3NYEA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-arginine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
b'HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 118
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyeA01
4EM4A 2NVKX 2OA1A 4ECHA 4ADWA 4CNKA 4EMWA 5GSNA 4Z25A 3QSSA 2YR6A 2QCUA 1GETA 5JCIA 3AECA 4KPRA 2C72A 2VQBA 3IF9A 2FBWA 4CCQA 4J36A 4JDRA 2BK4A 3AEDA 2BXSA 3NH3X 2XFPA 3F8RA 2W0HA 1AN9A 4H7UA 4UDPA 5ER0A 2GMJA 2JK6A 1BGJA 4U8NA 4APNA 1O5WA 2APGA 4Y4NA 3UP5A 3BNMA 2WOIA 4Y4LA 4EMJA 1GTHA 2GR1A 3UCLA 5M10A 2XFQA 4OPCA 2XVHA 3CPHG 3IHGA 3QJ4A 1E6EA 4TM0A 5L46A 3PVCA 2YAUA 1NAAA 1Q1RA 4B63A 4C3YA 1OJCA 4DSGA 1JOAA 2X50A 1D4CA 1COYA 4XXGA 2XLSA 3ALMA 3G3EA 4YJHA 2XFNA 1N4UA 1FL2A 4IVOB 2XLUA 2R0GA 2GQWA 2B7RA 4YSYA 4NTEA 3F8DA 4A5LA 1HYUA 3L8KA 1IUVA 1NG4A 3DA1A 1CJCA 2BS2A 3LZWA 4BK3A 4MJWA 1LJ1A 1H84A 4WCTA 1DOBA 1ZKQA 2VVMA 4PAAA 2Y6QA 3ZNNA 3UOVA 4B65A 4CNJA 3DH9A 1VQWA 2GVCA 3UOYA 3GYIA 3KLJA 3IHMA 3SQPA 4UDRA 2IVEA 2BA9A 2IVDA 1CC6A 1ZOVA 1NHPA 3CGEA 4IVMB 4YTMA 1S3EA 4H2PA 3V76A 4A6NB 2V6OA 2R45A 1E1MA 1DXLA 4D04A 1GTEA 1E1KA 4A7AA 1PJ6A 4H2RA 2BK5A 3FMWA 3AEBA 3NNEA 3WGTA 3CN8A 2B9WA 5CQFA 1FECA 4A99A 2WOWA 2ACZA 3T37A 3NYEA 2WDQA 3RHAA 2BXRA 3UTFA 4GCMA 3VRBA 1NG3A 2XFOA 4U2LA 3PS9A 1NDAA 5FS7A 2BYBA 3UKQA 4O5UA 1S2QA 3DK8A 1D4EA 3K7QX 2RGHA 4UP3A 4Z2RA 5C3JA 2UZZA 1NHRA 3C4NA 3H4KA 1GEUA 1ZDLA 2EQ8A 2GMHA 2WDVA 2WQYA 1IUXA 3CGBA 3UOXA 4YXDA 3ALLA 1MXTA 1GRFA 1TDOA 5FS9A 3AE4A 2JB2A 4DSHA 5TR3A 3AE5A 3GD4A 1GNDA 1FOHA 3P4RA 3NKSA 3SFEA 3DGHA 1PXCA 3RNMA 2CULA 3NG7X 4H4YA 2QA2A 1B5QA 3NK2X 1UKVG 1PDHA 3HZLA 1OJTA 1Y56A 1VG0A 1JEHA 4ICYA 1BWCA 1IUUA 3AXBA 2AQJA 4A79A 1W4XA 2FJBA 2YQUA 4ZCCA 3QFAA 4FK1C 1LQUA 4LA1A 4GDPA 2H88A 5IPYA 1JU2A 1QO8A 1RYIA 1GRBA 3GWDA 3CPIG 2VZ2A 2EQ7A 4OVIA 2YVFA 4B64A 1ZMDA 2V5ZA 4H4PA 1ELIA 2E5VA 4EM3A 1TDKA 4LU6A 2YR5A 5KXJA 2B9YA 2C75A 3NTAA 3OZ2A 2YM1A 4YT0A 2C73A 3CNJA 3REDA 4AT0A 2RGOA 1NEKA 4YJGA 2YG7A 3G5RA 3NTDA 1FEBA 1EL5A 3AEEA 2A87A 2E49A 4IA6A 4K2XA 4OPTA 3M0OA 1DODA 2YLSA 1OJ9A 4H4ZA 4GUVA 2I0ZA 4C77A 3QSEA 4H50A 3URHA 1P2HA 4U8LA 2OALA 4DNAA 4H4UA 3RP6A 1F8SA 2Q7VA 2X8HA 3DJEA 2A89A 2E4GA 2JB1A 2EQ6A 2X8CA 3FIMB 2WP6A 3UKFA 3AE2A 4B1BA 5JCLA 3M12A 4REKA 1PHHA 4X9MA 1ZY8A 1CHUA 4OPDA 1LV0A 3COXA 3P4QA 3ICRA 1VRQB 2QA1A 5HYMA 4J34A 2XVFA 4BURA 1ZP0A 5FS8A 4BJYA 4Z44A 2O9ZA 3D1CA 2Z5XA 2BACA 4J57A 2ZZ0A 4TM3A 1ZMCA 4OCGA 2X99A 4NEVA 3QVRA 1RP0A 1O94A 1D7LA 3GRTA 3E1TA 4DGKA 4U8PA 2CDUA 2C76A 1SEZA 3W4KA 3KA7A 1GRAA 5LV9A 3ZNOA 3UKKA 1CJ2A 3UTHA 1B4VA 3I3LA 3GMCA 5U1OA 1X31B 4EQSA 4B69A 2TPRA 2R0CA 2GV8A 3AEGA 4K5RA 4AP3A 3CGCA 4USQA 2B76A 2YLWA 1DOEA 2YG5A 3ATRA 3P4PA 4EMIA 4RG4A 4AP1A 1GREA 2X8GA 2WS3A 1E1LA 2AR8A 4FK1A 3DGZA 4RG3A 2R0PA 4M52A 1EL9A 1XDIA 4H4WA 1K0IA 4TM4A 1D4DA 3G5SA 3AYIA 1BKWA 2GRTA 2WHDA 3BI2A 3BI5A 4IA5A 4I59A 4JY2A 4B67A 2BC0A 2YG6A 3GRSA 4AOXA 1JNRA 3H8IA 1H82A 3ADAB 4XWRA 1F8RA 4PABA 4JY3A 1NENA 1GRHA 3S61A 5BULA 3VRDB 1GESA 1YQ3A 5M0ZA 4A65A 1DOCA 2Q0KA 2Z5YA 2PHHA 3OC4A 3LJPA 3KD9A 2WP9A 5KVHA 4H2QA 4D03A 3NGCX 1RSGA 2E48A 2F5ZA 2TMDA 4YJFA 1TDNA 5CKUA 2V61A 3CNPA 1F8WA 2B9XA 1VE9A 3K7TA 4C74A 3BI4A 1BF3A 1M64A 4JN9A 1E7PA 4WX1A 3VR8A 3GD3A 4H2NA 5HY5A 3CNSA 3SFDA 4P9SA 2E82A 1F6MA 1Q1WA 4H4XA 2XLRA 4BJZA 2XVIA 3NN0X 5FMHA 3AE8A 4RSLA 1KSUA 4J33A 2XFUA 2DU8A 3AD8B 1K4QA 4YWOA 3Q9TA 3VRAA 1E1NA 5JCNA 1Q9IA 2X3NA 3NYCA 3GWFA 5BUKA 2WBAA 4U8JA 5IQ4A 2E1MA 2RGJA 4GR1A 1GV4A 2BS4A 2R46A 1EVIA 1CL0A 2VOUA 5FS6A 5GRTA 2GAGB 1PXAA 2CVJA 3AYJA 4YSHA 4U8MA 5J60A 2J3NA 3NK0X 1KSSA 2JKCA 4CCRA 3PO7A 1JRYA 4NTDA 5KOWA 3ATQA 2XCGA 2RABA 1XHCA 1TYPA 2VQ7A 1ONFA 2VVLA 2C3DA 2VVLG 1EBDA 4QFDA 3ZNPA 4CY8A 2GB0A 3FPZA 4O5QA 2BK3A 1MOKA 1O95A 1Z6LA 1C0KA 2GAHB 2R9ZA 1GSNA 3AB1A 2WDRA 3KVEA 4BV6A 4USRA 5IQ1A 2GR3A 3BHKA 1IJHA 4Y4MA 4B68A 2OLNA 1H7XA 5U25A 2IIDA 1B8SA 4IV9A 3ALJA 1QJDA 1FCDA 3P4SA 2WP5A 1Y56B 5EB4A 2VRLA 2EQ9A 2YM2A 3LB8A 4H4TA 2C64A 2C67A 3DJGX 1LTXR 4CY6A 1N4VA 2E4AA 1LVLA 3FBSA 4N9XA 4YSZA 3CUKA 2FJDA 4GDEA 1ZOYA 2WPFA 2C66A 4E0VA 1PS9A 3AE6A 2ZZCA 4J56A 1GRGA 4H4VA 3UP4A 3CTYA 3L1RA 3AYLA 3NYFA 1DJQA 1H6VA 3WE0A 1N4WA 4FDCB 3AEAA 5KOXA 3DJJA 2GR2A 2OAMA 5KRQA 1TYTA 4H4SA 3ABVA 1GPEA 2GQFA 3GDPA 3QFBA 1YQ4A 3KPFA 2ARDA 1OJAA 2XLTA 4TM1A 3V3NA 2H89A 3GSIA 4ZCDA 3AWIA 4YSXA 4ZN0A 1H7WA 3BHFA 5EBKA 1L0VA 4A9WA 2YR4A 4EIPA 3IWAA 4U8OA 4XWZA 1N1PA 4Z26A 1BGNA 4HA6A 2YLXA 4EQXA 3QVPA 3CNTA 2R4EA 1VDCA 3UKHA 1JRZA 2BCGG 1D5TA 3CNDA 1DJNA 2GEWA 2NPXA 2XDOA 2FJAA 2YVGA 3ITJA 3AE7A 2A8XA 3NRNA 1P2EA 1H86A 3Q6JA 5BVAA 1XPQA 1KDGA 4K7ZA 3RP8A 1EL7A 4FX9A 2WESA 5KVIA 4LIIA 4CBQA 4K5SA 4OPIA 4K8DA 2YLZA 5JCMA 3FG2P 5HHFA 3F8PA 3R9UA 2GR0A 3IC9A 4UDQA 4GF7A 2XVJA 1VG9A 3EF6A 4U2TA 1CC4A 3SGLA 2C3CA 2C70A 4JQ9A 4U8IA 3DK4A 3P1WA 4C3XA 2ZBWA 1CJ3A 2ZZBA 5EB5A 5EOWA 1YY5A 3W4JA 1LPFA 2R4JA 5J7XA 1REOA 3UKLA 4YKGA 4YJHB 1TRBA 1XANA 1GERA 1C0IA 3UTGA 3UTEA 1Y0PA 3BNUA 3LOVA 3NT6A 4EQWA 3NLCA 3P9UA 1DDOA 1C0PA 1MO9A 4H4QA 3EAOA 1S3BA 3M13A 4BK2A 4TLXA 2V3BA 1EL8A 4I58A 1DAOA 2C65A 4J31A 4Z2TA 3S5WA 3QSMA 4A6NA 2PYXA 4OPUA 1K0LA 1PXBA 1F3PA 4X9NA 1H81A 1H83A 1V59A 4HB9A 3B6DA 3K30A 4J2WA 4X4JA 3AD7B 3ZDNA 2WETA 3LADA 4JNAA 4OPLA 4YTNA 1TDFA 3CGDA 1L9EA 2FJEA 2B7SA 4JNQA 3EANA 1YQZA 1L9DA 1PBCA 2BABA 2DKHA 2V60A 1CC2A 3AE1A 1FEAA 1PBDA 4NEWA 1DNCA 3AE3A 3CPJG 2C7GA 1PJ7A 1BZLA 1PJ5A 1D7YA 1NHSA 1KIFA 4YJFB 2CFYA 2WU2A 1KFYA 1PN0A 2YG4A 3C4AA 3EPTA 4GRTA 5BRTA 4BK1A 1C0LA 1YKJA 2WPEA 4QFCA 3AEFA 1ZX9A 4NZHA 3LXDA 1PBFA 3AD9B 1GALA 2XLPA 1KNRA 1JNZA 2BCPA 1B37A 5KWFA 5HXIA 3V3OA 2JAEA 3W4IA 2Q6UA 1NPXA 3NN6X 3VQRA 4AOSA 1PBEA 4U2SA 2Y6RA 3I6DA 3KU9A 2BS3A 4YTPA 5DBJA 4Z43A 4Z24A 4C5OA 4YJDA 1CF3A 1QLBA 3C96A 3NK1X 2WEUA 1K0JA 4KX6A 3UKPA 3GYJA 4B66A 4Z2UA 4EQRA 2QAEA 1L9CA 3GMBA 3G5QA 1OJDA 1IUSA 1CBOA 2XYOA 2GF3A 2XVEA 3LZXA 1AOGA 1LQTA 4NTCA 1CJ4A 2DKIA 1IUWA 2WU5A 3DK9A 3ICSA 3NIXA 3DJDA 3AE9A 5JCKA 4YKFA 1GOSA 3ZYXA 2WPCA 3O0HA 2YWLA 1TDEA 1E39A 3D8XA 4EIQA 1GT8A 4H4RA 4U8KA 3UKAA 5C2TA 3SM8A 4K22A 3CIRA 3RP7A 4TLZA 2VRMA 1ZK7A 3ICTA 3K7MX 3VR9A 2YLRA 1PBBA 3JSKA 3ISHA 1GXFA 1NHQA 2YG3A 2JB3A 3UOZA 2V3AA 4YJGB 1KNPA 1M6IA 1GRTA 2GH5A 5U63A 1IUTA 4CRTA 2HQMA 3KKJA 4OPGA 3II4A 2WOVA 2OLOA 3DMEA 2Q0LA 2YLTA 1S2YA 2JBVA 3B3RA 3GDNA 2YVJA 3H8LA 2AAQA 1KF6A 1JRXA 2BC1A 4AT2A 3NHOX 3ZNQA
chains in the Genus database with same CATH superfamily
4EM4A 2NVKX 2OA1A 4ECHA 4ADWA 4CNKA 4EMWA 5GSNA 4Z25A 3QSSA 2YR6A 2QCUA 1GETA 5JCIA 3AECA 4KPRA 2C72A 2VQBA 3IF9A 2FBWA 4CCQA 4J36A 4JDRA 2BK4A 3AEDA 2BXSA 3NH3X 5KMRA 2XFPA 3F8RA 2W0HA 1AN9A 4H7UA 4UDPA 5ER0A 2GMJA 2JK6A 1BGJA 4U8NA 3SYIA 4APNA 1O5WA 2APGA 4Y4NA 3UP5A 3BNMA 2WOIA 4Y4LA 4EMJA 1GTHA 2GR1A 3UCLA 5M10A 2XFQA 4OPCA 2XVHA 3CPHG 3IHGA 3QJ4A 1E6EA 4TM0A 5L46A 3PVCA 2YAUA 1NAAA 1Q1RA 4B63A 4C3YA 1OJCA 4NWZA 4DSGA 1JOAA 2X50A 1D4CA 1COYA 4XXGA 2XLSA 3ALMA 3G3EA 4YJHA 2XFNA 1N4UA 1FL2A 4IVOB 2XLUA 2R0GA 2GQWA 2B7RA 4YSYA 4NTEA 3F8DA 4A5LA 1HYUA 3L8KA 1IUVA 1NG4A 3DA1A 1CJCA 2BS2A 4BK3A 3LZWA 4MJWA 1LJ1A 1H84A 4WCTA 1DOBA 1ZKQA 2VVMA 4PAAA 2Y6QA 3ZNNA 3UOVA 4B65A 4CNJA 3DH9A 1VQWA 2GVCA 3UOYA 2BRYA 3GYIA 3KLJA 3IHMA 3SQPA 4UDRA 2IVEA 2BA9A 2IVDA 1CC6A 1ZOVA 1NHPA 3CGEA 4IVMB 4YTMA 4H2PA 1S3EA 3V76A 4A6NB 2V6OA 3KPKA 4II2A 2R45A 1E1MA 1DXLA 4D04A 1GTEA 1E1KA 4A7AA 1PJ6A 4H2RA 2BK5A 3FMWA 3AEBA 3NNEA 3WGTA 3CN8A 2B9WA 5CQFA 1FECA 4A99A 2WOWA 2ACZA 3T37A 3NYEA 2WDQA 3RHAA 2BXRA 3UTFA 4GCMA 3VRBA 1NG3A 2XFOA 4U2LA 3PS9A 1NDAA 5FS7A 2BYBA 3UKQA 4O5UA 1S2QA 3DK8A 1D4EA 3K7QX 2RGHA 4UP3A 4Z2RA 5C3JA 2UZZA 1NHRA 3C4NA 3H4KA 1GEUA 1ZDLA 2EQ8A 2GMHA 2WDVA 2WQYA 4G74A 1IUXA 3CGBA 3UOXA 4YXDA 3ALLA 1MXTA 1GRFA 1TDOA 5FS9A 3AE4A 5KMPA 2JB2A 4DSHA 5TR3A 3AE5A 3GD4A 1GNDA 1FOHA 3P4RA 3NKSA 4G9KA 3SFEA 3DGHA 1PXCA 3RNMA 2CULA 3NG7X 4H4YA 2QA2A 1B5QA 3NK2X 1UKVG 1PDHA 3HZLA 1OJTA 1Y56A 1VG0A 1JEHA 4ICYA 1BWCA 1IUUA 3AXBA 2AQJA 4A79A 1W4XA 2FJBA 2YQUA 4ZCCA 3QFAA 4FK1C 1LQUA 4LA1A 4GDPA 2H88A 5IPYA 2C4CA 1JU2A 1QO8A 1RYIA 1GRBA 3GWDA 3CPIG 2VZ2A 2EQ7A 4OVIA 2YVFA 4B64A 1ZMDA 2V5ZA 4H4PA 1ELIA 4G73A 2E5VA 4EM3A 1TDKA 4LU6A 2YR5A 5KXJA 2B9YA 2C75A 3NTAA 3OZ2A 2YM1A 4YT0A 2C73A 3CNJA 3REDA 4AT0A 2RGOA 1NEKA 4YJGA 2YG7A 3G5RA 3NTDA 1FEBA 1EL5A 3AEEA 2A87A 2E49A 4IA6A 4K2XA 4OPTA 3M0OA 1DODA 2YLSA 1OJ9A 4H4ZA 4GUVA 2I0ZA 4C77A 3QSEA 4H50A 3URHA 1P2HA 4U8LA 2OALA 4DNAA 3RP6A 4H4UA 1F8SA 2Q7VA 2X8HA 3DJEA 2A89A 2E4GA 2JB1A 2EQ6A 2X8CA 3FIMB 2WP6A 3UKFA 3AE2A 4GAVA 4B1BA 5JCLA 3M12A 4REKA 1PHHA 3T0KA 4X9MA 1ZY8A 1CHUA 4OPDA 1LV0A 3COXA 3P4QA 3ICRA 1VRQB 2QA1A 5HYMA 4J34A 2XVFA 5KMQA 4BURA 1ZP0A 5FS8A 4BJYA 4Z44A 2O9ZA 3D1CA 2Z5XA 2BACA 4J57A 2ZZ0A 4TM3A 4G6GA 1ZMCA 4OCGA 2X99A 3T2YA 4NEVA 3QVRA 1RP0A 1O94A 1D7LA 3GRTA 3E1TA 4DGKA 4U8PA 2CDUA 2C76A 1SEZA 3W4KA 3KA7A 1GRAA 5LV9A 3ZNOA 3UKKA 1CJ2A 3UTHA 1B4VA 3I3LA 3GMCA 5U1OA 1X31B 4EQSA 4B69A 2TPRA 3GYXA 2R0CA 2GV8A 3AEGA 4GAPA 4K5RA 4AP3A 3CGCA 4USQA 2B76A 2YLWA 1DOEA 2YG5A 3ATRA 3P4PA 4EMIA 4RG4A 4AP1A 1GREA 2X8GA 2WS3A 1E1LA 2AR8A 4FK1A 3DGZA 4RG3A 2R0PA 4M52A 1EL9A 1XDIA 4H4WA 1K0IA 4TM4A 1D4DA 3G5SA 3AYIA 1BKWA 4IA5A 2GRTA 2WHDA 3BI2A 3BI5A 4I59A 4JY2A 4B67A 2BC0A 2YG6A 3GRSA 4AOXA 1JNRA 3H8IA 1H82A 3ADAB 4XWRA 1F8RA 4PABA 4JY3A 1NENA 1GRHA 3S61A 5BULA 3VRDB 1GESA 1YQ3A 5M0ZA 4A65A 1DOCA 2Q0KA 2Z5YA 2PHHA 3OC4A 3SZWA 3LJPA 3KD9A 2WP9A 5KVHA 4H2QA 4D03A 3NGCX 1RSGA 2E48A 2F5ZA 2TMDA 4YJFA 1TDNA 5CKUA 2V61A 3CNPA 1F8WA 2B9XA 1VE9A 3K7TA 4II3A 4C74A 3BI4A 1BF3A 1M64A 4JN9A 1E7PA 4WX1A 3SZ0A 4H2NA 3GD3A 3VR8A 5HY5A 3CNSA 3SFDA 4P9SA 2E82A 1F6MA 1Q1WA 4H4XA 4BJZA 2XLRA 2XVIA 3NN0X 5FMHA 3AE8A 4RSLA 1KSUA 4J33A 2XFUA 2DU8A 3AD8B 1K4QA 4YWOA 3Q9TA 3VRAA 1E1NA 5JCNA 1Q9IA 2X3NA 3NYCA 3GWFA 5BUKA 2WBAA 4U8JA 5IQ4A 2RGJA 2E1MA 4GR1A 1GV4A 2BS4A 2R46A 1EVIA 2VOUA 1CL0A 5FS6A 5GRTA 2GAGB 1PXAA 2CVJA 3AYJA 4YSHA 3T31A 4U8MA 5J60A 2J3NA 3NK0X 1KSSA 2JKCA 4CCRA 3PO7A 1JRYA 4NTDA 5KOWA 3ATQA 2XCGA 2RABA 1XHCA 1TYPA 2VQ7A 1ONFA 2VVLA 2C3DA 2VVLG 1EBDA 4QFDA 3ZNPA 4CY8A 2GB0A 3FPZA 4O5QA 2BK3A 1MOKA 1O95A 1Z6LA 1C0KA 2GAHB 2R9ZA 1GSNA 3AB1A 2WDRA 3KVEA 4BV6A 4USRA 5IQ1A 2GR3A 3BHKA 1IJHA 4Y4MA 4B68A 2OLNA 1H7XA 5U25A 2IIDA 1B8SA 4IV9A 3ALJA 1QJDA 1FCDA 3P4SA 2WP5A 5KNLA 1Y56B 5EB4A 2VRLA 2EQ9A 2YM2A 3LB8A 4H4TA 2C64A 2C67A 3DJGX 1LTXR 3HYVA 1N4VA 4CY6A 2E4AA 1LVLA 3FBSA 3T14A 4N9XA 4YSZA 3CUKA 2FJDA 4GDEA 1ZOYA 2WPFA 2C66A 4E0VA 1PS9A 3AE6A 2ZZCA 4J56A 1GRGA 4H4VA 3UP4A 3CTYA 3L1RA 3AYLA 3NYFA 1DJQA 1H6VA 3WE0A 1N4WA 4FDCB 3AEAA 5KOXA 3DJJA 2GR2A 2OAMA 4G6HA 5KRQA 1TYTA 4H4SA 3ABVA 1GPEA 2GQFA 3SY4A 3GDPA 3QFBA 1YQ4A 3KPFA 2ARDA 1OJAA 2XLTA 4TM1A 3V3NA 2H89A 3GSIA 4ZCDA 3AWIA 4YSXA 4ZN0A 1H7WA 3BHFA 5EBKA 1L0VA 4A9WA 2YR4A 4EIPA 3IWAA 4U8OA 4XWZA 1N1PA 4Z26A 1BGNA 4HA6A 2YLXA 4EQXA 3QVPA 3CNTA 2R4EA 1VDCA 3UKHA 1JRZA 2BCGG 1D5TA 3CNDA 1DJNA 2GEWA 2NPXA 2XDOA 2FJAA 2YVGA 3ITJA 3AE7A 2A8XA 3NRNA 3SZCA 1P2EA 1H86A 3SX6A 3Q6JA 5BVAA 1XPQA 1KDGA 4K7ZA 3RP8A 1EL7A 4FX9A 2WESA 5KVIA 4LIIA 4CBQA 4K5SA 4OPIA 4K8DA 2YLZA 5JCMA 3FG2P 5HHFA 3F8PA 3R9UA 2GR0A 3IC9A 4UDQA 4GF7A 2XVJA 1VG9A 3EF6A 4U2TA 1CC4A 3SGLA 2C3CA 2C70A 4JQ9A 4U8IA 3DK4A 3P1WA 4C3XA 2ZBWA 1CJ3A 2ZZBA 5EB5A 5EOWA 1YY5A 3W4JA 1LPFA 2R4JA 5J7XA 1REOA 3UKLA 3T2ZA 4YKGA 4YJHB 1TRBA 1XANA 1GERA 1C0IA 3UTGA 3UTEA 1Y0PA 3BNUA 3T2KA 3LOVA 3NT6A 4EQWA 3NLCA 3P9UA 1DDOA 1C0PA 1MO9A 4H4QA 3EAOA 1S3BA 3CMMA 3M13A 4BK2A 4TLXA 2V3BA 1EL8A 4I58A 1DAOA 2C65A 4J31A 4Z2TA 3S5WA 3SZFA 3QSMA 4A6NA 2PYXA 4OPUA 1K0LA 1PXBA 1F3PA 4X9NA 1H81A 1H83A 1V59A 4HB9A 3B6DA 3K30A 4J2WA 4X4JA 3AD7B 3ZDNA 2WETA 3LADA 4JNAA 4OPLA 4YTNA 1TDFA 3CGDA 1L9EA 4NNJA 2FJEA 2B7SA 4JNQA 3EANA 1YQZA 1L9DA 1PBCA 2DKHA 2BABA 2V60A 1CC2A 3AE1A 1FEAA 1PBDA 4NEWA 1DNCA 3AE3A 3HYXA 3CPJG 2C7GA 5KMSA 1PJ7A 1BZLA 1PJ5A 1D7YA 1NHSA 1KIFA 4YJFB 2CFYA 3C4AA 1KFYA 1PN0A 3EPTA 2WU2A 2YG4A 4GRTA 5BRTA 4BK1A 1C0LA 1YKJA 2WPEA 4QFCA 3AEFA 1ZX9A 4NZHA 3LXDA 1PBFA 3AD9B 1GALA 2XLPA 1KNRA 1JNZA 2BCPA 1B37A 5KWFA 5HXIA 3V3OA 2JAEA 3W4IA 2Q6UA 1NPXA 3NN6X 3VQRA 4AOSA 1PBEA 4U2SA 2Y6RA 3I6DA 3KU9A 2BS3A 4YTPA 5DBJA 4Z43A 4Z24A 4C5OA 4YJDA 1CF3A 1QLBA 3C96A 3NK1X 2WEUA 1K0JA 4KX6A 3SXIA 3GYJA 3UKPA 4B66A 4Z2UA 4EQRA 2QAEA 1L9CA 3GMBA 3G5QA 1OJDA 1IUSA 1CBOA 2XYOA 2GF3A 2XVEA 3LZXA 1AOGA 1LQTA 4NTCA 1CJ4A 2DKIA 1IUWA 2WU5A 3DK9A 3ICSA 3NIXA 3DJDA 3AE9A 5JCKA 4YKFA 1GOSA 3ZYXA 2WPCA 3O0HA 2YWLA 1TDEA 1E39A 3D8XA 4EIQA 2BRAA 1GT8A 4H4RA 4U8KA 3UKAA 5C2TA 3SM8A 4K22A 3RP7A 3CIRA 4TLZA 2VRMA 1ZK7A 3ICTA 3K7MX 3VR9A 2YLRA 1PBBA 3JSKA 3ISHA 1GXFA 1NHQA 2YG3A 3HYWA 2JB3A 3UOZA 2V3AA 4YJGB 1KNPA 1M6IA 1GRTA 2GH5A 5U63A 1IUTA 4CRTA 2HQMA 3KKJA 4OPGA 3II4A 2WOVA 2OLOA 3DMEA 2Q0LA 2YLTA 1S2YA 2JBVA 3B3RA 3GDNA 2YVJA 3H8LA 2AAQA 1KF6A 1JRXA 2BC1A 4AT2A 3NHOX 3ZNQA
chains in the Genus database with same CATH topology
4EM4A 2NVKX 2OA1A 4ECHA 4ADWA 4CNKA 4EMWA 5GSNA 4Z25A 3QSSA 2YR6A 2QCUA 1GETA 5JCIA 3AECA 4KPRA 2C72A 2VQBA 3IF9A 2FBWA 4CCQA 4J36A 4JDRA 2BK4A 3AEDA 2BXSA 3NH3X 5KMRA 2XFPA 3F8RA 2W0HA 1AN9A 4H7UA 4UDPA 5ER0A 2GMJA 2JK6A 1BGJA 4U8NA 3SYIA 4APNA 1O5WA 2APGA 4Y4NA 3UP5A 3BNMA 2WOIA 4Y4LA 4EMJA 1GTHA 2GR1A 3UCLA 5M10A 2XFQA 4OPCA 2XVHA 3CPHG 3IHGA 3QJ4A 1E6EA 4TM0A 5L46A 3PVCA 2YAUA 1NAAA 1Q1RA 4B63A 4C3YA 1OJCA 4NWZA 4DSGA 1JOAA 2X50A 1D4CA 1COYA 4XXGA 2XLSA 3ALMA 3G3EA 4YJHA 2XFNA 1N4UA 1FL2A 4IVOB 2XLUA 2R0GA 2GQWA 2B7RA 4YSYA 4NTEA 3F8DA 4A5LA 1HYUA 3L8KA 1IUVA 1NG4A 3DA1A 1CJCA 2BS2A 3LZWA 4BK3A 4MJWA 1LJ1A 1H84A 4WCTA 1DOBA 1ZKQA 2VVMA 4PAAA 2Y6QA 3ZNNA 3UOVA 4B65A 4CNJA 3DH9A 1VQWA 2GVCA 3UOYA 2BRYA 3GYIA 3KLJA 3IHMA 3SQPA 4UDRA 2IVEA 2BA9A 2IVDA 1CC6A 1ZOVA 1NHPA 3CGEA 4IVMB 4YTMA 1S3EA 4H2PA 3V76A 4A6NB 2V6OA 3KPKA 4II2A 2R45A 1E1MA 1DXLA 4D04A 1GTEA 1E1KA 4A7AA 1PJ6A 4H2RA 2BK5A 3FMWA 3AEBA 3NNEA 3WGTA 3CN8A 2B9WA 5CQFA 1FECA 4A99A 2WOWA 2ACZA 3T37A 3NYEA 2WDQA 3RHAA 2BXRA 3UTFA 4GCMA 3VRBA 1NG3A 2XFOA 4U2LA 3PS9A 1NDAA 5FS7A 2BYBA 3UKQA 4O5UA 1S2QA 3DK8A 1D4EA 3K7QX 2RGHA 4UP3A 4Z2RA 5C3JA 2UZZA 1NHRA 3C4NA 3H4KA 1GEUA 1ZDLA 2EQ8A 2GMHA 2WDVA 2WQYA 4G74A 1IUXA 3CGBA 3UOXA 4YXDA 3ALLA 1MXTA 1GRFA 1TDOA 5FS9A 3AE4A 5KMPA 2JB2A 4DSHA 5TR3A 3AE5A 3GD4A 1GNDA 1FOHA 3P4RA 3NKSA 4G9KA 3SFEA 3DGHA 1PXCA 3RNMA 2CULA 3NG7X 4H4YA 2QA2A 1B5QA 3NK2X 1UKVG 1PDHA 3HZLA 1OJTA 1Y56A 1VG0A 1JEHA 4ICYA 1BWCA 1IUUA 3AXBA 2AQJA 4A79A 1W4XA 2FJBA 2YQUA 4ZCCA 3QFAA 4FK1C 1LQUA 4LA1A 4GDPA 2H88A 5IPYA 2C4CA 1JU2A 1QO8A 1RYIA 1GRBA 3GWDA 3CPIG 2VZ2A 2EQ7A 4OVIA 2YVFA 4B64A 1ZMDA 2V5ZA 4H4PA 1ELIA 4G73A 2E5VA 4EM3A 1TDKA 4LU6A 2YR5A 5KXJA 2B9YA 2C75A 3NTAA 3OZ2A 2YM1A 4YT0A 2C73A 3CNJA 3REDA 4AT0A 2RGOA 1NEKA 4YJGA 2YG7A 3G5RA 3NTDA 1FEBA 1EL5A 3AEEA 2A87A 2E49A 4IA6A 4K2XA 4OPTA 3M0OA 1DODA 2YLSA 1OJ9A 4H4ZA 4GUVA 2I0ZA 4C77A 3QSEA 4H50A 3URHA 1P2HA 4U8LA 2OALA 4DNAA 4H4UA 3RP6A 1F8SA 2Q7VA 2X8HA 3DJEA 2A89A 2E4GA 2JB1A 2EQ6A 2X8CA 3FIMB 2WP6A 3UKFA 3AE2A 4GAVA 4B1BA 5JCLA 3M12A 4REKA 1PHHA 3T0KA 4X9MA 1ZY8A 1CHUA 4OPDA 1LV0A 3COXA 3P4QA 3ICRA 1VRQB 2QA1A 5HYMA 4J34A 2XVFA 5KMQA 4BURA 1ZP0A 5FS8A 4BJYA 4Z44A 2O9ZA 3D1CA 2Z5XA 2BACA 4J57A 2ZZ0A 4TM3A 4G6GA 1ZMCA 4OCGA 2X99A 3T2YA 4NEVA 3QVRA 1RP0A 1O94A 1D7LA 3GRTA 3E1TA 4DGKA 4U8PA 2CDUA 2C76A 1SEZA 3W4KA 3KA7A 1GRAA 5LV9A 3ZNOA 3UKKA 1CJ2A 3UTHA 1B4VA 3I3LA 3GMCA 5U1OA 1X31B 4EQSA 4B69A 2TPRA 3GYXA 2R0CA 2GV8A 3AEGA 4GAPA 4K5RA 4AP3A 3CGCA 4USQA 2B76A 2YLWA 1DOEA 2YG5A 3ATRA 3P4PA 4EMIA 4RG4A 4AP1A 1GREA 2X8GA 2WS3A 1E1LA 2AR8A 4FK1A 3DGZA 4RG3A 2R0PA 4M52A 1EL9A 1XDIA 4H4WA 1K0IA 4TM4A 1D4DA 3G5SA 3AYIA 1BKWA 2GRTA 2WHDA 3BI2A 3BI5A 4IA5A 4I59A 4JY2A 4B67A 2BC0A 2YG6A 3GRSA 4AOXA 1JNRA 3H8IA 1H82A 3ADAB 4XWRA 1F8RA 4PABA 4JY3A 1NENA 1GRHA 3S61A 5BULA 3VRDB 1GESA 1YQ3A 5M0ZA 4A65A 1DOCA 2Q0KA 2Z5YA 2PHHA 3OC4A 3SZWA 3LJPA 3KD9A 2WP9A 5KVHA 4H2QA 4D03A 3NGCX 1RSGA 2E48A 2F5ZA 2TMDA 4YJFA 1TDNA 5CKUA 2V61A 3CNPA 1F8WA 2B9XA 1VE9A 3K7TA 4II3A 4C74A 3BI4A 1BF3A 1M64A 4JN9A 1E7PA 4WX1A 3SZ0A 3GD3A 4H2NA 3VR8A 5HY5A 3CNSA 3SFDA 4P9SA 2E82A 1F6MA 1Q1WA 4H4XA 2XLRA 4BJZA 2XVIA 3NN0X 5FMHA 3AE8A 4RSLA 1KSUA 4J33A 2XFUA 2DU8A 3AD8B 1K4QA 4YWOA 3Q9TA 3VRAA 1E1NA 5JCNA 1Q9IA 2X3NA 3NYCA 3GWFA 5BUKA 2WBAA 4U8JA 5IQ4A 2E1MA 2RGJA 4GR1A 1GV4A 2BS4A 2R46A 1EVIA 1CL0A 2VOUA 5FS6A 5GRTA 2GAGB 1PXAA 2CVJA 3AYJA 4YSHA 3T31A 4U8MA 5J60A 2J3NA 3NK0X 1KSSA 2JKCA 4CCRA 3PO7A 1JRYA 4NTDA 5KOWA 3ATQA 2XCGA 2RABA 1XHCA 1TYPA 2VQ7A 1ONFA 2VVLA 2C3DA 2VVLG 1EBDA 4QFDA 3ZNPA 4CY8A 2GB0A 3FPZA 4O5QA 2BK3A 1MOKA 1O95A 1Z6LA 1C0KA 2GAHB 2R9ZA 1GSNA 3AB1A 2WDRA 3KVEA 4BV6A 4USRA 5IQ1A 2GR3A 3BHKA 1IJHA 4Y4MA 4B68A 2OLNA 1H7XA 5U25A 2IIDA 1B8SA 4IV9A 3ALJA 1QJDA 1FCDA 3P4SA 2WP5A 5KNLA 1Y56B 5EB4A 2VRLA 2EQ9A 2YM2A 3LB8A 4H4TA 2C64A 2C67A 3DJGX 1LTXR 3HYVA 1N4VA 4CY6A 2E4AA 1LVLA 3FBSA 3T14A 4N9XA 4YSZA 3CUKA 2FJDA 4GDEA 1ZOYA 2WPFA 2C66A 4E0VA 1PS9A 3AE6A 2ZZCA 4J56A 1GRGA 4H4VA 3UP4A 3CTYA 3L1RA 3AYLA 3NYFA 1DJQA 1H6VA 3WE0A 1N4WA 4FDCB 3AEAA 5KOXA 3DJJA 2GR2A 2OAMA 4G6HA 5KRQA 1TYTA 4H4SA 3ABVA 1GPEA 2GQFA 3SY4A 3GDPA 3QFBA 1YQ4A 3KPFA 2ARDA 1OJAA 2XLTA 4TM1A 3V3NA 2H89A 3GSIA 4ZCDA 3AWIA 4YSXA 4ZN0A 1H7WA 3BHFA 5EBKA 1L0VA 4A9WA 2YR4A 4EIPA 3IWAA 4U8OA 4XWZA 1N1PA 4Z26A 1BGNA 4HA6A 2YLXA 4EQXA 3QVPA 3CNTA 2R4EA 1VDCA 3UKHA 1JRZA 2BCGG 1D5TA 3CNDA 1DJNA 2GEWA 2NPXA 2XDOA 2FJAA 2YVGA 3ITJA 3AE7A 2A8XA 3NRNA 3SZCA 1P2EA 1H86A 3SX6A 3Q6JA 5BVAA 1XPQA 1KDGA 4K7ZA 3RP8A 1EL7A 4FX9A 2WESA 5KVIA 4LIIA 4CBQA 4K5SA 4OPIA 4K8DA 2YLZA 5JCMA 3FG2P 5HHFA 3F8PA 3R9UA 2GR0A 3IC9A 4UDQA 4GF7A 2XVJA 1VG9A 3EF6A 4U2TA 1CC4A 3SGLA 2C3CA 2C70A 4JQ9A 4U8IA 3DK4A 3P1WA 4C3XA 2ZBWA 1CJ3A 2ZZBA 5EB5A 5EOWA 1YY5A 3W4JA 1LPFA 2R4JA 5J7XA 1REOA 3UKLA 3T2ZA 4YKGA 4YJHB 1TRBA 1XANA 1GERA 1C0IA 3UTGA 3UTEA 1Y0PA 3BNUA 3T2KA 3LOVA 3NT6A 4EQWA 3NLCA 3P9UA 1DDOA 1C0PA 1MO9A 4H4QA 3EAOA 1S3BA 3CMMA 3M13A 4BK2A 4TLXA 2V3BA 1EL8A 4I58A 1DAOA 2C65A 4J31A 4Z2TA 3S5WA 3SZFA 3QSMA 4A6NA 2PYXA 4OPUA 1K0LA 1PXBA 1F3PA 4X9NA 1H81A 1H83A 1V59A 4HB9A 3B6DA 3K30A 4J2WA 4X4JA 3AD7B 3ZDNA 2WETA 3LADA 4JNAA 4OPLA 4YTNA 1TDFA 3CGDA 1L9EA 4NNJA 2FJEA 2B7SA 4JNQA 3EANA 1YQZA 1L9DA 1PBCA 2BABA 2DKHA 2V60A 1CC2A 3AE1A 1FEAA 1PBDA 4NEWA 1DNCA 3AE3A 3HYXA 3CPJG 2C7GA 5KMSA 1PJ7A 1BZLA 1PJ5A 1D7YA 1NHSA 1KIFA 4YJFB 2CFYA 2WU2A 1KFYA 1PN0A 2YG4A 3C4AA 3EPTA 4GRTA 5BRTA 4BK1A 1C0LA 1YKJA 2WPEA 4QFCA 3AEFA 1ZX9A 4NZHA 3LXDA 1PBFA 3AD9B 1GALA 2XLPA 1KNRA 1JNZA 2BCPA 1B37A 5KWFA 5HXIA 3V3OA 2JAEA 3W4IA 2Q6UA 1NPXA 3NN6X 3VQRA 4AOSA 1PBEA 4U2SA 2Y6RA 3I6DA 3KU9A 2BS3A 4YTPA 5DBJA 4Z43A 4Z24A 4C5OA 4YJDA 1CF3A 1QLBA 3C96A 3NK1X 2WEUA 1K0JA 4KX6A 3SXIA 3GYJA 3UKPA 4B66A 4Z2UA 4EQRA 2QAEA 1L9CA 3GMBA 3G5QA 1OJDA 1IUSA 1CBOA 2XYOA 2GF3A 2XVEA 3LZXA 1AOGA 1LQTA 4NTCA 1CJ4A 2DKIA 1IUWA 2WU5A 3DK9A 3ICSA 3NIXA 3DJDA 3AE9A 5JCKA 4YKFA 1GOSA 3ZYXA 2WPCA 3O0HA 2YWLA 1TDEA 1E39A 3D8XA 4EIQA 2BRAA 1GT8A 4H4RA 4U8KA 3UKAA 5C2TA 3SM8A 4K22A 3CIRA 3RP7A 4TLZA 2VRMA 1ZK7A 3ICTA 3K7MX 3VR9A 2YLRA 1PBBA 3JSKA 3ISHA 1GXFA 1NHQA 2YG3A 3HYWA 2JB3A 3UOZA 2V3AA 4YJGB 1KNPA 1M6IA 1GRTA 2GH5A 5U63A 1IUTA 4CRTA 2HQMA 3KKJA 4OPGA 3II4A 2WOVA 2OLOA 3DMEA 2Q0LA 2YLTA 1S2YA 2JBVA 3B3RA 3GDNA 2YVJA 3H8LA 2AAQA 1KF6A 1JRXA 2BC1A 4AT2A 3NHOX 3ZNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM4 A;  2NVK X;  2OA1 A;  4ECH A;  4ADW A;  4CNK A;  4EMW A;  5GSN A;  4Z25 A;  3QSS A;  2YR6 A;  2QCU A;  1GET A;  5JCI A;  3AEC A;  4KPR A;  2C72 A;  2VQB A;  3IF9 A;  2FBW A;  4CCQ A;  4J36 A;  4JDR A;  2BK4 A;  3AED A;  2BXS A;  3NH3 X;  2XFP A;  3F8R A;  2W0H A;  1AN9 A;  4H7U A;  4UDP A;  5ER0 A;  2GMJ A;  2JK6 A;  1BGJ A;  4U8N A;  4APN A;  1O5W A;  2APG A;  4Y4N A;  3UP5 A;  3BNM A;  2WOI A;  4Y4L A;  4EMJ A;  1GTH A;  2GR1 A;  3UCL A;  5M10 A;  2XFQ A;  4OPC A;  2XVH A;  3CPH G;  3IHG A;  3QJ4 A;  1E6E A;  4TM0 A;  5L46 A;  3PVC A;  2YAU A;  1NAA A;  1Q1R A;  4B63 A;  4C3Y A;  1OJC A;  4DSG A;  1JOA A;  2X50 A;  1D4C A;  1COY A;  4XXG A;  2XLS A;  3ALM A;  3G3E A;  4YJH A;  2XFN A;  1N4U A;  1FL2 A;  4IVO B;  2XLU A;  2R0G A;  2GQW A;  2B7R A;  4YSY A;  4NTE A;  3F8D A;  4A5L A;  1HYU A;  3L8K A;  1IUV A;  1NG4 A;  3DA1 A;  1CJC A;  2BS2 A;  3LZW A;  4BK3 A;  4MJW A;  1LJ1 A;  1H84 A;  4WCT A;  1DOB A;  1ZKQ A;  2VVM A;  4PAA A;  2Y6Q A;  3ZNN A;  3UOV A;  4B65 A;  4CNJ A;  3DH9 A;  1VQW A;  2GVC A;  3UOY A;  3GYI A;  3KLJ A;  3IHM A;  3SQP A;  4UDR A;  2IVE A;  2BA9 A;  2IVD A;  1CC6 A;  1ZOV A;  1NHP A;  3CGE A;  4IVM B;  4YTM A;  1S3E A;  4H2P A;  3V76 A;  4A6N B;  2V6O A;  2R45 A;  1E1M A;  1DXL A;  4D04 A;  1GTE A;  1E1K A;  4A7A A;  1PJ6 A;  4H2R A;  2BK5 A;  3FMW A;  3AEB A;  3NNE A;  3WGT A;  3CN8 A;  2B9W A;  5CQF A;  1FEC A;  4A99 A;  2WOW A;  2ACZ A;  3T37 A;  3NYE A;  2WDQ A;  3RHA A;  2BXR A;  3UTF A;  4GCM A;  3VRB A;  1NG3 A;  2XFO A;  4U2L A;  3PS9 A;  1NDA A;  5FS7 A;  2BYB A;  3UKQ A;  4O5U A;  1S2Q A;  3DK8 A;  1D4E A;  3K7Q X;  2RGH A;  4UP3 A;  4Z2R A;  5C3J A;  2UZZ A;  1NHR A;  3C4N A;  3H4K A;  1GEU A;  1ZDL A;  2EQ8 A;  2GMH A;  2WDV A;  2WQY A;  1IUX A;  3CGB A;  3UOX A;  4YXD A;  3ALL A;  1MXT A;  1GRF A;  1TDO A;  5FS9 A;  3AE4 A;  2JB2 A;  4DSH A;  5TR3 A;  3AE5 A;  3GD4 A;  1GND A;  1FOH A;  3P4R A;  3NKS A;  3SFE A;  3DGH A;  1PXC A;  3RNM A;  2CUL A;  3NG7 X;  4H4Y A;  2QA2 A;  1B5Q A;  3NK2 X;  1UKV G;  1PDH A;  3HZL A;  1OJT A;  1Y56 A;  1VG0 A;  1JEH A;  4ICY A;  1BWC A;  1IUU A;  3AXB A;  2AQJ A;  4A79 A;  1W4X A;  2FJB A;  2YQU A;  4ZCC A;  3QFA A;  4FK1 C;  1LQU A;  4LA1 A;  4GDP A;  2H88 A;  5IPY A;  1JU2 A;  1QO8 A;  1RYI A;  1GRB A;  3GWD A;  3CPI G;  2VZ2 A;  2EQ7 A;  4OVI A;  2YVF A;  4B64 A;  1ZMD A;  2V5Z A;  4H4P A;  1ELI A;  2E5V A;  4EM3 A;  1TDK A;  4LU6 A;  2YR5 A;  5KXJ A;  2B9Y A;  2C75 A;  3NTA A;  3OZ2 A;  2YM1 A;  4YT0 A;  2C73 A;  3CNJ A;  3RED A;  4AT0 A;  2RGO A;  1NEK A;  4YJG A;  2YG7 A;  3G5R A;  3NTD A;  1FEB A;  1EL5 A;  3AEE A;  2A87 A;  2E49 A;  4IA6 A;  4K2X A;  4OPT A;  3M0O A;  1DOD A;  2YLS A;  1OJ9 A;  4H4Z A;  4GUV A;  2I0Z A;  4C77 A;  3QSE A;  4H50 A;  3URH A;  1P2H A;  4U8L A;  2OAL A;  4DNA A;  4H4U A;  3RP6 A;  1F8S A;  2Q7V A;  2X8H A;  3DJE A;  2A89 A;  2E4G A;  2JB1 A;  2EQ6 A;  2X8C A;  3FIM B;  2WP6 A;  3UKF A;  3AE2 A;  4B1B A;  5JCL A;  3M12 A;  4REK A;  1PHH A;  4X9M A;  1ZY8 A;  1CHU A;  4OPD A;  1LV0 A;  3COX A;  3P4Q A;  3ICR A;  1VRQ B;  2QA1 A;  5HYM A;  4J34 A;  2XVF A;  4BUR A;  1ZP0 A;  5FS8 A;  4BJY A;  4Z44 A;  2O9Z A;  3D1C A;  2Z5X A;  2BAC A;  4J57 A;  2ZZ0 A;  4TM3 A;  1ZMC A;  4OCG A;  2X99 A;  4NEV A;  3QVR A;  1RP0 A;  1O94 A;  1D7L A;  3GRT A;  3E1T A;  4DGK A;  4U8P A;  2CDU A;  2C76 A;  1SEZ A;  3W4K A;  3KA7 A;  1GRA A;  5LV9 A;  3ZNO A;  3UKK A;  1CJ2 A;  3UTH A;  1B4V A;  3I3L A;  3GMC A;  5U1O A;  1X31 B;  4EQS A;  4B69 A;  2TPR A;  2R0C A;  2GV8 A;  3AEG A;  4K5R A;  4AP3 A;  3CGC A;  4USQ A;  2B76 A;  2YLW A;  1DOE A;  2YG5 A;  3ATR A;  3P4P A;  4EMI A;  4RG4 A;  4AP1 A;  1GRE A;  2X8G A;  2WS3 A;  1E1L A;  2AR8 A;  4FK1 A;  3DGZ A;  4RG3 A;  2R0P A;  4M52 A;  1EL9 A;  1XDI A;  4H4W A;  1K0I A;  4TM4 A;  1D4D A;  3G5S A;  3AYI A;  1BKW A;  2GRT A;  2WHD A;  3BI2 A;  3BI5 A;  4IA5 A;  4I59 A;  4JY2 A;  4B67 A;  2BC0 A;  2YG6 A;  3GRS A;  4AOX A;  1JNR A;  3H8I A;  1H82 A;  3ADA B;  4XWR A;  1F8R A;  4PAB A;  4JY3 A;  1NEN A;  1GRH A;  3S61 A;  5BUL A;  3VRD B;  1GES A;  1YQ3 A;  5M0Z A;  4A65 A;  1DOC A;  2Q0K A;  2Z5Y A;  2PHH A;  3OC4 A;  3LJP A;  3KD9 A;  2WP9 A;  5KVH A;  4H2Q A;  4D03 A;  3NGC X;  1RSG A;  2E48 A;  2F5Z A;  2TMD A;  4YJF A;  1TDN A;  5CKU A;  2V61 A;  3CNP A;  1F8W A;  2B9X A;  1VE9 A;  3K7T A;  4C74 A;  3BI4 A;  1BF3 A;  1M64 A;  4JN9 A;  1E7P A;  4WX1 A;  3VR8 A;  3GD3 A;  4H2N A;  5HY5 A;  3CNS A;  3SFD A;  4P9S A;  2E82 A;  1F6M A;  1Q1W A;  4H4X A;  2XLR A;  4BJZ A;  2XVI A;  3NN0 X;  5FMH A;  3AE8 A;  4RSL A;  1KSU A;  4J33 A;  2XFU A;  2DU8 A;  3AD8 B;  1K4Q A;  4YWO A;  3Q9T A;  3VRA A;  1E1N A;  5JCN A;  1Q9I A;  2X3N A;  3NYC A;  3GWF A;  5BUK A;  2WBA A;  4U8J A;  5IQ4 A;  2E1M A;  2RGJ A;  4GR1 A;  1GV4 A;  2BS4 A;  2R46 A;  1EVI A;  1CL0 A;  2VOU A;  5FS6 A;  5GRT A;  2GAG B;  1PXA A;  2CVJ A;  3AYJ A;  4YSH A;  4U8M A;  5J60 A;  2J3N A;  3NK0 X;  1KSS A;  2JKC A;  4CCR A;  3PO7 A;  1JRY A;  4NTD A;  5KOW A;  3ATQ A;  2XCG A;  2RAB A;  1XHC A;  1TYP A;  2VQ7 A;  1ONF A;  2VVL A;  2C3D A;  2VVL G;  1EBD A;  4QFD A;  3ZNP A;  4CY8 A;  2GB0 A;  3FPZ A;  4O5Q A;  2BK3 A;  1MOK A;  1O95 A;  1Z6L A;  1C0K A;  2GAH B;  2R9Z A;  1GSN A;  3AB1 A;  2WDR A;  3KVE A;  4BV6 A;  4USR A;  5IQ1 A;  2GR3 A;  3BHK A;  1IJH A;  4Y4M A;  4B68 A;  2OLN A;  1H7X A;  5U25 A;  2IID A;  1B8S A;  4IV9 A;  3ALJ A;  1QJD A;  1FCD A;  3P4S A;  2WP5 A;  1Y56 B;  5EB4 A;  2VRL A;  2EQ9 A;  2YM2 A;  3LB8 A;  4H4T A;  2C64 A;  2C67 A;  3DJG X;  1LTX R;  4CY6 A;  1N4V A;  2E4A A;  1LVL A;  3FBS A;  4N9X A;  4YSZ A;  3CUK A;  2FJD A;  4GDE A;  1ZOY A;  2WPF A;  2C66 A;  4E0V A;  1PS9 A;  3AE6 A;  2ZZC A;  4J56 A;  1GRG A;  4H4V A;  3UP4 A;  3CTY A;  3L1R A;  3AYL A;  3NYF A;  1DJQ A;  1H6V A;  3WE0 A;  1N4W A;  4FDC B;  3AEA A;  5KOX A;  3DJJ A;  2GR2 A;  2OAM A;  5KRQ A;  1TYT A;  4H4S A;  3ABV A;  1GPE A;  2GQF A;  3GDP A;  3QFB A;  1YQ4 A;  3KPF A;  2ARD A;  1OJA A;  2XLT A;  4TM1 A;  3V3N A;  2H89 A;  3GSI A;  4ZCD A;  3AWI A;  4YSX A;  4ZN0 A;  1H7W A;  3BHF A;  5EBK A;  1L0V A;  4A9W A;  2YR4 A;  4EIP A;  3IWA A;  4U8O A;  4XWZ A;  1N1P A;  4Z26 A;  1BGN A;  4HA6 A;  2YLX A;  4EQX A;  3QVP A;  3CNT A;  2R4E A;  1VDC A;  3UKH A;  1JRZ A;  2BCG G;  1D5T A;  3CND A;  1DJN A;  2GEW A;  2NPX A;  2XDO A;  2FJA A;  2YVG A;  3ITJ A;  3AE7 A;  2A8X A;  3NRN A;  1P2E A;  1H86 A;  3Q6J A;  5BVA A;  1XPQ A;  1KDG A;  4K7Z A;  3RP8 A;  1EL7 A;  4FX9 A;  2WES A;  5KVI A;  4LII A;  4CBQ A;  4K5S A;  4OPI A;  4K8D A;  2YLZ A;  5JCM A;  3FG2 P;  5HHF A;  3F8P A;  3R9U A;  2GR0 A;  3IC9 A;  4UDQ A;  4GF7 A;  2XVJ A;  1VG9 A;  3EF6 A;  4U2T A;  1CC4 A;  3SGL A;  2C3C A;  2C70 A;  4JQ9 A;  4U8I A;  3DK4 A;  3P1W A;  4C3X A;  2ZBW A;  1CJ3 A;  2ZZB A;  5EB5 A;  5EOW A;  1YY5 A;  3W4J A;  1LPF A;  2R4J A;  5J7X A;  1REO A;  3UKL A;  4YKG A;  4YJH B;  1TRB A;  1XAN A;  1GER A;  1C0I A;  3UTG A;  3UTE A;  1Y0P A;  3BNU A;  3LOV A;  3NT6 A;  4EQW A;  3NLC A;  3P9U A;  1DDO A;  1C0P A;  1MO9 A;  4H4Q A;  3EAO A;  1S3B A;  3M13 A;  4BK2 A;  4TLX A;  2V3B A;  1EL8 A;  4I58 A;  1DAO A;  2C65 A;  4J31 A;  4Z2T A;  3S5W A;  3QSM A;  4A6N A;  2PYX A;  4OPU A;  1K0L A;  1PXB A;  1F3P A;  4X9N A;  1H81 A;  1H83 A;  1V59 A;  4HB9 A;  3B6D A;  3K30 A;  4J2W A;  4X4J A;  3AD7 B;  3ZDN A;  2WET A;  3LAD A;  4JNA A;  4OPL A;  4YTN A;  1TDF A;  3CGD A;  1L9E A;  2FJE A;  2B7S A;  4JNQ A;  3EAN A;  1YQZ A;  1L9D A;  1PBC A;  2BAB A;  2DKH A;  2V60 A;  1CC2 A;  3AE1 A;  1FEA A;  1PBD A;  4NEW A;  1DNC A;  3AE3 A;  3CPJ G;  2C7G A;  1PJ7 A;  1BZL A;  1PJ5 A;  1D7Y A;  1NHS A;  1KIF A;  4YJF B;  2CFY A;  2WU2 A;  1KFY A;  1PN0 A;  2YG4 A;  3C4A A;  3EPT A;  4GRT A;  5BRT A;  4BK1 A;  1C0L A;  1YKJ A;  2WPE A;  4QFC A;  3AEF A;  1ZX9 A;  4NZH A;  3LXD A;  1PBF A;  3AD9 B;  1GAL A;  2XLP A;  1KNR A;  1JNZ A;  2BCP A;  1B37 A;  5KWF A;  5HXI A;  3V3O A;  2JAE A;  3W4I A;  2Q6U A;  1NPX A;  3NN6 X;  3VQR A;  4AOS A;  1PBE A;  4U2S A;  2Y6R A;  3I6D A;  3KU9 A;  2BS3 A;  4YTP A;  5DBJ A;  4Z43 A;  4Z24 A;  4C5O A;  4YJD A;  1CF3 A;  1QLB A;  3C96 A;  3NK1 X;  2WEU A;  1K0J A;  4KX6 A;  3UKP A;  3GYJ A;  4B66 A;  4Z2U A;  4EQR A;  2QAE A;  1L9C A;  3GMB A;  3G5Q A;  1OJD A;  1IUS A;  1CBO A;  2XYO A;  2GF3 A;  2XVE A;  3LZX A;  1AOG A;  1LQT A;  4NTC A;  1CJ4 A;  2DKI A;  1IUW A;  2WU5 A;  3DK9 A;  3ICS A;  3NIX A;  3DJD A;  3AE9 A;  5JCK A;  4YKF A;  1GOS A;  3ZYX A;  2WPC A;  3O0H A;  2YWL A;  1TDE A;  1E39 A;  3D8X A;  4EIQ A;  1GT8 A;  4H4R A;  4U8K A;  3UKA A;  5C2T A;  3SM8 A;  4K22 A;  3CIR A;  3RP7 A;  4TLZ A;  2VRM A;  1ZK7 A;  3ICT A;  3K7M X;  3VR9 A;  2YLR A;  1PBB A;  3JSK A;  3ISH A;  1GXF A;  1NHQ A;  2YG3 A;  2JB3 A;  3UOZ A;  2V3A A;  4YJG B;  1KNP A;  1M6I A;  1GRT A;  2GH5 A;  5U63 A;  1IUT A;  4CRT A;  2HQM A;  3KKJ A;  4OPG A;  3II4 A;  2WOV A;  2OLO A;  3DME A;  2Q0L A;  2YLT A;  1S2Y A;  2JBV A;  3B3R A;  3GDN A;  2YVJ A;  3H8L A;  2AAQ A;  1KF6 A;  1JRX A;  2BC1 A;  4AT2 A;  3NHO X;  3ZNQ A; 
#chains in the Genus database with same CATH topology
 4EM4 A;  2NVK X;  2OA1 A;  4ECH A;  4ADW A;  4CNK A;  4EMW A;  5GSN A;  4Z25 A;  3QSS A;  2YR6 A;  2QCU A;  1GET A;  5JCI A;  3AEC A;  4KPR A;  2C72 A;  2VQB A;  3IF9 A;  2FBW A;  4CCQ A;  4J36 A;  4JDR A;  2BK4 A;  3AED A;  2BXS A;  3NH3 X;  5KMR A;  2XFP A;  3F8R A;  2W0H A;  1AN9 A;  4H7U A;  4UDP A;  5ER0 A;  2GMJ A;  2JK6 A;  1BGJ A;  4U8N A;  3SYI A;  4APN A;  1O5W A;  2APG A;  4Y4N A;  3UP5 A;  3BNM A;  2WOI A;  4Y4L A;  4EMJ A;  1GTH A;  2GR1 A;  3UCL A;  5M10 A;  2XFQ A;  4OPC A;  2XVH A;  3CPH G;  3IHG A;  3QJ4 A;  1E6E A;  4TM0 A;  5L46 A;  3PVC A;  2YAU A;  1NAA A;  1Q1R A;  4B63 A;  4C3Y A;  1OJC A;  4NWZ A;  4DSG A;  1JOA A;  2X50 A;  1D4C A;  1COY A;  4XXG A;  2XLS A;  3ALM A;  3G3E A;  4YJH A;  2XFN A;  1N4U A;  1FL2 A;  4IVO B;  2XLU A;  2R0G A;  2GQW A;  2B7R A;  4YSY A;  4NTE A;  3F8D A;  4A5L A;  1HYU A;  3L8K A;  1IUV A;  1NG4 A;  3DA1 A;  1CJC A;  2BS2 A;  4BK3 A;  3LZW A;  4MJW A;  1LJ1 A;  1H84 A;  4WCT A;  1DOB A;  1ZKQ A;  2VVM A;  4PAA A;  2Y6Q A;  3ZNN A;  3UOV A;  4B65 A;  4CNJ A;  3DH9 A;  1VQW A;  2GVC A;  3UOY A;  2BRY A;  3GYI A;  3KLJ A;  3IHM A;  3SQP A;  4UDR A;  2IVE A;  2BA9 A;  2IVD A;  1CC6 A;  1ZOV A;  1NHP A;  3CGE A;  4IVM B;  4YTM A;  4H2P A;  1S3E A;  3V76 A;  4A6N B;  2V6O A;  3KPK A;  4II2 A;  2R45 A;  1E1M A;  1DXL A;  4D04 A;  1GTE A;  1E1K A;  4A7A A;  1PJ6 A;  4H2R A;  2BK5 A;  3FMW A;  3AEB A;  3NNE A;  3WGT A;  3CN8 A;  2B9W A;  5CQF A;  1FEC A;  4A99 A;  2WOW A;  2ACZ A;  3T37 A;  3NYE A;  2WDQ A;  3RHA A;  2BXR A;  3UTF A;  4GCM A;  3VRB A;  1NG3 A;  2XFO A;  4U2L A;  3PS9 A;  1NDA A;  5FS7 A;  2BYB A;  3UKQ A;  4O5U A;  1S2Q A;  3DK8 A;  1D4E A;  3K7Q X;  2RGH A;  4UP3 A;  4Z2R A;  5C3J A;  2UZZ A;  1NHR A;  3C4N A;  3H4K A;  1GEU A;  1ZDL A;  2EQ8 A;  2GMH A;  2WDV A;  2WQY A;  4G74 A;  1IUX A;  3CGB A;  3UOX A;  4YXD A;  3ALL A;  1MXT A;  1GRF A;  1TDO A;  5FS9 A;  3AE4 A;  5KMP A;  2JB2 A;  4DSH A;  5TR3 A;  3AE5 A;  3GD4 A;  1GND A;  1FOH A;  3P4R A;  3NKS A;  4G9K A;  3SFE A;  3DGH A;  1PXC A;  3RNM A;  2CUL A;  3NG7 X;  4H4Y A;  2QA2 A;  1B5Q A;  3NK2 X;  1UKV G;  1PDH A;  3HZL A;  1OJT A;  1Y56 A;  1VG0 A;  1JEH A;  4ICY A;  1BWC A;  1IUU A;  3AXB A;  2AQJ A;  4A79 A;  1W4X A;  2FJB A;  2YQU A;  4ZCC A;  3QFA A;  4FK1 C;  1LQU A;  4LA1 A;  4GDP A;  2H88 A;  5IPY A;  2C4C A;  1JU2 A;  1QO8 A;  1RYI A;  1GRB A;  3GWD A;  3CPI G;  2VZ2 A;  2EQ7 A;  4OVI A;  2YVF A;  4B64 A;  1ZMD A;  2V5Z A;  4H4P A;  1ELI A;  4G73 A;  2E5V A;  4EM3 A;  1TDK A;  4LU6 A;  2YR5 A;  5KXJ A;  2B9Y A;  2C75 A;  3NTA A;  3OZ2 A;  2YM1 A;  4YT0 A;  2C73 A;  3CNJ A;  3RED A;  4AT0 A;  2RGO A;  1NEK A;  4YJG A;  2YG7 A;  3G5R A;  3NTD A;  1FEB A;  1EL5 A;  3AEE A;  2A87 A;  2E49 A;  4IA6 A;  4K2X A;  4OPT A;  3M0O A;  1DOD A;  2YLS A;  1OJ9 A;  4H4Z A;  4GUV A;  2I0Z A;  4C77 A;  3QSE A;  4H50 A;  3URH A;  1P2H A;  4U8L A;  2OAL A;  4DNA A;  3RP6 A;  4H4U A;  1F8S A;  2Q7V A;  2X8H A;  3DJE A;  2A89 A;  2E4G A;  2JB1 A;  2EQ6 A;  2X8C A;  3FIM B;  2WP6 A;  3UKF A;  3AE2 A;  4GAV A;  4B1B A;  5JCL A;  3M12 A;  4REK A;  1PHH A;  3T0K A;  4X9M A;  1ZY8 A;  1CHU A;  4OPD A;  1LV0 A;  3COX A;  3P4Q A;  3ICR A;  1VRQ B;  2QA1 A;  5HYM A;  4J34 A;  2XVF A;  5KMQ A;  4BUR A;  1ZP0 A;  5FS8 A;  4BJY A;  4Z44 A;  2O9Z A;  3D1C A;  2Z5X A;  2BAC A;  4J57 A;  2ZZ0 A;  4TM3 A;  4G6G A;  1ZMC A;  4OCG A;  2X99 A;  3T2Y A;  4NEV A;  3QVR A;  1RP0 A;  1O94 A;  1D7L A;  3GRT A;  3E1T A;  4DGK A;  4U8P A;  2CDU A;  2C76 A;  1SEZ A;  3W4K A;  3KA7 A;  1GRA A;  5LV9 A;  3ZNO A;  3UKK A;  1CJ2 A;  3UTH A;  1B4V A;  3I3L A;  3GMC A;  5U1O A;  1X31 B;  4EQS A;  4B69 A;  2TPR A;  3GYX A;  2R0C A;  2GV8 A;  3AEG A;  4GAP A;  4K5R A;  4AP3 A;  3CGC A;  4USQ A;  2B76 A;  2YLW A;  1DOE A;  2YG5 A;  3ATR A;  3P4P A;  4EMI A;  4RG4 A;  4AP1 A;  1GRE A;  2X8G A;  2WS3 A;  1E1L A;  2AR8 A;  4FK1 A;  3DGZ A;  4RG3 A;  2R0P A;  4M52 A;  1EL9 A;  1XDI A;  4H4W A;  1K0I A;  4TM4 A;  1D4D A;  3G5S A;  3AYI A;  1BKW A;  4IA5 A;  2GRT A;  2WHD A;  3BI2 A;  3BI5 A;  4I59 A;  4JY2 A;  4B67 A;  2BC0 A;  2YG6 A;  3GRS A;  4AOX A;  1JNR A;  3H8I A;  1H82 A;  3ADA B;  4XWR A;  1F8R A;  4PAB A;  4JY3 A;  1NEN A;  1GRH A;  3S61 A;  5BUL A;  3VRD B;  1GES A;  1YQ3 A;  5M0Z A;  4A65 A;  1DOC A;  2Q0K A;  2Z5Y A;  2PHH A;  3OC4 A;  3SZW A;  3LJP A;  3KD9 A;  2WP9 A;  5KVH A;  4H2Q A;  4D03 A;  3NGC X;  1RSG A;  2E48 A;  2F5Z A;  2TMD A;  4YJF A;  1TDN A;  5CKU A;  2V61 A;  3CNP A;  1F8W A;  2B9X A;  1VE9 A;  3K7T A;  4II3 A;  4C74 A;  3BI4 A;  1BF3 A;  1M64 A;  4JN9 A;  1E7P A;  4WX1 A;  3SZ0 A;  4H2N A;  3GD3 A;  3VR8 A;  5HY5 A;  3CNS A;  3SFD A;  4P9S A;  2E82 A;  1F6M A;  1Q1W A;  4H4X A;  4BJZ A;  2XLR A;  2XVI A;  3NN0 X;  5FMH A;  3AE8 A;  4RSL A;  1KSU A;  4J33 A;  2XFU A;  2DU8 A;  3AD8 B;  1K4Q A;  4YWO A;  3Q9T A;  3VRA A;  1E1N A;  5JCN A;  1Q9I A;  2X3N A;  3NYC A;  3GWF A;  5BUK A;  2WBA A;  4U8J A;  5IQ4 A;  2RGJ A;  2E1M A;  4GR1 A;  1GV4 A;  2BS4 A;  2R46 A;  1EVI A;  2VOU A;  1CL0 A;  5FS6 A;  5GRT A;  2GAG B;  1PXA A;  2CVJ A;  3AYJ A;  4YSH A;  3T31 A;  4U8M A;  5J60 A;  2J3N A;  3NK0 X;  1KSS A;  2JKC A;  4CCR A;  3PO7 A;  1JRY A;  4NTD A;  5KOW A;  3ATQ A;  2XCG A;  2RAB A;  1XHC A;  1TYP A;  2VQ7 A;  1ONF A;  2VVL A;  2C3D A;  2VVL G;  1EBD A;  4QFD A;  3ZNP A;  4CY8 A;  2GB0 A;  3FPZ A;  4O5Q A;  2BK3 A;  1MOK A;  1O95 A;  1Z6L A;  1C0K A;  2GAH B;  2R9Z A;  1GSN A;  3AB1 A;  2WDR A;  3KVE A;  4BV6 A;  4USR A;  5IQ1 A;  2GR3 A;  3BHK A;  1IJH A;  4Y4M A;  4B68 A;  2OLN A;  1H7X A;  5U25 A;  2IID A;  1B8S A;  4IV9 A;  3ALJ A;  1QJD A;  1FCD A;  3P4S A;  2WP5 A;  5KNL A;  1Y56 B;  5EB4 A;  2VRL A;  2EQ9 A;  2YM2 A;  3LB8 A;  4H4T A;  2C64 A;  2C67 A;  3DJG X;  1LTX R;  3HYV A;  1N4V A;  4CY6 A;  2E4A A;  1LVL A;  3FBS A;  3T14 A;  4N9X A;  4YSZ A;  3CUK A;  2FJD A;  4GDE A;  1ZOY A;  2WPF A;  2C66 A;  4E0V A;  1PS9 A;  3AE6 A;  2ZZC A;  4J56 A;  1GRG A;  4H4V A;  3UP4 A;  3CTY A;  3L1R A;  3AYL A;  3NYF A;  1DJQ A;  1H6V A;  3WE0 A;  1N4W A;  4FDC B;  3AEA A;  5KOX A;  3DJJ A;  2GR2 A;  2OAM A;  4G6H A;  5KRQ A;  1TYT A;  4H4S A;  3ABV A;  1GPE A;  2GQF A;  3SY4 A;  3GDP A;  3QFB A;  1YQ4 A;  3KPF A;  2ARD A;  1OJA A;  2XLT A;  4TM1 A;  3V3N A;  2H89 A;  3GSI A;  4ZCD A;  3AWI A;  4YSX A;  4ZN0 A;  1H7W A;  3BHF A;  5EBK A;  1L0V A;  4A9W A;  2YR4 A;  4EIP A;  3IWA A;  4U8O A;  4XWZ A;  1N1P A;  4Z26 A;  1BGN A;  4HA6 A;  2YLX A;  4EQX A;  3QVP A;  3CNT A;  2R4E A;  1VDC A;  3UKH A;  1JRZ A;  2BCG G;  1D5T A;  3CND A;  1DJN A;  2GEW A;  2NPX A;  2XDO A;  2FJA A;  2YVG A;  3ITJ A;  3AE7 A;  2A8X A;  3NRN A;  3SZC A;  1P2E A;  1H86 A;  3SX6 A;  3Q6J A;  5BVA A;  1XPQ A;  1KDG A;  4K7Z A;  3RP8 A;  1EL7 A;  4FX9 A;  2WES A;  5KVI A;  4LII A;  4CBQ A;  4K5S A;  4OPI A;  4K8D A;  2YLZ A;  5JCM A;  3FG2 P;  5HHF A;  3F8P A;  3R9U A;  2GR0 A;  3IC9 A;  4UDQ A;  4GF7 A;  2XVJ A;  1VG9 A;  3EF6 A;  4U2T A;  1CC4 A;  3SGL A;  2C3C A;  2C70 A;  4JQ9 A;  4U8I A;  3DK4 A;  3P1W A;  4C3X A;  2ZBW A;  1CJ3 A;  2ZZB A;  5EB5 A;  5EOW A;  1YY5 A;  3W4J A;  1LPF A;  2R4J A;  5J7X A;  1REO A;  3UKL A;  3T2Z A;  4YKG A;  4YJH B;  1TRB A;  1XAN A;  1GER A;  1C0I A;  3UTG A;  3UTE A;  1Y0P A;  3BNU A;  3T2K A;  3LOV A;  3NT6 A;  4EQW A;  3NLC A;  3P9U A;  1DDO A;  1C0P A;  1MO9 A;  4H4Q A;  3EAO A;  1S3B A;  3CMM A;  3M13 A;  4BK2 A;  4TLX A;  2V3B A;  1EL8 A;  4I58 A;  1DAO A;  2C65 A;  4J31 A;  4Z2T A;  3S5W A;  3SZF A;  3QSM A;  4A6N A;  2PYX A;  4OPU A;  1K0L A;  1PXB A;  1F3P A;  4X9N A;  1H81 A;  1H83 A;  1V59 A;  4HB9 A;  3B6D A;  3K30 A;  4J2W A;  4X4J A;  3AD7 B;  3ZDN A;  2WET A;  3LAD A;  4JNA A;  4OPL A;  4YTN A;  1TDF A;  3CGD A;  1L9E A;  4NNJ A;  2FJE A;  2B7S A;  4JNQ A;  3EAN A;  1YQZ A;  1L9D A;  1PBC A;  2DKH A;  2BAB A;  2V60 A;  1CC2 A;  3AE1 A;  1FEA A;  1PBD A;  4NEW A;  1DNC A;  3AE3 A;  3HYX A;  3CPJ G;  2C7G A;  5KMS A;  1PJ7 A;  1BZL A;  1PJ5 A;  1D7Y A;  1NHS A;  1KIF A;  4YJF B;  2CFY A;  3C4A A;  1KFY A;  1PN0 A;  3EPT A;  2WU2 A;  2YG4 A;  4GRT A;  5BRT A;  4BK1 A;  1C0L A;  1YKJ A;  2WPE A;  4QFC A;  3AEF A;  1ZX9 A;  4NZH A;  3LXD A;  1PBF A;  3AD9 B;  1GAL A;  2XLP A;  1KNR A;  1JNZ A;  2BCP A;  1B37 A;  5KWF A;  5HXI A;  3V3O A;  2JAE A;  3W4I A;  2Q6U A;  1NPX A;  3NN6 X;  3VQR A;  4AOS A;  1PBE A;  4U2S A;  2Y6R A;  3I6D A;  3KU9 A;  2BS3 A;  4YTP A;  5DBJ A;  4Z43 A;  4Z24 A;  4C5O A;  4YJD A;  1CF3 A;  1QLB A;  3C96 A;  3NK1 X;  2WEU A;  1K0J A;  4KX6 A;  3SXI A;  3GYJ A;  3UKP A;  4B66 A;  4Z2U A;  4EQR A;  2QAE A;  1L9C A;  3GMB A;  3G5Q A;  1OJD A;  1IUS A;  1CBO A;  2XYO A;  2GF3 A;  2XVE A;  3LZX A;  1AOG A;  1LQT A;  4NTC A;  1CJ4 A;  2DKI A;  1IUW A;  2WU5 A;  3DK9 A;  3ICS A;  3NIX A;  3DJD A;  3AE9 A;  5JCK A;  4YKF A;  1GOS A;  3ZYX A;  2WPC A;  3O0H A;  2YWL A;  1TDE A;  1E39 A;  3D8X A;  4EIQ A;  2BRA A;  1GT8 A;  4H4R A;  4U8K A;  3UKA A;  5C2T A;  3SM8 A;  4K22 A;  3RP7 A;  3CIR A;  4TLZ A;  2VRM A;  1ZK7 A;  3ICT A;  3K7M X;  3VR9 A;  2YLR A;  1PBB A;  3JSK A;  3ISH A;  1GXF A;  1NHQ A;  2YG3 A;  3HYW A;  2JB3 A;  3UOZ A;  2V3A A;  4YJG B;  1KNP A;  1M6I A;  1GRT A;  2GH5 A;  5U63 A;  1IUT A;  4CRT A;  2HQM A;  3KKJ A;  4OPG A;  3II4 A;  2WOV A;  2OLO A;  3DME A;  2Q0L A;  2YLT A;  1S2Y A;  2JBV A;  3B3R A;  3GDN A;  2YVJ A;  3H8L A;  2AAQ A;  1KF6 A;  1JRX A;  2BC1 A;  4AT2 A;  3NHO X;  3ZNQ A; 
#chains in the Genus database with same CATH homology
 4EM4 A;  2NVK X;  2OA1 A;  4ECH A;  4ADW A;  4CNK A;  4EMW A;  5GSN A;  4Z25 A;  3QSS A;  2YR6 A;  2QCU A;  1GET A;  5JCI A;  3AEC A;  4KPR A;  2C72 A;  2VQB A;  3IF9 A;  2FBW A;  4CCQ A;  4J36 A;  4JDR A;  2BK4 A;  3AED A;  2BXS A;  3NH3 X;  5KMR A;  2XFP A;  3F8R A;  2W0H A;  1AN9 A;  4H7U A;  4UDP A;  5ER0 A;  2GMJ A;  2JK6 A;  1BGJ A;  4U8N A;  3SYI A;  4APN A;  1O5W A;  2APG A;  4Y4N A;  3UP5 A;  3BNM A;  2WOI A;  4Y4L A;  4EMJ A;  1GTH A;  2GR1 A;  3UCL A;  5M10 A;  2XFQ A;  4OPC A;  2XVH A;  3CPH G;  3IHG A;  3QJ4 A;  1E6E A;  4TM0 A;  5L46 A;  3PVC A;  2YAU A;  1NAA A;  1Q1R A;  4B63 A;  4C3Y A;  1OJC A;  4NWZ A;  4DSG A;  1JOA A;  2X50 A;  1D4C A;  1COY A;  4XXG A;  2XLS A;  3ALM A;  3G3E A;  4YJH A;  2XFN A;  1N4U A;  1FL2 A;  4IVO B;  2XLU A;  2R0G A;  2GQW A;  2B7R A;  4YSY A;  4NTE A;  3F8D A;  4A5L A;  1HYU A;  3L8K A;  1IUV A;  1NG4 A;  3DA1 A;  1CJC A;  2BS2 A;  3LZW A;  4BK3 A;  4MJW A;  1LJ1 A;  1H84 A;  4WCT A;  1DOB A;  1ZKQ A;  2VVM A;  4PAA A;  2Y6Q A;  3ZNN A;  3UOV A;  4B65 A;  4CNJ A;  3DH9 A;  1VQW A;  2GVC A;  3UOY A;  2BRY A;  3GYI A;  3KLJ A;  3IHM A;  3SQP A;  4UDR A;  2IVE A;  2BA9 A;  2IVD A;  1CC6 A;  1ZOV A;  1NHP A;  3CGE A;  4IVM B;  4YTM A;  1S3E A;  4H2P A;  3V76 A;  4A6N B;  2V6O A;  3KPK A;  4II2 A;  2R45 A;  1E1M A;  1DXL A;  4D04 A;  1GTE A;  1E1K A;  4A7A A;  1PJ6 A;  4H2R A;  2BK5 A;  3FMW A;  3AEB A;  3NNE A;  3WGT A;  3CN8 A;  2B9W A;  5CQF A;  1FEC A;  4A99 A;  2WOW A;  2ACZ A;  3T37 A;  3NYE A;  2WDQ A;  3RHA A;  2BXR A;  3UTF A;  4GCM A;  3VRB A;  1NG3 A;  2XFO A;  4U2L A;  3PS9 A;  1NDA A;  5FS7 A;  2BYB A;  3UKQ A;  4O5U A;  1S2Q A;  3DK8 A;  1D4E A;  3K7Q X;  2RGH A;  4UP3 A;  4Z2R A;  5C3J A;  2UZZ A;  1NHR A;  3C4N A;  3H4K A;  1GEU A;  1ZDL A;  2EQ8 A;  2GMH A;  2WDV A;  2WQY A;  4G74 A;  1IUX A;  3CGB A;  3UOX A;  4YXD A;  3ALL A;  1MXT A;  1GRF A;  1TDO A;  5FS9 A;  3AE4 A;  5KMP A;  2JB2 A;  4DSH A;  5TR3 A;  3AE5 A;  3GD4 A;  1GND A;  1FOH A;  3P4R A;  3NKS A;  4G9K A;  3SFE A;  3DGH A;  1PXC A;  3RNM A;  2CUL A;  3NG7 X;  4H4Y A;  2QA2 A;  1B5Q A;  3NK2 X;  1UKV G;  1PDH A;  3HZL A;  1OJT A;  1Y56 A;  1VG0 A;  1JEH A;  4ICY A;  1BWC A;  1IUU A;  3AXB A;  2AQJ A;  4A79 A;  1W4X A;  2FJB A;  2YQU A;  4ZCC A;  3QFA A;  4FK1 C;  1LQU A;  4LA1 A;  4GDP A;  2H88 A;  5IPY A;  2C4C A;  1JU2 A;  1QO8 A;  1RYI A;  1GRB A;  3GWD A;  3CPI G;  2VZ2 A;  2EQ7 A;  4OVI A;  2YVF A;  4B64 A;  1ZMD A;  2V5Z A;  4H4P A;  1ELI A;  4G73 A;  2E5V A;  4EM3 A;  1TDK A;  4LU6 A;  2YR5 A;  5KXJ A;  2B9Y A;  2C75 A;  3NTA A;  3OZ2 A;  2YM1 A;  4YT0 A;  2C73 A;  3CNJ A;  3RED A;  4AT0 A;  2RGO A;  1NEK A;  4YJG A;  2YG7 A;  3G5R A;  3NTD A;  1FEB A;  1EL5 A;  3AEE A;  2A87 A;  2E49 A;  4IA6 A;  4K2X A;  4OPT A;  3M0O A;  1DOD A;  2YLS A;  1OJ9 A;  4H4Z A;  4GUV A;  2I0Z A;  4C77 A;  3QSE A;  4H50 A;  3URH A;  1P2H A;  4U8L A;  2OAL A;  4DNA A;  4H4U A;  3RP6 A;  1F8S A;  2Q7V A;  2X8H A;  3DJE A;  2A89 A;  2E4G A;  2JB1 A;  2EQ6 A;  2X8C A;  3FIM B;  2WP6 A;  3UKF A;  3AE2 A;  4GAV A;  4B1B A;  5JCL A;  3M12 A;  4REK A;  1PHH A;  3T0K A;  4X9M A;  1ZY8 A;  1CHU A;  4OPD A;  1LV0 A;  3COX A;  3P4Q A;  3ICR A;  1VRQ B;  2QA1 A;  5HYM A;  4J34 A;  2XVF A;  5KMQ A;  4BUR A;  1ZP0 A;  5FS8 A;  4BJY A;  4Z44 A;  2O9Z A;  3D1C A;  2Z5X A;  2BAC A;  4J57 A;  2ZZ0 A;  4TM3 A;  4G6G A;  1ZMC A;  4OCG A;  2X99 A;  3T2Y A;  4NEV A;  3QVR A;  1RP0 A;  1O94 A;  1D7L A;  3GRT A;  3E1T A;  4DGK A;  4U8P A;  2CDU A;  2C76 A;  1SEZ A;  3W4K A;  3KA7 A;  1GRA A;  5LV9 A;  3ZNO A;  3UKK A;  1CJ2 A;  3UTH A;  1B4V A;  3I3L A;  3GMC A;  5U1O A;  1X31 B;  4EQS A;  4B69 A;  2TPR A;  3GYX A;  2R0C A;  2GV8 A;  3AEG A;  4GAP A;  4K5R A;  4AP3 A;  3CGC A;  4USQ A;  2B76 A;  2YLW A;  1DOE A;  2YG5 A;  3ATR A;  3P4P A;  4EMI A;  4RG4 A;  4AP1 A;  1GRE A;  2X8G A;  2WS3 A;  1E1L A;  2AR8 A;  4FK1 A;  3DGZ A;  4RG3 A;  2R0P A;  4M52 A;  1EL9 A;  1XDI A;  4H4W A;  1K0I A;  4TM4 A;  1D4D A;  3G5S A;  3AYI A;  1BKW A;  2GRT A;  2WHD A;  3BI2 A;  3BI5 A;  4IA5 A;  4I59 A;  4JY2 A;  4B67 A;  2BC0 A;  2YG6 A;  3GRS A;  4AOX A;  1JNR A;  3H8I A;  1H82 A;  3ADA B;  4XWR A;  1F8R A;  4PAB A;  4JY3 A;  1NEN A;  1GRH A;  3S61 A;  5BUL A;  3VRD B;  1GES A;  1YQ3 A;  5M0Z A;  4A65 A;  1DOC A;  2Q0K A;  2Z5Y A;  2PHH A;  3OC4 A;  3SZW A;  3LJP A;  3KD9 A;  2WP9 A;  5KVH A;  4H2Q A;  4D03 A;  3NGC X;  1RSG A;  2E48 A;  2F5Z A;  2TMD A;  4YJF A;  1TDN A;  5CKU A;  2V61 A;  3CNP A;  1F8W A;  2B9X A;  1VE9 A;  3K7T A;  4II3 A;  4C74 A;  3BI4 A;  1BF3 A;  1M64 A;  4JN9 A;  1E7P A;  4WX1 A;  3SZ0 A;  3GD3 A;  4H2N A;  3VR8 A;  5HY5 A;  3CNS A;  3SFD A;  4P9S A;  2E82 A;  1F6M A;  1Q1W A;  4H4X A;  2XLR A;  4BJZ A;  2XVI A;  3NN0 X;  5FMH A;  3AE8 A;  4RSL A;  1KSU A;  4J33 A;  2XFU A;  2DU8 A;  3AD8 B;  1K4Q A;  4YWO A;  3Q9T A;  3VRA A;  1E1N A;  5JCN A;  1Q9I A;  2X3N A;  3NYC A;  3GWF A;  5BUK A;  2WBA A;  4U8J A;  5IQ4 A;  2E1M A;  2RGJ A;  4GR1 A;  1GV4 A;  2BS4 A;  2R46 A;  1EVI A;  1CL0 A;  2VOU A;  5FS6 A;  5GRT A;  2GAG B;  1PXA A;  2CVJ A;  3AYJ A;  4YSH A;  3T31 A;  4U8M A;  5J60 A;  2J3N A;  3NK0 X;  1KSS A;  2JKC A;  4CCR A;  3PO7 A;  1JRY A;  4NTD A;  5KOW A;  3ATQ A;  2XCG A;  2RAB A;  1XHC A;  1TYP A;  2VQ7 A;  1ONF A;  2VVL A;  2C3D A;  2VVL G;  1EBD A;  4QFD A;  3ZNP A;  4CY8 A;  2GB0 A;  3FPZ A;  4O5Q A;  2BK3 A;  1MOK A;  1O95 A;  1Z6L A;  1C0K A;  2GAH B;  2R9Z A;  1GSN A;  3AB1 A;  2WDR A;  3KVE A;  4BV6 A;  4USR A;  5IQ1 A;  2GR3 A;  3BHK A;  1IJH A;  4Y4M A;  4B68 A;  2OLN A;  1H7X A;  5U25 A;  2IID A;  1B8S A;  4IV9 A;  3ALJ A;  1QJD A;  1FCD A;  3P4S A;  2WP5 A;  5KNL A;  1Y56 B;  5EB4 A;  2VRL A;  2EQ9 A;  2YM2 A;  3LB8 A;  4H4T A;  2C64 A;  2C67 A;  3DJG X;  1LTX R;  3HYV A;  1N4V A;  4CY6 A;  2E4A A;  1LVL A;  3FBS A;  3T14 A;  4N9X A;  4YSZ A;  3CUK A;  2FJD A;  4GDE A;  1ZOY A;  2WPF A;  2C66 A;  4E0V A;  1PS9 A;  3AE6 A;  2ZZC A;  4J56 A;  1GRG A;  4H4V A;  3UP4 A;  3CTY A;  3L1R A;  3AYL A;  3NYF A;  1DJQ A;  1H6V A;  3WE0 A;  1N4W A;  4FDC B;  3AEA A;  5KOX A;  3DJJ A;  2GR2 A;  2OAM A;  4G6H A;  5KRQ A;  1TYT A;  4H4S A;  3ABV A;  1GPE A;  2GQF A;  3SY4 A;  3GDP A;  3QFB A;  1YQ4 A;  3KPF A;  2ARD A;  1OJA A;  2XLT A;  4TM1 A;  3V3N A;  2H89 A;  3GSI A;  4ZCD A;  3AWI A;  4YSX A;  4ZN0 A;  1H7W A;  3BHF A;  5EBK A;  1L0V A;  4A9W A;  2YR4 A;  4EIP A;  3IWA A;  4U8O A;  4XWZ A;  1N1P A;  4Z26 A;  1BGN A;  4HA6 A;  2YLX A;  4EQX A;  3QVP A;  3CNT A;  2R4E A;  1VDC A;  3UKH A;  1JRZ A;  2BCG G;  1D5T A;  3CND A;  1DJN A;  2GEW A;  2NPX A;  2XDO A;  2FJA A;  2YVG A;  3ITJ A;  3AE7 A;  2A8X A;  3NRN A;  3SZC A;  1P2E A;  1H86 A;  3SX6 A;  3Q6J A;  5BVA A;  1XPQ A;  1KDG A;  4K7Z A;  3RP8 A;  1EL7 A;  4FX9 A;  2WES A;  5KVI A;  4LII A;  4CBQ A;  4K5S A;  4OPI A;  4K8D A;  2YLZ A;  5JCM A;  3FG2 P;  5HHF A;  3F8P A;  3R9U A;  2GR0 A;  3IC9 A;  4UDQ A;  4GF7 A;  2XVJ A;  1VG9 A;  3EF6 A;  4U2T A;  1CC4 A;  3SGL A;  2C3C A;  2C70 A;  4JQ9 A;  4U8I A;  3DK4 A;  3P1W A;  4C3X A;  2ZBW A;  1CJ3 A;  2ZZB A;  5EB5 A;  5EOW A;  1YY5 A;  3W4J A;  1LPF A;  2R4J A;  5J7X A;  1REO A;  3UKL A;  3T2Z A;  4YKG A;  4YJH B;  1TRB A;  1XAN A;  1GER A;  1C0I A;  3UTG A;  3UTE A;  1Y0P A;  3BNU A;  3T2K A;  3LOV A;  3NT6 A;  4EQW A;  3NLC A;  3P9U A;  1DDO A;  1C0P A;  1MO9 A;  4H4Q A;  3EAO A;  1S3B A;  3CMM A;  3M13 A;  4BK2 A;  4TLX A;  2V3B A;  1EL8 A;  4I58 A;  1DAO A;  2C65 A;  4J31 A;  4Z2T A;  3S5W A;  3SZF A;  3QSM A;  4A6N A;  2PYX A;  4OPU A;  1K0L A;  1PXB A;  1F3P A;  4X9N A;  1H81 A;  1H83 A;  1V59 A;  4HB9 A;  3B6D A;  3K30 A;  4J2W A;  4X4J A;  3AD7 B;  3ZDN A;  2WET A;  3LAD A;  4JNA A;  4OPL A;  4YTN A;  1TDF A;  3CGD A;  1L9E A;  4NNJ A;  2FJE A;  2B7S A;  4JNQ A;  3EAN A;  1YQZ A;  1L9D A;  1PBC A;  2BAB A;  2DKH A;  2V60 A;  1CC2 A;  3AE1 A;  1FEA A;  1PBD A;  4NEW A;  1DNC A;  3AE3 A;  3HYX A;  3CPJ G;  2C7G A;  5KMS A;  1PJ7 A;  1BZL A;  1PJ5 A;  1D7Y A;  1NHS A;  1KIF A;  4YJF B;  2CFY A;  2WU2 A;  1KFY A;  1PN0 A;  2YG4 A;  3C4A A;  3EPT A;  4GRT A;  5BRT A;  4BK1 A;  1C0L A;  1YKJ A;  2WPE A;  4QFC A;  3AEF A;  1ZX9 A;  4NZH A;  3LXD A;  1PBF A;  3AD9 B;  1GAL A;  2XLP A;  1KNR A;  1JNZ A;  2BCP A;  1B37 A;  5KWF A;  5HXI A;  3V3O A;  2JAE A;  3W4I A;  2Q6U A;  1NPX A;  3NN6 X;  3VQR A;  4AOS A;  1PBE A;  4U2S A;  2Y6R A;  3I6D A;  3KU9 A;  2BS3 A;  4YTP A;  5DBJ A;  4Z43 A;  4Z24 A;  4C5O A;  4YJD A;  1CF3 A;  1QLB A;  3C96 A;  3NK1 X;  2WEU A;  1K0J A;  4KX6 A;  3SXI A;  3GYJ A;  3UKP A;  4B66 A;  4Z2U A;  4EQR A;  2QAE A;  1L9C A;  3GMB A;  3G5Q A;  1OJD A;  1IUS A;  1CBO A;  2XYO A;  2GF3 A;  2XVE A;  3LZX A;  1AOG A;  1LQT A;  4NTC A;  1CJ4 A;  2DKI A;  1IUW A;  2WU5 A;  3DK9 A;  3ICS A;  3NIX A;  3DJD A;  3AE9 A;  5JCK A;  4YKF A;  1GOS A;  3ZYX A;  2WPC A;  3O0H A;  2YWL A;  1TDE A;  1E39 A;  3D8X A;  4EIQ A;  2BRA A;  1GT8 A;  4H4R A;  4U8K A;  3UKA A;  5C2T A;  3SM8 A;  4K22 A;  3CIR A;  3RP7 A;  4TLZ A;  2VRM A;  1ZK7 A;  3ICT A;  3K7M X;  3VR9 A;  2YLR A;  1PBB A;  3JSK A;  3ISH A;  1GXF A;  1NHQ A;  2YG3 A;  3HYW A;  2JB3 A;  3UOZ A;  2V3A A;  4YJG B;  1KNP A;  1M6I A;  1GRT A;  2GH5 A;  5U63 A;  1IUT A;  4CRT A;  2HQM A;  3KKJ A;  4OPG A;  3II4 A;  2WOV A;  2OLO A;  3DME A;  2Q0L A;  2YLT A;  1S2Y A;  2JBV A;  3B3R A;  3GDN A;  2YVJ A;  3H8L A;  2AAQ A;  1KF6 A;  1JRX A;  2BC1 A;  4AT2 A;  3NHO X;  3ZNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...