1BT9A

Ompf porin mutant d74a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGAAAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MATRIX PORIN OUTER MEMBRANE PROTEIN F)
publication title Stability of trimeric OmpF porin: the contributions of the latching loop L2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bt9A00
2ODJA 4FMSA 3SZDA 1GFOA 5FVNA 1HXTA 4GCQA 2QTKA 4RJWA 4D5UA 1GFQA 4FSPA 2Y2XA 4LSIA 4KRAA 4D64A 4D65A 2PORA 5JDPA 3WI4A 2K4TA 1OPFA 3PRNA 4LSFA 4JFBA 3EMNX 1BT9A 3SY7A 5DL8A 3T24A 1MPFA 1HXUA 2XE2A 8PRNA 1H6S1 5DL7A 4BUMX 4C69X 4FT6A 4LSEA 7PRNA 1PRNA 1GFMA 2FGRA 3HW9A 3HWBA 3PORA 3VZTX 1PHOA 2XE3A 4FRXA 3UU2A 3VY8X 2XE5A 3POXA 4RJXA 5DL5A 6PRNA 3POQA 2OMFA 3NSGA 1HXXA 3O0EA 4GCSA 3VZWX 3VZUX 2Y0KA 3UPGA 2Y0HA 2ZLDA 4KR4A 4AUIA 4FSOA 1OSMA 3K19A 3VY9X 2J4UP 3POUA 3SYBA 1E54A 2FGQX 3WI5A 5PRNA 2ZFGA 2O4VA 4KR8A 5DL6A 2PRNA 4LSHA 2J1NA 3SZVA 3A2SX 3T0SA 1BH3A 3T20A 4FRTA 1GFNA 4FOZA 3SY9A 4GCPA 3SYSA 2XE1A 2Y0LA 1GFPA 3JTYA 2XG6A 3FYXA
chains in the Genus database with same CATH superfamily
3QRCA 2ODJA 3LK3B 3PGUA 2R4NA 2MNHA 4FMSA 3BRYA 2K0LA 2XMXA 4O3XB 3SZDA 5T5FA 1GFOA 5FVNA 1HXTA 5KAIO 5H2FO 1YS5A 2QTKA 1ZHZA 4GCQA 3LK41 4QQ1A 3PF1A 5G38A 5GTHO 4G75A 1P4TA 5GV0A 4RJWA 3AA0B 4D5UA 4AYDC 1GFQA 5AFUL 5GTIO 1MM5A 4UB8O 3AA6A 4AZLA 4FSPA 4N59A 4FZNA 2Y2XA 3AAAA 3LK2A 4LSIA 3AA1B 4KRAA 4D64A 2KXPB 2F1CX 2LFUA 3BRZA 5B5EO 4D65A 3LK3A 2M07A 2PORA 2YPVA 2LHFA 3AAEB 3UAQA 4JCHA 4K3CA 3WI4A 5JDPA 4E1TA 2K4TA 3C5OA 4PR7A 3PGRA 3HOLA 4FZMA 5AFUK 4O4XA 2XTRA 4O3WA 1QJ9A 1OPFA 3QRAA 3AA0A 3PRNA 4LSFA 1MM4A 2F1TA 4JFBA 2R88A 2W80C 3EMNX 3G7GA 1BT9A 3GP6A 3SY7A 5ADXL 3JCUO 5DL8A 4AKRB 3AA1A 1Q9FA 5IYUA 3T24A 2KXPA 2R89A 4U9CA 4C00A 1ZHXA 1MPFA 1HXUA 3AA7B 2XE2A 1IZNB 4FUVA 3AAEA 8PRNA 1H6S1 3HOEA 2X9KA 3DWOX 4O3ZA 5DL7A 3RBHA 5E79O 3LK42 4BUMX 1THQA 1Q9GA 2ERVA 2JQYA 4C69X 4AFKA 4FT6A 2AXTO 4LSEA 2IWVA 2KZ7B 4G76A 7PRNA 1PRNA 2KDYA 4XNKA 1GFMA 2MHLA 1ZHTA 4AKRA 2FGRA 4O49A 1QJ8A 3PGSA 3HW9A 3AA7A 3HWBA 3PORA 2M06A 5G39A 3VZTX 1IZNA 3WU2O 4AKMA 5G3AA 4PUXA 4UB6O 1ORMA 4F4BA 1PHOA 4AYMC 5B66O 3DWNA 2XE3A 4FRXA 3UU2A 3VY8X 2XE5A 4N75A 3POXA 4RJXA 5DL5A 6PRNA 2JMMA 3NJTA 3POQA 2OMFA 3KVDD 2KZ7A 1T16A 4N58A 2N2MA 3NSGA 1HXXA 3O0EA 2KC0A 3PQUA 2R4PA 4GCSA 4FZLA 3VZUX 3VZWX 2Y0KA 2WVPA 4O3YA 3UPGA 2Y0HA 2R4OA 2R8AA 2ZLDA 3DA3A 3VE1A 4KR4A 4AYNA 4AUIA 4FSOA 4C4VB 2Y7SA 4IL6O 1OSMA 1ZHYA 3K19A 3VE2A 3VY9X 4Z3TA 5ADXK 3POUA 2IWWA 4RLCA 2J4UP 4RL9A 3SYBA 1E54A 2W81C 2F1VA 2FGQX 4FESA 5G26A 1S5LO 3WI5A 4GHBA 5PRNA 4O4UA 2ZFGA 2O4VA 3PQSA 4AYID 4PJ0O 4KR8A 5DL6A 5KAFO 1G90A 2PRNA 4LSHA 5TISO 2J1NA 3A0BO 2YNKA 2N2LA 3A0HO 3SZVA 3A2SX 3T0SA 3V8UA 1BH3A 4C4VA 3T20A 2WJQA 1QJPA 2XTQA 3DZMA 1GFNA 3KZIO 1BXWA 4FOZA 4FRTA 2GE4A 4FQEA 3SY9A 4AYEC 3DA4A 2WJRA 4GCPA 4N74A 3SYSA 2XE1A 2Y0LA 5D5DA 1GFPA 3JTYA 4RLBA 1ZHWA 1T1LA 3AA6B 3AAAB 3LK2B 3TZGA 4GF4A 2X27X 3BS0A 4K3BA 4CTDA 4E1SA 2XG6A 4XNLA 3FYXA 5EE2A 2R4LA 4B61A
chains in the Genus database with same CATH topology
3QRCA 2ODJA 3LK3B 2MNHA 4FMSA 3SZDA 2K0LA 2XMXA 4O3XB 5T5FA 1GFOA 5FVNA 1HXTA 1YS5A 2QTKA 1ZHZA 4GCQA 3LK41 4QQ1A 4G75A 1P4TA 5GV0A 4RJWA 3AA0B 4D5UA 4AYDC 1GFQA 5AFUL 1MM5A 3AA6A 4AZLA 4FSPA 4N59A 4FZNA 2Y2XA 3AAAA 3LK2A 4LSIA 3AA1B 4KRAA 4D64A 2KXPB 2LFUA 4D65A 3LK3A 2M07A 2PORA 2YPVA 2LHFA 3AAEB 3UAQA 4JCHA 3WI4A 5JDPA 4E1TA 2K4TA 3C5OA 3HOLA 4FZMA 5AFUK 4O4XA 2XTRA 4O3WA 1QJ9A 1OPFA 3QRAA 3AA0A 3PRNA 4LSFA 1MM4A 2F1TA 4JFBA 2W80C 3EMNX 3G7GA 1BT9A 3GP6A 3SY7A 5ADXL 5DL8A 4AKRB 5IYUA 3AA1A 1Q9FA 3T24A 2KXPA 4U9CA 1ZHXA 1MPFA 1HXUA 3AA7B 2XE2A 1IZNB 4FUVA 3AAEA 8PRNA 1H6S1 3HOEA 4O3ZA 5DL7A 3RBHA 4BUMX 3LK42 1THQA 1Q9GA 2ERVA 4C69X 4AFKA 4FT6A 4LSEA 2KZ7B 4G76A 7PRNA 1PRNA 2KDYA 4XNKA 1GFMA 2MHLA 1ZHTA 4AKRA 2FGRA 4O49A 1QJ8A 3HW9A 3AA7A 3HWBA 3PORA 2M06A 3VZTX 4AKMA 1IZNA 4PUXA 1ORMA 4F4BA 1PHOA 4AYMC 2XE3A 4FRXA 3UU2A 3VY8X 2XE5A 3POXA 4RJXA 5DL5A 6PRNA 2JMMA 3POQA 2OMFA 3KVDD 2KZ7A 4N58A 2N2MA 3NSGA 1HXXA 3O0EA 2KC0A 3PQUA 4GCSA 4FZLA 3VZUX 3VZWX 2Y0KA 4O3YA 3UPGA 2Y0HA 3DA3A 2ZLDA 3VE1A 4AYNA 4KR4A 4AUIA 4FSOA 2Y7SA 1OSMA 1ZHYA 3K19A 3VE2A 3VY9X 4Z3TA 5ADXK 3POUA 2J4UP 4RLCA 4RL9A 3SYBA 1E54A 2W81C 2F1VA 2FGQX 4FESA 5G26A 3WI5A 4GHBA 5PRNA 4O4UA 2ZFGA 2O4VA 3PQSA 4AYID 4KR8A 5DL6A 1G90A 2PRNA 4LSHA 2J1NA 2YNKA 2N2LA 3SZVA 3A2SX 3T0SA 3V8UA 1BH3A 3T20A 1QJPA 2XTQA 4FRTA 1GFNA 4FOZA 1BXWA 3SY9A 2GE4A 4AYEC 3DA4A 4GCPA 3SYSA 2XE1A 2Y0LA 5D5DA 1GFPA 3JTYA 4RLBA 1ZHWA 3AA6B 3AAAB 3LK2B 3TZGA 4GF4A 2X27X 4E1SA 2XG6A 4XNLA 3FYXA 5EE2A 4B61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODJ A;  4FMS A;  3SZD A;  1GFO A;  5FVN A;  1HXT A;  4GCQ A;  2QTK A;  4RJW A;  4D5U A;  1GFQ A;  4FSP A;  2Y2X A;  4LSI A;  4KRA A;  4D64 A;  4D65 A;  2POR A;  5JDP A;  3WI4 A;  2K4T A;  1OPF A;  3PRN A;  4LSF A;  4JFB A;  3EMN X;  1BT9 A;  3SY7 A;  5DL8 A;  3T24 A;  1MPF A;  1HXU A;  2XE2 A;  8PRN A;  1H6S 1;  5DL7 A;  4BUM X;  4C69 X;  4FT6 A;  4LSE A;  7PRN A;  1PRN A;  1GFM A;  2FGR A;  3HW9 A;  3HWB A;  3POR A;  3VZT X;  1PHO A;  2XE3 A;  4FRX A;  3UU2 A;  3VY8 X;  2XE5 A;  3POX A;  4RJX A;  5DL5 A;  6PRN A;  3POQ A;  2OMF A;  3NSG A;  1HXX A;  3O0E A;  4GCS A;  3VZW X;  3VZU X;  2Y0K A;  3UPG A;  2Y0H A;  2ZLD A;  4KR4 A;  4AUI A;  4FSO A;  1OSM A;  3K19 A;  3VY9 X;  2J4U P;  3POU A;  3SYB A;  1E54 A;  2FGQ X;  3WI5 A;  5PRN A;  2ZFG A;  2O4V A;  4KR8 A;  5DL6 A;  2PRN A;  4LSH A;  2J1N A;  3SZV A;  3A2S X;  3T0S A;  1BH3 A;  3T20 A;  4FRT A;  1GFN A;  4FOZ A;  3SY9 A;  4GCP A;  3SYS A;  2XE1 A;  2Y0L A;  1GFP A;  3JTY A;  2XG6 A;  3FYX A; 
#chains in the Genus database with same CATH topology
 3QRC A;  2ODJ A;  3LK3 B;  3PGU A;  2R4N A;  2MNH A;  4FMS A;  3BRY A;  2K0L A;  2XMX A;  4O3X B;  3SZD A;  5T5F A;  1GFO A;  5FVN A;  1HXT A;  5KAI O;  5H2F O;  1YS5 A;  2QTK A;  1ZHZ A;  4GCQ A;  3LK4 1;  4QQ1 A;  3PF1 A;  5G38 A;  5GTH O;  4G75 A;  1P4T A;  5GV0 A;  4RJW A;  3AA0 B;  4D5U A;  4AYD C;  1GFQ A;  5AFU L;  5GTI O;  1MM5 A;  4UB8 O;  3AA6 A;  4AZL A;  4FSP A;  4N59 A;  4FZN A;  2Y2X A;  3AAA A;  3LK2 A;  4LSI A;  3AA1 B;  4KRA A;  4D64 A;  2KXP B;  2F1C X;  2LFU A;  3BRZ A;  5B5E O;  4D65 A;  3LK3 A;  2M07 A;  2POR A;  2YPV A;  2LHF A;  3AAE B;  3UAQ A;  4JCH A;  4K3C A;  3WI4 A;  5JDP A;  4E1T A;  2K4T A;  3C5O A;  4PR7 A;  3PGR A;  3HOL A;  4FZM A;  5AFU K;  4O4X A;  2XTR A;  4O3W A;  1QJ9 A;  1OPF A;  3QRA A;  3AA0 A;  3PRN A;  4LSF A;  1MM4 A;  2F1T A;  4JFB A;  2R88 A;  2W80 C;  3EMN X;  3G7G A;  1BT9 A;  3GP6 A;  3SY7 A;  5ADX L;  3JCU O;  5DL8 A;  4AKR B;  3AA1 A;  1Q9F A;  5IYU A;  3T24 A;  2KXP A;  2R89 A;  4U9C A;  4C00 A;  1ZHX A;  1MPF A;  1HXU A;  3AA7 B;  2XE2 A;  1IZN B;  4FUV A;  3AAE A;  8PRN A;  1H6S 1;  3HOE A;  2X9K A;  3DWO X;  4O3Z A;  5DL7 A;  3RBH A;  5E79 O;  3LK4 2;  4BUM X;  1THQ A;  1Q9G A;  2ERV A;  2JQY A;  4C69 X;  4AFK A;  4FT6 A;  2AXT O;  4LSE A;  2IWV A;  2KZ7 B;  4G76 A;  7PRN A;  1PRN A;  2KDY A;  4XNK A;  1GFM A;  2MHL A;  1ZHT A;  4AKR A;  2FGR A;  4O49 A;  1QJ8 A;  3PGS A;  3HW9 A;  3AA7 A;  3HWB A;  3POR A;  2M06 A;  5G39 A;  3VZT X;  1IZN A;  3WU2 O;  4AKM A;  5G3A A;  4PUX A;  4UB6 O;  1ORM A;  4F4B A;  1PHO A;  4AYM C;  5B66 O;  3DWN A;  2XE3 A;  4FRX A;  3UU2 A;  3VY8 X;  2XE5 A;  4N75 A;  3POX A;  4RJX A;  5DL5 A;  6PRN A;  2JMM A;  3NJT A;  3POQ A;  2OMF A;  3KVD D;  2KZ7 A;  1T16 A;  4N58 A;  2N2M A;  3NSG A;  1HXX A;  3O0E A;  2KC0 A;  3PQU A;  2R4P A;  4GCS A;  4FZL A;  3VZU X;  3VZW X;  2Y0K A;  2WVP A;  4O3Y A;  3UPG A;  2Y0H A;  2R4O A;  2R8A A;  2ZLD A;  3DA3 A;  3VE1 A;  4KR4 A;  4AYN A;  4AUI A;  4FSO A;  4C4V B;  2Y7S A;  4IL6 O;  1OSM A;  1ZHY A;  3K19 A;  3VE2 A;  3VY9 X;  4Z3T A;  5ADX K;  3POU A;  2IWW A;  4RLC A;  2J4U P;  4RL9 A;  3SYB A;  1E54 A;  2W81 C;  2F1V A;  2FGQ X;  4FES A;  5G26 A;  1S5L O;  3WI5 A;  4GHB A;  5PRN A;  4O4U A;  2ZFG A;  2O4V A;  3PQS A;  4AYI D;  4PJ0 O;  4KR8 A;  5DL6 A;  5KAF O;  1G90 A;  2PRN A;  4LSH A;  5TIS O;  2J1N A;  3A0B O;  2YNK A;  2N2L A;  3A0H O;  3SZV A;  3A2S X;  3T0S A;  3V8U A;  1BH3 A;  4C4V A;  3T20 A;  2WJQ A;  1QJP A;  2XTQ A;  3DZM A;  1GFN A;  3KZI O;  1BXW A;  4FOZ A;  4FRT A;  2GE4 A;  4FQE A;  3SY9 A;  4AYE C;  3DA4 A;  2WJR A;  4GCP A;  4N74 A;  3SYS A;  2XE1 A;  2Y0L A;  5D5D A;  1GFP A;  3JTY A;  4RLB A;  1ZHW A;  1T1L A;  3AA6 B;  3AAA B;  3LK2 B;  3TZG A;  4GF4 A;  2X27 X;  3BS0 A;  4K3B A;  4CTD A;  4E1S A;  2XG6 A;  4XNL A;  3FYX A;  5EE2 A;  2R4L A;  4B61 A; 
#chains in the Genus database with same CATH homology
 3QRC A;  2ODJ A;  3LK3 B;  2MNH A;  4FMS A;  3SZD A;  2K0L A;  2XMX A;  4O3X B;  5T5F A;  1GFO A;  5FVN A;  1HXT A;  1YS5 A;  2QTK A;  1ZHZ A;  4GCQ A;  3LK4 1;  4QQ1 A;  4G75 A;  1P4T A;  5GV0 A;  4RJW A;  3AA0 B;  4D5U A;  4AYD C;  1GFQ A;  5AFU L;  1MM5 A;  3AA6 A;  4AZL A;  4FSP A;  4N59 A;  4FZN A;  2Y2X A;  3AAA A;  3LK2 A;  4LSI A;  3AA1 B;  4KRA A;  4D64 A;  2KXP B;  2LFU A;  4D65 A;  3LK3 A;  2M07 A;  2POR A;  2YPV A;  2LHF A;  3AAE B;  3UAQ A;  4JCH A;  3WI4 A;  5JDP A;  4E1T A;  2K4T A;  3C5O A;  3HOL A;  4FZM A;  5AFU K;  4O4X A;  2XTR A;  4O3W A;  1QJ9 A;  1OPF A;  3QRA A;  3AA0 A;  3PRN A;  4LSF A;  1MM4 A;  2F1T A;  4JFB A;  2W80 C;  3EMN X;  3G7G A;  1BT9 A;  3GP6 A;  3SY7 A;  5ADX L;  5DL8 A;  4AKR B;  5IYU A;  3AA1 A;  1Q9F A;  3T24 A;  2KXP A;  4U9C A;  1ZHX A;  1MPF A;  1HXU A;  3AA7 B;  2XE2 A;  1IZN B;  4FUV A;  3AAE A;  8PRN A;  1H6S 1;  3HOE A;  4O3Z A;  5DL7 A;  3RBH A;  4BUM X;  3LK4 2;  1THQ A;  1Q9G A;  2ERV A;  4C69 X;  4AFK A;  4FT6 A;  4LSE A;  2KZ7 B;  4G76 A;  7PRN A;  1PRN A;  2KDY A;  4XNK A;  1GFM A;  2MHL A;  1ZHT A;  4AKR A;  2FGR A;  4O49 A;  1QJ8 A;  3HW9 A;  3AA7 A;  3HWB A;  3POR A;  2M06 A;  3VZT X;  4AKM A;  1IZN A;  4PUX A;  1ORM A;  4F4B A;  1PHO A;  4AYM C;  2XE3 A;  4FRX A;  3UU2 A;  3VY8 X;  2XE5 A;  3POX A;  4RJX A;  5DL5 A;  6PRN A;  2JMM A;  3POQ A;  2OMF A;  3KVD D;  2KZ7 A;  4N58 A;  2N2M A;  3NSG A;  1HXX A;  3O0E A;  2KC0 A;  3PQU A;  4GCS A;  4FZL A;  3VZU X;  3VZW X;  2Y0K A;  4O3Y A;  3UPG A;  2Y0H A;  3DA3 A;  2ZLD A;  3VE1 A;  4AYN A;  4KR4 A;  4AUI A;  4FSO A;  2Y7S A;  1OSM A;  1ZHY A;  3K19 A;  3VE2 A;  3VY9 X;  4Z3T A;  5ADX K;  3POU A;  2J4U P;  4RLC A;  4RL9 A;  3SYB A;  1E54 A;  2W81 C;  2F1V A;  2FGQ X;  4FES A;  5G26 A;  3WI5 A;  4GHB A;  5PRN A;  4O4U A;  2ZFG A;  2O4V A;  3PQS A;  4AYI D;  4KR8 A;  5DL6 A;  1G90 A;  2PRN A;  4LSH A;  2J1N A;  2YNK A;  2N2L A;  3SZV A;  3A2S X;  3T0S A;  3V8U A;  1BH3 A;  3T20 A;  1QJP A;  2XTQ A;  4FRT A;  1GFN A;  4FOZ A;  1BXW A;  3SY9 A;  2GE4 A;  4AYE C;  3DA4 A;  4GCP A;  3SYS A;  2XE1 A;  2Y0L A;  5D5D A;  1GFP A;  3JTY A;  4RLB A;  1ZHW A;  3AA6 B;  3AAA B;  3LK2 B;  3TZG A;  4GF4 A;  2X27 X;  4E1S A;  2XG6 A;  4XNL A;  3FYX A;  5EE2 A;  4B61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...