4H2NA

Crystal structure of mhpco, y270f mutant
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
370
structure length
370
Chain Sequence
b'KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKFETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 126
structure length 370
sequence length 370
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2nA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2nA01
1KF6A 1DJQA 2WETA 5ER0A 2WBAA 2BACA 1GV4A 4YT0A 2QAEA 4U8LA 2XVFA 2R4JA 1VRQB 5U63A 1H83A 3D8XA 2GQWA 2XLUA 4U2LA 2GR0A 2YG3A 2B9YA 1VDCA 5TR3A 3AECA 1B5QA 4LU6A 2WS3A 1MXTA 1H7WA 3CN8A 3P4SA 4GCMA 3C96A 2W0HA 2XLSA 1E1KA 3UKAA 1JRZA 4A6NA 2WPFA 5JCKA 2VRMA 2BC0A 3EANA 3GMCA 1VG9A 1F6MA 3NHOX 4BJYA 4FDCB 4YKGA 3REDA 4J34A 4C77A 1PBDA 4OPCA 3D1CA 4OPDA 2XYOA 3KD9A 3LJPA 4YSYA 2WP9A 3UOYA 5JCIA 2WOVA 3CPHG 1N4WA 4BV6A 1GERA 3AYLA 4NEVA 1V59A 2V61A 1E6EA 1GALA 1H84A 3I6DA 4TM1A 3CGBA 1DOEA 1H7XA 1OJAA 2EQ9A 2V6OA 3P4QA 4BK2A 3Q6JA 4AP1A 3BHFA 2R0GA 2PHHA 2DKIA 2C66A 2XVHA 4JNAA 2WU5A 1DJNA 4K5SA 4MJWA 4NZHA 4AOXA 3CGEA 3UP4A 2YG5A 3DH9A 1H82A 2OA1A 1GT8A 3FBSA 4USRA 1O94A 3BI2A 1E39A 1GTEA 2EQ8A 2Q6UA 4Z44A 1GOSA 4H4PA 1Q1WA 4U2TA 2Z5YA 3QJ4A 2VRLA 1GPEA 3AE7A 3F8PA 1JEHA 4RG3A 3DGHA 5C2TA 2YLWA 3RNMA 5KVHA 5KWFA 3EAOA 3KPFA 4J33A 1GREA 3P4RA 3OZ2A 1GRFA 1PXBA 2EQ6A 2YM1A 1YY5A 2WPCA 1OJCA 3CGCA 3DK8A 3EF6A 5HY5A 4JY2A 4EQXA 2RGJA 2WPEA 3UKKA 4C74A 3BI5A 4ZCCA 5HXIA 3BHKA 3SGLA 3NIXA 3NT6A 3S61A 3GWDA 3UTGA 3KLJA 3NK0X 4REKA 3P1WA 1TDKA 1L9DA 4I58A 3GD3A 1Q9IA 2WHDA 1CF3A 1O5WA 2FJDA 3GRTA 3IF9A 4TM0A 2YVFA 4EM3A 3AE8A 3GD4A 2GH5A 1PS9A 2X99A 1Y0PA 3F8DA 2ZZ0A 1ZY8A 3KU9A 5KVIA 3T37A 4EMJA 4EIPA 1BGJA 4J56A 4EQWA 2Z5XA 1NG3A 3L1RA 2H89A 4CCRA 4H4QA 1PJ7A 3AD9B 2GR2A 3DJDA 3Q9TA 4YSXA 1CJ4A 1PXCA 4Z24A 1ONFA 2DKHA 1KDGA 1KSSA 4X9NA 4B68A 3NN0X 2YR6A 4X4JA 2GRTA 2AAQA 2BK4A 2WDVA 3QSEA 3K7QX 3DJGX 4H4YA 2B9XA 2FJBA 1CJ3A 2GR3A 1H86A 2YR4A 4K22A 1EL7A 1ZMDA 3O0HA 1Q1RA 4GDPA 2XDOA 4IA5A 4FK1A 3G5RA 1QO8A 4O5UA 5KOWA 1E1NA 1H81A 2GVCA 3NYCA 4H2QA 2VQ7A 1TYTA 1GSNA 3ZYXA 2R0CA 1DOBA 2Q0LA 1JNZA 1B37A 1TRBA 2VVMA 3UOVA 1NENA 5L46A 4GF7A 2YWLA 2CVJA 4U8KA 1H6VA 3B6DA 1ZK7A 3V76A 3NGCX 3SM8A 4APNA 4H4VA 1GETA 3ADAB 1NHRA 2YG7A 2BS2A 5FS7A 2GMJA 3DK4A 5M0ZA 1TDEA 1Z6LA 2ZZCA 3ABVA 2GR1A 3AE5A 1D4EA 4J2WA 2WESA 3QVPA 4H4RA 2XVIA 4YXDA 4BK1A 2O9ZA 2E4GA 3P9UA 1FEBA 2JB1A 1M64A 1OJTA 3AEGA 4TLXA 4GUVA 4CNKA 4H50A 1UKVG 3NK1X 4NTDA 3I3LA 1KNPA 4BJZA 2JK6A 3BNUA 3VRBA 1JNRA 1N4VA 4FK1C 1KFYA 2RGHA 3AEBA 4B64A 1CJCA 3NTAA 3AB1A 2GQFA 1PHHA 2GMHA 1IUVA 1PBEA 4AT0A 1GRAA 1GRGA 1AOGA 3ICTA 1TYPA 3QVRA 2XCGA 2C67A 3NTDA 3S5WA 3AWIA 4WCTA 3RP8A 3DGZA 4RSLA 4U8JA 1YKJA 2WP5A 5C3JA 2AR8A 2VZ2A 4KX6A 1DXLA 2A89A 2Y6QA 4GDEA 1P2HA 3WE0A 5HHFA 4OPLA 2BCPA 4U2SA 4YSHA 2YG6A 4P9SA 2B9WA 4JY3A 3QSMA 2XLRA 2BXRA 1LQTA 2JAEA 4YKFA 4AT2A 1K0IA 1B4VA 3PS9A 4LA1A 3UKHA 4B1BA 4EM4A 1JOAA 5EOWA 2BS3A 1TDFA 4RG4A 2XFNA 3PVCA 2OAMA 3G5SA 1DOCA 1L9CA 4YWOA 3ZDNA 4GR1A 1F8WA 1D5TA 4WX1A 2ARDA 2QCUA 4CY6A 4IV9A 1QJDA 1F3PA 1PN0A 4IVOB 3K7MX 2WU2A 2C73A 3QSSA 4U8NA 3RP6A 4H2NA 1GTHA 3AD8B 1Y56B 1D7LA 5IPYA 2IIDA 1F8SA 1PJ6A 5J60A 5BUKA 1B8SA 3AYIA 4OPUA 2JB2A 1NDAA 4ZN0A 3FIMB 2BABA 1BKWA 2Q7VA 2I0ZA 4I59A 4LIIA 3ATRA 3SFEA 5BRTA 4TLZA 1SEZA 1OJ9A 1PBFA 1LJ1A 1IUXA 1LV0A 5EBKA 2E5VA 1EBDA 1DODA 2R0PA 2C70A 3ATQA 1IUSA 1IUWA 1E7PA 3AE9A 1D4CA 1NHQA 4A9WA 5FS9A 1GRTA 3CIRA 4AOSA 1YQ3A 2GAGB 3CPJG 1RSGA 4U8MA 4ECHA 1CC4A 2VVLA 5DBJA 4ZCDA 1XHCA 4N9XA 3ITJA 1LVLA 4JQ9A 2BXSA 1S3BA 2X8CA 4IA6A 2XLPA 5U1OA 2VVLG 1RP0A 4K7ZA 3DJEA 2EQ7A 3URHA 5GRTA 4CY8A 4Z43A 1HYUA 4YTNA 4Z2RA 3IHGA 3NN6X 4YSZA 2RABA 2C7GA 3KVEA 4DSHA 3QFBA 2YVJA 3AEFA 3VR9A 1D4DA 1PBCA 5CKUA 3V3OA 2YLSA 3GMBA 4A5LA 4C3YA 5KXJA 3NG7X 2APGA 3LZXA 3OC4A 4JNQA 3NYEA 3FMWA 4Z26A 1NPXA 3SQPA 2X50A 3DA1A 2B76A 1EL5A 1ZKQA 3AXBA 4XWRA 4DNAA 1GNDA 1IUTA 2X8HA 2WQYA 4B63A 5LV9A 1M6IA 2UZZA 5BVAA 3HZLA 2NVKX 3ICSA 4OPGA 4GRTA 3V3NA 1K0JA 5HYMA 1GEUA 2IVEA 2GV8A 4XWZA 4A7AA 2YLTA 3AD7B 4K8DA 3LADA 5JCMA 2YM2A 4Z2TA 3VQRA 1VQWA 3NH3X 2CFYA 2GB0A 1IUUA 3AE6A 2QA1A 3NLCA 4KPRA 2XFUA 4M52A 1YQZA 4IVMB 2XFPA 4J36A 5M10A 3LZWA 3II4A 2BK5A 4K5RA 2JB3A 2YQUA 2BS4A 1YQ4A 4A6NB 1FECA 5EB5A 4DSGA 2B7RA 4H4XA 1ZDLA 5FS6A 4UDRA 3CNJA 5FMHA 3ALJA 4O5QA 1KSUA 1K4QA 2XVJA 3H4KA 4EQSA 3QFAA 2Y6RA 1L0VA 3AYJA 4H4UA 1JU2A 3IHMA 4D03A 4EMWA 1GXFA 2CULA 1JRXA 4EMIA 2YG4A 1BZLA 1FEAA 1O95A 3AE2A 2XFOA 1CHUA 3M12A 4OCGA 4PAAA 4K2XA 1ZOVA 3EPTA 3P4PA 4E0VA 2YVGA 2BC1A 3UOZA 1LQUA 2ZBWA 2A87A 3GSIA 4Y4LA 3B3RA 5CQFA 1ZMCA 4B65A 2YAUA 1EL8A 4CCQA 3JSKA 3CTYA 3K7TA 2X8GA 1LPFA 2PYXA 2R45A 3C4NA 4J31A 4U8IA 2FJEA 4H2PA 4TM3A 5BULA 5IQ1A 3FPZA 3H8IA 3GYJA 5KOXA 4U8PA 4X9MA 5GSNA 2E1MA 4PABA 3GRSA 4NTEA 1MO9A 3CNPA 4ADWA 1PXAA 3LB8A 1S3EA 1NHSA 3NKSA 4H4SA 2XVEA 4B66A 2GF3A 1JRYA 3BNMA 4ICYA 4J57A 4UP3A 2BA9A 5J7XA 2GAHB 2R9ZA 4EIQA 4Y4MA 3UOXA 3GDNA 2BK3A 3NNEA 3GWFA 1CJ2A 4C5OA 5KRQA 1E1MA 2WOIA 3CNTA 4NEWA 1NAAA 3L8KA 2X3NA 2V3BA 3UTEA 1ZP0A 3UTHA 3ALMA 3AE4A 2C64A 1K0LA 3LOVA 4H2RA 2C76A 1DNCA 2OLNA 3DMEA 1N1PA 2QA2A 4YTPA 1FOHA 4H4ZA 1NEKA 3FG2P 4OVIA 4FX9A 3AEEA 3KA7A 4UDPA 2C75A 2XFQA 2TPRA 1X31B 4CRTA 5JCNA 2F5ZA 2XLTA 1Y56A 3GDPA 1EL9A 4B67A 4A79A 4YTMA 4A99A 4DGKA 3UKQA 3H8LA 1ELIA 1PDHA 3SFDA 3KKJA 4CNJA 1ZX9A 3G5QA 1MOKA 2AQJA 2WDQA 2R46A 2YLZA 2GEWA 3AEDA 1F8RA 2ACZA 3CPIG 1ZOYA 3GYIA 3AE1A 3C4AA 3AEAA 3NRNA 4OPTA 3UCLA 3UTFA 2Q0KA 4HA6A 5IQ4A 2C65A 2BCGG 4JN9A 1PJ5A 3DJJA 1RYIA 4C3XA 3VRDB 1W4XA 4XXGA 4D04A 1TDNA 1TDOA 3CNDA 4USQA 1NHPA 3BI4A 2YR5A 3UP5A 4UDQA 2C3CA 1QLBA 1GESA 1CL0A 4OPIA 1XANA 4NTCA 2WOWA 1REOA 2V3AA 1COYA 1VG0A 2V5ZA 1OJDA 5EB4A 1CC2A 4Z25A 1CBOA 1BWCA 2V60A 3UKLA 2OLOA 4A65A 4H4TA 2CDUA 1FL2A 1NG4A 2A8XA 2WP6A 4H7UA 4BK3A 4EQRA 2JKCA 4CBQA 2VOUA 4BURA 1N4UA 2C72A 3ICRA 1D7YA 2VQBA 2H88A 1GRHA 2NPXA 3E1TA 3RP7A 4Z2UA 3DK9A 4Y4NA 3CGDA 3M13A 3UKPA 3VR8A 5JCLA 1LTXR 1XPQA 1KNRA 4TM4A 3ISHA 3IC9A 2BYBA 3PO7A 1BGNA 1S2YA 3LXDA 1CC6A 2FJAA 2JBVA 1E1LA 2YLXA 5U25A 4AP3A 1S2QA 3CNSA 3IWAA 2RGOA 1FCDA 2TMDA 4B69A 3UKFA 1P2EA 4U8OA 3RHAA 2FBWA 3F8RA 1PBBA 3NK2X 2YLRA 3K30A 1IJHA 3VRAA 4HB9A 3M0OA 2J3NA 4JDRA 3R9UA 3COXA 1BF3A 3ALLA 2B7SA 2WDRA 1XDIA 3AE3A 2IVDA 2C3DA 3NYFA 2ZZBA 4H4WA 1GRBA 2OALA 5FS8A 2WEUA 2HQMA 1L9EA 2R4EA
chains in the Genus database with same CATH superfamily
1KF6A 1C0IA 1DJQA 1KIFA 2WETA 2WBAA 5ER0A 2BACA 1GV4A 4YT0A 2QAEA 4U8LA 2XVFA 2R4JA 1VRQB 5U63A 1H83A 3D8XA 2GQWA 2XLUA 4U2LA 3T0KA 2GR0A 2YG3A 2B9YA 1VDCA 5TR3A 3AECA 1B5QA 4LU6A 2WS3A 1MXTA 1H7WA 3CN8A 3P4SA 4GCMA 3C96A 2W0HA 2XLSA 1E1KA 3UKAA 1JRZA 4A6NA 2WPFA 5JCKA 2VRMA 2BC0A 4BJYA 3GMCA 1VG9A 1F6MA 3EANA 3NHOX 4FDCB 4YKGA 3REDA 4J34A 4C77A 1PBDA 4OPCA 3D1CA 4OPDA 2XYOA 3KD9A 3LJPA 4YSYA 2WP9A 3UOYA 5JCIA 2WOVA 3CPHG 1N4WA 4BV6A 1GERA 3AYLA 4NEVA 1V59A 2V61A 1E6EA 1GALA 1H84A 3I6DA 4TM1A 3CGBA 1DOEA 1H7XA 1OJAA 2EQ9A 2V6OA 4BK2A 3P4QA 3Q6JA 4AP1A 3BHFA 2R0GA 2PHHA 2DKIA 2C66A 2XVHA 4JNAA 2WU5A 1DJNA 4K5SA 4MJWA 4NZHA 1C0LA 4AOXA 3CGEA 3UP4A 2YG5A 3DH9A 1H82A 2OA1A 1GT8A 3FBSA 4USRA 1O94A 3BI2A 1E39A 1GTEA 2EQ8A 2Q6UA 4Z44A 1GOSA 4H4PA 1Q1WA 4U2TA 2Z5YA 3QJ4A 2VRLA 1GPEA 3AE7A 3F8PA 1JEHA 4RG3A 3DGHA 5C2TA 2YLWA 3RNMA 5KVHA 5KWFA 3EAOA 3KPFA 4J33A 1GREA 3P4RA 3OZ2A 1PXBA 1GRFA 2EQ6A 2YM1A 1YY5A 2WPCA 1OJCA 3CGCA 3DK8A 3EF6A 5HY5A 4JY2A 4EQXA 2RGJA 2WPEA 3UKKA 4C74A 3BI5A 4ZCCA 3BHKA 3SGLA 5HXIA 3NIXA 3NT6A 3S61A 3GWDA 3UTGA 3KLJA 3NK0X 4REKA 3P1WA 1TDKA 1L9DA 4I58A 5KMQA 3T14A 3GD3A 1Q9IA 2WHDA 1CF3A 2E49A 3IF9A 1O5WA 2FJDA 3GRTA 4TM0A 2YVFA 4EM3A 3AE8A 3GD4A 2GH5A 1PS9A 2X99A 1Y0PA 3F8DA 2ZZ0A 1ZY8A 3KU9A 5KVIA 3T37A 4EMJA 4EIPA 1BGJA 4J56A 3T31A 3W4KA 4EQWA 2Z5XA 1NG3A 3L1RA 2H89A 4CCRA 4H4QA 1PJ7A 3AD9B 3DJDA 1DDOA 2GR2A 3Q9TA 4YSXA 1CJ4A 1PXCA 4Z24A 1ONFA 2DKHA 1KDGA 1KSSA 4X9NA 4B68A 3NN0X 2YR6A 4X4JA 2GRTA 2AAQA 2BK4A 2WDVA 3QSEA 3K7QX 3DJGX 4H4YA 2B9XA 2FJBA 1CJ3A 2GR3A 1H86A 2YR4A 4K22A 1EL7A 1ZMDA 3O0HA 2BRAA 1Q1RA 4GDPA 4IA5A 2XDOA 4FK1A 3G5RA 1QO8A 4O5UA 5KOWA 4YJGA 3NYCA 1E1NA 1H81A 2GVCA 4H2QA 2VQ7A 1TYTA 1GSNA 3T2KA 3ZYXA 2R0CA 1DOBA 2Q0LA 1JNZA 1B37A 1TRBA 2VVMA 3UOVA 1NENA 5L46A 4G6HA 3SZFA 4GF7A 2YWLA 2CVJA 4U8KA 1H6VA 3B6DA 1ZK7A 3V76A 3NGCX 3SM8A 4APNA 4H4VA 3ADAB 1GETA 1NHRA 2YG7A 2BS2A 5FS7A 2GMJA 3DK4A 5M0ZA 1TDEA 1Z6LA 2ZZCA 3ABVA 2GR1A 3AE5A 1D4EA 4J2WA 3SYIA 2WESA 3QVPA 4H4RA 2XVIA 4YXDA 4BK1A 2O9ZA 1C0PA 3HYXA 2E4GA 3P9UA 1FEBA 2JB1A 1M64A 1OJTA 3AEGA 4TLXA 4GUVA 4CNKA 4H50A 4YJHA 4YJFA 1UKVG 3NK1X 4NTDA 5KMSA 3I3LA 1KNPA 4BJZA 2JK6A 3BNUA 3VRBA 1JNRA 1N4VA 4FK1C 2RGHA 1KFYA 3AEBA 4B64A 1CJCA 3NTAA 3AB1A 2GQFA 1PHHA 4NNJA 2GMHA 1IUVA 1PBEA 4AT0A 1GRAA 1GRGA 1AOGA 3ICTA 1TYPA 3QVRA 2XCGA 2C67A 3NTDA 3S5WA 3AWIA 4WCTA 3RP8A 4RSLA 3DGZA 4U8JA 1YKJA 2WP5A 5C3JA 2AR8A 2VZ2A 4KX6A 1DXLA 2A89A 2Y6QA 4GDEA 1P2HA 3WE0A 5HHFA 4OPLA 4YSHA 2BCPA 4U2SA 2YG6A 4P9SA 2B9WA 3QSMA 4JY3A 2XLRA 2BXRA 1LQTA 2JAEA 4YKFA 4AT2A 1K0IA 1B4VA 3PS9A 5KMRA 4LA1A 3UKHA 4B1BA 4EM4A 1JOAA 5EOWA 2BS3A 1TDFA 3T2YA 4G9KA 4RG4A 2XFNA 3PVCA 2OAMA 3G5SA 1DOCA 1VE9A 3CUKA 1L9CA 4YWOA 3ZDNA 4GR1A 1F8WA 1D5TA 4WX1A 2ARDA 2QCUA 4CY6A 4IV9A 4G74A 1QJDA 1PN0A 1F3PA 4IVOB 3K7MX 2WU2A 2C73A 3QSSA 4U8NA 3RP6A 4H2NA 1GTHA 3AD8B 1Y56B 1D7LA 5IPYA 2IIDA 1F8SA 1PJ6A 5J60A 3SY4A 5BUKA 1B8SA 2BRYA 3AYIA 4OPUA 2JB2A 1NDAA 4ZN0A 3FIMB 2BABA 1BKWA 2Q7VA 2I0ZA 4I59A 4LIIA 3ATRA 3SFEA 5BRTA 4TLZA 1SEZA 1PBFA 1OJ9A 1LJ1A 1IUXA 1LV0A 5EBKA 2E5VA 1EBDA 1DODA 2R0PA 2C70A 3ATQA 5KMPA 1IUSA 1IUWA 1E7PA 3AE9A 1D4CA 1NHQA 4A9WA 5FS9A 1GRTA 3CIRA 4AOSA 1YQ3A 2GAGB 3CPJG 1RSGA 4U8MA 4ECHA 1CC4A 2VVLA 5DBJA 4ZCDA 1XHCA 4N9XA 3ITJA 1LVLA 4JQ9A 4IA6A 1S3BA 2BXSA 2X8CA 2XLPA 5U1OA 2VVLG 1RP0A 3HYVA 4K7ZA 3DJEA 2EQ7A 3URHA 5GRTA 4CY8A 4Z43A 1HYUA 4YTNA 4Z2RA 3IHGA 3NN6X 4YSZA 2RABA 2C7GA 4G6GA 3KVEA 4DSHA 3QFBA 2YVJA 3AEFA 1EVIA 3VR9A 1D4DA 1PBCA 5CKUA 3V3OA 2YLSA 3GMBA 4G73A 4A5LA 4C3YA 3NG7X 5KXJA 3SX6A 2APGA 3LZXA 3OC4A 4JNQA 3NYEA 3FMWA 4II2A 4Z26A 1NPXA 3SQPA 2X50A 3DA1A 3ZNNA 2B76A 4GAVA 1EL5A 1ZKQA 3SZWA 3AXBA 4XWRA 4DNAA 1GNDA 1IUTA 2X8HA 2WQYA 4B63A 5LV9A 1M6IA 2UZZA 5BVAA 3HZLA 2NVKX 3ZNQA 3ICSA 4OPGA 4GRTA 3V3NA 1K0JA 5HYMA 1GEUA 2IVEA 4XWZA 2GV8A 4A7AA 3AD7B 2YLTA 4K8DA 3LADA 4YJFB 5JCMA 2YM2A 4Z2TA 3VQRA 1VQWA 3NH3X 2CFYA 2GB0A 1IUUA 3AE6A 2QA1A 3NLCA 4KPRA 2XFUA 4M52A 1YQZA 4IVMB 2XFPA 4J36A 5M10A 3LZWA 3II4A 2BK5A 4K5RA 2JB3A 2YQUA 2BS4A 1YQ4A 4A6NB 1FECA 5EB5A 4DSGA 2B7RA 4H4XA 1ZDLA 3HYWA 5FS6A 4UDRA 3CNJA 5FMHA 3ALJA 4O5QA 1KSUA 1K4QA 2XVJA 3H4KA 4EQSA 3QFAA 3W4IA 2Y6RA 1L0VA 4QFCA 3AYJA 4H4UA 1JU2A 3IHMA 4D03A 4EMWA 1GXFA 2CULA 1JRXA 4EMIA 2YG4A 1BZLA 1FEAA 3M12A 4QFDA 1O95A 1CHUA 4PAAA 2XFOA 3AE2A 4OCGA 4K2XA 3SZCA 1ZOVA 3EPTA 3P4PA 4E0VA 2YVGA 2BC1A 3UOZA 1LQUA 2ZBWA 2A87A 3GSIA 4Y4LA 3B3RA 5CQFA 1ZMCA 4B65A 2YAUA 1EL8A 3ZNPA 4CCQA 3JSKA 3CTYA 3K7TA 2X8GA 1LPFA 2PYXA 2R45A 3C4NA 4J31A 4U8IA 2FJEA 4H2PA 4TM3A 5BULA 5IQ1A 3FPZA 3H8IA 3GYJA 5KOXA 4U8PA 4X9MA 5GSNA 2E1MA 4PABA 3GRSA 4NTEA 1MO9A 3CNPA 4ADWA 1PXAA 3LB8A 1S3EA 1NHSA 3NKSA 4H4SA 4NWZA 2XVEA 4B66A 2GF3A 1JRYA 3BNMA 4ICYA 4J57A 4UP3A 2BA9A 5J7XA 2GAHB 2R9ZA 4EIQA 4Y4MA 3UOXA 3GDNA 3KPKA 2BK3A 3NNEA 3GWFA 1CJ2A 4C5OA 5KRQA 1E1MA 2WOIA 3CNTA 4NEWA 1NAAA 3L8KA 2X3NA 2V3BA 3UTEA 1ZP0A 3W4JA 3UTHA 3ALMA 3AE4A 1DAOA 4YJDA 1K0LA 2E82A 4H2RA 2C64A 1AN9A 2C76A 3LOVA 1DNCA 2OLNA 3DMEA 1N1PA 2QA2A 4YTPA 1FOHA 4H4ZA 1NEKA 3FG2P 4OVIA 4FX9A 3G3EA 3AEEA 3KA7A 5KNLA 4UDPA 2C75A 2XFQA 2TPRA 1X31B 4CRTA 5JCNA 2E4AA 2F5ZA 2XLTA 3T2ZA 1Y56A 3GDPA 1EL9A 4B67A 4A79A 4YTMA 4A99A 4DGKA 3UKQA 3H8LA 1ELIA 1PDHA 3SFDA 3KKJA 4CNJA 1ZX9A 3G5QA 1MOKA 2AQJA 2WDQA 2R46A 2YLZA 2GEWA 3AEDA 2E48A 1F8RA 2ACZA 3CPIG 1ZOYA 3GYIA 3C4AA 3AE1A 3AEAA 3NRNA 4OPTA 3UCLA 3UTFA 2Q0KA 4HA6A 3ZNOA 4YJGB 5IQ4A 2C65A 2BCGG 4JN9A 3CMMA 1PJ5A 3DJJA 1RYIA 4C3XA 3VRDB 1W4XA 4XXGA 4D04A 1TDNA 1TDOA 3CNDA 4USQA 1NHPA 3BI4A 2YR5A 3UP5A 4UDQA 2C3CA 1QLBA 1GESA 1CL0A 4OPIA 1XANA 4NTCA 2WOWA 1REOA 2V3AA 1COYA 1VG0A 2V5ZA 1OJDA 5EB4A 1CC2A 4Z25A 1CBOA 1BWCA 2V60A 4GAPA 2OLOA 3UKLA 4A65A 2DU8A 4H4TA 2CDUA 1FL2A 1NG4A 4BK3A 2A8XA 2WP6A 4H7UA 4EQRA 2JKCA 4CBQA 2VOUA 4BURA 1N4UA 2C72A 3SZ0A 3ICRA 1D7YA 2VQBA 2H88A 3RP7A 1GRHA 3E1TA 2NPXA 4Z2UA 3DK9A 4Y4NA 3CGDA 3M13A 4YJHB 3UKPA 3VR8A 5JCLA 1C0KA 1LTXR 1XPQA 3WGTA 1KNRA 4TM4A 3ISHA 3IC9A 2BYBA 3PO7A 1BGNA 1S2YA 3LXDA 1CC6A 2FJAA 2JBVA 1E1LA 2YLXA 5U25A 4AP3A 1S2QA 3CNSA 3IWAA 2RGOA 1FCDA 2TMDA 4B69A 3UKFA 1P2EA 4U8OA 3RHAA 2FBWA 3F8RA 1PBBA 3NK2X 3SXIA 2YLRA 3K30A 1IJHA 3VRAA 4HB9A 4II3A 3M0OA 2J3NA 4JDRA 3R9UA 3COXA 1BF3A 3ALLA 2B7SA 2C4CA 2WDRA 1XDIA 3AE3A 2IVDA 2C3DA 3NYFA 3GYXA 2ZZBA 4H4WA 1GRBA 2OALA 5FS8A 2WEUA 2HQMA 1L9EA 2R4EA
chains in the Genus database with same CATH topology
1KF6A 1DJQA 2WETA 5ER0A 2WBAA 2BACA 1GV4A 4YT0A 2QAEA 4U8LA 2XVFA 2R4JA 1VRQB 5U63A 1H83A 3D8XA 2GQWA 2XLUA 4U2LA 3T0KA 2GR0A 2YG3A 2B9YA 1VDCA 5TR3A 3AECA 1B5QA 4LU6A 2WS3A 1MXTA 1H7WA 3CN8A 3P4SA 4GCMA 3C96A 2W0HA 2XLSA 1E1KA 3UKAA 1JRZA 4A6NA 2WPFA 5JCKA 2VRMA 2BC0A 4BJYA 3GMCA 1VG9A 1F6MA 3EANA 3NHOX 4FDCB 4YKGA 3REDA 4J34A 4C77A 1PBDA 4OPCA 3D1CA 4OPDA 2XYOA 3KD9A 3LJPA 4YSYA 2WP9A 3UOYA 5JCIA 2WOVA 3CPHG 1N4WA 4BV6A 1GERA 3AYLA 4NEVA 1V59A 2V61A 1E6EA 1GALA 1H84A 3I6DA 4TM1A 3CGBA 1DOEA 1H7XA 1OJAA 2EQ9A 2V6OA 4BK2A 3P4QA 3Q6JA 4AP1A 3BHFA 2R0GA 2PHHA 2DKIA 2C66A 2XVHA 4JNAA 2WU5A 1DJNA 4K5SA 4MJWA 4NZHA 4AOXA 3CGEA 3UP4A 2YG5A 3DH9A 1H82A 2OA1A 1GT8A 3FBSA 4USRA 1O94A 3BI2A 1E39A 1GTEA 2EQ8A 2Q6UA 4Z44A 1GOSA 4H4PA 1Q1WA 4U2TA 2Z5YA 3QJ4A 2VRLA 1GPEA 3AE7A 3F8PA 1JEHA 4RG3A 3DGHA 5C2TA 2YLWA 3RNMA 5KVHA 5KWFA 3EAOA 3KPFA 4J33A 1GREA 3P4RA 3OZ2A 1GRFA 1PXBA 2EQ6A 2YM1A 1YY5A 2WPCA 1OJCA 3CGCA 3DK8A 3EF6A 5HY5A 4JY2A 4EQXA 2RGJA 2WPEA 3UKKA 4C74A 3BI5A 4ZCCA 5HXIA 3BHKA 3SGLA 3NIXA 3NT6A 3S61A 3GWDA 3UTGA 3KLJA 3NK0X 4REKA 3P1WA 1TDKA 1L9DA 4I58A 5KMQA 3T14A 3GD3A 1Q9IA 2WHDA 1CF3A 1O5WA 2FJDA 3GRTA 3IF9A 4TM0A 2YVFA 4EM3A 3AE8A 3GD4A 2GH5A 1PS9A 2X99A 1Y0PA 3F8DA 2ZZ0A 1ZY8A 3KU9A 5KVIA 3T37A 4EMJA 4EIPA 1BGJA 4J56A 3T31A 4EQWA 2Z5XA 1NG3A 3L1RA 2H89A 4CCRA 4H4QA 1PJ7A 3AD9B 2GR2A 3DJDA 3Q9TA 4YSXA 1CJ4A 1PXCA 4Z24A 1ONFA 2DKHA 1KDGA 1KSSA 4X9NA 4B68A 3NN0X 2YR6A 4X4JA 2GRTA 2AAQA 2BK4A 2WDVA 3QSEA 3K7QX 3DJGX 4H4YA 2B9XA 2FJBA 1CJ3A 2GR3A 1H86A 2YR4A 4K22A 1EL7A 1ZMDA 3O0HA 2BRAA 1Q1RA 4GDPA 4IA5A 2XDOA 4FK1A 3G5RA 1QO8A 4O5UA 5KOWA 1E1NA 1H81A 2GVCA 3NYCA 4H2QA 2VQ7A 1TYTA 1GSNA 3T2KA 3ZYXA 2R0CA 1DOBA 2Q0LA 1JNZA 1B37A 1TRBA 2VVMA 3UOVA 1NENA 4G6HA 3SZFA 5L46A 4GF7A 2YWLA 2CVJA 4U8KA 1H6VA 3B6DA 1ZK7A 3V76A 3NGCX 3SM8A 4APNA 4H4VA 1GETA 3ADAB 1NHRA 2YG7A 2BS2A 5FS7A 2GMJA 3DK4A 5M0ZA 1TDEA 1Z6LA 2ZZCA 3ABVA 2GR1A 3AE5A 1D4EA 4J2WA 3SYIA 2WESA 3QVPA 4H4RA 2XVIA 4YXDA 4BK1A 2O9ZA 3HYXA 2E4GA 3P9UA 1FEBA 2JB1A 1M64A 1OJTA 3AEGA 4TLXA 4GUVA 4CNKA 4H50A 1UKVG 3NK1X 4NTDA 5KMSA 3I3LA 1KNPA 4BJZA 2JK6A 3BNUA 3VRBA 1JNRA 1N4VA 4FK1C 1KFYA 2RGHA 3AEBA 4B64A 1CJCA 3NTAA 3AB1A 2GQFA 1PHHA 4NNJA 2GMHA 1IUVA 1PBEA 4AT0A 1GRAA 1GRGA 1AOGA 3ICTA 1TYPA 3QVRA 2XCGA 2C67A 3NTDA 3S5WA 3AWIA 4WCTA 3RP8A 3DGZA 4RSLA 4U8JA 1YKJA 2WP5A 5C3JA 2AR8A 2VZ2A 4KX6A 1DXLA 2A89A 2Y6QA 4GDEA 1P2HA 3WE0A 5HHFA 4OPLA 2BCPA 4U2SA 4YSHA 2YG6A 4P9SA 2B9WA 4JY3A 3QSMA 2XLRA 2BXRA 1LQTA 2JAEA 4YKFA 4AT2A 1K0IA 1B4VA 3PS9A 5KMRA 4LA1A 3UKHA 4B1BA 4EM4A 1JOAA 5EOWA 2BS3A 1TDFA 3T2YA 4G9KA 4RG4A 2XFNA 3PVCA 2OAMA 3G5SA 1DOCA 1L9CA 4YWOA 3ZDNA 4GR1A 1F8WA 1D5TA 4WX1A 2ARDA 2QCUA 4CY6A 4IV9A 4G74A 1QJDA 1F3PA 1PN0A 4IVOB 3K7MX 2WU2A 2C73A 3QSSA 4U8NA 3RP6A 4H2NA 1GTHA 3AD8B 1Y56B 1D7LA 5IPYA 2IIDA 1F8SA 1PJ6A 5J60A 3SY4A 5BUKA 1B8SA 2BRYA 3AYIA 4OPUA 2JB2A 1NDAA 4ZN0A 3FIMB 2BABA 1BKWA 2Q7VA 2I0ZA 4I59A 4LIIA 3ATRA 3SFEA 5BRTA 4TLZA 1SEZA 1OJ9A 1PBFA 1LJ1A 1IUXA 1LV0A 5EBKA 2E5VA 1EBDA 1DODA 2R0PA 2C70A 3ATQA 5KMPA 1IUSA 1IUWA 1E7PA 3AE9A 1D4CA 1NHQA 4A9WA 5FS9A 1GRTA 3CIRA 4AOSA 1YQ3A 2GAGB 3CPJG 1RSGA 4U8MA 4ECHA 1CC4A 2VVLA 5DBJA 4ZCDA 1XHCA 4N9XA 3ITJA 1LVLA 4JQ9A 4IA6A 1S3BA 2BXSA 2X8CA 2XLPA 5U1OA 2VVLG 1RP0A 3HYVA 4K7ZA 3DJEA 2EQ7A 3URHA 5GRTA 4CY8A 4Z43A 1HYUA 4YTNA 4Z2RA 3IHGA 3NN6X 4YSZA 2RABA 2C7GA 4G6GA 3KVEA 4DSHA 3QFBA 2YVJA 3AEFA 3VR9A 1D4DA 1PBCA 5CKUA 3V3OA 2YLSA 3GMBA 4G73A 4A5LA 4C3YA 3NG7X 5KXJA 3SX6A 2APGA 3LZXA 3OC4A 4JNQA 3NYEA 3FMWA 4II2A 4Z26A 1NPXA 3SQPA 2X50A 3DA1A 2B76A 4GAVA 1EL5A 1ZKQA 3SZWA 3AXBA 4XWRA 4DNAA 1GNDA 1IUTA 2X8HA 2WQYA 4B63A 5LV9A 1M6IA 2UZZA 5BVAA 3HZLA 2NVKX 3ICSA 4OPGA 4GRTA 3V3NA 1K0JA 5HYMA 1GEUA 2IVEA 2GV8A 4XWZA 4A7AA 2YLTA 3AD7B 4K8DA 3LADA 5JCMA 2YM2A 4Z2TA 3VQRA 1VQWA 3NH3X 2CFYA 2GB0A 1IUUA 3AE6A 2QA1A 3NLCA 4KPRA 2XFUA 4M52A 1YQZA 4IVMB 2XFPA 4J36A 5M10A 3LZWA 3II4A 2BK5A 4K5RA 2JB3A 2YQUA 2BS4A 1YQ4A 4A6NB 1FECA 5EB5A 4DSGA 2B7RA 4H4XA 1ZDLA 3HYWA 5FS6A 4UDRA 3CNJA 5FMHA 3ALJA 4O5QA 1KSUA 1K4QA 2XVJA 3H4KA 4EQSA 3QFAA 2Y6RA 1L0VA 3AYJA 4H4UA 1JU2A 3IHMA 4D03A 4EMWA 1GXFA 2CULA 1JRXA 4EMIA 2YG4A 1BZLA 1FEAA 1O95A 3AE2A 2XFOA 1CHUA 3M12A 4OCGA 4PAAA 4K2XA 3SZCA 1ZOVA 3EPTA 3P4PA 4E0VA 2YVGA 2BC1A 3UOZA 1LQUA 2ZBWA 2A87A 3GSIA 4Y4LA 3B3RA 5CQFA 1ZMCA 4B65A 2YAUA 1EL8A 4CCQA 3JSKA 3CTYA 3K7TA 2X8GA 1LPFA 2PYXA 2R45A 3C4NA 4J31A 4U8IA 2FJEA 4H2PA 4TM3A 5BULA 5IQ1A 3FPZA 3H8IA 3GYJA 5KOXA 4U8PA 4X9MA 5GSNA 2E1MA 4PABA 3GRSA 4NTEA 1MO9A 3CNPA 4ADWA 1PXAA 3LB8A 1S3EA 1NHSA 3NKSA 4H4SA 4NWZA 2XVEA 4B66A 2GF3A 1JRYA 3BNMA 4ICYA 4J57A 4UP3A 2BA9A 5J7XA 2GAHB 2R9ZA 4EIQA 4Y4MA 3UOXA 3GDNA 3KPKA 2BK3A 3NNEA 3GWFA 1CJ2A 4C5OA 5KRQA 1E1MA 2WOIA 3CNTA 4NEWA 1NAAA 3L8KA 2X3NA 2V3BA 3UTEA 1ZP0A 3UTHA 3ALMA 3AE4A 2C64A 1K0LA 3LOVA 4H2RA 2C76A 1DNCA 2OLNA 3DMEA 1N1PA 2QA2A 4YTPA 1FOHA 4H4ZA 1NEKA 3FG2P 4OVIA 4FX9A 3AEEA 3KA7A 5KNLA 4UDPA 2C75A 2XFQA 2TPRA 1X31B 4CRTA 5JCNA 2F5ZA 2XLTA 3T2ZA 1Y56A 3GDPA 1EL9A 4B67A 4A79A 4YTMA 4A99A 4DGKA 3UKQA 3H8LA 1ELIA 1PDHA 3SFDA 3KKJA 4CNJA 1ZX9A 3G5QA 1MOKA 2AQJA 2WDQA 2R46A 2YLZA 2GEWA 3AEDA 1F8RA 2ACZA 3CPIG 1ZOYA 3GYIA 3C4AA 3AE1A 3AEAA 3NRNA 4OPTA 3UCLA 3UTFA 2Q0KA 4HA6A 5IQ4A 2C65A 2BCGG 4JN9A 3CMMA 1PJ5A 3DJJA 1RYIA 4C3XA 3VRDB 1W4XA 4XXGA 4D04A 1TDNA 1TDOA 3CNDA 4USQA 1NHPA 3BI4A 2YR5A 3UP5A 4UDQA 2C3CA 1QLBA 1GESA 1CL0A 4OPIA 1XANA 4NTCA 2WOWA 1REOA 2V3AA 1COYA 1VG0A 2V5ZA 1OJDA 5EB4A 1CC2A 4Z25A 1CBOA 1BWCA 2V60A 4GAPA 2OLOA 3UKLA 4A65A 4H4TA 2CDUA 1FL2A 1NG4A 4BK3A 2A8XA 2WP6A 4H7UA 4EQRA 2JKCA 4CBQA 2VOUA 4BURA 1N4UA 2C72A 3SZ0A 3ICRA 1D7YA 2VQBA 2H88A 3RP7A 1GRHA 3E1TA 2NPXA 4Z2UA 3DK9A 4Y4NA 3CGDA 3M13A 3UKPA 3VR8A 5JCLA 1LTXR 1XPQA 1KNRA 4TM4A 3ISHA 3IC9A 2BYBA 3PO7A 1BGNA 1S2YA 3LXDA 1CC6A 2FJAA 2JBVA 1E1LA 2YLXA 5U25A 4AP3A 1S2QA 3CNSA 3IWAA 2RGOA 1FCDA 2TMDA 4B69A 3UKFA 1P2EA 4U8OA 3RHAA 2FBWA 3F8RA 1PBBA 3NK2X 3SXIA 2YLRA 3K30A 1IJHA 3VRAA 4HB9A 4II3A 3M0OA 2J3NA 4JDRA 3R9UA 3COXA 1BF3A 3ALLA 2B7SA 2C4CA 2WDRA 1XDIA 3AE3A 2IVDA 2C3DA 3NYFA 3GYXA 2ZZBA 4H4WA 1GRBA 2OALA 5FS8A 2WEUA 2HQMA 1L9EA 2R4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 A;  1DJQ A;  2WET A;  5ER0 A;  2WBA A;  2BAC A;  1GV4 A;  4YT0 A;  2QAE A;  4U8L A;  2XVF A;  2R4J A;  1VRQ B;  5U63 A;  1H83 A;  3D8X A;  2GQW A;  2XLU A;  4U2L A;  2GR0 A;  2YG3 A;  2B9Y A;  1VDC A;  5TR3 A;  3AEC A;  1B5Q A;  4LU6 A;  2WS3 A;  1MXT A;  1H7W A;  3CN8 A;  3P4S A;  4GCM A;  3C96 A;  2W0H A;  2XLS A;  1E1K A;  3UKA A;  1JRZ A;  4A6N A;  2WPF A;  5JCK A;  2VRM A;  2BC0 A;  3EAN A;  3GMC A;  1VG9 A;  1F6M A;  3NHO X;  4BJY A;  4FDC B;  4YKG A;  3RED A;  4J34 A;  4C77 A;  1PBD A;  4OPC A;  3D1C A;  4OPD A;  2XYO A;  3KD9 A;  3LJP A;  4YSY A;  2WP9 A;  3UOY A;  5JCI A;  2WOV A;  3CPH G;  1N4W A;  4BV6 A;  1GER A;  3AYL A;  4NEV A;  1V59 A;  2V61 A;  1E6E A;  1GAL A;  1H84 A;  3I6D A;  4TM1 A;  3CGB A;  1DOE A;  1H7X A;  1OJA A;  2EQ9 A;  2V6O A;  3P4Q A;  4BK2 A;  3Q6J A;  4AP1 A;  3BHF A;  2R0G A;  2PHH A;  2DKI A;  2C66 A;  2XVH A;  4JNA A;  2WU5 A;  1DJN A;  4K5S A;  4MJW A;  4NZH A;  4AOX A;  3CGE A;  3UP4 A;  2YG5 A;  3DH9 A;  1H82 A;  2OA1 A;  1GT8 A;  3FBS A;  4USR A;  1O94 A;  3BI2 A;  1E39 A;  1GTE A;  2EQ8 A;  2Q6U A;  4Z44 A;  1GOS A;  4H4P A;  1Q1W A;  4U2T A;  2Z5Y A;  3QJ4 A;  2VRL A;  1GPE A;  3AE7 A;  3F8P A;  1JEH A;  4RG3 A;  3DGH A;  5C2T A;  2YLW A;  3RNM A;  5KVH A;  5KWF A;  3EAO A;  3KPF A;  4J33 A;  1GRE A;  3P4R A;  3OZ2 A;  1GRF A;  1PXB A;  2EQ6 A;  2YM1 A;  1YY5 A;  2WPC A;  1OJC A;  3CGC A;  3DK8 A;  3EF6 A;  5HY5 A;  4JY2 A;  4EQX A;  2RGJ A;  2WPE A;  3UKK A;  4C74 A;  3BI5 A;  4ZCC A;  5HXI A;  3BHK A;  3SGL A;  3NIX A;  3NT6 A;  3S61 A;  3GWD A;  3UTG A;  3KLJ A;  3NK0 X;  4REK A;  3P1W A;  1TDK A;  1L9D A;  4I58 A;  3GD3 A;  1Q9I A;  2WHD A;  1CF3 A;  1O5W A;  2FJD A;  3GRT A;  3IF9 A;  4TM0 A;  2YVF A;  4EM3 A;  3AE8 A;  3GD4 A;  2GH5 A;  1PS9 A;  2X99 A;  1Y0P A;  3F8D A;  2ZZ0 A;  1ZY8 A;  3KU9 A;  5KVI A;  3T37 A;  4EMJ A;  4EIP A;  1BGJ A;  4J56 A;  4EQW A;  2Z5X A;  1NG3 A;  3L1R A;  2H89 A;  4CCR A;  4H4Q A;  1PJ7 A;  3AD9 B;  2GR2 A;  3DJD A;  3Q9T A;  4YSX A;  1CJ4 A;  1PXC A;  4Z24 A;  1ONF A;  2DKH A;  1KDG A;  1KSS A;  4X9N A;  4B68 A;  3NN0 X;  2YR6 A;  4X4J A;  2GRT A;  2AAQ A;  2BK4 A;  2WDV A;  3QSE A;  3K7Q X;  3DJG X;  4H4Y A;  2B9X A;  2FJB A;  1CJ3 A;  2GR3 A;  1H86 A;  2YR4 A;  4K22 A;  1EL7 A;  1ZMD A;  3O0H A;  1Q1R A;  4GDP A;  2XDO A;  4IA5 A;  4FK1 A;  3G5R A;  1QO8 A;  4O5U A;  5KOW A;  1E1N A;  1H81 A;  2GVC A;  3NYC A;  4H2Q A;  2VQ7 A;  1TYT A;  1GSN A;  3ZYX A;  2R0C A;  1DOB A;  2Q0L A;  1JNZ A;  1B37 A;  1TRB A;  2VVM A;  3UOV A;  1NEN A;  5L46 A;  4GF7 A;  2YWL A;  2CVJ A;  4U8K A;  1H6V A;  3B6D A;  1ZK7 A;  3V76 A;  3NGC X;  3SM8 A;  4APN A;  4H4V A;  1GET A;  3ADA B;  1NHR A;  2YG7 A;  2BS2 A;  5FS7 A;  2GMJ A;  3DK4 A;  5M0Z A;  1TDE A;  1Z6L A;  2ZZC A;  3ABV A;  2GR1 A;  3AE5 A;  1D4E A;  4J2W A;  2WES A;  3QVP A;  4H4R A;  2XVI A;  4YXD A;  4BK1 A;  2O9Z A;  2E4G A;  3P9U A;  1FEB A;  2JB1 A;  1M64 A;  1OJT A;  3AEG A;  4TLX A;  4GUV A;  4CNK A;  4H50 A;  1UKV G;  3NK1 X;  4NTD A;  3I3L A;  1KNP A;  4BJZ A;  2JK6 A;  3BNU A;  3VRB A;  1JNR A;  1N4V A;  4FK1 C;  1KFY A;  2RGH A;  3AEB A;  4B64 A;  1CJC A;  3NTA A;  3AB1 A;  2GQF A;  1PHH A;  2GMH A;  1IUV A;  1PBE A;  4AT0 A;  1GRA A;  1GRG A;  1AOG A;  3ICT A;  1TYP A;  3QVR A;  2XCG A;  2C67 A;  3NTD A;  3S5W A;  3AWI A;  4WCT A;  3RP8 A;  3DGZ A;  4RSL A;  4U8J A;  1YKJ A;  2WP5 A;  5C3J A;  2AR8 A;  2VZ2 A;  4KX6 A;  1DXL A;  2A89 A;  2Y6Q A;  4GDE A;  1P2H A;  3WE0 A;  5HHF A;  4OPL A;  2BCP A;  4U2S A;  4YSH A;  2YG6 A;  4P9S A;  2B9W A;  4JY3 A;  3QSM A;  2XLR A;  2BXR A;  1LQT A;  2JAE A;  4YKF A;  4AT2 A;  1K0I A;  1B4V A;  3PS9 A;  4LA1 A;  3UKH A;  4B1B A;  4EM4 A;  1JOA A;  5EOW A;  2BS3 A;  1TDF A;  4RG4 A;  2XFN A;  3PVC A;  2OAM A;  3G5S A;  1DOC A;  1L9C A;  4YWO A;  3ZDN A;  4GR1 A;  1F8W A;  1D5T A;  4WX1 A;  2ARD A;  2QCU A;  4CY6 A;  4IV9 A;  1QJD A;  1F3P A;  1PN0 A;  4IVO B;  3K7M X;  2WU2 A;  2C73 A;  3QSS A;  4U8N A;  3RP6 A;  4H2N A;  1GTH A;  3AD8 B;  1Y56 B;  1D7L A;  5IPY A;  2IID A;  1F8S A;  1PJ6 A;  5J60 A;  5BUK A;  1B8S A;  3AYI A;  4OPU A;  2JB2 A;  1NDA A;  4ZN0 A;  3FIM B;  2BAB A;  1BKW A;  2Q7V A;  2I0Z A;  4I59 A;  4LII A;  3ATR A;  3SFE A;  5BRT A;  4TLZ A;  1SEZ A;  1OJ9 A;  1PBF A;  1LJ1 A;  1IUX A;  1LV0 A;  5EBK A;  2E5V A;  1EBD A;  1DOD A;  2R0P A;  2C70 A;  3ATQ A;  1IUS A;  1IUW A;  1E7P A;  3AE9 A;  1D4C A;  1NHQ A;  4A9W A;  5FS9 A;  1GRT A;  3CIR A;  4AOS A;  1YQ3 A;  2GAG B;  3CPJ G;  1RSG A;  4U8M A;  4ECH A;  1CC4 A;  2VVL A;  5DBJ A;  4ZCD A;  1XHC A;  4N9X A;  3ITJ A;  1LVL A;  4JQ9 A;  2BXS A;  1S3B A;  2X8C A;  4IA6 A;  2XLP A;  5U1O A;  2VVL G;  1RP0 A;  4K7Z A;  3DJE A;  2EQ7 A;  3URH A;  5GRT A;  4CY8 A;  4Z43 A;  1HYU A;  4YTN A;  4Z2R A;  3IHG A;  3NN6 X;  4YSZ A;  2RAB A;  2C7G A;  3KVE A;  4DSH A;  3QFB A;  2YVJ A;  3AEF A;  3VR9 A;  1D4D A;  1PBC A;  5CKU A;  3V3O A;  2YLS A;  3GMB A;  4A5L A;  4C3Y A;  5KXJ A;  3NG7 X;  2APG A;  3LZX A;  3OC4 A;  4JNQ A;  3NYE A;  3FMW A;  4Z26 A;  1NPX A;  3SQP A;  2X50 A;  3DA1 A;  2B76 A;  1EL5 A;  1ZKQ A;  3AXB A;  4XWR A;  4DNA A;  1GND A;  1IUT A;  2X8H A;  2WQY A;  4B63 A;  5LV9 A;  1M6I A;  2UZZ A;  5BVA A;  3HZL A;  2NVK X;  3ICS A;  4OPG A;  4GRT A;  3V3N A;  1K0J A;  5HYM A;  1GEU A;  2IVE A;  2GV8 A;  4XWZ A;  4A7A A;  2YLT A;  3AD7 B;  4K8D A;  3LAD A;  5JCM A;  2YM2 A;  4Z2T A;  3VQR A;  1VQW A;  3NH3 X;  2CFY A;  2GB0 A;  1IUU A;  3AE6 A;  2QA1 A;  3NLC A;  4KPR A;  2XFU A;  4M52 A;  1YQZ A;  4IVM B;  2XFP A;  4J36 A;  5M10 A;  3LZW A;  3II4 A;  2BK5 A;  4K5R A;  2JB3 A;  2YQU A;  2BS4 A;  1YQ4 A;  4A6N B;  1FEC A;  5EB5 A;  4DSG A;  2B7R A;  4H4X A;  1ZDL A;  5FS6 A;  4UDR A;  3CNJ A;  5FMH A;  3ALJ A;  4O5Q A;  1KSU A;  1K4Q A;  2XVJ A;  3H4K A;  4EQS A;  3QFA A;  2Y6R A;  1L0V A;  3AYJ A;  4H4U A;  1JU2 A;  3IHM A;  4D03 A;  4EMW A;  1GXF A;  2CUL A;  1JRX A;  4EMI A;  2YG4 A;  1BZL A;  1FEA A;  1O95 A;  3AE2 A;  2XFO A;  1CHU A;  3M12 A;  4OCG A;  4PAA A;  4K2X A;  1ZOV A;  3EPT A;  3P4P A;  4E0V A;  2YVG A;  2BC1 A;  3UOZ A;  1LQU A;  2ZBW A;  2A87 A;  3GSI A;  4Y4L A;  3B3R A;  5CQF A;  1ZMC A;  4B65 A;  2YAU A;  1EL8 A;  4CCQ A;  3JSK A;  3CTY A;  3K7T A;  2X8G A;  1LPF A;  2PYX A;  2R45 A;  3C4N A;  4J31 A;  4U8I A;  2FJE A;  4H2P A;  4TM3 A;  5BUL A;  5IQ1 A;  3FPZ A;  3H8I A;  3GYJ A;  5KOX A;  4U8P A;  4X9M A;  5GSN A;  2E1M A;  4PAB A;  3GRS A;  4NTE A;  1MO9 A;  3CNP A;  4ADW A;  1PXA A;  3LB8 A;  1S3E A;  1NHS A;  3NKS A;  4H4S A;  2XVE A;  4B66 A;  2GF3 A;  1JRY A;  3BNM A;  4ICY A;  4J57 A;  4UP3 A;  2BA9 A;  5J7X A;  2GAH B;  2R9Z A;  4EIQ A;  4Y4M A;  3UOX A;  3GDN A;  2BK3 A;  3NNE A;  3GWF A;  1CJ2 A;  4C5O A;  5KRQ A;  1E1M A;  2WOI A;  3CNT A;  4NEW A;  1NAA A;  3L8K A;  2X3N A;  2V3B A;  3UTE A;  1ZP0 A;  3UTH A;  3ALM A;  3AE4 A;  2C64 A;  1K0L A;  3LOV A;  4H2R A;  2C76 A;  1DNC A;  2OLN A;  3DME A;  1N1P A;  2QA2 A;  4YTP A;  1FOH A;  4H4Z A;  1NEK A;  3FG2 P;  4OVI A;  4FX9 A;  3AEE A;  3KA7 A;  4UDP A;  2C75 A;  2XFQ A;  2TPR A;  1X31 B;  4CRT A;  5JCN A;  2F5Z A;  2XLT A;  1Y56 A;  3GDP A;  1EL9 A;  4B67 A;  4A79 A;  4YTM A;  4A99 A;  4DGK A;  3UKQ A;  3H8L A;  1ELI A;  1PDH A;  3SFD A;  3KKJ A;  4CNJ A;  1ZX9 A;  3G5Q A;  1MOK A;  2AQJ A;  2WDQ A;  2R46 A;  2YLZ A;  2GEW A;  3AED A;  1F8R A;  2ACZ A;  3CPI G;  1ZOY A;  3GYI A;  3AE1 A;  3C4A A;  3AEA A;  3NRN A;  4OPT A;  3UCL A;  3UTF A;  2Q0K A;  4HA6 A;  5IQ4 A;  2C65 A;  2BCG G;  4JN9 A;  1PJ5 A;  3DJJ A;  1RYI A;  4C3X A;  3VRD B;  1W4X A;  4XXG A;  4D04 A;  1TDN A;  1TDO A;  3CND A;  4USQ A;  1NHP A;  3BI4 A;  2YR5 A;  3UP5 A;  4UDQ A;  2C3C A;  1QLB A;  1GES A;  1CL0 A;  4OPI A;  1XAN A;  4NTC A;  2WOW A;  1REO A;  2V3A A;  1COY A;  1VG0 A;  2V5Z A;  1OJD A;  5EB4 A;  1CC2 A;  4Z25 A;  1CBO A;  1BWC A;  2V60 A;  3UKL A;  2OLO A;  4A65 A;  4H4T A;  2CDU A;  1FL2 A;  1NG4 A;  2A8X A;  2WP6 A;  4H7U A;  4BK3 A;  4EQR A;  2JKC A;  4CBQ A;  2VOU A;  4BUR A;  1N4U A;  2C72 A;  3ICR A;  1D7Y A;  2VQB A;  2H88 A;  1GRH A;  2NPX A;  3E1T A;  3RP7 A;  4Z2U A;  3DK9 A;  4Y4N A;  3CGD A;  3M13 A;  3UKP A;  3VR8 A;  5JCL A;  1LTX R;  1XPQ A;  1KNR A;  4TM4 A;  3ISH A;  3IC9 A;  2BYB A;  3PO7 A;  1BGN A;  1S2Y A;  3LXD A;  1CC6 A;  2FJA A;  2JBV A;  1E1L A;  2YLX A;  5U25 A;  4AP3 A;  1S2Q A;  3CNS A;  3IWA A;  2RGO A;  1FCD A;  2TMD A;  4B69 A;  3UKF A;  1P2E A;  4U8O A;  3RHA A;  2FBW A;  3F8R A;  1PBB A;  3NK2 X;  2YLR A;  3K30 A;  1IJH A;  3VRA A;  4HB9 A;  3M0O A;  2J3N A;  4JDR A;  3R9U A;  3COX A;  1BF3 A;  3ALL A;  2B7S A;  2WDR A;  1XDI A;  3AE3 A;  2IVD A;  2C3D A;  3NYF A;  2ZZB A;  4H4W A;  1GRB A;  2OAL A;  5FS8 A;  2WEU A;  2HQM A;  1L9E A;  2R4E A; 
#chains in the Genus database with same CATH topology
 1KF6 A;  1C0I A;  1DJQ A;  1KIF A;  2WET A;  2WBA A;  5ER0 A;  2BAC A;  1GV4 A;  4YT0 A;  2QAE A;  4U8L A;  2XVF A;  2R4J A;  1VRQ B;  5U63 A;  1H83 A;  3D8X A;  2GQW A;  2XLU A;  4U2L A;  3T0K A;  2GR0 A;  2YG3 A;  2B9Y A;  1VDC A;  5TR3 A;  3AEC A;  1B5Q A;  4LU6 A;  2WS3 A;  1MXT A;  1H7W A;  3CN8 A;  3P4S A;  4GCM A;  3C96 A;  2W0H A;  2XLS A;  1E1K A;  3UKA A;  1JRZ A;  4A6N A;  2WPF A;  5JCK A;  2VRM A;  2BC0 A;  4BJY A;  3GMC A;  1VG9 A;  1F6M A;  3EAN A;  3NHO X;  4FDC B;  4YKG A;  3RED A;  4J34 A;  4C77 A;  1PBD A;  4OPC A;  3D1C A;  4OPD A;  2XYO A;  3KD9 A;  3LJP A;  4YSY A;  2WP9 A;  3UOY A;  5JCI A;  2WOV A;  3CPH G;  1N4W A;  4BV6 A;  1GER A;  3AYL A;  4NEV A;  1V59 A;  2V61 A;  1E6E A;  1GAL A;  1H84 A;  3I6D A;  4TM1 A;  3CGB A;  1DOE A;  1H7X A;  1OJA A;  2EQ9 A;  2V6O A;  4BK2 A;  3P4Q A;  3Q6J A;  4AP1 A;  3BHF A;  2R0G A;  2PHH A;  2DKI A;  2C66 A;  2XVH A;  4JNA A;  2WU5 A;  1DJN A;  4K5S A;  4MJW A;  4NZH A;  1C0L A;  4AOX A;  3CGE A;  3UP4 A;  2YG5 A;  3DH9 A;  1H82 A;  2OA1 A;  1GT8 A;  3FBS A;  4USR A;  1O94 A;  3BI2 A;  1E39 A;  1GTE A;  2EQ8 A;  2Q6U A;  4Z44 A;  1GOS A;  4H4P A;  1Q1W A;  4U2T A;  2Z5Y A;  3QJ4 A;  2VRL A;  1GPE A;  3AE7 A;  3F8P A;  1JEH A;  4RG3 A;  3DGH A;  5C2T A;  2YLW A;  3RNM A;  5KVH A;  5KWF A;  3EAO A;  3KPF A;  4J33 A;  1GRE A;  3P4R A;  3OZ2 A;  1PXB A;  1GRF A;  2EQ6 A;  2YM1 A;  1YY5 A;  2WPC A;  1OJC A;  3CGC A;  3DK8 A;  3EF6 A;  5HY5 A;  4JY2 A;  4EQX A;  2RGJ A;  2WPE A;  3UKK A;  4C74 A;  3BI5 A;  4ZCC A;  3BHK A;  3SGL A;  5HXI A;  3NIX A;  3NT6 A;  3S61 A;  3GWD A;  3UTG A;  3KLJ A;  3NK0 X;  4REK A;  3P1W A;  1TDK A;  1L9D A;  4I58 A;  5KMQ A;  3T14 A;  3GD3 A;  1Q9I A;  2WHD A;  1CF3 A;  2E49 A;  3IF9 A;  1O5W A;  2FJD A;  3GRT A;  4TM0 A;  2YVF A;  4EM3 A;  3AE8 A;  3GD4 A;  2GH5 A;  1PS9 A;  2X99 A;  1Y0P A;  3F8D A;  2ZZ0 A;  1ZY8 A;  3KU9 A;  5KVI A;  3T37 A;  4EMJ A;  4EIP A;  1BGJ A;  4J56 A;  3T31 A;  3W4K A;  4EQW A;  2Z5X A;  1NG3 A;  3L1R A;  2H89 A;  4CCR A;  4H4Q A;  1PJ7 A;  3AD9 B;  3DJD A;  1DDO A;  2GR2 A;  3Q9T A;  4YSX A;  1CJ4 A;  1PXC A;  4Z24 A;  1ONF A;  2DKH A;  1KDG A;  1KSS A;  4X9N A;  4B68 A;  3NN0 X;  2YR6 A;  4X4J A;  2GRT A;  2AAQ A;  2BK4 A;  2WDV A;  3QSE A;  3K7Q X;  3DJG X;  4H4Y A;  2B9X A;  2FJB A;  1CJ3 A;  2GR3 A;  1H86 A;  2YR4 A;  4K22 A;  1EL7 A;  1ZMD A;  3O0H A;  2BRA A;  1Q1R A;  4GDP A;  4IA5 A;  2XDO A;  4FK1 A;  3G5R A;  1QO8 A;  4O5U A;  5KOW A;  4YJG A;  3NYC A;  1E1N A;  1H81 A;  2GVC A;  4H2Q A;  2VQ7 A;  1TYT A;  1GSN A;  3T2K A;  3ZYX A;  2R0C A;  1DOB A;  2Q0L A;  1JNZ A;  1B37 A;  1TRB A;  2VVM A;  3UOV A;  1NEN A;  5L46 A;  4G6H A;  3SZF A;  4GF7 A;  2YWL A;  2CVJ A;  4U8K A;  1H6V A;  3B6D A;  1ZK7 A;  3V76 A;  3NGC X;  3SM8 A;  4APN A;  4H4V A;  3ADA B;  1GET A;  1NHR A;  2YG7 A;  2BS2 A;  5FS7 A;  2GMJ A;  3DK4 A;  5M0Z A;  1TDE A;  1Z6L A;  2ZZC A;  3ABV A;  2GR1 A;  3AE5 A;  1D4E A;  4J2W A;  3SYI A;  2WES A;  3QVP A;  4H4R A;  2XVI A;  4YXD A;  4BK1 A;  2O9Z A;  1C0P A;  3HYX A;  2E4G A;  3P9U A;  1FEB A;  2JB1 A;  1M64 A;  1OJT A;  3AEG A;  4TLX A;  4GUV A;  4CNK A;  4H50 A;  4YJH A;  4YJF A;  1UKV G;  3NK1 X;  4NTD A;  5KMS A;  3I3L A;  1KNP A;  4BJZ A;  2JK6 A;  3BNU A;  3VRB A;  1JNR A;  1N4V A;  4FK1 C;  2RGH A;  1KFY A;  3AEB A;  4B64 A;  1CJC A;  3NTA A;  3AB1 A;  2GQF A;  1PHH A;  4NNJ A;  2GMH A;  1IUV A;  1PBE A;  4AT0 A;  1GRA A;  1GRG A;  1AOG A;  3ICT A;  1TYP A;  3QVR A;  2XCG A;  2C67 A;  3NTD A;  3S5W A;  3AWI A;  4WCT A;  3RP8 A;  4RSL A;  3DGZ A;  4U8J A;  1YKJ A;  2WP5 A;  5C3J A;  2AR8 A;  2VZ2 A;  4KX6 A;  1DXL A;  2A89 A;  2Y6Q A;  4GDE A;  1P2H A;  3WE0 A;  5HHF A;  4OPL A;  4YSH A;  2BCP A;  4U2S A;  2YG6 A;  4P9S A;  2B9W A;  3QSM A;  4JY3 A;  2XLR A;  2BXR A;  1LQT A;  2JAE A;  4YKF A;  4AT2 A;  1K0I A;  1B4V A;  3PS9 A;  5KMR A;  4LA1 A;  3UKH A;  4B1B A;  4EM4 A;  1JOA A;  5EOW A;  2BS3 A;  1TDF A;  3T2Y A;  4G9K A;  4RG4 A;  2XFN A;  3PVC A;  2OAM A;  3G5S A;  1DOC A;  1VE9 A;  3CUK A;  1L9C A;  4YWO A;  3ZDN A;  4GR1 A;  1F8W A;  1D5T A;  4WX1 A;  2ARD A;  2QCU A;  4CY6 A;  4IV9 A;  4G74 A;  1QJD A;  1PN0 A;  1F3P A;  4IVO B;  3K7M X;  2WU2 A;  2C73 A;  3QSS A;  4U8N A;  3RP6 A;  4H2N A;  1GTH A;  3AD8 B;  1Y56 B;  1D7L A;  5IPY A;  2IID A;  1F8S A;  1PJ6 A;  5J60 A;  3SY4 A;  5BUK A;  1B8S A;  2BRY A;  3AYI A;  4OPU A;  2JB2 A;  1NDA A;  4ZN0 A;  3FIM B;  2BAB A;  1BKW A;  2Q7V A;  2I0Z A;  4I59 A;  4LII A;  3ATR A;  3SFE A;  5BRT A;  4TLZ A;  1SEZ A;  1PBF A;  1OJ9 A;  1LJ1 A;  1IUX A;  1LV0 A;  5EBK A;  2E5V A;  1EBD A;  1DOD A;  2R0P A;  2C70 A;  3ATQ A;  5KMP A;  1IUS A;  1IUW A;  1E7P A;  3AE9 A;  1D4C A;  1NHQ A;  4A9W A;  5FS9 A;  1GRT A;  3CIR A;  4AOS A;  1YQ3 A;  2GAG B;  3CPJ G;  1RSG A;  4U8M A;  4ECH A;  1CC4 A;  2VVL A;  5DBJ A;  4ZCD A;  1XHC A;  4N9X A;  3ITJ A;  1LVL A;  4JQ9 A;  4IA6 A;  1S3B A;  2BXS A;  2X8C A;  2XLP A;  5U1O A;  2VVL G;  1RP0 A;  3HYV A;  4K7Z A;  3DJE A;  2EQ7 A;  3URH A;  5GRT A;  4CY8 A;  4Z43 A;  1HYU A;  4YTN A;  4Z2R A;  3IHG A;  3NN6 X;  4YSZ A;  2RAB A;  2C7G A;  4G6G A;  3KVE A;  4DSH A;  3QFB A;  2YVJ A;  3AEF A;  1EVI A;  3VR9 A;  1D4D A;  1PBC A;  5CKU A;  3V3O A;  2YLS A;  3GMB A;  4G73 A;  4A5L A;  4C3Y A;  3NG7 X;  5KXJ A;  3SX6 A;  2APG A;  3LZX A;  3OC4 A;  4JNQ A;  3NYE A;  3FMW A;  4II2 A;  4Z26 A;  1NPX A;  3SQP A;  2X50 A;  3DA1 A;  3ZNN A;  2B76 A;  4GAV A;  1EL5 A;  1ZKQ A;  3SZW A;  3AXB A;  4XWR A;  4DNA A;  1GND A;  1IUT A;  2X8H A;  2WQY A;  4B63 A;  5LV9 A;  1M6I A;  2UZZ A;  5BVA A;  3HZL A;  2NVK X;  3ZNQ A;  3ICS A;  4OPG A;  4GRT A;  3V3N A;  1K0J A;  5HYM A;  1GEU A;  2IVE A;  4XWZ A;  2GV8 A;  4A7A A;  3AD7 B;  2YLT A;  4K8D A;  3LAD A;  4YJF B;  5JCM A;  2YM2 A;  4Z2T A;  3VQR A;  1VQW A;  3NH3 X;  2CFY A;  2GB0 A;  1IUU A;  3AE6 A;  2QA1 A;  3NLC A;  4KPR A;  2XFU A;  4M52 A;  1YQZ A;  4IVM B;  2XFP A;  4J36 A;  5M10 A;  3LZW A;  3II4 A;  2BK5 A;  4K5R A;  2JB3 A;  2YQU A;  2BS4 A;  1YQ4 A;  4A6N B;  1FEC A;  5EB5 A;  4DSG A;  2B7R A;  4H4X A;  1ZDL A;  3HYW A;  5FS6 A;  4UDR A;  3CNJ A;  5FMH A;  3ALJ A;  4O5Q A;  1KSU A;  1K4Q A;  2XVJ A;  3H4K A;  4EQS A;  3QFA A;  3W4I A;  2Y6R A;  1L0V A;  4QFC A;  3AYJ A;  4H4U A;  1JU2 A;  3IHM A;  4D03 A;  4EMW A;  1GXF A;  2CUL A;  1JRX A;  4EMI A;  2YG4 A;  1BZL A;  1FEA A;  3M12 A;  4QFD A;  1O95 A;  1CHU A;  4PAA A;  2XFO A;  3AE2 A;  4OCG A;  4K2X A;  3SZC A;  1ZOV A;  3EPT A;  3P4P A;  4E0V A;  2YVG A;  2BC1 A;  3UOZ A;  1LQU A;  2ZBW A;  2A87 A;  3GSI A;  4Y4L A;  3B3R A;  5CQF A;  1ZMC A;  4B65 A;  2YAU A;  1EL8 A;  3ZNP A;  4CCQ A;  3JSK A;  3CTY A;  3K7T A;  2X8G A;  1LPF A;  2PYX A;  2R45 A;  3C4N A;  4J31 A;  4U8I A;  2FJE A;  4H2P A;  4TM3 A;  5BUL A;  5IQ1 A;  3FPZ A;  3H8I A;  3GYJ A;  5KOX A;  4U8P A;  4X9M A;  5GSN A;  2E1M A;  4PAB A;  3GRS A;  4NTE A;  1MO9 A;  3CNP A;  4ADW A;  1PXA A;  3LB8 A;  1S3E A;  1NHS A;  3NKS A;  4H4S A;  4NWZ A;  2XVE A;  4B66 A;  2GF3 A;  1JRY A;  3BNM A;  4ICY A;  4J57 A;  4UP3 A;  2BA9 A;  5J7X A;  2GAH B;  2R9Z A;  4EIQ A;  4Y4M A;  3UOX A;  3GDN A;  3KPK A;  2BK3 A;  3NNE A;  3GWF A;  1CJ2 A;  4C5O A;  5KRQ A;  1E1M A;  2WOI A;  3CNT A;  4NEW A;  1NAA A;  3L8K A;  2X3N A;  2V3B A;  3UTE A;  1ZP0 A;  3W4J A;  3UTH A;  3ALM A;  3AE4 A;  1DAO A;  4YJD A;  1K0L A;  2E82 A;  4H2R A;  2C64 A;  1AN9 A;  2C76 A;  3LOV A;  1DNC A;  2OLN A;  3DME A;  1N1P A;  2QA2 A;  4YTP A;  1FOH A;  4H4Z A;  1NEK A;  3FG2 P;  4OVI A;  4FX9 A;  3G3E A;  3AEE A;  3KA7 A;  5KNL A;  4UDP A;  2C75 A;  2XFQ A;  2TPR A;  1X31 B;  4CRT A;  5JCN A;  2E4A A;  2F5Z A;  2XLT A;  3T2Z A;  1Y56 A;  3GDP A;  1EL9 A;  4B67 A;  4A79 A;  4YTM A;  4A99 A;  4DGK A;  3UKQ A;  3H8L A;  1ELI A;  1PDH A;  3SFD A;  3KKJ A;  4CNJ A;  1ZX9 A;  3G5Q A;  1MOK A;  2AQJ A;  2WDQ A;  2R46 A;  2YLZ A;  2GEW A;  3AED A;  2E48 A;  1F8R A;  2ACZ A;  3CPI G;  1ZOY A;  3GYI A;  3C4A A;  3AE1 A;  3AEA A;  3NRN A;  4OPT A;  3UCL A;  3UTF A;  2Q0K A;  4HA6 A;  3ZNO A;  4YJG B;  5IQ4 A;  2C65 A;  2BCG G;  4JN9 A;  3CMM A;  1PJ5 A;  3DJJ A;  1RYI A;  4C3X A;  3VRD B;  1W4X A;  4XXG A;  4D04 A;  1TDN A;  1TDO A;  3CND A;  4USQ A;  1NHP A;  3BI4 A;  2YR5 A;  3UP5 A;  4UDQ A;  2C3C A;  1QLB A;  1GES A;  1CL0 A;  4OPI A;  1XAN A;  4NTC A;  2WOW A;  1REO A;  2V3A A;  1COY A;  1VG0 A;  2V5Z A;  1OJD A;  5EB4 A;  1CC2 A;  4Z25 A;  1CBO A;  1BWC A;  2V60 A;  4GAP A;  2OLO A;  3UKL A;  4A65 A;  2DU8 A;  4H4T A;  2CDU A;  1FL2 A;  1NG4 A;  4BK3 A;  2A8X A;  2WP6 A;  4H7U A;  4EQR A;  2JKC A;  4CBQ A;  2VOU A;  4BUR A;  1N4U A;  2C72 A;  3SZ0 A;  3ICR A;  1D7Y A;  2VQB A;  2H88 A;  3RP7 A;  1GRH A;  3E1T A;  2NPX A;  4Z2U A;  3DK9 A;  4Y4N A;  3CGD A;  3M13 A;  4YJH B;  3UKP A;  3VR8 A;  5JCL A;  1C0K A;  1LTX R;  1XPQ A;  3WGT A;  1KNR A;  4TM4 A;  3ISH A;  3IC9 A;  2BYB A;  3PO7 A;  1BGN A;  1S2Y A;  3LXD A;  1CC6 A;  2FJA A;  2JBV A;  1E1L A;  2YLX A;  5U25 A;  4AP3 A;  1S2Q A;  3CNS A;  3IWA A;  2RGO A;  1FCD A;  2TMD A;  4B69 A;  3UKF A;  1P2E A;  4U8O A;  3RHA A;  2FBW A;  3F8R A;  1PBB A;  3NK2 X;  3SXI A;  2YLR A;  3K30 A;  1IJH A;  3VRA A;  4HB9 A;  4II3 A;  3M0O A;  2J3N A;  4JDR A;  3R9U A;  3COX A;  1BF3 A;  3ALL A;  2B7S A;  2C4C A;  2WDR A;  1XDI A;  3AE3 A;  2IVD A;  2C3D A;  3NYF A;  3GYX A;  2ZZB A;  4H4W A;  1GRB A;  2OAL A;  5FS8 A;  2WEU A;  2HQM A;  1L9E A;  2R4E A; 
#chains in the Genus database with same CATH homology
 1KF6 A;  1DJQ A;  2WET A;  5ER0 A;  2WBA A;  2BAC A;  1GV4 A;  4YT0 A;  2QAE A;  4U8L A;  2XVF A;  2R4J A;  1VRQ B;  5U63 A;  1H83 A;  3D8X A;  2GQW A;  2XLU A;  4U2L A;  3T0K A;  2GR0 A;  2YG3 A;  2B9Y A;  1VDC A;  5TR3 A;  3AEC A;  1B5Q A;  4LU6 A;  2WS3 A;  1MXT A;  1H7W A;  3CN8 A;  3P4S A;  4GCM A;  3C96 A;  2W0H A;  2XLS A;  1E1K A;  3UKA A;  1JRZ A;  4A6N A;  2WPF A;  5JCK A;  2VRM A;  2BC0 A;  4BJY A;  3GMC A;  1VG9 A;  1F6M A;  3EAN A;  3NHO X;  4FDC B;  4YKG A;  3RED A;  4J34 A;  4C77 A;  1PBD A;  4OPC A;  3D1C A;  4OPD A;  2XYO A;  3KD9 A;  3LJP A;  4YSY A;  2WP9 A;  3UOY A;  5JCI A;  2WOV A;  3CPH G;  1N4W A;  4BV6 A;  1GER A;  3AYL A;  4NEV A;  1V59 A;  2V61 A;  1E6E A;  1GAL A;  1H84 A;  3I6D A;  4TM1 A;  3CGB A;  1DOE A;  1H7X A;  1OJA A;  2EQ9 A;  2V6O A;  4BK2 A;  3P4Q A;  3Q6J A;  4AP1 A;  3BHF A;  2R0G A;  2PHH A;  2DKI A;  2C66 A;  2XVH A;  4JNA A;  2WU5 A;  1DJN A;  4K5S A;  4MJW A;  4NZH A;  4AOX A;  3CGE A;  3UP4 A;  2YG5 A;  3DH9 A;  1H82 A;  2OA1 A;  1GT8 A;  3FBS A;  4USR A;  1O94 A;  3BI2 A;  1E39 A;  1GTE A;  2EQ8 A;  2Q6U A;  4Z44 A;  1GOS A;  4H4P A;  1Q1W A;  4U2T A;  2Z5Y A;  3QJ4 A;  2VRL A;  1GPE A;  3AE7 A;  3F8P A;  1JEH A;  4RG3 A;  3DGH A;  5C2T A;  2YLW A;  3RNM A;  5KVH A;  5KWF A;  3EAO A;  3KPF A;  4J33 A;  1GRE A;  3P4R A;  3OZ2 A;  1GRF A;  1PXB A;  2EQ6 A;  2YM1 A;  1YY5 A;  2WPC A;  1OJC A;  3CGC A;  3DK8 A;  3EF6 A;  5HY5 A;  4JY2 A;  4EQX A;  2RGJ A;  2WPE A;  3UKK A;  4C74 A;  3BI5 A;  4ZCC A;  5HXI A;  3BHK A;  3SGL A;  3NIX A;  3NT6 A;  3S61 A;  3GWD A;  3UTG A;  3KLJ A;  3NK0 X;  4REK A;  3P1W A;  1TDK A;  1L9D A;  4I58 A;  5KMQ A;  3T14 A;  3GD3 A;  1Q9I A;  2WHD A;  1CF3 A;  1O5W A;  2FJD A;  3GRT A;  3IF9 A;  4TM0 A;  2YVF A;  4EM3 A;  3AE8 A;  3GD4 A;  2GH5 A;  1PS9 A;  2X99 A;  1Y0P A;  3F8D A;  2ZZ0 A;  1ZY8 A;  3KU9 A;  5KVI A;  3T37 A;  4EMJ A;  4EIP A;  1BGJ A;  4J56 A;  3T31 A;  4EQW A;  2Z5X A;  1NG3 A;  3L1R A;  2H89 A;  4CCR A;  4H4Q A;  1PJ7 A;  3AD9 B;  2GR2 A;  3DJD A;  3Q9T A;  4YSX A;  1CJ4 A;  1PXC A;  4Z24 A;  1ONF A;  2DKH A;  1KDG A;  1KSS A;  4X9N A;  4B68 A;  3NN0 X;  2YR6 A;  4X4J A;  2GRT A;  2AAQ A;  2BK4 A;  2WDV A;  3QSE A;  3K7Q X;  3DJG X;  4H4Y A;  2B9X A;  2FJB A;  1CJ3 A;  2GR3 A;  1H86 A;  2YR4 A;  4K22 A;  1EL7 A;  1ZMD A;  3O0H A;  2BRA A;  1Q1R A;  4GDP A;  4IA5 A;  2XDO A;  4FK1 A;  3G5R A;  1QO8 A;  4O5U A;  5KOW A;  1E1N A;  1H81 A;  2GVC A;  3NYC A;  4H2Q A;  2VQ7 A;  1TYT A;  1GSN A;  3T2K A;  3ZYX A;  2R0C A;  1DOB A;  2Q0L A;  1JNZ A;  1B37 A;  1TRB A;  2VVM A;  3UOV A;  1NEN A;  4G6H A;  3SZF A;  5L46 A;  4GF7 A;  2YWL A;  2CVJ A;  4U8K A;  1H6V A;  3B6D A;  1ZK7 A;  3V76 A;  3NGC X;  3SM8 A;  4APN A;  4H4V A;  1GET A;  3ADA B;  1NHR A;  2YG7 A;  2BS2 A;  5FS7 A;  2GMJ A;  3DK4 A;  5M0Z A;  1TDE A;  1Z6L A;  2ZZC A;  3ABV A;  2GR1 A;  3AE5 A;  1D4E A;  4J2W A;  3SYI A;  2WES A;  3QVP A;  4H4R A;  2XVI A;  4YXD A;  4BK1 A;  2O9Z A;  3HYX A;  2E4G A;  3P9U A;  1FEB A;  2JB1 A;  1M64 A;  1OJT A;  3AEG A;  4TLX A;  4GUV A;  4CNK A;  4H50 A;  1UKV G;  3NK1 X;  4NTD A;  5KMS A;  3I3L A;  1KNP A;  4BJZ A;  2JK6 A;  3BNU A;  3VRB A;  1JNR A;  1N4V A;  4FK1 C;  1KFY A;  2RGH A;  3AEB A;  4B64 A;  1CJC A;  3NTA A;  3AB1 A;  2GQF A;  1PHH A;  4NNJ A;  2GMH A;  1IUV A;  1PBE A;  4AT0 A;  1GRA A;  1GRG A;  1AOG A;  3ICT A;  1TYP A;  3QVR A;  2XCG A;  2C67 A;  3NTD A;  3S5W A;  3AWI A;  4WCT A;  3RP8 A;  3DGZ A;  4RSL A;  4U8J A;  1YKJ A;  2WP5 A;  5C3J A;  2AR8 A;  2VZ2 A;  4KX6 A;  1DXL A;  2A89 A;  2Y6Q A;  4GDE A;  1P2H A;  3WE0 A;  5HHF A;  4OPL A;  2BCP A;  4U2S A;  4YSH A;  2YG6 A;  4P9S A;  2B9W A;  4JY3 A;  3QSM A;  2XLR A;  2BXR A;  1LQT A;  2JAE A;  4YKF A;  4AT2 A;  1K0I A;  1B4V A;  3PS9 A;  5KMR A;  4LA1 A;  3UKH A;  4B1B A;  4EM4 A;  1JOA A;  5EOW A;  2BS3 A;  1TDF A;  3T2Y A;  4G9K A;  4RG4 A;  2XFN A;  3PVC A;  2OAM A;  3G5S A;  1DOC A;  1L9C A;  4YWO A;  3ZDN A;  4GR1 A;  1F8W A;  1D5T A;  4WX1 A;  2ARD A;  2QCU A;  4CY6 A;  4IV9 A;  4G74 A;  1QJD A;  1F3P A;  1PN0 A;  4IVO B;  3K7M X;  2WU2 A;  2C73 A;  3QSS A;  4U8N A;  3RP6 A;  4H2N A;  1GTH A;  3AD8 B;  1Y56 B;  1D7L A;  5IPY A;  2IID A;  1F8S A;  1PJ6 A;  5J60 A;  3SY4 A;  5BUK A;  1B8S A;  2BRY A;  3AYI A;  4OPU A;  2JB2 A;  1NDA A;  4ZN0 A;  3FIM B;  2BAB A;  1BKW A;  2Q7V A;  2I0Z A;  4I59 A;  4LII A;  3ATR A;  3SFE A;  5BRT A;  4TLZ A;  1SEZ A;  1OJ9 A;  1PBF A;  1LJ1 A;  1IUX A;  1LV0 A;  5EBK A;  2E5V A;  1EBD A;  1DOD A;  2R0P A;  2C70 A;  3ATQ A;  5KMP A;  1IUS A;  1IUW A;  1E7P A;  3AE9 A;  1D4C A;  1NHQ A;  4A9W A;  5FS9 A;  1GRT A;  3CIR A;  4AOS A;  1YQ3 A;  2GAG B;  3CPJ G;  1RSG A;  4U8M A;  4ECH A;  1CC4 A;  2VVL A;  5DBJ A;  4ZCD A;  1XHC A;  4N9X A;  3ITJ A;  1LVL A;  4JQ9 A;  4IA6 A;  1S3B A;  2BXS A;  2X8C A;  2XLP A;  5U1O A;  2VVL G;  1RP0 A;  3HYV A;  4K7Z A;  3DJE A;  2EQ7 A;  3URH A;  5GRT A;  4CY8 A;  4Z43 A;  1HYU A;  4YTN A;  4Z2R A;  3IHG A;  3NN6 X;  4YSZ A;  2RAB A;  2C7G A;  4G6G A;  3KVE A;  4DSH A;  3QFB A;  2YVJ A;  3AEF A;  3VR9 A;  1D4D A;  1PBC A;  5CKU A;  3V3O A;  2YLS A;  3GMB A;  4G73 A;  4A5L A;  4C3Y A;  3NG7 X;  5KXJ A;  3SX6 A;  2APG A;  3LZX A;  3OC4 A;  4JNQ A;  3NYE A;  3FMW A;  4II2 A;  4Z26 A;  1NPX A;  3SQP A;  2X50 A;  3DA1 A;  2B76 A;  4GAV A;  1EL5 A;  1ZKQ A;  3SZW A;  3AXB A;  4XWR A;  4DNA A;  1GND A;  1IUT A;  2X8H A;  2WQY A;  4B63 A;  5LV9 A;  1M6I A;  2UZZ A;  5BVA A;  3HZL A;  2NVK X;  3ICS A;  4OPG A;  4GRT A;  3V3N A;  1K0J A;  5HYM A;  1GEU A;  2IVE A;  2GV8 A;  4XWZ A;  4A7A A;  2YLT A;  3AD7 B;  4K8D A;  3LAD A;  5JCM A;  2YM2 A;  4Z2T A;  3VQR A;  1VQW A;  3NH3 X;  2CFY A;  2GB0 A;  1IUU A;  3AE6 A;  2QA1 A;  3NLC A;  4KPR A;  2XFU A;  4M52 A;  1YQZ A;  4IVM B;  2XFP A;  4J36 A;  5M10 A;  3LZW A;  3II4 A;  2BK5 A;  4K5R A;  2JB3 A;  2YQU A;  2BS4 A;  1YQ4 A;  4A6N B;  1FEC A;  5EB5 A;  4DSG A;  2B7R A;  4H4X A;  1ZDL A;  3HYW A;  5FS6 A;  4UDR A;  3CNJ A;  5FMH A;  3ALJ A;  4O5Q A;  1KSU A;  1K4Q A;  2XVJ A;  3H4K A;  4EQS A;  3QFA A;  2Y6R A;  1L0V A;  3AYJ A;  4H4U A;  1JU2 A;  3IHM A;  4D03 A;  4EMW A;  1GXF A;  2CUL A;  1JRX A;  4EMI A;  2YG4 A;  1BZL A;  1FEA A;  1O95 A;  3AE2 A;  2XFO A;  1CHU A;  3M12 A;  4OCG A;  4PAA A;  4K2X A;  3SZC A;  1ZOV A;  3EPT A;  3P4P A;  4E0V A;  2YVG A;  2BC1 A;  3UOZ A;  1LQU A;  2ZBW A;  2A87 A;  3GSI A;  4Y4L A;  3B3R A;  5CQF A;  1ZMC A;  4B65 A;  2YAU A;  1EL8 A;  4CCQ A;  3JSK A;  3CTY A;  3K7T A;  2X8G A;  1LPF A;  2PYX A;  2R45 A;  3C4N A;  4J31 A;  4U8I A;  2FJE A;  4H2P A;  4TM3 A;  5BUL A;  5IQ1 A;  3FPZ A;  3H8I A;  3GYJ A;  5KOX A;  4U8P A;  4X9M A;  5GSN A;  2E1M A;  4PAB A;  3GRS A;  4NTE A;  1MO9 A;  3CNP A;  4ADW A;  1PXA A;  3LB8 A;  1S3E A;  1NHS A;  3NKS A;  4H4S A;  4NWZ A;  2XVE A;  4B66 A;  2GF3 A;  1JRY A;  3BNM A;  4ICY A;  4J57 A;  4UP3 A;  2BA9 A;  5J7X A;  2GAH B;  2R9Z A;  4EIQ A;  4Y4M A;  3UOX A;  3GDN A;  3KPK A;  2BK3 A;  3NNE A;  3GWF A;  1CJ2 A;  4C5O A;  5KRQ A;  1E1M A;  2WOI A;  3CNT A;  4NEW A;  1NAA A;  3L8K A;  2X3N A;  2V3B A;  3UTE A;  1ZP0 A;  3UTH A;  3ALM A;  3AE4 A;  2C64 A;  1K0L A;  3LOV A;  4H2R A;  2C76 A;  1DNC A;  2OLN A;  3DME A;  1N1P A;  2QA2 A;  4YTP A;  1FOH A;  4H4Z A;  1NEK A;  3FG2 P;  4OVI A;  4FX9 A;  3AEE A;  3KA7 A;  5KNL A;  4UDP A;  2C75 A;  2XFQ A;  2TPR A;  1X31 B;  4CRT A;  5JCN A;  2F5Z A;  2XLT A;  3T2Z A;  1Y56 A;  3GDP A;  1EL9 A;  4B67 A;  4A79 A;  4YTM A;  4A99 A;  4DGK A;  3UKQ A;  3H8L A;  1ELI A;  1PDH A;  3SFD A;  3KKJ A;  4CNJ A;  1ZX9 A;  3G5Q A;  1MOK A;  2AQJ A;  2WDQ A;  2R46 A;  2YLZ A;  2GEW A;  3AED A;  1F8R A;  2ACZ A;  3CPI G;  1ZOY A;  3GYI A;  3C4A A;  3AE1 A;  3AEA A;  3NRN A;  4OPT A;  3UCL A;  3UTF A;  2Q0K A;  4HA6 A;  5IQ4 A;  2C65 A;  2BCG G;  4JN9 A;  3CMM A;  1PJ5 A;  3DJJ A;  1RYI A;  4C3X A;  3VRD B;  1W4X A;  4XXG A;  4D04 A;  1TDN A;  1TDO A;  3CND A;  4USQ A;  1NHP A;  3BI4 A;  2YR5 A;  3UP5 A;  4UDQ A;  2C3C A;  1QLB A;  1GES A;  1CL0 A;  4OPI A;  1XAN A;  4NTC A;  2WOW A;  1REO A;  2V3A A;  1COY A;  1VG0 A;  2V5Z A;  1OJD A;  5EB4 A;  1CC2 A;  4Z25 A;  1CBO A;  1BWC A;  2V60 A;  4GAP A;  2OLO A;  3UKL A;  4A65 A;  4H4T A;  2CDU A;  1FL2 A;  1NG4 A;  4BK3 A;  2A8X A;  2WP6 A;  4H7U A;  4EQR A;  2JKC A;  4CBQ A;  2VOU A;  4BUR A;  1N4U A;  2C72 A;  3SZ0 A;  3ICR A;  1D7Y A;  2VQB A;  2H88 A;  3RP7 A;  1GRH A;  3E1T A;  2NPX A;  4Z2U A;  3DK9 A;  4Y4N A;  3CGD A;  3M13 A;  3UKP A;  3VR8 A;  5JCL A;  1LTX R;  1XPQ A;  1KNR A;  4TM4 A;  3ISH A;  3IC9 A;  2BYB A;  3PO7 A;  1BGN A;  1S2Y A;  3LXD A;  1CC6 A;  2FJA A;  2JBV A;  1E1L A;  2YLX A;  5U25 A;  4AP3 A;  1S2Q A;  3CNS A;  3IWA A;  2RGO A;  1FCD A;  2TMD A;  4B69 A;  3UKF A;  1P2E A;  4U8O A;  3RHA A;  2FBW A;  3F8R A;  1PBB A;  3NK2 X;  3SXI A;  2YLR A;  3K30 A;  1IJH A;  3VRA A;  4HB9 A;  4II3 A;  3M0O A;  2J3N A;  4JDR A;  3R9U A;  3COX A;  1BF3 A;  3ALL A;  2B7S A;  2C4C A;  2WDR A;  1XDI A;  3AE3 A;  2IVD A;  2C3D A;  3NYF A;  3GYX A;  2ZZB A;  4H4W A;  1GRB A;  2OAL A;  5FS8 A;  2WEU A;  2HQM A;  1L9E A;  2R4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...