5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
3LK3A 3LK3B 5AFUK 3AA1A 3AA1B 5ADXK 3AA7A 3AA0A 3AA7B 3AA0B 5AFUL 3LK2A 3LK41 2KXPB 2KXPA 3LK2B 5ADXL 3AAEA 3LK42 3AAEB 4AKRB 4AKRA 3AAAB 3AAAA 3AA6B 3AA6A 2KZ7A 1IZNA 2KZ7B 1IZNB
chains in the Genus database with same CATH superfamily
4AKHA 5FVNA 5DJQC 2KNDA 3MACA 2JMHA 2ZM0A 5M4YA 2LSIA 3OYXA 1LRZA 3ZMVB 5L3FB 2ACXA 2CBIA 3F31A 3KV5A 2YDQA 3P4PA 4O4JE 4AYNA 2IIUA 2BG9E 5HXEA 3G7GA 3ZN0B 4WBNE 2W61A 3VRAA 2WP9A 4MFRA 4GK0E 3AA0A 2UU9T 4D64A 5AQKB 3PUYF 3X1DA 4FRTA 4GCQA 2DWGA 4ERRA 1D0YA 4YY3T 2RA1A 2NTXA 4ZXLA 1OEDB 4LMKA 1OSMA 2MBGA 3NZQA 2KMFA 4AKLA 2VASA 1P4TA 1YKEB 4HWDA 4AUIA 1W09A 2R89A 2WJRA 1MNEA 3K3QC 1KK7A 1MPFA 2LOSA 2LSKA 2WMOA 4LF8T 1YKHB 5ADXL 3RC8A 1ZHCA 1N34T 3HL6A 4X1KE 5G26A 3ETVA 5HCJA 2CPTA 4ZS3A 3AE3A 5FXXA 5HEUA 4G63A 4U72A 1XMOT 3AA1A 4ISTA 5F8PA 1XDOA 4PJMA 3RYHE 5AQQB 1IBKT 3LDQB 4MLKA 2MOZA 3QB5A 4EZ4A 4A56A 3O9XA 2CXFA 3SWHA 3VY9X 4O4IE 2ZM6T 3RKOA 4PJNA 2XPKA 3DWOX 2DNXA 3CIRA 4KR4A 3NZPA 5EE2A 4PR7A 2JQHA 2XAJB 4UVCB 2JMMA 1HX1B 3FHNA 3FXDB 3QOFA 4WW0A 3E08A 2XSAA 5IYUA 2V8SV 3HW9A 2XE5A 3A2SX 3VKGA 2WCAA 3AVRA 2XG6A 3A8YC 3ZKRA 3PRNA 3SZVA 3UU4A 4EAHA 4GHBA 2YU1A 2WDVA 1D1CA 5DABA 1UGOA 2VKOA 4AKMA 3EI0A 3P7IA 4IDZA 3AA6A 5L3CB 2PG8A 4A5XA 2LSJA 3EUHA 3I9WA 2WSSV 5ABFA 5JTGA 3PUWF 4ZOLE 3DA4A 4YSYA 2EHOB 4MHCA 2ZFGA 2NOXA 3P4SA 3TLTA 5HEJA 3MZKB 5LYJE 5DQVA 2C0SA 2XE2A 2BS2A 3WAKA 5LOVE 3GA8A 3JCFA 3KV4A 4ZEYA 3CWZB 4CQIA 2DHRA 1FIOA 1Y64B 3FZHB 4DIDB 2HN1A 5HXHA 3ZMSB 1CUNA 3GWHA 3KDSE 4ZS2A 5C2TA 4COFA 3UQ4A 5BMVE 2R88A 4FQEA 5AQVB 2CA5A 4YLHA 1OWAA 1VOMA 2R4PA 1HFAA 2DWKA 4LFAT 4JFBA 3AA0B 4CXXA 2GE4A 4ZZCA 4DR1T 2LSGA 4X1IE 5ABGA 1ZV4X 2V6YA 4PFPA 1W0BA 3TLUA 4K0UA 4H63H 4OFZA 4CN6A 1YXRA 3VU7H 2XE1A 3VZTX 4K3CA 2IW5B 1MIYA 3RX6A 5IWAT 1HG5A 1US7B 2F4VT 3WI4A 2LRLA 2AXTO 1S35A 2LLYA 3LK42 2X9KA 5B66O 1DU2A 3PQSA 1OEDE 3P4RA 2H89A 3SS1A 2B1EA 3LK3A 4A97A 3SFEA 5JDGA 3AA1B 4NXMT 4GOUA 3SFDA 1LKXA 3T1HT 4YJ2E 3M3ZB 2CWOA 1SHZC 2HPJA 1YW0A 4JV5T 3EVYA 1IJ5A 3PTRB 1KEYA 5AQNB 2KDYA 3OKQA 3POUA 3T20A 1HR0T 3OYZA 3AXJA 4QH5A 4EYUA 2XJ7A 2NW9A 2J4UP 4EZHA 2Q9QC 4LF6T 1MIWA 2YKSA 1J5WA 3ZCIA 1ORMA 1G90A 1MIVA 2K3WA 4WYVA 1T16A 3P4QA 3PUSA 3FZKB 5JQGE 3CPZA 4ZI7E 2G0UA 4C4VA 5LA6E 1ZKEA 4EEDA 3TLWA 3UFGA 2X68A 1IBLT 4IHJE 4HKAA 3RLFF 2X27X 4XZCA 2Q9QA 3AE4A 5ABFB 2X0HA 4ILCA 2XQYA 5DL5A 3PE0A 4FZMA 3C5OA 2XY8B 3RRWA 1S94A 3V8UA 3A0BO 3TKLB 4KR8A 2WJQA 2LKGA 4O8SA 1YS5A 4LSFA 5JDLA 3E0ZA 4P0BA 3E22E 3L09A 5ABEA 4CZZB 1WYBA 2N9DA 4AI6A 1Z8UA 2BBJA 2KWIB 3LSVA 3GMIA 3C4XA 4UV8B 5G3AA 1HX8A 3MK7C 4H9QC 3AEAA 3HOLA 2LJLA 2ZM2A 2D9DA 1T1LA 4TWFA 2J4GA 2HHHT 3CMLA 2XM2A 4WNKA 2J1NA 5AQHB 2KLQA 4B3TT 5EK2A 4ANJA 4DR2T 3SY7A 2KXPB 4XNLA 1GFOA 2V6YB 4DR4T 1Q9FA 3Q5XA 3A0HO 3SRZA 1BXWA 2XM1A 2LOPA 2W00A 2XUEA 2BVLA 2SPCA 4DR3T 2V7JA 3I9YA 2CHNA 2KSRA 1X79A 3UUBA 4PJLA 2D0TA 5GTHO 2UXNB 1X9BA 4XNKA 2MTQA 2C5KT 3PURA 2LE8A 1BR2A 2RP4A 3LK3B 5CA1E 5CB4E 3RQWA 4ZHQE 1YQ3A 4DVDA 5FY7A 5GV0A 4QH1A 3UU6A 4U31A 4EV6A 4UR9A 1ZEEA 2E5VA 3FZFB 2OMFA 4YT0A 3ZT6A 5T5FA 3PDYA 2WB5A 3N9MA 4O4HE 2L3LA 4GCSA 1NENA 3JAFA 1IAPA 5AQTB 2WU2A 5KX5E 3AXJB 5H6RB 3KBTA 1MM4A 3FZMB 4P0AA 4CI3B 2JQYA 4TNVA 3AEFA 4UVBB 1HNZT 2W66A 4Z3TA 3RYIE 4ADZA 2DLRA 3C98B 4BA9A 4ZI3D 4O4LE 5LHIB 4N75A 2FJAA 2WY2A 3N2OA 3VKHA 4ILAA 5H2FO 3ZMUB 1BR0A 1FJGT 3PGUA 5KAFO 3AAAB 3PUGA 1H6S1 2LT3A 4YXDA 3EAMA 3WI5A 2Q9QB 3NBXX 2YU2A 4X64T 1FEWA 2IWVA 4ILBA 2UUCT 4O49A 2VQFT 4L9IA 2NP9A 2LM9A 3NRXA 5HEHA 1T98A 1D1AA 2HPLA 2MHLA 3F57A 4I50E 4JUYA 3RIFA 2PRNA 3O0EA 2IC6A 1BR1A 4TN7B 2LFUA 3GP6A 2XAFB 5LCYA 3RIUC 5LBQB 1ZHWA 1NEKA 5J2UE 2L8KA 4OK0A 5BR8T 2I0MA 3P4WA 3UU8A 2WDRA 4IT4A 4DNDA 1NAFA 2QVAA 2M6BA 3ZJ2A 5L3GB 5LBMA 4AISA 4OX9T 3RIUA 3F2EA 1KF6A 5KAIO 5JDPA 2Y0LA 4OYKA 4RJWA 2M06A 1WFDA 3CKDA 4PJJA 3TLSA 3V5SA 3B5MA 5FY1A 3ZCJA 2H7VC 4X66T 2M6IA 5FY0A 4HE8A 4LFBT 3IEEA 2H88A 4HFBA 3HKEE 2VKDA 3N5LA 4U7YA 1O3XA 4U9CA 2LM2A 2YN6A 5G38A 3B13A 3N9PA 3AE2A 2XQ9A 3B57A 4EEBA 3NRYA 4E1TA 5ADXK 3BRYA 2IHR1 3JTYA 2WU5A 2VVNA 3KBUA 1XNQT 3UUXB 4IE4A 5L3BB 4TX5A 2QA7A 3R84B 2UUBT 4IE6A 3H3MA 2Z6EA 3V5UA 2R4LA 5HEGA 4ZI2C 3ONXA 2XQ6A 3CQCB 5JH7E 2JPFA 4AIUA 2WM9A 3RC3A 5JR9C 5LHGB 4IE0A 2BZBA 1G8XA 5FXVA 5HEOA 4CN4A 4YSXA 1M62A 1ZHYA 3SYSA 3SZDA 5FKYA 3PJAA 3BQIA 3ZSSA 3D0TA 2K48A 2W4XA 4PK6A 5AQGB 3C51A 1S5LO 2YPVA 2A9UA 2OLTA 3ZC1A 4TNWA 4GKKT 3A7MA 4HFEA 4MBQA 4LFCT 1KFYA 3P50A 3PV0F 1I94T 2I6HA 4U7IA 4JEHB 5LMUT 3CX8B 5JRCA 5L3EB 2CXLA 5F3JA 2D2SA 2CHOA 3K3OA 4N74A 3PF1A 3L39A 2KWHA 3N9LA 1W0AA 3DP7A 4LF4T 1U4QA 5IYZE 4JI7T 4TUYE 4DV3T 3ZYMA 4C69X 3VZWX 4B3ST 1MMAA 3ZYKA 2K4TA 4I55E 1MMDA 5EK4A 2DCFA 4CXYA 4JI6T 5D5DA 1AJ3A 1IJ6A 4BAYB 2XHEB 4AFKA 2AXDS 2W67A 5L3DB 1J5ET 4LF9T 5LG3A 2PORA 5B5EO 4IIJE 5KMGP 4DV5T 3AA7A 3AAIA 1HNWT 5L4HA 4HWFA 3LK41 4TV9E 4I0UA 4YHJA 5FXZA 4FSOA 4BUMX 4EIWA 1GQEA 3NSGA 5F5WA 2E9XD 4EB6E 1GFNA 1J1JA 5HXSA 3O1JA 2LKHA 5JDFA 4HWCA 4AYID 4QXBB 2KXPA 4DV0T 4X65T 2Y0HA 3ZT5A 2NW8A 5FYMA 2WMNA 4UF0A 4DR6T 4HN9A 2V26A 4X1YE 4LMLA 4MALA 4QXHB 4QXCB 1N33T 3AECA 4FZLA 4XAXB 3MXZA 4ZI3C 2KINB 4DMVA 3QC9A 1BT9A 1HG2A 4RL9A 3MKDA 3PUVF 2V7LA 2NW7A 5LXTE 1HXXA 5HYAA 1B7TA 4M1PA 4PK4A 4UB8O 4A98A 2F1TA 5DQWA 3OVUA 2VKHA 2JMKA 2JRKA 4DUZT 2NWBA 5AQFB 4IL9A 4NUVA 4QH4A 4IDOA 3EDVA 5L2LA 4O2AE 3LK2A 1HCIA 2XTLA 1Y01A 3Q9DA 2UXXB 1QJ9A 5HAXA 3HOEA 5JR9B 3R6NA 3AE8A 4FSPA 2NTYA 4HFVA 3QRCA 4V1Av 3UTKA 3AEBA 4HEAA 3ABVA 2Y2XA 5FVLA 2VURA 5H6QB 4X5TA 2BS4A 1HTJF 3AAEA 3N9NA 2F1VA 3AAAA 2IAKA 2CCQA 4RJXA 5JRCB 1YQ4A 3H37A 1NWMX 3L3PA 3VRBA 4LF7T 2B76A 2WWVA 3BK9A 1KNZA 4DUYT 4CN1A 3ZJ1A 2UUAT 4N78D 3ZT7A 2ODVA 3MA9A 2ZMAA 5EZYE 2X51A 2E8IA 3QK6A 1UCUA 4NIQA 1EZ3A 5PRNA 1KNRA 1VRBA 3QNUA 4FUVA 1IZNA 1T72A 4KX6A 5KXJA 3AE5A 1WCRA 2QGSA 4UB6O 4H9SE 4YJ3E 4AKGA 5TISO 3I0OA 3ZC0A 2YNKA 1WR6A 3AA7B 3KFWX 4DR7T 2FJDA 3ZPOA 2QRXA 3HWBA 2XAHB 5DL6A 3ESLA 2WZIA 4PW8A 4O3YA 4U3CA 3UAQA 2I59A 2V5DA 4Z91A 1ZOYA 2W2UA 1IBMT 3NKZA 3UUNA 4LMJA 5FMNA 2J1DG 2N2NA 1UK5A 1E2AA 4H9OC 2WAUA 2E5LT 3BQKA 1WR0A 5LGNB 4UF0B 4LSHA 3HI2A 5AFUK 4DV2T 4TWHA 2D0UA 3SYBA 4DO0A 1D1BA 2H7OA 1PHOA 3VE2A 4GF4A 2XQAA 4UELA 4AYDC 2FJBA 4CI1B 4AKRB 2UXDT 4B6XA 1XWMA 3PU3A 5AQUB 3U3IA 4DV1T 4U74A 3IF8B 3OPCA 1T8BA 2H3RA 4JBWF 2D5UA 2MNHA 4IREA 4CTDA 3FBZA 2Y6XA 4U33A 2YDSA 3AE9A 4AXPA 2KZ7A 3T24A 3HR0A 2XASB 3VHLA 1M7KA 4FT6A 2CXDA 4P1NA 3RYFE 1D0ZA 2WWUA 4HTEA 4C91A 4F8HA 5FL0A 3LK2B 3FXEB 2X0YA 4DV6T 3N9OA 5L4EA 2VK9A 4RLCA 3RRCA 4C90A 5C3JA 4HWIB 3RYCE 5DL7A 2W62A 4JYAT 1MMGA 4HFHA 2IDOB 2JQQA 3N2KE 3PGSA 2LHFA 1LVKA 4B3RT 5LGTB 4OHFA 1E54A 2E9XC 3ZEFB 3AAEB 3C64A 2XMXA 2WBLA 1HNXT 1GFMA 2FUPA 5GTIO 2WQYA 3UPGA 2ACZA 5LP6E 2FJEA 1VCSA 2XQ7A 2LRKA 3CVRA 2N2LA 1QLBA 4AQYT 4D5UA 2WZHA 3VE1A 4PJ0O 3EDUA 4H9NC 2HH7A 2L9QA 3AE6A 3RH3A 2FGQX 2F1CX 2J62A 1WYCA 2VB6A 1OXZA 2OA5A 2V6XA 3EMNX 1IZNB 3OTOT 2YEVC 2XZEA 4EGWA 3UU5A 4PAGA 2M67A 5AQSB 4LSIA 1XMQT 2C5IT 1LVFA 2N1GA 3AEEA 2R4NA 2LHNA 2YOEA 2VVSA 4KHZF 4HFDA 2BKNA 4H9RC 4KP3C 5EK3A 4CI2B 4WZXA 5E0OA 1QUUA 4AYMC 4X62T 4O2BE 1SA0E 4U2ZA 2ERVA 2BVMA 2W0GA 4GKJT 4KMCA 2MAWA 1R8IA 1XNRT 2Q9QD 4JLEA 4GYRA 3CQXC 4GCPA 2XAGB 4PFOA 3UU3A 5LGUB 1GFQA 1XDPA 4E7SA 1QJ8A 2JIWA 4JI1T 5CJ5A 3ONJA 4PUXA 5CFBA 3K1SA 1JNRA 3ZMTB 3I1AA 5E79O 2V1DB 4IE5A 3K3NA 2BKOA 3AEDA 2ZLYA 4YHHT 1V9DA 4UXNB 2JJ9A 3UQ7A 4K0KT 3O1IA 3JCUO 4E1SA 5CGMA 1ZHZA 2IMLA 5FL1A 4JI3T 4GIWA 1BR4A 2BDEA 5FXWA 4EYYR 5LHHB 2VWAA 2X9YA 3IBPA 4GYSA 3GN5A 3SOLA 2KZ7B 5J1GA 5ETWA 3IA3A 4BJNA 5HWYA 3VY8X 4FESA 4QQ1A 1I6ZA 1HXTA 3HKDE 3A5XA 3N2GE 4Z90A 3HKBE 3RGLA 3EABA 2XTQA 5AQJB 2CLYC 5JR9A 3IHRA 4O3ZA 1Z0PA 3DWNA 3J9X1 3RF1A 4U2YA 3OBVE 2ODJA 3CX6B 5JDHA 3EHZA 2BKPA 3KZIO 5JVDE 4TZ4C 4JI2T 2UXCT 1QJPA 3ANWA 3LBXA 1U5PA 2E9XB 2CRBA 3K19A 3RIAA 5AQOB 5L47A 1L0VA 3PGRA 2A3DA 4G75A 3PU8A 2R8AA 3Q2MA 2X9WA 2K5BB 2BG9C 5AQMB 3UU2A 4Z8XA 4H9PC 5A1LA 4NPPA 2PTFA 2YDRA 3ETUA 2CEAA 4I43B 2BBHA 4KBMB 3LJCA 3ZLIA 5LJNA 3G06A 3K8PC 1WRDA 4YTMA 2BG9A 2KT9A 2Y8DA 3P8CD 2XTRA 5FNVE 2XE3A 1D0XA 2XSBA 4JI4T 1QSDA 3NVOA 4FOZA 2X9HA 4QX7B 3C4WA 5HCMA 3JC6D 2R6GF 1E1HB 3BRZA 2EHOD 3RPUA 4UIGA 2WS3A 4KI0F 3FB2A 3Q5EA 2X9XA 3T0SA 5C8YE 5GONE 4RLBA 5HXRA 3DZMA 1SE7A 4HGAA 4HFCA 2K24A 3UUMA 4AKRA 2C5JA 3ONLC 3DJBA 3QB5K 3ZSTA 5J2TE 2IUBA 3RBHA 1H7CA 2XQ4A 2XQ3A 5ABHA 4G2AA 5JDNA 1HS7A 2IWWA 2LHRA 4ZZBA 3W15B 4O3XB 2XQ5A 2CM0A 2CBJA 3GN5B 3HKCE 4QHOA 4EXTA 1ZP0A 3AE1A 2W81C 3O4XE 2UXBT 3KV6A 2V7IA 3PUQA 3FZLB 3FBLA 3UFEA 4HWHA 1HF8A 4IDNA 4NUUA 3AEGA 1GFPA 5CA0E 3MJXA 2V5CA 2OV9A 2KC0A 3KVDD 4H63V 4QKNA 2PBIA 1Q9GA 3O1HA 4G76A 3JAEA 3ZN1B 4CXWA 2K0LA 2ODUA 4OYJA 2ZM8A 1PRNA 2YINA 3CK6A 4PK5A 3LFMA 3ZYLA 4I4TE 2LEHA 1MMNA 2CLYB 2V7MA 2J47A 2ES0A 3JADA 4O3WA 5JDMA 1KNPA 5HWXA 4YTNA 1CHUA 4AKIA 3ANWB 4AQGA 3LBXB 2VL0A 1YD8G 5LB7B 4DBRA 4C00A 3RHWA 2V7KA 2DI4A 1MM5A 3KVAA 3WAJA 3LG7A 3KV9A 3S4UA 3CX7B 3C50A 3AA6B 3UT5E 4O4XA 1UX4A 3POXA 3PUZF 6PRNA 4AZLA 3PUAA 5AQPB 4FRXA 4TWDA 4L5GA 2MPKA 4FZNA 4ZI2D 5HXCA 2X66A 2X0LB 2A72A 3DTOA 3VZUX 3Q5DA 1HXUA 1N32T 1SUMB 3T1YT 5IHYA 2A2FX 1ZHXA 2BG9B 3WI3A 2AE9A 4PNIA 2XQ8A 7PRNA 4FI5A 5LMNT 2ZLDA 2CWYA 4N59A 4HFIA 4JCHA 2MYSA 3Q5WA 1THQA 4LSEA 2HN2A 4KUMB 2WDQA 3I0QA 4IDQA 5AQRB 5JDQA 4N58A 4K3BA 5AQLB 3U78A 3M65A 3ZMZB 2FBWA 3RQUA 4IL4A 4BJMA 1OEDC 3SY9A 4XBFB 4ILUA 3KINB 3CQGB 2IC9A 2M07A 5AFUL 8PRNA 2E2AA 3NJTA 4LF5T 4DMWA 1UURA 4ISSA 4EOZB 2FGRA 3BQLA 2WVPA 4IE7A 5J0ZA 1JNZA 1OEDA 2R4OA 1BH3A 4QX8B 3VR8A 5DL8A 4X20E 4B61A 3PQUA 4YFSA 4JI8T 4AQFC 4UVAB 1XZYA 4YTPA 4ASKA 4NXNT 3QUJA 1UX5A 1FMWA 3H3AA 2Y7SA 2JQKA 4FMSA 2W80C 2K9AA 2W63A 4QWNB 3PORA 4UV9B 3NWIA 2O4VA 2XAQB 4D65A 5AQIB 4AQFA 2YK0A 2X67A 3HA4A 4IDPA 2VQET 2NR4A 2JQ9A 2N2MA 3TLVA 3AE7A 4IGUA 4GK5E 2VL8A 2Y0KA 4AYEC 3AVSA 2DL1A 5FVKA 4B3MT 1MNDA 3RI5A 5LJMA 2VKJA 3N9QA 4KHPT 3AB3B 5G39A 3TZGA 2PFVA 1VCTA 3POQA 1UUSA 4YSZA 1FMVA 3T8OA 5TAOA 4JI0T 1W9RA 1WLXA 4WBOA 3J7Yq 1E7PA 3RKGA 3BS0A 3OJAA 5IUXA 2QTKA 4F4BA 4FJOA 4E7ZA 2GK9A 1G73A 3VR9A 4IL6O 3JC6C 4DR5T 5FP3A 2EHOC 3C4ZA 2LSYA 2PJQA 4C4VB 2E9XA 3WU2O 1T7SA 3L8RA 5LNKA 3PUXF 5JREA 2P9BA 4Q25A 4DV4T 3QRAA 1N36T 3UULA 1ZHTA 5KDMC 4DBQA 2EHOA 4JEUB 3KVBA 4JI5T 3FYXA 2Y48B 4TV8E 4O4UA 4L0RA 2RPAA 1OPFA 4KRAA 2CMRA 4UEMA 4P09A 2QYWA 5LG4A 4J2CA 2CE7A 4F6RC 3DA3A 4DV7T 3PJAJ 2BS3A
chains in the Genus database with same CATH topology
2NWBA 4AKHA 5FVNA 5DJQC 2KNDA 3MACA 2JMHA 3ANWA 2ZM0A 3LBXA 5M4YA 3SRZA 1BXWA 2LOPA 2W00A 2XUEA 2BVLA 1U5PA 2LSIA 2SPCA 2V7JA 4NUVA 3I9YA 1X79A 3EDVA 4PJLA 3OYXA 5L2LA 1LRZA 4O2AE 3ZMVB 2D0TA 5L3FB 2E9XB 3LK2A 2ACXA 1HCIA 2XTLA 3F31A 3KV5A 3Q9DA 2UXXB 3K19A 2A3DA 4G75A 2UXNB 3PU8A 3Q2MA 4O4JE 5HAXA 1QJ9A 4AYNA 3HOEA 4XNKA 2MTQA 2X9WA 2C5KT 3PURA 2K5BB 2LE8A 5JR9B 3R6NA 5HXEA 3G7GA 4FSPA 3UU2A 3ZN0B 4WBNE 1BR2A 2RP4A 3LK3B 5CA1E 2NTYA 4Z8XA 5CB4E 4H9PC 4HFVA 5A1LA 3QRCA 2W61A 4V1Av 3UTKA 4ZHQE 4HEAA 4MFRA 4GK0E 5FY7A 4DVDA 5GV0A 2Y2XA 3AA0A 4D64A 3ETUA 2CEAA 5H6QB 4FRTA 4I43B 4KBMB 4GCQA 1HTJF 3LJCA 3AAEA 2DWGA 4ERRA 3ZLIA 5LJNA 1D0YA 3K8PC 3N9NA 2F1VA 3AAAA 1ZEEA 2IAKA 1WRDA 2RA1A 2NTXA 2CCQA 4RJXA 2KT9A 2Y8DA 5JRCB 1OSMA 2MBGA 3H37A 1NWMX 3NZQA 2KMFA 2OMFA 4AKLA 2VASA 3L3PA 3P8CD 5T5FA 2XTRA 1P4TA 5FNVE 1YKEB 2XE3A 3PDYA 1D0XA 3BK9A 4AUIA 3N9MA 1KNZA 4O4HE 3ZJ1A 1QSDA 2L3LA 4GCSA 4FOZA 2X9HA 4N78D 1MNEA 3K3QC 1KK7A 1IAPA 1MPFA 4QX7B 3C4WA 2LOSA 2LSKA 2ODVA 2WMOA 3JC6D 2ZMAA 3MA9A 5EZYE 1YKHB 2X51A 2E8IA 3QK6A 1UCUA 5ADXL 1E1HB 5KX5E 3RC8A 1EZ3A 1ZHCA 2EHOD 5H6RB 3HL6A 5PRNA 3RPUA 1VRBA 3KBTA 4UIGA 1MM4A 4X1KE 5G26A 4FUVA 4P0AA 1IZNA 3FB2A 4CI3B 2X9XA 3ETVA 3T0SA 4UVBB 5C8YE 4Z3TA 4ZS3A 3RYIE 2QGSA 5FXXA 5GONE 4ADZA 4H9SE 2DLRA 4RLBA 3C98B 4BA9A 4G63A 4YJ3E 4O4LE 5HXRA 4HGAA 4ZI3D 5LHIB 3I0OA 4U72A 4AKGA 3AA1A 4ISTA 5F8PA 3ZC0A 2YNKA 4PJMA 3RYHE 3N2OA 1WR6A 3AA7B 3KFWX 3VKHA 4MLKA 3ZPOA 3ZMUB 2MOZA 4EZ4A 2K24A 3UUMA 1BR0A 4A56A 3HWBA 3O9XA 4AKRA 3AAAB 2C5JA 2CXFA 3PUGA 3SWHA 2LT3A 1H6S1 3VY9X 2XAHB 4O4IE 5DL6A 3RKOA 3ESLA 3DJBA 2Q9QB 3NBXX 4PJNA 4PW8A 3WI5A 2YU2A 4O3YA 5J2TE 1FEWA 3RBHA 3UAQA 2I59A 1H7CA 2DNXA 4O49A 4KR4A 4L9IA 3NZPA 2NP9A 2LM9A 4G2AA 5EE2A 5JDNA 1HS7A 3NRXA 2XAJB 4UVCB 2JMMA 1T98A 3FHNA 3FXDB 4WW0A 3UUNA 2LHRA 3E08A 3W15B 5FMNA 4O3XB 1D1AA 2HPLA 2CM0A 2J1DG 2MHLA 5IYUA 3F57A 2N2NA 4I50E 3GN5B 3HKCE 4JUYA 4QHOA 4EXTA 4H9OC 3HW9A 2WAUA 2XE5A 2PRNA 3O0EA 2IC6A 3A2SX 2W81C 3BQKA 3VKGA 3O4XE 5LGNB 1BR1A 4TN7B 2LFUA 4UF0B 4LSHA 3AVRA 3HI2A 5AFUK 2XG6A 3KV6A 2V7IA 3PUQA 3GP6A 2D0UA 2XAFB 5LCYA 3PRNA 3SYBA 4DO0A 3SZVA 1D1BA 4EAHA 2H7OA 2YU1A 1PHOA 4GHBA 3VE2A 4GF4A 3FBLA 3UFEA 1D1CA 5DABA 1HF8A 4UELA 4AYDC 2VKOA 4AKMA 4NUUA 4CI1B 1GFPA 3P7IA 5LBQB 4IDZA 4AKRB 3AA6A 1ZHWA 4B6XA 3PU3A 5L3CB 2PG8A 3U3IA 3MJXA 5CA0E 2LSJA 3EUHA 4H63V 4QKNA 2PBIA 5J2UE 1Q9GA 2KC0A 2L8KA 3I9WA 4OK0A 4U74A 2WSSV 3O1HA 3IF8B 4G76A 4ZOLE 4DNDA 3ZN1B 3DA4A 2H3RA 1NAFA 2EHOB 2D5UA 4MHCA 4CXWA 2MNHA 2K0LA 2ODUA 3ZJ2A 5L3GB 4OYJA 2ZFGA 2ZM8A 1PRNA 2YINA 5LBMA 4PK5A 2NOXA 3FBZA 3F2EA 3LFMA 3MZKB 2Y6XA 5LYJE 3ZYLA 4I4TE 5JDPA 2Y0LA 2LEHA 1MMNA 2CLYB 4OYKA 5DQVA 2C0SA 4AXPA 2KZ7A 2M06A 4RJWA 3T24A 2V7MA 3HR0A 2XASB 3CKDA 4PJJA 3VHLA 2XE2A 4FT6A 3WAKA 2ES0A 2CXDA 3RYFE 1D0ZA 2WWUA 5JDMA 4O3WA 5LOVE 5HWXA 3V5SA 4HTEA 3GA8A 4AKIA 3ANWB 5FY1A 4AQGA 3LBXB 3ZCJA 4C91A 3KV4A 2H7VC 3CWZB 5FY0A 1YD8G 4CQIA 4DBRA 4HE8A 2V7KA 2DI4A 1MM5A 2DHRA 3IEEA 3KVAA 3WAJA 1FIOA 1Y64B 3LG7A 3LK2B 3FXEB 3KV9A 3S4UA 5HXHA 3CX7B 3ZMSB 3HKEE 3N9OA 3C50A 1CUNA 3AA6B 2VK9A 2VKDA 3UT5E 4O4XA 1UX4A 4RLCA 3GWHA 3KDSE 3RRCA 3N5LA 4ZS2A 1O3XA 4C90A 3POXA 3RYCE 4U9CA 3B13A 3PUAA 5DL7A 4AZLA 6PRNA 4FRXA 3N9PA 2W62A 5BMVE 4L5GA 4FZNA 1MMGA 3B57A 4ZI2D 2CA5A 4YLHA 1OWAA 5HXCA 2X66A 1VOMA 2JQQA 2X0LB 3NRYA 4E1TA 5ADXK 2A72A 3N2KE 1HFAA 2DWKA 3DTOA 2LHFA 3JTYA 4JFBA 1LVKA 3VZUX 3KBUA 3AA0B 4CXXA 3UUXB 4IE4A 5L3BB 2GE4A 5LGTB 2LSGA 4X1IE 4TX5A 1HXUA 4OHFA 1E54A 2E9XC 2QA7A 3R84B 1ZV4X 3ZEFB 3AAEB 3C64A 4IE6A 4PFPA 2WBLA 2Z6EA 2A2FX 5IHYA 3V5UA 1GFMA 2XMXA 1ZHXA 3UPGA 4ZI2C 3ONXA 4K0UA 4H63H 4OFZA 5LP6E 3CQCB 5JH7E 3WI3A 2JPFA 4PNIA 7PRNA 2WM9A 3RC3A 5JR9C 5LHGB 4IE0A 3VU7H 2BZBA 4FI5A 2XE1A 3VZTX 2ZLDA 1G8XA 2IW5B 1MIYA 5FXVA 3RX6A 2CWYA 4N59A 1HG5A 1US7B 3CVRA 2N2LA 3KVDD 4JCHA 3WI4A 2MYSA 3Q5WA 4D5UA 1THQA 1ZHYA 3SYSA 4LSEA 3VE1A 3SZDA 3BQIA 3EDUA 4H9NC 1S35A 2HH7A 2L9QA 4KUMB 3I0QA 3RH3A 5JDQA 2FGQX 3D0TA 4N58A 3LK42 2K48A 3U78A 1WYCA 2VB6A 4PK6A 1OXZA 2OA5A 3M65A 3C51A 3ZMZB 2YPVA 3EMNX 1IZNB 3PQSA 4BJMA 2YEVC 3SS1A 3SY9A 2B1EA 3ZC1A 3LK3A 4PAGA 2M67A 4XBFB 4ILUA 3KINB 4LSIA 5JDGA 3AA1B 2C5IT 3CQGB 1LVFA 2N1GA 2LHNA 4MBQA 2IC9A 2M07A 5AFUL 8PRNA 4DMWA 4GOUA 4ISSA 1LKXA 4H9RC 4KP3C 5EK3A 4CI2B 4EOZB 4YJ2E 5E0OA 1QUUA 2CWOA 3BQLA 2FGRA 4JEHB 4AYMC 4IE7A 1SHZC 2HPJA 1YW0A 4O2BE 3EVYA 1SA0E 3CX8B 5JRCA 5L3EB 1BH3A 4QX8B 1IJ5A 3PTRB 2CXLA 2ERVA 5F3JA 2BVMA 2W0GA 5DL8A 2KDYA 3OKQA 4KMCA 2D2SA 4X20E 4B61A 3POUA 3K3OA 3PQUA 3T20A 2KWHA 3N9LA 3DP7A 4YFSA 2Q9QD 4AQFC 4UVAB 4JLEA 3OYZA 1U4QA 4GYRA 5IYZE 3CQXC 4GCPA 4ASKA 4TUYE 2XAGB 3ZYMA 4C69X 4PFOA 3VZWX 3QUJA 1UX5A 1FMWA 1MMAA 5LGUB 3H3AA 3ZYKA 4EYUA 2K4TA 2Y7SA 2NW9A 4I55E 1MMDA 5EK4A 4FMSA 2W80C 2K9AA 2DCFA 4CXYA 1GFQA 5D5DA 2J4UP 2W63A 4QWNB 4E7SA 3PORA 4EZHA 4UV9B 1AJ3A 1IJ6A 2Q9QC 1QJ8A 4BAYB 2O4VA 2XAQB 2XHEB 1MIWA 4AFKA 3ZCIA 1ORMA 4D65A 1G90A 1MIVA 5L3DB 4AQFA 4PUXA 2YK0A 2PORA 2X67A 3PUSA 3HA4A 4IIJE 5KMGP 3AA7A 3ZMTB 3AAIA 5JQGE 3I1AA 3CPZA 4ZI7E 2G0UA 2N2MA 2V1DB 3LK41 4IE5A 4IGUA 4TV9E 5LA6E 4YHJA 5FXZA 1ZKEA 4GK5E 4FSOA 4BUMX 4EIWA 2VL8A 2Y0KA 3K3NA 2X68A 4AYEC 4IHJE 3AVSA 3NSGA 4HKAA 2X27X 4XZCA 2Q9QA 2E9XD 1MNDA 4EB6E 2ZLYA 5LJMA 1GFNA 2VKJA 3N9QA 1V9DA 2XQYA 4UXNB 5DL5A 5HXSA 2JJ9A 3O1JA 3AB3B 3TZGA 3PE0A 4FZMA 3O1IA 4E1SA 1ZHZA 2PFVA 3C5OA 3RRWA 3POQA 5JDFA 1S94A 3V8UA 4AYID 4GIWA 3TKLB 4KR8A 1FMVA 3T8OA 5TAOA 1BR4A 4O8SA 4QXBB 2BDEA 5FXWA 1YS5A 2KXPA 4EYYR 5LHHB 1WLXA 4LSFA 2VWAA 2X9YA 5JDLA 3IBPA 3E0ZA 4GYSA 4WBOA 4P0BA 3GN5A 3E22E 3J7Yq 2Y0HA 3SOLA 2KZ7B 2NW8A 5J1GA 3OJAA 5FYMA 2WMNA 2QTKA 4F4BA 3L09A 4FJOA 5ETWA 4E7ZA 2GK9A 4UF0A 4CZZB 1G73A 4HN9A 2V26A 4BJNA 1WYBA 2N9DA 3JC6C 4X1YE 5FP3A 4AI6A 2KWIB 5HWYA 2EHOC 3C4ZA 3VY8X 3GMIA 3C4XA 4UV8B 4FESA 4QQ1A 2LSYA 4MALA 2PJQA 4QXHB 4QXCB 1HX8A 2E9XA 3MK7C 3HKDE 3A5XA 1HXTA 3N2GE 3HKBE 4H9QC 4FZLA 4XAXB 5LNKA 3MXZA 2XTQA 4ZI3C 5JREA 3HOLA 2KINB 2LJLA 2P9BA 3QRAA 2CLYC 2ZM2A 4DMVA 3QC9A 1BT9A 5JR9A 1HG2A 4RL9A 3IHRA 3UULA 4O3ZA 3MKDA 1ZHTA 5KDMC 4DBQA 1Z0PA 2V7LA 3J9X1 2EHOA 4JEUB 3KVBA 3CMLA 4WNKA 2J1NA 3OBVE 2ODJA 3FYXA 2KLQA 3CX6B 5EK2A 2NW7A 2Y48B 4ANJA 5JDHA 4TV8E 5LXTE 3SY7A 1HXXA 2KXPB 4L0RA 5HYAA 1OPFA 4O4UA 4KRAA 4XNLA 1B7TA 2CMRA 4M1PA 5JVDE 1GFOA 4TZ4C 4UEMA 4PK4A 4P09A 5LG4A 4J2CA 2CE7A 4F6RC 3DA3A 2F1TA 5DQWA 1Q9FA 3Q5XA 2VKHA 2JMKA 2JRKA 1QJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 A;  3LK3 B;  5AFU K;  3AA1 A;  3AA1 B;  5ADX K;  3AA7 A;  3AA0 A;  3AA7 B;  3AA0 B;  5AFU L;  3LK2 A;  3LK4 1;  2KXP B;  2KXP A;  3LK2 B;  5ADX L;  3AAE A;  3LK4 2;  3AAE B;  4AKR B;  4AKR A;  3AAA B;  3AAA A;  3AA6 B;  3AA6 A;  2KZ7 A;  1IZN A;  2KZ7 B;  1IZN B; 
#chains in the Genus database with same CATH topology
 4AKH A;  5FVN A;  5DJQ C;  2KND A;  3MAC A;  2JMH A;  2ZM0 A;  5M4Y A;  2LSI A;  3OYX A;  1LRZ A;  3ZMV B;  5L3F B;  2ACX A;  2CBI A;  3F31 A;  3KV5 A;  2YDQ A;  3P4P A;  4O4J E;  4AYN A;  2IIU A;  2BG9 E;  5HXE A;  3G7G A;  3ZN0 B;  4WBN E;  2W61 A;  3VRA A;  2WP9 A;  4MFR A;  4GK0 E;  3AA0 A;  2UU9 T;  4D64 A;  5AQK B;  3PUY F;  3X1D A;  4FRT A;  4GCQ A;  2DWG A;  4ERR A;  1D0Y A;  4YY3 T;  2RA1 A;  2NTX A;  4ZXL A;  1OED B;  4LMK A;  1OSM A;  2MBG A;  3NZQ A;  2KMF A;  4AKL A;  2VAS A;  1P4T A;  1YKE B;  4HWD A;  4AUI A;  1W09 A;  2R89 A;  2WJR A;  1MNE A;  3K3Q C;  1KK7 A;  1MPF A;  2LOS A;  2LSK A;  2WMO A;  4LF8 T;  1YKH B;  5ADX L;  3RC8 A;  1ZHC A;  1N34 T;  3HL6 A;  4X1K E;  5G26 A;  3ETV A;  5HCJ A;  2CPT A;  4ZS3 A;  3AE3 A;  5FXX A;  5HEU A;  4G63 A;  4U72 A;  1XMO T;  3AA1 A;  4IST A;  5F8P A;  1XDO A;  4PJM A;  3RYH E;  5AQQ B;  1IBK T;  3LDQ B;  4MLK A;  2MOZ A;  3QB5 A;  4EZ4 A;  4A56 A;  3O9X A;  2CXF A;  3SWH A;  3VY9 X;  4O4I E;  2ZM6 T;  3RKO A;  4PJN A;  2XPK A;  3DWO X;  2DNX A;  3CIR A;  4KR4 A;  3NZP A;  5EE2 A;  4PR7 A;  2JQH A;  2XAJ B;  4UVC B;  2JMM A;  1HX1 B;  3FHN A;  3FXD B;  3QOF A;  4WW0 A;  3E08 A;  2XSA A;  5IYU A;  2V8S V;  3HW9 A;  2XE5 A;  3A2S X;  3VKG A;  2WCA A;  3AVR A;  2XG6 A;  3A8Y C;  3ZKR A;  3PRN A;  3SZV A;  3UU4 A;  4EAH A;  4GHB A;  2YU1 A;  2WDV A;  1D1C A;  5DAB A;  1UGO A;  2VKO A;  4AKM A;  3EI0 A;  3P7I A;  4IDZ A;  3AA6 A;  5L3C B;  2PG8 A;  4A5X A;  2LSJ A;  3EUH A;  3I9W A;  2WSS V;  5ABF A;  5JTG A;  3PUW F;  4ZOL E;  3DA4 A;  4YSY A;  2EHO B;  4MHC A;  2ZFG A;  2NOX A;  3P4S A;  3TLT A;  5HEJ A;  3MZK B;  5LYJ E;  5DQV A;  2C0S A;  2XE2 A;  2BS2 A;  3WAK A;  5LOV E;  3GA8 A;  3JCF A;  3KV4 A;  4ZEY A;  3CWZ B;  4CQI A;  2DHR A;  1FIO A;  1Y64 B;  3FZH B;  4DID B;  2HN1 A;  5HXH A;  3ZMS B;  1CUN A;  3GWH A;  3KDS E;  4ZS2 A;  5C2T A;  4COF A;  3UQ4 A;  5BMV E;  2R88 A;  4FQE A;  5AQV B;  2CA5 A;  4YLH A;  1OWA A;  1VOM A;  2R4P A;  1HFA A;  2DWK A;  4LFA T;  4JFB A;  3AA0 B;  4CXX A;  2GE4 A;  4ZZC A;  4DR1 T;  2LSG A;  4X1I E;  5ABG A;  1ZV4 X;  2V6Y A;  4PFP A;  1W0B A;  3TLU A;  4K0U A;  4H63 H;  4OFZ A;  4CN6 A;  1YXR A;  3VU7 H;  2XE1 A;  3VZT X;  4K3C A;  2IW5 B;  1MIY A;  3RX6 A;  5IWA T;  1HG5 A;  1US7 B;  2F4V T;  3WI4 A;  2LRL A;  2AXT O;  1S35 A;  2LLY A;  3LK4 2;  2X9K A;  5B66 O;  1DU2 A;  3PQS A;  1OED E;  3P4R A;  2H89 A;  3SS1 A;  2B1E A;  3LK3 A;  4A97 A;  3SFE A;  5JDG A;  3AA1 B;  4NXM T;  4GOU A;  3SFD A;  1LKX A;  3T1H T;  4YJ2 E;  3M3Z B;  2CWO A;  1SHZ C;  2HPJ A;  1YW0 A;  4JV5 T;  3EVY A;  1IJ5 A;  3PTR B;  1KEY A;  5AQN B;  2KDY A;  3OKQ A;  3POU A;  3T20 A;  1HR0 T;  3OYZ A;  3AXJ A;  4QH5 A;  4EYU A;  2XJ7 A;  2NW9 A;  2J4U P;  4EZH A;  2Q9Q C;  4LF6 T;  1MIW A;  2YKS A;  1J5W A;  3ZCI A;  1ORM A;  1G90 A;  1MIV A;  2K3W A;  4WYV A;  1T16 A;  3P4Q A;  3PUS A;  3FZK B;  5JQG E;  3CPZ A;  4ZI7 E;  2G0U A;  4C4V A;  5LA6 E;  1ZKE A;  4EED A;  3TLW A;  3UFG A;  2X68 A;  1IBL T;  4IHJ E;  4HKA A;  3RLF F;  2X27 X;  4XZC A;  2Q9Q A;  3AE4 A;  5ABF B;  2X0H A;  4ILC A;  2XQY A;  5DL5 A;  3PE0 A;  4FZM A;  3C5O A;  2XY8 B;  3RRW A;  1S94 A;  3V8U A;  3A0B O;  3TKL B;  4KR8 A;  2WJQ A;  2LKG A;  4O8S A;  1YS5 A;  4LSF A;  5JDL A;  3E0Z A;  4P0B A;  3E22 E;  3L09 A;  5ABE A;  4CZZ B;  1WYB A;  2N9D A;  4AI6 A;  1Z8U A;  2BBJ A;  2KWI B;  3LSV A;  3GMI A;  3C4X A;  4UV8 B;  5G3A A;  1HX8 A;  3MK7 C;  4H9Q C;  3AEA A;  3HOL A;  2LJL A;  2ZM2 A;  2D9D A;  1T1L A;  4TWF A;  2J4G A;  2HHH T;  3CML A;  2XM2 A;  4WNK A;  2J1N A;  5AQH B;  2KLQ A;  4B3T T;  5EK2 A;  4ANJ A;  4DR2 T;  3SY7 A;  2KXP B;  4XNL A;  1GFO A;  2V6Y B;  4DR4 T;  1Q9F A;  3Q5X A;  3A0H O;  3SRZ A;  1BXW A;  2XM1 A;  2LOP A;  2W00 A;  2XUE A;  2BVL A;  2SPC A;  4DR3 T;  2V7J A;  3I9Y A;  2CHN A;  2KSR A;  1X79 A;  3UUB A;  4PJL A;  2D0T A;  5GTH O;  2UXN B;  1X9B A;  4XNK A;  2MTQ A;  2C5K T;  3PUR A;  2LE8 A;  1BR2 A;  2RP4 A;  3LK3 B;  5CA1 E;  5CB4 E;  3RQW A;  4ZHQ E;  1YQ3 A;  4DVD A;  5FY7 A;  5GV0 A;  4QH1 A;  3UU6 A;  4U31 A;  4EV6 A;  4UR9 A;  1ZEE A;  2E5V A;  3FZF B;  2OMF A;  4YT0 A;  3ZT6 A;  5T5F A;  3PDY A;  2WB5 A;  3N9M A;  4O4H E;  2L3L A;  4GCS A;  1NEN A;  3JAF A;  1IAP A;  5AQT B;  2WU2 A;  5KX5 E;  3AXJ B;  5H6R B;  3KBT A;  1MM4 A;  3FZM B;  4P0A A;  4CI3 B;  2JQY A;  4TNV A;  3AEF A;  4UVB B;  1HNZ T;  2W66 A;  4Z3T A;  3RYI E;  4ADZ A;  2DLR A;  3C98 B;  4BA9 A;  4ZI3 D;  4O4L E;  5LHI B;  4N75 A;  2FJA A;  2WY2 A;  3N2O A;  3VKH A;  4ILA A;  5H2F O;  3ZMU B;  1BR0 A;  1FJG T;  3PGU A;  5KAF O;  3AAA B;  3PUG A;  1H6S 1;  2LT3 A;  4YXD A;  3EAM A;  3WI5 A;  2Q9Q B;  3NBX X;  2YU2 A;  4X64 T;  1FEW A;  2IWV A;  4ILB A;  2UUC T;  4O49 A;  2VQF T;  4L9I A;  2NP9 A;  2LM9 A;  3NRX A;  5HEH A;  1T98 A;  1D1A A;  2HPL A;  2MHL A;  3F57 A;  4I50 E;  4JUY A;  3RIF A;  2PRN A;  3O0E A;  2IC6 A;  1BR1 A;  4TN7 B;  2LFU A;  3GP6 A;  2XAF B;  5LCY A;  3RIU C;  5LBQ B;  1ZHW A;  1NEK A;  5J2U E;  2L8K A;  4OK0 A;  5BR8 T;  2I0M A;  3P4W A;  3UU8 A;  2WDR A;  4IT4 A;  4DND A;  1NAF A;  2QVA A;  2M6B A;  3ZJ2 A;  5L3G B;  5LBM A;  4AIS A;  4OX9 T;  3RIU A;  3F2E A;  1KF6 A;  5KAI O;  5JDP A;  2Y0L A;  4OYK A;  4RJW A;  2M06 A;  1WFD A;  3CKD A;  4PJJ A;  3TLS A;  3V5S A;  3B5M A;  5FY1 A;  3ZCJ A;  2H7V C;  4X66 T;  2M6I A;  5FY0 A;  4HE8 A;  4LFB T;  3IEE A;  2H88 A;  4HFB A;  3HKE E;  2VKD A;  3N5L A;  4U7Y A;  1O3X A;  4U9C A;  2LM2 A;  2YN6 A;  5G38 A;  3B13 A;  3N9P A;  3AE2 A;  2XQ9 A;  3B57 A;  4EEB A;  3NRY A;  4E1T A;  5ADX K;  3BRY A;  2IHR 1;  3JTY A;  2WU5 A;  2VVN A;  3KBU A;  1XNQ T;  3UUX B;  4IE4 A;  5L3B B;  4TX5 A;  2QA7 A;  3R84 B;  2UUB T;  4IE6 A;  3H3M A;  2Z6E A;  3V5U A;  2R4L A;  5HEG A;  4ZI2 C;  3ONX A;  2XQ6 A;  3CQC B;  5JH7 E;  2JPF A;  4AIU A;  2WM9 A;  3RC3 A;  5JR9 C;  5LHG B;  4IE0 A;  2BZB A;  1G8X A;  5FXV A;  5HEO A;  4CN4 A;  4YSX A;  1M62 A;  1ZHY A;  3SYS A;  3SZD A;  5FKY A;  3PJA A;  3BQI A;  3ZSS A;  3D0T A;  2K48 A;  2W4X A;  4PK6 A;  5AQG B;  3C51 A;  1S5L O;  2YPV A;  2A9U A;  2OLT A;  3ZC1 A;  4TNW A;  4GKK T;  3A7M A;  4HFE A;  4MBQ A;  4LFC T;  1KFY A;  3P50 A;  3PV0 F;  1I94 T;  2I6H A;  4U7I A;  4JEH B;  5LMU T;  3CX8 B;  5JRC A;  5L3E B;  2CXL A;  5F3J A;  2D2S A;  2CHO A;  3K3O A;  4N74 A;  3PF1 A;  3L39 A;  2KWH A;  3N9L A;  1W0A A;  3DP7 A;  4LF4 T;  1U4Q A;  5IYZ E;  4JI7 T;  4TUY E;  4DV3 T;  3ZYM A;  4C69 X;  3VZW X;  4B3S T;  1MMA A;  3ZYK A;  2K4T A;  4I55 E;  1MMD A;  5EK4 A;  2DCF A;  4CXY A;  4JI6 T;  5D5D A;  1AJ3 A;  1IJ6 A;  4BAY B;  2XHE B;  4AFK A;  2AXD S;  2W67 A;  5L3D B;  1J5E T;  4LF9 T;  5LG3 A;  2POR A;  5B5E O;  4IIJ E;  5KMG P;  4DV5 T;  3AA7 A;  3AAI A;  1HNW T;  5L4H A;  4HWF A;  3LK4 1;  4TV9 E;  4I0U A;  4YHJ A;  5FXZ A;  4FSO A;  4BUM X;  4EIW A;  1GQE A;  3NSG A;  5F5W A;  2E9X D;  4EB6 E;  1GFN A;  1J1J A;  5HXS A;  3O1J A;  2LKH A;  5JDF A;  4HWC A;  4AYI D;  4QXB B;  2KXP A;  4DV0 T;  4X65 T;  2Y0H A;  3ZT5 A;  2NW8 A;  5FYM A;  2WMN A;  4UF0 A;  4DR6 T;  4HN9 A;  2V26 A;  4X1Y E;  4LML A;  4MAL A;  4QXH B;  4QXC B;  1N33 T;  3AEC A;  4FZL A;  4XAX B;  3MXZ A;  4ZI3 C;  2KIN B;  4DMV A;  3QC9 A;  1BT9 A;  1HG2 A;  4RL9 A;  3MKD A;  3PUV F;  2V7L A;  2NW7 A;  5LXT E;  1HXX A;  5HYA A;  1B7T A;  4M1P A;  4PK4 A;  4UB8 O;  4A98 A;  2F1T A;  5DQW A;  3OVU A;  2VKH A;  2JMK A;  2JRK A;  4DUZ T;  2NWB A;  5AQF B;  4IL9 A;  4NUV A;  4QH4 A;  4IDO A;  3EDV A;  5L2L A;  4O2A E;  3LK2 A;  1HCI A;  2XTL A;  1Y01 A;  3Q9D A;  2UXX B;  1QJ9 A;  5HAX A;  3HOE A;  5JR9 B;  3R6N A;  3AE8 A;  4FSP A;  2NTY A;  4HFV A;  3QRC A;  4V1A v;  3UTK A;  3AEB A;  4HEA A;  3ABV A;  2Y2X A;  5FVL A;  2VUR A;  5H6Q B;  4X5T A;  2BS4 A;  1HTJ F;  3AAE A;  3N9N A;  2F1V A;  3AAA A;  2IAK A;  2CCQ A;  4RJX A;  5JRC B;  1YQ4 A;  3H37 A;  1NWM X;  3L3P A;  3VRB A;  4LF7 T;  2B76 A;  2WWV A;  3BK9 A;  1KNZ A;  4DUY T;  4CN1 A;  3ZJ1 A;  2UUA T;  4N78 D;  3ZT7 A;  2ODV A;  3MA9 A;  2ZMA A;  5EZY E;  2X51 A;  2E8I A;  3QK6 A;  1UCU A;  4NIQ A;  1EZ3 A;  5PRN A;  1KNR A;  1VRB A;  3QNU A;  4FUV A;  1IZN A;  1T72 A;  4KX6 A;  5KXJ A;  3AE5 A;  1WCR A;  2QGS A;  4UB6 O;  4H9S E;  4YJ3 E;  4AKG A;  5TIS O;  3I0O A;  3ZC0 A;  2YNK A;  1WR6 A;  3AA7 B;  3KFW X;  4DR7 T;  2FJD A;  3ZPO A;  2QRX A;  3HWB A;  2XAH B;  5DL6 A;  3ESL A;  2WZI A;  4PW8 A;  4O3Y A;  4U3C A;  3UAQ A;  2I59 A;  2V5D A;  4Z91 A;  1ZOY A;  2W2U A;  1IBM T;  3NKZ A;  3UUN A;  4LMJ A;  5FMN A;  2J1D G;  2N2N A;  1UK5 A;  1E2A A;  4H9O C;  2WAU A;  2E5L T;  3BQK A;  1WR0 A;  5LGN B;  4UF0 B;  4LSH A;  3HI2 A;  5AFU K;  4DV2 T;  4TWH A;  2D0U A;  3SYB A;  4DO0 A;  1D1B A;  2H7O A;  1PHO A;  3VE2 A;  4GF4 A;  2XQA A;  4UEL A;  4AYD C;  2FJB A;  4CI1 B;  4AKR B;  2UXD T;  4B6X A;  1XWM A;  3PU3 A;  5AQU B;  3U3I A;  4DV1 T;  4U74 A;  3IF8 B;  3OPC A;  1T8B A;  2H3R A;  4JBW F;  2D5U A;  2MNH A;  4IRE A;  4CTD A;  3FBZ A;  2Y6X A;  4U33 A;  2YDS A;  3AE9 A;  4AXP A;  2KZ7 A;  3T24 A;  3HR0 A;  2XAS B;  3VHL A;  1M7K A;  4FT6 A;  2CXD A;  4P1N A;  3RYF E;  1D0Z A;  2WWU A;  4HTE A;  4C91 A;  4F8H A;  5FL0 A;  3LK2 B;  3FXE B;  2X0Y A;  4DV6 T;  3N9O A;  5L4E A;  2VK9 A;  4RLC A;  3RRC A;  4C90 A;  5C3J A;  4HWI B;  3RYC E;  5DL7 A;  2W62 A;  4JYA T;  1MMG A;  4HFH A;  2IDO B;  2JQQ A;  3N2K E;  3PGS A;  2LHF A;  1LVK A;  4B3R T;  5LGT B;  4OHF A;  1E54 A;  2E9X C;  3ZEF B;  3AAE B;  3C64 A;  2XMX A;  2WBL A;  1HNX T;  1GFM A;  2FUP A;  5GTI O;  2WQY A;  3UPG A;  2ACZ A;  5LP6 E;  2FJE A;  1VCS A;  2XQ7 A;  2LRK A;  3CVR A;  2N2L A;  1QLB A;  4AQY T;  4D5U A;  2WZH A;  3VE1 A;  4PJ0 O;  3EDU A;  4H9N C;  2HH7 A;  2L9Q A;  3AE6 A;  3RH3 A;  2FGQ X;  2F1C X;  2J62 A;  1WYC A;  2VB6 A;  1OXZ A;  2OA5 A;  2V6X A;  3EMN X;  1IZN B;  3OTO T;  2YEV C;  2XZE A;  4EGW A;  3UU5 A;  4PAG A;  2M67 A;  5AQS B;  4LSI A;  1XMQ T;  2C5I T;  1LVF A;  2N1G A;  3AEE A;  2R4N A;  2LHN A;  2YOE A;  2VVS A;  4KHZ F;  4HFD A;  2BKN A;  4H9R C;  4KP3 C;  5EK3 A;  4CI2 B;  4WZX A;  5E0O A;  1QUU A;  4AYM C;  4X62 T;  4O2B E;  1SA0 E;  4U2Z A;  2ERV A;  2BVM A;  2W0G A;  4GKJ T;  4KMC A;  2MAW A;  1R8I A;  1XNR T;  2Q9Q D;  4JLE A;  4GYR A;  3CQX C;  4GCP A;  2XAG B;  4PFO A;  3UU3 A;  5LGU B;  1GFQ A;  1XDP A;  4E7S A;  1QJ8 A;  2JIW A;  4JI1 T;  5CJ5 A;  3ONJ A;  4PUX A;  5CFB A;  3K1S A;  1JNR A;  3ZMT B;  3I1A A;  5E79 O;  2V1D B;  4IE5 A;  3K3N A;  2BKO A;  3AED A;  2ZLY A;  4YHH T;  1V9D A;  4UXN B;  2JJ9 A;  3UQ7 A;  4K0K T;  3O1I A;  3JCU O;  4E1S A;  5CGM A;  1ZHZ A;  2IML A;  5FL1 A;  4JI3 T;  4GIW A;  1BR4 A;  2BDE A;  5FXW A;  4EYY R;  5LHH B;  2VWA A;  2X9Y A;  3IBP A;  4GYS A;  3GN5 A;  3SOL A;  2KZ7 B;  5J1G A;  5ETW A;  3IA3 A;  4BJN A;  5HWY A;  3VY8 X;  4FES A;  4QQ1 A;  1I6Z A;  1HXT A;  3HKD E;  3A5X A;  3N2G E;  4Z90 A;  3HKB E;  3RGL A;  3EAB A;  2XTQ A;  5AQJ B;  2CLY C;  5JR9 A;  3IHR A;  4O3Z A;  1Z0P A;  3DWN A;  3J9X 1;  3RF1 A;  4U2Y A;  3OBV E;  2ODJ A;  3CX6 B;  5JDH A;  3EHZ A;  2BKP A;  3KZI O;  5JVD E;  4TZ4 C;  4JI2 T;  2UXC T;  1QJP A;  3ANW A;  3LBX A;  1U5P A;  2E9X B;  2CRB A;  3K19 A;  3RIA A;  5AQO B;  5L47 A;  1L0V A;  3PGR A;  2A3D A;  4G75 A;  3PU8 A;  2R8A A;  3Q2M A;  2X9W A;  2K5B B;  2BG9 C;  5AQM B;  3UU2 A;  4Z8X A;  4H9P C;  5A1L A;  4NPP A;  2PTF A;  2YDR A;  3ETU A;  2CEA A;  4I43 B;  2BBH A;  4KBM B;  3LJC A;  3ZLI A;  5LJN A;  3G06 A;  3K8P C;  1WRD A;  4YTM A;  2BG9 A;  2KT9 A;  2Y8D A;  3P8C D;  2XTR A;  5FNV E;  2XE3 A;  1D0X A;  2XSB A;  4JI4 T;  1QSD A;  3NVO A;  4FOZ A;  2X9H A;  4QX7 B;  3C4W A;  5HCM A;  3JC6 D;  2R6G F;  1E1H B;  3BRZ A;  2EHO D;  3RPU A;  4UIG A;  2WS3 A;  4KI0 F;  3FB2 A;  3Q5E A;  2X9X A;  3T0S A;  5C8Y E;  5GON E;  4RLB A;  5HXR A;  3DZM A;  1SE7 A;  4HGA A;  4HFC A;  2K24 A;  3UUM A;  4AKR A;  2C5J A;  3ONL C;  3DJB A;  3QB5 K;  3ZST A;  5J2T E;  2IUB A;  3RBH A;  1H7C A;  2XQ4 A;  2XQ3 A;  5ABH A;  4G2A A;  5JDN A;  1HS7 A;  2IWW A;  2LHR A;  4ZZB A;  3W15 B;  4O3X B;  2XQ5 A;  2CM0 A;  2CBJ A;  3GN5 B;  3HKC E;  4QHO A;  4EXT A;  1ZP0 A;  3AE1 A;  2W81 C;  3O4X E;  2UXB T;  3KV6 A;  2V7I A;  3PUQ A;  3FZL B;  3FBL A;  3UFE A;  4HWH A;  1HF8 A;  4IDN A;  4NUU A;  3AEG A;  1GFP A;  5CA0 E;  3MJX A;  2V5C A;  2OV9 A;  2KC0 A;  3KVD D;  4H63 V;  4QKN A;  2PBI A;  1Q9G A;  3O1H A;  4G76 A;  3JAE A;  3ZN1 B;  4CXW A;  2K0L A;  2ODU A;  4OYJ A;  2ZM8 A;  1PRN A;  2YIN A;  3CK6 A;  4PK5 A;  3LFM A;  3ZYL A;  4I4T E;  2LEH A;  1MMN A;  2CLY B;  2V7M A;  2J47 A;  2ES0 A;  3JAD A;  4O3W A;  5JDM A;  1KNP A;  5HWX A;  4YTN A;  1CHU A;  4AKI A;  3ANW B;  4AQG A;  3LBX B;  2VL0 A;  1YD8 G;  5LB7 B;  4DBR A;  4C00 A;  3RHW A;  2V7K A;  2DI4 A;  1MM5 A;  3KVA A;  3WAJ A;  3LG7 A;  3KV9 A;  3S4U A;  3CX7 B;  3C50 A;  3AA6 B;  3UT5 E;  4O4X A;  1UX4 A;  3POX A;  3PUZ F;  6PRN A;  4AZL A;  3PUA A;  5AQP B;  4FRX A;  4TWD A;  4L5G A;  2MPK A;  4FZN A;  4ZI2 D;  5HXC A;  2X66 A;  2X0L B;  2A72 A;  3DTO A;  3VZU X;  3Q5D A;  1HXU A;  1N32 T;  1SUM B;  3T1Y T;  5IHY A;  2A2F X;  1ZHX A;  2BG9 B;  3WI3 A;  2AE9 A;  4PNI A;  2XQ8 A;  7PRN A;  4FI5 A;  5LMN T;  2ZLD A;  2CWY A;  4N59 A;  4HFI A;  4JCH A;  2MYS A;  3Q5W A;  1THQ A;  4LSE A;  2HN2 A;  4KUM B;  2WDQ A;  3I0Q A;  4IDQ A;  5AQR B;  5JDQ A;  4N58 A;  4K3B A;  5AQL B;  3U78 A;  3M65 A;  3ZMZ B;  2FBW A;  3RQU A;  4IL4 A;  4BJM A;  1OED C;  3SY9 A;  4XBF B;  4ILU A;  3KIN B;  3CQG B;  2IC9 A;  2M07 A;  5AFU L;  8PRN A;  2E2A A;  3NJT A;  4LF5 T;  4DMW A;  1UUR A;  4ISS A;  4EOZ B;  2FGR A;  3BQL A;  2WVP A;  4IE7 A;  5J0Z A;  1JNZ A;  1OED A;  2R4O A;  1BH3 A;  4QX8 B;  3VR8 A;  5DL8 A;  4X20 E;  4B61 A;  3PQU A;  4YFS A;  4JI8 T;  4AQF C;  4UVA B;  1XZY A;  4YTP A;  4ASK A;  4NXN T;  3QUJ A;  1UX5 A;  1FMW A;  3H3A A;  2Y7S A;  2JQK A;  4FMS A;  2W80 C;  2K9A A;  2W63 A;  4QWN B;  3POR A;  4UV9 B;  3NWI A;  2O4V A;  2XAQ B;  4D65 A;  5AQI B;  4AQF A;  2YK0 A;  2X67 A;  3HA4 A;  4IDP A;  2VQE T;  2NR4 A;  2JQ9 A;  2N2M A;  3TLV A;  3AE7 A;  4IGU A;  4GK5 E;  2VL8 A;  2Y0K A;  4AYE C;  3AVS A;  2DL1 A;  5FVK A;  4B3M T;  1MND A;  3RI5 A;  5LJM A;  2VKJ A;  3N9Q A;  4KHP T;  3AB3 B;  5G39 A;  3TZG A;  2PFV A;  1VCT A;  3POQ A;  1UUS A;  4YSZ A;  1FMV A;  3T8O A;  5TAO A;  4JI0 T;  1W9R A;  1WLX A;  4WBO A;  3J7Y q;  1E7P A;  3RKG A;  3BS0 A;  3OJA A;  5IUX A;  2QTK A;  4F4B A;  4FJO A;  4E7Z A;  2GK9 A;  1G73 A;  3VR9 A;  4IL6 O;  3JC6 C;  4DR5 T;  5FP3 A;  2EHO C;  3C4Z A;  2LSY A;  2PJQ A;  4C4V B;  2E9X A;  3WU2 O;  1T7S A;  3L8R A;  5LNK A;  3PUX F;  5JRE A;  2P9B A;  4Q25 A;  4DV4 T;  3QRA A;  1N36 T;  3UUL A;  1ZHT A;  5KDM C;  4DBQ A;  2EHO A;  4JEU B;  3KVB A;  4JI5 T;  3FYX A;  2Y48 B;  4TV8 E;  4O4U A;  4L0R A;  2RPA A;  1OPF A;  4KRA A;  2CMR A;  4UEM A;  4P09 A;  2QYW A;  5LG4 A;  4J2C A;  2CE7 A;  4F6R C;  3DA3 A;  4DV7 T;  3PJA J;  2BS3 A; 
#chains in the Genus database with same CATH homology
 2NWB A;  4AKH A;  5FVN A;  5DJQ C;  2KND A;  3MAC A;  2JMH A;  3ANW A;  2ZM0 A;  3LBX A;  5M4Y A;  3SRZ A;  1BXW A;  2LOP A;  2W00 A;  2XUE A;  2BVL A;  1U5P A;  2LSI A;  2SPC A;  2V7J A;  4NUV A;  3I9Y A;  1X79 A;  3EDV A;  4PJL A;  3OYX A;  5L2L A;  1LRZ A;  4O2A E;  3ZMV B;  2D0T A;  5L3F B;  2E9X B;  3LK2 A;  2ACX A;  1HCI A;  2XTL A;  3F31 A;  3KV5 A;  3Q9D A;  2UXX B;  3K19 A;  2A3D A;  4G75 A;  2UXN B;  3PU8 A;  3Q2M A;  4O4J E;  5HAX A;  1QJ9 A;  4AYN A;  3HOE A;  4XNK A;  2MTQ A;  2X9W A;  2C5K T;  3PUR A;  2K5B B;  2LE8 A;  5JR9 B;  3R6N A;  5HXE A;  3G7G A;  4FSP A;  3UU2 A;  3ZN0 B;  4WBN E;  1BR2 A;  2RP4 A;  3LK3 B;  5CA1 E;  2NTY A;  4Z8X A;  5CB4 E;  4H9P C;  4HFV A;  5A1L A;  3QRC A;  2W61 A;  4V1A v;  3UTK A;  4ZHQ E;  4HEA A;  4MFR A;  4GK0 E;  5FY7 A;  4DVD A;  5GV0 A;  2Y2X A;  3AA0 A;  4D64 A;  3ETU A;  2CEA A;  5H6Q B;  4FRT A;  4I43 B;  4KBM B;  4GCQ A;  1HTJ F;  3LJC A;  3AAE A;  2DWG A;  4ERR A;  3ZLI A;  5LJN A;  1D0Y A;  3K8P C;  3N9N A;  2F1V A;  3AAA A;  1ZEE A;  2IAK A;  1WRD A;  2RA1 A;  2NTX A;  2CCQ A;  4RJX A;  2KT9 A;  2Y8D A;  5JRC B;  1OSM A;  2MBG A;  3H37 A;  1NWM X;  3NZQ A;  2KMF A;  2OMF A;  4AKL A;  2VAS A;  3L3P A;  3P8C D;  5T5F A;  2XTR A;  1P4T A;  5FNV E;  1YKE B;  2XE3 A;  3PDY A;  1D0X A;  3BK9 A;  4AUI A;  3N9M A;  1KNZ A;  4O4H E;  3ZJ1 A;  1QSD A;  2L3L A;  4GCS A;  4FOZ A;  2X9H A;  4N78 D;  1MNE A;  3K3Q C;  1KK7 A;  1IAP A;  1MPF A;  4QX7 B;  3C4W A;  2LOS A;  2LSK A;  2ODV A;  2WMO A;  3JC6 D;  2ZMA A;  3MA9 A;  5EZY E;  1YKH B;  2X51 A;  2E8I A;  3QK6 A;  1UCU A;  5ADX L;  1E1H B;  5KX5 E;  3RC8 A;  1EZ3 A;  1ZHC A;  2EHO D;  5H6R B;  3HL6 A;  5PRN A;  3RPU A;  1VRB A;  3KBT A;  4UIG A;  1MM4 A;  4X1K E;  5G26 A;  4FUV A;  4P0A A;  1IZN A;  3FB2 A;  4CI3 B;  2X9X A;  3ETV A;  3T0S A;  4UVB B;  5C8Y E;  4Z3T A;  4ZS3 A;  3RYI E;  2QGS A;  5FXX A;  5GON E;  4ADZ A;  4H9S E;  2DLR A;  4RLB A;  3C98 B;  4BA9 A;  4G63 A;  4YJ3 E;  4O4L E;  5HXR A;  4HGA A;  4ZI3 D;  5LHI B;  3I0O A;  4U72 A;  4AKG A;  3AA1 A;  4IST A;  5F8P A;  3ZC0 A;  2YNK A;  4PJM A;  3RYH E;  3N2O A;  1WR6 A;  3AA7 B;  3KFW X;  3VKH A;  4MLK A;  3ZPO A;  3ZMU B;  2MOZ A;  4EZ4 A;  2K24 A;  3UUM A;  1BR0 A;  4A56 A;  3HWB A;  3O9X A;  4AKR A;  3AAA B;  2C5J A;  2CXF A;  3PUG A;  3SWH A;  2LT3 A;  1H6S 1;  3VY9 X;  2XAH B;  4O4I E;  5DL6 A;  3RKO A;  3ESL A;  3DJB A;  2Q9Q B;  3NBX X;  4PJN A;  4PW8 A;  3WI5 A;  2YU2 A;  4O3Y A;  5J2T E;  1FEW A;  3RBH A;  3UAQ A;  2I59 A;  1H7C A;  2DNX A;  4O49 A;  4KR4 A;  4L9I A;  3NZP A;  2NP9 A;  2LM9 A;  4G2A A;  5EE2 A;  5JDN A;  1HS7 A;  3NRX A;  2XAJ B;  4UVC B;  2JMM A;  1T98 A;  3FHN A;  3FXD B;  4WW0 A;  3UUN A;  2LHR A;  3E08 A;  3W15 B;  5FMN A;  4O3X B;  1D1A A;  2HPL A;  2CM0 A;  2J1D G;  2MHL A;  5IYU A;  3F57 A;  2N2N A;  4I50 E;  3GN5 B;  3HKC E;  4JUY A;  4QHO A;  4EXT A;  4H9O C;  3HW9 A;  2WAU A;  2XE5 A;  2PRN A;  3O0E A;  2IC6 A;  3A2S X;  2W81 C;  3BQK A;  3VKG A;  3O4X E;  5LGN B;  1BR1 A;  4TN7 B;  2LFU A;  4UF0 B;  4LSH A;  3AVR A;  3HI2 A;  5AFU K;  2XG6 A;  3KV6 A;  2V7I A;  3PUQ A;  3GP6 A;  2D0U A;  2XAF B;  5LCY A;  3PRN A;  3SYB A;  4DO0 A;  3SZV A;  1D1B A;  4EAH A;  2H7O A;  2YU1 A;  1PHO A;  4GHB A;  3VE2 A;  4GF4 A;  3FBL A;  3UFE A;  1D1C A;  5DAB A;  1HF8 A;  4UEL A;  4AYD C;  2VKO A;  4AKM A;  4NUU A;  4CI1 B;  1GFP A;  3P7I A;  5LBQ B;  4IDZ A;  4AKR B;  3AA6 A;  1ZHW A;  4B6X A;  3PU3 A;  5L3C B;  2PG8 A;  3U3I A;  3MJX A;  5CA0 E;  2LSJ A;  3EUH A;  4H63 V;  4QKN A;  2PBI A;  5J2U E;  1Q9G A;  2KC0 A;  2L8K A;  3I9W A;  4OK0 A;  4U74 A;  2WSS V;  3O1H A;  3IF8 B;  4G76 A;  4ZOL E;  4DND A;  3ZN1 B;  3DA4 A;  2H3R A;  1NAF A;  2EHO B;  2D5U A;  4MHC A;  4CXW A;  2MNH A;  2K0L A;  2ODU A;  3ZJ2 A;  5L3G B;  4OYJ A;  2ZFG A;  2ZM8 A;  1PRN A;  2YIN A;  5LBM A;  4PK5 A;  2NOX A;  3FBZ A;  3F2E A;  3LFM A;  3MZK B;  2Y6X A;  5LYJ E;  3ZYL A;  4I4T E;  5JDP A;  2Y0L A;  2LEH A;  1MMN A;  2CLY B;  4OYK A;  5DQV A;  2C0S A;  4AXP A;  2KZ7 A;  2M06 A;  4RJW A;  3T24 A;  2V7M A;  3HR0 A;  2XAS B;  3CKD A;  4PJJ A;  3VHL A;  2XE2 A;  4FT6 A;  3WAK A;  2ES0 A;  2CXD A;  3RYF E;  1D0Z A;  2WWU A;  5JDM A;  4O3W A;  5LOV E;  5HWX A;  3V5S A;  4HTE A;  3GA8 A;  4AKI A;  3ANW B;  5FY1 A;  4AQG A;  3LBX B;  3ZCJ A;  4C91 A;  3KV4 A;  2H7V C;  3CWZ B;  5FY0 A;  1YD8 G;  4CQI A;  4DBR A;  4HE8 A;  2V7K A;  2DI4 A;  1MM5 A;  2DHR A;  3IEE A;  3KVA A;  3WAJ A;  1FIO A;  1Y64 B;  3LG7 A;  3LK2 B;  3FXE B;  3KV9 A;  3S4U A;  5HXH A;  3CX7 B;  3ZMS B;  3HKE E;  3N9O A;  3C50 A;  1CUN A;  3AA6 B;  2VK9 A;  2VKD A;  3UT5 E;  4O4X A;  1UX4 A;  4RLC A;  3GWH A;  3KDS E;  3RRC A;  3N5L A;  4ZS2 A;  1O3X A;  4C90 A;  3POX A;  3RYC E;  4U9C A;  3B13 A;  3PUA A;  5DL7 A;  4AZL A;  6PRN A;  4FRX A;  3N9P A;  2W62 A;  5BMV E;  4L5G A;  4FZN A;  1MMG A;  3B57 A;  4ZI2 D;  2CA5 A;  4YLH A;  1OWA A;  5HXC A;  2X66 A;  1VOM A;  2JQQ A;  2X0L B;  3NRY A;  4E1T A;  5ADX K;  2A72 A;  3N2K E;  1HFA A;  2DWK A;  3DTO A;  2LHF A;  3JTY A;  4JFB A;  1LVK A;  3VZU X;  3KBU A;  3AA0 B;  4CXX A;  3UUX B;  4IE4 A;  5L3B B;  2GE4 A;  5LGT B;  2LSG A;  4X1I E;  4TX5 A;  1HXU A;  4OHF A;  1E54 A;  2E9X C;  2QA7 A;  3R84 B;  1ZV4 X;  3ZEF B;  3AAE B;  3C64 A;  4IE6 A;  4PFP A;  2WBL A;  2Z6E A;  2A2F X;  5IHY A;  3V5U A;  1GFM A;  2XMX A;  1ZHX A;  3UPG A;  4ZI2 C;  3ONX A;  4K0U A;  4H63 H;  4OFZ A;  5LP6 E;  3CQC B;  5JH7 E;  3WI3 A;  2JPF A;  4PNI A;  7PRN A;  2WM9 A;  3RC3 A;  5JR9 C;  5LHG B;  4IE0 A;  3VU7 H;  2BZB A;  4FI5 A;  2XE1 A;  3VZT X;  2ZLD A;  1G8X A;  2IW5 B;  1MIY A;  5FXV A;  3RX6 A;  2CWY A;  4N59 A;  1HG5 A;  1US7 B;  3CVR A;  2N2L A;  3KVD D;  4JCH A;  3WI4 A;  2MYS A;  3Q5W A;  4D5U A;  1THQ A;  1ZHY A;  3SYS A;  4LSE A;  3VE1 A;  3SZD A;  3BQI A;  3EDU A;  4H9N C;  1S35 A;  2HH7 A;  2L9Q A;  4KUM B;  3I0Q A;  3RH3 A;  5JDQ A;  2FGQ X;  3D0T A;  4N58 A;  3LK4 2;  2K48 A;  3U78 A;  1WYC A;  2VB6 A;  4PK6 A;  1OXZ A;  2OA5 A;  3M65 A;  3C51 A;  3ZMZ B;  2YPV A;  3EMN X;  1IZN B;  3PQS A;  4BJM A;  2YEV C;  3SS1 A;  3SY9 A;  2B1E A;  3ZC1 A;  3LK3 A;  4PAG A;  2M67 A;  4XBF B;  4ILU A;  3KIN B;  4LSI A;  5JDG A;  3AA1 B;  2C5I T;  3CQG B;  1LVF A;  2N1G A;  2LHN A;  4MBQ A;  2IC9 A;  2M07 A;  5AFU L;  8PRN A;  4DMW A;  4GOU A;  4ISS A;  1LKX A;  4H9R C;  4KP3 C;  5EK3 A;  4CI2 B;  4EOZ B;  4YJ2 E;  5E0O A;  1QUU A;  2CWO A;  3BQL A;  2FGR A;  4JEH B;  4AYM C;  4IE7 A;  1SHZ C;  2HPJ A;  1YW0 A;  4O2B E;  3EVY A;  1SA0 E;  3CX8 B;  5JRC A;  5L3E B;  1BH3 A;  4QX8 B;  1IJ5 A;  3PTR B;  2CXL A;  2ERV A;  5F3J A;  2BVM A;  2W0G A;  5DL8 A;  2KDY A;  3OKQ A;  4KMC A;  2D2S A;  4X20 E;  4B61 A;  3POU A;  3K3O A;  3PQU A;  3T20 A;  2KWH A;  3N9L A;  3DP7 A;  4YFS A;  2Q9Q D;  4AQF C;  4UVA B;  4JLE A;  3OYZ A;  1U4Q A;  4GYR A;  5IYZ E;  3CQX C;  4GCP A;  4ASK A;  4TUY E;  2XAG B;  3ZYM A;  4C69 X;  4PFO A;  3VZW X;  3QUJ A;  1UX5 A;  1FMW A;  1MMA A;  5LGU B;  3H3A A;  3ZYK A;  4EYU A;  2K4T A;  2Y7S A;  2NW9 A;  4I55 E;  1MMD A;  5EK4 A;  4FMS A;  2W80 C;  2K9A A;  2DCF A;  4CXY A;  1GFQ A;  5D5D A;  2J4U P;  2W63 A;  4QWN B;  4E7S A;  3POR A;  4EZH A;  4UV9 B;  1AJ3 A;  1IJ6 A;  2Q9Q C;  1QJ8 A;  4BAY B;  2O4V A;  2XAQ B;  2XHE B;  1MIW A;  4AFK A;  3ZCI A;  1ORM A;  4D65 A;  1G90 A;  1MIV A;  5L3D B;  4AQF A;  4PUX A;  2YK0 A;  2POR A;  2X67 A;  3PUS A;  3HA4 A;  4IIJ E;  5KMG P;  3AA7 A;  3ZMT B;  3AAI A;  5JQG E;  3I1A A;  3CPZ A;  4ZI7 E;  2G0U A;  2N2M A;  2V1D B;  3LK4 1;  4IE5 A;  4IGU A;  4TV9 E;  5LA6 E;  4YHJ A;  5FXZ A;  1ZKE A;  4GK5 E;  4FSO A;  4BUM X;  4EIW A;  2VL8 A;  2Y0K A;  3K3N A;  2X68 A;  4AYE C;  4IHJ E;  3AVS A;  3NSG A;  4HKA A;  2X27 X;  4XZC A;  2Q9Q A;  2E9X D;  1MND A;  4EB6 E;  2ZLY A;  5LJM A;  1GFN A;  2VKJ A;  3N9Q A;  1V9D A;  2XQY A;  4UXN B;  5DL5 A;  5HXS A;  2JJ9 A;  3O1J A;  3AB3 B;  3TZG A;  3PE0 A;  4FZM A;  3O1I A;  4E1S A;  1ZHZ A;  2PFV A;  3C5O A;  3RRW A;  3POQ A;  5JDF A;  1S94 A;  3V8U A;  4AYI D;  4GIW A;  3TKL B;  4KR8 A;  1FMV A;  3T8O A;  5TAO A;  1BR4 A;  4O8S A;  4QXB B;  2BDE A;  5FXW A;  1YS5 A;  2KXP A;  4EYY R;  5LHH B;  1WLX A;  4LSF A;  2VWA A;  2X9Y A;  5JDL A;  3IBP A;  3E0Z A;  4GYS A;  4WBO A;  4P0B A;  3GN5 A;  3E22 E;  3J7Y q;  2Y0H A;  3SOL A;  2KZ7 B;  2NW8 A;  5J1G A;  3OJA A;  5FYM A;  2WMN A;  2QTK A;  4F4B A;  3L09 A;  4FJO A;  5ETW A;  4E7Z A;  2GK9 A;  4UF0 A;  4CZZ B;  1G73 A;  4HN9 A;  2V26 A;  4BJN A;  1WYB A;  2N9D A;  3JC6 C;  4X1Y E;  5FP3 A;  4AI6 A;  2KWI B;  5HWY A;  2EHO C;  3C4Z A;  3VY8 X;  3GMI A;  3C4X A;  4UV8 B;  4FES A;  4QQ1 A;  2LSY A;  4MAL A;  2PJQ A;  4QXH B;  4QXC B;  1HX8 A;  2E9X A;  3MK7 C;  3HKD E;  3A5X A;  1HXT A;  3N2G E;  3HKB E;  4H9Q C;  4FZL A;  4XAX B;  5LNK A;  3MXZ A;  2XTQ A;  4ZI3 C;  5JRE A;  3HOL A;  2KIN B;  2LJL A;  2P9B A;  3QRA A;  2CLY C;  2ZM2 A;  4DMV A;  3QC9 A;  1BT9 A;  5JR9 A;  1HG2 A;  4RL9 A;  3IHR A;  3UUL A;  4O3Z A;  3MKD A;  1ZHT A;  5KDM C;  4DBQ A;  1Z0P A;  2V7L A;  3J9X 1;  2EHO A;  4JEU B;  3KVB A;  3CML A;  4WNK A;  2J1N A;  3OBV E;  2ODJ A;  3FYX A;  2KLQ A;  3CX6 B;  5EK2 A;  2NW7 A;  2Y48 B;  4ANJ A;  5JDH A;  4TV8 E;  5LXT E;  3SY7 A;  1HXX A;  2KXP B;  4L0R A;  5HYA A;  1OPF A;  4O4U A;  4KRA A;  4XNL A;  1B7T A;  2CMR A;  4M1P A;  5JVD E;  1GFO A;  4TZ4 C;  4UEM A;  4PK4 A;  4P09 A;  5LG4 A;  4J2C A;  2CE7 A;  4F6R C;  3DA3 A;  2F1T A;  5DQW A;  1Q9F A;  3Q5X A;  2VKH A;  2JMK A;  2JRK A;  1QJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...