1BT9A

Ompf porin mutant d74a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGAAAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stability of trimeric OmpF porin: the contributions of the latching loop L2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords PROTEIN (MATRIX PORIN OUTER MEMBRANE PROTEIN F)
total genus 100
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1998-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1bt9A00
3POUA 3WI4A 3VY9X 2ZFGA 4FSPA 6PRNA 4FRTA 1MPFA 4C69X 1E54A 2FGQX 2XG6A 1OPFA 3VZTX 2K4TA 4GCSA 5DL8A 2O4VA 3SYSA 3FYXA 3PORA 7PRNA 2XE3A 4KRAA 5DL6A 2J1NA 4JFBA 4RJWA 3K19A 4D5UA 1BT9A 4FMSA 3VY8X 4FSOA 3VZWX 3SYBA 5DL5A 1GFNA 3SY7A 3VZUX 4FOZA 4LSEA 2QTKA 3UU2A 3WI5A 1GFQA 1GFMA 3O0EA 4GCPA 2ODJA 3HW9A 5PRNA 2J4UP 2Y2XA 2PRNA 1OSMA 4FRXA 2PORA 3SZVA 2Y0KA 3HWBA 3SY9A 4LSFA 2OMFA 3A2SX 4GCQA 4RJXA 2XE2A 4KR8A 1GFPA 2Y0HA 4LSHA 1PHOA 3T0SA 2XE5A 5DL7A 8PRNA 3SZDA 3T20A 4KR4A 1HXUA 2FGRA 2XE1A 3JTYA 1GFOA 3POQA 3EMNX 3POXA 3UPGA 1PRNA 1HXTA 3PRNA 2Y0LA 1BH3A 4AUIA 1H6S1 4BUMX 1HXXA 4FT6A 3T24A 4D65A 5JDPA 3NSGA 2ZLDA 5FVNA 4D64A 4LSIA
chains in the Genus database with same CATH superfamily
3POUA 3WI4A 3PGUA 2X27X 3LK42 2M06A 4N75A 2WVPA 5G3AA 3VY9X 2ZFGA 4FSPA 6PRNA 1QJ9A 2XMXA 5IYUA 3PGRA 4FRTA 1MPFA 2M07A 4RL9A 5G26A 2F1VA 3PGSA 4GHBA 2F1CX 1E54A 4C69X 2FGQX 4B61A 4F4BA 3QRAA 5GTIO 3GP6A 4UB8O 4E1TA 1T1LA 4AYMC 2XG6A 1OPFA 3VZTX 2K4TA 3DA3A 2KXPA 4GCSA 5KAFO 4N58A 5AFUK 4O4UA 5DL8A 2O4VA 2XTQA 3HOEA 2MNHA 3FYXA 3PORA 3SYSA 4AYNA 2KZ7A 1BXWA 3V8UA 7PRNA 2XE3A 4KRAA 4PJ0O 5DL6A 2GE4A 2R8AA 2X9KA 4AYEC 1S5LO 5G39A 5ADXL 2J1NA 3AA1B 3AA7B 3DA4A 3KVDD 4FZMA 2IWVA 4JFBA 4RJWA 4AKRB 1P4TA 3K19A 3LK3B 2R89A 4RLBA 3VE2A 4CTDA 1BT9A 4FMSA 4K3BA 4D5UA 2W81C 3VY8X 1ZHTA 4FSOA 3VZWX 3HOLA 3G7GA 3SYBA 5DL5A 3DWNA 1GFNA 3SY7A 2R4OA 5B66O 4RLCA 4FZNA 4FUVA 4XNKA 5AFUL 1QJ8A 3A0BO 1ZHWA 5D5DA 3VZUX 5ADXK 4FOZA 4LSEA 4G76A 4PUXA 4C4VB 2QTKA 3UU2A 3WI5A 5T5FA 4C4VA 2K0LA 1GFMA 1GFQA 3C5OA 3O0EA 4GCPA 4O3WA 1ZHZA 4O3ZA 2KDYA 2ERVA 1QJPA 4FZLA 2ODJA 3HW9A 4AZLA 3AA7A 4U9CA 5PRNA 1G90A 4C00A 4O4XA 1T16A 2J4UP 2Y2XA 3DZMA 2KXPB 2PRNA 4IL6O 1OSMA 5B5EO 4FESA 3RBHA 3VE1A 2Y7SA 2W80C 3AAAB 1THQA 4FRXA 2WJQA 3AAAA 3BRYA 3BRZA 3DWOX 2PORA 2R4NA 3LK2B 3PQUA 3SZVA 2Y0KA 3HWBA 3SY9A 4N74A 4LSFA 4N59A 2OMFA 5TISO 3A2SX 3LK41 2F1TA 1MM4A 2YPVA 2IWWA 2KZ7B 4GCQA 4RJXA 2XE2A 3WU2O 1MM5A 2LHFA 4KR8A 1GFPA 2Y0HA 2R4PA 4LSHA 5H2FO 3AA6B 1PHOA 4AKRA 1Q9FA 1ZHYA 2XE5A 3T0SA 5G38A 4Z3TA 3UAQA 2AXTO 4AFKA 3BS0A 2JMMA 5DL7A 4O49A 2KC0A 2R88A 1IZNA 3TZGA 3SZDA 8PRNA 3PF1A 4G75A 3T20A 4AYDC 4KR4A 3NJTA 4JCHA 2YNKA 5E79O 4GF4A 2N2MA 1HXUA 2FGRA 3AA0B 4UB6O 2MHLA 1ORMA 2XTRA 1Q9GA 2XE1A 3JTYA 4QQ1A 1GFOA 4XNLA 3POQA 4AYID 3A0HO 3KZIO 4O3XB 3PQSA 3EMNX 3POXA 5GTHO 5GV0A 3LK2A 3JCUO 3AAEB 4O3YA 3AA0A 5KAIO 3UPGA 1PRNA 1HXTA 1IZNB 1ZHXA 3QRCA 3PRNA 2Y0LA 1BH3A 4AUIA 3AA1A 1YS5A 5EE2A 1H6S1 4BUMX 1HXXA 3AA6A 2JQYA 3LK3A 4FT6A 3AAEA 4K3CA 4PR7A 2LFUA 2N2LA 3T24A 4D65A 4E1SA 5JDPA 2WJRA 4AKMA 3NSGA 2R4LA 2ZLDA 5FVNA 4FQEA 4D64A 4LSIA
chains in the Genus database with same CATH topology
3POUA 3WI4A 2X27X 3LK42 2M06A 3VY9X 2ZFGA 4FSPA 6PRNA 1QJ9A 2XMXA 5IYUA 4FRTA 1MPFA 2M07A 4RL9A 5G26A 2F1VA 4GHBA 4C69X 1E54A 2FGQX 4B61A 4F4BA 3QRAA 3GP6A 4E1TA 4AYMC 2XG6A 1OPFA 3VZTX 2K4TA 3DA3A 2KXPA 4GCSA 4N58A 5AFUK 4O4UA 5DL8A 2O4VA 2XTQA 3HOEA 2MNHA 3FYXA 3PORA 3SYSA 4AYNA 2KZ7A 1BXWA 3V8UA 7PRNA 2XE3A 4KRAA 5DL6A 2GE4A 4AYEC 5ADXL 2J1NA 3AA1B 3AA7B 3DA4A 3KVDD 4FZMA 4JFBA 4RJWA 1P4TA 3K19A 3LK3B 4RLBA 3VE2A 4D5UA 5GV0A 1BT9A 4FMSA 2W81C 3VY8X 1ZHTA 4FSOA 3VZWX 3HOLA 3G7GA 3SYBA 5DL5A 1GFNA 3SY7A 4RLCA 4FZNA 4FUVA 4XNKA 5AFUL 1QJ8A 1ZHWA 5D5DA 3VZUX 5ADXK 4FOZA 4LSEA 4G76A 4PUXA 2QTKA 3UU2A 3WI5A 5T5FA 2K0LA 1GFMA 1GFQA 3C5OA 3O0EA 4GCPA 4O3WA 1ZHZA 4O3ZA 2KDYA 2ERVA 1QJPA 4FZLA 2ODJA 3HW9A 4AZLA 3AA7A 4U9CA 5PRNA 1G90A 4O4XA 2J4UP 2Y2XA 2KXPB 2PRNA 1OSMA 4FESA 3RBHA 3VE1A 2Y7SA 2W80C 3AAAB 1THQA 4FRXA 3AAAA 2PORA 3LK2B 3PQUA 3SZVA 2Y0KA 3HWBA 3SY9A 4LSFA 4N59A 2OMFA 3A2SX 3LK41 2F1TA 1MM4A 2YPVA 2KZ7B 4GCQA 4RJXA 2XE2A 1MM5A 2LHFA 4KR8A 1GFPA 2Y0HA 4LSHA 3AA6B 1PHOA 4AKRA 1Q9FA 1ZHYA 2XE5A 3T0SA 4Z3TA 3UAQA 4AFKA 2JMMA 5DL7A 4O49A 2KC0A 1IZNA 3TZGA 8PRNA 3SZDA 3T20A 4G75A 4AYDC 4KR4A 4JCHA 2YNKA 4GF4A 2N2MA 1HXUA 2FGRA 3AA0B 2MHLA 1ORMA 2XTRA 1Q9GA 2XE1A 3JTYA 4QQ1A 1GFOA 4XNLA 3POQA 4AYID 4O3XB 3PQSA 3EMNX 3POXA 3LK2A 3AAEB 4O3YA 3AA0A 3UPGA 1PRNA 1HXTA 1IZNB 1ZHXA 3QRCA 3PRNA 2Y0LA 1BH3A 4AUIA 3AA1A 1YS5A 5EE2A 1H6S1 4BUMX 1HXXA 3AA6A 3LK3A 4FT6A 4AKRB 3AAEA 3T24A 4D65A 2LFUA 2N2LA 4E1SA 5JDPA 4AKMA 3NSGA 2ZLDA 5FVNA 4D64A 4LSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POU A;  3WI4 A;  3VY9 X;  2ZFG A;  4FSP A;  6PRN A;  4FRT A;  1MPF A;  4C69 X;  1E54 A;  2FGQ X;  2XG6 A;  1OPF A;  3VZT X;  2K4T A;  4GCS A;  5DL8 A;  2O4V A;  3SYS A;  3FYX A;  3POR A;  7PRN A;  2XE3 A;  4KRA A;  5DL6 A;  2J1N A;  4JFB A;  4RJW A;  3K19 A;  4D5U A;  1BT9 A;  4FMS A;  3VY8 X;  4FSO A;  3VZW X;  3SYB A;  5DL5 A;  1GFN A;  3SY7 A;  3VZU X;  4FOZ A;  4LSE A;  2QTK A;  3UU2 A;  3WI5 A;  1GFQ A;  1GFM A;  3O0E A;  4GCP A;  2ODJ A;  3HW9 A;  5PRN A;  2J4U P;  2Y2X A;  2PRN A;  1OSM A;  4FRX A;  2POR A;  3SZV A;  2Y0K A;  3HWB A;  3SY9 A;  4LSF A;  2OMF A;  3A2S X;  4GCQ A;  4RJX A;  2XE2 A;  4KR8 A;  1GFP A;  2Y0H A;  4LSH A;  1PHO A;  3T0S A;  2XE5 A;  5DL7 A;  8PRN A;  3SZD A;  3T20 A;  4KR4 A;  1HXU A;  2FGR A;  2XE1 A;  3JTY A;  1GFO A;  3POQ A;  3EMN X;  3POX A;  3UPG A;  1PRN A;  1HXT A;  3PRN A;  2Y0L A;  1BH3 A;  4AUI A;  1H6S 1;  4BUM X;  1HXX A;  4FT6 A;  3T24 A;  4D65 A;  5JDP A;  3NSG A;  2ZLD A;  5FVN A;  4D64 A;  4LSI A; 
#chains in the Genus database with same CATH topology
 3POU A;  3WI4 A;  3PGU A;  2X27 X;  3LK4 2;  2M06 A;  4N75 A;  2WVP A;  5G3A A;  3VY9 X;  2ZFG A;  4FSP A;  6PRN A;  1QJ9 A;  2XMX A;  5IYU A;  3PGR A;  4FRT A;  1MPF A;  2M07 A;  4RL9 A;  5G26 A;  2F1V A;  3PGS A;  4GHB A;  2F1C X;  1E54 A;  4C69 X;  2FGQ X;  4B61 A;  4F4B A;  3QRA A;  5GTI O;  3GP6 A;  4UB8 O;  4E1T A;  1T1L A;  4AYM C;  2XG6 A;  1OPF A;  3VZT X;  2K4T A;  3DA3 A;  2KXP A;  4GCS A;  5KAF O;  4N58 A;  5AFU K;  4O4U A;  5DL8 A;  2O4V A;  2XTQ A;  3HOE A;  2MNH A;  3FYX A;  3POR A;  3SYS A;  4AYN A;  2KZ7 A;  1BXW A;  3V8U A;  7PRN A;  2XE3 A;  4KRA A;  4PJ0 O;  5DL6 A;  2GE4 A;  2R8A A;  2X9K A;  4AYE C;  1S5L O;  5G39 A;  5ADX L;  2J1N A;  3AA1 B;  3AA7 B;  3DA4 A;  3KVD D;  4FZM A;  2IWV A;  4JFB A;  4RJW A;  4AKR B;  1P4T A;  3K19 A;  3LK3 B;  2R89 A;  4RLB A;  3VE2 A;  4CTD A;  1BT9 A;  4FMS A;  4K3B A;  4D5U A;  2W81 C;  3VY8 X;  1ZHT A;  4FSO A;  3VZW X;  3HOL A;  3G7G A;  3SYB A;  5DL5 A;  3DWN A;  1GFN A;  3SY7 A;  2R4O A;  5B66 O;  4RLC A;  4FZN A;  4FUV A;  4XNK A;  5AFU L;  1QJ8 A;  3A0B O;  1ZHW A;  5D5D A;  3VZU X;  5ADX K;  4FOZ A;  4LSE A;  4G76 A;  4PUX A;  4C4V B;  2QTK A;  3UU2 A;  3WI5 A;  5T5F A;  4C4V A;  2K0L A;  1GFM A;  1GFQ A;  3C5O A;  3O0E A;  4GCP A;  4O3W A;  1ZHZ A;  4O3Z A;  2KDY A;  2ERV A;  1QJP A;  4FZL A;  2ODJ A;  3HW9 A;  4AZL A;  3AA7 A;  4U9C A;  5PRN A;  1G90 A;  4C00 A;  4O4X A;  1T16 A;  2J4U P;  2Y2X A;  3DZM A;  2KXP B;  2PRN A;  4IL6 O;  1OSM A;  5B5E O;  4FES A;  3RBH A;  3VE1 A;  2Y7S A;  2W80 C;  3AAA B;  1THQ A;  4FRX A;  2WJQ A;  3AAA A;  3BRY A;  3BRZ A;  3DWO X;  2POR A;  2R4N A;  3LK2 B;  3PQU A;  3SZV A;  2Y0K A;  3HWB A;  3SY9 A;  4N74 A;  4LSF A;  4N59 A;  2OMF A;  5TIS O;  3A2S X;  3LK4 1;  2F1T A;  1MM4 A;  2YPV A;  2IWW A;  2KZ7 B;  4GCQ A;  4RJX A;  2XE2 A;  3WU2 O;  1MM5 A;  2LHF A;  4KR8 A;  1GFP A;  2Y0H A;  2R4P A;  4LSH A;  5H2F O;  3AA6 B;  1PHO A;  4AKR A;  1Q9F A;  1ZHY A;  2XE5 A;  3T0S A;  5G38 A;  4Z3T A;  3UAQ A;  2AXT O;  4AFK A;  3BS0 A;  2JMM A;  5DL7 A;  4O49 A;  2KC0 A;  2R88 A;  1IZN A;  3TZG A;  3SZD A;  8PRN A;  3PF1 A;  4G75 A;  3T20 A;  4AYD C;  4KR4 A;  3NJT A;  4JCH A;  2YNK A;  5E79 O;  4GF4 A;  2N2M A;  1HXU A;  2FGR A;  3AA0 B;  4UB6 O;  2MHL A;  1ORM A;  2XTR A;  1Q9G A;  2XE1 A;  3JTY A;  4QQ1 A;  1GFO A;  4XNL A;  3POQ A;  4AYI D;  3A0H O;  3KZI O;  4O3X B;  3PQS A;  3EMN X;  3POX A;  5GTH O;  5GV0 A;  3LK2 A;  3JCU O;  3AAE B;  4O3Y A;  3AA0 A;  5KAI O;  3UPG A;  1PRN A;  1HXT A;  1IZN B;  1ZHX A;  3QRC A;  3PRN A;  2Y0L A;  1BH3 A;  4AUI A;  3AA1 A;  1YS5 A;  5EE2 A;  1H6S 1;  4BUM X;  1HXX A;  3AA6 A;  2JQY A;  3LK3 A;  4FT6 A;  3AAE A;  4K3C A;  4PR7 A;  2LFU A;  2N2L A;  3T24 A;  4D65 A;  4E1S A;  5JDP A;  2WJR A;  4AKM A;  3NSG A;  2R4L A;  2ZLD A;  5FVN A;  4FQE A;  4D64 A;  4LSI A; 
#chains in the Genus database with same CATH homology
 3POU A;  3WI4 A;  2X27 X;  3LK4 2;  2M06 A;  3VY9 X;  2ZFG A;  4FSP A;  6PRN A;  1QJ9 A;  2XMX A;  5IYU A;  4FRT A;  1MPF A;  2M07 A;  4RL9 A;  5G26 A;  2F1V A;  4GHB A;  4C69 X;  1E54 A;  2FGQ X;  4B61 A;  4F4B A;  3QRA A;  3GP6 A;  4E1T A;  4AYM C;  2XG6 A;  1OPF A;  3VZT X;  2K4T A;  3DA3 A;  2KXP A;  4GCS A;  4N58 A;  5AFU K;  4O4U A;  5DL8 A;  2O4V A;  2XTQ A;  3HOE A;  2MNH A;  3FYX A;  3POR A;  3SYS A;  4AYN A;  2KZ7 A;  1BXW A;  3V8U A;  7PRN A;  2XE3 A;  4KRA A;  5DL6 A;  2GE4 A;  4AYE C;  5ADX L;  2J1N A;  3AA1 B;  3AA7 B;  3DA4 A;  3KVD D;  4FZM A;  4JFB A;  4RJW A;  1P4T A;  3K19 A;  3LK3 B;  4RLB A;  3VE2 A;  4D5U A;  5GV0 A;  1BT9 A;  4FMS A;  2W81 C;  3VY8 X;  1ZHT A;  4FSO A;  3VZW X;  3HOL A;  3G7G A;  3SYB A;  5DL5 A;  1GFN A;  3SY7 A;  4RLC A;  4FZN A;  4FUV A;  4XNK A;  5AFU L;  1QJ8 A;  1ZHW A;  5D5D A;  3VZU X;  5ADX K;  4FOZ A;  4LSE A;  4G76 A;  4PUX A;  2QTK A;  3UU2 A;  3WI5 A;  5T5F A;  2K0L A;  1GFM A;  1GFQ A;  3C5O A;  3O0E A;  4GCP A;  4O3W A;  1ZHZ A;  4O3Z A;  2KDY A;  2ERV A;  1QJP A;  4FZL A;  2ODJ A;  3HW9 A;  4AZL A;  3AA7 A;  4U9C A;  5PRN A;  1G90 A;  4O4X A;  2J4U P;  2Y2X A;  2KXP B;  2PRN A;  1OSM A;  4FES A;  3RBH A;  3VE1 A;  2Y7S A;  2W80 C;  3AAA B;  1THQ A;  4FRX A;  3AAA A;  2POR A;  3LK2 B;  3PQU A;  3SZV A;  2Y0K A;  3HWB A;  3SY9 A;  4LSF A;  4N59 A;  2OMF A;  3A2S X;  3LK4 1;  2F1T A;  1MM4 A;  2YPV A;  2KZ7 B;  4GCQ A;  4RJX A;  2XE2 A;  1MM5 A;  2LHF A;  4KR8 A;  1GFP A;  2Y0H A;  4LSH A;  3AA6 B;  1PHO A;  4AKR A;  1Q9F A;  1ZHY A;  2XE5 A;  3T0S A;  4Z3T A;  3UAQ A;  4AFK A;  2JMM A;  5DL7 A;  4O49 A;  2KC0 A;  1IZN A;  3TZG A;  8PRN A;  3SZD A;  3T20 A;  4G75 A;  4AYD C;  4KR4 A;  4JCH A;  2YNK A;  4GF4 A;  2N2M A;  1HXU A;  2FGR A;  3AA0 B;  2MHL A;  1ORM A;  2XTR A;  1Q9G A;  2XE1 A;  3JTY A;  4QQ1 A;  1GFO A;  4XNL A;  3POQ A;  4AYI D;  4O3X B;  3PQS A;  3EMN X;  3POX A;  3LK2 A;  3AAE B;  4O3Y A;  3AA0 A;  3UPG A;  1PRN A;  1HXT A;  1IZN B;  1ZHX A;  3QRC A;  3PRN A;  2Y0L A;  1BH3 A;  4AUI A;  3AA1 A;  1YS5 A;  5EE2 A;  1H6S 1;  4BUM X;  1HXX A;  3AA6 A;  3LK3 A;  4FT6 A;  4AKR B;  3AAE A;  3T24 A;  4D65 A;  2LFU A;  2N2L A;  4E1S A;  5JDP A;  4AKM A;  3NSG A;  2ZLD A;  5FVN A;  4D64 A;  4LSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...