1BT9A

Ompf porin mutant d74a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGAAAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords PROTEIN (MATRIX PORIN OUTER MEMBRANE PROTEIN F)
publication title Stability of trimeric OmpF porin: the contributions of the latching loop L2.
pubmed doi rcsb
source organism Escherichia coli
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bt9A00
2Y0LA 2PORA 3SYSA 3A2SX 3SY9A 2OMFA 4FSPA 4RJXA 2ODJA 5FVNA 3NSGA 3HWBA 4LSFA 4FMSA 4LSEA 5DL6A 2XG6A 3UPGA 1MPFA 2XE2A 3POXA 1PHOA 4GCQA 4GCPA 3EMNX 2Y0KA 1E54A 2Y2XA 1BT9A 2FGQX 5PRNA 3SZDA 3T0SA 3VZWX 3SY7A 4KR8A 3SYBA 3WI4A 2PRNA 4D65A 4JFBA 1GFPA 5JDPA 3JTYA 4FRXA 1HXXA 1GFNA 4FOZA 4LSIA 3VZUX 1H6S1 2J1NA 3UU2A 2QTKA 2J4UP 4KRAA 3VZTX 2Y0HA 2XE1A 3K19A 2K4TA 4BUMX 4GCSA 4FRTA 3VY8X 1GFMA 2XE3A 3VY9X 4C69X 4FT6A 3T24A 5DL5A 4D5UA 2FGRA 4D64A 3POUA 2ZLDA 5DL7A 1GFOA 3WI5A 4RJWA 1HXUA 4KR4A 2XE5A 1PRNA 3FYXA 3PRNA 4LSHA 3SZVA 1GFQA 3PORA 3T20A 3O0EA 4FSOA 5DL8A 3HW9A 1HXTA 1BH3A 7PRNA 2ZFGA 1OSMA 4AUIA 3POQA 1OPFA 2O4VA 8PRNA 6PRNA
chains in the Genus database with same CATH superfamily
3PGUA 2Y0LA 2PORA 4PUXA 4XNLA 5G39A 2WVPA 3A2SX 3JCUO 4O4UA 3SYSA 3SY9A 1MM4A 2OMFA 4GHBA 4E1TA 1IZNB 2KC0A 3LK2B 4FSPA 4RJXA 3HOLA 2ODJA 5FVNA 3NSGA 3HWBA 1ZHTA 2XTRA 4F4BA 4C00A 2R4LA 3AA0A 4LSFA 4FMSA 3PF1A 2W81C 4G75A 1Q9GA 4LSEA 5DL6A 4AYID 2XG6A 4AYEC 4RLCA 1S5LO 2X9KA 3UPGA 4O49A 2R4OA 1MPFA 3AAAB 4PR7A 3PGRA 4AYDC 4AKRB 2XE2A 3POXA 4FQEA 4C4VA 3A0BO 5B66O 2KXPA 1PHOA 4GCQA 5EE2A 4E1SA 4FZLA 4GCPA 2Y0KA 2KZ7B 3EMNX 1E54A 2M07A 3V8UA 2Y2XA 4O3ZA 1BT9A 2FGQX 3PQSA 1QJ9A 5PRNA 3SZDA 2K0LA 3T0SA 2AXTO 4IL6O 3VZWX 3SY7A 5TISO 5E79O 4QQ1A 4KR8A 1ORMA 3BRZA 4O4XA 3SYBA 2PRNA 2W80C 4JFBA 3BRYA 3WI4A 4D65A 1GFPA 2YNKA 3DWNA 1T1LA 1T16A 3JTYA 4N59A 3AA0B 2JMMA 3BS0A 5JDPA 2R4NA 4FRXA 4O3YA 3C5OA 1HXXA 4O3WA 1GFNA 3DZMA 2LHFA 3QRAA 3VE2A 4FOZA 4N74A 4AKMA 4PJ0O 3WU2O 5ADXL 1ZHYA 2N2MA 4K3BA 4LSIA 3VZUX 5GTHO 3DWOX 1Q9FA 1H6S1 2J1NA 3UU2A 1MM5A 3DA4A 2QTKA 1BXWA 2KXPB 2MHLA 4FESA 4KRAA 1P4TA 4AZLA 2J4UP 3VZTX 5AFUK 2Y7SA 2Y0HA 2WJRA 4XNKA 2XE1A 3K19A 2LFUA 2GE4A 5B5EO 5ADXK 3GP6A 2K4TA 2R8AA 3AA7A 1G90A 4BUMX 4GCSA 4FRTA 3VY8X 2M06A 2R4PA 2XTQA 3UAQA 3AA6A 1GFMA 2XE3A 4JCHA 3AAEA 3VY9X 4C69X 4AFKA 4FT6A 3T24A 5DL5A 2JQYA 3LK41 3LK3A 4RLBA 2YPVA 5G26A 4D5UA 5KAIO 2FGRA 2F1VA 4FUVA 4UB6O 4D64A 5IYUA 3AA1A 3QRCA 4AYMC 4K3CA 3POUA 3TZGA 1QJ8A 3VE1A 2ZLDA 4O3XB 5AFUL 5DL7A 4CTDA 5GV0A 1GFOA 3KVDD 3WI5A 1ZHZA 4UB8O 4AYNA 2N2LA 4FZNA 3KZIO 4FZMA 4RJWA 1HXUA 1QJPA 4Z3TA 2KDYA 3AA7B 3NJTA 4KR4A 4C4VB 2IWWA 2XE5A 1IZNA 1PRNA 2R89A 3LK2A 3FYXA 4RL9A 1YS5A 2X27X 3A0HO 3AA6B 3HOEA 3LK42 3PRNA 2MNHA 1THQA 3G7GA 2IWVA 4G76A 4LSHA 3AAEB 1ZHXA 2WJQA 4U9CA 3RBHA 3SZVA 4N58A 5G38A 1GFQA 3PORA 5T5FA 5D5DA 2R88A 2F1CX 3LK3B 3T20A 4B61A 3O0EA 4FSOA 5DL8A 5KAFO 1ZHWA 3HW9A 1HXTA 3AAAA 3AA1B 4N75A 1BH3A 2ERVA 2XMXA 4AKRA 7PRNA 5G3AA 4GF4A 6PRNA 2ZFGA 3PQUA 1OSMA 4AUIA 5GTIO 3POQA 2F1TA 2KZ7A 3PGSA 1OPFA 5H2FO 2O4VA 8PRNA 3DA3A
chains in the Genus database with same CATH topology
2Y0LA 2PORA 4PUXA 4XNLA 3SYSA 3A2SX 4O4UA 3SY9A 1MM4A 2OMFA 4GHBA 4E1TA 1IZNB 2KC0A 3LK2B 4FSPA 4RJXA 3HOLA 2ODJA 5FVNA 3NSGA 3HWBA 1ZHTA 2XTRA 4F4BA 3AA0A 4LSFA 4FMSA 4G75A 2W81C 1Q9GA 4LSEA 5DL6A 4AYID 2XG6A 4AYEC 4RLCA 3UPGA 4O49A 1MPFA 3AAAB 4AYDC 4AKRB 2XE2A 3POXA 2KXPA 1PHOA 4GCQA 5EE2A 4E1SA 4FZLA 4GCPA 2Y0KA 2KZ7B 3EMNX 1E54A 2M07A 3V8UA 2Y2XA 4O3ZA 1BT9A 2FGQX 3PQSA 1QJ9A 5PRNA 3SZDA 2K0LA 3T0SA 3VZWX 3SY7A 4QQ1A 4KR8A 1ORMA 4O4XA 3SYBA 3WI4A 2PRNA 2W80C 4JFBA 4D65A 1GFPA 2YNKA 5JDPA 3JTYA 4N59A 3AA0B 2JMMA 4FRXA 4O3YA 3C5OA 1HXXA 4O3WA 1GFNA 3QRAA 2LHFA 3VE2A 4AKMA 4FOZA 5ADXL 1ZHYA 2N2MA 4LSIA 3VZUX 1Q9FA 1H6S1 2J1NA 3UU2A 1MM5A 3DA4A 2QTKA 1BXWA 2KXPB 2MHLA 4FESA 4KRAA 1P4TA 4AZLA 2J4UP 3VZTX 5AFUK 2Y7SA 2Y0HA 2XE1A 3K19A 2LFUA 2GE4A 5ADXK 3GP6A 2K4TA 3AA7A 4BUMX 4GCSA 4FRTA 3VY8X 2M06A 2XTQA 3UAQA 3AA6A 1GFMA 2XE3A 4JCHA 3AAEA 3VY9X 4C69X 4AFKA 4FT6A 3T24A 5DL5A 3LK41 3LK3A 4RLBA 2YPVA 5G26A 4D5UA 2FGRA 2F1VA 4FUVA 4D64A 5IYUA 3AA1A 3QRCA 3POUA 3TZGA 1QJ8A 3VE1A 2ZLDA 4O3XB 5AFUL 5DL7A 5GV0A 1GFOA 3KVDD 3WI5A 1ZHZA 1G90A 4AYNA 2N2LA 4FZNA 4FZMA 4RJWA 1HXUA 1QJPA 4Z3TA 2KDYA 3AA7B 4KR4A 2XE5A 1IZNA 1PRNA 3LK2A 3FYXA 4RL9A 1YS5A 2X27X 3HOEA 3AA6B 3LK42 3PRNA 2MNHA 1THQA 3G7GA 4XNKA 4G76A 4LSHA 3AAEB 1ZHXA 4U9CA 3RBHA 3SZVA 4AYMC 4N58A 1GFQA 3PORA 5T5FA 5D5DA 3LK3B 3T20A 4B61A 3O0EA 4FSOA 5DL8A 1ZHWA 3HW9A 1HXTA 3AAAA 3AA1B 1BH3A 2ERVA 2XMXA 4AKRA 7PRNA 4GF4A 6PRNA 2ZFGA 3PQUA 1OSMA 4AUIA 3POQA 2F1TA 2KZ7A 1OPFA 2O4VA 8PRNA 3DA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0L A;  2POR A;  3SYS A;  3A2S X;  3SY9 A;  2OMF A;  4FSP A;  4RJX A;  2ODJ A;  5FVN A;  3NSG A;  3HWB A;  4LSF A;  4FMS A;  4LSE A;  5DL6 A;  2XG6 A;  3UPG A;  1MPF A;  2XE2 A;  3POX A;  1PHO A;  4GCQ A;  4GCP A;  3EMN X;  2Y0K A;  1E54 A;  2Y2X A;  1BT9 A;  2FGQ X;  5PRN A;  3SZD A;  3T0S A;  3VZW X;  3SY7 A;  4KR8 A;  3SYB A;  3WI4 A;  2PRN A;  4D65 A;  4JFB A;  1GFP A;  5JDP A;  3JTY A;  4FRX A;  1HXX A;  1GFN A;  4FOZ A;  4LSI A;  3VZU X;  1H6S 1;  2J1N A;  3UU2 A;  2QTK A;  2J4U P;  4KRA A;  3VZT X;  2Y0H A;  2XE1 A;  3K19 A;  2K4T A;  4BUM X;  4GCS A;  4FRT A;  3VY8 X;  1GFM A;  2XE3 A;  3VY9 X;  4C69 X;  4FT6 A;  3T24 A;  5DL5 A;  4D5U A;  2FGR A;  4D64 A;  3POU A;  2ZLD A;  5DL7 A;  1GFO A;  3WI5 A;  4RJW A;  1HXU A;  4KR4 A;  2XE5 A;  1PRN A;  3FYX A;  3PRN A;  4LSH A;  3SZV A;  1GFQ A;  3POR A;  3T20 A;  3O0E A;  4FSO A;  5DL8 A;  3HW9 A;  1HXT A;  1BH3 A;  7PRN A;  2ZFG A;  1OSM A;  4AUI A;  3POQ A;  1OPF A;  2O4V A;  8PRN A;  6PRN A; 
#chains in the Genus database with same CATH topology
 3PGU A;  2Y0L A;  2POR A;  4PUX A;  4XNL A;  5G39 A;  2WVP A;  3A2S X;  3JCU O;  4O4U A;  3SYS A;  3SY9 A;  1MM4 A;  2OMF A;  4GHB A;  4E1T A;  1IZN B;  2KC0 A;  3LK2 B;  4FSP A;  4RJX A;  3HOL A;  2ODJ A;  5FVN A;  3NSG A;  3HWB A;  1ZHT A;  2XTR A;  4F4B A;  4C00 A;  2R4L A;  3AA0 A;  4LSF A;  4FMS A;  3PF1 A;  2W81 C;  4G75 A;  1Q9G A;  4LSE A;  5DL6 A;  4AYI D;  2XG6 A;  4AYE C;  4RLC A;  1S5L O;  2X9K A;  3UPG A;  4O49 A;  2R4O A;  1MPF A;  3AAA B;  4PR7 A;  3PGR A;  4AYD C;  4AKR B;  2XE2 A;  3POX A;  4FQE A;  4C4V A;  3A0B O;  5B66 O;  2KXP A;  1PHO A;  4GCQ A;  5EE2 A;  4E1S A;  4FZL A;  4GCP A;  2Y0K A;  2KZ7 B;  3EMN X;  1E54 A;  2M07 A;  3V8U A;  2Y2X A;  4O3Z A;  1BT9 A;  2FGQ X;  3PQS A;  1QJ9 A;  5PRN A;  3SZD A;  2K0L A;  3T0S A;  2AXT O;  4IL6 O;  3VZW X;  3SY7 A;  5TIS O;  5E79 O;  4QQ1 A;  4KR8 A;  1ORM A;  3BRZ A;  4O4X A;  3SYB A;  2PRN A;  2W80 C;  4JFB A;  3BRY A;  3WI4 A;  4D65 A;  1GFP A;  2YNK A;  3DWN A;  1T1L A;  1T16 A;  3JTY A;  4N59 A;  3AA0 B;  2JMM A;  3BS0 A;  5JDP A;  2R4N A;  4FRX A;  4O3Y A;  3C5O A;  1HXX A;  4O3W A;  1GFN A;  3DZM A;  2LHF A;  3QRA A;  3VE2 A;  4FOZ A;  4N74 A;  4AKM A;  4PJ0 O;  3WU2 O;  5ADX L;  1ZHY A;  2N2M A;  4K3B A;  4LSI A;  3VZU X;  5GTH O;  3DWO X;  1Q9F A;  1H6S 1;  2J1N A;  3UU2 A;  1MM5 A;  3DA4 A;  2QTK A;  1BXW A;  2KXP B;  2MHL A;  4FES A;  4KRA A;  1P4T A;  4AZL A;  2J4U P;  3VZT X;  5AFU K;  2Y7S A;  2Y0H A;  2WJR A;  4XNK A;  2XE1 A;  3K19 A;  2LFU A;  2GE4 A;  5B5E O;  5ADX K;  3GP6 A;  2K4T A;  2R8A A;  3AA7 A;  1G90 A;  4BUM X;  4GCS A;  4FRT A;  3VY8 X;  2M06 A;  2R4P A;  2XTQ A;  3UAQ A;  3AA6 A;  1GFM A;  2XE3 A;  4JCH A;  3AAE A;  3VY9 X;  4C69 X;  4AFK A;  4FT6 A;  3T24 A;  5DL5 A;  2JQY A;  3LK4 1;  3LK3 A;  4RLB A;  2YPV A;  5G26 A;  4D5U A;  5KAI O;  2FGR A;  2F1V A;  4FUV A;  4UB6 O;  4D64 A;  5IYU A;  3AA1 A;  3QRC A;  4AYM C;  4K3C A;  3POU A;  3TZG A;  1QJ8 A;  3VE1 A;  2ZLD A;  4O3X B;  5AFU L;  5DL7 A;  4CTD A;  5GV0 A;  1GFO A;  3KVD D;  3WI5 A;  1ZHZ A;  4UB8 O;  4AYN A;  2N2L A;  4FZN A;  3KZI O;  4FZM A;  4RJW A;  1HXU A;  1QJP A;  4Z3T A;  2KDY A;  3AA7 B;  3NJT A;  4KR4 A;  4C4V B;  2IWW A;  2XE5 A;  1IZN A;  1PRN A;  2R89 A;  3LK2 A;  3FYX A;  4RL9 A;  1YS5 A;  2X27 X;  3A0H O;  3AA6 B;  3HOE A;  3LK4 2;  3PRN A;  2MNH A;  1THQ A;  3G7G A;  2IWV A;  4G76 A;  4LSH A;  3AAE B;  1ZHX A;  2WJQ A;  4U9C A;  3RBH A;  3SZV A;  4N58 A;  5G38 A;  1GFQ A;  3POR A;  5T5F A;  5D5D A;  2R88 A;  2F1C X;  3LK3 B;  3T20 A;  4B61 A;  3O0E A;  4FSO A;  5DL8 A;  5KAF O;  1ZHW A;  3HW9 A;  1HXT A;  3AAA A;  3AA1 B;  4N75 A;  1BH3 A;  2ERV A;  2XMX A;  4AKR A;  7PRN A;  5G3A A;  4GF4 A;  6PRN A;  2ZFG A;  3PQU A;  1OSM A;  4AUI A;  5GTI O;  3POQ A;  2F1T A;  2KZ7 A;  3PGS A;  1OPF A;  5H2F O;  2O4V A;  8PRN A;  3DA3 A; 
#chains in the Genus database with same CATH homology
 2Y0L A;  2POR A;  4PUX A;  4XNL A;  3SYS A;  3A2S X;  4O4U A;  3SY9 A;  1MM4 A;  2OMF A;  4GHB A;  4E1T A;  1IZN B;  2KC0 A;  3LK2 B;  4FSP A;  4RJX A;  3HOL A;  2ODJ A;  5FVN A;  3NSG A;  3HWB A;  1ZHT A;  2XTR A;  4F4B A;  3AA0 A;  4LSF A;  4FMS A;  4G75 A;  2W81 C;  1Q9G A;  4LSE A;  5DL6 A;  4AYI D;  2XG6 A;  4AYE C;  4RLC A;  3UPG A;  4O49 A;  1MPF A;  3AAA B;  4AYD C;  4AKR B;  2XE2 A;  3POX A;  2KXP A;  1PHO A;  4GCQ A;  5EE2 A;  4E1S A;  4FZL A;  4GCP A;  2Y0K A;  2KZ7 B;  3EMN X;  1E54 A;  2M07 A;  3V8U A;  2Y2X A;  4O3Z A;  1BT9 A;  2FGQ X;  3PQS A;  1QJ9 A;  5PRN A;  3SZD A;  2K0L A;  3T0S A;  3VZW X;  3SY7 A;  4QQ1 A;  4KR8 A;  1ORM A;  4O4X A;  3SYB A;  3WI4 A;  2PRN A;  2W80 C;  4JFB A;  4D65 A;  1GFP A;  2YNK A;  5JDP A;  3JTY A;  4N59 A;  3AA0 B;  2JMM A;  4FRX A;  4O3Y A;  3C5O A;  1HXX A;  4O3W A;  1GFN A;  3QRA A;  2LHF A;  3VE2 A;  4AKM A;  4FOZ A;  5ADX L;  1ZHY A;  2N2M A;  4LSI A;  3VZU X;  1Q9F A;  1H6S 1;  2J1N A;  3UU2 A;  1MM5 A;  3DA4 A;  2QTK A;  1BXW A;  2KXP B;  2MHL A;  4FES A;  4KRA A;  1P4T A;  4AZL A;  2J4U P;  3VZT X;  5AFU K;  2Y7S A;  2Y0H A;  2XE1 A;  3K19 A;  2LFU A;  2GE4 A;  5ADX K;  3GP6 A;  2K4T A;  3AA7 A;  4BUM X;  4GCS A;  4FRT A;  3VY8 X;  2M06 A;  2XTQ A;  3UAQ A;  3AA6 A;  1GFM A;  2XE3 A;  4JCH A;  3AAE A;  3VY9 X;  4C69 X;  4AFK A;  4FT6 A;  3T24 A;  5DL5 A;  3LK4 1;  3LK3 A;  4RLB A;  2YPV A;  5G26 A;  4D5U A;  2FGR A;  2F1V A;  4FUV A;  4D64 A;  5IYU A;  3AA1 A;  3QRC A;  3POU A;  3TZG A;  1QJ8 A;  3VE1 A;  2ZLD A;  4O3X B;  5AFU L;  5DL7 A;  5GV0 A;  1GFO A;  3KVD D;  3WI5 A;  1ZHZ A;  1G90 A;  4AYN A;  2N2L A;  4FZN A;  4FZM A;  4RJW A;  1HXU A;  1QJP A;  4Z3T A;  2KDY A;  3AA7 B;  4KR4 A;  2XE5 A;  1IZN A;  1PRN A;  3LK2 A;  3FYX A;  4RL9 A;  1YS5 A;  2X27 X;  3HOE A;  3AA6 B;  3LK4 2;  3PRN A;  2MNH A;  1THQ A;  3G7G A;  4XNK A;  4G76 A;  4LSH A;  3AAE B;  1ZHX A;  4U9C A;  3RBH A;  3SZV A;  4AYM C;  4N58 A;  1GFQ A;  3POR A;  5T5F A;  5D5D A;  3LK3 B;  3T20 A;  4B61 A;  3O0E A;  4FSO A;  5DL8 A;  1ZHW A;  3HW9 A;  1HXT A;  3AAA A;  3AA1 B;  1BH3 A;  2ERV A;  2XMX A;  4AKR A;  7PRN A;  4GF4 A;  6PRN A;  2ZFG A;  3PQU A;  1OSM A;  4AUI A;  3POQ A;  2F1T A;  2KZ7 A;  1OPF A;  2O4V A;  8PRN A;  3DA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...