1BT9A

Ompf porin mutant d74a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGAAAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability of trimeric OmpF porin: the contributions of the latching loop L2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords PROTEIN (MATRIX PORIN OUTER MEMBRANE PROTEIN F)
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bt9A00
4BUMX 3UPGA 4D64A 6PRNA 4RJWA 5DL7A 3WI5A 3JTYA 2QTKA 3VY8X 2J4UP 3VZUX 1E54A 3SYSA 3SY9A 2PRNA 2ODJA 4FOZA 3O0EA 5DL6A 8PRNA 2FGQX 3EMNX 3SZDA 5FVNA 2XE3A 3VZTX 4RJXA 2Y0HA 4FSOA 3WI4A 4GCQA 2PORA 3NSGA 3VZWX 2XE5A 2O4VA 4FT6A 1HXTA 4FMSA 4D5UA 3T20A 4KR8A 2OMFA 3HWBA 3HW9A 3K19A 3UU2A 4LSHA 1BH3A 1GFNA 4LSEA 4C69X 1GFQA 7PRNA 4LSIA 2ZFGA 3POUA 1PRNA 1H6S1 5DL5A 2ZLDA 3T0SA 5DL8A 4KR4A 2Y0LA 1OSMA 3SZVA 4GCPA 2XE1A 3SY7A 4GCSA 2XE2A 3PRNA 2Y2XA 4FRTA 3POQA 1OPFA 1BT9A 1HXUA 5PRNA 3A2SX 4JFBA 1HXXA 1PHOA 4LSFA 4FSPA 2Y0KA 1GFOA 1MPFA 4KRAA 4AUIA 2FGRA 4FRXA 3PORA 2J1NA 3POXA 2XG6A 4D65A 1GFMA 2K4TA 3SYBA 5JDPA 3FYXA 3T24A 3VY9X 1GFPA
chains in the Genus database with same CATH superfamily
3VE1A 4BUMX 1Q9GA 3LK3B 4O4XA 2YPVA 3UPGA 4D64A 4FZMA 1ZHXA 3G7GA 2R88A 3PQUA 4K3BA 5TISO 3PQSA 2R4PA 3DWOX 2KC0A 4RL9A 4RJWA 5DL7A 5G38A 3WI5A 3JTYA 2QTKA 4G76A 2GE4A 3VY8X 2J4UP 5KAFO 1E54A 3AA0A 3VZUX 5GTIO 4FUVA 4CTDA 3A0HO 3DWNA 4AKRB 3GP6A 3SYSA 4QQ1A 3SY9A 5GTHO 2PRNA 2R4OA 4AYDC 5IYUA 4UB6O 2ODJA 4XNLA 4Z3TA 1MM4A 3O0EA 4FOZA 3UAQA 2R89A 2YNKA 4AYMC 4FZLA 5DL6A 8PRNA 3A0BO 3LK41 2FGQX 5EE2A 4RLCA 4F4BA 3JCUO 3EMNX 3SZDA 3LK3A 5FVNA 4E1TA 5PRNA 2XE3A 3AA6A 1ZHZA 3C5OA 1IZNB 3NJTA 3VZTX 3BRZA 2KZ7A 2M07A 2XTQA 1ORMA 4RJXA 2Y0HA 4FSOA 3WI4A 4GCQA 2PORA 3AA6B 3AA7A 1S5LO 4GF4A 3AAAA 3NSGA 3KZIO 5B5EO 5AFUK 2W80C 5H2FO 2W81C 3AA1B 3VZWX 2XE5A 2F1CX 2XMXA 3PF1A 1ZHYA 4AKRA 2O4VA 4FQEA 4FT6A 1HXTA 2JQYA 4K3CA 5T5FA 4B61A 2K0LA 2WJQA 3PGUA 4FMSA 2M06A 2N2MA 4U9CA 3DA4A 4PJ0O 4D5UA 2JMMA 4O4UA 3QRAA 3T20A 4KR8A 3KVDD 4AYNA 3TZGA 4N58A 2R8AA 5G39A 1Q9FA 2OMFA 3LK42 3QRCA 2F1VA 3HWBA 3HW9A 4FESA 3PGRA 3BRYA 3K19A 4XNKA 2ERVA 1ZHWA 4O49A 4LSHA 3UU2A 1IZNA 1BH3A 4AKMA 4G75A 1GFNA 4LSEA 4PR7A 1QJPA 3LK2B 3PGSA 1GFQA 4N75A 4RLBA 4UB8O 4C69X 1MM5A 5G26A 7PRNA 4LSIA 2ZFGA 2XTRA 2AXTO 3POUA 1PRNA 1THQA 4O3WA 1H6S1 4AZLA 5GV0A 1P4TA 5DL5A 2ZLDA 3T0SA 4N74A 5AFUL 4GHBA 5DL8A 5ADXK 4O3YA 4FZNA 4KR4A 3AA1A 2MHLA 2Y0LA 2KZ7B 1OSMA 4JCHA 4N59A 2N2LA 2KDYA 3SZVA 3DA3A 2WVPA 4GCPA 2XE1A 3SY7A 4GCSA 2XE2A 3PRNA 5KAIO 4C4VB 4C4VA 2Y2XA 6PRNA 4FRTA 3POQA 1YS5A 5G3AA 1OPFA 1BT9A 1HXUA 3WU2O 4O3XB 3A2SX 1BXWA 1HXXA 1QJ9A 3AAEA 1PHOA 2KXPA 4JFBA 2MNHA 5E79O 2R4LA 4LSFA 4FSPA 2LFUA 3VE2A 2Y0KA 1ZHTA 4O3ZA 2KXPB 5D5DA 3AAEB 1GFOA 4PUXA 1MPFA 4KRAA 4AUIA 2Y7SA 4IL6O 2FGRA 4AYEC 4FRXA 4AFKA 2X27X 3PORA 2IWWA 2F1TA 2J1NA 3BS0A 2XG6A 3POXA 5ADXL 4AYID 4D65A 2IWVA 2LHFA 1GFMA 1QJ8A 3AAAB 5B66O 1T16A 4E1SA 3HOEA 1T1LA 2K4TA 3RBHA 3AA7B 1G90A 3SYBA 2X9KA 3V8UA 2WJRA 4C00A 3DZMA 2R4NA 3LK2A 3AA0B 5JDPA 3FYXA 3T24A 3HOLA 3VY9X 1GFPA
chains in the Genus database with same CATH topology
3VE1A 4BUMX 1Q9GA 3LK3B 4O4XA 2YPVA 3UPGA 4D64A 4FZMA 1ZHXA 3G7GA 3PQUA 6PRNA 3PQSA 4RL9A 2KC0A 4RJWA 5DL7A 3WI5A 3JTYA 2QTKA 4G76A 2GE4A 3VY8X 2J4UP 3VZUX 1E54A 3AA0A 4FUVA 4AKRB 3GP6A 3SYSA 4QQ1A 3SY9A 2PRNA 4AYDC 5IYUA 2ODJA 4XNLA 4Z3TA 1MM4A 3O0EA 4FOZA 3UAQA 2YNKA 4AYMC 4FZLA 5DL6A 8PRNA 3LK41 2FGQX 5EE2A 4RLCA 4F4BA 3EMNX 3SZDA 3LK3A 5FVNA 4E1TA 5PRNA 2XE3A 3AA6A 1ZHZA 3C5OA 1IZNB 3VZTX 2KZ7A 2M07A 2XTQA 1ORMA 4RJXA 2Y0HA 4FSOA 3WI4A 4GCQA 2PORA 3AA6B 3AA7A 4GF4A 3AAAA 3NSGA 5AFUK 2W80C 2W81C 3AA1B 3VZWX 2XE5A 2XMXA 4AKRA 1ZHYA 2O4VA 4B61A 4FT6A 1HXTA 5T5FA 2K0LA 4FMSA 2M06A 2N2MA 4U9CA 3DA4A 4D5UA 2JMMA 4O4UA 3QRAA 3T20A 4KR8A 3KVDD 4AYNA 3TZGA 4N58A 1Q9FA 2OMFA 3LK42 3QRCA 2F1VA 3HWBA 3HW9A 4FESA 4XNKA 3K19A 2ERVA 1ZHWA 4O49A 4LSHA 3UU2A 1IZNA 1BH3A 4AKMA 4G75A 1GFNA 4LSEA 1QJPA 3LK2B 4RLBA 1GFQA 4C69X 1MM5A 5G26A 7PRNA 4LSIA 2ZFGA 2XTRA 3POUA 1PRNA 1THQA 4O3WA 1H6S1 4AZLA 5GV0A 1P4TA 5DL5A 2ZLDA 3T0SA 5AFUL 4GHBA 5DL8A 5ADXK 4O3YA 4FZNA 4KR4A 3AA1A 2MHLA 2Y0LA 2KZ7B 1OSMA 4JCHA 4N59A 2N2LA 2KDYA 3SZVA 3DA3A 4GCPA 2XE1A 3SY7A 4GCSA 2XE2A 3PRNA 2Y2XA 4FRTA 3POQA 1YS5A 1OPFA 1BT9A 1HXUA 4O3XB 3A2SX 1BXWA 1HXXA 1QJ9A 3AAEA 1PHOA 2KXPA 4JFBA 2MNHA 4LSFA 4FSPA 2LFUA 3VE2A 2Y0KA 1ZHTA 4O3ZA 2KXPB 5D5DA 3AAEB 1GFOA 4PUXA 1MPFA 4KRAA 4AUIA 2Y7SA 2FGRA 4AYEC 4FRXA 4AFKA 2X27X 3PORA 2F1TA 2J1NA 3POXA 2XG6A 5ADXL 4AYID 4D65A 2LHFA 1GFMA 1QJ8A 3AAAB 4E1SA 3HOEA 2K4TA 3RBHA 3AA7B 1G90A 3SYBA 3V8UA 3LK2A 3AA0B 5JDPA 3FYXA 3T24A 3HOLA 3VY9X 1GFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BUM X;  3UPG A;  4D64 A;  6PRN A;  4RJW A;  5DL7 A;  3WI5 A;  3JTY A;  2QTK A;  3VY8 X;  2J4U P;  3VZU X;  1E54 A;  3SYS A;  3SY9 A;  2PRN A;  2ODJ A;  4FOZ A;  3O0E A;  5DL6 A;  8PRN A;  2FGQ X;  3EMN X;  3SZD A;  5FVN A;  2XE3 A;  3VZT X;  4RJX A;  2Y0H A;  4FSO A;  3WI4 A;  4GCQ A;  2POR A;  3NSG A;  3VZW X;  2XE5 A;  2O4V A;  4FT6 A;  1HXT A;  4FMS A;  4D5U A;  3T20 A;  4KR8 A;  2OMF A;  3HWB A;  3HW9 A;  3K19 A;  3UU2 A;  4LSH A;  1BH3 A;  1GFN A;  4LSE A;  4C69 X;  1GFQ A;  7PRN A;  4LSI A;  2ZFG A;  3POU A;  1PRN A;  1H6S 1;  5DL5 A;  2ZLD A;  3T0S A;  5DL8 A;  4KR4 A;  2Y0L A;  1OSM A;  3SZV A;  4GCP A;  2XE1 A;  3SY7 A;  4GCS A;  2XE2 A;  3PRN A;  2Y2X A;  4FRT A;  3POQ A;  1OPF A;  1BT9 A;  1HXU A;  5PRN A;  3A2S X;  4JFB A;  1HXX A;  1PHO A;  4LSF A;  4FSP A;  2Y0K A;  1GFO A;  1MPF A;  4KRA A;  4AUI A;  2FGR A;  4FRX A;  3POR A;  2J1N A;  3POX A;  2XG6 A;  4D65 A;  1GFM A;  2K4T A;  3SYB A;  5JDP A;  3FYX A;  3T24 A;  3VY9 X;  1GFP A; 
#chains in the Genus database with same CATH topology
 3VE1 A;  4BUM X;  1Q9G A;  3LK3 B;  4O4X A;  2YPV A;  3UPG A;  4D64 A;  4FZM A;  1ZHX A;  3G7G A;  2R88 A;  3PQU A;  4K3B A;  5TIS O;  3PQS A;  2R4P A;  3DWO X;  2KC0 A;  4RL9 A;  4RJW A;  5DL7 A;  5G38 A;  3WI5 A;  3JTY A;  2QTK A;  4G76 A;  2GE4 A;  3VY8 X;  2J4U P;  5KAF O;  1E54 A;  3AA0 A;  3VZU X;  5GTI O;  4FUV A;  4CTD A;  3A0H O;  3DWN A;  4AKR B;  3GP6 A;  3SYS A;  4QQ1 A;  3SY9 A;  5GTH O;  2PRN A;  2R4O A;  4AYD C;  5IYU A;  4UB6 O;  2ODJ A;  4XNL A;  4Z3T A;  1MM4 A;  3O0E A;  4FOZ A;  3UAQ A;  2R89 A;  2YNK A;  4AYM C;  4FZL A;  5DL6 A;  8PRN A;  3A0B O;  3LK4 1;  2FGQ X;  5EE2 A;  4RLC A;  4F4B A;  3JCU O;  3EMN X;  3SZD A;  3LK3 A;  5FVN A;  4E1T A;  5PRN A;  2XE3 A;  3AA6 A;  1ZHZ A;  3C5O A;  1IZN B;  3NJT A;  3VZT X;  3BRZ A;  2KZ7 A;  2M07 A;  2XTQ A;  1ORM A;  4RJX A;  2Y0H A;  4FSO A;  3WI4 A;  4GCQ A;  2POR A;  3AA6 B;  3AA7 A;  1S5L O;  4GF4 A;  3AAA A;  3NSG A;  3KZI O;  5B5E O;  5AFU K;  2W80 C;  5H2F O;  2W81 C;  3AA1 B;  3VZW X;  2XE5 A;  2F1C X;  2XMX A;  3PF1 A;  1ZHY A;  4AKR A;  2O4V A;  4FQE A;  4FT6 A;  1HXT A;  2JQY A;  4K3C A;  5T5F A;  4B61 A;  2K0L A;  2WJQ A;  3PGU A;  4FMS A;  2M06 A;  2N2M A;  4U9C A;  3DA4 A;  4PJ0 O;  4D5U A;  2JMM A;  4O4U A;  3QRA A;  3T20 A;  4KR8 A;  3KVD D;  4AYN A;  3TZG A;  4N58 A;  2R8A A;  5G39 A;  1Q9F A;  2OMF A;  3LK4 2;  3QRC A;  2F1V A;  3HWB A;  3HW9 A;  4FES A;  3PGR A;  3BRY A;  3K19 A;  4XNK A;  2ERV A;  1ZHW A;  4O49 A;  4LSH A;  3UU2 A;  1IZN A;  1BH3 A;  4AKM A;  4G75 A;  1GFN A;  4LSE A;  4PR7 A;  1QJP A;  3LK2 B;  3PGS A;  1GFQ A;  4N75 A;  4RLB A;  4UB8 O;  4C69 X;  1MM5 A;  5G26 A;  7PRN A;  4LSI A;  2ZFG A;  2XTR A;  2AXT O;  3POU A;  1PRN A;  1THQ A;  4O3W A;  1H6S 1;  4AZL A;  5GV0 A;  1P4T A;  5DL5 A;  2ZLD A;  3T0S A;  4N74 A;  5AFU L;  4GHB A;  5DL8 A;  5ADX K;  4O3Y A;  4FZN A;  4KR4 A;  3AA1 A;  2MHL A;  2Y0L A;  2KZ7 B;  1OSM A;  4JCH A;  4N59 A;  2N2L A;  2KDY A;  3SZV A;  3DA3 A;  2WVP A;  4GCP A;  2XE1 A;  3SY7 A;  4GCS A;  2XE2 A;  3PRN A;  5KAI O;  4C4V B;  4C4V A;  2Y2X A;  6PRN A;  4FRT A;  3POQ A;  1YS5 A;  5G3A A;  1OPF A;  1BT9 A;  1HXU A;  3WU2 O;  4O3X B;  3A2S X;  1BXW A;  1HXX A;  1QJ9 A;  3AAE A;  1PHO A;  2KXP A;  4JFB A;  2MNH A;  5E79 O;  2R4L A;  4LSF A;  4FSP A;  2LFU A;  3VE2 A;  2Y0K A;  1ZHT A;  4O3Z A;  2KXP B;  5D5D A;  3AAE B;  1GFO A;  4PUX A;  1MPF A;  4KRA A;  4AUI A;  2Y7S A;  4IL6 O;  2FGR A;  4AYE C;  4FRX A;  4AFK A;  2X27 X;  3POR A;  2IWW A;  2F1T A;  2J1N A;  3BS0 A;  2XG6 A;  3POX A;  5ADX L;  4AYI D;  4D65 A;  2IWV A;  2LHF A;  1GFM A;  1QJ8 A;  3AAA B;  5B66 O;  1T16 A;  4E1S A;  3HOE A;  1T1L A;  2K4T A;  3RBH A;  3AA7 B;  1G90 A;  3SYB A;  2X9K A;  3V8U A;  2WJR A;  4C00 A;  3DZM A;  2R4N A;  3LK2 A;  3AA0 B;  5JDP A;  3FYX A;  3T24 A;  3HOL A;  3VY9 X;  1GFP A; 
#chains in the Genus database with same CATH homology
 3VE1 A;  4BUM X;  1Q9G A;  3LK3 B;  4O4X A;  2YPV A;  3UPG A;  4D64 A;  4FZM A;  1ZHX A;  3G7G A;  3PQU A;  6PRN A;  3PQS A;  4RL9 A;  2KC0 A;  4RJW A;  5DL7 A;  3WI5 A;  3JTY A;  2QTK A;  4G76 A;  2GE4 A;  3VY8 X;  2J4U P;  3VZU X;  1E54 A;  3AA0 A;  4FUV A;  4AKR B;  3GP6 A;  3SYS A;  4QQ1 A;  3SY9 A;  2PRN A;  4AYD C;  5IYU A;  2ODJ A;  4XNL A;  4Z3T A;  1MM4 A;  3O0E A;  4FOZ A;  3UAQ A;  2YNK A;  4AYM C;  4FZL A;  5DL6 A;  8PRN A;  3LK4 1;  2FGQ X;  5EE2 A;  4RLC A;  4F4B A;  3EMN X;  3SZD A;  3LK3 A;  5FVN A;  4E1T A;  5PRN A;  2XE3 A;  3AA6 A;  1ZHZ A;  3C5O A;  1IZN B;  3VZT X;  2KZ7 A;  2M07 A;  2XTQ A;  1ORM A;  4RJX A;  2Y0H A;  4FSO A;  3WI4 A;  4GCQ A;  2POR A;  3AA6 B;  3AA7 A;  4GF4 A;  3AAA A;  3NSG A;  5AFU K;  2W80 C;  2W81 C;  3AA1 B;  3VZW X;  2XE5 A;  2XMX A;  4AKR A;  1ZHY A;  2O4V A;  4B61 A;  4FT6 A;  1HXT A;  5T5F A;  2K0L A;  4FMS A;  2M06 A;  2N2M A;  4U9C A;  3DA4 A;  4D5U A;  2JMM A;  4O4U A;  3QRA A;  3T20 A;  4KR8 A;  3KVD D;  4AYN A;  3TZG A;  4N58 A;  1Q9F A;  2OMF A;  3LK4 2;  3QRC A;  2F1V A;  3HWB A;  3HW9 A;  4FES A;  4XNK A;  3K19 A;  2ERV A;  1ZHW A;  4O49 A;  4LSH A;  3UU2 A;  1IZN A;  1BH3 A;  4AKM A;  4G75 A;  1GFN A;  4LSE A;  1QJP A;  3LK2 B;  4RLB A;  1GFQ A;  4C69 X;  1MM5 A;  5G26 A;  7PRN A;  4LSI A;  2ZFG A;  2XTR A;  3POU A;  1PRN A;  1THQ A;  4O3W A;  1H6S 1;  4AZL A;  5GV0 A;  1P4T A;  5DL5 A;  2ZLD A;  3T0S A;  5AFU L;  4GHB A;  5DL8 A;  5ADX K;  4O3Y A;  4FZN A;  4KR4 A;  3AA1 A;  2MHL A;  2Y0L A;  2KZ7 B;  1OSM A;  4JCH A;  4N59 A;  2N2L A;  2KDY A;  3SZV A;  3DA3 A;  4GCP A;  2XE1 A;  3SY7 A;  4GCS A;  2XE2 A;  3PRN A;  2Y2X A;  4FRT A;  3POQ A;  1YS5 A;  1OPF A;  1BT9 A;  1HXU A;  4O3X B;  3A2S X;  1BXW A;  1HXX A;  1QJ9 A;  3AAE A;  1PHO A;  2KXP A;  4JFB A;  2MNH A;  4LSF A;  4FSP A;  2LFU A;  3VE2 A;  2Y0K A;  1ZHT A;  4O3Z A;  2KXP B;  5D5D A;  3AAE B;  1GFO A;  4PUX A;  1MPF A;  4KRA A;  4AUI A;  2Y7S A;  2FGR A;  4AYE C;  4FRX A;  4AFK A;  2X27 X;  3POR A;  2F1T A;  2J1N A;  3POX A;  2XG6 A;  5ADX L;  4AYI D;  4D65 A;  2LHF A;  1GFM A;  1QJ8 A;  3AAA B;  4E1S A;  3HOE A;  2K4T A;  3RBH A;  3AA7 B;  1G90 A;  3SYB A;  3V8U A;  3LK2 A;  3AA0 B;  5JDP A;  3FYX A;  3T24 A;  3HOL A;  3VY9 X;  1GFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...