3NYCA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
381
structure length
381
Chain Sequence
b'HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 126
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nycA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nycA01
2GAGB 3B6DA 3DA1A 1GALA 1BF3A 1VG9A 2WP5A 4EQRA 1NENA 3CGBA 4XWRA 3UKKA 4GR1A 1PN0A 3D8XA 1EBDA 1N1PA 2J3NA 3P4QA 2OLOA 4H4ZA 1CJ3A 3UOZA 4J2WA 3Q9TA 5FMHA 4A79A 2VZ2A 4GDPA 1TYPA 1O94A 1JU2A 4U8NA 1DAOA 3AYLA 2H88A 1Z6LA 2WEUA 3AE3A 3OC4A 1JRXA 4ZCCA 4RSLA 1ONFA 2DKHA 2GQWA 3GMBA 4OPLA 3UOVA 3ALMA 3IWAA 4J33A 1CC4A 4ZN0A 2WDRA 1W4XA 2XLSA 2WESA 3LJPA 2BCGG 3AE1A 4EQWA 2GMJA 3AECA 3KKJA 1CHUA 4GRTA 4WX1A 1GRFA 1EVIA 2CFYA 1FCDA 2V3BA 1MO9A 5GRTA 1D7YA 2VRLA 1ZMCA 3LADA 4Z26A 3E1TA 2C76A 3NK1X 3LOVA 4K5RA 2FJBA 1E1NA 3UCLA 1N4WA 2FJDA 4B1BA 1D7LA 3QVRA 1NPXA 4CY8A 4TLXA 1LTXR 1FECA 4BK1A 1ZDLA 3CPJG 3CPHG 2ZZ0A 1E1LA 3NLCA 1TRBA 4IV9A 2FJEA 2PHHA 3BNMA 1DDOA 3ZYXA 1NG3A 2VVMA 1ZMDA 2WP6A 1PDHA 2W0HA 1GV4A 2XLTA 2YWLA 2XFUA 3RNMA 3WE0A 3F8PA 4JDRA 1IUXA 4H4PA 4U2LA 3AD7B 3NYEA 1E7PA 1H86A 1DODA 1UKVG 1DOBA 5FS6A 3COXA 2C67A 2OLNA 1PJ6A 2GR3A 2WBAA 3V3NA 4C77A 2O9ZA 1Q1RA 3C4NA 2IVEA 1PHHA 1XANA 2DKIA 2TPRA 1OJTA 4KX6A 5JCKA 3W4IA 4Z2RA 4UP3A 4QFDA 2XVHA 2AQJA 1PXCA 1PBFA 1VG0A 4OPIA 4EIQA 1O95A 4YSXA 3KU9A 4NEVA 3M0OA 4H2QA 2BACA 4IVOB 1ZK7A 4BURA 4A65A 4U8OA 1BGNA 4GF7A 5KOWA 1H81A 4FX9A 3NN0X 2VRMA 4H4TA 1NHRA 2GMHA 5EBKA 2WPCA 1S3EA 3REDA 4FDCB 5ER0A 3NN6X 4C3YA 3DJEA 2X8CA 1GEUA 2V60A 4YSZA 1L9EA 1D4EA 3RP7A 4I59A 3GRTA 4X9NA 3GSIA 3CPIG 3NT6A 2E4GA 1GXFA 2Q7VA 3NTAA 4KPRA 1K0JA 2WOWA 3ZNNA 2YR5A 1YQ3A 3WGTA 4CBQA 2E48A 4EMJA 1PBEA 1K4QA 4K5SA 4CY6A 3CNDA 1P2HA 4RG4A 3UOXA 4YTPA 1DOCA 2YLZA 5KRQA 2YLTA 1GRHA 3PS9A 1BKWA 2X99A 1B4VA 4K7ZA 1YKJA 2GR2A 3QSMA 2JB1A 1LJ1A 3URHA 2JAEA 5HHFA 1CC2A 2X8GA 2E49A 4H4WA 1FOHA 3EF6A 3SFDA 4YJHB 3GD3A 3V76A 4YKFA 4DNAA 3S5WA 3P9UA 2GEWA 3KPFA 1AN9A 1ZOYA 3AE4A 1CJ4A 3ZNPA 1IUVA 1E1MA 3DK9A 3IHGA 4U2SA 1YQ4A 1PXAA 2F5ZA 4H4SA 2OA1A 3SGLA 4H7UA 4Z43A 1CJCA 2B9XA 1E6EA 2WHDA 3AE9A 3K7MX 1VRQB 2NPXA 2BS2A 2Z5YA 1ZX9A 4BJYA 3ADAB 3RP6A 3K30A 2QA1A 3FPZA 4D04A 1EL9A 2YG7A 3DMEA 2JB2A 1IJHA 4K22A 3UKHA 4C3XA 1K0LA 1NG4A 4CRTA 4EQSA 1ELIA 1PBCA 2XLPA 3BI2A 2GF3A 1L9DA 2C73A 3CUKA 2WPEA 1OJAA 4YJHA 3DK4A 1GRGA 3G5QA 3K7TA 2C72A 4J56A 4UDRA 1KSUA 2WDQA 2EQ9A 3DGHA 2PYXA 3CGCA 3GWDA 1KFYA 3EAOA 3T37A 2I0ZA 3IC9A 1OJCA 4JN9A 5CQFA 2E5VA 1NEKA 5JCMA 3UTFA 5U25A 3CGDA 1O5WA 3NRNA 4H2RA 1NDAA 1RP0A 3RP8A 3VR8A 1KSSA 5KWFA 2R9ZA 3NHOX 2WOVA 3UKPA 2WQYA 4HA6A 3P4RA 2X8HA 1LQUA 3SFEA 4CCQA 4EMWA 4A6NB 1JNRA 3QFAA 2WDVA 1IUWA 3ZNQA 1XPQA 2RGJA 1RSGA 2V5ZA 4Z44A 3AEDA 1BZLA 2HQMA 2C3DA 4A7AA 4ADWA 4CNKA 3ATRA 4C74A 4Z25A 3ZDNA 1VQWA 2YG5A 1S3BA 3NK0X 2B9WA 3VQRA 3GWFA 2H89A 3ZNOA 3O0HA 4BV6A 2TMDA 1PBBA 1GPEA 3KD9A 3P4PA 4DGKA 1P2EA 3AE7A 4OPGA 2OALA 2JK6A 3H8LA 4EM3A 2XVJA 2XDOA 1ZKQA 3ICTA 3AXBA 3NNEA 4XXGA 4Y4MA 3V3OA 3ICRA 2YVJA 2WU5A 1GOSA 5J7XA 5JCIA 4JY3A 4B66A 4TM1A 4A6NA 3VR9A 4FK1A 1PJ5A 2B7RA 2R46A 1JEHA 4CNJA 3NYCA 1KNPA 2Q0KA 4B68A 3Q6JA 1VDCA 2ZBWA 4YSHA 4ECHA 1REOA 2B9YA 4H4VA 3IF9A 1NHSA 1H7XA 2ZZBA 5KOXA 2GRTA 2B76A 2GVCA 3DGZA 3DJGX 3EPTA 1YQZA 3B3RA 4B67A 1JRZA 5GSNA 1E1KA 3BHFA 2XFQA 4LIIA 2A89A 1LVLA 1N4VA 3AE8A 3AEAA 4K2XA 1XDIA 3L8KA 4YSYA 2WP9A 4N9XA 3H4KA 2GB0A 3K7QX 2QCUA 1GREA 3UP4A 1TDNA 4B65A 4EM4A 4YT0A 5BVAA 5C2TA 2YG4A 1JOAA 5CKUA 3VRAA 3GDNA 2E82A 3FMWA 3KA7A 4C5OA 2XFOA 2BS3A 4USRA 2GR1A 2YM1A 2C65A 1GNDA 4YJGB 4H2NA 3DJJA 2BK4A 4OPDA 3SQPA 3QVPA 4U8PA 2NVKX 4BK2A 4J31A 2RABA 3QFBA 5C3JA 4WCTA 4AT0A 4UDQA 4YTNA 3AD8B 5HXIA 4YTMA 1KNRA 1E39A 4AP1A 3H8IA 2GH5A 3AYIA 2AR8A 3DJDA 2YLSA 1TYTA 2VQBA 3AE6A 4IA5A 3FIMB 2YAUA 4Z2TA 3AEGA 3D1CA 2JKCA 1ZY8A 1QJDA 3IHMA 4OPTA 1D5TA 1DXLA 4LU6A 3ABVA 4ZCDA 3ALLA 3L1RA 5M10A 1TDOA 1EL5A 1NHQA 4EQXA 2C3CA 2Y6QA 1JNZA 2ZZCA 3AE2A 2VQ7A 1GTEA 4NEWA 4YJGA 1H84A 2A8XA 1LV0A 4IVMB 1GRTA 3AEEA 4OPCA 1IUSA 3F8DA 4JNAA 2APGA 3CNTA 4NTDA 4B69A 2RGOA 3VRDB 2BC0A 1CL0A 2XCGA 1Y0PA 1B8SA 3BNUA 4Y4LA 3QJ4A 3M13A 2XYOA 4DSHA 4O5UA 4B63A 2YR4A 3UKAA 2OAMA 4U8LA 1NAAA 1TDFA 4K8DA 4U2TA 3CTYA 1OJDA 2C64A 1XHCA 3F8RA 1S2QA 4ICYA 3S61A 4AOXA 3AEBA 3G3EA 2XLRA 1F6MA 4EMIA 5EB4A 4X4JA 3W4KA 3ATQA 1GESA 2YR6A 5FS7A 1H83A 5U63A 4PAAA 1X31B 2YLWA 2GR0A 1S2YA 3KVEA 3NG7X 3UTHA 4BJZA 2C75A 4GDEA 2E4AA 1IUTA 1BGJA 4H4QA 1PJ7A 2RGHA 1PBDA 2A87A 4OVIA 1H7WA 2CVJA 4B64A 1F8WA 1LQTA 4UDPA 1LPFA 4GCMA 3GRSA 4QFCA 5KXJA 5JCLA 3LB8A 3BHKA 4YJFB 4TM4A 3AWIA 5FS9A 5EB5A 3UTEA 3DH9A 5U1OA 3AE5A 2YM2A 1QO8A 2GQFA 4YWOA 4XWZA 1DJNA 4AOSA 4PABA 4A99A 1F8SA 3GYJA 2YG3A 3PO7A 3M12A 3ALJA 3LZWA 4H4XA 1FEAA 1CF3A 3I6DA 4RG3A 4YXDA 3BI5A 3I3LA 3W4JA 4CCRA 1ZOVA 2C70A 4J57A 2BC1A 3NYFA 1PXBA 2XVEA 3BI4A 3UOYA 4X9MA 1YY5A 2FJAA 1KIFA 2WU2A 3CNJA 3NK2X 5M0ZA 3ISHA 5J60A 4A5LA 1Q9IA 3UKFA 4J36A 4JY2A 3UKLA 1D4DA 2YG6A 3AD9B 1B5QA 1COYA 3DK8A 4NTEA 3GYIA 2XFNA 3LZXA 1DJQA 3II4A 1C0KA 2CULA 3QSEA 4YJFA 2EQ6A 3CN8A 2VVLA 4JNQA 3UKQA 5EOWA 4Z24A 2XLUA 1Y56B 2R0PA 1HYUA 1DNCA 3CIRA 3QSSA 2BK5A 5IPYA 2R4EA 5DBJA 3AYJA 1V59A 2R0GA 3GMCA 4JQ9A 5L46A 3VRBA 1GRAA 2Y6RA 1GERA 3OZ2A 3PVCA 2GV8A 4E0VA 3UP5A 2JBVA 1DOEA 4H4RA 4Y4NA 4AP3A 4MJWA 4YKGA 2WPFA 1ZP0A 1BWCA 1EL8A 2V6OA 4I58A 1KF6A 5LV9A 3CGEA 4EIPA 2UZZA 2YVFA 2B7SA 2WS3A 3C4AA 4FK1C 2FBWA 1GSNA 2BYBA 2VOUA 3NIXA 1MXTA 3CNPA 2BA9A 3KLJA 2R0CA 3UTGA 2BABA 1C0PA 4H50A 1TDKA 4J34A 2GAHB 2XVIA 1F3PA 4D03A 4NTCA 1K0IA 2WOIA 3G5SA 1CBOA 4GUVA 5BRTA 3NGCX 3NTDA 4U8MA 5HY5A 2R4JA 1GTHA 1Y56A 3RHAA 1GT8A 2BS4A 3ITJA 1JRYA 4LA1A 2AAQA 5FS8A 1Q1WA 2BCPA 1KDGA 4YJDA 2V61A 5IQ1A 5TR3A 4HB9A 1M64A 1C0IA 1H82A 1TDEA 2WETA 1IUUA 2X3NA 2XVFA 4OPUA 4Z2UA 1H6VA 1VE9A 1M6IA 2JB3A 2R45A 1PS9A 1CJ2A 2CDUA 5IQ4A 2EQ8A 3AEFA 2C7GA 4U8IA 3GDPA 2ARDA 3LXDA 4TLZA 1AOGA 4TM3A 4BK3A 4H2PA 3ICSA 1MOKA 4M52A 4U8JA 4A9WA 3NH3X 2Q0LA 2E1MA 3CNSA 4NZHA 3P1WA 5KVIA 4DSGA 2DU8A 3SM8A 1FL2A 4IA6A 2BXRA 3FG2P 3G5RA 4P9SA 5BULA 3HZLA 1B37A 1GRBA 4OCGA 5JCNA 2X50A 2EQ7A 2VVLG 3EANA 1QLBA 4O5QA 5KVHA 1RYIA 1FEBA 1CC6A 1GETA 2YLRA 3NKSA 4APNA 2IIDA 2V3AA 1D4CA 4U8KA 1NHPA 4H4UA 4REKA 2YLXA 1OJ9A 3FBSA 1SEZA 4TM0A 3JSKA 2Q6UA 2YQUA 5HYMA 2C66A 4USQA 3GD4A 3C96A 1L0VA 4AT2A 2BXSA 1L9CA 4H4YA 2XFPA 2QAEA 5BUKA 2Z5XA 2YVGA 2BK3A 3P4SA 2IVDA 3R9UA 1EL7A 1C0LA 2QA2A 1F8RA 1N4UA 2ACZA 3AB1A
chains in the Genus database with same CATH superfamily
2GAGB 3B6DA 3DA1A 1GALA 1BF3A 1VG9A 2WP5A 4EQRA 1NENA 3CGBA 4XWRA 3UKKA 4GR1A 1PN0A 3D8XA 1EBDA 1N1PA 2J3NA 3P4QA 2OLOA 4H4ZA 1CJ3A 3UOZA 4J2WA 5TR3A 3Q9TA 5FMHA 4A79A 2VZ2A 4GDPA 1TYPA 1O94A 1JU2A 4U8NA 1DAOA 3AYLA 2H88A 1Z6LA 2WEUA 3AE3A 2BRAA 3OC4A 4NWZA 1JRXA 4ZCCA 4RSLA 1ONFA 2DKHA 3GMBA 2GQWA 4OPLA 3UOVA 3ALMA 3IWAA 4J33A 1CC4A 4ZN0A 2WDRA 1W4XA 2XLSA 2WESA 3LJPA 2BCGG 3AE1A 4EQWA 2GMJA 3AECA 3KKJA 1CHUA 4GRTA 4WX1A 1GRFA 1EVIA 2CFYA 1FCDA 2V3BA 1MO9A 5GRTA 1D7YA 2VRLA 1ZMCA 3LADA 4Z26A 3E1TA 2C76A 3NK1X 3LOVA 4K5RA 2FJBA 1E1NA 3UCLA 1N4WA 2FJDA 4B1BA 1D7LA 3QVRA 1NPXA 4CY8A 4GAPA 4TLXA 1LTXR 1FECA 1ZDLA 3CPJG 3CPHG 2ZZ0A 1E1LA 3NLCA 1TRBA 4IV9A 2FJEA 2PHHA 3BNMA 1DDOA 3ZYXA 1NG3A 2VVMA 1ZMDA 2WP6A 3SZWA 1PDHA 2W0HA 1GV4A 2XLTA 2YWLA 2XFUA 3RNMA 3WE0A 3F8PA 4JDRA 1IUXA 4H4PA 4U2LA 3AD7B 3HYVA 3NYEA 1E7PA 1H86A 1DODA 1UKVG 1DOBA 5FS6A 3COXA 2C67A 2OLNA 1PJ6A 2GR3A 2WBAA 3HYWA 3V3NA 4C77A 2O9ZA 1Q1RA 3C4NA 2IVEA 1PHHA 2DKIA 1XANA 2TPRA 1OJTA 4KX6A 5JCKA 3W4IA 4Z2RA 4UP3A 4QFDA 2XVHA 2AQJA 1PXCA 1PBFA 4EIQA 1VG0A 4OPIA 1O95A 4YSXA 3KU9A 4NEVA 3M0OA 4H2QA 2BACA 4IVOB 1ZK7A 4BURA 4A65A 4U8OA 1BGNA 4GF7A 4G6GA 5KOWA 1H81A 4FX9A 3NN0X 2VRMA 4H4TA 2GMHA 1NHRA 5EBKA 2WPCA 1S3EA 3KPKA 3REDA 4FDCB 5ER0A 3NN6X 4C3YA 3DJEA 2X8CA 1GEUA 2V60A 4YSZA 1L9EA 1D4EA 3RP7A 3T31A 4I59A 3GRTA 4X9NA 3GSIA 3CPIG 3NT6A 2E4GA 1GXFA 2Q7VA 3NTAA 4KPRA 1K0JA 2WOWA 3ZNNA 2YR5A 1YQ3A 3WGTA 4CBQA 2E48A 4EMJA 1PBEA 1K4QA 4K5SA 4CY6A 3CNDA 1P2HA 4RG4A 3UOXA 4YTPA 1DOCA 2YLZA 5KRQA 2YLTA 1GRHA 3PS9A 1BKWA 2X99A 1B4VA 4K7ZA 1YKJA 2GR2A 3QSMA 2JB1A 1LJ1A 3URHA 2JAEA 5HHFA 1CC2A 2X8GA 2E49A 4H4WA 1FOHA 3EF6A 3SFDA 4YJHB 3GD3A 3V76A 4YKFA 5KMSA 4DNAA 3S5WA 3P9UA 2GEWA 3KPFA 3CMMA 1AN9A 1ZOYA 3AE4A 1CJ4A 3ZNPA 1IUVA 1E1MA 3IHGA 3DK9A 4U2SA 1YQ4A 1PXAA 2F5ZA 4H4SA 2OA1A 3SGLA 4H7UA 4Z43A 1CJCA 2B9XA 1E6EA 2WHDA 3AE9A 3K7MX 1VRQB 2NPXA 2BS2A 2Z5YA 1ZX9A 4BJYA 3ADAB 3RP6A 3K30A 2QA1A 3FPZA 4D04A 1EL9A 2YG7A 3DMEA 2JB2A 1IJHA 4K22A 3UKHA 4C3XA 1K0LA 1NG4A 4CRTA 4EQSA 1ELIA 1PBCA 2XLPA 3BI2A 2GF3A 1L9DA 2C73A 3CUKA 2WPEA 1OJAA 4YJHA 3DK4A 1GRGA 3G5QA 3K7TA 2C72A 4J56A 4UDRA 1KSUA 2WDQA 2EQ9A 3DGHA 2PYXA 3CGCA 3GWDA 1KFYA 3EAOA 3T37A 2I0ZA 3IC9A 1OJCA 4JN9A 5CQFA 2E5VA 1NEKA 5JCMA 3UTFA 5U25A 3CGDA 1O5WA 4NNJA 3NRNA 4H2RA 1NDAA 3RP8A 1RP0A 3VR8A 1KSSA 5KWFA 2R9ZA 3NHOX 2WOVA 3UKPA 2WQYA 4HA6A 3P4RA 2X8HA 1LQUA 3SFEA 4CCQA 4EMWA 4A6NB 1JNRA 3QFAA 2WDVA 1IUWA 3ZNQA 2RGJA 1XPQA 1RSGA 2V5ZA 4Z44A 3AEDA 1BZLA 2HQMA 2C3DA 5KMRA 4A7AA 4ADWA 4CNKA 3ATRA 4C74A 4Z25A 3ZDNA 1VQWA 2YG5A 1S3BA 3NK0X 2B9WA 3VQRA 3GWFA 2H89A 3ZNOA 3O0HA 3SXIA 2TMDA 1PBBA 1GPEA 3KD9A 3P4PA 4BV6A 4DGKA 1P2EA 3AE7A 4OPGA 2OALA 2JK6A 3H8LA 4EM3A 2XVJA 2XDOA 1ZKQA 3ICTA 3AXBA 3NNEA 4XXGA 4Y4MA 3V3OA 3ICRA 2YVJA 2WU5A 1GOSA 5J7XA 5JCIA 4JY3A 4B66A 4TM1A 4A6NA 3VR9A 4FK1A 1PJ5A 2B7RA 2R46A 1JEHA 4CNJA 3NYCA 1KNPA 2Q0KA 4B68A 3Q6JA 1VDCA 2ZBWA 4YSHA 4ECHA 1REOA 2B9YA 4H4VA 3IF9A 1NHSA 1H7XA 2ZZBA 5KOXA 2GRTA 2B76A 2GVCA 3DGZA 3DJGX 3EPTA 1YQZA 3B3RA 4B67A 1JRZA 5GSNA 1E1KA 3BHFA 2XFQA 4LIIA 2A89A 1LVLA 1N4VA 3AE8A 3AEAA 4K2XA 1XDIA 3L8KA 3T2YA 4YSYA 2WP9A 4N9XA 3H4KA 2GB0A 3K7QX 2QCUA 1GREA 4G6HA 1TDNA 3UP4A 4B65A 4EM4A 4YT0A 5BVAA 5C2TA 2YG4A 1JOAA 5CKUA 3VRAA 3GDNA 2E82A 3FMWA 3KA7A 4C5OA 2XFOA 2BS3A 4USRA 2GR1A 2YM1A 2C65A 4H2NA 4YJGB 1GNDA 3DJJA 2BK4A 4OPDA 3SQPA 3QVPA 4U8PA 2NVKX 4BK2A 4J31A 2RABA 3QFBA 5C3JA 3T2ZA 4WCTA 4AT0A 4UDQA 4YTNA 3AD8B 5HXIA 4YTMA 1KNRA 1E39A 4AP1A 3SZ0A 3H8IA 3T2KA 2GH5A 3AYIA 5KMPA 2AR8A 3DJDA 3T14A 2YLSA 1TYTA 2VQBA 3AE6A 4IA5A 3FIMB 2YAUA 4Z2TA 3AEGA 3D1CA 2JKCA 1ZY8A 1QJDA 3IHMA 3SY4A 4OPTA 1D5TA 1DXLA 4LU6A 3ABVA 4ZCDA 3ALLA 3L1RA 5M10A 1TDOA 1EL5A 1NHQA 4EQXA 2C3CA 2Y6QA 1JNZA 2ZZCA 3AE2A 2VQ7A 1GTEA 4NEWA 4YJGA 1H84A 2A8XA 1LV0A 4IVMB 1GRTA 2BRYA 3SYIA 3AEEA 4OPCA 1IUSA 3F8DA 4JNAA 2APGA 3CNTA 4NTDA 4B69A 2RGOA 3VRDB 2BC0A 4G73A 5KMQA 1CL0A 2XCGA 1Y0PA 1B8SA 3BNUA 3GYXA 4Y4LA 3QJ4A 3M13A 2XYOA 4DSHA 4O5UA 4B63A 2YR4A 3UKAA 2OAMA 4U8LA 1NAAA 1TDFA 4K8DA 4U2TA 3CTYA 1OJDA 2C64A 1XHCA 3F8RA 1S2QA 4ICYA 4II3A 3S61A 3SZFA 4AOXA 3AEBA 3G3EA 2XLRA 1F6MA 4EMIA 5EB4A 4X4JA 3W4KA 3ATQA 1GESA 2YR6A 5FS7A 1H83A 5U63A 4PAAA 1X31B 2YLWA 2GR0A 1S2YA 3KVEA 3NG7X 3UTHA 4BJZA 2C75A 4GDEA 2E4AA 1IUTA 1BGJA 4H4QA 1PJ7A 2RGHA 1PBDA 2A87A 4OVIA 1H7WA 2CVJA 4B64A 1F8WA 1LQTA 4UDPA 1LPFA 4GCMA 3GRSA 4QFCA 5KXJA 5JCLA 3LB8A 3BHKA 4YJFB 4TM4A 3AWIA 5FS9A 5EB5A 3UTEA 3DH9A 5U1OA 3AE5A 4GAVA 2YM2A 1QO8A 2GQFA 4YWOA 4XWZA 1DJNA 4AOSA 4PABA 4A99A 1F8SA 3GYJA 2YG3A 3PO7A 3M12A 3ALJA 3LZWA 4H4XA 1FEAA 1CF3A 3I6DA 4RG3A 4YXDA 3BI5A 3I3LA 3W4JA 4CCRA 1ZOVA 2C70A 4J57A 2BC1A 3NYFA 1PXBA 2XVEA 3BI4A 4II2A 4X9MA 1YY5A 2FJAA 1KIFA 2WU2A 3CNJA 3NK2X 5M0ZA 3ISHA 5J60A 4A5LA 1Q9IA 3UKFA 4J36A 4JY2A 3UKLA 1D4DA 2YG6A 3AD9B 1B5QA 1COYA 3DK8A 4NTEA 3GYIA 2XFNA 3LZXA 1DJQA 3II4A 1C0KA 2CULA 3QSEA 4YJFA 2EQ6A 3CN8A 2VVLA 4JNQA 3UKQA 5EOWA 4Z24A 2XLUA 1Y56B 2R0PA 1HYUA 1DNCA 3CIRA 3QSSA 2BK5A 5IPYA 2R4EA 5DBJA 3AYJA 2R0GA 1V59A 3GMCA 4JQ9A 5L46A 3VRBA 1GRAA 2Y6RA 1GERA 3OZ2A 3PVCA 2GV8A 4E0VA 3UP5A 2JBVA 1DOEA 4H4RA 4Y4NA 4AP3A 4MJWA 4YKGA 2WPFA 1ZP0A 1BWCA 1EL8A 2V6OA 4I58A 1KF6A 5LV9A 4EIPA 3CGEA 2UZZA 2YVFA 2B7SA 3C4AA 2WS3A 4G9KA 4FK1C 2FBWA 1GSNA 2BYBA 2VOUA 3NIXA 1MXTA 3CNPA 2BA9A 3KLJA 2R0CA 3UTGA 2BABA 1C0PA 2C4CA 1TDKA 4H50A 4J34A 2GAHB 2XVIA 1F3PA 4D03A 4NTCA 1K0IA 2WOIA 3G5SA 1CBOA 4GUVA 5BRTA 3NGCX 3NTDA 4U8MA 5HY5A 2R4JA 1GTHA 3T0KA 1Y56A 3RHAA 1GT8A 5KNLA 2BS4A 3ITJA 1JRYA 4LA1A 2AAQA 5FS8A 1Q1WA 2BCPA 1KDGA 4YJDA 2V61A 5IQ1A 4BK1A 4HB9A 1M64A 1C0IA 2X3NA 1H82A 1TDEA 1IUUA 2WETA 2XVFA 4OPUA 4Z2UA 1H6VA 1VE9A 1M6IA 2JB3A 2R45A 1PS9A 1CJ2A 2CDUA 3UOYA 5IQ4A 2EQ8A 3AEFA 2C7GA 4U8IA 3GDPA 2ARDA 3LXDA 4TLZA 1AOGA 4TM3A 4BK3A 3SZCA 4H2PA 3ICSA 1MOKA 4M52A 4U8JA 4A9WA 3NH3X 2Q0LA 2E1MA 3CNSA 4NZHA 3P1WA 5KVIA 4DSGA 2DU8A 4IA6A 3SM8A 1FL2A 2BXRA 3FG2P 4G74A 3G5RA 4P9SA 5BULA 3HZLA 1B37A 1GRBA 4OCGA 5JCNA 2X50A 2EQ7A 2VVLG 3EANA 1QLBA 4O5QA 5KVHA 1RYIA 1FEBA 1CC6A 1GETA 2YLRA 3NKSA 4APNA 2IIDA 2V3AA 1D4CA 4U8KA 1NHPA 4H4UA 4REKA 2YLXA 1OJ9A 3FBSA 1SEZA 4TM0A 3JSKA 2Q6UA 5HYMA 2YQUA 3SX6A 2C66A 4USQA 3GD4A 3C96A 1L0VA 4AT2A 2BXSA 1L9CA 4H4YA 2XFPA 2QAEA 5BUKA 2Z5XA 2YVGA 2BK3A 3P4SA 2IVDA 3HYXA 3R9UA 1EL7A 1C0LA 2QA2A 1F8RA 1N4UA 2ACZA 3AB1A
chains in the Genus database with same CATH topology
2GAGB 3B6DA 3DA1A 1GALA 1BF3A 1VG9A 2WP5A 4EQRA 1NENA 3CGBA 4XWRA 3UKKA 4GR1A 1PN0A 3D8XA 1EBDA 1N1PA 2J3NA 3P4QA 2OLOA 4H4ZA 1CJ3A 3UOZA 4J2WA 3Q9TA 5FMHA 4A79A 2VZ2A 4GDPA 1TYPA 1O94A 1JU2A 4U8NA 1DAOA 3AYLA 2H88A 1Z6LA 2WEUA 3AE3A 2BRAA 3OC4A 4NWZA 1JRXA 4ZCCA 4RSLA 1ONFA 2DKHA 2GQWA 3GMBA 4OPLA 3UOVA 3ALMA 3IWAA 4J33A 1CC4A 4ZN0A 2WDRA 1W4XA 2XLSA 2WESA 3LJPA 2BCGG 3AE1A 4EQWA 2GMJA 3AECA 3KKJA 1CHUA 4GRTA 4WX1A 1GRFA 1EVIA 2CFYA 1FCDA 2V3BA 1MO9A 5GRTA 1D7YA 2VRLA 1ZMCA 3LADA 4Z26A 3E1TA 2C76A 3NK1X 3LOVA 4K5RA 2FJBA 1E1NA 3UCLA 1N4WA 2FJDA 4B1BA 1D7LA 3QVRA 1NPXA 4CY8A 4GAPA 4TLXA 1LTXR 1FECA 4BK1A 1ZDLA 3CPJG 3CPHG 2ZZ0A 1E1LA 3NLCA 1TRBA 4IV9A 2FJEA 2PHHA 3BNMA 1DDOA 3ZYXA 1NG3A 2VVMA 1ZMDA 2WP6A 3SZWA 1PDHA 2W0HA 1GV4A 2XLTA 2YWLA 2XFUA 3RNMA 3WE0A 3F8PA 4JDRA 1IUXA 4H4PA 4U2LA 3AD7B 3HYVA 3NYEA 1E7PA 1H86A 1DODA 1UKVG 1DOBA 5FS6A 3COXA 2C67A 2OLNA 1PJ6A 2GR3A 2WBAA 3HYWA 3V3NA 4C77A 2O9ZA 1Q1RA 3C4NA 2IVEA 1PHHA 1XANA 2DKIA 2TPRA 1OJTA 4KX6A 5JCKA 3W4IA 4Z2RA 4UP3A 4QFDA 2XVHA 2AQJA 1PXCA 1PBFA 1VG0A 4OPIA 4EIQA 1O95A 4YSXA 3KU9A 4NEVA 3M0OA 4H2QA 2BACA 4IVOB 1ZK7A 4BURA 4A65A 4U8OA 1BGNA 4GF7A 4G6GA 5KOWA 1H81A 4FX9A 3NN0X 2VRMA 4H4TA 1NHRA 2GMHA 5EBKA 2WPCA 1S3EA 3KPKA 3REDA 4FDCB 5ER0A 3NN6X 4C3YA 3DJEA 2X8CA 1GEUA 2V60A 4YSZA 1L9EA 1D4EA 3RP7A 3T31A 4I59A 3GRTA 4X9NA 3GSIA 3CPIG 3NT6A 2E4GA 1GXFA 2Q7VA 3NTAA 4KPRA 1K0JA 2WOWA 3ZNNA 2YR5A 1YQ3A 3WGTA 4CBQA 2E48A 4EMJA 1PBEA 1K4QA 4K5SA 4CY6A 3CNDA 1P2HA 4RG4A 3UOXA 4YTPA 1DOCA 2YLZA 5KRQA 2YLTA 1GRHA 3PS9A 1BKWA 2X99A 1B4VA 4K7ZA 1YKJA 2GR2A 3QSMA 2JB1A 1LJ1A 3URHA 2JAEA 5HHFA 1CC2A 2X8GA 2E49A 4H4WA 1FOHA 3EF6A 3SFDA 4YJHB 3GD3A 3V76A 4YKFA 5KMSA 4DNAA 3S5WA 3P9UA 2GEWA 3KPFA 3CMMA 1AN9A 1ZOYA 3AE4A 1CJ4A 3ZNPA 1IUVA 1E1MA 3DK9A 3IHGA 4U2SA 1YQ4A 1PXAA 2F5ZA 4H4SA 2OA1A 3SGLA 4H7UA 4Z43A 1CJCA 2B9XA 1E6EA 2WHDA 3AE9A 3K7MX 1VRQB 2NPXA 2BS2A 2Z5YA 1ZX9A 4BJYA 3ADAB 3RP6A 3K30A 2QA1A 3FPZA 4D04A 1EL9A 2YG7A 3DMEA 2JB2A 1IJHA 4K22A 3UKHA 4C3XA 1K0LA 1NG4A 4CRTA 4EQSA 1ELIA 1PBCA 2XLPA 3BI2A 2GF3A 1L9DA 2C73A 3CUKA 2WPEA 1OJAA 4YJHA 3DK4A 1GRGA 3G5QA 3K7TA 2C72A 4J56A 4UDRA 1KSUA 2WDQA 2EQ9A 3DGHA 2PYXA 3CGCA 3GWDA 1KFYA 3EAOA 3T37A 2I0ZA 3IC9A 1OJCA 4JN9A 5CQFA 2E5VA 1NEKA 5JCMA 3UTFA 5U25A 3CGDA 1O5WA 4NNJA 3NRNA 4H2RA 1NDAA 1RP0A 3RP8A 3VR8A 1KSSA 5KWFA 2R9ZA 3NHOX 2WOVA 3UKPA 2WQYA 4HA6A 3P4RA 2X8HA 1LQUA 3SFEA 4CCQA 4EMWA 4A6NB 1JNRA 3QFAA 2WDVA 1IUWA 3ZNQA 1XPQA 2RGJA 1RSGA 2V5ZA 4Z44A 3AEDA 1BZLA 2HQMA 2C3DA 5KMRA 4A7AA 4ADWA 4CNKA 3ATRA 4C74A 4Z25A 3ZDNA 1VQWA 2YG5A 1S3BA 3NK0X 2B9WA 3VQRA 3GWFA 2H89A 3ZNOA 3O0HA 3SXIA 2TMDA 1PBBA 1GPEA 3KD9A 3P4PA 4BV6A 4DGKA 1P2EA 3AE7A 4OPGA 2OALA 2JK6A 3H8LA 4EM3A 2XVJA 2XDOA 1ZKQA 3ICTA 3AXBA 3NNEA 4XXGA 4Y4MA 3V3OA 3ICRA 2YVJA 2WU5A 1GOSA 5J7XA 5JCIA 4JY3A 4B66A 4TM1A 4A6NA 3VR9A 4FK1A 1PJ5A 2B7RA 2R46A 1JEHA 4CNJA 3NYCA 1KNPA 2Q0KA 4B68A 3Q6JA 1VDCA 2ZBWA 4YSHA 4ECHA 1REOA 2B9YA 4H4VA 3IF9A 1NHSA 1H7XA 2ZZBA 5KOXA 2GRTA 2B76A 2GVCA 3DGZA 3DJGX 3EPTA 1YQZA 3B3RA 4B67A 1JRZA 5GSNA 1E1KA 3BHFA 2XFQA 4LIIA 2A89A 1LVLA 1N4VA 3AE8A 3AEAA 4K2XA 1XDIA 3L8KA 3T2YA 4YSYA 2WP9A 4N9XA 3H4KA 2GB0A 3K7QX 2QCUA 1GREA 4G6HA 1TDNA 3UP4A 4B65A 4EM4A 4YT0A 5BVAA 5C2TA 2YG4A 1JOAA 5CKUA 3VRAA 3GDNA 2E82A 3FMWA 3KA7A 4C5OA 2XFOA 2BS3A 4USRA 2GR1A 2YM1A 2C65A 1GNDA 4YJGB 4H2NA 3DJJA 2BK4A 4OPDA 3SQPA 3QVPA 4U8PA 2NVKX 4BK2A 4J31A 2RABA 3QFBA 5C3JA 3T2ZA 4WCTA 4AT0A 4UDQA 4YTNA 3AD8B 5HXIA 4YTMA 1KNRA 1E39A 4AP1A 3SZ0A 3H8IA 3T2KA 2GH5A 3AYIA 5KMPA 2AR8A 3DJDA 3T14A 2YLSA 1TYTA 2VQBA 3AE6A 4IA5A 3FIMB 2YAUA 4Z2TA 3AEGA 3D1CA 2JKCA 1ZY8A 1QJDA 3IHMA 3SY4A 4OPTA 1D5TA 1DXLA 4LU6A 3ABVA 4ZCDA 3ALLA 3L1RA 5M10A 1TDOA 1EL5A 1NHQA 4EQXA 2C3CA 2Y6QA 1JNZA 2ZZCA 3AE2A 2VQ7A 1GTEA 4NEWA 4YJGA 1H84A 2A8XA 1LV0A 4IVMB 1GRTA 2BRYA 3SYIA 3AEEA 4OPCA 1IUSA 3F8DA 4JNAA 2APGA 3CNTA 4NTDA 4B69A 2RGOA 3VRDB 2BC0A 4G73A 5KMQA 1CL0A 2XCGA 1Y0PA 1B8SA 3BNUA 3GYXA 4Y4LA 3QJ4A 3M13A 2XYOA 4DSHA 4O5UA 4B63A 2YR4A 3UKAA 2OAMA 4U8LA 1NAAA 1TDFA 4K8DA 4U2TA 3CTYA 1OJDA 2C64A 1XHCA 3F8RA 1S2QA 4ICYA 4II3A 3S61A 3SZFA 4AOXA 3AEBA 3G3EA 2XLRA 1F6MA 4EMIA 5EB4A 4X4JA 3W4KA 3ATQA 1GESA 2YR6A 5FS7A 1H83A 5U63A 4PAAA 1X31B 2YLWA 2GR0A 1S2YA 3KVEA 3NG7X 3UTHA 4BJZA 2C75A 4GDEA 2E4AA 1IUTA 1BGJA 4H4QA 1PJ7A 2RGHA 1PBDA 2A87A 4OVIA 1H7WA 2CVJA 4B64A 1F8WA 1LQTA 4UDPA 1LPFA 4GCMA 3GRSA 4QFCA 5KXJA 5JCLA 3LB8A 3BHKA 4YJFB 4TM4A 3AWIA 5FS9A 5EB5A 3UTEA 3DH9A 5U1OA 3AE5A 4GAVA 2YM2A 1QO8A 2GQFA 4YWOA 4XWZA 1DJNA 4AOSA 4PABA 4A99A 1F8SA 3GYJA 2YG3A 3PO7A 3M12A 3ALJA 3LZWA 4H4XA 1FEAA 1CF3A 3I6DA 4RG3A 4YXDA 3BI5A 3I3LA 3W4JA 4CCRA 1ZOVA 2C70A 4J57A 2BC1A 3NYFA 1PXBA 2XVEA 3BI4A 4II2A 4X9MA 1YY5A 2FJAA 1KIFA 2WU2A 3CNJA 3NK2X 5M0ZA 3ISHA 5J60A 4A5LA 1Q9IA 3UKFA 4J36A 4JY2A 3UKLA 1D4DA 2YG6A 3AD9B 1B5QA 1COYA 3DK8A 4NTEA 3GYIA 2XFNA 3LZXA 1DJQA 3II4A 1C0KA 2CULA 3QSEA 4YJFA 2EQ6A 3CN8A 2VVLA 4JNQA 3UKQA 5EOWA 4Z24A 2XLUA 1Y56B 2R0PA 1HYUA 1DNCA 3CIRA 3QSSA 2BK5A 5IPYA 2R4EA 5DBJA 3AYJA 1V59A 2R0GA 3GMCA 4JQ9A 5L46A 3VRBA 1GRAA 2Y6RA 1GERA 3OZ2A 3PVCA 2GV8A 4E0VA 3UP5A 2JBVA 1DOEA 4H4RA 4Y4NA 4AP3A 4MJWA 4YKGA 2WPFA 1ZP0A 1BWCA 1EL8A 2V6OA 4I58A 1KF6A 5LV9A 3CGEA 4EIPA 2UZZA 2YVFA 2B7SA 2WS3A 3C4AA 4G9KA 4FK1C 2FBWA 1GSNA 2BYBA 2VOUA 3NIXA 1MXTA 3CNPA 2BA9A 3KLJA 2R0CA 3UTGA 2BABA 1C0PA 2C4CA 1TDKA 4H50A 4J34A 2GAHB 2XVIA 1F3PA 4D03A 4NTCA 1K0IA 2WOIA 3G5SA 1CBOA 4GUVA 5BRTA 3NGCX 3NTDA 4U8MA 5HY5A 2R4JA 1GTHA 3T0KA 1Y56A 3RHAA 1GT8A 5KNLA 2BS4A 3ITJA 1JRYA 4LA1A 2AAQA 5FS8A 1Q1WA 2BCPA 1KDGA 4YJDA 2V61A 5IQ1A 5TR3A 4HB9A 1M64A 1C0IA 1H82A 1TDEA 2WETA 1IUUA 2X3NA 2XVFA 4OPUA 4Z2UA 1H6VA 1VE9A 1M6IA 2JB3A 2R45A 1PS9A 1CJ2A 2CDUA 3UOYA 5IQ4A 2EQ8A 3AEFA 2C7GA 4U8IA 3GDPA 2ARDA 3LXDA 4TLZA 1AOGA 4TM3A 4BK3A 3SZCA 4H2PA 3ICSA 1MOKA 4M52A 4U8JA 4A9WA 3NH3X 2Q0LA 2E1MA 3CNSA 4NZHA 3P1WA 5KVIA 4DSGA 2DU8A 3SM8A 1FL2A 4IA6A 2BXRA 3FG2P 4G74A 3G5RA 4P9SA 5BULA 3HZLA 1B37A 1GRBA 4OCGA 5JCNA 2X50A 2EQ7A 2VVLG 3EANA 1QLBA 4O5QA 5KVHA 1RYIA 1FEBA 1CC6A 1GETA 2YLRA 3NKSA 4APNA 2IIDA 2V3AA 1D4CA 4U8KA 1NHPA 4H4UA 4REKA 2YLXA 1OJ9A 3FBSA 1SEZA 4TM0A 3JSKA 2Q6UA 2YQUA 5HYMA 3SX6A 2C66A 4USQA 3GD4A 3C96A 1L0VA 4AT2A 2BXSA 1L9CA 4H4YA 2XFPA 2QAEA 5BUKA 2Z5XA 2YVGA 2BK3A 3P4SA 2IVDA 3HYXA 3R9UA 1EL7A 1C0LA 2QA2A 1F8RA 1N4UA 2ACZA 3AB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAG B;  3B6D A;  3DA1 A;  1GAL A;  1BF3 A;  1VG9 A;  2WP5 A;  4EQR A;  1NEN A;  3CGB A;  4XWR A;  3UKK A;  4GR1 A;  1PN0 A;  3D8X A;  1EBD A;  1N1P A;  2J3N A;  3P4Q A;  2OLO A;  4H4Z A;  1CJ3 A;  3UOZ A;  4J2W A;  3Q9T A;  5FMH A;  4A79 A;  2VZ2 A;  4GDP A;  1TYP A;  1O94 A;  1JU2 A;  4U8N A;  1DAO A;  3AYL A;  2H88 A;  1Z6L A;  2WEU A;  3AE3 A;  3OC4 A;  1JRX A;  4ZCC A;  4RSL A;  1ONF A;  2DKH A;  2GQW A;  3GMB A;  4OPL A;  3UOV A;  3ALM A;  3IWA A;  4J33 A;  1CC4 A;  4ZN0 A;  2WDR A;  1W4X A;  2XLS A;  2WES A;  3LJP A;  2BCG G;  3AE1 A;  4EQW A;  2GMJ A;  3AEC A;  3KKJ A;  1CHU A;  4GRT A;  4WX1 A;  1GRF A;  1EVI A;  2CFY A;  1FCD A;  2V3B A;  1MO9 A;  5GRT A;  1D7Y A;  2VRL A;  1ZMC A;  3LAD A;  4Z26 A;  3E1T A;  2C76 A;  3NK1 X;  3LOV A;  4K5R A;  2FJB A;  1E1N A;  3UCL A;  1N4W A;  2FJD A;  4B1B A;  1D7L A;  3QVR A;  1NPX A;  4CY8 A;  4TLX A;  1LTX R;  1FEC A;  4BK1 A;  1ZDL A;  3CPJ G;  3CPH G;  2ZZ0 A;  1E1L A;  3NLC A;  1TRB A;  4IV9 A;  2FJE A;  2PHH A;  3BNM A;  1DDO A;  3ZYX A;  1NG3 A;  2VVM A;  1ZMD A;  2WP6 A;  1PDH A;  2W0H A;  1GV4 A;  2XLT A;  2YWL A;  2XFU A;  3RNM A;  3WE0 A;  3F8P A;  4JDR A;  1IUX A;  4H4P A;  4U2L A;  3AD7 B;  3NYE A;  1E7P A;  1H86 A;  1DOD A;  1UKV G;  1DOB A;  5FS6 A;  3COX A;  2C67 A;  2OLN A;  1PJ6 A;  2GR3 A;  2WBA A;  3V3N A;  4C77 A;  2O9Z A;  1Q1R A;  3C4N A;  2IVE A;  1PHH A;  1XAN A;  2DKI A;  2TPR A;  1OJT A;  4KX6 A;  5JCK A;  3W4I A;  4Z2R A;  4UP3 A;  4QFD A;  2XVH A;  2AQJ A;  1PXC A;  1PBF A;  1VG0 A;  4OPI A;  4EIQ A;  1O95 A;  4YSX A;  3KU9 A;  4NEV A;  3M0O A;  4H2Q A;  2BAC A;  4IVO B;  1ZK7 A;  4BUR A;  4A65 A;  4U8O A;  1BGN A;  4GF7 A;  5KOW A;  1H81 A;  4FX9 A;  3NN0 X;  2VRM A;  4H4T A;  1NHR A;  2GMH A;  5EBK A;  2WPC A;  1S3E A;  3RED A;  4FDC B;  5ER0 A;  3NN6 X;  4C3Y A;  3DJE A;  2X8C A;  1GEU A;  2V60 A;  4YSZ A;  1L9E A;  1D4E A;  3RP7 A;  4I59 A;  3GRT A;  4X9N A;  3GSI A;  3CPI G;  3NT6 A;  2E4G A;  1GXF A;  2Q7V A;  3NTA A;  4KPR A;  1K0J A;  2WOW A;  3ZNN A;  2YR5 A;  1YQ3 A;  3WGT A;  4CBQ A;  2E48 A;  4EMJ A;  1PBE A;  1K4Q A;  4K5S A;  4CY6 A;  3CND A;  1P2H A;  4RG4 A;  3UOX A;  4YTP A;  1DOC A;  2YLZ A;  5KRQ A;  2YLT A;  1GRH A;  3PS9 A;  1BKW A;  2X99 A;  1B4V A;  4K7Z A;  1YKJ A;  2GR2 A;  3QSM A;  2JB1 A;  1LJ1 A;  3URH A;  2JAE A;  5HHF A;  1CC2 A;  2X8G A;  2E49 A;  4H4W A;  1FOH A;  3EF6 A;  3SFD A;  4YJH B;  3GD3 A;  3V76 A;  4YKF A;  4DNA A;  3S5W A;  3P9U A;  2GEW A;  3KPF A;  1AN9 A;  1ZOY A;  3AE4 A;  1CJ4 A;  3ZNP A;  1IUV A;  1E1M A;  3DK9 A;  3IHG A;  4U2S A;  1YQ4 A;  1PXA A;  2F5Z A;  4H4S A;  2OA1 A;  3SGL A;  4H7U A;  4Z43 A;  1CJC A;  2B9X A;  1E6E A;  2WHD A;  3AE9 A;  3K7M X;  1VRQ B;  2NPX A;  2BS2 A;  2Z5Y A;  1ZX9 A;  4BJY A;  3ADA B;  3RP6 A;  3K30 A;  2QA1 A;  3FPZ A;  4D04 A;  1EL9 A;  2YG7 A;  3DME A;  2JB2 A;  1IJH A;  4K22 A;  3UKH A;  4C3X A;  1K0L A;  1NG4 A;  4CRT A;  4EQS A;  1ELI A;  1PBC A;  2XLP A;  3BI2 A;  2GF3 A;  1L9D A;  2C73 A;  3CUK A;  2WPE A;  1OJA A;  4YJH A;  3DK4 A;  1GRG A;  3G5Q A;  3K7T A;  2C72 A;  4J56 A;  4UDR A;  1KSU A;  2WDQ A;  2EQ9 A;  3DGH A;  2PYX A;  3CGC A;  3GWD A;  1KFY A;  3EAO A;  3T37 A;  2I0Z A;  3IC9 A;  1OJC A;  4JN9 A;  5CQF A;  2E5V A;  1NEK A;  5JCM A;  3UTF A;  5U25 A;  3CGD A;  1O5W A;  3NRN A;  4H2R A;  1NDA A;  1RP0 A;  3RP8 A;  3VR8 A;  1KSS A;  5KWF A;  2R9Z A;  3NHO X;  2WOV A;  3UKP A;  2WQY A;  4HA6 A;  3P4R A;  2X8H A;  1LQU A;  3SFE A;  4CCQ A;  4EMW A;  4A6N B;  1JNR A;  3QFA A;  2WDV A;  1IUW A;  3ZNQ A;  1XPQ A;  2RGJ A;  1RSG A;  2V5Z A;  4Z44 A;  3AED A;  1BZL A;  2HQM A;  2C3D A;  4A7A A;  4ADW A;  4CNK A;  3ATR A;  4C74 A;  4Z25 A;  3ZDN A;  1VQW A;  2YG5 A;  1S3B A;  3NK0 X;  2B9W A;  3VQR A;  3GWF A;  2H89 A;  3ZNO A;  3O0H A;  4BV6 A;  2TMD A;  1PBB A;  1GPE A;  3KD9 A;  3P4P A;  4DGK A;  1P2E A;  3AE7 A;  4OPG A;  2OAL A;  2JK6 A;  3H8L A;  4EM3 A;  2XVJ A;  2XDO A;  1ZKQ A;  3ICT A;  3AXB A;  3NNE A;  4XXG A;  4Y4M A;  3V3O A;  3ICR A;  2YVJ A;  2WU5 A;  1GOS A;  5J7X A;  5JCI A;  4JY3 A;  4B66 A;  4TM1 A;  4A6N A;  3VR9 A;  4FK1 A;  1PJ5 A;  2B7R A;  2R46 A;  1JEH A;  4CNJ A;  3NYC A;  1KNP A;  2Q0K A;  4B68 A;  3Q6J A;  1VDC A;  2ZBW A;  4YSH A;  4ECH A;  1REO A;  2B9Y A;  4H4V A;  3IF9 A;  1NHS A;  1H7X A;  2ZZB A;  5KOX A;  2GRT A;  2B76 A;  2GVC A;  3DGZ A;  3DJG X;  3EPT A;  1YQZ A;  3B3R A;  4B67 A;  1JRZ A;  5GSN A;  1E1K A;  3BHF A;  2XFQ A;  4LII A;  2A89 A;  1LVL A;  1N4V A;  3AE8 A;  3AEA A;  4K2X A;  1XDI A;  3L8K A;  4YSY A;  2WP9 A;  4N9X A;  3H4K A;  2GB0 A;  3K7Q X;  2QCU A;  1GRE A;  3UP4 A;  1TDN A;  4B65 A;  4EM4 A;  4YT0 A;  5BVA A;  5C2T A;  2YG4 A;  1JOA A;  5CKU A;  3VRA A;  3GDN A;  2E82 A;  3FMW A;  3KA7 A;  4C5O A;  2XFO A;  2BS3 A;  4USR A;  2GR1 A;  2YM1 A;  2C65 A;  1GND A;  4YJG B;  4H2N A;  3DJJ A;  2BK4 A;  4OPD A;  3SQP A;  3QVP A;  4U8P A;  2NVK X;  4BK2 A;  4J31 A;  2RAB A;  3QFB A;  5C3J A;  4WCT A;  4AT0 A;  4UDQ A;  4YTN A;  3AD8 B;  5HXI A;  4YTM A;  1KNR A;  1E39 A;  4AP1 A;  3H8I A;  2GH5 A;  3AYI A;  2AR8 A;  3DJD A;  2YLS A;  1TYT A;  2VQB A;  3AE6 A;  4IA5 A;  3FIM B;  2YAU A;  4Z2T A;  3AEG A;  3D1C A;  2JKC A;  1ZY8 A;  1QJD A;  3IHM A;  4OPT A;  1D5T A;  1DXL A;  4LU6 A;  3ABV A;  4ZCD A;  3ALL A;  3L1R A;  5M10 A;  1TDO A;  1EL5 A;  1NHQ A;  4EQX A;  2C3C A;  2Y6Q A;  1JNZ A;  2ZZC A;  3AE2 A;  2VQ7 A;  1GTE A;  4NEW A;  4YJG A;  1H84 A;  2A8X A;  1LV0 A;  4IVM B;  1GRT A;  3AEE A;  4OPC A;  1IUS A;  3F8D A;  4JNA A;  2APG A;  3CNT A;  4NTD A;  4B69 A;  2RGO A;  3VRD B;  2BC0 A;  1CL0 A;  2XCG A;  1Y0P A;  1B8S A;  3BNU A;  4Y4L A;  3QJ4 A;  3M13 A;  2XYO A;  4DSH A;  4O5U A;  4B63 A;  2YR4 A;  3UKA A;  2OAM A;  4U8L A;  1NAA A;  1TDF A;  4K8D A;  4U2T A;  3CTY A;  1OJD A;  2C64 A;  1XHC A;  3F8R A;  1S2Q A;  4ICY A;  3S61 A;  4AOX A;  3AEB A;  3G3E A;  2XLR A;  1F6M A;  4EMI A;  5EB4 A;  4X4J A;  3W4K A;  3ATQ A;  1GES A;  2YR6 A;  5FS7 A;  1H83 A;  5U63 A;  4PAA A;  1X31 B;  2YLW A;  2GR0 A;  1S2Y A;  3KVE A;  3NG7 X;  3UTH A;  4BJZ A;  2C75 A;  4GDE A;  2E4A A;  1IUT A;  1BGJ A;  4H4Q A;  1PJ7 A;  2RGH A;  1PBD A;  2A87 A;  4OVI A;  1H7W A;  2CVJ A;  4B64 A;  1F8W A;  1LQT A;  4UDP A;  1LPF A;  4GCM A;  3GRS A;  4QFC A;  5KXJ A;  5JCL A;  3LB8 A;  3BHK A;  4YJF B;  4TM4 A;  3AWI A;  5FS9 A;  5EB5 A;  3UTE A;  3DH9 A;  5U1O A;  3AE5 A;  2YM2 A;  1QO8 A;  2GQF A;  4YWO A;  4XWZ A;  1DJN A;  4AOS A;  4PAB A;  4A99 A;  1F8S A;  3GYJ A;  2YG3 A;  3PO7 A;  3M12 A;  3ALJ A;  3LZW A;  4H4X A;  1FEA A;  1CF3 A;  3I6D A;  4RG3 A;  4YXD A;  3BI5 A;  3I3L A;  3W4J A;  4CCR A;  1ZOV A;  2C70 A;  4J57 A;  2BC1 A;  3NYF A;  1PXB A;  2XVE A;  3BI4 A;  3UOY A;  4X9M A;  1YY5 A;  2FJA A;  1KIF A;  2WU2 A;  3CNJ A;  3NK2 X;  5M0Z A;  3ISH A;  5J60 A;  4A5L A;  1Q9I A;  3UKF A;  4J36 A;  4JY2 A;  3UKL A;  1D4D A;  2YG6 A;  3AD9 B;  1B5Q A;  1COY A;  3DK8 A;  4NTE A;  3GYI A;  2XFN A;  3LZX A;  1DJQ A;  3II4 A;  1C0K A;  2CUL A;  3QSE A;  4YJF A;  2EQ6 A;  3CN8 A;  2VVL A;  4JNQ A;  3UKQ A;  5EOW A;  4Z24 A;  2XLU A;  1Y56 B;  2R0P A;  1HYU A;  1DNC A;  3CIR A;  3QSS A;  2BK5 A;  5IPY A;  2R4E A;  5DBJ A;  3AYJ A;  1V59 A;  2R0G A;  3GMC A;  4JQ9 A;  5L46 A;  3VRB A;  1GRA A;  2Y6R A;  1GER A;  3OZ2 A;  3PVC A;  2GV8 A;  4E0V A;  3UP5 A;  2JBV A;  1DOE A;  4H4R A;  4Y4N A;  4AP3 A;  4MJW A;  4YKG A;  2WPF A;  1ZP0 A;  1BWC A;  1EL8 A;  2V6O A;  4I58 A;  1KF6 A;  5LV9 A;  3CGE A;  4EIP A;  2UZZ A;  2YVF A;  2B7S A;  2WS3 A;  3C4A A;  4FK1 C;  2FBW A;  1GSN A;  2BYB A;  2VOU A;  3NIX A;  1MXT A;  3CNP A;  2BA9 A;  3KLJ A;  2R0C A;  3UTG A;  2BAB A;  1C0P A;  4H50 A;  1TDK A;  4J34 A;  2GAH B;  2XVI A;  1F3P A;  4D03 A;  4NTC A;  1K0I A;  2WOI A;  3G5S A;  1CBO A;  4GUV A;  5BRT A;  3NGC X;  3NTD A;  4U8M A;  5HY5 A;  2R4J A;  1GTH A;  1Y56 A;  3RHA A;  1GT8 A;  2BS4 A;  3ITJ A;  1JRY A;  4LA1 A;  2AAQ A;  5FS8 A;  1Q1W A;  2BCP A;  1KDG A;  4YJD A;  2V61 A;  5IQ1 A;  5TR3 A;  4HB9 A;  1M64 A;  1C0I A;  1H82 A;  1TDE A;  2WET A;  1IUU A;  2X3N A;  2XVF A;  4OPU A;  4Z2U A;  1H6V A;  1VE9 A;  1M6I A;  2JB3 A;  2R45 A;  1PS9 A;  1CJ2 A;  2CDU A;  5IQ4 A;  2EQ8 A;  3AEF A;  2C7G A;  4U8I A;  3GDP A;  2ARD A;  3LXD A;  4TLZ A;  1AOG A;  4TM3 A;  4BK3 A;  4H2P A;  3ICS A;  1MOK A;  4M52 A;  4U8J A;  4A9W A;  3NH3 X;  2Q0L A;  2E1M A;  3CNS A;  4NZH A;  3P1W A;  5KVI A;  4DSG A;  2DU8 A;  3SM8 A;  1FL2 A;  4IA6 A;  2BXR A;  3FG2 P;  3G5R A;  4P9S A;  5BUL A;  3HZL A;  1B37 A;  1GRB A;  4OCG A;  5JCN A;  2X50 A;  2EQ7 A;  2VVL G;  3EAN A;  1QLB A;  4O5Q A;  5KVH A;  1RYI A;  1FEB A;  1CC6 A;  1GET A;  2YLR A;  3NKS A;  4APN A;  2IID A;  2V3A A;  1D4C A;  4U8K A;  1NHP A;  4H4U A;  4REK A;  2YLX A;  1OJ9 A;  3FBS A;  1SEZ A;  4TM0 A;  3JSK A;  2Q6U A;  2YQU A;  5HYM A;  2C66 A;  4USQ A;  3GD4 A;  3C96 A;  1L0V A;  4AT2 A;  2BXS A;  1L9C A;  4H4Y A;  2XFP A;  2QAE A;  5BUK A;  2Z5X A;  2YVG A;  2BK3 A;  3P4S A;  2IVD A;  3R9U A;  1EL7 A;  1C0L A;  2QA2 A;  1F8R A;  1N4U A;  2ACZ A;  3AB1 A; 
#chains in the Genus database with same CATH topology
 2GAG B;  3B6D A;  3DA1 A;  1GAL A;  1BF3 A;  1VG9 A;  2WP5 A;  4EQR A;  1NEN A;  3CGB A;  4XWR A;  3UKK A;  4GR1 A;  1PN0 A;  3D8X A;  1EBD A;  1N1P A;  2J3N A;  3P4Q A;  2OLO A;  4H4Z A;  1CJ3 A;  3UOZ A;  4J2W A;  5TR3 A;  3Q9T A;  5FMH A;  4A79 A;  2VZ2 A;  4GDP A;  1TYP A;  1O94 A;  1JU2 A;  4U8N A;  1DAO A;  3AYL A;  2H88 A;  1Z6L A;  2WEU A;  3AE3 A;  2BRA A;  3OC4 A;  4NWZ A;  1JRX A;  4ZCC A;  4RSL A;  1ONF A;  2DKH A;  3GMB A;  2GQW A;  4OPL A;  3UOV A;  3ALM A;  3IWA A;  4J33 A;  1CC4 A;  4ZN0 A;  2WDR A;  1W4X A;  2XLS A;  2WES A;  3LJP A;  2BCG G;  3AE1 A;  4EQW A;  2GMJ A;  3AEC A;  3KKJ A;  1CHU A;  4GRT A;  4WX1 A;  1GRF A;  1EVI A;  2CFY A;  1FCD A;  2V3B A;  1MO9 A;  5GRT A;  1D7Y A;  2VRL A;  1ZMC A;  3LAD A;  4Z26 A;  3E1T A;  2C76 A;  3NK1 X;  3LOV A;  4K5R A;  2FJB A;  1E1N A;  3UCL A;  1N4W A;  2FJD A;  4B1B A;  1D7L A;  3QVR A;  1NPX A;  4CY8 A;  4GAP A;  4TLX A;  1LTX R;  1FEC A;  1ZDL A;  3CPJ G;  3CPH G;  2ZZ0 A;  1E1L A;  3NLC A;  1TRB A;  4IV9 A;  2FJE A;  2PHH A;  3BNM A;  1DDO A;  3ZYX A;  1NG3 A;  2VVM A;  1ZMD A;  2WP6 A;  3SZW A;  1PDH A;  2W0H A;  1GV4 A;  2XLT A;  2YWL A;  2XFU A;  3RNM A;  3WE0 A;  3F8P A;  4JDR A;  1IUX A;  4H4P A;  4U2L A;  3AD7 B;  3HYV A;  3NYE A;  1E7P A;  1H86 A;  1DOD A;  1UKV G;  1DOB A;  5FS6 A;  3COX A;  2C67 A;  2OLN A;  1PJ6 A;  2GR3 A;  2WBA A;  3HYW A;  3V3N A;  4C77 A;  2O9Z A;  1Q1R A;  3C4N A;  2IVE A;  1PHH A;  2DKI A;  1XAN A;  2TPR A;  1OJT A;  4KX6 A;  5JCK A;  3W4I A;  4Z2R A;  4UP3 A;  4QFD A;  2XVH A;  2AQJ A;  1PXC A;  1PBF A;  4EIQ A;  1VG0 A;  4OPI A;  1O95 A;  4YSX A;  3KU9 A;  4NEV A;  3M0O A;  4H2Q A;  2BAC A;  4IVO B;  1ZK7 A;  4BUR A;  4A65 A;  4U8O A;  1BGN A;  4GF7 A;  4G6G A;  5KOW A;  1H81 A;  4FX9 A;  3NN0 X;  2VRM A;  4H4T A;  2GMH A;  1NHR A;  5EBK A;  2WPC A;  1S3E A;  3KPK A;  3RED A;  4FDC B;  5ER0 A;  3NN6 X;  4C3Y A;  3DJE A;  2X8C A;  1GEU A;  2V60 A;  4YSZ A;  1L9E A;  1D4E A;  3RP7 A;  3T31 A;  4I59 A;  3GRT A;  4X9N A;  3GSI A;  3CPI G;  3NT6 A;  2E4G A;  1GXF A;  2Q7V A;  3NTA A;  4KPR A;  1K0J A;  2WOW A;  3ZNN A;  2YR5 A;  1YQ3 A;  3WGT A;  4CBQ A;  2E48 A;  4EMJ A;  1PBE A;  1K4Q A;  4K5S A;  4CY6 A;  3CND A;  1P2H A;  4RG4 A;  3UOX A;  4YTP A;  1DOC A;  2YLZ A;  5KRQ A;  2YLT A;  1GRH A;  3PS9 A;  1BKW A;  2X99 A;  1B4V A;  4K7Z A;  1YKJ A;  2GR2 A;  3QSM A;  2JB1 A;  1LJ1 A;  3URH A;  2JAE A;  5HHF A;  1CC2 A;  2X8G A;  2E49 A;  4H4W A;  1FOH A;  3EF6 A;  3SFD A;  4YJH B;  3GD3 A;  3V76 A;  4YKF A;  5KMS A;  4DNA A;  3S5W A;  3P9U A;  2GEW A;  3KPF A;  3CMM A;  1AN9 A;  1ZOY A;  3AE4 A;  1CJ4 A;  3ZNP A;  1IUV A;  1E1M A;  3IHG A;  3DK9 A;  4U2S A;  1YQ4 A;  1PXA A;  2F5Z A;  4H4S A;  2OA1 A;  3SGL A;  4H7U A;  4Z43 A;  1CJC A;  2B9X A;  1E6E A;  2WHD A;  3AE9 A;  3K7M X;  1VRQ B;  2NPX A;  2BS2 A;  2Z5Y A;  1ZX9 A;  4BJY A;  3ADA B;  3RP6 A;  3K30 A;  2QA1 A;  3FPZ A;  4D04 A;  1EL9 A;  2YG7 A;  3DME A;  2JB2 A;  1IJH A;  4K22 A;  3UKH A;  4C3X A;  1K0L A;  1NG4 A;  4CRT A;  4EQS A;  1ELI A;  1PBC A;  2XLP A;  3BI2 A;  2GF3 A;  1L9D A;  2C73 A;  3CUK A;  2WPE A;  1OJA A;  4YJH A;  3DK4 A;  1GRG A;  3G5Q A;  3K7T A;  2C72 A;  4J56 A;  4UDR A;  1KSU A;  2WDQ A;  2EQ9 A;  3DGH A;  2PYX A;  3CGC A;  3GWD A;  1KFY A;  3EAO A;  3T37 A;  2I0Z A;  3IC9 A;  1OJC A;  4JN9 A;  5CQF A;  2E5V A;  1NEK A;  5JCM A;  3UTF A;  5U25 A;  3CGD A;  1O5W A;  4NNJ A;  3NRN A;  4H2R A;  1NDA A;  3RP8 A;  1RP0 A;  3VR8 A;  1KSS A;  5KWF A;  2R9Z A;  3NHO X;  2WOV A;  3UKP A;  2WQY A;  4HA6 A;  3P4R A;  2X8H A;  1LQU A;  3SFE A;  4CCQ A;  4EMW A;  4A6N B;  1JNR A;  3QFA A;  2WDV A;  1IUW A;  3ZNQ A;  2RGJ A;  1XPQ A;  1RSG A;  2V5Z A;  4Z44 A;  3AED A;  1BZL A;  2HQM A;  2C3D A;  5KMR A;  4A7A A;  4ADW A;  4CNK A;  3ATR A;  4C74 A;  4Z25 A;  3ZDN A;  1VQW A;  2YG5 A;  1S3B A;  3NK0 X;  2B9W A;  3VQR A;  3GWF A;  2H89 A;  3ZNO A;  3O0H A;  3SXI A;  2TMD A;  1PBB A;  1GPE A;  3KD9 A;  3P4P A;  4BV6 A;  4DGK A;  1P2E A;  3AE7 A;  4OPG A;  2OAL A;  2JK6 A;  3H8L A;  4EM3 A;  2XVJ A;  2XDO A;  1ZKQ A;  3ICT A;  3AXB A;  3NNE A;  4XXG A;  4Y4M A;  3V3O A;  3ICR A;  2YVJ A;  2WU5 A;  1GOS A;  5J7X A;  5JCI A;  4JY3 A;  4B66 A;  4TM1 A;  4A6N A;  3VR9 A;  4FK1 A;  1PJ5 A;  2B7R A;  2R46 A;  1JEH A;  4CNJ A;  3NYC A;  1KNP A;  2Q0K A;  4B68 A;  3Q6J A;  1VDC A;  2ZBW A;  4YSH A;  4ECH A;  1REO A;  2B9Y A;  4H4V A;  3IF9 A;  1NHS A;  1H7X A;  2ZZB A;  5KOX A;  2GRT A;  2B76 A;  2GVC A;  3DGZ A;  3DJG X;  3EPT A;  1YQZ A;  3B3R A;  4B67 A;  1JRZ A;  5GSN A;  1E1K A;  3BHF A;  2XFQ A;  4LII A;  2A89 A;  1LVL A;  1N4V A;  3AE8 A;  3AEA A;  4K2X A;  1XDI A;  3L8K A;  3T2Y A;  4YSY A;  2WP9 A;  4N9X A;  3H4K A;  2GB0 A;  3K7Q X;  2QCU A;  1GRE A;  4G6H A;  1TDN A;  3UP4 A;  4B65 A;  4EM4 A;  4YT0 A;  5BVA A;  5C2T A;  2YG4 A;  1JOA A;  5CKU A;  3VRA A;  3GDN A;  2E82 A;  3FMW A;  3KA7 A;  4C5O A;  2XFO A;  2BS3 A;  4USR A;  2GR1 A;  2YM1 A;  2C65 A;  4H2N A;  4YJG B;  1GND A;  3DJJ A;  2BK4 A;  4OPD A;  3SQP A;  3QVP A;  4U8P A;  2NVK X;  4BK2 A;  4J31 A;  2RAB A;  3QFB A;  5C3J A;  3T2Z A;  4WCT A;  4AT0 A;  4UDQ A;  4YTN A;  3AD8 B;  5HXI A;  4YTM A;  1KNR A;  1E39 A;  4AP1 A;  3SZ0 A;  3H8I A;  3T2K A;  2GH5 A;  3AYI A;  5KMP A;  2AR8 A;  3DJD A;  3T14 A;  2YLS A;  1TYT A;  2VQB A;  3AE6 A;  4IA5 A;  3FIM B;  2YAU A;  4Z2T A;  3AEG A;  3D1C A;  2JKC A;  1ZY8 A;  1QJD A;  3IHM A;  3SY4 A;  4OPT A;  1D5T A;  1DXL A;  4LU6 A;  3ABV A;  4ZCD A;  3ALL A;  3L1R A;  5M10 A;  1TDO A;  1EL5 A;  1NHQ A;  4EQX A;  2C3C A;  2Y6Q A;  1JNZ A;  2ZZC A;  3AE2 A;  2VQ7 A;  1GTE A;  4NEW A;  4YJG A;  1H84 A;  2A8X A;  1LV0 A;  4IVM B;  1GRT A;  2BRY A;  3SYI A;  3AEE A;  4OPC A;  1IUS A;  3F8D A;  4JNA A;  2APG A;  3CNT A;  4NTD A;  4B69 A;  2RGO A;  3VRD B;  2BC0 A;  4G73 A;  5KMQ A;  1CL0 A;  2XCG A;  1Y0P A;  1B8S A;  3BNU A;  3GYX A;  4Y4L A;  3QJ4 A;  3M13 A;  2XYO A;  4DSH A;  4O5U A;  4B63 A;  2YR4 A;  3UKA A;  2OAM A;  4U8L A;  1NAA A;  1TDF A;  4K8D A;  4U2T A;  3CTY A;  1OJD A;  2C64 A;  1XHC A;  3F8R A;  1S2Q A;  4ICY A;  4II3 A;  3S61 A;  3SZF A;  4AOX A;  3AEB A;  3G3E A;  2XLR A;  1F6M A;  4EMI A;  5EB4 A;  4X4J A;  3W4K A;  3ATQ A;  1GES A;  2YR6 A;  5FS7 A;  1H83 A;  5U63 A;  4PAA A;  1X31 B;  2YLW A;  2GR0 A;  1S2Y A;  3KVE A;  3NG7 X;  3UTH A;  4BJZ A;  2C75 A;  4GDE A;  2E4A A;  1IUT A;  1BGJ A;  4H4Q A;  1PJ7 A;  2RGH A;  1PBD A;  2A87 A;  4OVI A;  1H7W A;  2CVJ A;  4B64 A;  1F8W A;  1LQT A;  4UDP A;  1LPF A;  4GCM A;  3GRS A;  4QFC A;  5KXJ A;  5JCL A;  3LB8 A;  3BHK A;  4YJF B;  4TM4 A;  3AWI A;  5FS9 A;  5EB5 A;  3UTE A;  3DH9 A;  5U1O A;  3AE5 A;  4GAV A;  2YM2 A;  1QO8 A;  2GQF A;  4YWO A;  4XWZ A;  1DJN A;  4AOS A;  4PAB A;  4A99 A;  1F8S A;  3GYJ A;  2YG3 A;  3PO7 A;  3M12 A;  3ALJ A;  3LZW A;  4H4X A;  1FEA A;  1CF3 A;  3I6D A;  4RG3 A;  4YXD A;  3BI5 A;  3I3L A;  3W4J A;  4CCR A;  1ZOV A;  2C70 A;  4J57 A;  2BC1 A;  3NYF A;  1PXB A;  2XVE A;  3BI4 A;  4II2 A;  4X9M A;  1YY5 A;  2FJA A;  1KIF A;  2WU2 A;  3CNJ A;  3NK2 X;  5M0Z A;  3ISH A;  5J60 A;  4A5L A;  1Q9I A;  3UKF A;  4J36 A;  4JY2 A;  3UKL A;  1D4D A;  2YG6 A;  3AD9 B;  1B5Q A;  1COY A;  3DK8 A;  4NTE A;  3GYI A;  2XFN A;  3LZX A;  1DJQ A;  3II4 A;  1C0K A;  2CUL A;  3QSE A;  4YJF A;  2EQ6 A;  3CN8 A;  2VVL A;  4JNQ A;  3UKQ A;  5EOW A;  4Z24 A;  2XLU A;  1Y56 B;  2R0P A;  1HYU A;  1DNC A;  3CIR A;  3QSS A;  2BK5 A;  5IPY A;  2R4E A;  5DBJ A;  3AYJ A;  2R0G A;  1V59 A;  3GMC A;  4JQ9 A;  5L46 A;  3VRB A;  1GRA A;  2Y6R A;  1GER A;  3OZ2 A;  3PVC A;  2GV8 A;  4E0V A;  3UP5 A;  2JBV A;  1DOE A;  4H4R A;  4Y4N A;  4AP3 A;  4MJW A;  4YKG A;  2WPF A;  1ZP0 A;  1BWC A;  1EL8 A;  2V6O A;  4I58 A;  1KF6 A;  5LV9 A;  4EIP A;  3CGE A;  2UZZ A;  2YVF A;  2B7S A;  3C4A A;  2WS3 A;  4G9K A;  4FK1 C;  2FBW A;  1GSN A;  2BYB A;  2VOU A;  3NIX A;  1MXT A;  3CNP A;  2BA9 A;  3KLJ A;  2R0C A;  3UTG A;  2BAB A;  1C0P A;  2C4C A;  1TDK A;  4H50 A;  4J34 A;  2GAH B;  2XVI A;  1F3P A;  4D03 A;  4NTC A;  1K0I A;  2WOI A;  3G5S A;  1CBO A;  4GUV A;  5BRT A;  3NGC X;  3NTD A;  4U8M A;  5HY5 A;  2R4J A;  1GTH A;  3T0K A;  1Y56 A;  3RHA A;  1GT8 A;  5KNL A;  2BS4 A;  3ITJ A;  1JRY A;  4LA1 A;  2AAQ A;  5FS8 A;  1Q1W A;  2BCP A;  1KDG A;  4YJD A;  2V61 A;  5IQ1 A;  4BK1 A;  4HB9 A;  1M64 A;  1C0I A;  2X3N A;  1H82 A;  1TDE A;  1IUU A;  2WET A;  2XVF A;  4OPU A;  4Z2U A;  1H6V A;  1VE9 A;  1M6I A;  2JB3 A;  2R45 A;  1PS9 A;  1CJ2 A;  2CDU A;  3UOY A;  5IQ4 A;  2EQ8 A;  3AEF A;  2C7G A;  4U8I A;  3GDP A;  2ARD A;  3LXD A;  4TLZ A;  1AOG A;  4TM3 A;  4BK3 A;  3SZC A;  4H2P A;  3ICS A;  1MOK A;  4M52 A;  4U8J A;  4A9W A;  3NH3 X;  2Q0L A;  2E1M A;  3CNS A;  4NZH A;  3P1W A;  5KVI A;  4DSG A;  2DU8 A;  4IA6 A;  3SM8 A;  1FL2 A;  2BXR A;  3FG2 P;  4G74 A;  3G5R A;  4P9S A;  5BUL A;  3HZL A;  1B37 A;  1GRB A;  4OCG A;  5JCN A;  2X50 A;  2EQ7 A;  2VVL G;  3EAN A;  1QLB A;  4O5Q A;  5KVH A;  1RYI A;  1FEB A;  1CC6 A;  1GET A;  2YLR A;  3NKS A;  4APN A;  2IID A;  2V3A A;  1D4C A;  4U8K A;  1NHP A;  4H4U A;  4REK A;  2YLX A;  1OJ9 A;  3FBS A;  1SEZ A;  4TM0 A;  3JSK A;  2Q6U A;  5HYM A;  2YQU A;  3SX6 A;  2C66 A;  4USQ A;  3GD4 A;  3C96 A;  1L0V A;  4AT2 A;  2BXS A;  1L9C A;  4H4Y A;  2XFP A;  2QAE A;  5BUK A;  2Z5X A;  2YVG A;  2BK3 A;  3P4S A;  2IVD A;  3HYX A;  3R9U A;  1EL7 A;  1C0L A;  2QA2 A;  1F8R A;  1N4U A;  2ACZ A;  3AB1 A; 
#chains in the Genus database with same CATH homology
 2GAG B;  3B6D A;  3DA1 A;  1GAL A;  1BF3 A;  1VG9 A;  2WP5 A;  4EQR A;  1NEN A;  3CGB A;  4XWR A;  3UKK A;  4GR1 A;  1PN0 A;  3D8X A;  1EBD A;  1N1P A;  2J3N A;  3P4Q A;  2OLO A;  4H4Z A;  1CJ3 A;  3UOZ A;  4J2W A;  3Q9T A;  5FMH A;  4A79 A;  2VZ2 A;  4GDP A;  1TYP A;  1O94 A;  1JU2 A;  4U8N A;  1DAO A;  3AYL A;  2H88 A;  1Z6L A;  2WEU A;  3AE3 A;  2BRA A;  3OC4 A;  4NWZ A;  1JRX A;  4ZCC A;  4RSL A;  1ONF A;  2DKH A;  2GQW A;  3GMB A;  4OPL A;  3UOV A;  3ALM A;  3IWA A;  4J33 A;  1CC4 A;  4ZN0 A;  2WDR A;  1W4X A;  2XLS A;  2WES A;  3LJP A;  2BCG G;  3AE1 A;  4EQW A;  2GMJ A;  3AEC A;  3KKJ A;  1CHU A;  4GRT A;  4WX1 A;  1GRF A;  1EVI A;  2CFY A;  1FCD A;  2V3B A;  1MO9 A;  5GRT A;  1D7Y A;  2VRL A;  1ZMC A;  3LAD A;  4Z26 A;  3E1T A;  2C76 A;  3NK1 X;  3LOV A;  4K5R A;  2FJB A;  1E1N A;  3UCL A;  1N4W A;  2FJD A;  4B1B A;  1D7L A;  3QVR A;  1NPX A;  4CY8 A;  4GAP A;  4TLX A;  1LTX R;  1FEC A;  4BK1 A;  1ZDL A;  3CPJ G;  3CPH G;  2ZZ0 A;  1E1L A;  3NLC A;  1TRB A;  4IV9 A;  2FJE A;  2PHH A;  3BNM A;  1DDO A;  3ZYX A;  1NG3 A;  2VVM A;  1ZMD A;  2WP6 A;  3SZW A;  1PDH A;  2W0H A;  1GV4 A;  2XLT A;  2YWL A;  2XFU A;  3RNM A;  3WE0 A;  3F8P A;  4JDR A;  1IUX A;  4H4P A;  4U2L A;  3AD7 B;  3HYV A;  3NYE A;  1E7P A;  1H86 A;  1DOD A;  1UKV G;  1DOB A;  5FS6 A;  3COX A;  2C67 A;  2OLN A;  1PJ6 A;  2GR3 A;  2WBA A;  3HYW A;  3V3N A;  4C77 A;  2O9Z A;  1Q1R A;  3C4N A;  2IVE A;  1PHH A;  1XAN A;  2DKI A;  2TPR A;  1OJT A;  4KX6 A;  5JCK A;  3W4I A;  4Z2R A;  4UP3 A;  4QFD A;  2XVH A;  2AQJ A;  1PXC A;  1PBF A;  1VG0 A;  4OPI A;  4EIQ A;  1O95 A;  4YSX A;  3KU9 A;  4NEV A;  3M0O A;  4H2Q A;  2BAC A;  4IVO B;  1ZK7 A;  4BUR A;  4A65 A;  4U8O A;  1BGN A;  4GF7 A;  4G6G A;  5KOW A;  1H81 A;  4FX9 A;  3NN0 X;  2VRM A;  4H4T A;  1NHR A;  2GMH A;  5EBK A;  2WPC A;  1S3E A;  3KPK A;  3RED A;  4FDC B;  5ER0 A;  3NN6 X;  4C3Y A;  3DJE A;  2X8C A;  1GEU A;  2V60 A;  4YSZ A;  1L9E A;  1D4E A;  3RP7 A;  3T31 A;  4I59 A;  3GRT A;  4X9N A;  3GSI A;  3CPI G;  3NT6 A;  2E4G A;  1GXF A;  2Q7V A;  3NTA A;  4KPR A;  1K0J A;  2WOW A;  3ZNN A;  2YR5 A;  1YQ3 A;  3WGT A;  4CBQ A;  2E48 A;  4EMJ A;  1PBE A;  1K4Q A;  4K5S A;  4CY6 A;  3CND A;  1P2H A;  4RG4 A;  3UOX A;  4YTP A;  1DOC A;  2YLZ A;  5KRQ A;  2YLT A;  1GRH A;  3PS9 A;  1BKW A;  2X99 A;  1B4V A;  4K7Z A;  1YKJ A;  2GR2 A;  3QSM A;  2JB1 A;  1LJ1 A;  3URH A;  2JAE A;  5HHF A;  1CC2 A;  2X8G A;  2E49 A;  4H4W A;  1FOH A;  3EF6 A;  3SFD A;  4YJH B;  3GD3 A;  3V76 A;  4YKF A;  5KMS A;  4DNA A;  3S5W A;  3P9U A;  2GEW A;  3KPF A;  3CMM A;  1AN9 A;  1ZOY A;  3AE4 A;  1CJ4 A;  3ZNP A;  1IUV A;  1E1M A;  3DK9 A;  3IHG A;  4U2S A;  1YQ4 A;  1PXA A;  2F5Z A;  4H4S A;  2OA1 A;  3SGL A;  4H7U A;  4Z43 A;  1CJC A;  2B9X A;  1E6E A;  2WHD A;  3AE9 A;  3K7M X;  1VRQ B;  2NPX A;  2BS2 A;  2Z5Y A;  1ZX9 A;  4BJY A;  3ADA B;  3RP6 A;  3K30 A;  2QA1 A;  3FPZ A;  4D04 A;  1EL9 A;  2YG7 A;  3DME A;  2JB2 A;  1IJH A;  4K22 A;  3UKH A;  4C3X A;  1K0L A;  1NG4 A;  4CRT A;  4EQS A;  1ELI A;  1PBC A;  2XLP A;  3BI2 A;  2GF3 A;  1L9D A;  2C73 A;  3CUK A;  2WPE A;  1OJA A;  4YJH A;  3DK4 A;  1GRG A;  3G5Q A;  3K7T A;  2C72 A;  4J56 A;  4UDR A;  1KSU A;  2WDQ A;  2EQ9 A;  3DGH A;  2PYX A;  3CGC A;  3GWD A;  1KFY A;  3EAO A;  3T37 A;  2I0Z A;  3IC9 A;  1OJC A;  4JN9 A;  5CQF A;  2E5V A;  1NEK A;  5JCM A;  3UTF A;  5U25 A;  3CGD A;  1O5W A;  4NNJ A;  3NRN A;  4H2R A;  1NDA A;  1RP0 A;  3RP8 A;  3VR8 A;  1KSS A;  5KWF A;  2R9Z A;  3NHO X;  2WOV A;  3UKP A;  2WQY A;  4HA6 A;  3P4R A;  2X8H A;  1LQU A;  3SFE A;  4CCQ A;  4EMW A;  4A6N B;  1JNR A;  3QFA A;  2WDV A;  1IUW A;  3ZNQ A;  1XPQ A;  2RGJ A;  1RSG A;  2V5Z A;  4Z44 A;  3AED A;  1BZL A;  2HQM A;  2C3D A;  5KMR A;  4A7A A;  4ADW A;  4CNK A;  3ATR A;  4C74 A;  4Z25 A;  3ZDN A;  1VQW A;  2YG5 A;  1S3B A;  3NK0 X;  2B9W A;  3VQR A;  3GWF A;  2H89 A;  3ZNO A;  3O0H A;  3SXI A;  2TMD A;  1PBB A;  1GPE A;  3KD9 A;  3P4P A;  4BV6 A;  4DGK A;  1P2E A;  3AE7 A;  4OPG A;  2OAL A;  2JK6 A;  3H8L A;  4EM3 A;  2XVJ A;  2XDO A;  1ZKQ A;  3ICT A;  3AXB A;  3NNE A;  4XXG A;  4Y4M A;  3V3O A;  3ICR A;  2YVJ A;  2WU5 A;  1GOS A;  5J7X A;  5JCI A;  4JY3 A;  4B66 A;  4TM1 A;  4A6N A;  3VR9 A;  4FK1 A;  1PJ5 A;  2B7R A;  2R46 A;  1JEH A;  4CNJ A;  3NYC A;  1KNP A;  2Q0K A;  4B68 A;  3Q6J A;  1VDC A;  2ZBW A;  4YSH A;  4ECH A;  1REO A;  2B9Y A;  4H4V A;  3IF9 A;  1NHS A;  1H7X A;  2ZZB A;  5KOX A;  2GRT A;  2B76 A;  2GVC A;  3DGZ A;  3DJG X;  3EPT A;  1YQZ A;  3B3R A;  4B67 A;  1JRZ A;  5GSN A;  1E1K A;  3BHF A;  2XFQ A;  4LII A;  2A89 A;  1LVL A;  1N4V A;  3AE8 A;  3AEA A;  4K2X A;  1XDI A;  3L8K A;  3T2Y A;  4YSY A;  2WP9 A;  4N9X A;  3H4K A;  2GB0 A;  3K7Q X;  2QCU A;  1GRE A;  4G6H A;  1TDN A;  3UP4 A;  4B65 A;  4EM4 A;  4YT0 A;  5BVA A;  5C2T A;  2YG4 A;  1JOA A;  5CKU A;  3VRA A;  3GDN A;  2E82 A;  3FMW A;  3KA7 A;  4C5O A;  2XFO A;  2BS3 A;  4USR A;  2GR1 A;  2YM1 A;  2C65 A;  1GND A;  4YJG B;  4H2N A;  3DJJ A;  2BK4 A;  4OPD A;  3SQP A;  3QVP A;  4U8P A;  2NVK X;  4BK2 A;  4J31 A;  2RAB A;  3QFB A;  5C3J A;  3T2Z A;  4WCT A;  4AT0 A;  4UDQ A;  4YTN A;  3AD8 B;  5HXI A;  4YTM A;  1KNR A;  1E39 A;  4AP1 A;  3SZ0 A;  3H8I A;  3T2K A;  2GH5 A;  3AYI A;  5KMP A;  2AR8 A;  3DJD A;  3T14 A;  2YLS A;  1TYT A;  2VQB A;  3AE6 A;  4IA5 A;  3FIM B;  2YAU A;  4Z2T A;  3AEG A;  3D1C A;  2JKC A;  1ZY8 A;  1QJD A;  3IHM A;  3SY4 A;  4OPT A;  1D5T A;  1DXL A;  4LU6 A;  3ABV A;  4ZCD A;  3ALL A;  3L1R A;  5M10 A;  1TDO A;  1EL5 A;  1NHQ A;  4EQX A;  2C3C A;  2Y6Q A;  1JNZ A;  2ZZC A;  3AE2 A;  2VQ7 A;  1GTE A;  4NEW A;  4YJG A;  1H84 A;  2A8X A;  1LV0 A;  4IVM B;  1GRT A;  2BRY A;  3SYI A;  3AEE A;  4OPC A;  1IUS A;  3F8D A;  4JNA A;  2APG A;  3CNT A;  4NTD A;  4B69 A;  2RGO A;  3VRD B;  2BC0 A;  4G73 A;  5KMQ A;  1CL0 A;  2XCG A;  1Y0P A;  1B8S A;  3BNU A;  3GYX A;  4Y4L A;  3QJ4 A;  3M13 A;  2XYO A;  4DSH A;  4O5U A;  4B63 A;  2YR4 A;  3UKA A;  2OAM A;  4U8L A;  1NAA A;  1TDF A;  4K8D A;  4U2T A;  3CTY A;  1OJD A;  2C64 A;  1XHC A;  3F8R A;  1S2Q A;  4ICY A;  4II3 A;  3S61 A;  3SZF A;  4AOX A;  3AEB A;  3G3E A;  2XLR A;  1F6M A;  4EMI A;  5EB4 A;  4X4J A;  3W4K A;  3ATQ A;  1GES A;  2YR6 A;  5FS7 A;  1H83 A;  5U63 A;  4PAA A;  1X31 B;  2YLW A;  2GR0 A;  1S2Y A;  3KVE A;  3NG7 X;  3UTH A;  4BJZ A;  2C75 A;  4GDE A;  2E4A A;  1IUT A;  1BGJ A;  4H4Q A;  1PJ7 A;  2RGH A;  1PBD A;  2A87 A;  4OVI A;  1H7W A;  2CVJ A;  4B64 A;  1F8W A;  1LQT A;  4UDP A;  1LPF A;  4GCM A;  3GRS A;  4QFC A;  5KXJ A;  5JCL A;  3LB8 A;  3BHK A;  4YJF B;  4TM4 A;  3AWI A;  5FS9 A;  5EB5 A;  3UTE A;  3DH9 A;  5U1O A;  3AE5 A;  4GAV A;  2YM2 A;  1QO8 A;  2GQF A;  4YWO A;  4XWZ A;  1DJN A;  4AOS A;  4PAB A;  4A99 A;  1F8S A;  3GYJ A;  2YG3 A;  3PO7 A;  3M12 A;  3ALJ A;  3LZW A;  4H4X A;  1FEA A;  1CF3 A;  3I6D A;  4RG3 A;  4YXD A;  3BI5 A;  3I3L A;  3W4J A;  4CCR A;  1ZOV A;  2C70 A;  4J57 A;  2BC1 A;  3NYF A;  1PXB A;  2XVE A;  3BI4 A;  4II2 A;  4X9M A;  1YY5 A;  2FJA A;  1KIF A;  2WU2 A;  3CNJ A;  3NK2 X;  5M0Z A;  3ISH A;  5J60 A;  4A5L A;  1Q9I A;  3UKF A;  4J36 A;  4JY2 A;  3UKL A;  1D4D A;  2YG6 A;  3AD9 B;  1B5Q A;  1COY A;  3DK8 A;  4NTE A;  3GYI A;  2XFN A;  3LZX A;  1DJQ A;  3II4 A;  1C0K A;  2CUL A;  3QSE A;  4YJF A;  2EQ6 A;  3CN8 A;  2VVL A;  4JNQ A;  3UKQ A;  5EOW A;  4Z24 A;  2XLU A;  1Y56 B;  2R0P A;  1HYU A;  1DNC A;  3CIR A;  3QSS A;  2BK5 A;  5IPY A;  2R4E A;  5DBJ A;  3AYJ A;  1V59 A;  2R0G A;  3GMC A;  4JQ9 A;  5L46 A;  3VRB A;  1GRA A;  2Y6R A;  1GER A;  3OZ2 A;  3PVC A;  2GV8 A;  4E0V A;  3UP5 A;  2JBV A;  1DOE A;  4H4R A;  4Y4N A;  4AP3 A;  4MJW A;  4YKG A;  2WPF A;  1ZP0 A;  1BWC A;  1EL8 A;  2V6O A;  4I58 A;  1KF6 A;  5LV9 A;  3CGE A;  4EIP A;  2UZZ A;  2YVF A;  2B7S A;  2WS3 A;  3C4A A;  4G9K A;  4FK1 C;  2FBW A;  1GSN A;  2BYB A;  2VOU A;  3NIX A;  1MXT A;  3CNP A;  2BA9 A;  3KLJ A;  2R0C A;  3UTG A;  2BAB A;  1C0P A;  2C4C A;  1TDK A;  4H50 A;  4J34 A;  2GAH B;  2XVI A;  1F3P A;  4D03 A;  4NTC A;  1K0I A;  2WOI A;  3G5S A;  1CBO A;  4GUV A;  5BRT A;  3NGC X;  3NTD A;  4U8M A;  5HY5 A;  2R4J A;  1GTH A;  3T0K A;  1Y56 A;  3RHA A;  1GT8 A;  5KNL A;  2BS4 A;  3ITJ A;  1JRY A;  4LA1 A;  2AAQ A;  5FS8 A;  1Q1W A;  2BCP A;  1KDG A;  4YJD A;  2V61 A;  5IQ1 A;  5TR3 A;  4HB9 A;  1M64 A;  1C0I A;  1H82 A;  1TDE A;  2WET A;  1IUU A;  2X3N A;  2XVF A;  4OPU A;  4Z2U A;  1H6V A;  1VE9 A;  1M6I A;  2JB3 A;  2R45 A;  1PS9 A;  1CJ2 A;  2CDU A;  3UOY A;  5IQ4 A;  2EQ8 A;  3AEF A;  2C7G A;  4U8I A;  3GDP A;  2ARD A;  3LXD A;  4TLZ A;  1AOG A;  4TM3 A;  4BK3 A;  3SZC A;  4H2P A;  3ICS A;  1MOK A;  4M52 A;  4U8J A;  4A9W A;  3NH3 X;  2Q0L A;  2E1M A;  3CNS A;  4NZH A;  3P1W A;  5KVI A;  4DSG A;  2DU8 A;  3SM8 A;  1FL2 A;  4IA6 A;  2BXR A;  3FG2 P;  4G74 A;  3G5R A;  4P9S A;  5BUL A;  3HZL A;  1B37 A;  1GRB A;  4OCG A;  5JCN A;  2X50 A;  2EQ7 A;  2VVL G;  3EAN A;  1QLB A;  4O5Q A;  5KVH A;  1RYI A;  1FEB A;  1CC6 A;  1GET A;  2YLR A;  3NKS A;  4APN A;  2IID A;  2V3A A;  1D4C A;  4U8K A;  1NHP A;  4H4U A;  4REK A;  2YLX A;  1OJ9 A;  3FBS A;  1SEZ A;  4TM0 A;  3JSK A;  2Q6U A;  2YQU A;  5HYM A;  3SX6 A;  2C66 A;  4USQ A;  3GD4 A;  3C96 A;  1L0V A;  4AT2 A;  2BXS A;  1L9C A;  4H4Y A;  2XFP A;  2QAE A;  5BUK A;  2Z5X A;  2YVG A;  2BK3 A;  3P4S A;  2IVD A;  3HYX A;  3R9U A;  1EL7 A;  1C0L A;  2QA2 A;  1F8R A;  1N4U A;  2ACZ A;  3AB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...