2YWLA

Crystal structure of thioredoxin reductase-related protein ttha0370 from thermus thermophilus hb8
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
MWDVIVVGGGPSGLSAALFLARAGLKVLVLDGGRSKVKGVSRVPNYPGLLDEPSGEELLRRLEAHARRYGAEVRPGVVKGVRDMGGVFEVETEEGVEKAERLLLCTHKDPTLPSLLGLTRRGAYIDTDEGGRTSYPRVYAAGVARGKVPGHAIISAGDGAYVAVHLVSDLRGEPYKDHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase related protein
publication title Crystal structure of thioredoxin reductase-related protein TTHA0370 from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2ywlA01
4OPTA 3GRSA 4NTEA 1Z6LA 2GR1A 2CDUA 3CGBA 4ADWA 4EQSA 4H2PA 4GDPA 1L9EA 4APNA 2BK4A 4O5QA 3EAOA 3SQPA 2C66A 1KSUA 1IUSA 3AD9B 1CJCA 3P4QA 4TM3A 1EL8A 4Y4MA 2I0ZA 2CULA 4M52A 1JNRA 2A8XA 3AWIA 2YG3A 4GDEA 3RP6A 3B3RA 1CC4A 5CQFA 1YQZA 4Z44A 1KSSA 3I6DA 3UTGA 3CIRA 3DK9A 2UZZA 1O5WA 3AYLA 3UKFA 5U25A 4UDPA 1LQUA 1YQ4A 1ZMDA 3CTYA 4IA5A 4I58A 4YWOA 3AE5A 4RSLA 4Z2UA 1IUXA 2XCGA 1REOA 3CNJA 2ZBWA 1F8SA 3NK2X 2C67A 3P9UA 3AE6A 3NYFA 1PJ7A 3NIXA 2YG4A 2WU5A 2TPRA 3K7MX 4C77A 2GEWA 5EB4A 4B66A 3AE1A 4WCTA 5EBKA 3VR9A 3UP4A 2V5ZA 4A9WA 1H83A 1KDGA 4H4UA 1RP0A 4YKGA 1NG3A 1DOEA 2X50A 3AE9A 2DKHA 4K22A 4BK1A 1DXLA 1LVLA 1JU2A 1CJ3A 2X99A 3DJDA 4JY2A 1B5QA 4U8LA 3V3OA 4MJWA 3UTHA 1PBDA 2JK6A 4RG3A 1E39A 1GNDA 3O0HA 2EQ6A 2IVDA 3LJPA 1D5TA 1GV4A 1GXFA 1GT8A 2YG6A 1L9DA 2A89A 3GD4A 2VQBA 3EPTA 2C70A 4U8OA 3REDA 1TRBA 2GAHB 2BS2A 1EL7A 3CNTA 4GR1A 5FS8A 5TR3A 3RNMA 3CPJG 2EQ8A 4TM1A 1YQ3A 4HB9A 3IHMA 3NTDA 4B63A 1GRAA 3CNPA 4Z26A 5KOXA 4U8JA 2BK3A 1ZKQA 3GD3A 4K5RA 4UDRA 3BNMA 2QA2A 2YLSA 2R0GA 1RYIA 3QVRA 5EB5A 3GYJA 1VQWA 3NK1X 4DGKA 5KVHA 2YVFA 1OJTA 3CGEA 3AE7A 3Q6JA 2XLRA 3AECA 1ELIA 3ATRA 4B68A 5C2TA 1IUTA 2V6OA 3NK0X 5JCIA 5GRTA 2WPEA 4U8KA 2ACZA 5J60A 2WQYA 3ALLA 3QFAA 4FDCB 3AD7B 2XLTA 4J36A 1BZLA 4AT2A 2AR8A 2XLPA 2YR5A 2ZZ0A 3KA7A 4D04A 3T37A 2Q0LA 1F8WA 3NRNA 4RG4A 2GRTA 2YLWA 1ZP0A 3GDNA 4CRTA 2JKCA 3DGZA 1CF3A 2GVCA 4KPRA 5LV9A 1OJDA 4NEVA 2GAGB 2RGJA 2FJEA 1LTXR 3WE0A 2YLTA 1GREA 4IA6A 3QFBA 2HQMA 1LPFA 2H89A 1LJ1A 3KU9A 3B6DA 4XXGA 4FX9A 1CBOA 4K5SA 4B64A 3BI5A 1E1KA 2IVEA 3AEEA 1GALA 2RGOA 3M0OA 4A5LA 4C3YA 5BULA 4EQRA 3C4AA 3G5SA 2CFYA 4EQWA 1TDNA 1TDKA 1GTHA 1N1PA 2DKIA 2X8GA 1PXCA 3M12A 4U8MA 5FS7A 1XHCA 1NHSA 1Y56A 3URHA 1NENA 3FG2P 2OAMA 1Q9IA 3GDPA 2BS4A 2A87A 2GR3A 1BKWA 1BGJA 1IUUA 2C76A 2J3NA 3BHFA 3IWAA 4C3XA 1K0IA 1KNPA 2YVJA 1DJQA 1FCDA 1Y56B 4OPCA 2B9XA 3AEBA 3FPZA 3ALJA 2YQUA 1TYTA 1OJ9A 2JB3A 4B67A 4IVMB 4Z2TA 2BXSA 3UOVA 3DK8A 1NDAA 4A7AA 2C73A 3GSIA 1LQTA 1E1NA 2GQWA 2Y6QA 3RP7A 1JOAA 3CGCA 4J33A 1P2EA 3UKHA 4B1BA 2YVGA 1EL5A 4CY6A 2APGA 2OA1A 4EQXA 4Z43A 4A79A 4C74A 1TDFA 1FEBA 1B8SA 4AP3A 4CNKA 2C72A 3LOVA 2WS3A 2WP5A 3NN0X 4OCGA 4WX1A 2NVKX 1PXBA 4C5OA 2YLRA 4HA6A 4JY3A 1ZX9A 1O94A 4P9SA 4JDRA 1NEKA 2YLZA 4JNQA 4CBQA 5IQ1A 1K0LA 2WEUA 4TLXA 2H88A 2EQ7A 1PJ5A 2YG7A 3DA1A 3NHOX 5CKUA 4BV6A 3AE3A 3NT6A 4A65A 3FBSA 1TYPA 2E5VA 3CN8A 1GEUA 1O95A 4JNAA 2Z5XA 3AYIA 1FECA 5FMHA 3PO7A 1PBCA 3AEFA 1L0VA 1SEZA 3ITJA 4OPIA 1FEAA 3LXDA 1DOBA 2JBVA 3ICSA 4H4ZA 3H8LA 2C3CA 2B7SA 2VVMA 2WU2A 3VQRA 5L46A 1ZK7A 2BACA 2V61A 3OZ2A 5KWFA 3CPIG 4YKFA 4J57A 1D4CA 2VZ2A 4NTDA 1K0JA 4J34A 2JAEA 3DJJA 2XVIA 4IVOB 1DODA 2XYOA 1FL2A 2E4GA 5KOWA 3COXA 1YKJA 4CY8A 5M0ZA 3SFDA 2Z5YA 5FS6A 2GR2A 1DNCA 4H4RA 3BI2A 2R4JA 3V76A 2GB0A 2C75A 2C64A 4EIQA 1IJHA 2BA9A 3UKQA 4Z25A 4YXDA 2O9ZA 3UKLA 5GSNA 4O5UA 2FJDA 1XPQA 4USRA 4USQA 1F6MA 3K7QX 1JRZA 1PBFA 5DBJA 5JCKA 3M13A 2XVFA 3NN6X 2OLOA 2XFNA 1D7LA 3NLCA 3ZDNA 2B9WA 3S61A 4H4YA 2B7RA 3I3LA 3UKAA 5JCMA 2WOIA 1CJ2A 3ADAB 1NAAA 3NH3X 1BGNA 2VVLA 3SGLA 1M64A 4ZCCA 3ZYXA 1H7WA 1ZY8A 3VRAA 2XFQA 4H50A 1FOHA 1H84A 2R0CA 3NTAA 2R46A 3KVEA 3AXBA 3FMWA 3NG7X 1RSGA 2C7GA 3PS9A 2GV8A 4DNAA 3D1CA 4EM3A 1JRXA 1Q1WA 5FS9A 4BJYA 2ZZCA 2GQFA 2YG5A 4OPUA 4U2TA 3CPHG 3S5WA 4H4WA 1JRYA 3R9UA 1LV0A 2WDQA 1CJ4A 4Z24A 5U1OA 1PS9A 2Q7VA 1AOGA 4XWZA 3QSSA 3F8PA 3P4SA 4BURA 1CHUA 1NHRA 3KKJA 2YM2A 1W4XA 3G5RA 5U63A 3BNUA 1M6IA 1UKVG 2X8CA 2XVEA 3L1RA 5HHFA 4EMJA 1ZMCA 2F5ZA 2QAEA 4UP3A 1MO9A 2X8HA 1P2HA 2XFPA 1NPXA 1S3EA 3II4A 4BJZA 4J56A 1NG4A 3LADA 1CC2A 3EANA 1XANA 4BK2A 4FK1A 4X4JA 1OJAA 2FJAA 2VRLA 3DK4A 3P4RA 4TM0A 4AOSA 4H7UA 1D4DA 3ISHA 4YTMA 3UP5A 2CVJA 2BK5A 1H81A 1D7YA 3RHAA 3K30A 1PBEA 4AT0A 2OLNA 4LIIA 4CCQA 3OC4A 1E7PA 3QVPA 4A6NA 3ICRA 2GR0A 3LZXA 1K4QA 1F3PA 4OVIA 2Q0KA 4X9NA 1ZDLA 3FIMB 2IIDA 5J7XA 4J2WA 2GH5A 4H4SA 2W0HA 3AE8A 3LB8A 4EMWA 3F8DA 3H4KA 3ALMA 4A6NB 1S3BA 2YR4A 4YT0A 4CNJA 4ICYA 2V3BA 3ICTA 4GUVA 1PN0A 1S2QA 1Y0PA 4U8IA 5HY5A 3PVCA 3UKPA 4EIPA 4H4XA 1IUWA 2ZZBA 2YLXA 3AE2A 4YSYA 2QCUA 3VRDB 5JCLA 2BXRA 1TDOA 3Q9TA 1IUVA 2BC1A 4X9MA 1GESA 4Y4NA 3C4NA 3F8RA 2JB2A 1E1LA 4YSZA 3AEDA 1H82A 2XFOA 5BRTA 3P1WA 3NYCA 1JNZA 1EL9A 1PHHA 4LU6A 4YTPA 4GF7A 2VQ7A 2XVJA 4EMIA 2RGHA 3AYJA 3IHGA 1OJCA 4U8NA 4OPDA 4B65A 1KNRA 2WOVA 2QA1A 2BABA 1JEHA 5KXJA 2WETA 2WP6A 1VRQB 1DOCA 4ZCDA 3DJGX 4H2QA 1YY5A 1EBDA 3GRTA 1QLBA 3GWFA 1H7XA 4H4PA 2V3AA 2WOWA 4NZHA 1S2YA 2R45A 1NHPA 3UCLA 1B37A 2WPCA 3VR8A 4Z2RA 2YWLA 2VOUA 4DSGA 2XLUA 3V3NA 3BHKA 2R9ZA 4GRTA 4H4QA 1TDEA 2GF3A 3EF6A 4UDQA 3UTEA 4H4VA 1COYA 3DGHA 4ZN0A 1PDHA 1L9CA 1MOKA 2C65A 4DSHA 3H8IA 2TMDA 1XDIA 2WHDA 4A99A 3C96A 1N4VA 2BCGG 3GWDA 2WDVA 3UOZA 3P4PA 1VDCA 1QJDA 1N4UA 2YM1A 4K8DA 1E6EA 2BCPA 3ABVA 5KRQA 4REKA 3IC9A 5C3JA 4KX6A 1N4WA 1PJ6A 3UOXA 1GRTA 2XVHA 2AQJA 3QJ4A 1DJNA 2PYXA 4H2NA 5KVIA 3RP8A 5BVAA 2B76A 2BC0A 2V60A 3UKKA 1CC6A 2BYBA 2B9YA 3CGDA 2WP9A 3DH9A 4FK1C 5IPYA 3UOYA 1E1MA 2GMJA 1BWCA 3NGCX 4H2RA 4AOXA 1GRFA 2X3NA 3ATQA 4OPLA 3HZLA 3AEAA 1GRGA 4TM4A 5M10A 1PBBA 2XFUA 1GRBA 5IQ4A 4GCMA 3BI4A 4JN9A 1PXAA 4Y4LA 3L8KA 2YAUA 2FJBA 5EOWA 3UTFA 2VRMA 2BS3A 3JSKA 1H6VA 3QSEA 1Q1RA 1VG9A 4E0VA 3GMBA 1GPEA 3DMEA 1QO8A 1GOSA 4U2SA 1ZOVA 3D8XA 1GTEA 2OALA 2YR6A 3E1TA 3G5QA 4K7ZA 5BUKA 1GETA 4U2LA 1CL0A 4NTCA 4ECHA 3NKSA 1D4EA 2PHHA 2XDOA 2WBAA 3NYEA 1GSNA 1F8RA 3CNDA 4D03A 3AD8B 1X31B 5ER0A 4I59A 2R0PA 1V59A 3CNSA 3GYIA 2Y6RA 1BF3A 4PAAA 2FBWA 1GERA 2R4EA 4N9XA 2WDRA 1ZOYA 2AAQA 4H4TA 3QSMA 1B4VA 1NHQA 2ARDA 4YSHA 4K2XA 4J31A 5JCNA 3IF9A 4CCRA 2EQ9A 4TLZA 3GMCA 1ONFA 3K7TA 3KD9A 3AB1A 1GRHA 3LZWA 4YSXA 1KF6A 2RABA 1KFYA 2C3DA 4B69A 5HYMA 3KPFA 2GMHA 4BK3A 3SFEA 4XWRA 4YTNA 4EM4A 4U8PA 2VVLG 4IV9A 4JQ9A 1H86A 2JB1A 3DJEA 5HXIA 1VG0A 4PABA 1MXTA 3VRBA 4AP1A 2NPXA 3KLJA 3AE4A 4LA1A 4OPGA 3SM8A 1HYUA 2E1MA 2Q6UA 3NNEA 4NEWA 3AEGA 2XLSA 2WPFA 2WESA
chains in the Genus database with same CATH superfamily
4OPTA 3GRSA 4NTEA 1Z6LA 2GR1A 2CDUA 3CGBA 4ADWA 4EQSA 4H2PA 4GDPA 1L9EA 4APNA 2BK4A 4O5QA 3EAOA 3SQPA 2C66A 1KSUA 1IUSA 2BRYA 3AD9B 1CJCA 3P4QA 4TM3A 1EL8A 4Y4MA 2I0ZA 2CULA 4M52A 1JNRA 2A8XA 3AWIA 2YG3A 4GDEA 3RP6A 3B3RA 1CC4A 5CQFA 1YQZA 4Z44A 1KSSA 3I6DA 3UTGA 3CIRA 4G9KA 3DK9A 2UZZA 1O5WA 3AYLA 3UKFA 5U25A 4UDPA 1LQUA 1YQ4A 1ZMDA 3CTYA 4IA5A 4I58A 4YWOA 3AE5A 4RSLA 4Z2UA 1IUXA 3T31A 2XCGA 1REOA 3CNJA 2ZBWA 1F8SA 3NK2X 2C67A 3P9UA 3AE6A 3NYFA 1PJ7A 3NIXA 2YG4A 2WU5A 2TPRA 3K7MX 4C77A 2GEWA 5EB4A 2BRAA 4B66A 3AE1A 4WCTA 5EBKA 3VR9A 3UP4A 2V5ZA 4A9WA 1H83A 1KDGA 4H4UA 3T2KA 1RP0A 5KNLA 4YKGA 1NG3A 1DOEA 2X50A 3AE9A 2DKHA 4K22A 4BK1A 1DXLA 1LVLA 1JU2A 1CJ3A 2X99A 3DJDA 4JY2A 1B5QA 4U8LA 3V3OA 4MJWA 3UTHA 1PBDA 2JK6A 4RG3A 1E39A 1GNDA 3O0HA 2EQ6A 2IVDA 3LJPA 1D5TA 1GV4A 1GXFA 1GT8A 2YG6A 1L9DA 2A89A 3GD4A 2VQBA 3EPTA 2C70A 4U8OA 3REDA 1TRBA 2GAHB 2BS2A 1EL7A 3CNTA 4GR1A 5FS8A 5TR3A 3RNMA 3CPJG 2EQ8A 4TM1A 1YQ3A 4HB9A 3IHMA 3NTDA 4B63A 1GRAA 3CNPA 4Z26A 5KOXA 4U8JA 2BK3A 1ZKQA 3GD3A 4K5RA 4UDRA 3SXIA 3BNMA 2QA2A 2YLSA 2R0GA 1RYIA 3QVRA 5EB5A 3GYJA 1VQWA 3NK1X 4DGKA 4G73A 5KVHA 2YVFA 1OJTA 3CGEA 3AE7A 3SZWA 3Q6JA 2XLRA 3AECA 1ELIA 3ATRA 4B68A 5C2TA 1IUTA 2V6OA 3NK0X 5JCIA 5GRTA 2WPEA 4U8KA 2ACZA 5J60A 2WQYA 3ALLA 3QFAA 4FDCB 3AD7B 2XLTA 4J36A 1BZLA 4AT2A 2AR8A 2XLPA 2YR5A 2ZZ0A 3KA7A 4D04A 3T37A 2Q0LA 1F8WA 3NRNA 4RG4A 2GRTA 2YLWA 1ZP0A 3GDNA 4CRTA 2JKCA 3DGZA 1CF3A 2GVCA 4KPRA 5LV9A 1OJDA 4NEVA 2GAGB 2RGJA 2FJEA 1LTXR 3HYVA 2YLTA 3WE0A 1GREA 4IA6A 3QFBA 2HQMA 1LPFA 2H89A 1LJ1A 3KU9A 3B6DA 4XXGA 4FX9A 1CBOA 4K5SA 4B64A 3BI5A 1E1KA 2IVEA 3AEEA 1GALA 2RGOA 3M0OA 4A5LA 4C3YA 5BULA 4EQRA 3C4AA 3G5SA 2CFYA 4EQWA 1TDNA 1TDKA 1GTHA 1N1PA 2DKIA 2X8GA 1PXCA 3M12A 4U8MA 5FS7A 3T2YA 1XHCA 1NHSA 1Y56A 3URHA 1NENA 3FG2P 2OAMA 1Q9IA 3GDPA 2BS4A 2A87A 2GR3A 1BKWA 1BGJA 1IUUA 2C76A 2J3NA 3BHFA 3IWAA 4C3XA 1K0IA 1KNPA 2YVJA 4G6HA 1DJQA 1FCDA 1Y56B 4OPCA 2B9XA 3AEBA 3FPZA 3ALJA 2YQUA 1TYTA 3SZ0A 1OJ9A 2JB3A 4B67A 4IVMB 4Z2TA 2BXSA 3UOVA 3DK8A 1NDAA 4A7AA 2C73A 3GSIA 1LQTA 1E1NA 2GQWA 2Y6QA 3RP7A 1JOAA 3CGCA 4J33A 1P2EA 3UKHA 4B1BA 2YVGA 1EL5A 4CY6A 2APGA 2OA1A 4EQXA 3SZFA 4Z43A 4A79A 4C74A 1TDFA 1FEBA 1B8SA 5KMRA 4AP3A 4CNKA 2C72A 3LOVA 2WS3A 2WP5A 3NN0X 4OCGA 4WX1A 2NVKX 1PXBA 4C5OA 2YLRA 4HA6A 4JY3A 1ZX9A 1O94A 4P9SA 4JDRA 1NEKA 2YLZA 4JNQA 4CBQA 5IQ1A 1K0LA 2WEUA 4TLXA 2H88A 2EQ7A 1PJ5A 2YG7A 3DA1A 3NHOX 5CKUA 4BV6A 3AE3A 3NT6A 4A65A 3FBSA 1TYPA 2E5VA 3CN8A 1GEUA 1O95A 4JNAA 2Z5XA 3AYIA 1FECA 5FMHA 3PO7A 1PBCA 3AEFA 1L0VA 1SEZA 3ITJA 4OPIA 1FEAA 3LXDA 2C4CA 1DOBA 2JBVA 3ICSA 4H4ZA 3H8LA 2C3CA 2B7SA 2VVMA 2WU2A 4G74A 3VQRA 5L46A 1ZK7A 2BACA 2V61A 3OZ2A 5KWFA 3CPIG 4YKFA 4J57A 1D4CA 2VZ2A 4NTDA 1K0JA 4J34A 2JAEA 3DJJA 2XVIA 4GAVA 1DODA 4IVOB 3T14A 2XYOA 1FL2A 2E4GA 5KOWA 3COXA 1YKJA 4CY8A 5M0ZA 3SFDA 2Z5YA 5FS6A 2GR2A 1DNCA 4H4RA 3BI2A 2R4JA 3V76A 2GB0A 2C75A 2C64A 4EIQA 1IJHA 2BA9A 3UKQA 4Z25A 4YXDA 2O9ZA 3UKLA 3SX6A 5GSNA 3SY4A 4O5UA 2FJDA 1XPQA 4USRA 4USQA 1F6MA 3K7QX 1JRZA 1PBFA 5DBJA 5JCKA 3M13A 2XVFA 3NN6X 2OLOA 2XFNA 1D7LA 3NLCA 3ZDNA 2B9WA 3S61A 4H4YA 2B7RA 3I3LA 3UKAA 5JCMA 2WOIA 1CJ2A 3ADAB 1NAAA 3NH3X 1BGNA 2VVLA 3SGLA 1M64A 4ZCCA 3ZYXA 1H7WA 1ZY8A 3VRAA 2XFQA 4H50A 1FOHA 1H84A 2R0CA 3NTAA 2R46A 3KVEA 3AXBA 3FMWA 3NG7X 1RSGA 2C7GA 3PS9A 2GV8A 4DNAA 3D1CA 4II3A 4EM3A 1JRXA 1Q1WA 5FS9A 4BJYA 2ZZCA 2GQFA 2YG5A 4OPUA 4U2TA 3CPHG 3S5WA 4H4WA 1JRYA 3R9UA 1LV0A 2WDQA 1CJ4A 4Z24A 5U1OA 1PS9A 2Q7VA 1AOGA 4XWZA 3QSSA 3F8PA 3P4SA 4BURA 1CHUA 1NHRA 3KKJA 2YM2A 1W4XA 3G5RA 5U63A 3BNUA 1M6IA 1UKVG 2X8CA 2XVEA 3L1RA 5HHFA 4EMJA 1ZMCA 2F5ZA 2QAEA 4UP3A 1MO9A 2X8HA 1P2HA 2XFPA 1NPXA 1S3EA 3II4A 4BJZA 4J56A 1NG4A 3LADA 1CC2A 3EANA 5KMQA 1XANA 4BK2A 4FK1A 4X4JA 1OJAA 2FJAA 2VRLA 3DK4A 3P4RA 4TM0A 4AOSA 4H7UA 1D4DA 3ISHA 4YTMA 3UP5A 2CVJA 2BK5A 1H81A 1D7YA 3RHAA 3K30A 1PBEA 4AT0A 2OLNA 4LIIA 4CCQA 3OC4A 1E7PA 3QVPA 4A6NA 3ICRA 2GR0A 3LZXA 1K4QA 1F3PA 4OVIA 2Q0KA 4X9NA 1ZDLA 3FIMB 3HYWA 2IIDA 5J7XA 4J2WA 2GH5A 4H4SA 2W0HA 3AE8A 3LB8A 4EMWA 3F8DA 3H4KA 3ALMA 4A6NB 1S3BA 2YR4A 4YT0A 4CNJA 4ICYA 2V3BA 3ICTA 4GUVA 1PN0A 1S2QA 1Y0PA 4U8IA 3SYIA 5HY5A 3PVCA 3UKPA 4EIPA 4H4XA 1IUWA 2ZZBA 2YLXA 3AE2A 4YSYA 2QCUA 3VRDB 5JCLA 2BXRA 1TDOA 3GYXA 1IUVA 2BC1A 3Q9TA 1GESA 4X9MA 4Y4NA 3C4NA 3F8RA 4G6GA 2JB2A 1E1LA 4YSZA 3AEDA 1H82A 2XFOA 5BRTA 3P1WA 3NYCA 1JNZA 1EL9A 1PHHA 4LU6A 4YTPA 4GF7A 2VQ7A 2XVJA 4EMIA 2RGHA 3AYJA 3IHGA 1OJCA 4U8NA 4OPDA 4B65A 1KNRA 2WOVA 2QA1A 2BABA 1JEHA 5KXJA 2WETA 2WP6A 1VRQB 1DOCA 4ZCDA 3DJGX 4H2QA 1YY5A 4NNJA 3SZCA 3T0KA 1EBDA 3GRTA 1QLBA 4II2A 3GWFA 1H7XA 4H4PA 2V3AA 2WOWA 4NZHA 1S2YA 2R45A 1NHPA 3UCLA 1B37A 2WPCA 3VR8A 4Z2RA 2YWLA 2VOUA 4DSGA 2XLUA 3V3NA 3BHKA 2R9ZA 4GRTA 4H4QA 1TDEA 2GF3A 3EF6A 4UDQA 3UTEA 4H4VA 1COYA 3DGHA 4ZN0A 1PDHA 1L9CA 1MOKA 2C65A 4DSHA 3H8IA 2TMDA 3T2ZA 1XDIA 2WHDA 4A99A 3C96A 1N4VA 2BCGG 3GWDA 2WDVA 3UOZA 3P4PA 1VDCA 1QJDA 1N4UA 2YM1A 4K8DA 1E6EA 2BCPA 3ABVA 3KPKA 5KRQA 4REKA 3IC9A 5C3JA 4KX6A 1N4WA 1PJ6A 3UOXA 1GRTA 2XVHA 2AQJA 3QJ4A 1DJNA 2PYXA 4H2NA 5KVIA 3RP8A 5BVAA 5KMPA 2B76A 2BC0A 2V60A 4NWZA 3UKKA 1CC6A 2BYBA 2B9YA 3CGDA 2WP9A 3DH9A 4FK1C 5IPYA 3UOYA 1E1MA 2GMJA 1BWCA 3NGCX 4H2RA 4AOXA 1GRFA 2X3NA 3ATQA 4OPLA 3HZLA 3AEAA 1GRGA 4TM4A 5M10A 1PBBA 2XFUA 1GRBA 5IQ4A 4GCMA 3BI4A 4JN9A 1PXAA 4Y4LA 3L8KA 2YAUA 2FJBA 5EOWA 3UTFA 2VRMA 2BS3A 3JSKA 5KMSA 1H6VA 3QSEA 1Q1RA 1VG9A 4E0VA 3GMBA 1GPEA 3DMEA 1QO8A 1GOSA 4U2SA 1ZOVA 3D8XA 1GTEA 2OALA 2YR6A 3CMMA 3E1TA 3G5QA 4K7ZA 5BUKA 1GETA 4U2LA 1CL0A 4NTCA 4ECHA 4GAPA 3NKSA 1D4EA 2PHHA 2XDOA 2WBAA 3NYEA 1GSNA 1F8RA 3CNDA 4D03A 3AD8B 1X31B 5ER0A 4I59A 2R0PA 1V59A 3CNSA 3GYIA 2Y6RA 1BF3A 4PAAA 2FBWA 1GERA 2R4EA 4N9XA 2WDRA 1ZOYA 2AAQA 4H4TA 3QSMA 1B4VA 1NHQA 2ARDA 4YSHA 4K2XA 4J31A 5JCNA 3IF9A 4CCRA 2EQ9A 4TLZA 3GMCA 1ONFA 3K7TA 3KD9A 3AB1A 1GRHA 3LZWA 4YSXA 1KF6A 2RABA 1KFYA 2C3DA 4B69A 5HYMA 3KPFA 2GMHA 4BK3A 3SFEA 4XWRA 4YTNA 4EM4A 4U8PA 2VVLG 4IV9A 4JQ9A 1H86A 2JB1A 3DJEA 5HXIA 1VG0A 4PABA 1MXTA 3VRBA 4AP1A 2NPXA 3KLJA 3AE4A 4LA1A 4OPGA 3SM8A 1HYUA 2E1MA 2Q6UA 3HYXA 3NNEA 4NEWA 3AEGA 2XLSA 2WPFA 2WESA
chains in the Genus database with same CATH topology
4OPTA 3GRSA 4NTEA 1Z6LA 2GR1A 2CDUA 3CGBA 4ADWA 4EQSA 4H2PA 4GDPA 1L9EA 4APNA 2BK4A 4O5QA 3EAOA 3SQPA 2C66A 1KSUA 1IUSA 2BRYA 3AD9B 1CJCA 3P4QA 4TM3A 1EL8A 4Y4MA 2I0ZA 2CULA 4M52A 1JNRA 2A8XA 3AWIA 2YG3A 4GDEA 3RP6A 3B3RA 1CC4A 5CQFA 1YQZA 4Z44A 1KSSA 3I6DA 3UTGA 3CIRA 4G9KA 3DK9A 2UZZA 1O5WA 3AYLA 3UKFA 5U25A 4UDPA 1LQUA 1YQ4A 1ZMDA 3CTYA 4IA5A 4I58A 4YWOA 3AE5A 4RSLA 4Z2UA 1IUXA 3T31A 2XCGA 1REOA 3CNJA 2ZBWA 1F8SA 3NK2X 2C67A 3P9UA 3AE6A 3NYFA 1PJ7A 3NIXA 2YG4A 2WU5A 2TPRA 3K7MX 4C77A 2GEWA 5EB4A 2BRAA 4B66A 3AE1A 4WCTA 5EBKA 3VR9A 3UP4A 2V5ZA 4A9WA 1H83A 1KDGA 4H4UA 3T2KA 1RP0A 5KNLA 4YKGA 1NG3A 1DOEA 2X50A 3AE9A 2DKHA 4K22A 4BK1A 1DXLA 1LVLA 1JU2A 1CJ3A 2X99A 3DJDA 4JY2A 1B5QA 4U8LA 3V3OA 4MJWA 3UTHA 1PBDA 2JK6A 4RG3A 1E39A 1GNDA 3O0HA 2EQ6A 2IVDA 3LJPA 1D5TA 1GV4A 1GXFA 1GT8A 2YG6A 1L9DA 2A89A 3GD4A 2VQBA 3EPTA 2C70A 4U8OA 3REDA 1TRBA 2GAHB 2BS2A 1EL7A 3CNTA 4GR1A 5FS8A 5TR3A 3RNMA 3CPJG 2EQ8A 4TM1A 1YQ3A 4HB9A 3IHMA 3NTDA 4B63A 1GRAA 3CNPA 4Z26A 5KOXA 4U8JA 2BK3A 1ZKQA 3GD3A 4K5RA 4UDRA 3SXIA 3BNMA 2QA2A 2YLSA 2R0GA 1RYIA 3QVRA 5EB5A 3GYJA 1VQWA 3NK1X 4DGKA 4G73A 5KVHA 2YVFA 1OJTA 3CGEA 3AE7A 3SZWA 3Q6JA 2XLRA 3AECA 1ELIA 3ATRA 4B68A 5C2TA 1IUTA 2V6OA 3NK0X 5JCIA 5GRTA 2WPEA 4U8KA 2ACZA 5J60A 2WQYA 3ALLA 3QFAA 4FDCB 3AD7B 2XLTA 4J36A 1BZLA 4AT2A 2AR8A 2XLPA 2YR5A 2ZZ0A 3KA7A 4D04A 3T37A 2Q0LA 1F8WA 3NRNA 4RG4A 2GRTA 2YLWA 1ZP0A 3GDNA 4CRTA 2JKCA 3DGZA 1CF3A 2GVCA 4KPRA 5LV9A 1OJDA 4NEVA 2GAGB 2RGJA 2FJEA 1LTXR 3HYVA 2YLTA 3WE0A 1GREA 4IA6A 3QFBA 2HQMA 1LPFA 2H89A 1LJ1A 3KU9A 3B6DA 4XXGA 4FX9A 1CBOA 4K5SA 4B64A 3BI5A 1E1KA 2IVEA 3AEEA 1GALA 2RGOA 3M0OA 4A5LA 4C3YA 5BULA 4EQRA 3C4AA 3G5SA 2CFYA 4EQWA 1TDNA 1TDKA 1GTHA 1N1PA 2DKIA 2X8GA 1PXCA 3M12A 4U8MA 5FS7A 3T2YA 1XHCA 1NHSA 1Y56A 3URHA 1NENA 3FG2P 2OAMA 1Q9IA 3GDPA 2BS4A 2A87A 2GR3A 1BKWA 1BGJA 1IUUA 2C76A 2J3NA 3BHFA 3IWAA 4C3XA 1K0IA 1KNPA 2YVJA 4G6HA 1DJQA 1FCDA 1Y56B 4OPCA 2B9XA 3AEBA 3FPZA 3ALJA 2YQUA 1TYTA 3SZ0A 1OJ9A 2JB3A 4B67A 4IVMB 4Z2TA 2BXSA 3UOVA 3DK8A 1NDAA 4A7AA 2C73A 3GSIA 1LQTA 1E1NA 2GQWA 2Y6QA 3RP7A 1JOAA 3CGCA 4J33A 1P2EA 3UKHA 4B1BA 2YVGA 1EL5A 4CY6A 2APGA 2OA1A 4EQXA 3SZFA 4Z43A 4A79A 4C74A 1TDFA 1FEBA 1B8SA 5KMRA 4AP3A 4CNKA 2C72A 3LOVA 2WS3A 2WP5A 3NN0X 4OCGA 4WX1A 2NVKX 1PXBA 4C5OA 2YLRA 4HA6A 4JY3A 1ZX9A 1O94A 4P9SA 4JDRA 1NEKA 2YLZA 4JNQA 4CBQA 5IQ1A 1K0LA 2WEUA 4TLXA 2H88A 2EQ7A 1PJ5A 2YG7A 3DA1A 3NHOX 5CKUA 4BV6A 3AE3A 3NT6A 4A65A 3FBSA 1TYPA 2E5VA 3CN8A 1GEUA 1O95A 4JNAA 2Z5XA 3AYIA 1FECA 5FMHA 3PO7A 1PBCA 3AEFA 1L0VA 1SEZA 3ITJA 4OPIA 1FEAA 3LXDA 2C4CA 1DOBA 2JBVA 3ICSA 4H4ZA 3H8LA 2C3CA 2B7SA 2VVMA 2WU2A 4G74A 3VQRA 5L46A 1ZK7A 2BACA 2V61A 3OZ2A 5KWFA 3CPIG 4YKFA 4J57A 1D4CA 2VZ2A 4NTDA 1K0JA 4J34A 2JAEA 3DJJA 2XVIA 4GAVA 1DODA 4IVOB 3T14A 2XYOA 1FL2A 2E4GA 5KOWA 3COXA 1YKJA 4CY8A 5M0ZA 3SFDA 2Z5YA 5FS6A 2GR2A 1DNCA 4H4RA 3BI2A 2R4JA 3V76A 2GB0A 2C75A 2C64A 4EIQA 1IJHA 2BA9A 3UKQA 4Z25A 4YXDA 2O9ZA 3UKLA 3SX6A 5GSNA 3SY4A 4O5UA 2FJDA 1XPQA 4USRA 4USQA 1F6MA 3K7QX 1JRZA 1PBFA 5DBJA 5JCKA 3M13A 2XVFA 3NN6X 2OLOA 2XFNA 1D7LA 3NLCA 3ZDNA 2B9WA 3S61A 4H4YA 2B7RA 3I3LA 3UKAA 5JCMA 2WOIA 1CJ2A 3ADAB 1NAAA 3NH3X 1BGNA 2VVLA 3SGLA 1M64A 4ZCCA 3ZYXA 1H7WA 1ZY8A 3VRAA 2XFQA 4H50A 1FOHA 1H84A 2R0CA 3NTAA 2R46A 3KVEA 3AXBA 3FMWA 3NG7X 1RSGA 2C7GA 3PS9A 2GV8A 4DNAA 3D1CA 4II3A 4EM3A 1JRXA 1Q1WA 5FS9A 4BJYA 2ZZCA 2GQFA 2YG5A 4OPUA 4U2TA 3CPHG 3S5WA 4H4WA 1JRYA 3R9UA 1LV0A 2WDQA 1CJ4A 4Z24A 5U1OA 1PS9A 2Q7VA 1AOGA 4XWZA 3QSSA 3F8PA 3P4SA 4BURA 1CHUA 1NHRA 3KKJA 2YM2A 1W4XA 3G5RA 5U63A 3BNUA 1M6IA 1UKVG 2X8CA 2XVEA 3L1RA 5HHFA 4EMJA 1ZMCA 2F5ZA 2QAEA 4UP3A 1MO9A 2X8HA 1P2HA 2XFPA 1NPXA 1S3EA 3II4A 4BJZA 4J56A 1NG4A 3LADA 1CC2A 3EANA 5KMQA 1XANA 4BK2A 4FK1A 4X4JA 1OJAA 2FJAA 2VRLA 3DK4A 3P4RA 4TM0A 4AOSA 4H7UA 1D4DA 3ISHA 4YTMA 3UP5A 2CVJA 2BK5A 1H81A 1D7YA 3RHAA 3K30A 1PBEA 4AT0A 2OLNA 4LIIA 4CCQA 3OC4A 1E7PA 3QVPA 4A6NA 3ICRA 2GR0A 3LZXA 1K4QA 1F3PA 4OVIA 2Q0KA 4X9NA 1ZDLA 3FIMB 3HYWA 2IIDA 5J7XA 4J2WA 2GH5A 4H4SA 2W0HA 3AE8A 3LB8A 4EMWA 3F8DA 3H4KA 3ALMA 4A6NB 1S3BA 2YR4A 4YT0A 4CNJA 4ICYA 2V3BA 3ICTA 4GUVA 1PN0A 1S2QA 1Y0PA 4U8IA 3SYIA 5HY5A 3PVCA 3UKPA 4EIPA 4H4XA 1IUWA 2ZZBA 2YLXA 3AE2A 4YSYA 2QCUA 3VRDB 5JCLA 2BXRA 1TDOA 3GYXA 1IUVA 2BC1A 3Q9TA 1GESA 4X9MA 4Y4NA 3C4NA 3F8RA 4G6GA 2JB2A 1E1LA 4YSZA 3AEDA 1H82A 2XFOA 5BRTA 3P1WA 3NYCA 1JNZA 1EL9A 1PHHA 4LU6A 4YTPA 4GF7A 2VQ7A 2XVJA 4EMIA 2RGHA 3AYJA 3IHGA 1OJCA 4U8NA 4OPDA 4B65A 1KNRA 2WOVA 2QA1A 2BABA 1JEHA 5KXJA 2WETA 2WP6A 1VRQB 1DOCA 4ZCDA 3DJGX 4H2QA 1YY5A 4NNJA 3SZCA 3T0KA 1EBDA 3GRTA 1QLBA 4II2A 3GWFA 1H7XA 4H4PA 2V3AA 2WOWA 4NZHA 1S2YA 2R45A 1NHPA 3UCLA 1B37A 2WPCA 3VR8A 4Z2RA 2YWLA 2VOUA 4DSGA 2XLUA 3V3NA 3BHKA 2R9ZA 4GRTA 4H4QA 1TDEA 2GF3A 3EF6A 4UDQA 3UTEA 4H4VA 1COYA 3DGHA 4ZN0A 1PDHA 1L9CA 1MOKA 2C65A 4DSHA 3H8IA 2TMDA 3T2ZA 1XDIA 2WHDA 4A99A 3C96A 1N4VA 2BCGG 3GWDA 2WDVA 3UOZA 3P4PA 1VDCA 1QJDA 1N4UA 2YM1A 4K8DA 1E6EA 2BCPA 3ABVA 3KPKA 5KRQA 4REKA 3IC9A 5C3JA 4KX6A 1N4WA 1PJ6A 3UOXA 1GRTA 2XVHA 2AQJA 3QJ4A 1DJNA 2PYXA 4H2NA 5KVIA 3RP8A 5BVAA 5KMPA 2B76A 2BC0A 2V60A 4NWZA 3UKKA 1CC6A 2BYBA 2B9YA 3CGDA 2WP9A 3DH9A 4FK1C 5IPYA 3UOYA 1E1MA 2GMJA 1BWCA 3NGCX 4H2RA 4AOXA 1GRFA 2X3NA 3ATQA 4OPLA 3HZLA 3AEAA 1GRGA 4TM4A 5M10A 1PBBA 2XFUA 1GRBA 5IQ4A 4GCMA 3BI4A 4JN9A 1PXAA 4Y4LA 3L8KA 2YAUA 2FJBA 5EOWA 3UTFA 2VRMA 2BS3A 3JSKA 5KMSA 1H6VA 3QSEA 1Q1RA 1VG9A 4E0VA 3GMBA 1GPEA 3DMEA 1QO8A 1GOSA 4U2SA 1ZOVA 3D8XA 1GTEA 2OALA 2YR6A 3CMMA 3E1TA 3G5QA 4K7ZA 5BUKA 1GETA 4U2LA 1CL0A 4NTCA 4ECHA 4GAPA 3NKSA 1D4EA 2PHHA 2XDOA 2WBAA 3NYEA 1GSNA 1F8RA 3CNDA 4D03A 3AD8B 1X31B 5ER0A 4I59A 2R0PA 1V59A 3CNSA 3GYIA 2Y6RA 1BF3A 4PAAA 2FBWA 1GERA 2R4EA 4N9XA 2WDRA 1ZOYA 2AAQA 4H4TA 3QSMA 1B4VA 1NHQA 2ARDA 4YSHA 4K2XA 4J31A 5JCNA 3IF9A 4CCRA 2EQ9A 4TLZA 3GMCA 1ONFA 3K7TA 3KD9A 3AB1A 1GRHA 3LZWA 4YSXA 1KF6A 2RABA 1KFYA 2C3DA 4B69A 5HYMA 3KPFA 2GMHA 4BK3A 3SFEA 4XWRA 4YTNA 4EM4A 4U8PA 2VVLG 4IV9A 4JQ9A 1H86A 2JB1A 3DJEA 5HXIA 1VG0A 4PABA 1MXTA 3VRBA 4AP1A 2NPXA 3KLJA 3AE4A 4LA1A 4OPGA 3SM8A 1HYUA 2E1MA 2Q6UA 3HYXA 3NNEA 4NEWA 3AEGA 2XLSA 2WPFA 2WESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPT A;  3GRS A;  4NTE A;  1Z6L A;  2GR1 A;  2CDU A;  3CGB A;  4ADW A;  4EQS A;  4H2P A;  4GDP A;  1L9E A;  4APN A;  2BK4 A;  4O5Q A;  3EAO A;  3SQP A;  2C66 A;  1KSU A;  1IUS A;  3AD9 B;  1CJC A;  3P4Q A;  4TM3 A;  1EL8 A;  4Y4M A;  2I0Z A;  2CUL A;  4M52 A;  1JNR A;  2A8X A;  3AWI A;  2YG3 A;  4GDE A;  3RP6 A;  3B3R A;  1CC4 A;  5CQF A;  1YQZ A;  4Z44 A;  1KSS A;  3I6D A;  3UTG A;  3CIR A;  3DK9 A;  2UZZ A;  1O5W A;  3AYL A;  3UKF A;  5U25 A;  4UDP A;  1LQU A;  1YQ4 A;  1ZMD A;  3CTY A;  4IA5 A;  4I58 A;  4YWO A;  3AE5 A;  4RSL A;  4Z2U A;  1IUX A;  2XCG A;  1REO A;  3CNJ A;  2ZBW A;  1F8S A;  3NK2 X;  2C67 A;  3P9U A;  3AE6 A;  3NYF A;  1PJ7 A;  3NIX A;  2YG4 A;  2WU5 A;  2TPR A;  3K7M X;  4C77 A;  2GEW A;  5EB4 A;  4B66 A;  3AE1 A;  4WCT A;  5EBK A;  3VR9 A;  3UP4 A;  2V5Z A;  4A9W A;  1H83 A;  1KDG A;  4H4U A;  1RP0 A;  4YKG A;  1NG3 A;  1DOE A;  2X50 A;  3AE9 A;  2DKH A;  4K22 A;  4BK1 A;  1DXL A;  1LVL A;  1JU2 A;  1CJ3 A;  2X99 A;  3DJD A;  4JY2 A;  1B5Q A;  4U8L A;  3V3O A;  4MJW A;  3UTH A;  1PBD A;  2JK6 A;  4RG3 A;  1E39 A;  1GND A;  3O0H A;  2EQ6 A;  2IVD A;  3LJP A;  1D5T A;  1GV4 A;  1GXF A;  1GT8 A;  2YG6 A;  1L9D A;  2A89 A;  3GD4 A;  2VQB A;  3EPT A;  2C70 A;  4U8O A;  3RED A;  1TRB A;  2GAH B;  2BS2 A;  1EL7 A;  3CNT A;  4GR1 A;  5FS8 A;  5TR3 A;  3RNM A;  3CPJ G;  2EQ8 A;  4TM1 A;  1YQ3 A;  4HB9 A;  3IHM A;  3NTD A;  4B63 A;  1GRA A;  3CNP A;  4Z26 A;  5KOX A;  4U8J A;  2BK3 A;  1ZKQ A;  3GD3 A;  4K5R A;  4UDR A;  3BNM A;  2QA2 A;  2YLS A;  2R0G A;  1RYI A;  3QVR A;  5EB5 A;  3GYJ A;  1VQW A;  3NK1 X;  4DGK A;  5KVH A;  2YVF A;  1OJT A;  3CGE A;  3AE7 A;  3Q6J A;  2XLR A;  3AEC A;  1ELI A;  3ATR A;  4B68 A;  5C2T A;  1IUT A;  2V6O A;  3NK0 X;  5JCI A;  5GRT A;  2WPE A;  4U8K A;  2ACZ A;  5J60 A;  2WQY A;  3ALL A;  3QFA A;  4FDC B;  3AD7 B;  2XLT A;  4J36 A;  1BZL A;  4AT2 A;  2AR8 A;  2XLP A;  2YR5 A;  2ZZ0 A;  3KA7 A;  4D04 A;  3T37 A;  2Q0L A;  1F8W A;  3NRN A;  4RG4 A;  2GRT A;  2YLW A;  1ZP0 A;  3GDN A;  4CRT A;  2JKC A;  3DGZ A;  1CF3 A;  2GVC A;  4KPR A;  5LV9 A;  1OJD A;  4NEV A;  2GAG B;  2RGJ A;  2FJE A;  1LTX R;  3WE0 A;  2YLT A;  1GRE A;  4IA6 A;  3QFB A;  2HQM A;  1LPF A;  2H89 A;  1LJ1 A;  3KU9 A;  3B6D A;  4XXG A;  4FX9 A;  1CBO A;  4K5S A;  4B64 A;  3BI5 A;  1E1K A;  2IVE A;  3AEE A;  1GAL A;  2RGO A;  3M0O A;  4A5L A;  4C3Y A;  5BUL A;  4EQR A;  3C4A A;  3G5S A;  2CFY A;  4EQW A;  1TDN A;  1TDK A;  1GTH A;  1N1P A;  2DKI A;  2X8G A;  1PXC A;  3M12 A;  4U8M A;  5FS7 A;  1XHC A;  1NHS A;  1Y56 A;  3URH A;  1NEN A;  3FG2 P;  2OAM A;  1Q9I A;  3GDP A;  2BS4 A;  2A87 A;  2GR3 A;  1BKW A;  1BGJ A;  1IUU A;  2C76 A;  2J3N A;  3BHF A;  3IWA A;  4C3X A;  1K0I A;  1KNP A;  2YVJ A;  1DJQ A;  1FCD A;  1Y56 B;  4OPC A;  2B9X A;  3AEB A;  3FPZ A;  3ALJ A;  2YQU A;  1TYT A;  1OJ9 A;  2JB3 A;  4B67 A;  4IVM B;  4Z2T A;  2BXS A;  3UOV A;  3DK8 A;  1NDA A;  4A7A A;  2C73 A;  3GSI A;  1LQT A;  1E1N A;  2GQW A;  2Y6Q A;  3RP7 A;  1JOA A;  3CGC A;  4J33 A;  1P2E A;  3UKH A;  4B1B A;  2YVG A;  1EL5 A;  4CY6 A;  2APG A;  2OA1 A;  4EQX A;  4Z43 A;  4A79 A;  4C74 A;  1TDF A;  1FEB A;  1B8S A;  4AP3 A;  4CNK A;  2C72 A;  3LOV A;  2WS3 A;  2WP5 A;  3NN0 X;  4OCG A;  4WX1 A;  2NVK X;  1PXB A;  4C5O A;  2YLR A;  4HA6 A;  4JY3 A;  1ZX9 A;  1O94 A;  4P9S A;  4JDR A;  1NEK A;  2YLZ A;  4JNQ A;  4CBQ A;  5IQ1 A;  1K0L A;  2WEU A;  4TLX A;  2H88 A;  2EQ7 A;  1PJ5 A;  2YG7 A;  3DA1 A;  3NHO X;  5CKU A;  4BV6 A;  3AE3 A;  3NT6 A;  4A65 A;  3FBS A;  1TYP A;  2E5V A;  3CN8 A;  1GEU A;  1O95 A;  4JNA A;  2Z5X A;  3AYI A;  1FEC A;  5FMH A;  3PO7 A;  1PBC A;  3AEF A;  1L0V A;  1SEZ A;  3ITJ A;  4OPI A;  1FEA A;  3LXD A;  1DOB A;  2JBV A;  3ICS A;  4H4Z A;  3H8L A;  2C3C A;  2B7S A;  2VVM A;  2WU2 A;  3VQR A;  5L46 A;  1ZK7 A;  2BAC A;  2V61 A;  3OZ2 A;  5KWF A;  3CPI G;  4YKF A;  4J57 A;  1D4C A;  2VZ2 A;  4NTD A;  1K0J A;  4J34 A;  2JAE A;  3DJJ A;  2XVI A;  4IVO B;  1DOD A;  2XYO A;  1FL2 A;  2E4G A;  5KOW A;  3COX A;  1YKJ A;  4CY8 A;  5M0Z A;  3SFD A;  2Z5Y A;  5FS6 A;  2GR2 A;  1DNC A;  4H4R A;  3BI2 A;  2R4J A;  3V76 A;  2GB0 A;  2C75 A;  2C64 A;  4EIQ A;  1IJH A;  2BA9 A;  3UKQ A;  4Z25 A;  4YXD A;  2O9Z A;  3UKL A;  5GSN A;  4O5U A;  2FJD A;  1XPQ A;  4USR A;  4USQ A;  1F6M A;  3K7Q X;  1JRZ A;  1PBF A;  5DBJ A;  5JCK A;  3M13 A;  2XVF A;  3NN6 X;  2OLO A;  2XFN A;  1D7L A;  3NLC A;  3ZDN A;  2B9W A;  3S61 A;  4H4Y A;  2B7R A;  3I3L A;  3UKA A;  5JCM A;  2WOI A;  1CJ2 A;  3ADA B;  1NAA A;  3NH3 X;  1BGN A;  2VVL A;  3SGL A;  1M64 A;  4ZCC A;  3ZYX A;  1H7W A;  1ZY8 A;  3VRA A;  2XFQ A;  4H50 A;  1FOH A;  1H84 A;  2R0C A;  3NTA A;  2R46 A;  3KVE A;  3AXB A;  3FMW A;  3NG7 X;  1RSG A;  2C7G A;  3PS9 A;  2GV8 A;  4DNA A;  3D1C A;  4EM3 A;  1JRX A;  1Q1W A;  5FS9 A;  4BJY A;  2ZZC A;  2GQF A;  2YG5 A;  4OPU A;  4U2T A;  3CPH G;  3S5W A;  4H4W A;  1JRY A;  3R9U A;  1LV0 A;  2WDQ A;  1CJ4 A;  4Z24 A;  5U1O A;  1PS9 A;  2Q7V A;  1AOG A;  4XWZ A;  3QSS A;  3F8P A;  3P4S A;  4BUR A;  1CHU A;  1NHR A;  3KKJ A;  2YM2 A;  1W4X A;  3G5R A;  5U63 A;  3BNU A;  1M6I A;  1UKV G;  2X8C A;  2XVE A;  3L1R A;  5HHF A;  4EMJ A;  1ZMC A;  2F5Z A;  2QAE A;  4UP3 A;  1MO9 A;  2X8H A;  1P2H A;  2XFP A;  1NPX A;  1S3E A;  3II4 A;  4BJZ A;  4J56 A;  1NG4 A;  3LAD A;  1CC2 A;  3EAN A;  1XAN A;  4BK2 A;  4FK1 A;  4X4J A;  1OJA A;  2FJA A;  2VRL A;  3DK4 A;  3P4R A;  4TM0 A;  4AOS A;  4H7U A;  1D4D A;  3ISH A;  4YTM A;  3UP5 A;  2CVJ A;  2BK5 A;  1H81 A;  1D7Y A;  3RHA A;  3K30 A;  1PBE A;  4AT0 A;  2OLN A;  4LII A;  4CCQ A;  3OC4 A;  1E7P A;  3QVP A;  4A6N A;  3ICR A;  2GR0 A;  3LZX A;  1K4Q A;  1F3P A;  4OVI A;  2Q0K A;  4X9N A;  1ZDL A;  3FIM B;  2IID A;  5J7X A;  4J2W A;  2GH5 A;  4H4S A;  2W0H A;  3AE8 A;  3LB8 A;  4EMW A;  3F8D A;  3H4K A;  3ALM A;  4A6N B;  1S3B A;  2YR4 A;  4YT0 A;  4CNJ A;  4ICY A;  2V3B A;  3ICT A;  4GUV A;  1PN0 A;  1S2Q A;  1Y0P A;  4U8I A;  5HY5 A;  3PVC A;  3UKP A;  4EIP A;  4H4X A;  1IUW A;  2ZZB A;  2YLX A;  3AE2 A;  4YSY A;  2QCU A;  3VRD B;  5JCL A;  2BXR A;  1TDO A;  3Q9T A;  1IUV A;  2BC1 A;  4X9M A;  1GES A;  4Y4N A;  3C4N A;  3F8R A;  2JB2 A;  1E1L A;  4YSZ A;  3AED A;  1H82 A;  2XFO A;  5BRT A;  3P1W A;  3NYC A;  1JNZ A;  1EL9 A;  1PHH A;  4LU6 A;  4YTP A;  4GF7 A;  2VQ7 A;  2XVJ A;  4EMI A;  2RGH A;  3AYJ A;  3IHG A;  1OJC A;  4U8N A;  4OPD A;  4B65 A;  1KNR A;  2WOV A;  2QA1 A;  2BAB A;  1JEH A;  5KXJ A;  2WET A;  2WP6 A;  1VRQ B;  1DOC A;  4ZCD A;  3DJG X;  4H2Q A;  1YY5 A;  1EBD A;  3GRT A;  1QLB A;  3GWF A;  1H7X A;  4H4P A;  2V3A A;  2WOW A;  4NZH A;  1S2Y A;  2R45 A;  1NHP A;  3UCL A;  1B37 A;  2WPC A;  3VR8 A;  4Z2R A;  2YWL A;  2VOU A;  4DSG A;  2XLU A;  3V3N A;  3BHK A;  2R9Z A;  4GRT A;  4H4Q A;  1TDE A;  2GF3 A;  3EF6 A;  4UDQ A;  3UTE A;  4H4V A;  1COY A;  3DGH A;  4ZN0 A;  1PDH A;  1L9C A;  1MOK A;  2C65 A;  4DSH A;  3H8I A;  2TMD A;  1XDI A;  2WHD A;  4A99 A;  3C96 A;  1N4V A;  2BCG G;  3GWD A;  2WDV A;  3UOZ A;  3P4P A;  1VDC A;  1QJD A;  1N4U A;  2YM1 A;  4K8D A;  1E6E A;  2BCP A;  3ABV A;  5KRQ A;  4REK A;  3IC9 A;  5C3J A;  4KX6 A;  1N4W A;  1PJ6 A;  3UOX A;  1GRT A;  2XVH A;  2AQJ A;  3QJ4 A;  1DJN A;  2PYX A;  4H2N A;  5KVI A;  3RP8 A;  5BVA A;  2B76 A;  2BC0 A;  2V60 A;  3UKK A;  1CC6 A;  2BYB A;  2B9Y A;  3CGD A;  2WP9 A;  3DH9 A;  4FK1 C;  5IPY A;  3UOY A;  1E1M A;  2GMJ A;  1BWC A;  3NGC X;  4H2R A;  4AOX A;  1GRF A;  2X3N A;  3ATQ A;  4OPL A;  3HZL A;  3AEA A;  1GRG A;  4TM4 A;  5M10 A;  1PBB A;  2XFU A;  1GRB A;  5IQ4 A;  4GCM A;  3BI4 A;  4JN9 A;  1PXA A;  4Y4L A;  3L8K A;  2YAU A;  2FJB A;  5EOW A;  3UTF A;  2VRM A;  2BS3 A;  3JSK A;  1H6V A;  3QSE A;  1Q1R A;  1VG9 A;  4E0V A;  3GMB A;  1GPE A;  3DME A;  1QO8 A;  1GOS A;  4U2S A;  1ZOV A;  3D8X A;  1GTE A;  2OAL A;  2YR6 A;  3E1T A;  3G5Q A;  4K7Z A;  5BUK A;  1GET A;  4U2L A;  1CL0 A;  4NTC A;  4ECH A;  3NKS A;  1D4E A;  2PHH A;  2XDO A;  2WBA A;  3NYE A;  1GSN A;  1F8R A;  3CND A;  4D03 A;  3AD8 B;  1X31 B;  5ER0 A;  4I59 A;  2R0P A;  1V59 A;  3CNS A;  3GYI A;  2Y6R A;  1BF3 A;  4PAA A;  2FBW A;  1GER A;  2R4E A;  4N9X A;  2WDR A;  1ZOY A;  2AAQ A;  4H4T A;  3QSM A;  1B4V A;  1NHQ A;  2ARD A;  4YSH A;  4K2X A;  4J31 A;  5JCN A;  3IF9 A;  4CCR A;  2EQ9 A;  4TLZ A;  3GMC A;  1ONF A;  3K7T A;  3KD9 A;  3AB1 A;  1GRH A;  3LZW A;  4YSX A;  1KF6 A;  2RAB A;  1KFY A;  2C3D A;  4B69 A;  5HYM A;  3KPF A;  2GMH A;  4BK3 A;  3SFE A;  4XWR A;  4YTN A;  4EM4 A;  4U8P A;  2VVL G;  4IV9 A;  4JQ9 A;  1H86 A;  2JB1 A;  3DJE A;  5HXI A;  1VG0 A;  4PAB A;  1MXT A;  3VRB A;  4AP1 A;  2NPX A;  3KLJ A;  3AE4 A;  4LA1 A;  4OPG A;  3SM8 A;  1HYU A;  2E1M A;  2Q6U A;  3NNE A;  4NEW A;  3AEG A;  2XLS A;  2WPF A;  2WES A; 
#chains in the Genus database with same CATH topology
 4OPT A;  3GRS A;  4NTE A;  1Z6L A;  2GR1 A;  2CDU A;  3CGB A;  4ADW A;  4EQS A;  4H2P A;  4GDP A;  1L9E A;  4APN A;  2BK4 A;  4O5Q A;  3EAO A;  3SQP A;  2C66 A;  1KSU A;  1IUS A;  2BRY A;  3AD9 B;  1CJC A;  3P4Q A;  4TM3 A;  1EL8 A;  4Y4M A;  2I0Z A;  2CUL A;  4M52 A;  1JNR A;  2A8X A;  3AWI A;  2YG3 A;  4GDE A;  3RP6 A;  3B3R A;  1CC4 A;  5CQF A;  1YQZ A;  4Z44 A;  1KSS A;  3I6D A;  3UTG A;  3CIR A;  4G9K A;  3DK9 A;  2UZZ A;  1O5W A;  3AYL A;  3UKF A;  5U25 A;  4UDP A;  1LQU A;  1YQ4 A;  1ZMD A;  3CTY A;  4IA5 A;  4I58 A;  4YWO A;  3AE5 A;  4RSL A;  4Z2U A;  1IUX A;  3T31 A;  2XCG A;  1REO A;  3CNJ A;  2ZBW A;  1F8S A;  3NK2 X;  2C67 A;  3P9U A;  3AE6 A;  3NYF A;  1PJ7 A;  3NIX A;  2YG4 A;  2WU5 A;  2TPR A;  3K7M X;  4C77 A;  2GEW A;  5EB4 A;  2BRA A;  4B66 A;  3AE1 A;  4WCT A;  5EBK A;  3VR9 A;  3UP4 A;  2V5Z A;  4A9W A;  1H83 A;  1KDG A;  4H4U A;  3T2K A;  1RP0 A;  5KNL A;  4YKG A;  1NG3 A;  1DOE A;  2X50 A;  3AE9 A;  2DKH A;  4K22 A;  4BK1 A;  1DXL A;  1LVL A;  1JU2 A;  1CJ3 A;  2X99 A;  3DJD A;  4JY2 A;  1B5Q A;  4U8L A;  3V3O A;  4MJW A;  3UTH A;  1PBD A;  2JK6 A;  4RG3 A;  1E39 A;  1GND A;  3O0H A;  2EQ6 A;  2IVD A;  3LJP A;  1D5T A;  1GV4 A;  1GXF A;  1GT8 A;  2YG6 A;  1L9D A;  2A89 A;  3GD4 A;  2VQB A;  3EPT A;  2C70 A;  4U8O A;  3RED A;  1TRB A;  2GAH B;  2BS2 A;  1EL7 A;  3CNT A;  4GR1 A;  5FS8 A;  5TR3 A;  3RNM A;  3CPJ G;  2EQ8 A;  4TM1 A;  1YQ3 A;  4HB9 A;  3IHM A;  3NTD A;  4B63 A;  1GRA A;  3CNP A;  4Z26 A;  5KOX A;  4U8J A;  2BK3 A;  1ZKQ A;  3GD3 A;  4K5R A;  4UDR A;  3SXI A;  3BNM A;  2QA2 A;  2YLS A;  2R0G A;  1RYI A;  3QVR A;  5EB5 A;  3GYJ A;  1VQW A;  3NK1 X;  4DGK A;  4G73 A;  5KVH A;  2YVF A;  1OJT A;  3CGE A;  3AE7 A;  3SZW A;  3Q6J A;  2XLR A;  3AEC A;  1ELI A;  3ATR A;  4B68 A;  5C2T A;  1IUT A;  2V6O A;  3NK0 X;  5JCI A;  5GRT A;  2WPE A;  4U8K A;  2ACZ A;  5J60 A;  2WQY A;  3ALL A;  3QFA A;  4FDC B;  3AD7 B;  2XLT A;  4J36 A;  1BZL A;  4AT2 A;  2AR8 A;  2XLP A;  2YR5 A;  2ZZ0 A;  3KA7 A;  4D04 A;  3T37 A;  2Q0L A;  1F8W A;  3NRN A;  4RG4 A;  2GRT A;  2YLW A;  1ZP0 A;  3GDN A;  4CRT A;  2JKC A;  3DGZ A;  1CF3 A;  2GVC A;  4KPR A;  5LV9 A;  1OJD A;  4NEV A;  2GAG B;  2RGJ A;  2FJE A;  1LTX R;  3HYV A;  2YLT A;  3WE0 A;  1GRE A;  4IA6 A;  3QFB A;  2HQM A;  1LPF A;  2H89 A;  1LJ1 A;  3KU9 A;  3B6D A;  4XXG A;  4FX9 A;  1CBO A;  4K5S A;  4B64 A;  3BI5 A;  1E1K A;  2IVE A;  3AEE A;  1GAL A;  2RGO A;  3M0O A;  4A5L A;  4C3Y A;  5BUL A;  4EQR A;  3C4A A;  3G5S A;  2CFY A;  4EQW A;  1TDN A;  1TDK A;  1GTH A;  1N1P A;  2DKI A;  2X8G A;  1PXC A;  3M12 A;  4U8M A;  5FS7 A;  3T2Y A;  1XHC A;  1NHS A;  1Y56 A;  3URH A;  1NEN A;  3FG2 P;  2OAM A;  1Q9I A;  3GDP A;  2BS4 A;  2A87 A;  2GR3 A;  1BKW A;  1BGJ A;  1IUU A;  2C76 A;  2J3N A;  3BHF A;  3IWA A;  4C3X A;  1K0I A;  1KNP A;  2YVJ A;  4G6H A;  1DJQ A;  1FCD A;  1Y56 B;  4OPC A;  2B9X A;  3AEB A;  3FPZ A;  3ALJ A;  2YQU A;  1TYT A;  3SZ0 A;  1OJ9 A;  2JB3 A;  4B67 A;  4IVM B;  4Z2T A;  2BXS A;  3UOV A;  3DK8 A;  1NDA A;  4A7A A;  2C73 A;  3GSI A;  1LQT A;  1E1N A;  2GQW A;  2Y6Q A;  3RP7 A;  1JOA A;  3CGC A;  4J33 A;  1P2E A;  3UKH A;  4B1B A;  2YVG A;  1EL5 A;  4CY6 A;  2APG A;  2OA1 A;  4EQX A;  3SZF A;  4Z43 A;  4A79 A;  4C74 A;  1TDF A;  1FEB A;  1B8S A;  5KMR A;  4AP3 A;  4CNK A;  2C72 A;  3LOV A;  2WS3 A;  2WP5 A;  3NN0 X;  4OCG A;  4WX1 A;  2NVK X;  1PXB A;  4C5O A;  2YLR A;  4HA6 A;  4JY3 A;  1ZX9 A;  1O94 A;  4P9S A;  4JDR A;  1NEK A;  2YLZ A;  4JNQ A;  4CBQ A;  5IQ1 A;  1K0L A;  2WEU A;  4TLX A;  2H88 A;  2EQ7 A;  1PJ5 A;  2YG7 A;  3DA1 A;  3NHO X;  5CKU A;  4BV6 A;  3AE3 A;  3NT6 A;  4A65 A;  3FBS A;  1TYP A;  2E5V A;  3CN8 A;  1GEU A;  1O95 A;  4JNA A;  2Z5X A;  3AYI A;  1FEC A;  5FMH A;  3PO7 A;  1PBC A;  3AEF A;  1L0V A;  1SEZ A;  3ITJ A;  4OPI A;  1FEA A;  3LXD A;  2C4C A;  1DOB A;  2JBV A;  3ICS A;  4H4Z A;  3H8L A;  2C3C A;  2B7S A;  2VVM A;  2WU2 A;  4G74 A;  3VQR A;  5L46 A;  1ZK7 A;  2BAC A;  2V61 A;  3OZ2 A;  5KWF A;  3CPI G;  4YKF A;  4J57 A;  1D4C A;  2VZ2 A;  4NTD A;  1K0J A;  4J34 A;  2JAE A;  3DJJ A;  2XVI A;  4GAV A;  1DOD A;  4IVO B;  3T14 A;  2XYO A;  1FL2 A;  2E4G A;  5KOW A;  3COX A;  1YKJ A;  4CY8 A;  5M0Z A;  3SFD A;  2Z5Y A;  5FS6 A;  2GR2 A;  1DNC A;  4H4R A;  3BI2 A;  2R4J A;  3V76 A;  2GB0 A;  2C75 A;  2C64 A;  4EIQ A;  1IJH A;  2BA9 A;  3UKQ A;  4Z25 A;  4YXD A;  2O9Z A;  3UKL A;  3SX6 A;  5GSN A;  3SY4 A;  4O5U A;  2FJD A;  1XPQ A;  4USR A;  4USQ A;  1F6M A;  3K7Q X;  1JRZ A;  1PBF A;  5DBJ A;  5JCK A;  3M13 A;  2XVF A;  3NN6 X;  2OLO A;  2XFN A;  1D7L A;  3NLC A;  3ZDN A;  2B9W A;  3S61 A;  4H4Y A;  2B7R A;  3I3L A;  3UKA A;  5JCM A;  2WOI A;  1CJ2 A;  3ADA B;  1NAA A;  3NH3 X;  1BGN A;  2VVL A;  3SGL A;  1M64 A;  4ZCC A;  3ZYX A;  1H7W A;  1ZY8 A;  3VRA A;  2XFQ A;  4H50 A;  1FOH A;  1H84 A;  2R0C A;  3NTA A;  2R46 A;  3KVE A;  3AXB A;  3FMW A;  3NG7 X;  1RSG A;  2C7G A;  3PS9 A;  2GV8 A;  4DNA A;  3D1C A;  4II3 A;  4EM3 A;  1JRX A;  1Q1W A;  5FS9 A;  4BJY A;  2ZZC A;  2GQF A;  2YG5 A;  4OPU A;  4U2T A;  3CPH G;  3S5W A;  4H4W A;  1JRY A;  3R9U A;  1LV0 A;  2WDQ A;  1CJ4 A;  4Z24 A;  5U1O A;  1PS9 A;  2Q7V A;  1AOG A;  4XWZ A;  3QSS A;  3F8P A;  3P4S A;  4BUR A;  1CHU A;  1NHR A;  3KKJ A;  2YM2 A;  1W4X A;  3G5R A;  5U63 A;  3BNU A;  1M6I A;  1UKV G;  2X8C A;  2XVE A;  3L1R A;  5HHF A;  4EMJ A;  1ZMC A;  2F5Z A;  2QAE A;  4UP3 A;  1MO9 A;  2X8H A;  1P2H A;  2XFP A;  1NPX A;  1S3E A;  3II4 A;  4BJZ A;  4J56 A;  1NG4 A;  3LAD A;  1CC2 A;  3EAN A;  5KMQ A;  1XAN A;  4BK2 A;  4FK1 A;  4X4J A;  1OJA A;  2FJA A;  2VRL A;  3DK4 A;  3P4R A;  4TM0 A;  4AOS A;  4H7U A;  1D4D A;  3ISH A;  4YTM A;  3UP5 A;  2CVJ A;  2BK5 A;  1H81 A;  1D7Y A;  3RHA A;  3K30 A;  1PBE A;  4AT0 A;  2OLN A;  4LII A;  4CCQ A;  3OC4 A;  1E7P A;  3QVP A;  4A6N A;  3ICR A;  2GR0 A;  3LZX A;  1K4Q A;  1F3P A;  4OVI A;  2Q0K A;  4X9N A;  1ZDL A;  3FIM B;  3HYW A;  2IID A;  5J7X A;  4J2W A;  2GH5 A;  4H4S A;  2W0H A;  3AE8 A;  3LB8 A;  4EMW A;  3F8D A;  3H4K A;  3ALM A;  4A6N B;  1S3B A;  2YR4 A;  4YT0 A;  4CNJ A;  4ICY A;  2V3B A;  3ICT A;  4GUV A;  1PN0 A;  1S2Q A;  1Y0P A;  4U8I A;  3SYI A;  5HY5 A;  3PVC A;  3UKP A;  4EIP A;  4H4X A;  1IUW A;  2ZZB A;  2YLX A;  3AE2 A;  4YSY A;  2QCU A;  3VRD B;  5JCL A;  2BXR A;  1TDO A;  3GYX A;  1IUV A;  2BC1 A;  3Q9T A;  1GES A;  4X9M A;  4Y4N A;  3C4N A;  3F8R A;  4G6G A;  2JB2 A;  1E1L A;  4YSZ A;  3AED A;  1H82 A;  2XFO A;  5BRT A;  3P1W A;  3NYC A;  1JNZ A;  1EL9 A;  1PHH A;  4LU6 A;  4YTP A;  4GF7 A;  2VQ7 A;  2XVJ A;  4EMI A;  2RGH A;  3AYJ A;  3IHG A;  1OJC A;  4U8N A;  4OPD A;  4B65 A;  1KNR A;  2WOV A;  2QA1 A;  2BAB A;  1JEH A;  5KXJ A;  2WET A;  2WP6 A;  1VRQ B;  1DOC A;  4ZCD A;  3DJG X;  4H2Q A;  1YY5 A;  4NNJ A;  3SZC A;  3T0K A;  1EBD A;  3GRT A;  1QLB A;  4II2 A;  3GWF A;  1H7X A;  4H4P A;  2V3A A;  2WOW A;  4NZH A;  1S2Y A;  2R45 A;  1NHP A;  3UCL A;  1B37 A;  2WPC A;  3VR8 A;  4Z2R A;  2YWL A;  2VOU A;  4DSG A;  2XLU A;  3V3N A;  3BHK A;  2R9Z A;  4GRT A;  4H4Q A;  1TDE A;  2GF3 A;  3EF6 A;  4UDQ A;  3UTE A;  4H4V A;  1COY A;  3DGH A;  4ZN0 A;  1PDH A;  1L9C A;  1MOK A;  2C65 A;  4DSH A;  3H8I A;  2TMD A;  3T2Z A;  1XDI A;  2WHD A;  4A99 A;  3C96 A;  1N4V A;  2BCG G;  3GWD A;  2WDV A;  3UOZ A;  3P4P A;  1VDC A;  1QJD A;  1N4U A;  2YM1 A;  4K8D A;  1E6E A;  2BCP A;  3ABV A;  3KPK A;  5KRQ A;  4REK A;  3IC9 A;  5C3J A;  4KX6 A;  1N4W A;  1PJ6 A;  3UOX A;  1GRT A;  2XVH A;  2AQJ A;  3QJ4 A;  1DJN A;  2PYX A;  4H2N A;  5KVI A;  3RP8 A;  5BVA A;  5KMP A;  2B76 A;  2BC0 A;  2V60 A;  4NWZ A;  3UKK A;  1CC6 A;  2BYB A;  2B9Y A;  3CGD A;  2WP9 A;  3DH9 A;  4FK1 C;  5IPY A;  3UOY A;  1E1M A;  2GMJ A;  1BWC A;  3NGC X;  4H2R A;  4AOX A;  1GRF A;  2X3N A;  3ATQ A;  4OPL A;  3HZL A;  3AEA A;  1GRG A;  4TM4 A;  5M10 A;  1PBB A;  2XFU A;  1GRB A;  5IQ4 A;  4GCM A;  3BI4 A;  4JN9 A;  1PXA A;  4Y4L A;  3L8K A;  2YAU A;  2FJB A;  5EOW A;  3UTF A;  2VRM A;  2BS3 A;  3JSK A;  5KMS A;  1H6V A;  3QSE A;  1Q1R A;  1VG9 A;  4E0V A;  3GMB A;  1GPE A;  3DME A;  1QO8 A;  1GOS A;  4U2S A;  1ZOV A;  3D8X A;  1GTE A;  2OAL A;  2YR6 A;  3CMM A;  3E1T A;  3G5Q A;  4K7Z A;  5BUK A;  1GET A;  4U2L A;  1CL0 A;  4NTC A;  4ECH A;  4GAP A;  3NKS A;  1D4E A;  2PHH A;  2XDO A;  2WBA A;  3NYE A;  1GSN A;  1F8R A;  3CND A;  4D03 A;  3AD8 B;  1X31 B;  5ER0 A;  4I59 A;  2R0P A;  1V59 A;  3CNS A;  3GYI A;  2Y6R A;  1BF3 A;  4PAA A;  2FBW A;  1GER A;  2R4E A;  4N9X A;  2WDR A;  1ZOY A;  2AAQ A;  4H4T A;  3QSM A;  1B4V A;  1NHQ A;  2ARD A;  4YSH A;  4K2X A;  4J31 A;  5JCN A;  3IF9 A;  4CCR A;  2EQ9 A;  4TLZ A;  3GMC A;  1ONF A;  3K7T A;  3KD9 A;  3AB1 A;  1GRH A;  3LZW A;  4YSX A;  1KF6 A;  2RAB A;  1KFY A;  2C3D A;  4B69 A;  5HYM A;  3KPF A;  2GMH A;  4BK3 A;  3SFE A;  4XWR A;  4YTN A;  4EM4 A;  4U8P A;  2VVL G;  4IV9 A;  4JQ9 A;  1H86 A;  2JB1 A;  3DJE A;  5HXI A;  1VG0 A;  4PAB A;  1MXT A;  3VRB A;  4AP1 A;  2NPX A;  3KLJ A;  3AE4 A;  4LA1 A;  4OPG A;  3SM8 A;  1HYU A;  2E1M A;  2Q6U A;  3HYX A;  3NNE A;  4NEW A;  3AEG A;  2XLS A;  2WPF A;  2WES A; 
#chains in the Genus database with same CATH homology
 4OPT A;  3GRS A;  4NTE A;  1Z6L A;  2GR1 A;  2CDU A;  3CGB A;  4ADW A;  4EQS A;  4H2P A;  4GDP A;  1L9E A;  4APN A;  2BK4 A;  4O5Q A;  3EAO A;  3SQP A;  2C66 A;  1KSU A;  1IUS A;  2BRY A;  3AD9 B;  1CJC A;  3P4Q A;  4TM3 A;  1EL8 A;  4Y4M A;  2I0Z A;  2CUL A;  4M52 A;  1JNR A;  2A8X A;  3AWI A;  2YG3 A;  4GDE A;  3RP6 A;  3B3R A;  1CC4 A;  5CQF A;  1YQZ A;  4Z44 A;  1KSS A;  3I6D A;  3UTG A;  3CIR A;  4G9K A;  3DK9 A;  2UZZ A;  1O5W A;  3AYL A;  3UKF A;  5U25 A;  4UDP A;  1LQU A;  1YQ4 A;  1ZMD A;  3CTY A;  4IA5 A;  4I58 A;  4YWO A;  3AE5 A;  4RSL A;  4Z2U A;  1IUX A;  3T31 A;  2XCG A;  1REO A;  3CNJ A;  2ZBW A;  1F8S A;  3NK2 X;  2C67 A;  3P9U A;  3AE6 A;  3NYF A;  1PJ7 A;  3NIX A;  2YG4 A;  2WU5 A;  2TPR A;  3K7M X;  4C77 A;  2GEW A;  5EB4 A;  2BRA A;  4B66 A;  3AE1 A;  4WCT A;  5EBK A;  3VR9 A;  3UP4 A;  2V5Z A;  4A9W A;  1H83 A;  1KDG A;  4H4U A;  3T2K A;  1RP0 A;  5KNL A;  4YKG A;  1NG3 A;  1DOE A;  2X50 A;  3AE9 A;  2DKH A;  4K22 A;  4BK1 A;  1DXL A;  1LVL A;  1JU2 A;  1CJ3 A;  2X99 A;  3DJD A;  4JY2 A;  1B5Q A;  4U8L A;  3V3O A;  4MJW A;  3UTH A;  1PBD A;  2JK6 A;  4RG3 A;  1E39 A;  1GND A;  3O0H A;  2EQ6 A;  2IVD A;  3LJP A;  1D5T A;  1GV4 A;  1GXF A;  1GT8 A;  2YG6 A;  1L9D A;  2A89 A;  3GD4 A;  2VQB A;  3EPT A;  2C70 A;  4U8O A;  3RED A;  1TRB A;  2GAH B;  2BS2 A;  1EL7 A;  3CNT A;  4GR1 A;  5FS8 A;  5TR3 A;  3RNM A;  3CPJ G;  2EQ8 A;  4TM1 A;  1YQ3 A;  4HB9 A;  3IHM A;  3NTD A;  4B63 A;  1GRA A;  3CNP A;  4Z26 A;  5KOX A;  4U8J A;  2BK3 A;  1ZKQ A;  3GD3 A;  4K5R A;  4UDR A;  3SXI A;  3BNM A;  2QA2 A;  2YLS A;  2R0G A;  1RYI A;  3QVR A;  5EB5 A;  3GYJ A;  1VQW A;  3NK1 X;  4DGK A;  4G73 A;  5KVH A;  2YVF A;  1OJT A;  3CGE A;  3AE7 A;  3SZW A;  3Q6J A;  2XLR A;  3AEC A;  1ELI A;  3ATR A;  4B68 A;  5C2T A;  1IUT A;  2V6O A;  3NK0 X;  5JCI A;  5GRT A;  2WPE A;  4U8K A;  2ACZ A;  5J60 A;  2WQY A;  3ALL A;  3QFA A;  4FDC B;  3AD7 B;  2XLT A;  4J36 A;  1BZL A;  4AT2 A;  2AR8 A;  2XLP A;  2YR5 A;  2ZZ0 A;  3KA7 A;  4D04 A;  3T37 A;  2Q0L A;  1F8W A;  3NRN A;  4RG4 A;  2GRT A;  2YLW A;  1ZP0 A;  3GDN A;  4CRT A;  2JKC A;  3DGZ A;  1CF3 A;  2GVC A;  4KPR A;  5LV9 A;  1OJD A;  4NEV A;  2GAG B;  2RGJ A;  2FJE A;  1LTX R;  3HYV A;  2YLT A;  3WE0 A;  1GRE A;  4IA6 A;  3QFB A;  2HQM A;  1LPF A;  2H89 A;  1LJ1 A;  3KU9 A;  3B6D A;  4XXG A;  4FX9 A;  1CBO A;  4K5S A;  4B64 A;  3BI5 A;  1E1K A;  2IVE A;  3AEE A;  1GAL A;  2RGO A;  3M0O A;  4A5L A;  4C3Y A;  5BUL A;  4EQR A;  3C4A A;  3G5S A;  2CFY A;  4EQW A;  1TDN A;  1TDK A;  1GTH A;  1N1P A;  2DKI A;  2X8G A;  1PXC A;  3M12 A;  4U8M A;  5FS7 A;  3T2Y A;  1XHC A;  1NHS A;  1Y56 A;  3URH A;  1NEN A;  3FG2 P;  2OAM A;  1Q9I A;  3GDP A;  2BS4 A;  2A87 A;  2GR3 A;  1BKW A;  1BGJ A;  1IUU A;  2C76 A;  2J3N A;  3BHF A;  3IWA A;  4C3X A;  1K0I A;  1KNP A;  2YVJ A;  4G6H A;  1DJQ A;  1FCD A;  1Y56 B;  4OPC A;  2B9X A;  3AEB A;  3FPZ A;  3ALJ A;  2YQU A;  1TYT A;  3SZ0 A;  1OJ9 A;  2JB3 A;  4B67 A;  4IVM B;  4Z2T A;  2BXS A;  3UOV A;  3DK8 A;  1NDA A;  4A7A A;  2C73 A;  3GSI A;  1LQT A;  1E1N A;  2GQW A;  2Y6Q A;  3RP7 A;  1JOA A;  3CGC A;  4J33 A;  1P2E A;  3UKH A;  4B1B A;  2YVG A;  1EL5 A;  4CY6 A;  2APG A;  2OA1 A;  4EQX A;  3SZF A;  4Z43 A;  4A79 A;  4C74 A;  1TDF A;  1FEB A;  1B8S A;  5KMR A;  4AP3 A;  4CNK A;  2C72 A;  3LOV A;  2WS3 A;  2WP5 A;  3NN0 X;  4OCG A;  4WX1 A;  2NVK X;  1PXB A;  4C5O A;  2YLR A;  4HA6 A;  4JY3 A;  1ZX9 A;  1O94 A;  4P9S A;  4JDR A;  1NEK A;  2YLZ A;  4JNQ A;  4CBQ A;  5IQ1 A;  1K0L A;  2WEU A;  4TLX A;  2H88 A;  2EQ7 A;  1PJ5 A;  2YG7 A;  3DA1 A;  3NHO X;  5CKU A;  4BV6 A;  3AE3 A;  3NT6 A;  4A65 A;  3FBS A;  1TYP A;  2E5V A;  3CN8 A;  1GEU A;  1O95 A;  4JNA A;  2Z5X A;  3AYI A;  1FEC A;  5FMH A;  3PO7 A;  1PBC A;  3AEF A;  1L0V A;  1SEZ A;  3ITJ A;  4OPI A;  1FEA A;  3LXD A;  2C4C A;  1DOB A;  2JBV A;  3ICS A;  4H4Z A;  3H8L A;  2C3C A;  2B7S A;  2VVM A;  2WU2 A;  4G74 A;  3VQR A;  5L46 A;  1ZK7 A;  2BAC A;  2V61 A;  3OZ2 A;  5KWF A;  3CPI G;  4YKF A;  4J57 A;  1D4C A;  2VZ2 A;  4NTD A;  1K0J A;  4J34 A;  2JAE A;  3DJJ A;  2XVI A;  4GAV A;  1DOD A;  4IVO B;  3T14 A;  2XYO A;  1FL2 A;  2E4G A;  5KOW A;  3COX A;  1YKJ A;  4CY8 A;  5M0Z A;  3SFD A;  2Z5Y A;  5FS6 A;  2GR2 A;  1DNC A;  4H4R A;  3BI2 A;  2R4J A;  3V76 A;  2GB0 A;  2C75 A;  2C64 A;  4EIQ A;  1IJH A;  2BA9 A;  3UKQ A;  4Z25 A;  4YXD A;  2O9Z A;  3UKL A;  3SX6 A;  5GSN A;  3SY4 A;  4O5U A;  2FJD A;  1XPQ A;  4USR A;  4USQ A;  1F6M A;  3K7Q X;  1JRZ A;  1PBF A;  5DBJ A;  5JCK A;  3M13 A;  2XVF A;  3NN6 X;  2OLO A;  2XFN A;  1D7L A;  3NLC A;  3ZDN A;  2B9W A;  3S61 A;  4H4Y A;  2B7R A;  3I3L A;  3UKA A;  5JCM A;  2WOI A;  1CJ2 A;  3ADA B;  1NAA A;  3NH3 X;  1BGN A;  2VVL A;  3SGL A;  1M64 A;  4ZCC A;  3ZYX A;  1H7W A;  1ZY8 A;  3VRA A;  2XFQ A;  4H50 A;  1FOH A;  1H84 A;  2R0C A;  3NTA A;  2R46 A;  3KVE A;  3AXB A;  3FMW A;  3NG7 X;  1RSG A;  2C7G A;  3PS9 A;  2GV8 A;  4DNA A;  3D1C A;  4II3 A;  4EM3 A;  1JRX A;  1Q1W A;  5FS9 A;  4BJY A;  2ZZC A;  2GQF A;  2YG5 A;  4OPU A;  4U2T A;  3CPH G;  3S5W A;  4H4W A;  1JRY A;  3R9U A;  1LV0 A;  2WDQ A;  1CJ4 A;  4Z24 A;  5U1O A;  1PS9 A;  2Q7V A;  1AOG A;  4XWZ A;  3QSS A;  3F8P A;  3P4S A;  4BUR A;  1CHU A;  1NHR A;  3KKJ A;  2YM2 A;  1W4X A;  3G5R A;  5U63 A;  3BNU A;  1M6I A;  1UKV G;  2X8C A;  2XVE A;  3L1R A;  5HHF A;  4EMJ A;  1ZMC A;  2F5Z A;  2QAE A;  4UP3 A;  1MO9 A;  2X8H A;  1P2H A;  2XFP A;  1NPX A;  1S3E A;  3II4 A;  4BJZ A;  4J56 A;  1NG4 A;  3LAD A;  1CC2 A;  3EAN A;  5KMQ A;  1XAN A;  4BK2 A;  4FK1 A;  4X4J A;  1OJA A;  2FJA A;  2VRL A;  3DK4 A;  3P4R A;  4TM0 A;  4AOS A;  4H7U A;  1D4D A;  3ISH A;  4YTM A;  3UP5 A;  2CVJ A;  2BK5 A;  1H81 A;  1D7Y A;  3RHA A;  3K30 A;  1PBE A;  4AT0 A;  2OLN A;  4LII A;  4CCQ A;  3OC4 A;  1E7P A;  3QVP A;  4A6N A;  3ICR A;  2GR0 A;  3LZX A;  1K4Q A;  1F3P A;  4OVI A;  2Q0K A;  4X9N A;  1ZDL A;  3FIM B;  3HYW A;  2IID A;  5J7X A;  4J2W A;  2GH5 A;  4H4S A;  2W0H A;  3AE8 A;  3LB8 A;  4EMW A;  3F8D A;  3H4K A;  3ALM A;  4A6N B;  1S3B A;  2YR4 A;  4YT0 A;  4CNJ A;  4ICY A;  2V3B A;  3ICT A;  4GUV A;  1PN0 A;  1S2Q A;  1Y0P A;  4U8I A;  3SYI A;  5HY5 A;  3PVC A;  3UKP A;  4EIP A;  4H4X A;  1IUW A;  2ZZB A;  2YLX A;  3AE2 A;  4YSY A;  2QCU A;  3VRD B;  5JCL A;  2BXR A;  1TDO A;  3GYX A;  1IUV A;  2BC1 A;  3Q9T A;  1GES A;  4X9M A;  4Y4N A;  3C4N A;  3F8R A;  4G6G A;  2JB2 A;  1E1L A;  4YSZ A;  3AED A;  1H82 A;  2XFO A;  5BRT A;  3P1W A;  3NYC A;  1JNZ A;  1EL9 A;  1PHH A;  4LU6 A;  4YTP A;  4GF7 A;  2VQ7 A;  2XVJ A;  4EMI A;  2RGH A;  3AYJ A;  3IHG A;  1OJC A;  4U8N A;  4OPD A;  4B65 A;  1KNR A;  2WOV A;  2QA1 A;  2BAB A;  1JEH A;  5KXJ A;  2WET A;  2WP6 A;  1VRQ B;  1DOC A;  4ZCD A;  3DJG X;  4H2Q A;  1YY5 A;  4NNJ A;  3SZC A;  3T0K A;  1EBD A;  3GRT A;  1QLB A;  4II2 A;  3GWF A;  1H7X A;  4H4P A;  2V3A A;  2WOW A;  4NZH A;  1S2Y A;  2R45 A;  1NHP A;  3UCL A;  1B37 A;  2WPC A;  3VR8 A;  4Z2R A;  2YWL A;  2VOU A;  4DSG A;  2XLU A;  3V3N A;  3BHK A;  2R9Z A;  4GRT A;  4H4Q A;  1TDE A;  2GF3 A;  3EF6 A;  4UDQ A;  3UTE A;  4H4V A;  1COY A;  3DGH A;  4ZN0 A;  1PDH A;  1L9C A;  1MOK A;  2C65 A;  4DSH A;  3H8I A;  2TMD A;  3T2Z A;  1XDI A;  2WHD A;  4A99 A;  3C96 A;  1N4V A;  2BCG G;  3GWD A;  2WDV A;  3UOZ A;  3P4P A;  1VDC A;  1QJD A;  1N4U A;  2YM1 A;  4K8D A;  1E6E A;  2BCP A;  3ABV A;  3KPK A;  5KRQ A;  4REK A;  3IC9 A;  5C3J A;  4KX6 A;  1N4W A;  1PJ6 A;  3UOX A;  1GRT A;  2XVH A;  2AQJ A;  3QJ4 A;  1DJN A;  2PYX A;  4H2N A;  5KVI A;  3RP8 A;  5BVA A;  5KMP A;  2B76 A;  2BC0 A;  2V60 A;  4NWZ A;  3UKK A;  1CC6 A;  2BYB A;  2B9Y A;  3CGD A;  2WP9 A;  3DH9 A;  4FK1 C;  5IPY A;  3UOY A;  1E1M A;  2GMJ A;  1BWC A;  3NGC X;  4H2R A;  4AOX A;  1GRF A;  2X3N A;  3ATQ A;  4OPL A;  3HZL A;  3AEA A;  1GRG A;  4TM4 A;  5M10 A;  1PBB A;  2XFU A;  1GRB A;  5IQ4 A;  4GCM A;  3BI4 A;  4JN9 A;  1PXA A;  4Y4L A;  3L8K A;  2YAU A;  2FJB A;  5EOW A;  3UTF A;  2VRM A;  2BS3 A;  3JSK A;  5KMS A;  1H6V A;  3QSE A;  1Q1R A;  1VG9 A;  4E0V A;  3GMB A;  1GPE A;  3DME A;  1QO8 A;  1GOS A;  4U2S A;  1ZOV A;  3D8X A;  1GTE A;  2OAL A;  2YR6 A;  3CMM A;  3E1T A;  3G5Q A;  4K7Z A;  5BUK A;  1GET A;  4U2L A;  1CL0 A;  4NTC A;  4ECH A;  4GAP A;  3NKS A;  1D4E A;  2PHH A;  2XDO A;  2WBA A;  3NYE A;  1GSN A;  1F8R A;  3CND A;  4D03 A;  3AD8 B;  1X31 B;  5ER0 A;  4I59 A;  2R0P A;  1V59 A;  3CNS A;  3GYI A;  2Y6R A;  1BF3 A;  4PAA A;  2FBW A;  1GER A;  2R4E A;  4N9X A;  2WDR A;  1ZOY A;  2AAQ A;  4H4T A;  3QSM A;  1B4V A;  1NHQ A;  2ARD A;  4YSH A;  4K2X A;  4J31 A;  5JCN A;  3IF9 A;  4CCR A;  2EQ9 A;  4TLZ A;  3GMC A;  1ONF A;  3K7T A;  3KD9 A;  3AB1 A;  1GRH A;  3LZW A;  4YSX A;  1KF6 A;  2RAB A;  1KFY A;  2C3D A;  4B69 A;  5HYM A;  3KPF A;  2GMH A;  4BK3 A;  3SFE A;  4XWR A;  4YTN A;  4EM4 A;  4U8P A;  2VVL G;  4IV9 A;  4JQ9 A;  1H86 A;  2JB1 A;  3DJE A;  5HXI A;  1VG0 A;  4PAB A;  1MXT A;  3VRB A;  4AP1 A;  2NPX A;  3KLJ A;  3AE4 A;  4LA1 A;  4OPG A;  3SM8 A;  1HYU A;  2E1M A;  2Q6U A;  3HYX A;  3NNE A;  4NEW A;  3AEG A;  2XLS A;  2WPF A;  2WES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...