3DMEA

Crystal structure of conserved exported protein from bordetella pertussis. northeast structural genomics target ber141
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
366
structure length
366
Chain Sequence
b'TDIDCIVIGAGVVGLAIARALAAGGHEVLVAEAAEGIGTGTSSRNSEVIHAGIYYPADSLKARLCVRGKHLLYEYCAARGVPHQRLGKLIVATSDAEASQLDSIARRAGANGVDDLQHIDGAAARRLEPALHCTAALVSPSTGIVDSHALMLAYQGDAESDGAQLVFHTPLIAGRVRPEGGFELDFGGAEPMTLSCRVLINAAGLHAPGLARRIEGIPRDSIPPEYLCKGSYFTLAGRAPFSRLIYPVPQHAGLGVHLTLDLGGQAKFGPDTEWIATEDYTLDPRRADVFYAAVRSYWPALPDGALAPGYTGIRPKISGPHEPAADFAIAGPASHGVAGLVNLYGIESPGLTASLAIAEETLARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved exported protein
publication title Crystal structure of conserved exported protein from Bordetella pertussis. NorthEast Structural Genomics target BeR141
rcsb
source organism Bordetella pertussis
molecule tags Structural genomics, unknown function
total genus 110
structure length 366
sequence length 366
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3dmeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3dmeA01
3VQRA 4I59A 3CTYA 2BK5A 2JB2A 2ARDA 5J7XA 1MO9A 1PJ5A 4B67A 1H81A 1IUVA 2GV8A 1GOSA 4C3YA 3P4RA 1TDKA 1KSSA 4CCQA 3G3EA 4P9SA 2XLPA 2E4AA 1ZP0A 1DAOA 3P4PA 3F8DA 3ADAB 4H4YA 1ZK7A 1ZX9A 4KX6A 4YJFA 4CBQA 3PS9A 5FS6A 3S5WA 5U63A 2YLTA 2IVDA 2X8CA 4KPRA 1PJ6A 3CNDA 4A6NA 4TM4A 2W0HA 4H4VA 1YQ3A 4Z43A 3LB8A 3P4SA 3P4QA 3QSSA 2QAEA 5KVHA 1ZOVA 5J60A 3II4A 4CCRA 1S3EA 3NLCA 3QSMA 2GR3A 4X4JA 1RSGA 1PJ7A 1NDAA 4AOXA 1FOHA 3RP7A 1PN0A 3QSEA 2XLTA 2BCGG 4U2SA 1K0LA 3ICRA 1E6EA 5EBKA 3VRBA 5FMHA 3QFBA 1KF6A 2Q6UA 1H7WA 3UP4A 1F8RA 1GSNA 3NH3X 2DKHA 4GDPA 1NG3A 1PBCA 1YQ4A 1F3PA 1D5TA 1GTEA 4RG4A 1EVIA 2XLRA 3IHMA 4YJDA 2X3NA 2WOWA 2XVHA 4UP3A 1TDOA 2AQJA 5IPYA 5L46A 1M64A 1NHPA 4D04A 4EIPA 1QLBA 2BS3A 1JRYA 2XVJA 2FJBA 1E1LA 2CULA 2YVJA 3ATQA 4BK3A 3NK0X 1CBOA 1E39A 4GRTA 4A7AA 2B7SA 2WEUA 1SEZA 3K7MX 2RGHA 2C76A 3W4IA 1NENA 2GR1A 3UTFA 1TYPA 2YG5A 4IA5A 1XHCA 1Y56A 2Q0KA 2WPEA 4BJYA 2VVMA 4C3XA 2IVEA 3SGLA 2EQ9A 2CVJA 3AE3A 2GQFA 3DJJA 2BXRA 4NZHA 5ER0A 1D4CA 3GWFA 1BWCA 1P2EA 4JY2A 2OALA 4NEVA 1K0JA 3ATRA 1NEKA 1ONFA 3LADA 1PXCA 2R4EA 3AB1A 1GNDA 2XYOA 5GRTA 5FS7A 4OPCA 1IUSA 4YJHA 2E4GA 3G5QA 4U2LA 3UOZA 1K4QA 1JNRA 3NRNA 4N9XA 3C96A 1JOAA 4NTEA 3UOVA 1KFYA 4K2XA 5KOWA 4A9WA 3H8LA 4BV6A 4B63A 2VRMA 1REOA 1Q1RA 3GRSA 4EMJA 4USQA 2Q7VA 5KVIA 1B4VA 5IQ4A 1B37A 4Z26A 1EL5A 1S2YA 2ACZA 1LV0A 1JRZA 4Z24A 2E1MA 5JCMA 3FMWA 2VVLA 2WU5A 2YR4A 2WP9A 3NG7X 4K5SA 4XWZA 4Y4LA 3SFDA 4AP1A 1VQWA 4YKFA 2QA2A 2C66A 4H2PA 1DDOA 3G5SA 1L9CA 1IUWA 1RP0A 2YR6A 4RG3A 1COYA 1ELIA 4REKA 3FBSA 4JY3A 5M0ZA 3UOYA 4YJGA 4M52A 3FIMB 5BULA 4IA6A 2BC0A 2ZZBA 3FG2P 3ALJA 3B6DA 1YY5A 1GTHA 2C67A 5JCKA 3CN8A 2GB0A 1GESA 2E5VA 3K7QX 1NPXA 1D7YA 1ZMCA 2V60A 1VE9A 1MXTA 3NTAA 2WS3A 2BS4A 1GEUA 3R9UA 4BK1A 2PHHA 2JK6A 4Y4NA 3UKHA 4U2TA 2B9XA 3DJEA 2YVFA 2YLXA 4Z2UA 2XCGA 3CNTA 3ISHA 1DJNA 2I0ZA 1VG9A 2ZZCA 3VR8A 3CGEA 3DMEA 1S2QA 2VOUA 3AE7A 3LZXA 2APGA 1S3BA 4EM4A 3KVEA 5LV9A 1XDIA 2VZ2A 1CJ4A 3LZWA 3RNMA 1GERA 1OJTA 2VVLG 2GH5A 3COXA 4CY6A 3NYFA 2XVIA 4J36A 1XANA 1LJ1A 3C4AA 4CY8A 1L9EA 2XFNA 4H2RA 4NTCA 3W4KA 2QCUA 1PXBA 1MOKA 2FBWA 3QJ4A 2X8HA 1NG4A 4YTPA 1N1PA 3GSIA 4H4ZA 4EM3A 1Y0PA 4YXDA 1GV4A 1EL7A 3E1TA 1Z6LA 1ZOYA 4JNAA 2TMDA 2X99A 1DXLA 2JBVA 4O5UA 4IVMB 3GMCA 4EQSA 4O5QA 3LOVA 3EF6A 1TDEA 3DA1A 5CQFA 2YLWA 4BK2A 2BC1A 2C65A 3CIRA 3D1CA 2RGOA 1CHUA 4Z2RA 3AYJA 2FJAA 1TDNA 3AEBA 1F8SA 1Q9IA 3CPJG 2XFUA 2E48A 2DKIA 2O9ZA 4U8NA 2WDVA 2R9ZA 4B68A 2OAMA 2XFOA 3UKAA 2AAQA 2JB3A 4GR1A 1C0LA 2GR2A 2B9WA 1C0IA 3AD7B 1O94A 3UOXA 1KDGA 4OCGA 1PS9A 5U25A 3Q9TA 1EBDA 2GRTA 3KU9A 4J57A 4EMIA 4JNQA 1BF3A 1N4WA 3NT6A 4WCTA 2A8XA 3GRTA 4IVOB 4C77A 1CC2A 2R0GA 2YAUA 2BACA 4K22A 1KNPA 3AECA 3F8PA 4U8LA 5KWFA 3CGBA 4YT0A 5EB5A 2X50A 2WOIA 3UP5A 3DJGX 4AT2A 1DOCA 1ZMDA 1PHHA 2YG7A 2Z5XA 5BRTA 3AE9A 3AE1A 4GF7A 2Z5YA 4ADWA 3KPFA 3CNPA 1PXAA 3AE6A 3UKKA 3VRDB 2WPFA 3HZLA 1FCDA 4MJWA 4OPGA 4HA6A 1ZY8A 2R0PA 2XVFA 1GRGA 1HYUA 2Y6QA 4NEWA 5JCIA 2YLRA 4U8IA 2GVCA 3ICSA 4JN9A 1LPFA 1H86A 3DK9A 2YR5A 4Z44A 2E82A 2GR0A 1AN9A 1JU2A 4EQWA 1VG0A 3AYLA 1H84A 4FX9A 5TR3A 3C4NA 3M12A 4YSHA 1B8SA 4USRA 5M10A 3AEAA 4J56A 4EQXA 3GWDA 1CJ3A 1D7LA 4QFCA 4LU6A 3DK4A 3I3LA 2WPCA 3DJDA 1PBBA 2YVGA 1NAAA 5DBJA 2C70A 1ZDLA 3IC9A 1IJHA 3L8KA 1CC4A 2NVKX 3K7TA 3PO7A 4YJGB 1H7XA 3S61A 4H4XA 1GRTA 1JRXA 4XXGA 4BURA 3LJPA 2JB1A 2CDUA 3EAOA 1Q1WA 4ZCCA 5FS8A 1C0PA 1JEHA 1OJDA 2OA1A 2Y6RA 3GYJA 3UKLA 3UTEA 4GUVA 3AWIA 4TM1A 1CF3A 4OVIA 1BKWA 2GEWA 3AE4A 4I58A 1N4UA 4IV9A 3UCLA 1GREA 2YWLA 2GAHB 1P2HA 2V61A 2ZBWA 3IWAA 1GRBA 4OPIA 5IQ1A 4YTNA 3ALMA 1IUUA 3AE8A 5JCNA 3BHFA 3GD3A 2X8GA 1GPEA 3NN0X 2JAEA 3AEEA 2V6OA 4AOSA 1D4EA 1GRFA 2BK3A 1CJCA 1GRAA 1GRHA 1LVLA 2XLUA 4B64A 1H83A 4ICYA 5BUKA 3QVRA 4UDPA 4TM0A 4UDQA 2BA9A 3CGCA 1F6MA 2AR8A 2DU8A 4J33A 3CNSA 5KRQA 1JNZA 1LTXR 2OLOA 1H6VA 4CRTA 4DNAA 1N4VA 3KLJA 4CNKA 3VR9A 2YLZA 1W4XA 4YJFB 2BS2A 4H4QA 2C7GA 2B7RA 4EMWA 3P9UA 3DH9A 4K5RA 3UKPA 1E1NA 4C5OA 4A6NB 1DOBA 1BZLA 1GETA 1NHSA 2C73A 4H7UA 1CL0A 3NHOX 1C0KA 2XLSA 4H4PA 4AT0A 2JKCA 3DK8A 2R4JA 3CPHG 4NTDA 4YTMA 3CPIG 4PAAA 4TLZA 1QJDA 3AEFA 2YM2A 5BVAA 2WBAA 2VQBA 1YKJA 1ZKQA 2YM1A 1AOGA 1PBDA 3NYCA 1D4DA 4D03A 2UZZA 5HYMA 3BI4A 4H4SA 3ZNNA 4UDRA 4FK1C 3BNMA 2H89A 1EL9A 4H4TA 4LA1A 1F8WA 3NK1X 3WE0A 4YSYA 2V5ZA 4JDRA 2V3AA 3V3OA 2WP5A 1PBFA 1FECA 4H2QA 2BYBA 3KA7A 4U8KA 2GF3A 2XFPA 4U8OA 1PDHA 2CFYA 1CJ2A 1KSUA 2C75A 3V76A 1H82A 4B65A 1KIFA 5CKUA 1RYIA 1FL2A 3JSKA 3RHAA 2C3DA 3NN6X 1O95A 3QFAA 4AP3A 2NPXA 2V3BA 2RGJA 1PBEA 2C3CA 3K30A 1FEAA 4YKGA 1IUXA 4FDCB 5EOWA 4YWOA 2FJDA 3NKSA 4J34A 2HQMA 4QFDA 1NHQA 3H8IA 4LIIA 2FJEA 4Z25A 4PABA 3ALLA 4A5LA 4DGKA 3PVCA 2EQ6A 2XDOA 4FK1A 3O0HA 4TLXA 4X9MA 4WX1A 2BABA 2XFQA 1Y56B 4Y4MA 1X31B 1BGJA 1L0VA 5JCLA 3RP8A 2GMHA 3WGTA 2WESA 3B3RA 4A79A 2R45A 3BNUA 1DNCA 1BGNA 2C64A 4U8PA 2B76A 2ZZ0A 1TDFA 1EL8A 2WU2A 4EIQA 3H4KA 3ZNOA 4YJHB 4OPLA 2E49A 3IF9A 3NK2X 1DODA 3BI2A 1NHRA 3IHGA 3ITJA 4C74A 4GCMA 3NNEA 3M13A 5HY5A 3CNJA 1DJQA 2EQ8A 4YSZA 1DOEA 3BHKA 3SM8A 2GMJA 3GMBA 3OZ2A 3T37A 3ZNPA 1TYTA 5GSNA 3VRAA 4H50A 3ZYXA 4YSXA 3NIXA 5EB4A 3UTGA 4DSGA 4GDEA 3REDA 4A65A 4XWRA 3AYIA 4RSLA 1TRBA 3FPZA 1OJ9A 1L9DA 4OPTA 1E7PA 2R0CA 1M6IA 5KXJA 1KNRA 3RP6A 2WP6A 3AE2A 2RABA 2XVEA 4ECHA 1OJCA 3UKFA 4Z2TA 1LQUA 2YQUA 3GDNA 3OC4A 2J3NA 3AD8B 3F8RA 3KKJA 5HXIA 1XPQA 3QVPA 3AXBA 2BK4A 3P1WA 2YLSA 4B66A 3UTHA 2A89A 3NYEA 2H88A 3G5RA 2WHDA 3I6DA 2Q0LA 2PYXA 3AEGA 1YQZA 2WOVA 2YG4A 4H2NA 4HB9A 3URHA 3EANA 5C3JA 2TPRA 1GT8A 4B69A 1CC6A 3ICTA 1VDCA 3SQPA 2OLNA 3LXDA 3AD9B 4H4RA 3BI5A 1V59A 1VRQB 3AEDA 3CGDA 4K7ZA 3M0OA 3GDPA 1B5QA 4ZN0A 3NGCX 2WETA 3GD4A 4H4UA 4OPUA 1OJAA 4H4WA 2WDQA 3EPTA 1IUTA 2C72A 3UKQA 1O5WA 1UKVG 2GAGB 2YG3A 4A99A 2QA1A 4OPDA 3KD9A 5FS9A 1E1KA 2GQWA 4U8JA 1FEBA 2R46A 3AE5A 4K8DA 2IIDA 3D8XA 3W4JA 3L1RA 2VQ7A 4CNJA 4EQRA 2BCPA 2EQ7A 2A87A 3ZNQA 3V3NA 5C2TA 1GALA 1QO8A 4U8MA 1GXFA 2VRLA 3ABVA 4J2WA 4B1BA 4E0VA 3Q6JA 2YG6A 3CUKA 2WDRA 4X9NA 2F5ZA 5U1OA 4DSHA 3DGHA 1K0IA 4ZCDA 2BXSA 2B9YA 4J31A 4APNA 3DGZA 1E1MA 2WQYA 3ZDNA 3NTDA 5HHFA 4JQ9A 4TM3A 5KOXA 1LQTA 4BJZA 3SFEA 3GYIA
chains in the Genus database with same CATH superfamily
3VQRA 4I59A 3CTYA 2BK5A 2JB2A 2ARDA 5J7XA 1MO9A 1PJ5A 4B67A 1H81A 1IUVA 2GV8A 1GOSA 4C3YA 3P4RA 1TDKA 1KSSA 4CCQA 3G3EA 4P9SA 2XLPA 2E4AA 1ZP0A 1DAOA 3P4PA 3F8DA 3ADAB 4H4YA 1ZK7A 1ZX9A 4KX6A 4YJFA 4CBQA 3PS9A 5FS6A 3S5WA 5U63A 2YLTA 2IVDA 2X8CA 4KPRA 1PJ6A 3CNDA 4A6NA 4TM4A 2W0HA 4H4VA 1YQ3A 4Z43A 3LB8A 3P4SA 3P4QA 3QSSA 2QAEA 5KVHA 1ZOVA 5J60A 3II4A 4CCRA 1S3EA 3NLCA 3QSMA 2GR3A 4X4JA 1RSGA 1PJ7A 1NDAA 4AOXA 1FOHA 3RP7A 1PN0A 3QSEA 2XLTA 2BCGG 4U2SA 1K0LA 3ICRA 1E6EA 3KPKA 5EBKA 3VRBA 5FMHA 3QFBA 1KF6A 2Q6UA 1H7WA 3UP4A 1F8RA 1GSNA 3NH3X 2DKHA 4GDPA 1NG3A 1PBCA 1YQ4A 1F3PA 1D5TA 1GTEA 4RG4A 1EVIA 2XLRA 3IHMA 2X3NA 4YJDA 2WOWA 2XVHA 4UP3A 1TDOA 2AQJA 5IPYA 5L46A 1M64A 4EIPA 1NHPA 4D04A 1QLBA 2BS3A 1JRYA 2XVJA 2FJBA 1E1LA 2CULA 2YVJA 4BK3A 3ATQA 3NK0X 1CBOA 1E39A 4GRTA 4A7AA 2B7SA 2WEUA 3CMMA 1SEZA 3K7MX 2RGHA 2C76A 3W4IA 1NENA 2GR1A 3UTFA 1TYPA 2YG5A 4IA5A 1XHCA 1Y56A 2Q0KA 2WPEA 4BJYA 2VVMA 4C3XA 2IVEA 3SGLA 2EQ9A 2CVJA 3AE3A 2GQFA 3DJJA 2BXRA 4NZHA 5ER0A 1D4CA 3GWFA 1BWCA 4JY2A 1P2EA 2OALA 4NEVA 1K0JA 3ATRA 1NEKA 1ONFA 3LADA 1PXCA 2R4EA 3AB1A 1GNDA 2XYOA 5GRTA 5FS7A 4OPCA 1IUSA 4YJHA 2E4GA 3G5QA 4U2LA 3UOZA 1K4QA 1JNRA 3NRNA 4N9XA 3C96A 1JOAA 4NTEA 3UOVA 1KFYA 4K2XA 5KOWA 4A9WA 3H8LA 4BV6A 4B63A 2VRMA 1REOA 1Q1RA 3GRSA 4EMJA 4USQA 2Q7VA 5KVIA 1B4VA 5IQ4A 1B37A 3SZCA 1EL5A 1S2YA 4Z26A 2ACZA 3SY4A 1LV0A 1JRZA 4Z24A 2E1MA 5JCMA 3FMWA 2VVLA 2WU5A 2YR4A 2WP9A 3NG7X 4K5SA 4XWZA 4Y4LA 3SFDA 4AP1A 1VQWA 4YKFA 2QA2A 4H2PA 2C66A 1DDOA 3G5SA 1L9CA 1IUWA 1RP0A 2YR6A 4RG3A 1COYA 1ELIA 4REKA 4JY3A 3FBSA 5M0ZA 3UOYA 4YJGA 4M52A 3FIMB 5BULA 4IA6A 2BC0A 2ZZBA 3FG2P 3SYIA 3ALJA 3B6DA 1YY5A 1GTHA 2C67A 4II2A 5JCKA 2BRYA 3CN8A 2GB0A 1GESA 2E5VA 3K7QX 1NPXA 1D7YA 1ZMCA 2V60A 1VE9A 1MXTA 3NTAA 2WS3A 2BS4A 1GEUA 3R9UA 4BK1A 2PHHA 2JK6A 4Y4NA 3UKHA 4U2TA 2B9XA 3DJEA 2YVFA 2YLXA 4Z2UA 2XCGA 3CNTA 3ISHA 1DJNA 2I0ZA 1VG9A 2ZZCA 3HYVA 3VR8A 3CGEA 3DMEA 2VOUA 1S2QA 3AE7A 3LZXA 2APGA 1S3BA 4EM4A 3KVEA 5LV9A 1XDIA 2VZ2A 1CJ4A 3LZWA 3RNMA 1GERA 1OJTA 2VVLG 2GH5A 3COXA 4CY6A 3NYFA 2XVIA 4J36A 1XANA 1LJ1A 3C4AA 4CY8A 1L9EA 2XFNA 4H2RA 4NTCA 3W4KA 2QCUA 1PXBA 1MOKA 2FBWA 3QJ4A 2X8HA 1NG4A 4YTPA 1N1PA 3GSIA 4H4ZA 4EM3A 1Y0PA 4YXDA 1GV4A 1EL7A 3E1TA 1Z6LA 1ZOYA 4JNAA 2TMDA 2X99A 1DXLA 2JBVA 4O5UA 4IVMB 3GMCA 4EQSA 4O5QA 3LOVA 3EF6A 1TDEA 3DA1A 5CQFA 2BRAA 2YLWA 4BK2A 2BC1A 2C65A 3CIRA 3D1CA 2RGOA 1CHUA 4Z2RA 4G9KA 3AYJA 2FJAA 1TDNA 3AEBA 1F8SA 1Q9IA 3CPJG 2XFUA 2E48A 2DKIA 2O9ZA 4U8NA 2WDVA 2R9ZA 4B68A 2OAMA 2XFOA 3UKAA 2AAQA 2JB3A 4GR1A 1C0LA 2GR2A 2B9WA 1C0IA 3AD7B 1O94A 3UOXA 1KDGA 4OCGA 1PS9A 5U25A 3Q9TA 1EBDA 2GRTA 3KU9A 4J57A 3GYXA 4EMIA 4JNQA 1BF3A 1N4WA 3NT6A 4WCTA 2A8XA 3GRTA 4IVOB 4C77A 3HYWA 1CC2A 2R0GA 4K22A 2BACA 2YAUA 1KNPA 3AECA 3F8PA 4U8LA 5KWFA 3CGBA 4YT0A 5EB5A 2X50A 2WOIA 3UP5A 3DJGX 4AT2A 1DOCA 1ZMDA 1PHHA 2YG7A 2Z5XA 5BRTA 3AE9A 3AE1A 4GF7A 2Z5YA 4ADWA 3KPFA 3CNPA 1PXAA 3AE6A 3UKKA 3VRDB 2WPFA 3HZLA 1FCDA 4MJWA 4OPGA 4HA6A 2R0PA 1ZY8A 2XVFA 1GRGA 1HYUA 2Y6QA 4NEWA 5JCIA 2YLRA 4U8IA 2GVCA 3ICSA 4JN9A 1LPFA 1H86A 3SXIA 3DK9A 2YR5A 4Z44A 2E82A 2GR0A 3T2KA 1AN9A 1JU2A 4EQWA 1VG0A 3AYLA 1H84A 4FX9A 5TR3A 3C4NA 3M12A 4YSHA 1B8SA 4USRA 3T0KA 5M10A 3AEAA 4J56A 4EQXA 3GWDA 5KMRA 1CJ3A 1D7LA 4QFCA 4LU6A 3DK4A 3I3LA 2WPCA 3DJDA 1PBBA 2YVGA 1NAAA 5DBJA 2C70A 1ZDLA 3IC9A 1IJHA 3L8KA 1CC4A 2NVKX 3K7TA 3PO7A 4YJGB 1H7XA 3S61A 3T2YA 4H4XA 1GRTA 1JRXA 4XXGA 4BURA 3LJPA 2JB1A 2CDUA 3EAOA 1Q1WA 4ZCCA 5FS8A 1C0PA 1JEHA 1OJDA 2OA1A 2Y6RA 3T31A 2C4CA 3GYJA 3UKLA 3UTEA 4GUVA 3AWIA 4TM1A 1CF3A 4OVIA 5KMSA 1BKWA 2GEWA 3AE4A 4I58A 1N4UA 4IV9A 3UCLA 1GREA 2YWLA 2GAHB 1P2HA 2V61A 2ZBWA 3IWAA 1GRBA 4OPIA 5IQ1A 4YTNA 3ALMA 1IUUA 3AE8A 5JCNA 3BHFA 3GD3A 2X8GA 1GPEA 3NN0X 2JAEA 3AEEA 2V6OA 4AOSA 1D4EA 1GRFA 2BK3A 1CJCA 1GRAA 1GRHA 1LVLA 2XLUA 4B64A 1H83A 4G6GA 4ICYA 5BUKA 3QVRA 4UDPA 4TM0A 4UDQA 2BA9A 3CGCA 1F6MA 2AR8A 2DU8A 4GAVA 4J33A 3CNSA 5KRQA 1JNZA 1LTXR 2OLOA 1H6VA 4CRTA 4DNAA 1N4VA 3KLJA 4CNKA 3VR9A 2YLZA 1W4XA 4YJFB 2BS2A 4H4QA 2C7GA 2B7RA 4EMWA 3P9UA 3DH9A 4K5RA 3UKPA 1E1NA 4C5OA 4A6NB 1DOBA 1BZLA 1GETA 1NHSA 2C73A 4H7UA 1CL0A 3NHOX 1C0KA 2XLSA 4H4PA 4AT0A 2JKCA 3DK8A 2R4JA 3CPHG 4NTDA 4YTMA 3CPIG 4PAAA 4TLZA 1QJDA 3AEFA 2YM2A 5BVAA 2WBAA 2VQBA 1YKJA 1ZKQA 2YM1A 1AOGA 1PBDA 3NYCA 1D4DA 4D03A 2UZZA 5HYMA 3BI4A 4H4SA 3ZNNA 4UDRA 4FK1C 3BNMA 2H89A 1EL9A 4H4TA 4LA1A 1F8WA 3NK1X 3WE0A 4YSYA 2V5ZA 4GAPA 2V3AA 4JDRA 3V3OA 2WP5A 1PBFA 4H2QA 1FECA 2BYBA 3KA7A 4U8KA 2GF3A 2XFPA 4U8OA 1PDHA 2CFYA 1CJ2A 1KSUA 2C75A 3V76A 1H82A 4B65A 1KIFA 5CKUA 1RYIA 3SZ0A 1FL2A 5KMQA 3JSKA 3RHAA 2C3DA 3NN6X 1O95A 3QFAA 4AP3A 2NPXA 2V3BA 2RGJA 1PBEA 2C3CA 3K30A 1FEAA 4YKGA 1IUXA 4FDCB 5KNLA 5EOWA 4YWOA 2FJDA 3NKSA 4J34A 2HQMA 4QFDA 1NHQA 3H8IA 4LIIA 2FJEA 4Z25A 3ALLA 4PABA 4A5LA 4DGKA 3PVCA 2EQ6A 2XDOA 4FK1A 4NNJA 3O0HA 4TLXA 4X9MA 4WX1A 2BABA 2XFQA 1Y56B 4G6HA 4Y4MA 1X31B 1BGJA 1L0VA 5JCLA 3RP8A 4G73A 2GMHA 3WGTA 2WESA 3B3RA 4A79A 2R45A 3BNUA 1DNCA 1BGNA 3SX6A 2C64A 4U8PA 2B76A 2ZZ0A 1TDFA 1EL8A 2WU2A 4EIQA 3H4KA 3ZNOA 4YJHB 4OPLA 2E49A 4G74A 3IF9A 3NK2X 1DODA 3BI2A 1NHRA 3IHGA 3ITJA 4C74A 4GCMA 3NNEA 3M13A 5HY5A 3SZWA 3CNJA 1DJQA 2EQ8A 4YSZA 1DOEA 2GMJA 3BHKA 3GMBA 3SM8A 3OZ2A 3T37A 3ZNPA 1TYTA 5GSNA 3VRAA 4H50A 3ZYXA 4YSXA 3NIXA 5EB4A 3UTGA 4DSGA 4GDEA 3REDA 4A65A 4XWRA 3AYIA 4RSLA 1TRBA 3FPZA 1OJ9A 1L9DA 4OPTA 1E7PA 2R0CA 1M6IA 5KXJA 1KNRA 3RP6A 2WP6A 3AE2A 2RABA 2XVEA 4ECHA 1OJCA 3UKFA 4Z2TA 1LQUA 2YQUA 3GDNA 3OC4A 2J3NA 3AD8B 3T14A 3F8RA 5HXIA 3KKJA 1XPQA 4NWZA 3QVPA 3AXBA 2BK4A 3P1WA 2YLSA 4B66A 3UTHA 2A89A 3T2ZA 3NYEA 2H88A 3G5RA 2WHDA 3I6DA 2Q0LA 2PYXA 3AEGA 4II3A 1YQZA 2WOVA 4H2NA 2YG4A 4HB9A 3URHA 3EANA 5C3JA 2TPRA 1GT8A 4B69A 1CC6A 3ICTA 1VDCA 3SQPA 2OLNA 3LXDA 3AD9B 4H4RA 3SZFA 3BI5A 1V59A 1VRQB 3AEDA 3CGDA 3HYXA 4K7ZA 3M0OA 3GDPA 1B5QA 4ZN0A 3NGCX 2WETA 3GD4A 4H4UA 4OPUA 1OJAA 4H4WA 2WDQA 3EPTA 1IUTA 2C72A 3UKQA 1O5WA 1UKVG 2GAGB 2YG3A 4A99A 2QA1A 4OPDA 3KD9A 5FS9A 1E1KA 2GQWA 4U8JA 1FEBA 2R46A 3AE5A 4K8DA 2IIDA 3D8XA 3W4JA 3L1RA 2VQ7A 4CNJA 4EQRA 2BCPA 2EQ7A 2A87A 3ZNQA 3V3NA 5C2TA 1GALA 1QO8A 4U8MA 1GXFA 2VRLA 3ABVA 4J2WA 4B1BA 4E0VA 3Q6JA 2YG6A 3CUKA 2WDRA 4X9NA 2F5ZA 5U1OA 4DSHA 3DGHA 1K0IA 4ZCDA 2BXSA 2B9YA 4J31A 4APNA 3DGZA 1E1MA 2WQYA 3ZDNA 3NTDA 5HHFA 4JQ9A 4TM3A 5KMPA 5KOXA 1LQTA 4BJZA 3SFEA 3GYIA
chains in the Genus database with same CATH topology
3VQRA 4I59A 3CTYA 2BK5A 2JB2A 2ARDA 5J7XA 1MO9A 1PJ5A 4B67A 1H81A 1IUVA 2GV8A 1GOSA 4C3YA 3P4RA 1TDKA 1KSSA 4CCQA 3G3EA 4P9SA 2XLPA 2E4AA 1ZP0A 1DAOA 3P4PA 3F8DA 3ADAB 4H4YA 1ZK7A 1ZX9A 4KX6A 4YJFA 4CBQA 3PS9A 5FS6A 3S5WA 5U63A 2YLTA 2IVDA 2X8CA 4KPRA 1PJ6A 3CNDA 4A6NA 4TM4A 2W0HA 4H4VA 1YQ3A 4Z43A 3LB8A 3P4SA 3P4QA 3QSSA 2QAEA 5KVHA 1ZOVA 5J60A 3II4A 4CCRA 1S3EA 3NLCA 3QSMA 2GR3A 4X4JA 1RSGA 1PJ7A 1NDAA 4AOXA 1FOHA 3RP7A 1PN0A 3QSEA 2XLTA 2BCGG 4U2SA 1K0LA 3ICRA 1E6EA 3KPKA 5EBKA 3VRBA 5FMHA 3QFBA 1KF6A 2Q6UA 1H7WA 3UP4A 1F8RA 1GSNA 3NH3X 2DKHA 4GDPA 1NG3A 1PBCA 1YQ4A 1F3PA 1D5TA 1GTEA 4RG4A 1EVIA 2XLRA 3IHMA 4YJDA 2X3NA 2WOWA 2XVHA 4UP3A 1TDOA 2AQJA 5IPYA 5L46A 1M64A 1NHPA 4D04A 4EIPA 1QLBA 2BS3A 1JRYA 2XVJA 2FJBA 1E1LA 2CULA 2YVJA 3ATQA 4BK3A 3NK0X 1CBOA 1E39A 4GRTA 4A7AA 2B7SA 2WEUA 3CMMA 1SEZA 3K7MX 2RGHA 2C76A 3W4IA 1NENA 2GR1A 3UTFA 1TYPA 2YG5A 4IA5A 1XHCA 1Y56A 2Q0KA 2WPEA 4BJYA 2VVMA 4C3XA 2IVEA 3SGLA 2EQ9A 2CVJA 3AE3A 2GQFA 3DJJA 2BXRA 4NZHA 5ER0A 1D4CA 3GWFA 1BWCA 1P2EA 4JY2A 2OALA 4NEVA 1K0JA 3ATRA 1NEKA 1ONFA 3LADA 1PXCA 2R4EA 3AB1A 1GNDA 2XYOA 5GRTA 5FS7A 4OPCA 1IUSA 4YJHA 2E4GA 3G5QA 4U2LA 3UOZA 1K4QA 1JNRA 3NRNA 4N9XA 3C96A 1JOAA 4NTEA 3UOVA 1KFYA 4K2XA 5KOWA 4A9WA 3H8LA 4BV6A 4B63A 2VRMA 1REOA 1Q1RA 3GRSA 4EMJA 4USQA 2Q7VA 5KVIA 1B4VA 5IQ4A 1B37A 3SZCA 1EL5A 1S2YA 4Z26A 2ACZA 3SY4A 1LV0A 1JRZA 4Z24A 2E1MA 5JCMA 3FMWA 2VVLA 2WU5A 2YR4A 2WP9A 3NG7X 4K5SA 4XWZA 4Y4LA 3SFDA 4AP1A 1VQWA 4YKFA 2QA2A 2C66A 4H2PA 1DDOA 3G5SA 1L9CA 1IUWA 1RP0A 2YR6A 4RG3A 1COYA 1ELIA 4REKA 3FBSA 4JY3A 5M0ZA 3UOYA 4YJGA 4M52A 3FIMB 5BULA 4IA6A 2BC0A 2ZZBA 3FG2P 3SYIA 3ALJA 3B6DA 1YY5A 1GTHA 2C67A 4II2A 5JCKA 2BRYA 3CN8A 2GB0A 1GESA 2E5VA 3K7QX 1NPXA 1D7YA 1ZMCA 2V60A 1VE9A 1MXTA 3NTAA 2WS3A 2BS4A 1GEUA 3R9UA 4BK1A 2PHHA 2JK6A 4Y4NA 3UKHA 4U2TA 2B9XA 3DJEA 2YVFA 2YLXA 4Z2UA 2XCGA 3CNTA 3ISHA 1DJNA 2I0ZA 1VG9A 2ZZCA 3HYVA 3VR8A 3CGEA 3DMEA 1S2QA 2VOUA 3AE7A 3LZXA 2APGA 1S3BA 4EM4A 3KVEA 5LV9A 1XDIA 2VZ2A 1CJ4A 3LZWA 3RNMA 1GERA 1OJTA 2VVLG 2GH5A 3COXA 4CY6A 3NYFA 2XVIA 4J36A 1XANA 1LJ1A 3C4AA 4CY8A 1L9EA 2XFNA 4H2RA 4NTCA 3W4KA 2QCUA 1PXBA 1MOKA 2FBWA 3QJ4A 2X8HA 1NG4A 4YTPA 1N1PA 3GSIA 4H4ZA 4EM3A 1Y0PA 4YXDA 1GV4A 1EL7A 3E1TA 1Z6LA 1ZOYA 4JNAA 2TMDA 2X99A 1DXLA 2JBVA 4O5UA 4IVMB 3GMCA 4EQSA 4O5QA 3LOVA 3EF6A 1TDEA 3DA1A 5CQFA 2BRAA 2YLWA 4BK2A 2BC1A 2C65A 3CIRA 3D1CA 2RGOA 1CHUA 4Z2RA 4G9KA 3AYJA 2FJAA 1TDNA 3AEBA 1F8SA 1Q9IA 3CPJG 2XFUA 2E48A 2DKIA 2O9ZA 4U8NA 2WDVA 2R9ZA 4B68A 2OAMA 2XFOA 3UKAA 2AAQA 2JB3A 4GR1A 1C0LA 2GR2A 2B9WA 1C0IA 3AD7B 1O94A 3UOXA 1KDGA 4OCGA 1PS9A 5U25A 3Q9TA 1EBDA 2GRTA 3KU9A 4J57A 3GYXA 4EMIA 4JNQA 1BF3A 1N4WA 3NT6A 4WCTA 2A8XA 3GRTA 4IVOB 4C77A 3HYWA 1CC2A 2R0GA 2YAUA 2BACA 4K22A 1KNPA 3AECA 3F8PA 4U8LA 5KWFA 3CGBA 4YT0A 5EB5A 2X50A 2WOIA 3UP5A 3DJGX 4AT2A 1DOCA 1ZMDA 1PHHA 2YG7A 2Z5XA 5BRTA 3AE9A 3AE1A 4GF7A 2Z5YA 4ADWA 3KPFA 3CNPA 1PXAA 3AE6A 3UKKA 3VRDB 2WPFA 3HZLA 1FCDA 4MJWA 4OPGA 4HA6A 1ZY8A 2R0PA 2XVFA 1GRGA 1HYUA 2Y6QA 4NEWA 5JCIA 2YLRA 4U8IA 2GVCA 3ICSA 4JN9A 1LPFA 1H86A 3SXIA 3DK9A 2YR5A 4Z44A 2E82A 2GR0A 3T2KA 1AN9A 1JU2A 4EQWA 1VG0A 3AYLA 1H84A 4FX9A 5TR3A 3C4NA 3M12A 4YSHA 1B8SA 4USRA 3T0KA 5M10A 3AEAA 4J56A 4EQXA 3GWDA 5KMRA 1CJ3A 1D7LA 4QFCA 4LU6A 3DK4A 3I3LA 2WPCA 3DJDA 1PBBA 2YVGA 1NAAA 5DBJA 2C70A 1ZDLA 3IC9A 1IJHA 3L8KA 1CC4A 2NVKX 3K7TA 3PO7A 4YJGB 1H7XA 3S61A 3T2YA 4H4XA 1GRTA 1JRXA 4XXGA 4BURA 3LJPA 2JB1A 2CDUA 3EAOA 1Q1WA 4ZCCA 5FS8A 1C0PA 1JEHA 1OJDA 2OA1A 2Y6RA 3T31A 2C4CA 3GYJA 3UKLA 3UTEA 4GUVA 3AWIA 4TM1A 1CF3A 4OVIA 5KMSA 1BKWA 2GEWA 3AE4A 4I58A 1N4UA 4IV9A 3UCLA 1GREA 2YWLA 2GAHB 1P2HA 2V61A 2ZBWA 3IWAA 1GRBA 4OPIA 5IQ1A 4YTNA 3ALMA 1IUUA 3AE8A 5JCNA 3BHFA 3GD3A 2X8GA 1GPEA 3NN0X 2JAEA 3AEEA 2V6OA 4AOSA 1D4EA 1GRFA 2BK3A 1CJCA 1GRAA 1GRHA 1LVLA 2XLUA 4B64A 1H83A 4G6GA 4ICYA 5BUKA 3QVRA 4UDPA 4TM0A 4UDQA 2BA9A 3CGCA 1F6MA 2AR8A 2DU8A 4GAVA 4J33A 3CNSA 5KRQA 1JNZA 1LTXR 2OLOA 1H6VA 4CRTA 4DNAA 1N4VA 3KLJA 4CNKA 3VR9A 2YLZA 1W4XA 4YJFB 2BS2A 4H4QA 2C7GA 2B7RA 4EMWA 3P9UA 3DH9A 4K5RA 3UKPA 1E1NA 4C5OA 4A6NB 1DOBA 1BZLA 1GETA 1NHSA 2C73A 4H7UA 1CL0A 3NHOX 1C0KA 2XLSA 4H4PA 4AT0A 2JKCA 3DK8A 2R4JA 3CPHG 4NTDA 4YTMA 3CPIG 4PAAA 4TLZA 1QJDA 3AEFA 2YM2A 5BVAA 2WBAA 2VQBA 1YKJA 1ZKQA 2YM1A 1AOGA 1PBDA 3NYCA 1D4DA 4D03A 2UZZA 5HYMA 3BI4A 4H4SA 3ZNNA 4UDRA 4FK1C 3BNMA 2H89A 1EL9A 4H4TA 4LA1A 1F8WA 3NK1X 3WE0A 4YSYA 2V5ZA 4GAPA 2V3AA 4JDRA 3V3OA 2WP5A 1PBFA 1FECA 4H2QA 2BYBA 3KA7A 4U8KA 2GF3A 2XFPA 4U8OA 1PDHA 2CFYA 1CJ2A 1KSUA 2C75A 3V76A 1H82A 4B65A 1KIFA 5CKUA 1RYIA 3SZ0A 1FL2A 5KMQA 3JSKA 3RHAA 2C3DA 3NN6X 1O95A 3QFAA 4AP3A 2NPXA 2V3BA 2RGJA 1PBEA 2C3CA 3K30A 1FEAA 4YKGA 1IUXA 4FDCB 5KNLA 5EOWA 4YWOA 2FJDA 3NKSA 4J34A 2HQMA 4QFDA 1NHQA 3H8IA 4LIIA 2FJEA 4Z25A 4PABA 3ALLA 4A5LA 4DGKA 3PVCA 2EQ6A 2XDOA 4FK1A 4NNJA 3O0HA 4TLXA 4X9MA 4WX1A 2BABA 2XFQA 1Y56B 4G6HA 4Y4MA 1X31B 1BGJA 1L0VA 5JCLA 3RP8A 4G73A 2GMHA 3WGTA 2WESA 3B3RA 4A79A 2R45A 3BNUA 1DNCA 1BGNA 3SX6A 2C64A 4U8PA 2B76A 2ZZ0A 1TDFA 1EL8A 2WU2A 4EIQA 3H4KA 3ZNOA 4YJHB 4OPLA 2E49A 4G74A 3IF9A 3NK2X 1DODA 3BI2A 1NHRA 3IHGA 3ITJA 4C74A 4GCMA 3NNEA 3M13A 5HY5A 3SZWA 3CNJA 1DJQA 2EQ8A 4YSZA 1DOEA 3BHKA 3SM8A 2GMJA 3GMBA 3OZ2A 3T37A 3ZNPA 1TYTA 5GSNA 3VRAA 4H50A 3ZYXA 4YSXA 3NIXA 5EB4A 3UTGA 4DSGA 4GDEA 3REDA 4A65A 4XWRA 3AYIA 4RSLA 1TRBA 3FPZA 1OJ9A 1L9DA 4OPTA 1E7PA 2R0CA 1M6IA 5KXJA 1KNRA 3RP6A 2WP6A 3AE2A 2RABA 2XVEA 4ECHA 1OJCA 3UKFA 4Z2TA 1LQUA 2YQUA 3GDNA 3OC4A 2J3NA 3AD8B 3T14A 3F8RA 3KKJA 5HXIA 1XPQA 4NWZA 3QVPA 3AXBA 2BK4A 3P1WA 2YLSA 4B66A 3UTHA 2A89A 3T2ZA 3NYEA 2H88A 3G5RA 2WHDA 3I6DA 2Q0LA 2PYXA 3AEGA 4II3A 1YQZA 2WOVA 2YG4A 4H2NA 4HB9A 3URHA 3EANA 5C3JA 2TPRA 1GT8A 4B69A 1CC6A 3ICTA 1VDCA 3SQPA 2OLNA 3LXDA 3AD9B 4H4RA 3SZFA 3BI5A 1V59A 1VRQB 3AEDA 3CGDA 3HYXA 4K7ZA 3M0OA 3GDPA 1B5QA 4ZN0A 3NGCX 2WETA 3GD4A 4H4UA 4OPUA 1OJAA 4H4WA 2WDQA 3EPTA 1IUTA 2C72A 3UKQA 1O5WA 1UKVG 2GAGB 2YG3A 4A99A 2QA1A 4OPDA 3KD9A 5FS9A 1E1KA 2GQWA 4U8JA 1FEBA 2R46A 3AE5A 4K8DA 2IIDA 3D8XA 3W4JA 3L1RA 2VQ7A 4CNJA 4EQRA 2BCPA 2EQ7A 2A87A 3ZNQA 3V3NA 5C2TA 1GALA 1QO8A 4U8MA 1GXFA 2VRLA 3ABVA 4J2WA 4B1BA 4E0VA 3Q6JA 2YG6A 3CUKA 2WDRA 4X9NA 2F5ZA 5U1OA 4DSHA 3DGHA 1K0IA 4ZCDA 2BXSA 2B9YA 4J31A 4APNA 3DGZA 1E1MA 2WQYA 3ZDNA 3NTDA 5HHFA 4JQ9A 4TM3A 5KMPA 5KOXA 1LQTA 4BJZA 3SFEA 3GYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQR A;  4I59 A;  3CTY A;  2BK5 A;  2JB2 A;  2ARD A;  5J7X A;  1MO9 A;  1PJ5 A;  4B67 A;  1H81 A;  1IUV A;  2GV8 A;  1GOS A;  4C3Y A;  3P4R A;  1TDK A;  1KSS A;  4CCQ A;  3G3E A;  4P9S A;  2XLP A;  2E4A A;  1ZP0 A;  1DAO A;  3P4P A;  3F8D A;  3ADA B;  4H4Y A;  1ZK7 A;  1ZX9 A;  4KX6 A;  4YJF A;  4CBQ A;  3PS9 A;  5FS6 A;  3S5W A;  5U63 A;  2YLT A;  2IVD A;  2X8C A;  4KPR A;  1PJ6 A;  3CND A;  4A6N A;  4TM4 A;  2W0H A;  4H4V A;  1YQ3 A;  4Z43 A;  3LB8 A;  3P4S A;  3P4Q A;  3QSS A;  2QAE A;  5KVH A;  1ZOV A;  5J60 A;  3II4 A;  4CCR A;  1S3E A;  3NLC A;  3QSM A;  2GR3 A;  4X4J A;  1RSG A;  1PJ7 A;  1NDA A;  4AOX A;  1FOH A;  3RP7 A;  1PN0 A;  3QSE A;  2XLT A;  2BCG G;  4U2S A;  1K0L A;  3ICR A;  1E6E A;  5EBK A;  3VRB A;  5FMH A;  3QFB A;  1KF6 A;  2Q6U A;  1H7W A;  3UP4 A;  1F8R A;  1GSN A;  3NH3 X;  2DKH A;  4GDP A;  1NG3 A;  1PBC A;  1YQ4 A;  1F3P A;  1D5T A;  1GTE A;  4RG4 A;  1EVI A;  2XLR A;  3IHM A;  4YJD A;  2X3N A;  2WOW A;  2XVH A;  4UP3 A;  1TDO A;  2AQJ A;  5IPY A;  5L46 A;  1M64 A;  1NHP A;  4D04 A;  4EIP A;  1QLB A;  2BS3 A;  1JRY A;  2XVJ A;  2FJB A;  1E1L A;  2CUL A;  2YVJ A;  3ATQ A;  4BK3 A;  3NK0 X;  1CBO A;  1E39 A;  4GRT A;  4A7A A;  2B7S A;  2WEU A;  1SEZ A;  3K7M X;  2RGH A;  2C76 A;  3W4I A;  1NEN A;  2GR1 A;  3UTF A;  1TYP A;  2YG5 A;  4IA5 A;  1XHC A;  1Y56 A;  2Q0K A;  2WPE A;  4BJY A;  2VVM A;  4C3X A;  2IVE A;  3SGL A;  2EQ9 A;  2CVJ A;  3AE3 A;  2GQF A;  3DJJ A;  2BXR A;  4NZH A;  5ER0 A;  1D4C A;  3GWF A;  1BWC A;  1P2E A;  4JY2 A;  2OAL A;  4NEV A;  1K0J A;  3ATR A;  1NEK A;  1ONF A;  3LAD A;  1PXC A;  2R4E A;  3AB1 A;  1GND A;  2XYO A;  5GRT A;  5FS7 A;  4OPC A;  1IUS A;  4YJH A;  2E4G A;  3G5Q A;  4U2L A;  3UOZ A;  1K4Q A;  1JNR A;  3NRN A;  4N9X A;  3C96 A;  1JOA A;  4NTE A;  3UOV A;  1KFY A;  4K2X A;  5KOW A;  4A9W A;  3H8L A;  4BV6 A;  4B63 A;  2VRM A;  1REO A;  1Q1R A;  3GRS A;  4EMJ A;  4USQ A;  2Q7V A;  5KVI A;  1B4V A;  5IQ4 A;  1B37 A;  4Z26 A;  1EL5 A;  1S2Y A;  2ACZ A;  1LV0 A;  1JRZ A;  4Z24 A;  2E1M A;  5JCM A;  3FMW A;  2VVL A;  2WU5 A;  2YR4 A;  2WP9 A;  3NG7 X;  4K5S A;  4XWZ A;  4Y4L A;  3SFD A;  4AP1 A;  1VQW A;  4YKF A;  2QA2 A;  2C66 A;  4H2P A;  1DDO A;  3G5S A;  1L9C A;  1IUW A;  1RP0 A;  2YR6 A;  4RG3 A;  1COY A;  1ELI A;  4REK A;  3FBS A;  4JY3 A;  5M0Z A;  3UOY A;  4YJG A;  4M52 A;  3FIM B;  5BUL A;  4IA6 A;  2BC0 A;  2ZZB A;  3FG2 P;  3ALJ A;  3B6D A;  1YY5 A;  1GTH A;  2C67 A;  5JCK A;  3CN8 A;  2GB0 A;  1GES A;  2E5V A;  3K7Q X;  1NPX A;  1D7Y A;  1ZMC A;  2V60 A;  1VE9 A;  1MXT A;  3NTA A;  2WS3 A;  2BS4 A;  1GEU A;  3R9U A;  4BK1 A;  2PHH A;  2JK6 A;  4Y4N A;  3UKH A;  4U2T A;  2B9X A;  3DJE A;  2YVF A;  2YLX A;  4Z2U A;  2XCG A;  3CNT A;  3ISH A;  1DJN A;  2I0Z A;  1VG9 A;  2ZZC A;  3VR8 A;  3CGE A;  3DME A;  1S2Q A;  2VOU A;  3AE7 A;  3LZX A;  2APG A;  1S3B A;  4EM4 A;  3KVE A;  5LV9 A;  1XDI A;  2VZ2 A;  1CJ4 A;  3LZW A;  3RNM A;  1GER A;  1OJT A;  2VVL G;  2GH5 A;  3COX A;  4CY6 A;  3NYF A;  2XVI A;  4J36 A;  1XAN A;  1LJ1 A;  3C4A A;  4CY8 A;  1L9E A;  2XFN A;  4H2R A;  4NTC A;  3W4K A;  2QCU A;  1PXB A;  1MOK A;  2FBW A;  3QJ4 A;  2X8H A;  1NG4 A;  4YTP A;  1N1P A;  3GSI A;  4H4Z A;  4EM3 A;  1Y0P A;  4YXD A;  1GV4 A;  1EL7 A;  3E1T A;  1Z6L A;  1ZOY A;  4JNA A;  2TMD A;  2X99 A;  1DXL A;  2JBV A;  4O5U A;  4IVM B;  3GMC A;  4EQS A;  4O5Q A;  3LOV A;  3EF6 A;  1TDE A;  3DA1 A;  5CQF A;  2YLW A;  4BK2 A;  2BC1 A;  2C65 A;  3CIR A;  3D1C A;  2RGO A;  1CHU A;  4Z2R A;  3AYJ A;  2FJA A;  1TDN A;  3AEB A;  1F8S A;  1Q9I A;  3CPJ G;  2XFU A;  2E48 A;  2DKI A;  2O9Z A;  4U8N A;  2WDV A;  2R9Z A;  4B68 A;  2OAM A;  2XFO A;  3UKA A;  2AAQ A;  2JB3 A;  4GR1 A;  1C0L A;  2GR2 A;  2B9W A;  1C0I A;  3AD7 B;  1O94 A;  3UOX A;  1KDG A;  4OCG A;  1PS9 A;  5U25 A;  3Q9T A;  1EBD A;  2GRT A;  3KU9 A;  4J57 A;  4EMI A;  4JNQ A;  1BF3 A;  1N4W A;  3NT6 A;  4WCT A;  2A8X A;  3GRT A;  4IVO B;  4C77 A;  1CC2 A;  2R0G A;  2YAU A;  2BAC A;  4K22 A;  1KNP A;  3AEC A;  3F8P A;  4U8L A;  5KWF A;  3CGB A;  4YT0 A;  5EB5 A;  2X50 A;  2WOI A;  3UP5 A;  3DJG X;  4AT2 A;  1DOC A;  1ZMD A;  1PHH A;  2YG7 A;  2Z5X A;  5BRT A;  3AE9 A;  3AE1 A;  4GF7 A;  2Z5Y A;  4ADW A;  3KPF A;  3CNP A;  1PXA A;  3AE6 A;  3UKK A;  3VRD B;  2WPF A;  3HZL A;  1FCD A;  4MJW A;  4OPG A;  4HA6 A;  1ZY8 A;  2R0P A;  2XVF A;  1GRG A;  1HYU A;  2Y6Q A;  4NEW A;  5JCI A;  2YLR A;  4U8I A;  2GVC A;  3ICS A;  4JN9 A;  1LPF A;  1H86 A;  3DK9 A;  2YR5 A;  4Z44 A;  2E82 A;  2GR0 A;  1AN9 A;  1JU2 A;  4EQW A;  1VG0 A;  3AYL A;  1H84 A;  4FX9 A;  5TR3 A;  3C4N A;  3M12 A;  4YSH A;  1B8S A;  4USR A;  5M10 A;  3AEA A;  4J56 A;  4EQX A;  3GWD A;  1CJ3 A;  1D7L A;  4QFC A;  4LU6 A;  3DK4 A;  3I3L A;  2WPC A;  3DJD A;  1PBB A;  2YVG A;  1NAA A;  5DBJ A;  2C70 A;  1ZDL A;  3IC9 A;  1IJH A;  3L8K A;  1CC4 A;  2NVK X;  3K7T A;  3PO7 A;  4YJG B;  1H7X A;  3S61 A;  4H4X A;  1GRT A;  1JRX A;  4XXG A;  4BUR A;  3LJP A;  2JB1 A;  2CDU A;  3EAO A;  1Q1W A;  4ZCC A;  5FS8 A;  1C0P A;  1JEH A;  1OJD A;  2OA1 A;  2Y6R A;  3GYJ A;  3UKL A;  3UTE A;  4GUV A;  3AWI A;  4TM1 A;  1CF3 A;  4OVI A;  1BKW A;  2GEW A;  3AE4 A;  4I58 A;  1N4U A;  4IV9 A;  3UCL A;  1GRE A;  2YWL A;  2GAH B;  1P2H A;  2V61 A;  2ZBW A;  3IWA A;  1GRB A;  4OPI A;  5IQ1 A;  4YTN A;  3ALM A;  1IUU A;  3AE8 A;  5JCN A;  3BHF A;  3GD3 A;  2X8G A;  1GPE A;  3NN0 X;  2JAE A;  3AEE A;  2V6O A;  4AOS A;  1D4E A;  1GRF A;  2BK3 A;  1CJC A;  1GRA A;  1GRH A;  1LVL A;  2XLU A;  4B64 A;  1H83 A;  4ICY A;  5BUK A;  3QVR A;  4UDP A;  4TM0 A;  4UDQ A;  2BA9 A;  3CGC A;  1F6M A;  2AR8 A;  2DU8 A;  4J33 A;  3CNS A;  5KRQ A;  1JNZ A;  1LTX R;  2OLO A;  1H6V A;  4CRT A;  4DNA A;  1N4V A;  3KLJ A;  4CNK A;  3VR9 A;  2YLZ A;  1W4X A;  4YJF B;  2BS2 A;  4H4Q A;  2C7G A;  2B7R A;  4EMW A;  3P9U A;  3DH9 A;  4K5R A;  3UKP A;  1E1N A;  4C5O A;  4A6N B;  1DOB A;  1BZL A;  1GET A;  1NHS A;  2C73 A;  4H7U A;  1CL0 A;  3NHO X;  1C0K A;  2XLS A;  4H4P A;  4AT0 A;  2JKC A;  3DK8 A;  2R4J A;  3CPH G;  4NTD A;  4YTM A;  3CPI G;  4PAA A;  4TLZ A;  1QJD A;  3AEF A;  2YM2 A;  5BVA A;  2WBA A;  2VQB A;  1YKJ A;  1ZKQ A;  2YM1 A;  1AOG A;  1PBD A;  3NYC A;  1D4D A;  4D03 A;  2UZZ A;  5HYM A;  3BI4 A;  4H4S A;  3ZNN A;  4UDR A;  4FK1 C;  3BNM A;  2H89 A;  1EL9 A;  4H4T A;  4LA1 A;  1F8W A;  3NK1 X;  3WE0 A;  4YSY A;  2V5Z A;  4JDR A;  2V3A A;  3V3O A;  2WP5 A;  1PBF A;  1FEC A;  4H2Q A;  2BYB A;  3KA7 A;  4U8K A;  2GF3 A;  2XFP A;  4U8O A;  1PDH A;  2CFY A;  1CJ2 A;  1KSU A;  2C75 A;  3V76 A;  1H82 A;  4B65 A;  1KIF A;  5CKU A;  1RYI A;  1FL2 A;  3JSK A;  3RHA A;  2C3D A;  3NN6 X;  1O95 A;  3QFA A;  4AP3 A;  2NPX A;  2V3B A;  2RGJ A;  1PBE A;  2C3C A;  3K30 A;  1FEA A;  4YKG A;  1IUX A;  4FDC B;  5EOW A;  4YWO A;  2FJD A;  3NKS A;  4J34 A;  2HQM A;  4QFD A;  1NHQ A;  3H8I A;  4LII A;  2FJE A;  4Z25 A;  4PAB A;  3ALL A;  4A5L A;  4DGK A;  3PVC A;  2EQ6 A;  2XDO A;  4FK1 A;  3O0H A;  4TLX A;  4X9M A;  4WX1 A;  2BAB A;  2XFQ A;  1Y56 B;  4Y4M A;  1X31 B;  1BGJ A;  1L0V A;  5JCL A;  3RP8 A;  2GMH A;  3WGT A;  2WES A;  3B3R A;  4A79 A;  2R45 A;  3BNU A;  1DNC A;  1BGN A;  2C64 A;  4U8P A;  2B76 A;  2ZZ0 A;  1TDF A;  1EL8 A;  2WU2 A;  4EIQ A;  3H4K A;  3ZNO A;  4YJH B;  4OPL A;  2E49 A;  3IF9 A;  3NK2 X;  1DOD A;  3BI2 A;  1NHR A;  3IHG A;  3ITJ A;  4C74 A;  4GCM A;  3NNE A;  3M13 A;  5HY5 A;  3CNJ A;  1DJQ A;  2EQ8 A;  4YSZ A;  1DOE A;  3BHK A;  3SM8 A;  2GMJ A;  3GMB A;  3OZ2 A;  3T37 A;  3ZNP A;  1TYT A;  5GSN A;  3VRA A;  4H50 A;  3ZYX A;  4YSX A;  3NIX A;  5EB4 A;  3UTG A;  4DSG A;  4GDE A;  3RED A;  4A65 A;  4XWR A;  3AYI A;  4RSL A;  1TRB A;  3FPZ A;  1OJ9 A;  1L9D A;  4OPT A;  1E7P A;  2R0C A;  1M6I A;  5KXJ A;  1KNR A;  3RP6 A;  2WP6 A;  3AE2 A;  2RAB A;  2XVE A;  4ECH A;  1OJC A;  3UKF A;  4Z2T A;  1LQU A;  2YQU A;  3GDN A;  3OC4 A;  2J3N A;  3AD8 B;  3F8R A;  3KKJ A;  5HXI A;  1XPQ A;  3QVP A;  3AXB A;  2BK4 A;  3P1W A;  2YLS A;  4B66 A;  3UTH A;  2A89 A;  3NYE A;  2H88 A;  3G5R A;  2WHD A;  3I6D A;  2Q0L A;  2PYX A;  3AEG A;  1YQZ A;  2WOV A;  2YG4 A;  4H2N A;  4HB9 A;  3URH A;  3EAN A;  5C3J A;  2TPR A;  1GT8 A;  4B69 A;  1CC6 A;  3ICT A;  1VDC A;  3SQP A;  2OLN A;  3LXD A;  3AD9 B;  4H4R A;  3BI5 A;  1V59 A;  1VRQ B;  3AED A;  3CGD A;  4K7Z A;  3M0O A;  3GDP A;  1B5Q A;  4ZN0 A;  3NGC X;  2WET A;  3GD4 A;  4H4U A;  4OPU A;  1OJA A;  4H4W A;  2WDQ A;  3EPT A;  1IUT A;  2C72 A;  3UKQ A;  1O5W A;  1UKV G;  2GAG B;  2YG3 A;  4A99 A;  2QA1 A;  4OPD A;  3KD9 A;  5FS9 A;  1E1K A;  2GQW A;  4U8J A;  1FEB A;  2R46 A;  3AE5 A;  4K8D A;  2IID A;  3D8X A;  3W4J A;  3L1R A;  2VQ7 A;  4CNJ A;  4EQR A;  2BCP A;  2EQ7 A;  2A87 A;  3ZNQ A;  3V3N A;  5C2T A;  1GAL A;  1QO8 A;  4U8M A;  1GXF A;  2VRL A;  3ABV A;  4J2W A;  4B1B A;  4E0V A;  3Q6J A;  2YG6 A;  3CUK A;  2WDR A;  4X9N A;  2F5Z A;  5U1O A;  4DSH A;  3DGH A;  1K0I A;  4ZCD A;  2BXS A;  2B9Y A;  4J31 A;  4APN A;  3DGZ A;  1E1M A;  2WQY A;  3ZDN A;  3NTD A;  5HHF A;  4JQ9 A;  4TM3 A;  5KOX A;  1LQT A;  4BJZ A;  3SFE A;  3GYI A; 
#chains in the Genus database with same CATH topology
 3VQR A;  4I59 A;  3CTY A;  2BK5 A;  2JB2 A;  2ARD A;  5J7X A;  1MO9 A;  1PJ5 A;  4B67 A;  1H81 A;  1IUV A;  2GV8 A;  1GOS A;  4C3Y A;  3P4R A;  1TDK A;  1KSS A;  4CCQ A;  3G3E A;  4P9S A;  2XLP A;  2E4A A;  1ZP0 A;  1DAO A;  3P4P A;  3F8D A;  3ADA B;  4H4Y A;  1ZK7 A;  1ZX9 A;  4KX6 A;  4YJF A;  4CBQ A;  3PS9 A;  5FS6 A;  3S5W A;  5U63 A;  2YLT A;  2IVD A;  2X8C A;  4KPR A;  1PJ6 A;  3CND A;  4A6N A;  4TM4 A;  2W0H A;  4H4V A;  1YQ3 A;  4Z43 A;  3LB8 A;  3P4S A;  3P4Q A;  3QSS A;  2QAE A;  5KVH A;  1ZOV A;  5J60 A;  3II4 A;  4CCR A;  1S3E A;  3NLC A;  3QSM A;  2GR3 A;  4X4J A;  1RSG A;  1PJ7 A;  1NDA A;  4AOX A;  1FOH A;  3RP7 A;  1PN0 A;  3QSE A;  2XLT A;  2BCG G;  4U2S A;  1K0L A;  3ICR A;  1E6E A;  3KPK A;  5EBK A;  3VRB A;  5FMH A;  3QFB A;  1KF6 A;  2Q6U A;  1H7W A;  3UP4 A;  1F8R A;  1GSN A;  3NH3 X;  2DKH A;  4GDP A;  1NG3 A;  1PBC A;  1YQ4 A;  1F3P A;  1D5T A;  1GTE A;  4RG4 A;  1EVI A;  2XLR A;  3IHM A;  2X3N A;  4YJD A;  2WOW A;  2XVH A;  4UP3 A;  1TDO A;  2AQJ A;  5IPY A;  5L46 A;  1M64 A;  4EIP A;  1NHP A;  4D04 A;  1QLB A;  2BS3 A;  1JRY A;  2XVJ A;  2FJB A;  1E1L A;  2CUL A;  2YVJ A;  4BK3 A;  3ATQ A;  3NK0 X;  1CBO A;  1E39 A;  4GRT A;  4A7A A;  2B7S A;  2WEU A;  3CMM A;  1SEZ A;  3K7M X;  2RGH A;  2C76 A;  3W4I A;  1NEN A;  2GR1 A;  3UTF A;  1TYP A;  2YG5 A;  4IA5 A;  1XHC A;  1Y56 A;  2Q0K A;  2WPE A;  4BJY A;  2VVM A;  4C3X A;  2IVE A;  3SGL A;  2EQ9 A;  2CVJ A;  3AE3 A;  2GQF A;  3DJJ A;  2BXR A;  4NZH A;  5ER0 A;  1D4C A;  3GWF A;  1BWC A;  4JY2 A;  1P2E A;  2OAL A;  4NEV A;  1K0J A;  3ATR A;  1NEK A;  1ONF A;  3LAD A;  1PXC A;  2R4E A;  3AB1 A;  1GND A;  2XYO A;  5GRT A;  5FS7 A;  4OPC A;  1IUS A;  4YJH A;  2E4G A;  3G5Q A;  4U2L A;  3UOZ A;  1K4Q A;  1JNR A;  3NRN A;  4N9X A;  3C96 A;  1JOA A;  4NTE A;  3UOV A;  1KFY A;  4K2X A;  5KOW A;  4A9W A;  3H8L A;  4BV6 A;  4B63 A;  2VRM A;  1REO A;  1Q1R A;  3GRS A;  4EMJ A;  4USQ A;  2Q7V A;  5KVI A;  1B4V A;  5IQ4 A;  1B37 A;  3SZC A;  1EL5 A;  1S2Y A;  4Z26 A;  2ACZ A;  3SY4 A;  1LV0 A;  1JRZ A;  4Z24 A;  2E1M A;  5JCM A;  3FMW A;  2VVL A;  2WU5 A;  2YR4 A;  2WP9 A;  3NG7 X;  4K5S A;  4XWZ A;  4Y4L A;  3SFD A;  4AP1 A;  1VQW A;  4YKF A;  2QA2 A;  4H2P A;  2C66 A;  1DDO A;  3G5S A;  1L9C A;  1IUW A;  1RP0 A;  2YR6 A;  4RG3 A;  1COY A;  1ELI A;  4REK A;  4JY3 A;  3FBS A;  5M0Z A;  3UOY A;  4YJG A;  4M52 A;  3FIM B;  5BUL A;  4IA6 A;  2BC0 A;  2ZZB A;  3FG2 P;  3SYI A;  3ALJ A;  3B6D A;  1YY5 A;  1GTH A;  2C67 A;  4II2 A;  5JCK A;  2BRY A;  3CN8 A;  2GB0 A;  1GES A;  2E5V A;  3K7Q X;  1NPX A;  1D7Y A;  1ZMC A;  2V60 A;  1VE9 A;  1MXT A;  3NTA A;  2WS3 A;  2BS4 A;  1GEU A;  3R9U A;  4BK1 A;  2PHH A;  2JK6 A;  4Y4N A;  3UKH A;  4U2T A;  2B9X A;  3DJE A;  2YVF A;  2YLX A;  4Z2U A;  2XCG A;  3CNT A;  3ISH A;  1DJN A;  2I0Z A;  1VG9 A;  2ZZC A;  3HYV A;  3VR8 A;  3CGE A;  3DME A;  2VOU A;  1S2Q A;  3AE7 A;  3LZX A;  2APG A;  1S3B A;  4EM4 A;  3KVE A;  5LV9 A;  1XDI A;  2VZ2 A;  1CJ4 A;  3LZW A;  3RNM A;  1GER A;  1OJT A;  2VVL G;  2GH5 A;  3COX A;  4CY6 A;  3NYF A;  2XVI A;  4J36 A;  1XAN A;  1LJ1 A;  3C4A A;  4CY8 A;  1L9E A;  2XFN A;  4H2R A;  4NTC A;  3W4K A;  2QCU A;  1PXB A;  1MOK A;  2FBW A;  3QJ4 A;  2X8H A;  1NG4 A;  4YTP A;  1N1P A;  3GSI A;  4H4Z A;  4EM3 A;  1Y0P A;  4YXD A;  1GV4 A;  1EL7 A;  3E1T A;  1Z6L A;  1ZOY A;  4JNA A;  2TMD A;  2X99 A;  1DXL A;  2JBV A;  4O5U A;  4IVM B;  3GMC A;  4EQS A;  4O5Q A;  3LOV A;  3EF6 A;  1TDE A;  3DA1 A;  5CQF A;  2BRA A;  2YLW A;  4BK2 A;  2BC1 A;  2C65 A;  3CIR A;  3D1C A;  2RGO A;  1CHU A;  4Z2R A;  4G9K A;  3AYJ A;  2FJA A;  1TDN A;  3AEB A;  1F8S A;  1Q9I A;  3CPJ G;  2XFU A;  2E48 A;  2DKI A;  2O9Z A;  4U8N A;  2WDV A;  2R9Z A;  4B68 A;  2OAM A;  2XFO A;  3UKA A;  2AAQ A;  2JB3 A;  4GR1 A;  1C0L A;  2GR2 A;  2B9W A;  1C0I A;  3AD7 B;  1O94 A;  3UOX A;  1KDG A;  4OCG A;  1PS9 A;  5U25 A;  3Q9T A;  1EBD A;  2GRT A;  3KU9 A;  4J57 A;  3GYX A;  4EMI A;  4JNQ A;  1BF3 A;  1N4W A;  3NT6 A;  4WCT A;  2A8X A;  3GRT A;  4IVO B;  4C77 A;  3HYW A;  1CC2 A;  2R0G A;  4K22 A;  2BAC A;  2YAU A;  1KNP A;  3AEC A;  3F8P A;  4U8L A;  5KWF A;  3CGB A;  4YT0 A;  5EB5 A;  2X50 A;  2WOI A;  3UP5 A;  3DJG X;  4AT2 A;  1DOC A;  1ZMD A;  1PHH A;  2YG7 A;  2Z5X A;  5BRT A;  3AE9 A;  3AE1 A;  4GF7 A;  2Z5Y A;  4ADW A;  3KPF A;  3CNP A;  1PXA A;  3AE6 A;  3UKK A;  3VRD B;  2WPF A;  3HZL A;  1FCD A;  4MJW A;  4OPG A;  4HA6 A;  2R0P A;  1ZY8 A;  2XVF A;  1GRG A;  1HYU A;  2Y6Q A;  4NEW A;  5JCI A;  2YLR A;  4U8I A;  2GVC A;  3ICS A;  4JN9 A;  1LPF A;  1H86 A;  3SXI A;  3DK9 A;  2YR5 A;  4Z44 A;  2E82 A;  2GR0 A;  3T2K A;  1AN9 A;  1JU2 A;  4EQW A;  1VG0 A;  3AYL A;  1H84 A;  4FX9 A;  5TR3 A;  3C4N A;  3M12 A;  4YSH A;  1B8S A;  4USR A;  3T0K A;  5M10 A;  3AEA A;  4J56 A;  4EQX A;  3GWD A;  5KMR A;  1CJ3 A;  1D7L A;  4QFC A;  4LU6 A;  3DK4 A;  3I3L A;  2WPC A;  3DJD A;  1PBB A;  2YVG A;  1NAA A;  5DBJ A;  2C70 A;  1ZDL A;  3IC9 A;  1IJH A;  3L8K A;  1CC4 A;  2NVK X;  3K7T A;  3PO7 A;  4YJG B;  1H7X A;  3S61 A;  3T2Y A;  4H4X A;  1GRT A;  1JRX A;  4XXG A;  4BUR A;  3LJP A;  2JB1 A;  2CDU A;  3EAO A;  1Q1W A;  4ZCC A;  5FS8 A;  1C0P A;  1JEH A;  1OJD A;  2OA1 A;  2Y6R A;  3T31 A;  2C4C A;  3GYJ A;  3UKL A;  3UTE A;  4GUV A;  3AWI A;  4TM1 A;  1CF3 A;  4OVI A;  5KMS A;  1BKW A;  2GEW A;  3AE4 A;  4I58 A;  1N4U A;  4IV9 A;  3UCL A;  1GRE A;  2YWL A;  2GAH B;  1P2H A;  2V61 A;  2ZBW A;  3IWA A;  1GRB A;  4OPI A;  5IQ1 A;  4YTN A;  3ALM A;  1IUU A;  3AE8 A;  5JCN A;  3BHF A;  3GD3 A;  2X8G A;  1GPE A;  3NN0 X;  2JAE A;  3AEE A;  2V6O A;  4AOS A;  1D4E A;  1GRF A;  2BK3 A;  1CJC A;  1GRA A;  1GRH A;  1LVL A;  2XLU A;  4B64 A;  1H83 A;  4G6G A;  4ICY A;  5BUK A;  3QVR A;  4UDP A;  4TM0 A;  4UDQ A;  2BA9 A;  3CGC A;  1F6M A;  2AR8 A;  2DU8 A;  4GAV A;  4J33 A;  3CNS A;  5KRQ A;  1JNZ A;  1LTX R;  2OLO A;  1H6V A;  4CRT A;  4DNA A;  1N4V A;  3KLJ A;  4CNK A;  3VR9 A;  2YLZ A;  1W4X A;  4YJF B;  2BS2 A;  4H4Q A;  2C7G A;  2B7R A;  4EMW A;  3P9U A;  3DH9 A;  4K5R A;  3UKP A;  1E1N A;  4C5O A;  4A6N B;  1DOB A;  1BZL A;  1GET A;  1NHS A;  2C73 A;  4H7U A;  1CL0 A;  3NHO X;  1C0K A;  2XLS A;  4H4P A;  4AT0 A;  2JKC A;  3DK8 A;  2R4J A;  3CPH G;  4NTD A;  4YTM A;  3CPI G;  4PAA A;  4TLZ A;  1QJD A;  3AEF A;  2YM2 A;  5BVA A;  2WBA A;  2VQB A;  1YKJ A;  1ZKQ A;  2YM1 A;  1AOG A;  1PBD A;  3NYC A;  1D4D A;  4D03 A;  2UZZ A;  5HYM A;  3BI4 A;  4H4S A;  3ZNN A;  4UDR A;  4FK1 C;  3BNM A;  2H89 A;  1EL9 A;  4H4T A;  4LA1 A;  1F8W A;  3NK1 X;  3WE0 A;  4YSY A;  2V5Z A;  4GAP A;  2V3A A;  4JDR A;  3V3O A;  2WP5 A;  1PBF A;  4H2Q A;  1FEC A;  2BYB A;  3KA7 A;  4U8K A;  2GF3 A;  2XFP A;  4U8O A;  1PDH A;  2CFY A;  1CJ2 A;  1KSU A;  2C75 A;  3V76 A;  1H82 A;  4B65 A;  1KIF A;  5CKU A;  1RYI A;  3SZ0 A;  1FL2 A;  5KMQ A;  3JSK A;  3RHA A;  2C3D A;  3NN6 X;  1O95 A;  3QFA A;  4AP3 A;  2NPX A;  2V3B A;  2RGJ A;  1PBE A;  2C3C A;  3K30 A;  1FEA A;  4YKG A;  1IUX A;  4FDC B;  5KNL A;  5EOW A;  4YWO A;  2FJD A;  3NKS A;  4J34 A;  2HQM A;  4QFD A;  1NHQ A;  3H8I A;  4LII A;  2FJE A;  4Z25 A;  3ALL A;  4PAB A;  4A5L A;  4DGK A;  3PVC A;  2EQ6 A;  2XDO A;  4FK1 A;  4NNJ A;  3O0H A;  4TLX A;  4X9M A;  4WX1 A;  2BAB A;  2XFQ A;  1Y56 B;  4G6H A;  4Y4M A;  1X31 B;  1BGJ A;  1L0V A;  5JCL A;  3RP8 A;  4G73 A;  2GMH A;  3WGT A;  2WES A;  3B3R A;  4A79 A;  2R45 A;  3BNU A;  1DNC A;  1BGN A;  3SX6 A;  2C64 A;  4U8P A;  2B76 A;  2ZZ0 A;  1TDF A;  1EL8 A;  2WU2 A;  4EIQ A;  3H4K A;  3ZNO A;  4YJH B;  4OPL A;  2E49 A;  4G74 A;  3IF9 A;  3NK2 X;  1DOD A;  3BI2 A;  1NHR A;  3IHG A;  3ITJ A;  4C74 A;  4GCM A;  3NNE A;  3M13 A;  5HY5 A;  3SZW A;  3CNJ A;  1DJQ A;  2EQ8 A;  4YSZ A;  1DOE A;  2GMJ A;  3BHK A;  3GMB A;  3SM8 A;  3OZ2 A;  3T37 A;  3ZNP A;  1TYT A;  5GSN A;  3VRA A;  4H50 A;  3ZYX A;  4YSX A;  3NIX A;  5EB4 A;  3UTG A;  4DSG A;  4GDE A;  3RED A;  4A65 A;  4XWR A;  3AYI A;  4RSL A;  1TRB A;  3FPZ A;  1OJ9 A;  1L9D A;  4OPT A;  1E7P A;  2R0C A;  1M6I A;  5KXJ A;  1KNR A;  3RP6 A;  2WP6 A;  3AE2 A;  2RAB A;  2XVE A;  4ECH A;  1OJC A;  3UKF A;  4Z2T A;  1LQU A;  2YQU A;  3GDN A;  3OC4 A;  2J3N A;  3AD8 B;  3T14 A;  3F8R A;  5HXI A;  3KKJ A;  1XPQ A;  4NWZ A;  3QVP A;  3AXB A;  2BK4 A;  3P1W A;  2YLS A;  4B66 A;  3UTH A;  2A89 A;  3T2Z A;  3NYE A;  2H88 A;  3G5R A;  2WHD A;  3I6D A;  2Q0L A;  2PYX A;  3AEG A;  4II3 A;  1YQZ A;  2WOV A;  4H2N A;  2YG4 A;  4HB9 A;  3URH A;  3EAN A;  5C3J A;  2TPR A;  1GT8 A;  4B69 A;  1CC6 A;  3ICT A;  1VDC A;  3SQP A;  2OLN A;  3LXD A;  3AD9 B;  4H4R A;  3SZF A;  3BI5 A;  1V59 A;  1VRQ B;  3AED A;  3CGD A;  3HYX A;  4K7Z A;  3M0O A;  3GDP A;  1B5Q A;  4ZN0 A;  3NGC X;  2WET A;  3GD4 A;  4H4U A;  4OPU A;  1OJA A;  4H4W A;  2WDQ A;  3EPT A;  1IUT A;  2C72 A;  3UKQ A;  1O5W A;  1UKV G;  2GAG B;  2YG3 A;  4A99 A;  2QA1 A;  4OPD A;  3KD9 A;  5FS9 A;  1E1K A;  2GQW A;  4U8J A;  1FEB A;  2R46 A;  3AE5 A;  4K8D A;  2IID A;  3D8X A;  3W4J A;  3L1R A;  2VQ7 A;  4CNJ A;  4EQR A;  2BCP A;  2EQ7 A;  2A87 A;  3ZNQ A;  3V3N A;  5C2T A;  1GAL A;  1QO8 A;  4U8M A;  1GXF A;  2VRL A;  3ABV A;  4J2W A;  4B1B A;  4E0V A;  3Q6J A;  2YG6 A;  3CUK A;  2WDR A;  4X9N A;  2F5Z A;  5U1O A;  4DSH A;  3DGH A;  1K0I A;  4ZCD A;  2BXS A;  2B9Y A;  4J31 A;  4APN A;  3DGZ A;  1E1M A;  2WQY A;  3ZDN A;  3NTD A;  5HHF A;  4JQ9 A;  4TM3 A;  5KMP A;  5KOX A;  1LQT A;  4BJZ A;  3SFE A;  3GYI A; 
#chains in the Genus database with same CATH homology
 3VQR A;  4I59 A;  3CTY A;  2BK5 A;  2JB2 A;  2ARD A;  5J7X A;  1MO9 A;  1PJ5 A;  4B67 A;  1H81 A;  1IUV A;  2GV8 A;  1GOS A;  4C3Y A;  3P4R A;  1TDK A;  1KSS A;  4CCQ A;  3G3E A;  4P9S A;  2XLP A;  2E4A A;  1ZP0 A;  1DAO A;  3P4P A;  3F8D A;  3ADA B;  4H4Y A;  1ZK7 A;  1ZX9 A;  4KX6 A;  4YJF A;  4CBQ A;  3PS9 A;  5FS6 A;  3S5W A;  5U63 A;  2YLT A;  2IVD A;  2X8C A;  4KPR A;  1PJ6 A;  3CND A;  4A6N A;  4TM4 A;  2W0H A;  4H4V A;  1YQ3 A;  4Z43 A;  3LB8 A;  3P4S A;  3P4Q A;  3QSS A;  2QAE A;  5KVH A;  1ZOV A;  5J60 A;  3II4 A;  4CCR A;  1S3E A;  3NLC A;  3QSM A;  2GR3 A;  4X4J A;  1RSG A;  1PJ7 A;  1NDA A;  4AOX A;  1FOH A;  3RP7 A;  1PN0 A;  3QSE A;  2XLT A;  2BCG G;  4U2S A;  1K0L A;  3ICR A;  1E6E A;  3KPK A;  5EBK A;  3VRB A;  5FMH A;  3QFB A;  1KF6 A;  2Q6U A;  1H7W A;  3UP4 A;  1F8R A;  1GSN A;  3NH3 X;  2DKH A;  4GDP A;  1NG3 A;  1PBC A;  1YQ4 A;  1F3P A;  1D5T A;  1GTE A;  4RG4 A;  1EVI A;  2XLR A;  3IHM A;  4YJD A;  2X3N A;  2WOW A;  2XVH A;  4UP3 A;  1TDO A;  2AQJ A;  5IPY A;  5L46 A;  1M64 A;  1NHP A;  4D04 A;  4EIP A;  1QLB A;  2BS3 A;  1JRY A;  2XVJ A;  2FJB A;  1E1L A;  2CUL A;  2YVJ A;  3ATQ A;  4BK3 A;  3NK0 X;  1CBO A;  1E39 A;  4GRT A;  4A7A A;  2B7S A;  2WEU A;  3CMM A;  1SEZ A;  3K7M X;  2RGH A;  2C76 A;  3W4I A;  1NEN A;  2GR1 A;  3UTF A;  1TYP A;  2YG5 A;  4IA5 A;  1XHC A;  1Y56 A;  2Q0K A;  2WPE A;  4BJY A;  2VVM A;  4C3X A;  2IVE A;  3SGL A;  2EQ9 A;  2CVJ A;  3AE3 A;  2GQF A;  3DJJ A;  2BXR A;  4NZH A;  5ER0 A;  1D4C A;  3GWF A;  1BWC A;  1P2E A;  4JY2 A;  2OAL A;  4NEV A;  1K0J A;  3ATR A;  1NEK A;  1ONF A;  3LAD A;  1PXC A;  2R4E A;  3AB1 A;  1GND A;  2XYO A;  5GRT A;  5FS7 A;  4OPC A;  1IUS A;  4YJH A;  2E4G A;  3G5Q A;  4U2L A;  3UOZ A;  1K4Q A;  1JNR A;  3NRN A;  4N9X A;  3C96 A;  1JOA A;  4NTE A;  3UOV A;  1KFY A;  4K2X A;  5KOW A;  4A9W A;  3H8L A;  4BV6 A;  4B63 A;  2VRM A;  1REO A;  1Q1R A;  3GRS A;  4EMJ A;  4USQ A;  2Q7V A;  5KVI A;  1B4V A;  5IQ4 A;  1B37 A;  3SZC A;  1EL5 A;  1S2Y A;  4Z26 A;  2ACZ A;  3SY4 A;  1LV0 A;  1JRZ A;  4Z24 A;  2E1M A;  5JCM A;  3FMW A;  2VVL A;  2WU5 A;  2YR4 A;  2WP9 A;  3NG7 X;  4K5S A;  4XWZ A;  4Y4L A;  3SFD A;  4AP1 A;  1VQW A;  4YKF A;  2QA2 A;  2C66 A;  4H2P A;  1DDO A;  3G5S A;  1L9C A;  1IUW A;  1RP0 A;  2YR6 A;  4RG3 A;  1COY A;  1ELI A;  4REK A;  3FBS A;  4JY3 A;  5M0Z A;  3UOY A;  4YJG A;  4M52 A;  3FIM B;  5BUL A;  4IA6 A;  2BC0 A;  2ZZB A;  3FG2 P;  3SYI A;  3ALJ A;  3B6D A;  1YY5 A;  1GTH A;  2C67 A;  4II2 A;  5JCK A;  2BRY A;  3CN8 A;  2GB0 A;  1GES A;  2E5V A;  3K7Q X;  1NPX A;  1D7Y A;  1ZMC A;  2V60 A;  1VE9 A;  1MXT A;  3NTA A;  2WS3 A;  2BS4 A;  1GEU A;  3R9U A;  4BK1 A;  2PHH A;  2JK6 A;  4Y4N A;  3UKH A;  4U2T A;  2B9X A;  3DJE A;  2YVF A;  2YLX A;  4Z2U A;  2XCG A;  3CNT A;  3ISH A;  1DJN A;  2I0Z A;  1VG9 A;  2ZZC A;  3HYV A;  3VR8 A;  3CGE A;  3DME A;  1S2Q A;  2VOU A;  3AE7 A;  3LZX A;  2APG A;  1S3B A;  4EM4 A;  3KVE A;  5LV9 A;  1XDI A;  2VZ2 A;  1CJ4 A;  3LZW A;  3RNM A;  1GER A;  1OJT A;  2VVL G;  2GH5 A;  3COX A;  4CY6 A;  3NYF A;  2XVI A;  4J36 A;  1XAN A;  1LJ1 A;  3C4A A;  4CY8 A;  1L9E A;  2XFN A;  4H2R A;  4NTC A;  3W4K A;  2QCU A;  1PXB A;  1MOK A;  2FBW A;  3QJ4 A;  2X8H A;  1NG4 A;  4YTP A;  1N1P A;  3GSI A;  4H4Z A;  4EM3 A;  1Y0P A;  4YXD A;  1GV4 A;  1EL7 A;  3E1T A;  1Z6L A;  1ZOY A;  4JNA A;  2TMD A;  2X99 A;  1DXL A;  2JBV A;  4O5U A;  4IVM B;  3GMC A;  4EQS A;  4O5Q A;  3LOV A;  3EF6 A;  1TDE A;  3DA1 A;  5CQF A;  2BRA A;  2YLW A;  4BK2 A;  2BC1 A;  2C65 A;  3CIR A;  3D1C A;  2RGO A;  1CHU A;  4Z2R A;  4G9K A;  3AYJ A;  2FJA A;  1TDN A;  3AEB A;  1F8S A;  1Q9I A;  3CPJ G;  2XFU A;  2E48 A;  2DKI A;  2O9Z A;  4U8N A;  2WDV A;  2R9Z A;  4B68 A;  2OAM A;  2XFO A;  3UKA A;  2AAQ A;  2JB3 A;  4GR1 A;  1C0L A;  2GR2 A;  2B9W A;  1C0I A;  3AD7 B;  1O94 A;  3UOX A;  1KDG A;  4OCG A;  1PS9 A;  5U25 A;  3Q9T A;  1EBD A;  2GRT A;  3KU9 A;  4J57 A;  3GYX A;  4EMI A;  4JNQ A;  1BF3 A;  1N4W A;  3NT6 A;  4WCT A;  2A8X A;  3GRT A;  4IVO B;  4C77 A;  3HYW A;  1CC2 A;  2R0G A;  2YAU A;  2BAC A;  4K22 A;  1KNP A;  3AEC A;  3F8P A;  4U8L A;  5KWF A;  3CGB A;  4YT0 A;  5EB5 A;  2X50 A;  2WOI A;  3UP5 A;  3DJG X;  4AT2 A;  1DOC A;  1ZMD A;  1PHH A;  2YG7 A;  2Z5X A;  5BRT A;  3AE9 A;  3AE1 A;  4GF7 A;  2Z5Y A;  4ADW A;  3KPF A;  3CNP A;  1PXA A;  3AE6 A;  3UKK A;  3VRD B;  2WPF A;  3HZL A;  1FCD A;  4MJW A;  4OPG A;  4HA6 A;  1ZY8 A;  2R0P A;  2XVF A;  1GRG A;  1HYU A;  2Y6Q A;  4NEW A;  5JCI A;  2YLR A;  4U8I A;  2GVC A;  3ICS A;  4JN9 A;  1LPF A;  1H86 A;  3SXI A;  3DK9 A;  2YR5 A;  4Z44 A;  2E82 A;  2GR0 A;  3T2K A;  1AN9 A;  1JU2 A;  4EQW A;  1VG0 A;  3AYL A;  1H84 A;  4FX9 A;  5TR3 A;  3C4N A;  3M12 A;  4YSH A;  1B8S A;  4USR A;  3T0K A;  5M10 A;  3AEA A;  4J56 A;  4EQX A;  3GWD A;  5KMR A;  1CJ3 A;  1D7L A;  4QFC A;  4LU6 A;  3DK4 A;  3I3L A;  2WPC A;  3DJD A;  1PBB A;  2YVG A;  1NAA A;  5DBJ A;  2C70 A;  1ZDL A;  3IC9 A;  1IJH A;  3L8K A;  1CC4 A;  2NVK X;  3K7T A;  3PO7 A;  4YJG B;  1H7X A;  3S61 A;  3T2Y A;  4H4X A;  1GRT A;  1JRX A;  4XXG A;  4BUR A;  3LJP A;  2JB1 A;  2CDU A;  3EAO A;  1Q1W A;  4ZCC A;  5FS8 A;  1C0P A;  1JEH A;  1OJD A;  2OA1 A;  2Y6R A;  3T31 A;  2C4C A;  3GYJ A;  3UKL A;  3UTE A;  4GUV A;  3AWI A;  4TM1 A;  1CF3 A;  4OVI A;  5KMS A;  1BKW A;  2GEW A;  3AE4 A;  4I58 A;  1N4U A;  4IV9 A;  3UCL A;  1GRE A;  2YWL A;  2GAH B;  1P2H A;  2V61 A;  2ZBW A;  3IWA A;  1GRB A;  4OPI A;  5IQ1 A;  4YTN A;  3ALM A;  1IUU A;  3AE8 A;  5JCN A;  3BHF A;  3GD3 A;  2X8G A;  1GPE A;  3NN0 X;  2JAE A;  3AEE A;  2V6O A;  4AOS A;  1D4E A;  1GRF A;  2BK3 A;  1CJC A;  1GRA A;  1GRH A;  1LVL A;  2XLU A;  4B64 A;  1H83 A;  4G6G A;  4ICY A;  5BUK A;  3QVR A;  4UDP A;  4TM0 A;  4UDQ A;  2BA9 A;  3CGC A;  1F6M A;  2AR8 A;  2DU8 A;  4GAV A;  4J33 A;  3CNS A;  5KRQ A;  1JNZ A;  1LTX R;  2OLO A;  1H6V A;  4CRT A;  4DNA A;  1N4V A;  3KLJ A;  4CNK A;  3VR9 A;  2YLZ A;  1W4X A;  4YJF B;  2BS2 A;  4H4Q A;  2C7G A;  2B7R A;  4EMW A;  3P9U A;  3DH9 A;  4K5R A;  3UKP A;  1E1N A;  4C5O A;  4A6N B;  1DOB A;  1BZL A;  1GET A;  1NHS A;  2C73 A;  4H7U A;  1CL0 A;  3NHO X;  1C0K A;  2XLS A;  4H4P A;  4AT0 A;  2JKC A;  3DK8 A;  2R4J A;  3CPH G;  4NTD A;  4YTM A;  3CPI G;  4PAA A;  4TLZ A;  1QJD A;  3AEF A;  2YM2 A;  5BVA A;  2WBA A;  2VQB A;  1YKJ A;  1ZKQ A;  2YM1 A;  1AOG A;  1PBD A;  3NYC A;  1D4D A;  4D03 A;  2UZZ A;  5HYM A;  3BI4 A;  4H4S A;  3ZNN A;  4UDR A;  4FK1 C;  3BNM A;  2H89 A;  1EL9 A;  4H4T A;  4LA1 A;  1F8W A;  3NK1 X;  3WE0 A;  4YSY A;  2V5Z A;  4GAP A;  2V3A A;  4JDR A;  3V3O A;  2WP5 A;  1PBF A;  1FEC A;  4H2Q A;  2BYB A;  3KA7 A;  4U8K A;  2GF3 A;  2XFP A;  4U8O A;  1PDH A;  2CFY A;  1CJ2 A;  1KSU A;  2C75 A;  3V76 A;  1H82 A;  4B65 A;  1KIF A;  5CKU A;  1RYI A;  3SZ0 A;  1FL2 A;  5KMQ A;  3JSK A;  3RHA A;  2C3D A;  3NN6 X;  1O95 A;  3QFA A;  4AP3 A;  2NPX A;  2V3B A;  2RGJ A;  1PBE A;  2C3C A;  3K30 A;  1FEA A;  4YKG A;  1IUX A;  4FDC B;  5KNL A;  5EOW A;  4YWO A;  2FJD A;  3NKS A;  4J34 A;  2HQM A;  4QFD A;  1NHQ A;  3H8I A;  4LII A;  2FJE A;  4Z25 A;  4PAB A;  3ALL A;  4A5L A;  4DGK A;  3PVC A;  2EQ6 A;  2XDO A;  4FK1 A;  4NNJ A;  3O0H A;  4TLX A;  4X9M A;  4WX1 A;  2BAB A;  2XFQ A;  1Y56 B;  4G6H A;  4Y4M A;  1X31 B;  1BGJ A;  1L0V A;  5JCL A;  3RP8 A;  4G73 A;  2GMH A;  3WGT A;  2WES A;  3B3R A;  4A79 A;  2R45 A;  3BNU A;  1DNC A;  1BGN A;  3SX6 A;  2C64 A;  4U8P A;  2B76 A;  2ZZ0 A;  1TDF A;  1EL8 A;  2WU2 A;  4EIQ A;  3H4K A;  3ZNO A;  4YJH B;  4OPL A;  2E49 A;  4G74 A;  3IF9 A;  3NK2 X;  1DOD A;  3BI2 A;  1NHR A;  3IHG A;  3ITJ A;  4C74 A;  4GCM A;  3NNE A;  3M13 A;  5HY5 A;  3SZW A;  3CNJ A;  1DJQ A;  2EQ8 A;  4YSZ A;  1DOE A;  3BHK A;  3SM8 A;  2GMJ A;  3GMB A;  3OZ2 A;  3T37 A;  3ZNP A;  1TYT A;  5GSN A;  3VRA A;  4H50 A;  3ZYX A;  4YSX A;  3NIX A;  5EB4 A;  3UTG A;  4DSG A;  4GDE A;  3RED A;  4A65 A;  4XWR A;  3AYI A;  4RSL A;  1TRB A;  3FPZ A;  1OJ9 A;  1L9D A;  4OPT A;  1E7P A;  2R0C A;  1M6I A;  5KXJ A;  1KNR A;  3RP6 A;  2WP6 A;  3AE2 A;  2RAB A;  2XVE A;  4ECH A;  1OJC A;  3UKF A;  4Z2T A;  1LQU A;  2YQU A;  3GDN A;  3OC4 A;  2J3N A;  3AD8 B;  3T14 A;  3F8R A;  3KKJ A;  5HXI A;  1XPQ A;  4NWZ A;  3QVP A;  3AXB A;  2BK4 A;  3P1W A;  2YLS A;  4B66 A;  3UTH A;  2A89 A;  3T2Z A;  3NYE A;  2H88 A;  3G5R A;  2WHD A;  3I6D A;  2Q0L A;  2PYX A;  3AEG A;  4II3 A;  1YQZ A;  2WOV A;  2YG4 A;  4H2N A;  4HB9 A;  3URH A;  3EAN A;  5C3J A;  2TPR A;  1GT8 A;  4B69 A;  1CC6 A;  3ICT A;  1VDC A;  3SQP A;  2OLN A;  3LXD A;  3AD9 B;  4H4R A;  3SZF A;  3BI5 A;  1V59 A;  1VRQ B;  3AED A;  3CGD A;  3HYX A;  4K7Z A;  3M0O A;  3GDP A;  1B5Q A;  4ZN0 A;  3NGC X;  2WET A;  3GD4 A;  4H4U A;  4OPU A;  1OJA A;  4H4W A;  2WDQ A;  3EPT A;  1IUT A;  2C72 A;  3UKQ A;  1O5W A;  1UKV G;  2GAG B;  2YG3 A;  4A99 A;  2QA1 A;  4OPD A;  3KD9 A;  5FS9 A;  1E1K A;  2GQW A;  4U8J A;  1FEB A;  2R46 A;  3AE5 A;  4K8D A;  2IID A;  3D8X A;  3W4J A;  3L1R A;  2VQ7 A;  4CNJ A;  4EQR A;  2BCP A;  2EQ7 A;  2A87 A;  3ZNQ A;  3V3N A;  5C2T A;  1GAL A;  1QO8 A;  4U8M A;  1GXF A;  2VRL A;  3ABV A;  4J2W A;  4B1B A;  4E0V A;  3Q6J A;  2YG6 A;  3CUK A;  2WDR A;  4X9N A;  2F5Z A;  5U1O A;  4DSH A;  3DGH A;  1K0I A;  4ZCD A;  2BXS A;  2B9Y A;  4J31 A;  4APN A;  3DGZ A;  1E1M A;  2WQY A;  3ZDN A;  3NTD A;  5HHF A;  4JQ9 A;  4TM3 A;  5KMP A;  5KOX A;  1LQT A;  4BJZ A;  3SFE A;  3GYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...