5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
3AA1A 3AAEB 4AKRA 3AAAB 3AA1B 4AKRB 5ADXK 1IZNA 2KZ7A 3LK42 1IZNB 2KZ7B 3AA6A 5ADXL 3AA0A 3AA6B 3AA0B 3AA7A 2KXPA 3AA7B 2KXPB 5AFUK 3LK3A 3LK2A 3LK3B 5AFUL 3LK41 3LK2B 3AAEA 3AAAA
chains in the Genus database with same CATH superfamily
5A1LA 1WYCA 2WSSV 2V7IA 3AVRA 3I9WA 4EV6A 3SFEA 5J1GA 2BDEA 4AYNA 3ZMTB 4QXCB 3IHRA 4XBFB 2F1CX 4YHJA 3F57A 2LKHA 4AKRA 3RYCE 4OYJA 2QYWA 4EYUA 3GN5B 5C2TA 3FHNA 4XNKA 5FKYA 2WVPA 3A5XA 4FT6A 4YSZA 3MKDA 3RIUC 4LF6T 3PV0F 4GYSA 2VURA 4EB6E 1D0XA 4IE6A 2EHOA 5LNKA 1HG5A 5DJQC 4PJLA 1MMDA 4G76A 4DMWA 4J2CA 5LMNT 5L4HA 4L0RA 4PK6A 1HXUA 2K5BB 1I6ZA 4H63V 3E22E 2FJAA 3LK3A 4JV5T 2NR4A 2WMNA 2HH7A 5KXJA 4LSEA 1ZV4X 2CBJA 2EHOD 4JYAT 4DUZT 4Z8XA 4FSOA 4PUXA 3E08A 5ABHA 3AA0B 2UXCT 1WYBA 3VKGA 2F4VT 2WMOA 4UR9A 3AE6A 5AQIB 2LSGA 3PGSA 4GCSA 3FZHB 4P0BA 3Q5EA 2YU2A 2RPAA 3VHLA 3ZMUB 1AJ3A 4UB6O 4ILCA 3HR0A 3PUGA 4UF0B 3PUXF 3C4ZA 3G7GA 4FI5A 3PORA 4XAXB 2G0UA 3VU7H 3LK41 3EDUA 4JUYA 3N9LA 5T5FA 2LSKA 2NTYA 3IF8B 1UCUA 3P7IA 3SZDA 5LGTB 2Q9QB 3QK6A 2ZMAA 2L3LA 5AFUK 1YS5A 2W81C 2I0MA 4BA9A 1OXZA 2YOEA 3WAKA 2R8AA 3ZJ1A 3ZC1A 1T1LA 2V5DA 4LFAT 1MPFA 2LHNA 4TWHA 2VL8A 4DNDA 4ZHQE 3K3NA 3KV6A 2CLYB 1S35A 2DLRA 5JRCB 4LF8T 3ZN1B 4CN6A 4AYEC 4N58A 4U3CA 4XZCA 2F1VA 2VQET 3ESLA 3AE4A 1WR0A 1Y01A 4ZOLE 4AZLA 2XAQB 3ONLC 4F8HA 2C5KT 2K9AA 1ZHYA 4DUYT 4GHBA 3UQ7A 2X51A 4K3BA 4X66T 1GFQA 2VVSA 4JI6T 2XQ7A 2XTRA 1LRZA 4MLKA 1OSMA 4JCHA 1E1HB 4U7IA 3C51A 4D5UA 2JQQA 5AQUB 8PRNA 4CXYA 3NBXX 5JDQA 2RA1A 2GE4A 4TV8E 3IBPA 2E8IA 3I1AA 1BT9A 2A9UA 3UFEA 3HI2A 4EOZB 1X9BA 5B66O 2WAUA 1GFMA 4IE4A 2VQFT 4AKRB 3AEGA 2SPCA 5ADXK 2X9YA 3LG7A 2ZM0A 5J0ZA 2BG9E 5KAFO 4H9RC 1XMOT 5C8YE 3AE3A 3F2EA 2B76A 4QQ1A 1B7TA 2DHRA 5HXSA 2BG9B 4PFPA 2JJ9A 3DZMA 4N59A 1BR0A 2EHOB 2IHR1 4FZLA 3SFDA 5J2UE 3AE9A 1HR0T 4Z90A 3VE2A 4B3TT 2CCQA 3N9NA 4KBMB 1KNRA 3ZJ2A 3A2SX 3B5MA 2CMRA 2IW5B 2QGSA 3FZMB 1OEDC 2BKNA 1GFPA 2V6YB 2X27X 4GK5E 2WDQA 4UIGA 1BXWA 2NP9A 4AXPA 3LK3B 4D65A 4D64A 2NOXA 2X9WA 2X9HA 3RYHE 2HPLA 2A72A 4AKGA 3ANWA 4GCPA 2CE7A 2MAWA 2BVMA 2WWUA 2XUEA 3NWIA 3AA6B 4LF9T 1BR4A 3J7Yq 4TZ4C 1KK7A 2CLYC 4X20E 4DR5T 2PRNA 3PUWF 1XDOA 2X9XA 5DL8A 1HNXT 4AKHA 3C4XA 5CA0E 5FY1A 5KAIO 1VRBA 5FMNA 1QSDA 2NW9A 4E7ZA 5LHIB 3L8RA 3JADA 1XDPA 3N9OA 3JAFA 1DU2A 1WCRA 5L3BB 4LMKA 2Y7SA 2J4GA 4U31A 4B6XA 3VR8A 1D1BA 4CQIA 4PW8A 5LHGB 3KVDD 4CI3B 5D5DA 3SYBA 3NZPA 5DQWA 4KR8A 3LBXB 3MXZA 3CX8B 2W63A 4UVAB 4IE0A 1P4TA 2ES0A 2XAFB 3Q9DA 5LJNA 4B61A 5GONE 2NW7A 1FJGT 5J2TE 1KEYA 5JR9C 3R6NA 2BS3A 4QH5A 3O1IA 3VE1A 4U72A 3AB3B 3MACA 4AISA 3WI5A 4ADZA 4JI1T 2PORA 5AQRB 3R84B 2KDYA 3CK6A 4DR1T 3HKBE 4UXNB 2XQYA 1US7B 5LB7B 3PUYF 4EAHA 3KINB 2E9XB 4CI1B 4YSYA 5TISO 4U74A 5JDNA 3PJAA 4U2YA 1T72A 4O4XA 3KZIO 1W9RA 4UV8B 4C4VA 2V26A 1IBLT 3GMIA 4AYMC 2WWVA 2WJQA 2EHOC 3KVAA 5JH7E 4GK0E 3SY9A 1WR6A 4O4IE 3GP6A 3CMLA 3W15B 3D0TA 3POQA 4IHJE 3O4XE 2VWAA 5CA1E 3LSVA 3PUAA 2D5UA 2L8KA 1WFDA 2GK9A 3FB2A 3AEBA 5FXWA 4K3CA 2DWGA 2XQ9A 3P4RA 5DL7A 5ABFB 4FRXA 1M62A 2BBJA 5CFBA 2CXLA 4KRAA 3T1HT 3RHWA 5L4EA 4H9OC 2X0LB 4YXDA 1ZEEA 2P9BA 3K1SA 4KHPT 4QKNA 3DTOA 3P4WA 3RQWA 2N9DA 2J1DG 4AKMA 2V7KA 4QXBB 2WBLA 3SYSA 2J4UP 2ZFGA 1Q9FA 1MM5A 5LMUT 4O8SA 4DR6T 2XHEB 3AE7A 2JMKA 4AI6A 5FY7A 4ERRA 5LCYA 3LFMA 4FSPA 1MNEA 2M06A 2PG8A 4AFKA 3AE2A 3CWZB 2XAJB 4PNIA 5AFUL 2VKOA 2BZBA 5JDPA 1HX1B 2LE8A 1NWMX 3I0QA 3ANWB 5FVLA 4DV4T 2LRLA 3G06A 4DR4T 5JDLA 2IC9A 2CM0A 2KXPA 5IHYA 4C91A 5LGUB 2Y0HA 4MALA 5JQGE 5JREA 1E54A 3Q5XA 1UX4A 3N2GE 3PE0A 4EEBA 3H3AA 2IWVA 2UUAT 4NIQA 4ZS3A 1S94A 2E5VA 4EZ4A 4C69X 5L3FB 2FBWA 2WZHA 4X62T 2LEHA 1N34T 2X9KA 3VY9X 4ANJA 1HG2A 3PU3A 4ISTA 4WNKA 3ZT6A 1IJ5A 5EE2A 4YFSA 4N78D 2X68A 2MTQA 3CX7B 2IDOB 4WBOA 3QOFA 3FBZA 2M6IA 3TLSA 1THQA 2H89A 2YDQA 4ILUA 1HS7A 3AXJA 4O3YA 2KMFA 4IL4A 3T1YT 3NVOA 2WDRA 1I94T 3Q5WA 3KBUA 3T0SA 5JR9A 3DA4A 4Z3TA 1E7PA 5G38A 5LOVE 5KX5E 2JPFA 2XE5A 4JEHB 4OFZA 3DWOX 3O9XA 2C5IT 5ADXL 2I6HA 2VB6A 1ORMA 2X67A 2CEAA 3BRZA 4IDPA 2LSJA 2UXBT 4CXXA 3P4PA 3VRAA 1H6S1 1HNZT 4A56A 4TUYE 1IAPA 1ZHXA 3LK42 2HHHT 2R4PA 3OPCA 4TWFA 4U33A 4ZEYA 2XTLA 4K0KT 2R4NA 4EYYR 1E2AA 4QX7B 2UXDT 3O1HA 1QUUA 4ZZCA 4M1PA 4FQEA 4LMLA 1G73A 4KX6A 4FZNA 3ZKRA 2BVLA 4JFBA 4ZXLA 1HX8A 2W80C 4WYVA 3PQSA 3VZWX 1LVFA 3AEEA 2MPKA 3PUQA 1JNRA 3RIAA 3JCFA 4JI2T 1OPFA 2LHFA 4NUVA 1H7CA 3V5SA 1T98A 4FRTA 3UUBA 4CN4A 3HWBA 4DMVA 5LJMA 2PJQA 3EDVA 2LRKA 1T16A 2DCFA 5JTGA 5AQMB 3U78A 4PJ0O 4F6RC 2YDRA 4IREA 5M4YA 2HN2A 4UVBB 1J5WA 3ZCIA 4LSIA 4O3WA 1NAFA 3BK9A 2ZM8A 2LM2A 1N32T 2QA7A 4EZHA 1OEDB 3KDSE 4PK5A 4ILBA 3UU2A 2LJLA 4DV5T 1VCTA 4X64T 5HXHA 3I0OA 4QX8B 3L39A 2K48A 3OYZA 3Q2MA 2VL0A 5AQHB 2XAHB 2XJ7A 2XG6A 4IDQA 3PTRB 3SOLA 3C64A 4QXHB 2BKOA 5HWXA 3CQXC 4LF5T 3DWNA 3UUMA 2XY8B 4V1Av 4H63H 1XWMA 2KXPB 1NENA 2WP9A 3HL6A 2Y2XA 5AQQB 4GF4A 3RPUA 2MNHA 3ZSTA 4MHCA 4YHHT 2CRBA 3UUNA 2IAKA 2J1NA 3BS0A 4JLEA 2VK9A 1JNZA 1MMGA 2XQ5A 3P8CD 3BQLA 4O3ZA 3CIRA 4HFDA 4H9NC 3PGRA 4ZZBA 5AQVB 1NEKA 3UQ4A 3K19A 4HWCA 2OA5A 2XM1A 4AQFA 2JIWA 7PRNA 1YKEB 4HWFA 3BQIA 4EEDA 5FL0A 2Y48B 1V9DA 1O3XA 4TX5A 3AXJB 4CXWA 2W62A 3I9YA 4TNWA 4HFCA 1XZYA 5JR9B 3POXA 2VASA 2HPJA 4AKLA 2AE9A 3QB5A 5LG3A 3A7MA 1GFNA 2JQYA 3N9QA 2ZLYA 4QWNB 3HOEA 5H6QB 5AQTB 3CKDA 4GOUA 2OMFA 5HCMA 3IA3A 4O4HE 2OV9A 3NJTA 3AAIA 2LT3A 4IDNA 1YW0A 2UXNB 2R6GF 2F1TA 1MNDA 3L3PA 4I50E 5HEOA 2UXXB 4HWDA 4YTMA 5DL5A 2CWOA 3VZTX 3PUSA 4KHZF 3MA9A 2JRKA 4ASKA 2JMHA 5AQSB 4ZS2A 1UK5A 1OWAA 4N74A 4IL6O 1IZNA 3DA3A 2W00A 3ZCJA 4YTPA 4O4JE 1MIWA 2YK0A 3RLFF 2KWIB 3HKDE 3SS1A 2DL1A 5HWYA 4U7YA 3JCUO 3SRZA 3RI5A 2IC6A 1LVKA 4MFRA 4OX9T 3ONXA 3OKQA 4ZI3C 3DJBA 4DV6T 2R4LA 2K4TA 5FXVA 1Z8UA 4O2AE 1SE7A 3X1DA 3AE1A 5H2FO 2MOZA 3UUXB 3UU8A 3FZLB 5FL1A 2ODJA 1GQEA 2FUPA 3ZT5A 3VY8X 2L9QA 2VKHA 5IYZE 3AAAA 4UB8O 4CTDA 1ZP0A 2ODUA 4JI8T 3WAJA 1WRDA 4L9IA 3N9MA 4WW0A 5B5EO 4U2ZA 3RF1A 3K8PC 2M6BA 5LGNB 2IWWA 1YD8G 2H3RA 2WS3A 4HKAA 4PJNA 3TZGA 5C3JA 3QNUA 3KFWX 3LK2A 3UT5E 4YSXA 2V6XA 4DIDB 1PHOA 3RIFA 4DR7T 4RLCA 3LDQB 5CGMA 4NUUA 4YLHA 2PBIA 5AQOB 2V8SV 2KT9A 2V7JA 3ETVA 1XNQT 4HN9A 3GN5A 3ZC0A 5ABEA 1G8XA 2W0GA 5HEUA 4YY3T 4DV0T 4FMSA 3EMNX 4RJWA 4DVDA 4KI0F 4JI4T 2MYSA 3ZYMA 4L5GA 3AAEA 1HNWT 3NSGA 2KNDA 2XZEA 4PAGA 1BR2A 4YJ2E 4AKIA 2R89A 4C00A 4IDOA 2WU5A 1HFAA 1XNRT 4G63A 4E1TA 4LF4T 3FBLA 1D1AA 3AA7A 2BBHA 4DBQA 3H3MA 5F3JA 5TAOA 3JTYA 2FJEA 3PURA 4MBQA 1BR1A 3UU6A 2KSRA 3RX6A 5JVDE 2DWKA 2XQ8A 3AECA 3RRWA 2JMMA 4N75A 4I43B 2ODVA 3GWHA 3PUVF 2V1DB 2XSBA 5LBMA 4GIWA 2FGRA 3GA8A 2QVAA 3SZVA 4JBWF 4AYDC 1ZHTA 1U5PA 5HXRA 5LA6E 4NPPA 3CQCB 4B3RT 4ILAA 2XMXA 2YKSA 1HXTA 2AXDS 3FXEB 4O4UA 1SHZC 2Y6XA 3Q5DA 3A8YC 4GCQA 2YN6A 2LHRA 3PDYA 4ZI7E 4PR7A 3MK7C 2O4VA 1KNPA 4COFA 3QRAA 5AQJB 2LSYA 3QB5K 4HGAA 2Q9QA 3ZMVB 2YDSA 1CHUA 1IZNB 2V7MA 3A0HO 1ZKEA 4WBNE 3RGLA 1G90A 3FZKB 1KNZA 1N33T 4FUVA 2XAGB 2CPTA 5E0OA 4FZMA 2FJDA 4X1YE 1IBKT 3ZN0B 4YTNA 4LSHA 2YEVC 5FNVE 3C5OA 4DV3T 2WQYA 2Q9QD 3VZUX 3C4WA 3N5LA 1U4QA 1HF8A 5HEHA 4ZI3D 3TLTA 4UVCB 2CHOA 3RC3A 2D0TA 3AAAB 4I55E 4PJMA 1WLXA 1MIYA 3C50A 2ACXA 4OYKA 3N2KE 3NRYA 4O49A 4HE8A 2Z6EA 3VKHA 3V8UA 4AQFC 2V7LA 2YNKA 2CBIA 1VOMA 1M7KA 5AQNB 3LK2B 3OJAA 4H9SE 5E79O 3HKCE 1D1CA 3JAEA 2WU2A 2H88A 3OVUA 4KUMB 2HN1A 2KINB 3BRYA 2WY2A 4UEMA 5EK2A 4AIUA 1EZ3A 2W66A 5CB4E 1MMAA 2UU9T 2ACZA 5HCJA 3AA1A 1R8IA 2OLTA 6PRNA 3S4UA 4ISSA 4H9QC 5ETWA 4IDZA 2RP4A 4ZI2D 3PUZF 4I0UA 4C4VB 4O3XB 3V5UA 3ZPOA 2X0HA 4B3MT 2WZIA 2BG9A 2MHLA 3UTKA 4LF7T 4KMCA 3ZMSB 4JI7T 3A0BO 3AAEB 4O4LE 3UULA 5PRNA 2D2SA 5DABA 3TLWA 2A2FX 3FXDB 3AA7B 2VKJA 2V6YA 1HXXA 4JI0T 1N36T 4PK4A 4P09A 3KV9A 4HFEA 5FVKA 2N2NA 2J47A 3B13A 4TV9E 2XPKA 2QRXA 3AA6A 4RL9A 2XASB 2LKGA 5FYMA 2JQ9A 2XE2A 2MBGA 3M3ZB 4AQGA 1BH3A 3EABA 3ZMZB 2AXTO 3N2OA 4HEAA 1OEDE 5LP6E 3POUA 2CXFA 2YU1A 4E1SA 1KF6A 1QJ9A 4HWHA 3NKZA 5IWAT 4GYRA 1W09A 1SUMB 2BS4A 2W67A 3LJCA 5G26A 4TWDA 2K24A 3UU3A 4FJOA 4HFIA 2K3WA 5LG4A 2LLYA 4RJXA 3OYXA 3BQKA 4KR4A 2H7VC 5L3GB 3PJAJ 4UELA 2R88A 1HTJF 5GTIO 4G75A 4AYID 3FYXA 4Z91A 4CZZB 2C0SA 4DR3T 2QTKA 3LBXA 2NWBA 3L09A 1UUSA 4X5TA 3OBVE 1MM4A 2WJRA 1D0ZA 4BJNA 3PF1A 3ZYKA 2CA5A 4LSFA 3UU5A 4LFBT 1L0VA 3ZLIA 5LYJE 2Y8DA 5IUXA 3WU2O 1W0BA 2D0UA 2XE3A 4BUMX 2N2LA 1YXRA 3RC8A 5H6RB 2E9XA 3KVBA 1FIOA 5G3AA 4HWIB 2X66A 2KZ7A 1MIVA 5G39A 2LOSA 1XMQT 3AEFA 3F31A 1ZHCA 5DQVA 2W2UA 3VR9A 2H7OA 4FOZA 1J1JA 2DI4A 2XM2A 2ERVA 1FEWA 4BAYB 5JDGA 1X79A 1YQ3A 5FXZA 2FJBA 2E9XD 5HEGA 3JC6C 3K3OA 4XNLA 3KV4A 2W4XA 4YJ3E 3QRCA 3SY7A 3PQUA 3UU4A 3B57A 3SWHA 5ABFA 2C5JA 4AUIA 4NXNT 2DNXA 2WB5A 2A3DA 2XQAA 4K0UA 3HOLA 1W0AA 5HXCA 3AA1B 3CQGB 1KFYA 4IE5A 2LOPA 5L3CB 2K0LA 3RIUA 4P1NA 3QC9A 3EHZA 3TLVA 3KV5A 2Y0LA 2WM9A 2KC0A 2E5LT 5ABGA 1UGOA 2IIUA 4GKJT 5FY0A 2D9DA 4DV2T 2XQ6A 4O2BE 3CX6B 4QHOA 2ZLDA 2JQKA 2LM9A 3EI0A 3HW9A 5L2LA 5EK3A 2B1EA 4F4BA 3QUJA 5HAXA 3PU8A 2Q9QC 5BMVE 4G2AA 3RKGA 1SA0E 1GFOA 3U3IA 3RYIE 3TKLB 4B3ST 4NXMT 1YKHB 4TN7B 3AEAA 5AQLB 4DO0A 1Z0PA 5CJ5A 5L3DB 3AE8A 3NRXA 3KBTA 2IMLA 5JDMA 4DV7T 2NW8A 4I4TE 4A97A 4JI5T 1ZOYA 3ETUA 4DV1T 1ZHZA 1ZHWA 1FMVA 2CXDA 4A98A 1MMNA 5DL6A 3CVRA 3EAMA 4OHFA 2Y0KA 5LBQB 3EUHA 5AQPB 3C98B 2V5CA 3ABVA 5HXEA 4IE7A 3M65A 4X1IE 4TNVA 3PRNA 1YQ4A 4X65T 1FMWA 3PGUA 4YT0A 5BR8T 4EGWA 2UUBT 5KMGP 5FXXA 3HA4A 2XQ4A 4ZI2C 4X1KE 4Q25A 5HYAA 3OTOT 5F8PA 3T24A 5AQKB 5L47A 3ZT7A 4CI2B 2YPVA 2XE1A 4IL9A 2ZM2A 4C90A 1S5LO 2PFVA 3ZSSA 2FGQX 3P50A 3T20A 3UAQA 5FP3A 4U9CA 2BG9C 2LSIA 2KZ7B 5AQGB 5HEJA 1D0YA 4IGUA 3DP7A 5EK4A 3K3QC 3ZEFB 2LFUA 4E7SA 2CHNA 5LXTE 3TLUA 3IEEA 3WI3A 4DBRA 2N1GA 4RLBA 5EZYE 2UUCT 3AA0A 2XQ3A 4HFVA 2WCAA 4P0AA 4WZXA 3H37A 4GKKT 3O1JA 5F5WA 3JC6D 4LFCT 2M67A 2E2AA 4HTEA 5LHHB 4UV9B 3O0EA 2M07A 1IJ6A 3N9PA 4IIJE 4OK0A 4UF0A 1VCSA 3RH3A 3MJXA 3E0ZA 3ZYLA 5L3EB 3RQUA 2XSAA 3RKOA 4QH1A 1HCIA 2CWYA 3P4SA 4H9PC 4KP3C 3AVSA 4LMJA 2R4OA 3RBHA 2X0YA 1OEDA 3FZFB 1T7SA 2VKDA 3RYFE 1CUNA 1IBMT 2JQHA 2J62A 3ONJA 4EIWA 5KDMC 4QH4A 5GTHO 5JDFA 2KWHA 2BKPA 4HFBA 3T8OA 4BJMA 3J9X1 3WI4A 2KLQA 2IUBA 2YINA 5JDHA 5JRCA 1PRNA 1QJ8A 3UFGA 4JI3T 4PJJA 4FESA 3NZQA 2NTXA 4AQYT 2BS2A 4JEUB 1T8BA 1LKXA 1Y64B 5FVNA 2N2MA 3CPZA 3AE5A 1QJPA 3UPGA 3EVYA 1J5ET 5IYUA 3AEDA 4HFHA 4EXTA 3MZKB 3VRBA 5GV0A 4PFOA 2VVNA 3P4QA 1QLBA 4CN1A 5AQFB 2E9XC 2PTFA 1Q9GA 1UURA 4IT4A 2XTQA 4A5XA 3HKEE 1UX5A 2WDVA 2ZM6T 2W61A 4DR2T 2I59A 3RRCA
chains in the Genus database with same CATH topology
5A1LA 1WYCA 1OWAA 2WSSV 5LG4A 5CA1E 2V7IA 3AVRA 4RJXA 3I9WA 3OYXA 1IZNA 3BQKA 4KR4A 2H7VC 5L3GB 3PUAA 3DA3A 2W00A 4UELA 5J1GA 3ZCJA 1HTJF 2D5UA 2L8KA 4O4JE 1MIWA 4G75A 2GK9A 2YK0A 3FYXA 2KWIB 4AYID 3FB2A 3HKDE 4CZZB 2C0SA 5FXWA 2DWGA 2QTKA 2BDEA 3SS1A 4AYNA 3LBXA 2NWBA 5DL7A 3L09A 3ZMTB 5HWYA 4QXCB 3IHRA 3SRZA 4FRXA 3OBVE 1MM4A 4XBFB 2IC6A 1LVKA 1D0ZA 2CXLA 4MFRA 4YHJA 4BJNA 4KRAA 3F57A 3ONXA 3OKQA 4ZI3C 3ZYKA 4AKRA 3RYCE 3DJBA 4OYJA 4H9OC 2CA5A 2X0LB 4EYUA 3GN5B 2K4TA 4LSFA 5FXVA 1ZEEA 4O2AE 3ZLIA 2P9BA 5LYJE 2Y8DA 3FHNA 4XNKA 2MOZA 4QKNA 3DTOA 2D0UA 2XE3A 2N9DA 2J1DG 3UUXB 4AKMA 4BUMX 2N2LA 2V7KA 3A5XA 4QXBB 4FT6A 2ODJA 2WBLA 3RC8A 3SYSA 3MKDA 5H6RB 2J4UP 2ZFGA 3VY8X 2L9QA 4GYSA 2VKHA 4EB6E 2E9XA 1D0XA 1Q9FA 5IYZE 4IE6A 3AAAA 2EHOA 2ODUA 3KVBA 5LNKA 1MM5A 1HG5A 3WAJA 1FIOA 4O8SA 1WRDA 5DJQC 4PJLA 2XHEB 2X66A 2KZ7A 2JMKA 4IHJE 4L9IA 3N9MA 1MMDA 4WW0A 1MIVA 4G76A 4AI6A 5FY7A 2LOSA 4ERRA 5LCYA 3LFMA 3F31A 3K8PC 4FSPA 4DMWA 5LGNB 1MNEA 2M06A 1YD8G 1ZHCA 2H3RA 2PG8A 4J2CA 5DQVA 4AFKA 2H7OA 4L0RA 4HKAA 4PK6A 2K5BB 4PJNA 1HXUA 4FOZA 3CWZB 2XAJB 4H63V 3TZGA 3E22E 4PNIA 2DI4A 3LK3A 3KFWX 2ERVA 1FEWA 4BAYB 5JDGA 3LK2A 5AFUL 3UT5E 1X79A 2VKOA 2WMNA 5FXZA 2HH7A 2BZBA 4LSEA 5JDPA 1ZV4X 2LE8A 2E9XD 1NWMX 2EHOD 3JC6C 3I0QA 3ANWB 3K3OA 4XNLA 4Z8XA 4FSOA 1PHOA 4PUXA 3KV4A 4YJ3E 3E08A 3QRCA 3SY7A 4RLCA 3PQUA 5JDLA 3AA0B 2IC9A 4NUUA 2CM0A 2KXPA 5IHYA 3B57A 4YLHA 4C91A 5LGUB 3SWHA 2Y0HA 2C5JA 4MALA 5JQGE 5JREA 1E54A 2PBIA 4AUIA 3Q5XA 1UX4A 3N2GE 3PE0A 3H3AA 2DNXA 1WYBA 2KT9A 2V7JA 3ETVA 3VKGA 2A3DA 4ZS3A 4K0UA 4HN9A 2WMOA 3HOLA 3GN5A 3ZC0A 1S94A 4EZ4A 2LSGA 3AA1B 5HXCA 3CQGB 4C69X 4GCSA 4IE5A 2LOPA 1G8XA 5L3CB 2K0LA 4P0BA 5L3FB 2YU2A 3ZMUB 3VHLA 2W0GA 1AJ3A 2LEHA 3HR0A 3QC9A 3VY9X 4FMSA 3PUGA 3EMNX 4ANJA 1HG2A 4UF0B 3KV5A 4RJWA 3PU3A 3C4ZA 2Y0LA 2WM9A 4ISTA 2KC0A 4WNKA 4DVDA 3G7GA 2MYSA 4FI5A 1IJ5A 3PORA 4XAXB 5EE2A 4YFSA 5FY0A 4N78D 3ZYMA 4L5GA 2G0UA 3VU7H 3LK41 3AAEA 3EDUA 4JUYA 3N9LA 3NSGA 4O2BE 2KNDA 2X68A 2MTQA 4PAGA 3CX6B 4QHOA 3CX7B 2LSKA 2ZLDA 2NTYA 4WBOA 2LM9A 3IF8B 1BR2A 1UCUA 4YJ2E 4AKIA 3FBZA 3P7IA 3SZDA 3HW9A 1HFAA 4G63A 5LGTB 2Q9QB 3QK6A 5L2LA 1THQA 2ZMAA 5EK3A 2B1EA 3FBLA 1D1AA 4ILUA 1HS7A 3AA7A 4E1TA 4O3YA 4DBQA 2KMFA 4F4BA 2L3LA 3QUJA 5HAXA 3PU8A 5AFUK 2Q9QC 1YS5A 2W81C 5BMVE 4BA9A 3Q5WA 3KBUA 1OXZA 4G2AA 5F3JA 3T0SA 3WAKA 5TAOA 5JR9A 3DA4A 3JTYA 4Z3TA 3PURA 1SA0E 3ZJ1A 3ZC1A 1GFOA 3U3IA 4MBQA 1BR1A 5LOVE 3RYIE 3RX6A 5JVDE 3TKLB 5KX5E 2DWKA 1MPFA 3RRWA 2JMMA 2LHNA 2JPFA 2XE5A 4JEHB 4OFZA 4I43B 3O9XA 2C5IT 2VL8A 5ADXL 2ODVA 3GWHA 4DNDA 4ZHQE 1YKHB 3K3NA 2CLYB 3KV6A 4TN7B 1S35A 2DLRA 5JRCB 3ZN1B 2V1DB 5LBMA 2VB6A 4DO0A 1Z0PA 4GIWA 5L3DB 3GA8A 1ORMA 2FGRA 3NRXA 4N58A 4AYEC 3SZVA 2X67A 2CEAA 4XZCA 2F1VA 4AYDC 3KBTA 1ZHTA 5JDMA 1U5PA 5HXRA 5LA6E 2NW8A 3ESLA 3CQCB 4I4TE 2LSJA 3ETUA 4CXXA 1ZHZA 2XMXA 1H6S1 4A56A 1ZHWA 4TUYE 1IAPA 1FMVA 2CXDA 1ZHXA 3LK42 4ZOLE 1HXTA 4AZLA 1MMNA 4O4UA 3FXEB 5DL6A 1SHZC 3CVRA 2XAQB 2C5KT 2XTLA 2Y6XA 4OHFA 5LBQB 2Y0KA 2K9AA 1ZHYA 4EYYR 3EUHA 4GCQA 3C98B 4GHBA 4QX7B 2LHRA 3PDYA 4ZI7E 5HXEA 3O1HA 4IE7A 3M65A 3MK7C 2O4VA 2X51A 1QUUA 4X1IE 1GFQA 4M1PA 3QRAA 1G73A 2LSYA 2XTRA 4JCHA 1LRZA 4MLKA 1OSMA 3PRNA 1E1HB 3C51A 4FZNA 4D5UA 2BVLA 2JQQA 4HGAA 4JFBA 2Q9QA 3ZMVB 8PRNA 1IZNB 1FMWA 1HX8A 4CXYA 2W80C 2V7MA 3NBXX 1ZKEA 3PQSA 3VZWX 1LVFA 4WBNE 5JDQA 2RA1A 1G90A 2GE4A 1KNZA 4TV8E 5KMGP 3PUQA 5FXXA 3IBPA 2E8IA 3I1AA 3HA4A 4FUVA 2XAGB 4ZI2C 1BT9A 1OPFA 5E0OA 3UFEA 4X1KE 3HI2A 4EOZB 2LHFA 4NUVA 4FZMA 1H7CA 3V5SA 5HYAA 2WAUA 4X1YE 1T98A 4FRTA 1GFMA 4IE4A 5F8PA 3T24A 3ZN0B 3HWBA 4DMVA 4AKRB 4CI2B 5LJMA 2SPCA 2YPVA 2XE1A 2X9YA 4LSHA 2YEVC 5ADXK 5FNVE 2ZM2A 3LG7A 2ZM0A 3C5OA 2PJQA 2Q9QD 3VZUX 3C4WA 3EDVA 4H9RC 4C90A 3N5LA 1U4QA 5C8YE 1HF8A 3F2EA 4QQ1A 1B7TA 2DCFA 3U78A 4F6RC 2DHRA 2PFVA 5M4YA 4ZI3D 4UVBB 5HXSA 2FGQX 4UVCB 3RC3A 3ZCIA 4LSIA 4PFPA 4O3WA 2JJ9A 1NAFA 2D0TA 4N59A 3T20A 1BR0A 3AAAB 4I55E 5FP3A 2EHOB 4PJMA 3UAQA 1WLXA 4FZLA 3BK9A 2ZM8A 3C50A 1MIYA 2ACXA 3O4XE 5J2UE 4U9CA 3VE2A 2LSIA 2KZ7B 4OYKA 3N2KE 3NRYA 2QA7A 4EZHA 1D0YA 3KDSE 4PK5A 4IGUA 2CCQA 3N9NA 4KBMB 4O49A 3ZJ2A 3DP7A 4HE8A 5EK4A 3A2SX 2Z6EA 3K3QC 3VKHA 3V8UA 3ZEFB 2LFUA 2CMRA 2IW5B 4AQFC 2LJLA 2QGSA 2V7LA 4E7SA 5LXTE 2YNKA 3UU2A 1VOMA 5HXHA 3I0OA 4QX8B 2K48A 3IEEA 3OYZA 3Q2MA 1GFPA 2X27X 4GK5E 3WI3A 4UIGA 4DBRA 1BXWA 2N1GA 2NP9A 3LK3B 4AXPA 4D65A 4D64A 2NOXA 2X9WA 2X9HA 3LK2B 3RYHE 2HPLA 3OJAA 2A72A 2XAHB 4H9SE 4AKGA 2XG6A 3HKCE 3ANWA 3PTRB 3SOLA 4RLBA 1D1CA 3C64A 4QXHB 5HWXA 4GCPA 5EZYE 3CQXC 2CE7A 4KUMB 3AA0A 2KINB 2BVMA 3UUMA 2WWUA 2XUEA 4HFVA 3AA6B 4V1Av 4H63H 4P0AA 3H37A 1BR4A 2KXPB 3J7Yq 4TZ4C 4UEMA 1KK7A 3HL6A 2Y2XA 5EK2A 4GF4A 3RPUA 2MNHA 2CLYC 1EZ3A 3O1JA 4MHCA 4X20E 1MMAA 3JC6D 5CB4E 2PRNA 3AA1A 3UUNA 2M67A 2IAKA 6PRNA 2J1NA 3S4UA 4HTEA 4ISSA 4JLEA 5LHHB 4UV9B 3O0EA 2M07A 2VK9A 2X9XA 5DL8A 4H9QC 1IJ6A 1MMGA 3N9PA 5ETWA 3P8CD 2RP4A 4IIJE 3BQLA 4IDZA 4OK0A 4UF0A 3C4XA 4ZI2D 4AKHA 4O3ZA 5CA0E 4O3XB 5FY1A 1VRBA 5FMNA 1QSDA 2NW9A 3RH3A 3V5UA 3ZPOA 3MJXA 3E0ZA 4H9NC 3ZYLA 4E7ZA 5LHIB 5L3EB 2MHLA 3RKOA 1HCIA 2CWYA 3UTKA 3K19A 4KMCA 4H9PC 4KP3C 3ZMSB 3AVSA 2OA5A 3N9OA 3AAEB 4O4LE 3UULA 4AQFA 3RBHA 5PRNA 5L3BB 1YKEB 2D2SA 7PRNA 2Y7SA 2VKDA 3BQIA 1CUNA 5DABA 3RYFE 4B6XA 2Y48B 1D1BA 2A2FX 1V9DA 3FXDB 4CQIA 1O3XA 4TX5A 3AA7B 4PW8A 5LHGB 2VKJA 4CI3B 3KVDD 4CXWA 5D5DA 1HXXA 2W62A 3SYBA 3NZPA 5DQWA 4EIWA 4KR8A 3I9YA 5KDMC 3LBXB 3MXZA 3CX8B 2W63A 4UVAB 5JDFA 4IE0A 4P09A 4PK4A 2KWHA 1P4TA 2ES0A 2XAFB 5JR9B 3KV9A 3T8OA 3POXA 4BJMA 3J9X1 3WI4A 2KLQA 2HPJA 2VASA 3Q9DA 2N2NA 5LJNA 4B61A 5GONE 2NW7A 5J2TE 3B13A 4TV9E 4AKLA 2YINA 5JR9C 3R6NA 3AA6A 5JDHA 4RL9A 2XASB 5JRCA 5FYMA 1PRNA 1QJ8A 3O1IA 3VE1A 4U72A 4PJJA 3AB3B 3MACA 4FESA 3WI5A 4ADZA 3NZQA 2NTXA 1GFNA 2XE2A 3N9QA 2ZLYA 4JEUB 4QWNB 2PORA 3HOEA 3R84B 1LKXA 2MBGA 5H6QB 4AQGA 1BH3A 2KDYA 3CKDA 3ZMZB 3N2OA 1Y64B 4HEAA 5LP6E 2N2MA 3HKBE 5FVNA 3CPZA 4UXNB 4GOUA 2CXFA 2XQYA 3POUA 1US7B 1QJPA 2YU1A 2OMFA 4E1SA 3UPGA 4EAHA 3EVYA 3KINB 5IYUA 2E9XB 1QJ9A 4O4HE 4CI1B 4EXTA 3AAIA 2LT3A 4U74A 5JDNA 1YW0A 3MZKB 4O4XA 5GV0A 4PFOA 2UXNB 4UV8B 2F1TA 1MNDA 3L3PA 2V26A 4GYRA 3GMIA 4I50E 4AYMC 2E9XC 1Q9GA 2EHOC 3KVAA 5T5FA 5JH7E 2UXXB 4GK0E 5DL5A 2CWOA 3SY9A 2XTQA 1WR6A 3HKEE 3LJCA 4O4IE 3GP6A 1UX5A 3CMLA 3VZTX 3PUSA 5G26A 3W15B 2W61A 3MA9A 3D0TA 2I59A 2JRKA 3RRCA 4ASKA 2JMHA 2K24A 3POQA 4FJOA 4ZS2A 2VWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  3AAE B;  4AKR A;  3AAA B;  3AA1 B;  4AKR B;  5ADX K;  1IZN A;  2KZ7 A;  3LK4 2;  1IZN B;  2KZ7 B;  3AA6 A;  5ADX L;  3AA0 A;  3AA6 B;  3AA0 B;  3AA7 A;  2KXP A;  3AA7 B;  2KXP B;  5AFU K;  3LK3 A;  3LK2 A;  3LK3 B;  5AFU L;  3LK4 1;  3LK2 B;  3AAE A;  3AAA A; 
#chains in the Genus database with same CATH topology
 5A1L A;  1WYC A;  2WSS V;  2V7I A;  3AVR A;  3I9W A;  4EV6 A;  3SFE A;  5J1G A;  2BDE A;  4AYN A;  3ZMT B;  4QXC B;  3IHR A;  4XBF B;  2F1C X;  4YHJ A;  3F57 A;  2LKH A;  4AKR A;  3RYC E;  4OYJ A;  2QYW A;  4EYU A;  3GN5 B;  5C2T A;  3FHN A;  4XNK A;  5FKY A;  2WVP A;  3A5X A;  4FT6 A;  4YSZ A;  3MKD A;  3RIU C;  4LF6 T;  3PV0 F;  4GYS A;  2VUR A;  4EB6 E;  1D0X A;  4IE6 A;  2EHO A;  5LNK A;  1HG5 A;  5DJQ C;  4PJL A;  1MMD A;  4G76 A;  4DMW A;  4J2C A;  5LMN T;  5L4H A;  4L0R A;  4PK6 A;  1HXU A;  2K5B B;  1I6Z A;  4H63 V;  3E22 E;  2FJA A;  3LK3 A;  4JV5 T;  2NR4 A;  2WMN A;  2HH7 A;  5KXJ A;  4LSE A;  1ZV4 X;  2CBJ A;  2EHO D;  4JYA T;  4DUZ T;  4Z8X A;  4FSO A;  4PUX A;  3E08 A;  5ABH A;  3AA0 B;  2UXC T;  1WYB A;  3VKG A;  2F4V T;  2WMO A;  4UR9 A;  3AE6 A;  5AQI B;  2LSG A;  3PGS A;  4GCS A;  3FZH B;  4P0B A;  3Q5E A;  2YU2 A;  2RPA A;  3VHL A;  3ZMU B;  1AJ3 A;  4UB6 O;  4ILC A;  3HR0 A;  3PUG A;  4UF0 B;  3PUX F;  3C4Z A;  3G7G A;  4FI5 A;  3POR A;  4XAX B;  2G0U A;  3VU7 H;  3LK4 1;  3EDU A;  4JUY A;  3N9L A;  5T5F A;  2LSK A;  2NTY A;  3IF8 B;  1UCU A;  3P7I A;  3SZD A;  5LGT B;  2Q9Q B;  3QK6 A;  2ZMA A;  2L3L A;  5AFU K;  1YS5 A;  2W81 C;  2I0M A;  4BA9 A;  1OXZ A;  2YOE A;  3WAK A;  2R8A A;  3ZJ1 A;  3ZC1 A;  1T1L A;  2V5D A;  4LFA T;  1MPF A;  2LHN A;  4TWH A;  2VL8 A;  4DND A;  4ZHQ E;  3K3N A;  3KV6 A;  2CLY B;  1S35 A;  2DLR A;  5JRC B;  4LF8 T;  3ZN1 B;  4CN6 A;  4AYE C;  4N58 A;  4U3C A;  4XZC A;  2F1V A;  2VQE T;  3ESL A;  3AE4 A;  1WR0 A;  1Y01 A;  4ZOL E;  4AZL A;  2XAQ B;  3ONL C;  4F8H A;  2C5K T;  2K9A A;  1ZHY A;  4DUY T;  4GHB A;  3UQ7 A;  2X51 A;  4K3B A;  4X66 T;  1GFQ A;  2VVS A;  4JI6 T;  2XQ7 A;  2XTR A;  1LRZ A;  4MLK A;  1OSM A;  4JCH A;  1E1H B;  4U7I A;  3C51 A;  4D5U A;  2JQQ A;  5AQU B;  8PRN A;  4CXY A;  3NBX X;  5JDQ A;  2RA1 A;  2GE4 A;  4TV8 E;  3IBP A;  2E8I A;  3I1A A;  1BT9 A;  2A9U A;  3UFE A;  3HI2 A;  4EOZ B;  1X9B A;  5B66 O;  2WAU A;  1GFM A;  4IE4 A;  2VQF T;  4AKR B;  3AEG A;  2SPC A;  5ADX K;  2X9Y A;  3LG7 A;  2ZM0 A;  5J0Z A;  2BG9 E;  5KAF O;  4H9R C;  1XMO T;  5C8Y E;  3AE3 A;  3F2E A;  2B76 A;  4QQ1 A;  1B7T A;  2DHR A;  5HXS A;  2BG9 B;  4PFP A;  2JJ9 A;  3DZM A;  4N59 A;  1BR0 A;  2EHO B;  2IHR 1;  4FZL A;  3SFD A;  5J2U E;  3AE9 A;  1HR0 T;  4Z90 A;  3VE2 A;  4B3T T;  2CCQ A;  3N9N A;  4KBM B;  1KNR A;  3ZJ2 A;  3A2S X;  3B5M A;  2CMR A;  2IW5 B;  2QGS A;  3FZM B;  1OED C;  2BKN A;  1GFP A;  2V6Y B;  2X27 X;  4GK5 E;  2WDQ A;  4UIG A;  1BXW A;  2NP9 A;  4AXP A;  3LK3 B;  4D65 A;  4D64 A;  2NOX A;  2X9W A;  2X9H A;  3RYH E;  2HPL A;  2A72 A;  4AKG A;  3ANW A;  4GCP A;  2CE7 A;  2MAW A;  2BVM A;  2WWU A;  2XUE A;  3NWI A;  3AA6 B;  4LF9 T;  1BR4 A;  3J7Y q;  4TZ4 C;  1KK7 A;  2CLY C;  4X20 E;  4DR5 T;  2PRN A;  3PUW F;  1XDO A;  2X9X A;  5DL8 A;  1HNX T;  4AKH A;  3C4X A;  5CA0 E;  5FY1 A;  5KAI O;  1VRB A;  5FMN A;  1QSD A;  2NW9 A;  4E7Z A;  5LHI B;  3L8R A;  3JAD A;  1XDP A;  3N9O A;  3JAF A;  1DU2 A;  1WCR A;  5L3B B;  4LMK A;  2Y7S A;  2J4G A;  4U31 A;  4B6X A;  3VR8 A;  1D1B A;  4CQI A;  4PW8 A;  5LHG B;  3KVD D;  4CI3 B;  5D5D A;  3SYB A;  3NZP A;  5DQW A;  4KR8 A;  3LBX B;  3MXZ A;  3CX8 B;  2W63 A;  4UVA B;  4IE0 A;  1P4T A;  2ES0 A;  2XAF B;  3Q9D A;  5LJN A;  4B61 A;  5GON E;  2NW7 A;  1FJG T;  5J2T E;  1KEY A;  5JR9 C;  3R6N A;  2BS3 A;  4QH5 A;  3O1I A;  3VE1 A;  4U72 A;  3AB3 B;  3MAC A;  4AIS A;  3WI5 A;  4ADZ A;  4JI1 T;  2POR A;  5AQR B;  3R84 B;  2KDY A;  3CK6 A;  4DR1 T;  3HKB E;  4UXN B;  2XQY A;  1US7 B;  5LB7 B;  3PUY F;  4EAH A;  3KIN B;  2E9X B;  4CI1 B;  4YSY A;  5TIS O;  4U74 A;  5JDN A;  3PJA A;  4U2Y A;  1T72 A;  4O4X A;  3KZI O;  1W9R A;  4UV8 B;  4C4V A;  2V26 A;  1IBL T;  3GMI A;  4AYM C;  2WWV A;  2WJQ A;  2EHO C;  3KVA A;  5JH7 E;  4GK0 E;  3SY9 A;  1WR6 A;  4O4I E;  3GP6 A;  3CML A;  3W15 B;  3D0T A;  3POQ A;  4IHJ E;  3O4X E;  2VWA A;  5CA1 E;  3LSV A;  3PUA A;  2D5U A;  2L8K A;  1WFD A;  2GK9 A;  3FB2 A;  3AEB A;  5FXW A;  4K3C A;  2DWG A;  2XQ9 A;  3P4R A;  5DL7 A;  5ABF B;  4FRX A;  1M62 A;  2BBJ A;  5CFB A;  2CXL A;  4KRA A;  3T1H T;  3RHW A;  5L4E A;  4H9O C;  2X0L B;  4YXD A;  1ZEE A;  2P9B A;  3K1S A;  4KHP T;  4QKN A;  3DTO A;  3P4W A;  3RQW A;  2N9D A;  2J1D G;  4AKM A;  2V7K A;  4QXB B;  2WBL A;  3SYS A;  2J4U P;  2ZFG A;  1Q9F A;  1MM5 A;  5LMU T;  4O8S A;  4DR6 T;  2XHE B;  3AE7 A;  2JMK A;  4AI6 A;  5FY7 A;  4ERR A;  5LCY A;  3LFM A;  4FSP A;  1MNE A;  2M06 A;  2PG8 A;  4AFK A;  3AE2 A;  3CWZ B;  2XAJ B;  4PNI A;  5AFU L;  2VKO A;  2BZB A;  5JDP A;  1HX1 B;  2LE8 A;  1NWM X;  3I0Q A;  3ANW B;  5FVL A;  4DV4 T;  2LRL A;  3G06 A;  4DR4 T;  5JDL A;  2IC9 A;  2CM0 A;  2KXP A;  5IHY A;  4C91 A;  5LGU B;  2Y0H A;  4MAL A;  5JQG E;  5JRE A;  1E54 A;  3Q5X A;  1UX4 A;  3N2G E;  3PE0 A;  4EEB A;  3H3A A;  2IWV A;  2UUA T;  4NIQ A;  4ZS3 A;  1S94 A;  2E5V A;  4EZ4 A;  4C69 X;  5L3F B;  2FBW A;  2WZH A;  4X62 T;  2LEH A;  1N34 T;  2X9K A;  3VY9 X;  4ANJ A;  1HG2 A;  3PU3 A;  4IST A;  4WNK A;  3ZT6 A;  1IJ5 A;  5EE2 A;  4YFS A;  4N78 D;  2X68 A;  2MTQ A;  3CX7 B;  2IDO B;  4WBO A;  3QOF A;  3FBZ A;  2M6I A;  3TLS A;  1THQ A;  2H89 A;  2YDQ A;  4ILU A;  1HS7 A;  3AXJ A;  4O3Y A;  2KMF A;  4IL4 A;  3T1Y T;  3NVO A;  2WDR A;  1I94 T;  3Q5W A;  3KBU A;  3T0S A;  5JR9 A;  3DA4 A;  4Z3T A;  1E7P A;  5G38 A;  5LOV E;  5KX5 E;  2JPF A;  2XE5 A;  4JEH B;  4OFZ A;  3DWO X;  3O9X A;  2C5I T;  5ADX L;  2I6H A;  2VB6 A;  1ORM A;  2X67 A;  2CEA A;  3BRZ A;  4IDP A;  2LSJ A;  2UXB T;  4CXX A;  3P4P A;  3VRA A;  1H6S 1;  1HNZ T;  4A56 A;  4TUY E;  1IAP A;  1ZHX A;  3LK4 2;  2HHH T;  2R4P A;  3OPC A;  4TWF A;  4U33 A;  4ZEY A;  2XTL A;  4K0K T;  2R4N A;  4EYY R;  1E2A A;  4QX7 B;  2UXD T;  3O1H A;  1QUU A;  4ZZC A;  4M1P A;  4FQE A;  4LML A;  1G73 A;  4KX6 A;  4FZN A;  3ZKR A;  2BVL A;  4JFB A;  4ZXL A;  1HX8 A;  2W80 C;  4WYV A;  3PQS A;  3VZW X;  1LVF A;  3AEE A;  2MPK A;  3PUQ A;  1JNR A;  3RIA A;  3JCF A;  4JI2 T;  1OPF A;  2LHF A;  4NUV A;  1H7C A;  3V5S A;  1T98 A;  4FRT A;  3UUB A;  4CN4 A;  3HWB A;  4DMV A;  5LJM A;  2PJQ A;  3EDV A;  2LRK A;  1T16 A;  2DCF A;  5JTG A;  5AQM B;  3U78 A;  4PJ0 O;  4F6R C;  2YDR A;  4IRE A;  5M4Y A;  2HN2 A;  4UVB B;  1J5W A;  3ZCI A;  4LSI A;  4O3W A;  1NAF A;  3BK9 A;  2ZM8 A;  2LM2 A;  1N32 T;  2QA7 A;  4EZH A;  1OED B;  3KDS E;  4PK5 A;  4ILB A;  3UU2 A;  2LJL A;  4DV5 T;  1VCT A;  4X64 T;  5HXH A;  3I0O A;  4QX8 B;  3L39 A;  2K48 A;  3OYZ A;  3Q2M A;  2VL0 A;  5AQH B;  2XAH B;  2XJ7 A;  2XG6 A;  4IDQ A;  3PTR B;  3SOL A;  3C64 A;  4QXH B;  2BKO A;  5HWX A;  3CQX C;  4LF5 T;  3DWN A;  3UUM A;  2XY8 B;  4V1A v;  4H63 H;  1XWM A;  2KXP B;  1NEN A;  2WP9 A;  3HL6 A;  2Y2X A;  5AQQ B;  4GF4 A;  3RPU A;  2MNH A;  3ZST A;  4MHC A;  4YHH T;  2CRB A;  3UUN A;  2IAK A;  2J1N A;  3BS0 A;  4JLE A;  2VK9 A;  1JNZ A;  1MMG A;  2XQ5 A;  3P8C D;  3BQL A;  4O3Z A;  3CIR A;  4HFD A;  4H9N C;  3PGR A;  4ZZB A;  5AQV B;  1NEK A;  3UQ4 A;  3K19 A;  4HWC A;  2OA5 A;  2XM1 A;  4AQF A;  2JIW A;  7PRN A;  1YKE B;  4HWF A;  3BQI A;  4EED A;  5FL0 A;  2Y48 B;  1V9D A;  1O3X A;  4TX5 A;  3AXJ B;  4CXW A;  2W62 A;  3I9Y A;  4TNW A;  4HFC A;  1XZY A;  5JR9 B;  3POX A;  2VAS A;  2HPJ A;  4AKL A;  2AE9 A;  3QB5 A;  5LG3 A;  3A7M A;  1GFN A;  2JQY A;  3N9Q A;  2ZLY A;  4QWN B;  3HOE A;  5H6Q B;  5AQT B;  3CKD A;  4GOU A;  2OMF A;  5HCM A;  3IA3 A;  4O4H E;  2OV9 A;  3NJT A;  3AAI A;  2LT3 A;  4IDN A;  1YW0 A;  2UXN B;  2R6G F;  2F1T A;  1MND A;  3L3P A;  4I50 E;  5HEO A;  2UXX B;  4HWD A;  4YTM A;  5DL5 A;  2CWO A;  3VZT X;  3PUS A;  4KHZ F;  3MA9 A;  2JRK A;  4ASK A;  2JMH A;  5AQS B;  4ZS2 A;  1UK5 A;  1OWA A;  4N74 A;  4IL6 O;  1IZN A;  3DA3 A;  2W00 A;  3ZCJ A;  4YTP A;  4O4J E;  1MIW A;  2YK0 A;  3RLF F;  2KWI B;  3HKD E;  3SS1 A;  2DL1 A;  5HWY A;  4U7Y A;  3JCU O;  3SRZ A;  3RI5 A;  2IC6 A;  1LVK A;  4MFR A;  4OX9 T;  3ONX A;  3OKQ A;  4ZI3 C;  3DJB A;  4DV6 T;  2R4L A;  2K4T A;  5FXV A;  1Z8U A;  4O2A E;  1SE7 A;  3X1D A;  3AE1 A;  5H2F O;  2MOZ A;  3UUX B;  3UU8 A;  3FZL B;  5FL1 A;  2ODJ A;  1GQE A;  2FUP A;  3ZT5 A;  3VY8 X;  2L9Q A;  2VKH A;  5IYZ E;  3AAA A;  4UB8 O;  4CTD A;  1ZP0 A;  2ODU A;  4JI8 T;  3WAJ A;  1WRD A;  4L9I A;  3N9M A;  4WW0 A;  5B5E O;  4U2Z A;  3RF1 A;  3K8P C;  2M6B A;  5LGN B;  2IWW A;  1YD8 G;  2H3R A;  2WS3 A;  4HKA A;  4PJN A;  3TZG A;  5C3J A;  3QNU A;  3KFW X;  3LK2 A;  3UT5 E;  4YSX A;  2V6X A;  4DID B;  1PHO A;  3RIF A;  4DR7 T;  4RLC A;  3LDQ B;  5CGM A;  4NUU A;  4YLH A;  2PBI A;  5AQO B;  2V8S V;  2KT9 A;  2V7J A;  3ETV A;  1XNQ T;  4HN9 A;  3GN5 A;  3ZC0 A;  5ABE A;  1G8X A;  2W0G A;  5HEU A;  4YY3 T;  4DV0 T;  4FMS A;  3EMN X;  4RJW A;  4DVD A;  4KI0 F;  4JI4 T;  2MYS A;  3ZYM A;  4L5G A;  3AAE A;  1HNW T;  3NSG A;  2KND A;  2XZE A;  4PAG A;  1BR2 A;  4YJ2 E;  4AKI A;  2R89 A;  4C00 A;  4IDO A;  2WU5 A;  1HFA A;  1XNR T;  4G63 A;  4E1T A;  4LF4 T;  3FBL A;  1D1A A;  3AA7 A;  2BBH A;  4DBQ A;  3H3M A;  5F3J A;  5TAO A;  3JTY A;  2FJE A;  3PUR A;  4MBQ A;  1BR1 A;  3UU6 A;  2KSR A;  3RX6 A;  5JVD E;  2DWK A;  2XQ8 A;  3AEC A;  3RRW A;  2JMM A;  4N75 A;  4I43 B;  2ODV A;  3GWH A;  3PUV F;  2V1D B;  2XSB A;  5LBM A;  4GIW A;  2FGR A;  3GA8 A;  2QVA A;  3SZV A;  4JBW F;  4AYD C;  1ZHT A;  1U5P A;  5HXR A;  5LA6 E;  4NPP A;  3CQC B;  4B3R T;  4ILA A;  2XMX A;  2YKS A;  1HXT A;  2AXD S;  3FXE B;  4O4U A;  1SHZ C;  2Y6X A;  3Q5D A;  3A8Y C;  4GCQ A;  2YN6 A;  2LHR A;  3PDY A;  4ZI7 E;  4PR7 A;  3MK7 C;  2O4V A;  1KNP A;  4COF A;  3QRA A;  5AQJ B;  2LSY A;  3QB5 K;  4HGA A;  2Q9Q A;  3ZMV B;  2YDS A;  1CHU A;  1IZN B;  2V7M A;  3A0H O;  1ZKE A;  4WBN E;  3RGL A;  1G90 A;  3FZK B;  1KNZ A;  1N33 T;  4FUV A;  2XAG B;  2CPT A;  5E0O A;  4FZM A;  2FJD A;  4X1Y E;  1IBK T;  3ZN0 B;  4YTN A;  4LSH A;  2YEV C;  5FNV E;  3C5O A;  4DV3 T;  2WQY A;  2Q9Q D;  3VZU X;  3C4W A;  3N5L A;  1U4Q A;  1HF8 A;  5HEH A;  4ZI3 D;  3TLT A;  4UVC B;  2CHO A;  3RC3 A;  2D0T A;  3AAA B;  4I55 E;  4PJM A;  1WLX A;  1MIY A;  3C50 A;  2ACX A;  4OYK A;  3N2K E;  3NRY A;  4O49 A;  4HE8 A;  2Z6E A;  3VKH A;  3V8U A;  4AQF C;  2V7L A;  2YNK A;  2CBI A;  1VOM A;  1M7K A;  5AQN B;  3LK2 B;  3OJA A;  4H9S E;  5E79 O;  3HKC E;  1D1C A;  3JAE A;  2WU2 A;  2H88 A;  3OVU A;  4KUM B;  2HN1 A;  2KIN B;  3BRY A;  2WY2 A;  4UEM A;  5EK2 A;  4AIU A;  1EZ3 A;  2W66 A;  5CB4 E;  1MMA A;  2UU9 T;  2ACZ A;  5HCJ A;  3AA1 A;  1R8I A;  2OLT A;  6PRN A;  3S4U A;  4ISS A;  4H9Q C;  5ETW A;  4IDZ A;  2RP4 A;  4ZI2 D;  3PUZ F;  4I0U A;  4C4V B;  4O3X B;  3V5U A;  3ZPO A;  2X0H A;  4B3M T;  2WZI A;  2BG9 A;  2MHL A;  3UTK A;  4LF7 T;  4KMC A;  3ZMS B;  4JI7 T;  3A0B O;  3AAE B;  4O4L E;  3UUL A;  5PRN A;  2D2S A;  5DAB A;  3TLW A;  2A2F X;  3FXD B;  3AA7 B;  2VKJ A;  2V6Y A;  1HXX A;  4JI0 T;  1N36 T;  4PK4 A;  4P09 A;  3KV9 A;  4HFE A;  5FVK A;  2N2N A;  2J47 A;  3B13 A;  4TV9 E;  2XPK A;  2QRX A;  3AA6 A;  4RL9 A;  2XAS B;  2LKG A;  5FYM A;  2JQ9 A;  2XE2 A;  2MBG A;  3M3Z B;  4AQG A;  1BH3 A;  3EAB A;  3ZMZ B;  2AXT O;  3N2O A;  4HEA A;  1OED E;  5LP6 E;  3POU A;  2CXF A;  2YU1 A;  4E1S A;  1KF6 A;  1QJ9 A;  4HWH A;  3NKZ A;  5IWA T;  4GYR A;  1W09 A;  1SUM B;  2BS4 A;  2W67 A;  3LJC A;  5G26 A;  4TWD A;  2K24 A;  3UU3 A;  4FJO A;  4HFI A;  2K3W A;  5LG4 A;  2LLY A;  4RJX A;  3OYX A;  3BQK A;  4KR4 A;  2H7V C;  5L3G B;  3PJA J;  4UEL A;  2R88 A;  1HTJ F;  5GTI O;  4G75 A;  4AYI D;  3FYX A;  4Z91 A;  4CZZ B;  2C0S A;  4DR3 T;  2QTK A;  3LBX A;  2NWB A;  3L09 A;  1UUS A;  4X5T A;  3OBV E;  1MM4 A;  2WJR A;  1D0Z A;  4BJN A;  3PF1 A;  3ZYK A;  2CA5 A;  4LSF A;  3UU5 A;  4LFB T;  1L0V A;  3ZLI A;  5LYJ E;  2Y8D A;  5IUX A;  3WU2 O;  1W0B A;  2D0U A;  2XE3 A;  4BUM X;  2N2L A;  1YXR A;  3RC8 A;  5H6R B;  2E9X A;  3KVB A;  1FIO A;  5G3A A;  4HWI B;  2X66 A;  2KZ7 A;  1MIV A;  5G39 A;  2LOS A;  1XMQ T;  3AEF A;  3F31 A;  1ZHC A;  5DQV A;  2W2U A;  3VR9 A;  2H7O A;  4FOZ A;  1J1J A;  2DI4 A;  2XM2 A;  2ERV A;  1FEW A;  4BAY B;  5JDG A;  1X79 A;  1YQ3 A;  5FXZ A;  2FJB A;  2E9X D;  5HEG A;  3JC6 C;  3K3O A;  4XNL A;  3KV4 A;  2W4X A;  4YJ3 E;  3QRC A;  3SY7 A;  3PQU A;  3UU4 A;  3B57 A;  3SWH A;  5ABF A;  2C5J A;  4AUI A;  4NXN T;  2DNX A;  2WB5 A;  2A3D A;  2XQA A;  4K0U A;  3HOL A;  1W0A A;  5HXC A;  3AA1 B;  3CQG B;  1KFY A;  4IE5 A;  2LOP A;  5L3C B;  2K0L A;  3RIU A;  4P1N A;  3QC9 A;  3EHZ A;  3TLV A;  3KV5 A;  2Y0L A;  2WM9 A;  2KC0 A;  2E5L T;  5ABG A;  1UGO A;  2IIU A;  4GKJ T;  5FY0 A;  2D9D A;  4DV2 T;  2XQ6 A;  4O2B E;  3CX6 B;  4QHO A;  2ZLD A;  2JQK A;  2LM9 A;  3EI0 A;  3HW9 A;  5L2L A;  5EK3 A;  2B1E A;  4F4B A;  3QUJ A;  5HAX A;  3PU8 A;  2Q9Q C;  5BMV E;  4G2A A;  3RKG A;  1SA0 E;  1GFO A;  3U3I A;  3RYI E;  3TKL B;  4B3S T;  4NXM T;  1YKH B;  4TN7 B;  3AEA A;  5AQL B;  4DO0 A;  1Z0P A;  5CJ5 A;  5L3D B;  3AE8 A;  3NRX A;  3KBT A;  2IML A;  5JDM A;  4DV7 T;  2NW8 A;  4I4T E;  4A97 A;  4JI5 T;  1ZOY A;  3ETU A;  4DV1 T;  1ZHZ A;  1ZHW A;  1FMV A;  2CXD A;  4A98 A;  1MMN A;  5DL6 A;  3CVR A;  3EAM A;  4OHF A;  2Y0K A;  5LBQ B;  3EUH A;  5AQP B;  3C98 B;  2V5C A;  3ABV A;  5HXE A;  4IE7 A;  3M65 A;  4X1I E;  4TNV A;  3PRN A;  1YQ4 A;  4X65 T;  1FMW A;  3PGU A;  4YT0 A;  5BR8 T;  4EGW A;  2UUB T;  5KMG P;  5FXX A;  3HA4 A;  2XQ4 A;  4ZI2 C;  4X1K E;  4Q25 A;  5HYA A;  3OTO T;  5F8P A;  3T24 A;  5AQK B;  5L47 A;  3ZT7 A;  4CI2 B;  2YPV A;  2XE1 A;  4IL9 A;  2ZM2 A;  4C90 A;  1S5L O;  2PFV A;  3ZSS A;  2FGQ X;  3P50 A;  3T20 A;  3UAQ A;  5FP3 A;  4U9C A;  2BG9 C;  2LSI A;  2KZ7 B;  5AQG B;  5HEJ A;  1D0Y A;  4IGU A;  3DP7 A;  5EK4 A;  3K3Q C;  3ZEF B;  2LFU A;  4E7S A;  2CHN A;  5LXT E;  3TLU A;  3IEE A;  3WI3 A;  4DBR A;  2N1G A;  4RLB A;  5EZY E;  2UUC T;  3AA0 A;  2XQ3 A;  4HFV A;  2WCA A;  4P0A A;  4WZX A;  3H37 A;  4GKK T;  3O1J A;  5F5W A;  3JC6 D;  4LFC T;  2M67 A;  2E2A A;  4HTE A;  5LHH B;  4UV9 B;  3O0E A;  2M07 A;  1IJ6 A;  3N9P A;  4IIJ E;  4OK0 A;  4UF0 A;  1VCS A;  3RH3 A;  3MJX A;  3E0Z A;  3ZYL A;  5L3E B;  3RQU A;  2XSA A;  3RKO A;  4QH1 A;  1HCI A;  2CWY A;  3P4S A;  4H9P C;  4KP3 C;  3AVS A;  4LMJ A;  2R4O A;  3RBH A;  2X0Y A;  1OED A;  3FZF B;  1T7S A;  2VKD A;  3RYF E;  1CUN A;  1IBM T;  2JQH A;  2J62 A;  3ONJ A;  4EIW A;  5KDM C;  4QH4 A;  5GTH O;  5JDF A;  2KWH A;  2BKP A;  4HFB A;  3T8O A;  4BJM A;  3J9X 1;  3WI4 A;  2KLQ A;  2IUB A;  2YIN A;  5JDH A;  5JRC A;  1PRN A;  1QJ8 A;  3UFG A;  4JI3 T;  4PJJ A;  4FES A;  3NZQ A;  2NTX A;  4AQY T;  2BS2 A;  4JEU B;  1T8B A;  1LKX A;  1Y64 B;  5FVN A;  2N2M A;  3CPZ A;  3AE5 A;  1QJP A;  3UPG A;  3EVY A;  1J5E T;  5IYU A;  3AED A;  4HFH A;  4EXT A;  3MZK B;  3VRB A;  5GV0 A;  4PFO A;  2VVN A;  3P4Q A;  1QLB A;  4CN1 A;  5AQF B;  2E9X C;  2PTF A;  1Q9G A;  1UUR A;  4IT4 A;  2XTQ A;  4A5X A;  3HKE E;  1UX5 A;  2WDV A;  2ZM6 T;  2W61 A;  4DR2 T;  2I59 A;  3RRC A; 
#chains in the Genus database with same CATH homology
 5A1L A;  1WYC A;  1OWA A;  2WSS V;  5LG4 A;  5CA1 E;  2V7I A;  3AVR A;  4RJX A;  3I9W A;  3OYX A;  1IZN A;  3BQK A;  4KR4 A;  2H7V C;  5L3G B;  3PUA A;  3DA3 A;  2W00 A;  4UEL A;  5J1G A;  3ZCJ A;  1HTJ F;  2D5U A;  2L8K A;  4O4J E;  1MIW A;  4G75 A;  2GK9 A;  2YK0 A;  3FYX A;  2KWI B;  4AYI D;  3FB2 A;  3HKD E;  4CZZ B;  2C0S A;  5FXW A;  2DWG A;  2QTK A;  2BDE A;  3SS1 A;  4AYN A;  3LBX A;  2NWB A;  5DL7 A;  3L09 A;  3ZMT B;  5HWY A;  4QXC B;  3IHR A;  3SRZ A;  4FRX A;  3OBV E;  1MM4 A;  4XBF B;  2IC6 A;  1LVK A;  1D0Z A;  2CXL A;  4MFR A;  4YHJ A;  4BJN A;  4KRA A;  3F57 A;  3ONX A;  3OKQ A;  4ZI3 C;  3ZYK A;  4AKR A;  3RYC E;  3DJB A;  4OYJ A;  4H9O C;  2CA5 A;  2X0L B;  4EYU A;  3GN5 B;  2K4T A;  4LSF A;  5FXV A;  1ZEE A;  4O2A E;  3ZLI A;  2P9B A;  5LYJ E;  2Y8D A;  3FHN A;  4XNK A;  2MOZ A;  4QKN A;  3DTO A;  2D0U A;  2XE3 A;  2N9D A;  2J1D G;  3UUX B;  4AKM A;  4BUM X;  2N2L A;  2V7K A;  3A5X A;  4QXB B;  4FT6 A;  2ODJ A;  2WBL A;  3RC8 A;  3SYS A;  3MKD A;  5H6R B;  2J4U P;  2ZFG A;  3VY8 X;  2L9Q A;  4GYS A;  2VKH A;  4EB6 E;  2E9X A;  1D0X A;  1Q9F A;  5IYZ E;  4IE6 A;  3AAA A;  2EHO A;  2ODU A;  3KVB A;  5LNK A;  1MM5 A;  1HG5 A;  3WAJ A;  1FIO A;  4O8S A;  1WRD A;  5DJQ C;  4PJL A;  2XHE B;  2X66 A;  2KZ7 A;  2JMK A;  4IHJ E;  4L9I A;  3N9M A;  1MMD A;  4WW0 A;  1MIV A;  4G76 A;  4AI6 A;  5FY7 A;  2LOS A;  4ERR A;  5LCY A;  3LFM A;  3F31 A;  3K8P C;  4FSP A;  4DMW A;  5LGN B;  1MNE A;  2M06 A;  1YD8 G;  1ZHC A;  2H3R A;  2PG8 A;  4J2C A;  5DQV A;  4AFK A;  2H7O A;  4L0R A;  4HKA A;  4PK6 A;  2K5B B;  4PJN A;  1HXU A;  4FOZ A;  3CWZ B;  2XAJ B;  4H63 V;  3TZG A;  3E22 E;  4PNI A;  2DI4 A;  3LK3 A;  3KFW X;  2ERV A;  1FEW A;  4BAY B;  5JDG A;  3LK2 A;  5AFU L;  3UT5 E;  1X79 A;  2VKO A;  2WMN A;  5FXZ A;  2HH7 A;  2BZB A;  4LSE A;  5JDP A;  1ZV4 X;  2LE8 A;  2E9X D;  1NWM X;  2EHO D;  3JC6 C;  3I0Q A;  3ANW B;  3K3O A;  4XNL A;  4Z8X A;  4FSO A;  1PHO A;  4PUX A;  3KV4 A;  4YJ3 E;  3E08 A;  3QRC A;  3SY7 A;  4RLC A;  3PQU A;  5JDL A;  3AA0 B;  2IC9 A;  4NUU A;  2CM0 A;  2KXP A;  5IHY A;  3B57 A;  4YLH A;  4C91 A;  5LGU B;  3SWH A;  2Y0H A;  2C5J A;  4MAL A;  5JQG E;  5JRE A;  1E54 A;  2PBI A;  4AUI A;  3Q5X A;  1UX4 A;  3N2G E;  3PE0 A;  3H3A A;  2DNX A;  1WYB A;  2KT9 A;  2V7J A;  3ETV A;  3VKG A;  2A3D A;  4ZS3 A;  4K0U A;  4HN9 A;  2WMO A;  3HOL A;  3GN5 A;  3ZC0 A;  1S94 A;  4EZ4 A;  2LSG A;  3AA1 B;  5HXC A;  3CQG B;  4C69 X;  4GCS A;  4IE5 A;  2LOP A;  1G8X A;  5L3C B;  2K0L A;  4P0B A;  5L3F B;  2YU2 A;  3ZMU B;  3VHL A;  2W0G A;  1AJ3 A;  2LEH A;  3HR0 A;  3QC9 A;  3VY9 X;  4FMS A;  3PUG A;  3EMN X;  4ANJ A;  1HG2 A;  4UF0 B;  3KV5 A;  4RJW A;  3PU3 A;  3C4Z A;  2Y0L A;  2WM9 A;  4IST A;  2KC0 A;  4WNK A;  4DVD A;  3G7G A;  2MYS A;  4FI5 A;  1IJ5 A;  3POR A;  4XAX B;  5EE2 A;  4YFS A;  5FY0 A;  4N78 D;  3ZYM A;  4L5G A;  2G0U A;  3VU7 H;  3LK4 1;  3AAE A;  3EDU A;  4JUY A;  3N9L A;  3NSG A;  4O2B E;  2KND A;  2X68 A;  2MTQ A;  4PAG A;  3CX6 B;  4QHO A;  3CX7 B;  2LSK A;  2ZLD A;  2NTY A;  4WBO A;  2LM9 A;  3IF8 B;  1BR2 A;  1UCU A;  4YJ2 E;  4AKI A;  3FBZ A;  3P7I A;  3SZD A;  3HW9 A;  1HFA A;  4G63 A;  5LGT B;  2Q9Q B;  3QK6 A;  5L2L A;  1THQ A;  2ZMA A;  5EK3 A;  2B1E A;  3FBL A;  1D1A A;  4ILU A;  1HS7 A;  3AA7 A;  4E1T A;  4O3Y A;  4DBQ A;  2KMF A;  4F4B A;  2L3L A;  3QUJ A;  5HAX A;  3PU8 A;  5AFU K;  2Q9Q C;  1YS5 A;  2W81 C;  5BMV E;  4BA9 A;  3Q5W A;  3KBU A;  1OXZ A;  4G2A A;  5F3J A;  3T0S A;  3WAK A;  5TAO A;  5JR9 A;  3DA4 A;  3JTY A;  4Z3T A;  3PUR A;  1SA0 E;  3ZJ1 A;  3ZC1 A;  1GFO A;  3U3I A;  4MBQ A;  1BR1 A;  5LOV E;  3RYI E;  3RX6 A;  5JVD E;  3TKL B;  5KX5 E;  2DWK A;  1MPF A;  3RRW A;  2JMM A;  2LHN A;  2JPF A;  2XE5 A;  4JEH B;  4OFZ A;  4I43 B;  3O9X A;  2C5I T;  2VL8 A;  5ADX L;  2ODV A;  3GWH A;  4DND A;  4ZHQ E;  1YKH B;  3K3N A;  2CLY B;  3KV6 A;  4TN7 B;  1S35 A;  2DLR A;  5JRC B;  3ZN1 B;  2V1D B;  5LBM A;  2VB6 A;  4DO0 A;  1Z0P A;  4GIW A;  5L3D B;  3GA8 A;  1ORM A;  2FGR A;  3NRX A;  4N58 A;  4AYE C;  3SZV A;  2X67 A;  2CEA A;  4XZC A;  2F1V A;  4AYD C;  3KBT A;  1ZHT A;  5JDM A;  1U5P A;  5HXR A;  5LA6 E;  2NW8 A;  3ESL A;  3CQC B;  4I4T E;  2LSJ A;  3ETU A;  4CXX A;  1ZHZ A;  2XMX A;  1H6S 1;  4A56 A;  1ZHW A;  4TUY E;  1IAP A;  1FMV A;  2CXD A;  1ZHX A;  3LK4 2;  4ZOL E;  1HXT A;  4AZL A;  1MMN A;  4O4U A;  3FXE B;  5DL6 A;  1SHZ C;  3CVR A;  2XAQ B;  2C5K T;  2XTL A;  2Y6X A;  4OHF A;  5LBQ B;  2Y0K A;  2K9A A;  1ZHY A;  4EYY R;  3EUH A;  4GCQ A;  3C98 B;  4GHB A;  4QX7 B;  2LHR A;  3PDY A;  4ZI7 E;  5HXE A;  3O1H A;  4IE7 A;  3M65 A;  3MK7 C;  2O4V A;  2X51 A;  1QUU A;  4X1I E;  1GFQ A;  4M1P A;  3QRA A;  1G73 A;  2LSY A;  2XTR A;  4JCH A;  1LRZ A;  4MLK A;  1OSM A;  3PRN A;  1E1H B;  3C51 A;  4FZN A;  4D5U A;  2BVL A;  2JQQ A;  4HGA A;  4JFB A;  2Q9Q A;  3ZMV B;  8PRN A;  1IZN B;  1FMW A;  1HX8 A;  4CXY A;  2W80 C;  2V7M A;  3NBX X;  1ZKE A;  3PQS A;  3VZW X;  1LVF A;  4WBN E;  5JDQ A;  2RA1 A;  1G90 A;  2GE4 A;  1KNZ A;  4TV8 E;  5KMG P;  3PUQ A;  5FXX A;  3IBP A;  2E8I A;  3I1A A;  3HA4 A;  4FUV A;  2XAG B;  4ZI2 C;  1BT9 A;  1OPF A;  5E0O A;  3UFE A;  4X1K E;  3HI2 A;  4EOZ B;  2LHF A;  4NUV A;  4FZM A;  1H7C A;  3V5S A;  5HYA A;  2WAU A;  4X1Y E;  1T98 A;  4FRT A;  1GFM A;  4IE4 A;  5F8P A;  3T24 A;  3ZN0 B;  3HWB A;  4DMV A;  4AKR B;  4CI2 B;  5LJM A;  2SPC A;  2YPV A;  2XE1 A;  2X9Y A;  4LSH A;  2YEV C;  5ADX K;  5FNV E;  2ZM2 A;  3LG7 A;  2ZM0 A;  3C5O A;  2PJQ A;  2Q9Q D;  3VZU X;  3C4W A;  3EDV A;  4H9R C;  4C90 A;  3N5L A;  1U4Q A;  5C8Y E;  1HF8 A;  3F2E A;  4QQ1 A;  1B7T A;  2DCF A;  3U78 A;  4F6R C;  2DHR A;  2PFV A;  5M4Y A;  4ZI3 D;  4UVB B;  5HXS A;  2FGQ X;  4UVC B;  3RC3 A;  3ZCI A;  4LSI A;  4PFP A;  4O3W A;  2JJ9 A;  1NAF A;  2D0T A;  4N59 A;  3T20 A;  1BR0 A;  3AAA B;  4I55 E;  5FP3 A;  2EHO B;  4PJM A;  3UAQ A;  1WLX A;  4FZL A;  3BK9 A;  2ZM8 A;  3C50 A;  1MIY A;  2ACX A;  3O4X E;  5J2U E;  4U9C A;  3VE2 A;  2LSI A;  2KZ7 B;  4OYK A;  3N2K E;  3NRY A;  2QA7 A;  4EZH A;  1D0Y A;  3KDS E;  4PK5 A;  4IGU A;  2CCQ A;  3N9N A;  4KBM B;  4O49 A;  3ZJ2 A;  3DP7 A;  4HE8 A;  5EK4 A;  3A2S X;  2Z6E A;  3K3Q C;  3VKH A;  3V8U A;  3ZEF B;  2LFU A;  2CMR A;  2IW5 B;  4AQF C;  2LJL A;  2QGS A;  2V7L A;  4E7S A;  5LXT E;  2YNK A;  3UU2 A;  1VOM A;  5HXH A;  3I0O A;  4QX8 B;  2K48 A;  3IEE A;  3OYZ A;  3Q2M A;  1GFP A;  2X27 X;  4GK5 E;  3WI3 A;  4UIG A;  4DBR A;  1BXW A;  2N1G A;  2NP9 A;  3LK3 B;  4AXP A;  4D65 A;  4D64 A;  2NOX A;  2X9W A;  2X9H A;  3LK2 B;  3RYH E;  2HPL A;  3OJA A;  2A72 A;  2XAH B;  4H9S E;  4AKG A;  2XG6 A;  3HKC E;  3ANW A;  3PTR B;  3SOL A;  4RLB A;  1D1C A;  3C64 A;  4QXH B;  5HWX A;  4GCP A;  5EZY E;  3CQX C;  2CE7 A;  4KUM B;  3AA0 A;  2KIN B;  2BVM A;  3UUM A;  2WWU A;  2XUE A;  4HFV A;  3AA6 B;  4V1A v;  4H63 H;  4P0A A;  3H37 A;  1BR4 A;  2KXP B;  3J7Y q;  4TZ4 C;  4UEM A;  1KK7 A;  3HL6 A;  2Y2X A;  5EK2 A;  4GF4 A;  3RPU A;  2MNH A;  2CLY C;  1EZ3 A;  3O1J A;  4MHC A;  4X20 E;  1MMA A;  3JC6 D;  5CB4 E;  2PRN A;  3AA1 A;  3UUN A;  2M67 A;  2IAK A;  6PRN A;  2J1N A;  3S4U A;  4HTE A;  4ISS A;  4JLE A;  5LHH B;  4UV9 B;  3O0E A;  2M07 A;  2VK9 A;  2X9X A;  5DL8 A;  4H9Q C;  1IJ6 A;  1MMG A;  3N9P A;  5ETW A;  3P8C D;  2RP4 A;  4IIJ E;  3BQL A;  4IDZ A;  4OK0 A;  4UF0 A;  3C4X A;  4ZI2 D;  4AKH A;  4O3Z A;  5CA0 E;  4O3X B;  5FY1 A;  1VRB A;  5FMN A;  1QSD A;  2NW9 A;  3RH3 A;  3V5U A;  3ZPO A;  3MJX A;  3E0Z A;  4H9N C;  3ZYL A;  4E7Z A;  5LHI B;  5L3E B;  2MHL A;  3RKO A;  1HCI A;  2CWY A;  3UTK A;  3K19 A;  4KMC A;  4H9P C;  4KP3 C;  3ZMS B;  3AVS A;  2OA5 A;  3N9O A;  3AAE B;  4O4L E;  3UUL A;  4AQF A;  3RBH A;  5PRN A;  5L3B B;  1YKE B;  2D2S A;  7PRN A;  2Y7S A;  2VKD A;  3BQI A;  1CUN A;  5DAB A;  3RYF E;  4B6X A;  2Y48 B;  1D1B A;  2A2F X;  1V9D A;  3FXD B;  4CQI A;  1O3X A;  4TX5 A;  3AA7 B;  4PW8 A;  5LHG B;  2VKJ A;  4CI3 B;  3KVD D;  4CXW A;  5D5D A;  1HXX A;  2W62 A;  3SYB A;  3NZP A;  5DQW A;  4EIW A;  4KR8 A;  3I9Y A;  5KDM C;  3LBX B;  3MXZ A;  3CX8 B;  2W63 A;  4UVA B;  5JDF A;  4IE0 A;  4P09 A;  4PK4 A;  2KWH A;  1P4T A;  2ES0 A;  2XAF B;  5JR9 B;  3KV9 A;  3T8O A;  3POX A;  4BJM A;  3J9X 1;  3WI4 A;  2KLQ A;  2HPJ A;  2VAS A;  3Q9D A;  2N2N A;  5LJN A;  4B61 A;  5GON E;  2NW7 A;  5J2T E;  3B13 A;  4TV9 E;  4AKL A;  2YIN A;  5JR9 C;  3R6N A;  3AA6 A;  5JDH A;  4RL9 A;  2XAS B;  5JRC A;  5FYM A;  1PRN A;  1QJ8 A;  3O1I A;  3VE1 A;  4U72 A;  4PJJ A;  3AB3 B;  3MAC A;  4FES A;  3WI5 A;  4ADZ A;  3NZQ A;  2NTX A;  1GFN A;  2XE2 A;  3N9Q A;  2ZLY A;  4JEU B;  4QWN B;  2POR A;  3HOE A;  3R84 B;  1LKX A;  2MBG A;  5H6Q B;  4AQG A;  1BH3 A;  2KDY A;  3CKD A;  3ZMZ B;  3N2O A;  1Y64 B;  4HEA A;  5LP6 E;  2N2M A;  3HKB E;  5FVN A;  3CPZ A;  4UXN B;  4GOU A;  2CXF A;  2XQY A;  3POU A;  1US7 B;  1QJP A;  2YU1 A;  2OMF A;  4E1S A;  3UPG A;  4EAH A;  3EVY A;  3KIN B;  5IYU A;  2E9X B;  1QJ9 A;  4O4H E;  4CI1 B;  4EXT A;  3AAI A;  2LT3 A;  4U74 A;  5JDN A;  1YW0 A;  3MZK B;  4O4X A;  5GV0 A;  4PFO A;  2UXN B;  4UV8 B;  2F1T A;  1MND A;  3L3P A;  2V26 A;  4GYR A;  3GMI A;  4I50 E;  4AYM C;  2E9X C;  1Q9G A;  2EHO C;  3KVA A;  5T5F A;  5JH7 E;  2UXX B;  4GK0 E;  5DL5 A;  2CWO A;  3SY9 A;  2XTQ A;  1WR6 A;  3HKE E;  3LJC A;  4O4I E;  3GP6 A;  1UX5 A;  3CML A;  3VZT X;  3PUS A;  5G26 A;  3W15 B;  2W61 A;  3MA9 A;  3D0T A;  2I59 A;  2JRK A;  3RRC A;  4ASK A;  2JMH A;  2K24 A;  3POQ A;  4FJO A;  4ZS2 A;  2VWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...