ A;  5KVH A;  3NHO X;  1YQ4 A;  2E4G A;  3FPZ A;  1GRF A;  1NEK A;  2C64 A;  1S3B A;  1GER A;  2ZZC A;  3NRN A;  4IVO B;  4JNQ A;  2WES A;  4X9N A;  4H4Q A;  1ZY8 A;  5IPY A;  1X31 B;  5HY5 A;  4YTM A;  2BS3 A;  2R45 A;  2XVE A;  3AWI A;  3M12 A;  3F8P A;  3PS9 A;  2V3A A;  1D5T A;  2JBV A;  4GAP A;  2BK5 A;  1PBE A;  1PXB A;  2WPF A;  3ATR A;  4O5U A;  3I3L A;  1PBC A;  4H2Q A;  4OPD A;  3UKH A;  4A9W A;  4EIQ A;  2GAH B;  1REO A;  3P4S A;  2YVJ A;  1DJQ A;  2JB1 A;  2B76 A;  3AE2 A;  4GR1 A;  3K30 A;  5DBJ A;  4YXD A;  4NTC A;  3F8R A;  1D4C A;  5FS7 A;  3COX A;  4EMW A;  2VQ7 A;  1ZMD A;  2C7G A;  3QSS A;  3NK0 X;  3RP8 A;  3UKF A;  4AP1 A;  4A79 A;  3T14 A;  4H4P A;  3SZ0 A;  2V60 A;  2GF3 A;  3KPK A;  4WX1 A;  3CND A;  1H83 A;  2X8G A;  3CNP A;  2WOW A;  5HXI A;  3R9U A;  3GD4 A;  1KSU A;  4GDP A;  4FDC B;  1H84 A;  1PN0 A;  2XLP A;  1PJ5 A;  3AD9 B;  3P9U A;  2GQF A;  2ACZ A;  4D04 A;  1GRG A;  4WCT A;  3O0H A;  2XLS A;  2YG7 A;  2IVE A;  4YTP A;  2WU2 A;  1DNC A;  4K8D A;  2RGJ A;  2WP6 A;  4ZN0 A;  5JCM A;  1ZOV A;  3OC4 A;  3QFA A;  2XFQ A;  4NEW A;  5KMR A;  2JKC A;  1KSS A;  1CJ4 A;  3DME A;  2W0H A;  1H7X A;  4O5Q A;  4EM3 A;  2C76 A;  2FJE A;  3GMC A;  1K4Q A;  4JNA A;  2XVJ A;  3CGE A;  4J36 A;  3AYJ A;  1FL2 A;  4UDP A;  4B64 A;  3QSE A;  4H4S A;  1DOE A;  1H86 A;  1B37 A;  4EM4 A;  1TDK A;  3NLC A;  3AYL A;  4U8L A;  2HQM A;  3T2Y A;  5U63 A;  1HYU A;  1IUW A;  1SEZ A;  2APG A;  2RGH A;  3CNS A;  2C65 A;  2I0Z A;  2AAQ A;  1QLB A;  1M64 A;  1TDO A;  3T2K A;  1PXA A;  1NHS A;  3II4 A;  1GEU A;  2YG3 A;  3CGC A;  4CNJ A;  1E1M A;  4U2L A;  1YY5 A;  4Y4L A;  1GV4 A;  1DOC A;  2B9W A;  2R0G A;  2WP9 A;  3T31 A;  3C4A A;  4AOX A;  1NDA A;  4NZH A;  4ZCC A;  2YVG A;  1UKV G;  2VOU A;  5KNL A;  2Z5X A;  2BA9 A;  2YR6 A;  3QJ4 A;  1ZOY A;  4CY8 A;  2H88 A;  3SZW A;  5HYM A;  4ZCD A;  3CIR A;  2GEW A;  1OJT A;  1E1L A;  2V61 A;  4G9K A;  3GRT A;  1KFY A;  1LVL A;  4Z2T A;  1YQ3 A;  2WBA A;  1LPF A;  2XFN A;  3Q9T A;  4Y4M A;  1IUX A;  5EOW A;  4CRT A;  2TMD A;  3S61 A;  4AOS A;  4IV9 A;  3KA7 A;  5ER0 A;  1F3P A;  2OLN A;  2WOI A;  4K2X A;  4HB9 A;  1PDH A;  3UP5 A;  3GSI A;  4GUV A;  4UDQ A;  3VQR A;  4C5O A;  3KVE A;  1TDN A;  4PAB A;  1GTE A;  4M52 A;  3UKL A;  1LTX R;  2YLW A;  4EMI A;  2WOV A;  3NH3 X;  4CNK A;  2BAC A;  3NYE A;  4J33 A;  4A5L A;  4B63 A;  2QCU A;  1B4V A;  2BS2 A;  1O5W A;  4K5S A;  5TR3 A;  1NPX A;  2B9Y A;  2Q0L A;  5CQF A;  2R0P A;  3DA1 A;  3CNJ A;  2R46 A;  4YSZ A;  3CPI G;  2V3B A;  3DK9 A;  4N9X A;  5L46 A;  4I59 A;  3SFE A;  2WPC A;  2BXR A;  2TPR A;  2IID A;  4U8M A;  4J31 A;  3PVC A;  4YKF A;  1VRQ B;  5LV9 A;  2QA2 A;  2RGO A;  1O95 A;  4A6N A;  3SXI A;  2YVF A;  3G5Q A;  2R4E A;  1XDI A;  2A87 A;  2YLT A;  3FG2 P;  3URH A;  4ICY A;  2VVM A;  2FBW A;  4B67 A;  3GDP A;  5KWF A;  3SFD A;  3F8D A;  1VG9 A;  4BV6 A;  4K22 A;  1GRH A;  1Q1W A;  1EL5 A;  4RG3 A;  1KF6 A;  3AEA A;  3K7M X;  4YKG A;  2ZBW A;  1S3E A;  2Y6Q A;  1S2Q A;  2B7S A;  4TLZ A;  3SM8 A;  4Z2U A;  1K0J A;  1Q9I A;  5CKU A;  4FK1 C;  3ALL A;  1PJ6 A;  1YKJ A;  2BS4 A;  1PHH A;  4K5R A;  4XXG A;  4ECH A;  1DOD A;  3RNM A;  4NTD A;  2F5Z A;  2EQ6 A;  5JCN A;  2YG4 A;  2YM1 A;  4U8O A;  1W4X A;  1KNP A;  2ARD A;  4Z26 A;  1LJ1 A;  3ICT A;  1P2E A;  5HHF A;  3B3R A;  3JSK A;  1Q1R A;  1ZMC A;  4GF7 A;  2O9Z A;  4OPG A;  2R4J A;  3LZX A;  3NIX A;  4H2N A;  3HYV A;  1E7P A;  2NVK X;  3OZ2 A;  3T37 A;  4BK3 A;  5BVA A;  2YLX A;  2C67 A;  1NEN A;  3DJE A;  1F6M A;  4GCM A;  3LB8 A;  1TYT A;  1L9D A;  3SZF A;  2CFY A;  1NG3 A;  3NGC X;  2H89 A;  1JNR A;  2WEU A;  3DH9 A;  2GMH A;  2OAM A;  2BXS A;  3GWD A;  3VRA A;  4NTE A;  3IHG A;  2YWL A;  3BNM A;  2PYX A;  5KMP A;  4YSX A;  2X3N A;  1PXC A;  4TM4 A;  4H4U A;  2Q6U A;  4USQ A;  3ZDN A;  4BK1 A;  2EQ7 A;  5KRQ A;  1B8S A;  3NYF A;  5BRT A;  4TLX A;  2WDR A;  2C75 A;  4U2T A;  3UOZ A;  3V3N A;  4OCG A;  2X8C A;  2XVF A;  3M13 A;  1GPE A;  4Z43 A;  3BHF A;  2BAB A;  3AB1 A;  1ZX9 A;  3NNE A;  5M10 A;  3EAN A;  1E39 A;  3ALJ A;  4Z25 A;  1O94 A;  1Y56 A;  3PO7 A;  2WQY A;  2VQB A;  4J57 A;  3BHK A;  3Q6J A;  3AD7 B;  3SQP A;  2GVC A;  4CCQ A;  4U8P A;  1K0I A;  3GRS A;  1CJ2 A;  4II3 A;  2Q0K A;  4YSH A;  1ZP0 A;  1BZL A;  3L8K A;  5J7X A;  2CVJ A;  1V59 A;  3G5S A;  2NPX A;  3CPJ G;  3GMB A;  2YLS A;  4A7A A;  1JRY A;  4BK2 A;  2GAG B;  1L0V A;  4H2P A;  4J2W A;  2C73 A;  1ONF A;  3IHM A;  3GYI A;  1IUU A;  3H8I A;  2C3D A;  4C74 A;  3CPH G;  4XWR A;  1QO8 A;  2BCG G;  1JEH A;  1DJN A;  1FEA A;  2BC0 A;  2E5V A;  4H4V A;  4AT0 A;  1IUV A;  3QVR A;  4JN9 A;  1AOG A;  3UOX A;  4J34 A;  4DSG A;  2VVL A;  3BI5 A;  4G6H A;  1OJC A;  4RG4 A;  3T2Z A;  2BK4 A;  5GRT A;  3DK4 A;  5EB4 A;  3H4K A;  3LJP A;  5JCK A;  3AE7 A;  4OPI A;  4H4W A;  1GRE A;  3HZL A;  4U2S A;  1CJ3 A;  1LQT A;  2GH5 A;  5M0Z A;  3GWF A;  1GSN A;  1E6E A;  5KMQ A;  3B6D A;  4EQX A;  2BC1 A;  1TDE A;  2AR8 A;  4G74 A;  2YLZ A;  2BK3 A;  1PJ7 A;  1ZKQ A;  2RAB A;  3ITJ A;  3LXD A;  1BWC A;  3CNT A;  4J56 A;  3BI4 A;  2WPE A;  2A8X A;  2GB0 A;  3UTG A;  4B66 A;  1IUS A;  1E1N A;  1ELI A;  3AEE A;  2B9X A;  1CF3 A;  3CGD A;  4XWZ A;  3UTE A;  3SY4 A;  5EB5 A;  2VVL G;  1L9C A;  2GR2 A;  1LV0 A;  4I58 A;  4A6N B;  4GDE A;  4B68 A;  4GAV A;  4JDR A;  1JNZ A;  4A65 A;  2OA1 A;  1FEC A;  4H4T A;  3RP6 A;  2BRA A;  2YR4 A;  1DXL A;  4OPC A;  1PBD A;  2VZ2 A;  3UOV A;  1B5Q A;  3QFB A;  3EPT A;  2OAL A;  1IJH A;  1GES A;  3T0K A;  1GTH A;  2V6O A;  2Y6R A;  1S2Y A;  2C3C A;  4EQW A;  3BNU A;  4OPT A;  1GND A;  1N1P A;  5J60 A;  3DGH A;  2JB2 A;  2AQJ A;  2J3N A;  2XFU A;  4LA1 A;  4EQS A;  3UOY A;  4IVM B;  2WS3 A;  1D4D A;  1PBB A;  1NAA A;  1EBD A;  2YG6 A;  1BGN A;  1VDC A;  3ADA B;  4DGK A;  3AEG A;  2XDO A;  2YQU A;  3KPF A;  3ATQ A;  4BJZ A;  5KMS A;  3QVP A;  4CBQ A;  2EQ8 A;  1F8R A;  2VRL A;  2GQW A;  3AXB A;  2YAU A;  2EQ9 A;  4BUR A;  4CCR A;  2XYO A;  1OJ9 A;  1H6V A;  2BRY A;  3VRB A;  2PHH A;  3K7Q X;  4A99 A;  1KDG A;  3AEB A;  1NHP A;  4HA6 A;  4Z44 A;  3EF6 A;  1EL9 A;  3FBS A;  4TM0 A;  2B7R A;  4REK A;  3UKK A;  3G5R A;  1BF3 A;  1NG4 A;  3FMW A;  2ZZB A;  1CHU A;  1QJD A;  3CTY A;  1CC2 A;  2GR3 A;  4NWZ A;  1P2H A;  1H82 A;  3NTD A;  3AEC A;  1M6I A;  5KXJ A;  1K0L A;  3VR8 A;  5FS8 A;  4YT0 A;  3UCL A;  2X99 A;  4BJY A;  1E1K A;  5KOX A;  5IQ4 A;  1TDF A;  3UKQ A;  3L1R A;  2YLR A;  1N4U A;  3UKP A;  3AE6 A;  5JCI A;  1N4V A;  3FIM B;  3NK1 X;  4OVI A;  4U8J A;  4FX9 A;  2Q7V A;  3GD3 A;  1CBO A;  4H4Z A;  1BGJ A;  4Z2R A;  3UTF A;  2Z5Y A;  3RP7 A;  4YTN A;  3ICR A;  1Y56 B;  2IVD A;  3IWA A;  3D8X A;  5FS9 A;  3DJJ A;  2YM2 A;  3HYW A;  4X9M A;  1CC4 A;  5KVI A;  3WE0 A;  4AT2 A;  2WHD A;  4H4X A;  3NN6 X;  3CN8 A;  3V76 A;  3P1W A;  4H7U A;  3GYJ A;  4OPU A;  4ADW A;  2CDU A;  5U1O A;  4B65 A;  3AE5 A;  3ALM A;  3C96 A;  3AED A;  3P4Q A;  1N4W A;  2FJB A;  1PS9 A;  3DJD A;  1GRB A;  2FJD A;  2WU5 A;  3VRD B;  2C70 A;  3SZC A;  2XLT A;  1D7L A;  4U8I A;  4LII A;  1H81 A;  2BYB A;  3ABV A;  3SYI A;  4USR A;  4RSL A;  3VR9 A;  4E0V A;  4GRT A;  3V3O A;  3H8L A;  2R0C A;  3I6D A;  4U8K A;  2VRM A;  3EAO A;  1OJA A;  4EMJ A;  1MXT A;  2GMJ A;  2XCG A;  1F8S A;  2XLR A;  3UKA A;  3S5W A;  1DOB A;  1EL7 A;  4YSY A;  5JCL A;  3D1C A;  3P4R A;  4UP3 A;  5C2T A;  4UDR A;  5BUK A;  2YR5 A;  2A89 A;  3E1T A;  1ZK7 A;  4U8N A;  4MJW A;  1BKW A;  2BCP A;  3GDN A;  4KX6 A;  1CJC A;  4AP3 A;  2E1M A;  2WDQ A;  3NT6 A;  4Z24 A;  1MO9 A;  3ICS A;  3NKS A;  4C77 A;  3ZYX A;  4APN A;  3CGB A;  2WET A;  4TM1 A;  1TRB A;  4G73 A;  4JY3 A;  2C72 A;  3KD9 A;  3HYX A;  3KKJ A;  2XLU A;  3K7T A;  3NYC A;  1GAL A;  4DNA A;  1YQZ A;  3KU9 A;  3IF9 A;  3NTA A;  3UP4 A;  4TM3 A;  2ZZ0 A;  4CY6 A;  3AYI A;  3C4N A;  1NHR A;  1GRA A;  1CC6 A;  1GXF A;  1TYP A;  1H7W A;  1VQW A;  1COY A;  4IA5 A;  3LAD A;  3NK2 X;  1VG0 A;  5IQ1 A;  2FJA A;  3SX6 A;  3QSM A;  2GV8 A;  4X4J A;  1JRX A;  5FMH A;  3RHA A;  5C3J A;  1D7Y A;  2GRT A;  2DKI A;  4KPR A;  3RED A;  4H4Y A;  3SGL A;  2XVH A;  1Z6L A;  1XPQ A;  4II2 A;  4IA6 A;  1GET A;  1GOS A;  2JK6 A;  2GR1 A;  1ZDL A;  4G6G A;  2C66 A;  3ISH A;  1XAN A;  1D4E A;  4K7Z A;  4B1B A;  2V5Z A;  3BI2 A;  3M0O A;  4LU6 A;  2XFP A;  1JU2 A;  4JY2 A;  4OPL A;  3AE8 A;  3UTH A;  4B69 A;  1JOA A;  2X8H A;  4DSH A;  4C3Y A;  5GSN A;  3NG7 X;  4H2R A;  4EQR A;  5U25 A;  1PBF A;  3P4P A;  1JRZ A;  4NEV A;  3NN0 X;  2X50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...