5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
1IZNA 3AA6A 3AAAA 5AFUL 5ADXL 3LK3B 3LK2A 3LK42 2KZ7B 2KXPA 3AA7A 3AA0A 4AKRB 3AAEB 3AA1B 3LK3A 2KZ7A 5AFUK 4AKRA 3AAEA 3AA1A 3LK41 5ADXK 1IZNB 3AAAB 3AA6B 3LK2B 2KXPB 3AA0B 3AA7B
chains in the Genus database with same CATH superfamily
4B3TT 3JCUO 3HKBE 1ZHCA 2YDQA 2XTQA 2LJLA 3O1JA 1HF8A 3EAMA 4P0BA 1MM4A 3CQGB 3IEEA 1UX5A 3FZHB 4PJMA 4AIUA 5L3BB 4FI5A 2J1NA 1I6ZA 4O3ZA 1T72A 4PK6A 1NAFA 4ZS3A 4K3BA 3RQUA 4RJWA 2R4OA 1YXRA 2CLYB 3KZIO 4O4LE 5C3JA 3QRCA 4YTPA 3FYXA 2NR4A 1L0VA 1D0ZA 4EV6A 1T98A 4OHFA 2V7JA 2IW5B 2ACZA 3JC6C 4MLKA 2BG9E 4NXNT 4AXPA 5BR8T 4ISSA 3AA6B 1IBMT 4E7SA 5AQUB 2WAUA 2K24A 3ESLA 4YLHA 3WAKA 3H3MA 3HW9A 1Z0PA 3PQUA 3TZGA 3AEDA 4U31A 4O4UA 3RKGA 4Z3TA 1FMVA 3C4ZA 2XM2A 4ZI2C 3BS0A 4LFAT 4IL4A 4O3XB 3UAQA 4C90A 3A7MA 2CXLA 5J1GA 4DIDB 2ZM6T 2XZEA 2MHLA 2LRLA 3G06A 1JNRA 4IE4A 2OA5A 2EHOC 4HWDA 3AEAA 4FJOA 5FXZA 2E9XB 4H63V 4UVCB 3P4PA 2ODUA 5TISO 3AVRA 2ZLYA 3RH3A 1XWMA 3KVDD 4N58A 5L3GB 2W61A 3RKOA 4NUVA 2LHRA 4HGAA 3QC9A 2Y2XA 3L09A 3UU5A 4EZ4A 2ZM8A 1OEDA 3B5MA 5T5FA 5L2LA 2HN2A 3NZPA 4BAYB 2XQ7A 1UURA 5IHYA 2K4TA 1IAPA 2YK0A 5EK4A 3I9YA 5FP3A 1KEYA 5FXWA 2JPFA 4LFCT 4O3WA 2VWAA 2BBJA 4HFDA 3E08A 2IC9A 1N36T 2CCQA 3ABVA 3AE8A 2H3RA 1YD8G 4OYJA 2KINB 1MIWA 4QH5A 5HEUA 3CMLA 2K3WA 1CUNA 4P1NA 4YJ2E 2BDEA 2LOPA 5LXTE 4AKLA 1QJ9A 4Z91A 2E8IA 3N2GE 4LF6T 3EDVA 4CI1B 1HNXT 3UULA 3PUSA 3KINB 5FY7A 4GHBA 2WM9A 2UXXB 4PJNA 3N2OA 4PFPA 1D0YA 3PJAA 2HH7A 4HWCA 2W81C 4AI6A 4UVBB 4Q25A 4F8HA 4HEAA 1I94T 5L3FB 5CFBA 2XSBA 2F4VT 3PU8A 5AQLB 2YINA 4HFBA 3LK41 2OV9A 5LA6E 4WZXA 4AYID 4FT6A 3ZC1A 2CRBA 3VHLA 5AFUL 3S4UA 4KUMB 3JCFA 1DU2A 4KMCA 3DTOA 2DNXA 4AUIA 3LG7A 4L5GA 1HFAA 2V6YB 3NVOA 3KDSE 2CM0A 3PUGA 3ZMVB 4HWHA 3HOEA 8PRNA 4JEHB 3VR9A 1IZNA 5KX5E 2ERVA 4O4JE 2BVMA 2G0UA 3ANWB 2UXCT 4DMWA 2BKOA 5L4HA 4JUYA 3NJTA 5LBQB 4O4IE 2H7OA 5M4YA 3CPZA 3J9X1 2Q9QC 1OWAA 4UELA 3ZJ1A 3C50A 4DVDA 2ODJA 4U2YA 2X0LB 4G76A 2JQYA 5LJNA 2VVNA 4TN7B 2JMMA 4J2CA 2C5IT 3CK6A 2JQKA 4Z90A 2WWVA 2KZ7A 5AQHB 2R8AA 4AKIA 3QK6A 4NXMT 2WB5A 2WDQA 5L4EA 1H7CA 2E9XD 5EZYE 1Z8UA 2GK9A 4CXXA 2Y0KA 3LK3B 3IHRA 3LK2A 3O0EA 1LRZA 1SUMB 5DQWA 4C4VB 3MXZA 5HEJA 1ZHZA 5EK2A 3SWHA 3RHWA 2N2MA 3WI4A 1UK5A 3N9LA 2QA7A 4B3ST 4JEUB 5HXHA 5G38A 3BQIA 2CE7A 2V7MA 3T24A 4RLCA 2C5KT 2K0LA 2YEVC 3QB5A 2KDYA 2KLQA 1X79A 2YNKA 5LHHB 4AFKA 4GCPA 4QH1A 5B66O 4BUMX 1N33T 3EI0A 2EHOA 3RIAA 4IE7A 4PW8A 5BMVE 2XAGB 2E5VA 4QKNA 1KK7A 4WYVA 4AKRA 3FXDB 2X27X 2XQ9A 5AQTB 2LHNA 3TLWA 4FUVA 4AYEC 3HKEE 2X0YA 5CA0E 5LNKA 2VK9A 4TNWA 3Q2MA 2XMXA 4IGUA 3AA1B 3AE4A 4JI8T 1D1AA 5L47A 4JI7T 2LSKA 4AISA 5JQGE 4IDNA 3ONJA 4IL6O 4UF0A 2JQHA 3NBXX 2R4LA 3QUJA 2YKSA 5JR9A 3K1SA 2XM1A 1MNEA 3AA7B 5JRCB 4MBQA 4IL9A 3ZN1B 4DMVA 1YKEB 4IREA 4ZOLE 3AEGA 3LDQB 2XSAA 3POQA 4U74A 5AQGB 1XMOT 3ZLIA 1YQ3A 3GA8A 3JAEA 3G7GA 3TLUA 2JQ9A 3AAAB 5AQRB 4H9SE 4XAXB 3PUAA 2JIWA 3OYXA 3F2EA 2WBLA 2L3LA 3CX7B 3V5UA 2ZMAA 3RQWA 3UT5E 3ETUA 4LSFA 2E9XC 4TV9E 4D64A 4LSIA 4C00A 4KHPT 4AZLA 4ERRA 3ZC0A 3UUXB 1U5PA 1SA0E 4CI3B 4AKGA 2J62A 4ANJA 1HXXA 1W0AA 2I59A 4AQGA 3KV4A 2FJAA 2RP4A 3WAJA 2WS3A 4U7YA 2KNDA 2X9XA 1NWMX 2YU1A 4RL9A 1GFMA 3MACA 1YQ4A 2J4UP 2N9DA 1HCIA 3AE2A 4QH4A 2UU9T 2MAWA 4QHOA 4HFHA 4PAGA 4EYYR 4ZEYA 4D65A 3AA0B 5DABA 2ZM0A 2VB6A 1ZEEA 5AQIB 3AEBA 2YN6A 1MMDA 2H89A 3L39A 2Q9QA 2DCFA 2XJ7A 2VL8A 5HWXA 4IDPA 3BK9A 4DR7T 4YTNA 4CQIA 5L3CB 2VASA 3F57A 3T1YT 4CI2B 3KVAA 2X66A 2LSGA 2IMLA 3AEEA 2B1EA 3ZEFB 1J1JA 2UXNB 3C64A 3O1HA 4FRXA 2N2LA 4P09A 3A5XA 1T8BA 3CKDA 2MPKA 4P0AA 2UXBT 4QQ1A 2WU5A 3N9NA 2A2FX 4X1IE 3NSGA 4NIQA 4O2AE 4UB8O 1VCTA 2NWBA 3AAEA 3JADA 5JDNA 2KMFA 4JLEA 3AE5A 4UB6O 3FZKB 4TWFA 3ZMZB 3P4RA 5HCJA 4TWDA 2MTQA 3PURA 4E7ZA 4UV8B 3PUYF 3Q9DA 4BJMA 4YSXA 4LF9T 2L8KA 4IIJE 3AE3A 4YSZA 2BG9B 1E7PA 2XQ8A 4JI0T 1XNRT 2UXDT 1GQEA 2BS4A 1FJGT 4LMKA 3SRZA 1MPFA 5ETWA 2DI4A 1ZOYA 5E0OA 2V7KA 3ZPOA 2WZHA 1GFPA 3ETVA 1HTJF 5JVDE 2Y0LA 5G3AA 3OKQA 4V1Av 5TAOA 5G39A 2VURA 1E1HB 4EXTA 4WBNE 3PRNA 2ACXA 5JTGA 3AVSA 4IDZA 4KR8A 5LCYA 2KXPA 3SZVA 1US7B 4ZZBA 4FRTA 2BKNA 3RYHE 1T16A 2LOSA 5H2FO 3ZT5A 2XTLA 3AB3B 1W9RA 4EEDA 5FY1A 1OPFA 3SY7A 2H7VC 4LMJA 2RA1A 4JV5T 3AA6A 2F1TA 1UGOA 2VKDA 4AYMC 5ADXL 4XNKA 3U78A 4FZLA 4DNDA 3PUZF 4FOZA 4IDQA 2WSSV 4FZNA 4N78D 2OLTA 2PORA 4N75A 4M1PA 2R88A 2N1GA 3ZMUB 4KBMB 4WNKA 3B13A 2VKJA 3CVRA 1ZKEA 3RRCA 2KSRA 2WP9A 2IIUA 3PORA 4B61A 2BS2A 2O4VA 5KXJA 3EHZA 3FZLB 1N32T 4XZCA 3RPUA 3T20A 3HI2A 2W0GA 1OEDE 4ILAA 2E9XA 3UQ4A 2V7LA 1YW0A 1WR6A 2F1VA 4EZHA 4X66T 4NUUA 5JR9C 1QSDA 3IF8B 1AJ3A 2IDOB 2ZM2A 2LSJA 3H37A 1X9BA 4JFBA 5AQVB 1D1BA 1B7TA 3VRAA 4LF4T 1GFOA 2XASB 1OSMA 4DV5T 1S35A 5JH7E 5HXCA 4LSEA 2LSIA 4G63A 4B3RT 2BBHA 5LP6E 1VRBA 3FZMB 4GYSA 3BRYA 2Y8DA 3HKCE 4I50E 2QRXA 3CWZB 3OVUA 2BZBA 3Q5EA 3LFMA 4L9IA 1R8IA 3MK7C 3D0TA 5ABGA 4XNLA 3MKDA 2VKHA 2J47A 2NW9A 4UV9B 4DUYT 2UUCT 2LHFA 1HNWT 2UUBT 5C2TA 2XY8B 2X67A 2DHRA 4N74A 2JRKA 2WMNA 4KHZF 2LLYA 2W80C 3UTKA 4ISTA 3RIFA 4ZHQE 2A72A 4UEMA 5L3DB 1ZHWA 2LT3A 5FY0A 3ZYMA 4B3MT 2M67A 1MIVA 4EB6E 2XAFB 2CXDA 4YT0A 2HPLA 5AQMB 1GFQA 2ZFGA 3PUXF 2HHHT 4U9CA 4ASKA 2XQ6A 3NRYA 4AYNA 4HTEA 2MOZA 4B6XA 1QLBA 3P4SA 2W00A 3I1AA 4IE5A 1LKXA 3UU6A 4NPPA 5FL0A 4QX7B 3GMIA 3KV6A 3ZCIA 1Y64B 3QNUA 3OTOT 5C8YE 2X9WA 4K0UA 3F31A 2V6YA 4H9PC 3LK42 4A5XA 4IE6A 3M65A 1U4QA 3ZYKA 3ANWA 2BVLA 3SFDA 1KFYA 4U3CA 1HR0T 2VQET 3P8CD 4H63H 1D1CA 3HR0A 1J5WA 4IE0A 4DV0T 4A56A 3LK2B 4ILUA 4LMLA 1MMAA 5GTHO 4I55E 2M06A 4H9OC 2D9DA 4I43B 4HFVA 3KBUA 3RYCE 5JDGA 5AQOB 1BR2A 5AFUK 1G73A 3ONLC 3A8YC 2W63A 2CBIA 1THQA 4COFA 1MMGA 4QWNB 1BR1A 5JDPA 3UU8A 5DQVA 4JI6T 1LVFA 4YY3T 2JMHA 4GCQA 2IWWA 3POXA 2LM2A 3LK3A 4LF7T 2X68A 4AKMA 4G75A 4C4VA 4WBOA 2VL0A 5KAIO 2VQFT 2ES0A 1ORMA 4GIWA 4KRAA 5HYAA 4UIGA 4AYDC 4YHHT 2CLYC 5HCMA 4GK0E 3O9XA 1W09A 4X1YE 4QXBB 2JMKA 5LGUB 4MFRA 3AE1A 4JYAT 4JCHA 1WYCA 2XQ3A 4XBFB 5LYJE 4ZXLA 3LBXB 5LGTB 2Y0HA 5HXEA 5HAXA 2CBJA 2PG8A 3WI3A 3ZMSB 3ZSSA 3K19A 3QRAA 5JDHA 4HE8A 4ZI7E 3WU2O 2NTYA 2CXFA 3CQCB 3FZFB 4DBQA 3A2SX 5LMNT 4GYRA 3UQ7A 1MNDA 3RYIE 1WRDA 4HN9A 4DR3T 2IAKA 2WY2A 3K3QC 3EVYA 2KC0A 3I0OA 2XPKA 3N9PA 4OK0A 3UFGA 4U33A 3AA1A 3GN5B 4FESA 2P9BA 4UVAB 5ABFA 5F3JA 5FL1A 2XUEA 4Z8XA 3AXJB 4CN4A 5IYUA 1SE7A 3AA7A 3UFEA 4FZMA 3KVBA 3VZTX 2X0HA 2RPAA 5IYZE 2MNHA 5CA1E 2W62A 2W66A 4HFIA 2OMFA 1BR4A 2XTRA 1WLXA 4O49A 1T1LA 3SYBA 4PNIA 4A97A 3AAAA 5GV0A 4I0UA 4U72A 3B57A 3EMNX 5DL8A 5F8PA 1XNQT 3DA3A 2JQQA 2V5CA 5JDQA 2Z6EA 2CHNA 4A98A 3AAIA 4AKHA 4MALA 3BQKA 3N9QA 2WWUA 4X65T 3RF1A 2V6XA 3GP6A 2IC6A 1D0XA 3U3IA 2LSYA 2L9QA 1HX8A 4O4HE 3PQSA 4X62T 2QGSA 3EDUA 1XDOA 4YXDA 3C4XA 2QVAA 1BH3A 1IJ5A 2C5JA 2FJBA 4ZS2A 3R6NA 2WU2A 1MMNA 2UUAT 1FIOA 2Q9QB 3K8PC 4GF4A 4JBWF 1Q9GA 2XAQB 4EYUA 2FGQX 4PJLA 3VRBA 4LF8T 4DV7T 5HXSA 3CIRA 2E5LT 2PFVA 5FYMA 2WMOA 1UCUA 4AQFA 2NW7A 1ZV4X 2V5DA 3V5SA 1WFDA 3SOLA 3ZCJA 4CXWA 1GFNA 3Q5WA 2AE9A 2XAJB 2FBWA 5J2UE 2D2SA 3RC8A 2IUBA 2F1CX 2A9UA 4TNVA 2DL1A 2GE4A 2WJQA 2KWIB 2DWGA 1YS5A 2K9AA 3FB2A 4FMSA 1VOMA 1NENA 5CJ5A 1ZP0A 2M07A 3O1IA 4HKAA 1IBKT 4CZZB 3ZYLA 2WDVA 2LEHA 3MJXA 3MZKB 4ZZCA 3FHNA 4DO0A 1KNPA 1HS7A 5JDFA 5LMUT 5H6RB 1M7KA 3RI5A 2CWYA 2KT9A 2B76A 4GK5E 1ZHTA 4IDOA 3T8OA 4X1KE 4YJ3E 4G2AA 3PE0A 5LBMA 4ILBA 2BG9A 2KXPB 3PF1A 3N9MA 2WJRA 2XQAA 3NKZA 4OYKA 2XQYA 3ZMTB 3PUWF 3GWHA 1M62A 3P4WA 3UU3A 7PRNA 3TLVA 4HWFA 4DV3T 1HXUA 2CA5A 3I9WA 4DV6T 4CTDA 3UUNA 2PJQA 4CN6A 4K0KT 3VKGA 4TWHA 4DR5T 1OXZA 4EIWA 3C98B 1PHOA 4JI1T 1V9DA 3UPGA 3JTYA 5HXRA 2CWOA 3AE6A 3RRWA 5GONE 5LB7B 2Y7SA 3POUA 5J2TE 3RYFE 3VZWX 4H9RC 3TLTA 2I0MA 4JI5T 3Q5XA 4PK4A 1OEDB 5IUXA 2LFUA 4E1TA 2CMRA 3VE1A 3AECA 3T0SA 2AXTO 2BKPA 2D0UA 5AQQB 1PRNA 3VE2A 2Q9QD 1E2AA 2HPJA 4PJ0O 3RIUC 3RX6A 4X20E 3A0BO 1NEKA 3MA9A 4DR4T 4F6RC 3N2KE 4N59A 1KF6A 2R4NA 2YDRA 4C69X 5DJQC 2ZLDA 5EK3A 4PJJA 2AXDS 3C4WA 4U2ZA 3PUQA 4ILCA 3P7IA 1KNZA 4O4XA 5ADXK 2HN1A 2XQ5A 4GKJT 6PRNA 3QOFA 1HX1B 5IWAT 3HA4A 4K3CA 4EAHA 1T7SA 3NRXA 5KDMC 1S5LO 3CX8B 4F4BA 4BA9A 4BJNA 2VVSA 2I6HA 2XAHB 1KNRA 3SZDA 1XZYA 5KAFO 5FVLA 3FBZA 2PRNA 2NTXA 4DV2T 4OX9T 1WR0A 3QB5K 4E1SA 3K3NA 4RJXA 1IJ6A 2KWHA 3T1HT 3VZUX 2R4PA 5FMNA 1ZHXA 2E2AA 2C0SA 5HEGA 2K5BB 2DLRA 4L0RA 4H9QC 3OBVE 5FVNA 5EE2A 5LG4A 3PJAJ 3ZT7A 4FSPA 2YU2A 4WW0A 4LF5T 4FQEA 1UUSA 5FNVE 1IZNB 2IHR1 5HEHA 1H6S1 4EGWA 2K48A 2W4XA 2QTKA 2J1DG 1Q9FA 2XE3A 1SHZC 2X9KA 3BQLA 4HFCA 2W2UA 3LSVA 1MIYA 4TV8E 5DL7A 3PGSA 2JJ9A 3R84B 2PTFA 1EZ3A 3ZSTA 4I4TE 5A1LA 4UXNB 3ZKRA 4ADZA 4KI0F 3RBHA 1P4TA 3P50A 2X9HA 3I0QA 2KZ7B 1YKHB 2V7IA 2J4GA 2V1DB 2ODVA 3CQXC 4HFEA 2LE8A 2XQ4A 2CHOA 2A3DA 4TX5A 4AQFC 4C91A 1VCSA 3ZJ2A 4UR9A 1BXWA 3TKLB 2R89A 2NP9A 1E54A 5AQFB 1BT9A 3E0ZA 4ZI3D 1Y01A 5LOVE 2D0TA 2M6IA 1HXTA 5LGNB 1IBLT 3VU7H 4DUZT 5L3EB 4PFOA 2Y6XA 4H9NC 2V26A 4TUYE 5AQSB 2LKGA 4O2BE 4DBRA 1QUUA 5LG3A 4CN1A 2DWKA 3KV5A 5J0ZA 3L8RA 3C51A 4OFZA 4GKKT 2EHOB 1FMWA 3IBPA 3DA4A 2IWVA 3KFWX 4EOZB 5G26A 5JREA 2FUPA 2WCAA 5KMGP 2NW8A 3K3OA 2XE1A 3PGUA 4JI3T 3VKHA 3EUHA 4AKRB 2WDRA 3HL6A 3IA3A 2WZIA 2BG9C 3ONXA 3HOLA 3N5LA 3SFEA 1W0BA 5DL6A 2WQYA 2YDSA 3BRZA 1CHUA 4GCSA 4EEBA 3SY9A 3X1DA 5H6QB 4YSYA 3FBLA 4PUXA 4QXCB 2LKHA 4YFSA 4PK5A 5JDLA 2QYWA 2R6GF 1WCRA 3UUBA 5CGMA 4YTMA 3C5OA 4UF0B 2PBIA 1N34T 5JR9B 4TZ4C 1UX4A 4KR4A 2CEAA 3DWNA 4O3YA 3PGRA 3RIUA 5FVKA 3PDYA 4KX6A 3RLFF 2FJEA 3EABA 2FJDA 1LVKA 5LJMA 2X51A 3PTRB 1QJ8A 3VR8A 4AQYT 2MBGA 2NOXA 3A0HO 4GOUA 4U7IA 4CXYA 2W67A 3PU3A 3LBXA 1WYBA 3Q5DA 4JI2T 2LM9A 2LRKA 3V8UA 5ABFB 3OJAA 2M6BA 1G90A 3DJBA 5E79O 2FGRA 1S94A 1O3XA 3UUMA 5AQJB 4QXHB 3UU2A 2V8SV 4LFBT 5JRCA 3AE9A 1G8XA 2N2NA 2D5UA 2H88A 3CX6B 3OPCA 4QX8B 4ZI3C 5DL5A 5ABEA 1HG5A 5AQKB 2YPVA 3GN5A 3SS1A 3AEFA 4DR1T 4O8SA 4DV4T 3H3AA 1OEDC 2VKOA 1XMQT 4HWIB 2YOEA 3AXJA 3E22E 2XG6A 3W15B 5GTIO 5FXVA 3KBTA 3HWBA 4D5UA 3JC6D 5ABHA 5D5DA 3ZN0B 5F5WA 4DR2T 3KV9A 5CB4E 3RGLA 3HKDE 4DR6T 3DP7A 3NZQA 3SYSA 2WVPA 4IHJE 2Y48B 5JDMA 1J5ET 5HWYA 2XE2A 5FXXA 1XDPA 4IT4A 5HEOA 5AQPB 3O4XE 4DV1T 1MM5A 3FXEB 2SPCA 4YHJA 4LSHA 4JI4T 3NWIA 5LHIB 1HG2A 3VY9X 4KP3C 1QJPA 3DZMA 2XHEB 4ZI2D 2BS3A 1HNZT 5PRNA 3JAFA 2MYSA 3P4QA 3J7Yq 3VY8X 5LHGB 4PR7A 3L3PA 3AE7A 1ZHYA 3DWOX 5FKYA 3TLSA 3ZT6A 3UU4A 5AQNB 4X64T 3PUVF 2EHOD 2X9YA 3LJCA 2XE5A 4X5TA 1BR0A 3RC3A 3M3ZB 1JNZA 3AA0A 5B5EO 4MHCA 3AAEB 3OYZA 4RLBA 4FSOA 1FEWA 3N9OA 3WI5A 2CPTA 3PV0F
chains in the Genus database with same CATH topology
1PRNA 3VE2A 3ZN1B 2Q9QD 3HKBE 1ZHCA 3LK42 4H9PC 2HPJA 4DMVA 2XTQA 2LJLA 3RX6A 1YKEB 4X20E 3O1JA 1HF8A 4IE6A 3M65A 1U4QA 3MA9A 4P0BA 3ZYKA 1MM4A 3ANWA 2BVLA 3CQGB 3IEEA 4ZOLE 4F6RC 4U74A 3POQA 1UX5A 3N2KE 4PJMA 3ZLIA 3P8CD 4H63H 3GA8A 5L3BB 4FI5A 3G7GA 1D1CA 3HR0A 4N59A 4IE0A 3AAAB 4A56A 4C69X 3LK2B 4ILUA 5DJQC 1MMAA 2ZLDA 4H9SE 4XAXB 2J1NA 4I55E 3PUAA 4O3ZA 2M06A 3OYXA 5EK3A 4H9OC 3F2EA 2WBLA 4PK6A 4PJJA 1NAFA 2L3LA 3C4WA 4ZS3A 4I43B 4RJWA 4HFVA 3PUQA 3CX7B 3V5UA 2ZMAA 2CLYB 3KBUA 3UT5E 3RYCE 3ETUA 4LSFA 5JDGA 1BR2A 3P7IA 1KNZA 2E9XC 5AFUK 4O4LE 4TV9E 1G73A 4D64A 4O4XA 3QRCA 5ADXK 4LSIA 2W63A 1THQA 3FYXA 1MMGA 4QWNB 6PRNA 1BR1A 5JDPA 4AZLA 1D0ZA 4ERRA 3HA4A 3ZC0A 1T98A 4EAHA 3NRXA 5DQVA 3UUXB 4OHFA 2V7JA 2IW5B 1U5PA 1LVFA 3JC6C 5KDMC 4MLKA 3CX8B 2JMHA 4F4BA 1SA0E 4CI3B 4BA9A 4GCQA 4AKGA 4BJNA 3POXA 4AXPA 2XAHB 3SZDA 4ANJA 1HXXA 3LK3A 2I59A 4AQGA 3KV4A 3FBZA 2PRNA 2NTXA 2X68A 4ISSA 4AKMA 2RP4A 3WAJA 4E1SA 3K3NA 4G75A 4RJXA 2KNDA 4WBOA 1IJ6A 2KWHA 3AA6B 4E7SA 3VZUX 2WAUA 2X9XA 2K24A 5FMNA 1ZHXA 3ESLA 1NWMX 4YLHA 2YU1A 4RL9A 3WAKA 2ES0A 2C0SA 1GFMA 1ORMA 4GIWA 3MACA 4KRAA 3HW9A 2K5BB 1Z0PA 2DLRA 4UIGA 5HYAA 2J4UP 4AYDC 4L0RA 3PQUA 4H9QC 2N9DA 3OBVE 5FVNA 3TZGA 1HCIA 5EE2A 5LG4A 2CLYC 4O4UA 4Z3TA 1FMVA 4GK0E 4FSPA 3C4ZA 2YU2A 4WW0A 4ZI2C 3O9XA 4X1YE 5FNVE 4QXBB 2JMKA 4QHOA 4MFRA 5LGUB 4O3XB 4PAGA 3UAQA 4EYYR 1IZNB 4C90A 4JCHA 1WYCA 4XBFB 4D65A 2CXLA 3AA0B 5DABA 5LYJE 2ZM0A 2VB6A 1ZEEA 3LBXB 1H6S1 5LGTB 2Y0HA 5J1GA 1MMDA 5HXEA 2Q9QA 2DCFA 2K48A 5HAXA 2MHLA 2PG8A 3WI3A 3ZMSB 2QTKA 2J1DG 1Q9FA 2VL8A 5HWXA 4IE4A 2XE3A 3K19A 1SHZC 2OA5A 3BK9A 3BQLA 2EHOC 3QRAA 5JDHA 1MIYA 4TV8E 5DL7A 4FJOA 4HE8A 4CQIA 4ZI7E 2JJ9A 5FXZA 3R84B 2NTYA 2CXFA 3CQCB 5L3CB 4DBQA 3A2SX 2VASA 2X9WA 2E9XB 1EZ3A 3F57A 4CI2B 4H63V 4UVCB 4I4TE 2ODUA 3KVAA 5A1LA 4GYRA 2X66A 3AVRA 2LSGA 4UXNB 2ZLYA 2B1EA 1MNDA 3RH3A 3ZEFB 3KVDD 4ADZA 2UXNB 3C64A 3O1HA 4FRXA 4N58A 3RYIE 2N2LA 4P09A 3A5XA 2W61A 5L3GB 3RBHA 1WRDA 1P4TA 4HN9A 2IAKA 3CKDA 3RKOA 2X9HA 3K3QC 3I0QA 2KZ7B 4P0AA 4QQ1A 3EVYA 1YKHB 2LHRA 2V7IA 3N9NA 4NUVA 2A2FX 4X1IE 2KC0A 3NSGA 4HGAA 4O2AE 2V1DB 3I0OA 3QC9A 2Y2XA 3L09A 2ODVA 3CQXC 2LE8A 3N9PA 2NWBA 4OK0A 4EZ4A 2A3DA 2ZM8A 3AAEA 4TX5A 4AQFC 4C91A 3AA1A 5T5FA 5JDNA 5L2LA 2KMFA 4JLEA 3GN5B 3NZPA 4BAYB 3ZJ2A 4FESA 2P9BA 4UVAB 5IHYA 3ZMZB 2K4TA 1BXWA 3TKLB 1IAPA 2YK0A 5F3JA 2NP9A 5EK4A 3I9YA 2XUEA 4Z8XA 5FP3A 1E54A 2MTQA 3PURA 4E7ZA 4UV8B 1BT9A 3E0ZA 4ZI3D 3Q9DA 5FXWA 5IYUA 2JPFA 4BJMA 3AA7A 3UFEA 4O3WA 5LOVE 2VWAA 4FZMA 3KVBA 2D0TA 2L8KA 3E08A 1HXTA 4IIJE 5LGNB 3VZTX 2IC9A 5IYZE 2CCQA 2MNHA 3VU7H 5CA1E 2W62A 2H3RA 1YD8G 4OYJA 2KINB 1MIWA 5L3EB 4PFOA 2Y6XA 4H9NC 2V26A 2OMFA 1BR4A 2XTRA 1WLXA 4TUYE 3CMLA 4O49A 4DBRA 4O2BE 1CUNA 4YJ2E 2BDEA 2LOPA 3SYBA 1QUUA 4PNIA 3SRZA 1MPFA 3AAAA 5LXTE 5GV0A 2DWKA 4AKLA 5ETWA 1QJ9A 2DI4A 2E8IA 3B57A 3KV5A 4U72A 3EMNX 3N2GE 5DL8A 5E0OA 2V7KA 5F8PA 3C51A 3DA3A 3EDVA 3ZPOA 4CI1B 2JQQA 3UULA 1GFPA 3ETVA 3PUSA 4OFZA 5JDQA 1HTJF 5JVDE 2EHOB 1FMWA 3KINB 3IBPA 5FY7A 2Y0LA 2WM9A 2Z6EA 3DA4A 2UXXB 4GHBA 3OKQA 3KFWX 4PJNA 4EOZB 4V1Av 5TAOA 5G26A 3N2OA 4PFPA 1E1HB 3AAIA 1D0YA 5JREA 4EXTA 2HH7A 4WBNE 3PRNA 4AKHA 4MALA 3BQKA 2NW8A 5KMGP 2W81C 2ACXA 2WWUA 3K3OA 3N9QA 4AI6A 4UVBB 2XE1A 3GP6A 2IC6A 1D0XA 3AVSA 3U3IA 2LSYA 4HEAA 1HX8A 2L9QA 4O4HE 4IDZA 2QGSA 3EUHA 5L3FB 3EDUA 5LCYA 3VKHA 2KXPA 3PQSA 1US7B 4KR8A 3SZVA 4AKRB 3PU8A 4FRTA 3HL6A 2YINA 3C4XA 3ONXA 3HOLA 3RYHE 1BH3A 3N5LA 1IJ5A 2C5JA 2LOSA 4ZS2A 5DL6A 3LK41 3R6NA 2XTLA 1MMNA 3AB3B 5LA6E 1FIOA 4AYID 4FT6A 3ZC1A 5FY1A 1OPFA 2Q9QB 2H7VC 3SY7A 4GCSA 3K8PC 4GF4A 2RA1A 3SY9A 3VHLA 5H6QB 3AA6A 3FBLA 5AFUL 1Q9GA 2XAQB 4EYUA 4QXCB 2F1TA 2FGQX 4PUXA 2VKDA 4PJLA 4YFSA 3S4UA 5ADXL 4XNKA 4AYMC 4PK5A 5JDLA 4KUMB 3U78A 5HXSA 4FZLA 4DNDA 3C5OA 4UF0B 2PBIA 5JR9B 4FOZA 4KMCA 2WSSV 4TZ4C 3DTOA 4FZNA 2DNXA 1UX4A 4N78D 4KR4A 4AUIA 2CEAA 2PFVA 4O3YA 3LG7A 4L5GA 5FYMA 2WMOA 1HFAA 2PORA 3PDYA 3KDSE 2CM0A 4M1PA 3PUGA 3ZMVB 1UCUA 1LVKA 2N1GA 5LJMA 2X51A 3PTRB 3HOEA 3ZMUB 8PRNA 1QJ8A 4JEHB 1IZNA 4KBMB 4AQFA 2NW7A 1ZV4X 4WNKA 3V5SA 5KX5E 4O4JE 3B13A 2ERVA 2BVMA 2MBGA 3SOLA 2G0UA 2VKJA 2NOXA 3ANWB 3CVRA 4GOUA 1ZKEA 4CXYA 3PU3A 3ZCJA 3RRCA 4DMWA 3LBXA 4CXWA 1GFNA 3PORA 1WYBA 3Q5WA 4B61A 2O4VA 4JUYA 2XAJB 5LBQB 2LM9A 2H7OA 4O4IE 4XZCA 5M4YA 3V8UA 3CPZA 3RPUA 3J9X1 5J2UE 3T20A 2D2SA 2Q9QC 1OWAA 3OJAA 1G90A 3DJBA 4UELA 3RC8A 3HI2A 3ZJ1A 2FGRA 2W0GA 2GE4A 3C50A 1S94A 4DVDA 2ODJA 2KWIB 2X0LB 2DWGA 1YS5A 2K9AA 3FB2A 4FMSA 4G76A 1VOMA 2E9XA 5LJNA 1O3XA 3UUMA 4TN7B 2V7LA 1YW0A 1WR6A 4QXHB 3UU2A 2M07A 3O1IA 4HKAA 2JMMA 4J2CA 2F1VA 4EZHA 5JRCA 4CZZB 2C5IT 4NUUA 5JR9C 1G8XA 1QSDA 3IF8B 3ZYLA 2N2NA 2D5UA 2LEHA 1AJ3A 3CX6B 2KZ7A 3MJXA 4QX8B 2ZM2A 4ZI3C 3MZKB 5DL5A 4AKIA 3QK6A 2LSJA 3FHNA 3H37A 4DO0A 4JFBA 1D1BA 1HG5A 1HS7A 1B7TA 5JDFA 2YPVA 1H7CA 2E9XD 5EZYE 5H6RB 3GN5A 3SS1A 2GK9A 4O8SA 3H3AA 4CXXA 1GFOA 3LK3B 3IHRA 2Y0KA 3LK2A 2XASB 2VKOA 2CWYA 2KT9A 3O0EA 1LRZA 1OSMA 5DQWA 2XG6A 3E22E 4GK5E 1ZHTA 1S35A 3W15B 5JH7E 3T8OA 5FXVA 3MXZA 4X1KE 3KBTA 4YJ3E 5HXCA 1ZHZA 3HWBA 4D5UA 3JC6D 2LSIA 4G2AA 4G63A 4LSEA 3ZN0B 5D5DA 5EK2A 3SWHA 5LP6E 1VRBA 2N2MA 3WI4A 3PE0A 3KV9A 4GYSA 3N9LA 5LBMA 5CB4E 2QA7A 3HKDE 2Y8DA 3HKCE 4JEUB 2KXPB 3DP7A 3N9MA 3NZQA 4I50E 5HXHA 3SYSA 3CWZB 4IHJE 2Y48B 5JDMA 2BZBA 3BQIA 2CE7A 3LFMA 2V7MA 4L9IA 5HWYA 2XE2A 3T24A 3MK7C 4OYKA 3D0TA 5FXXA 2XQYA 4RLCA 2C5KT 4XNLA 3ZMTB 2K0LA 2YEVC 3MKDA 3GWHA 3O4XE 2VKHA 1MM5A 2KDYA 2KLQA 1X79A 3FXEB 2YNKA 2SPCA 4YHJA 5LHHB 4LSHA 4AFKA 4GCPA 2NW9A 4UV9B 2LHFA 4BUMX 7PRNA 5LHIB 2EHOA 1HG2A 3VY9X 4KP3C 1QJPA 2X67A 2XHEB 4IE7A 4ZI2D 1HXUA 2DHRA 5PRNA 2CA5A 3I9WA 4PW8A 2MYSA 3UUNA 5BMVE 2PJQA 2XAGB 2JRKA 3J7Yq 3VY8X 3VKGA 2WMNA 5LHGB 3L3PA 2W80C 3UTKA 4QKNA 1ZHYA 1OXZA 4EIWA 1KK7A 4ISTA 4ZHQE 2A72A 3C98B 4UEMA 1PHOA 5L3DB 1V9DA 1ZHWA 3UPGA 2LT3A 3JTYA 5FY0A 3ZYMA 2M67A 4AKRA 1MIVA 5HXRA 3FXDB 2CWOA 3RRWA 5GONE 4EB6E 2X27X 2EHOD 2XAFB 2CXDA 2Y7SA 3POUA 2HPLA 2LHNA 2X9YA 1GFQA 3LJCA 2XE5A 5J2TE 3RYFE 2ZFGA 4H9RC 4FUVA 3VZWX 4AYEC 4U9CA 3HKEE 1BR0A 3RC3A 4ASKA 5CA0E 5LNKA 2VK9A 3Q2MA 3NRYA 4AYNA 3AA0A 3Q5XA 4HTEA 4PK4A 2MOZA 3AAEB 3AA1B 3OYZA 4IGUA 4MHCA 2XMXA 4B6XA 4RLBA 1D1AA 2LSKA 2W00A 3I1AA 4IE5A 5JQGE 4FSOA 1FEWA 2LFUA 1LKXA 4E1TA 2CMRA 4UF0A 4QX7B 3NBXX 3QUJA 3GMIA 3KV6A 5JR9A 3ZCIA 3VE1A 1Y64B 3N9OA 3WI5A 5C8YE 1MNEA 3T0SA 3AA7B 2D0UA 5JRCB 4MBQA 4K0UA 3F31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN A;  3AA6 A;  3AAA A;  5AFU L;  5ADX L;  3LK3 B;  3LK2 A;  3LK4 2;  2KZ7 B;  2KXP A;  3AA7 A;  3AA0 A;  4AKR B;  3AAE B;  3AA1 B;  3LK3 A;  2KZ7 A;  5AFU K;  4AKR A;  3AAE A;  3AA1 A;  3LK4 1;  5ADX K;  1IZN B;  3AAA B;  3AA6 B;  3LK2 B;  2KXP B;  3AA0 B;  3AA7 B; 
#chains in the Genus database with same CATH topology
 4B3T T;  3JCU O;  3HKB E;  1ZHC A;  2YDQ A;  2XTQ A;  2LJL A;  3O1J A;  1HF8 A;  3EAM A;  4P0B A;  1MM4 A;  3CQG B;  3IEE A;  1UX5 A;  3FZH B;  4PJM A;  4AIU A;  5L3B B;  4FI5 A;  2J1N A;  1I6Z A;  4O3Z A;  1T72 A;  4PK6 A;  1NAF A;  4ZS3 A;  4K3B A;  3RQU A;  4RJW A;  2R4O A;  1YXR A;  2CLY B;  3KZI O;  4O4L E;  5C3J A;  3QRC A;  4YTP A;  3FYX A;  2NR4 A;  1L0V A;  1D0Z A;  4EV6 A;  1T98 A;  4OHF A;  2V7J A;  2IW5 B;  2ACZ A;  3JC6 C;  4MLK A;  2BG9 E;  4NXN T;  4AXP A;  5BR8 T;  4ISS A;  3AA6 B;  1IBM T;  4E7S A;  5AQU B;  2WAU A;  2K24 A;  3ESL A;  4YLH A;  3WAK A;  3H3M A;  3HW9 A;  1Z0P A;  3PQU A;  3TZG A;  3AED A;  4U31 A;  4O4U A;  3RKG A;  4Z3T A;  1FMV A;  3C4Z A;  2XM2 A;  4ZI2 C;  3BS0 A;  4LFA T;  4IL4 A;  4O3X B;  3UAQ A;  4C90 A;  3A7M A;  2CXL A;  5J1G A;  4DID B;  2ZM6 T;  2XZE A;  2MHL A;  2LRL A;  3G06 A;  1JNR A;  4IE4 A;  2OA5 A;  2EHO C;  4HWD A;  3AEA A;  4FJO A;  5FXZ A;  2E9X B;  4H63 V;  4UVC B;  3P4P A;  2ODU A;  5TIS O;  3AVR A;  2ZLY A;  3RH3 A;  1XWM A;  3KVD D;  4N58 A;  5L3G B;  2W61 A;  3RKO A;  4NUV A;  2LHR A;  4HGA A;  3QC9 A;  2Y2X A;  3L09 A;  3UU5 A;  4EZ4 A;  2ZM8 A;  1OED A;  3B5M A;  5T5F A;  5L2L A;  2HN2 A;  3NZP A;  4BAY B;  2XQ7 A;  1UUR A;  5IHY A;  2K4T A;  1IAP A;  2YK0 A;  5EK4 A;  3I9Y A;  5FP3 A;  1KEY A;  5FXW A;  2JPF A;  4LFC T;  4O3W A;  2VWA A;  2BBJ A;  4HFD A;  3E08 A;  2IC9 A;  1N36 T;  2CCQ A;  3ABV A;  3AE8 A;  2H3R A;  1YD8 G;  4OYJ A;  2KIN B;  1MIW A;  4QH5 A;  5HEU A;  3CML A;  2K3W A;  1CUN A;  4P1N A;  4YJ2 E;  2BDE A;  2LOP A;  5LXT E;  4AKL A;  1QJ9 A;  4Z91 A;  2E8I A;  3N2G E;  4LF6 T;  3EDV A;  4CI1 B;  1HNX T;  3UUL A;  3PUS A;  3KIN B;  5FY7 A;  4GHB A;  2WM9 A;  2UXX B;  4PJN A;  3N2O A;  4PFP A;  1D0Y A;  3PJA A;  2HH7 A;  4HWC A;  2W81 C;  4AI6 A;  4UVB B;  4Q25 A;  4F8H A;  4HEA A;  1I94 T;  5L3F B;  5CFB A;  2XSB A;  2F4V T;  3PU8 A;  5AQL B;  2YIN A;  4HFB A;  3LK4 1;  2OV9 A;  5LA6 E;  4WZX A;  4AYI D;  4FT6 A;  3ZC1 A;  2CRB A;  3VHL A;  5AFU L;  3S4U A;  4KUM B;  3JCF A;  1DU2 A;  4KMC A;  3DTO A;  2DNX A;  4AUI A;  3LG7 A;  4L5G A;  1HFA A;  2V6Y B;  3NVO A;  3KDS E;  2CM0 A;  3PUG A;  3ZMV B;  4HWH A;  3HOE A;  8PRN A;  4JEH B;  3VR9 A;  1IZN A;  5KX5 E;  2ERV A;  4O4J E;  2BVM A;  2G0U A;  3ANW B;  2UXC T;  4DMW A;  2BKO A;  5L4H A;  4JUY A;  3NJT A;  5LBQ B;  4O4I E;  2H7O A;  5M4Y A;  3CPZ A;  3J9X 1;  2Q9Q C;  1OWA A;  4UEL A;  3ZJ1 A;  3C50 A;  4DVD A;  2ODJ A;  4U2Y A;  2X0L B;  4G76 A;  2JQY A;  5LJN A;  2VVN A;  4TN7 B;  2JMM A;  4J2C A;  2C5I T;  3CK6 A;  2JQK A;  4Z90 A;  2WWV A;  2KZ7 A;  5AQH B;  2R8A A;  4AKI A;  3QK6 A;  4NXM T;  2WB5 A;  2WDQ A;  5L4E A;  1H7C A;  2E9X D;  5EZY E;  1Z8U A;  2GK9 A;  4CXX A;  2Y0K A;  3LK3 B;  3IHR A;  3LK2 A;  3O0E A;  1LRZ A;  1SUM B;  5DQW A;  4C4V B;  3MXZ A;  5HEJ A;  1ZHZ A;  5EK2 A;  3SWH A;  3RHW A;  2N2M A;  3WI4 A;  1UK5 A;  3N9L A;  2QA7 A;  4B3S T;  4JEU B;  5HXH A;  5G38 A;  3BQI A;  2CE7 A;  2V7M A;  3T24 A;  4RLC A;  2C5K T;  2K0L A;  2YEV C;  3QB5 A;  2KDY A;  2KLQ A;  1X79 A;  2YNK A;  5LHH B;  4AFK A;  4GCP A;  4QH1 A;  5B66 O;  4BUM X;  1N33 T;  3EI0 A;  2EHO A;  3RIA A;  4IE7 A;  4PW8 A;  5BMV E;  2XAG B;  2E5V A;  4QKN A;  1KK7 A;  4WYV A;  4AKR A;  3FXD B;  2X27 X;  2XQ9 A;  5AQT B;  2LHN A;  3TLW A;  4FUV A;  4AYE C;  3HKE E;  2X0Y A;  5CA0 E;  5LNK A;  2VK9 A;  4TNW A;  3Q2M A;  2XMX A;  4IGU A;  3AA1 B;  3AE4 A;  4JI8 T;  1D1A A;  5L47 A;  4JI7 T;  2LSK A;  4AIS A;  5JQG E;  4IDN A;  3ONJ A;  4IL6 O;  4UF0 A;  2JQH A;  3NBX X;  2R4L A;  3QUJ A;  2YKS A;  5JR9 A;  3K1S A;  2XM1 A;  1MNE A;  3AA7 B;  5JRC B;  4MBQ A;  4IL9 A;  3ZN1 B;  4DMV A;  1YKE B;  4IRE A;  4ZOL E;  3AEG A;  3LDQ B;  2XSA A;  3POQ A;  4U74 A;  5AQG B;  1XMO T;  3ZLI A;  1YQ3 A;  3GA8 A;  3JAE A;  3G7G A;  3TLU A;  2JQ9 A;  3AAA B;  5AQR B;  4H9S E;  4XAX B;  3PUA A;  2JIW A;  3OYX A;  3F2E A;  2WBL A;  2L3L A;  3CX7 B;  3V5U A;  2ZMA A;  3RQW A;  3UT5 E;  3ETU A;  4LSF A;  2E9X C;  4TV9 E;  4D64 A;  4LSI A;  4C00 A;  4KHP T;  4AZL A;  4ERR A;  3ZC0 A;  3UUX B;  1U5P A;  1SA0 E;  4CI3 B;  4AKG A;  2J62 A;  4ANJ A;  1HXX A;  1W0A A;  2I59 A;  4AQG A;  3KV4 A;  2FJA A;  2RP4 A;  3WAJ A;  2WS3 A;  4U7Y A;  2KND A;  2X9X A;  1NWM X;  2YU1 A;  4RL9 A;  1GFM A;  3MAC A;  1YQ4 A;  2J4U P;  2N9D A;  1HCI A;  3AE2 A;  4QH4 A;  2UU9 T;  2MAW A;  4QHO A;  4HFH A;  4PAG A;  4EYY R;  4ZEY A;  4D65 A;  3AA0 B;  5DAB A;  2ZM0 A;  2VB6 A;  1ZEE A;  5AQI B;  3AEB A;  2YN6 A;  1MMD A;  2H89 A;  3L39 A;  2Q9Q A;  2DCF A;  2XJ7 A;  2VL8 A;  5HWX A;  4IDP A;  3BK9 A;  4DR7 T;  4YTN A;  4CQI A;  5L3C B;  2VAS A;  3F57 A;  3T1Y T;  4CI2 B;  3KVA A;  2X66 A;  2LSG A;  2IML A;  3AEE A;  2B1E A;  3ZEF B;  1J1J A;  2UXN B;  3C64 A;  3O1H A;  4FRX A;  2N2L A;  4P09 A;  3A5X A;  1T8B A;  3CKD A;  2MPK A;  4P0A A;  2UXB T;  4QQ1 A;  2WU5 A;  3N9N A;  2A2F X;  4X1I E;  3NSG A;  4NIQ A;  4O2A E;  4UB8 O;  1VCT A;  2NWB A;  3AAE A;  3JAD A;  5JDN A;  2KMF A;  4JLE A;  3AE5 A;  4UB6 O;  3FZK B;  4TWF A;  3ZMZ B;  3P4R A;  5HCJ A;  4TWD A;  2MTQ A;  3PUR A;  4E7Z A;  4UV8 B;  3PUY F;  3Q9D A;  4BJM A;  4YSX A;  4LF9 T;  2L8K A;  4IIJ E;  3AE3 A;  4YSZ A;  2BG9 B;  1E7P A;  2XQ8 A;  4JI0 T;  1XNR T;  2UXD T;  1GQE A;  2BS4 A;  1FJG T;  4LMK A;  3SRZ A;  1MPF A;  5ETW A;  2DI4 A;  1ZOY A;  5E0O A;  2V7K A;  3ZPO A;  2WZH A;  1GFP A;  3ETV A;  1HTJ F;  5JVD E;  2Y0L A;  5G3A A;  3OKQ A;  4V1A v;  5TAO A;  5G39 A;  2VUR A;  1E1H B;  4EXT A;  4WBN E;  3PRN A;  2ACX A;  5JTG A;  3AVS A;  4IDZ A;  4KR8 A;  5LCY A;  2KXP A;  3SZV A;  1US7 B;  4ZZB A;  4FRT A;  2BKN A;  3RYH E;  1T16 A;  2LOS A;  5H2F O;  3ZT5 A;  2XTL A;  3AB3 B;  1W9R A;  4EED A;  5FY1 A;  1OPF A;  3SY7 A;  2H7V C;  4LMJ A;  2RA1 A;  4JV5 T;  3AA6 A;  2F1T A;  1UGO A;  2VKD A;  4AYM C;  5ADX L;  4XNK A;  3U78 A;  4FZL A;  4DND A;  3PUZ F;  4FOZ A;  4IDQ A;  2WSS V;  4FZN A;  4N78 D;  2OLT A;  2POR A;  4N75 A;  4M1P A;  2R88 A;  2N1G A;  3ZMU B;  4KBM B;  4WNK A;  3B13 A;  2VKJ A;  3CVR A;  1ZKE A;  3RRC A;  2KSR A;  2WP9 A;  2IIU A;  3POR A;  4B61 A;  2BS2 A;  2O4V A;  5KXJ A;  3EHZ A;  3FZL B;  1N32 T;  4XZC A;  3RPU A;  3T20 A;  3HI2 A;  2W0G A;  1OED E;  4ILA A;  2E9X A;  3UQ4 A;  2V7L A;  1YW0 A;  1WR6 A;  2F1V A;  4EZH A;  4X66 T;  4NUU A;  5JR9 C;  1QSD A;  3IF8 B;  1AJ3 A;  2IDO B;  2ZM2 A;  2LSJ A;  3H37 A;  1X9B A;  4JFB A;  5AQV B;  1D1B A;  1B7T A;  3VRA A;  4LF4 T;  1GFO A;  2XAS B;  1OSM A;  4DV5 T;  1S35 A;  5JH7 E;  5HXC A;  4LSE A;  2LSI A;  4G63 A;  4B3R T;  2BBH A;  5LP6 E;  1VRB A;  3FZM B;  4GYS A;  3BRY A;  2Y8D A;  3HKC E;  4I50 E;  2QRX A;  3CWZ B;  3OVU A;  2BZB A;  3Q5E A;  3LFM A;  4L9I A;  1R8I A;  3MK7 C;  3D0T A;  5ABG A;  4XNL A;  3MKD A;  2VKH A;  2J47 A;  2NW9 A;  4UV9 B;  4DUY T;  2UUC T;  2LHF A;  1HNW T;  2UUB T;  5C2T A;  2XY8 B;  2X67 A;  2DHR A;  4N74 A;  2JRK A;  2WMN A;  4KHZ F;  2LLY A;  2W80 C;  3UTK A;  4IST A;  3RIF A;  4ZHQ E;  2A72 A;  4UEM A;  5L3D B;  1ZHW A;  2LT3 A;  5FY0 A;  3ZYM A;  4B3M T;  2M67 A;  1MIV A;  4EB6 E;  2XAF B;  2CXD A;  4YT0 A;  2HPL A;  5AQM B;  1GFQ A;  2ZFG A;  3PUX F;  2HHH T;  4U9C A;  4ASK A;  2XQ6 A;  3NRY A;  4AYN A;  4HTE A;  2MOZ A;  4B6X A;  1QLB A;  3P4S A;  2W00 A;  3I1A A;  4IE5 A;  1LKX A;  3UU6 A;  4NPP A;  5FL0 A;  4QX7 B;  3GMI A;  3KV6 A;  3ZCI A;  1Y64 B;  3QNU A;  3OTO T;  5C8Y E;  2X9W A;  4K0U A;  3F31 A;  2V6Y A;  4H9P C;  3LK4 2;  4A5X A;  4IE6 A;  3M65 A;  1U4Q A;  3ZYK A;  3ANW A;  2BVL A;  3SFD A;  1KFY A;  4U3C A;  1HR0 T;  2VQE T;  3P8C D;  4H63 H;  1D1C A;  3HR0 A;  1J5W A;  4IE0 A;  4DV0 T;  4A56 A;  3LK2 B;  4ILU A;  4LML A;  1MMA A;  5GTH O;  4I55 E;  2M06 A;  4H9O C;  2D9D A;  4I43 B;  4HFV A;  3KBU A;  3RYC E;  5JDG A;  5AQO B;  1BR2 A;  5AFU K;  1G73 A;  3ONL C;  3A8Y C;  2W63 A;  2CBI A;  1THQ A;  4COF A;  1MMG A;  4QWN B;  1BR1 A;  5JDP A;  3UU8 A;  5DQV A;  4JI6 T;  1LVF A;  4YY3 T;  2JMH A;  4GCQ A;  2IWW A;  3POX A;  2LM2 A;  3LK3 A;  4LF7 T;  2X68 A;  4AKM A;  4G75 A;  4C4V A;  4WBO A;  2VL0 A;  5KAI O;  2VQF T;  2ES0 A;  1ORM A;  4GIW A;  4KRA A;  5HYA A;  4UIG A;  4AYD C;  4YHH T;  2CLY C;  5HCM A;  4GK0 E;  3O9X A;  1W09 A;  4X1Y E;  4QXB B;  2JMK A;  5LGU B;  4MFR A;  3AE1 A;  4JYA T;  4JCH A;  1WYC A;  2XQ3 A;  4XBF B;  5LYJ E;  4ZXL A;  3LBX B;  5LGT B;  2Y0H A;  5HXE A;  5HAX A;  2CBJ A;  2PG8 A;  3WI3 A;  3ZMS B;  3ZSS A;  3K19 A;  3QRA A;  5JDH A;  4HE8 A;  4ZI7 E;  3WU2 O;  2NTY A;  2CXF A;  3CQC B;  3FZF B;  4DBQ A;  3A2S X;  5LMN T;  4GYR A;  3UQ7 A;  1MND A;  3RYI E;  1WRD A;  4HN9 A;  4DR3 T;  2IAK A;  2WY2 A;  3K3Q C;  3EVY A;  2KC0 A;  3I0O A;  2XPK A;  3N9P A;  4OK0 A;  3UFG A;  4U33 A;  3AA1 A;  3GN5 B;  4FES A;  2P9B A;  4UVA B;  5ABF A;  5F3J A;  5FL1 A;  2XUE A;  4Z8X A;  3AXJ B;  4CN4 A;  5IYU A;  1SE7 A;  3AA7 A;  3UFE A;  4FZM A;  3KVB A;  3VZT X;  2X0H A;  2RPA A;  5IYZ E;  2MNH A;  5CA1 E;  2W62 A;  2W66 A;  4HFI A;  2OMF A;  1BR4 A;  2XTR A;  1WLX A;  4O49 A;  1T1L A;  3SYB A;  4PNI A;  4A97 A;  3AAA A;  5GV0 A;  4I0U A;  4U72 A;  3B57 A;  3EMN X;  5DL8 A;  5F8P A;  1XNQ T;  3DA3 A;  2JQQ A;  2V5C A;  5JDQ A;  2Z6E A;  2CHN A;  4A98 A;  3AAI A;  4AKH A;  4MAL A;  3BQK A;  3N9Q A;  2WWU A;  4X65 T;  3RF1 A;  2V6X A;  3GP6 A;  2IC6 A;  1D0X A;  3U3I A;  2LSY A;  2L9Q A;  1HX8 A;  4O4H E;  3PQS A;  4X62 T;  2QGS A;  3EDU A;  1XDO A;  4YXD A;  3C4X A;  2QVA A;  1BH3 A;  1IJ5 A;  2C5J A;  2FJB A;  4ZS2 A;  3R6N A;  2WU2 A;  1MMN A;  2UUA T;  1FIO A;  2Q9Q B;  3K8P C;  4GF4 A;  4JBW F;  1Q9G A;  2XAQ B;  4EYU A;  2FGQ X;  4PJL A;  3VRB A;  4LF8 T;  4DV7 T;  5HXS A;  3CIR A;  2E5L T;  2PFV A;  5FYM A;  2WMO A;  1UCU A;  4AQF A;  2NW7 A;  1ZV4 X;  2V5D A;  3V5S A;  1WFD A;  3SOL A;  3ZCJ A;  4CXW A;  1GFN A;  3Q5W A;  2AE9 A;  2XAJ B;  2FBW A;  5J2U E;  2D2S A;  3RC8 A;  2IUB A;  2F1C X;  2A9U A;  4TNV A;  2DL1 A;  2GE4 A;  2WJQ A;  2KWI B;  2DWG A;  1YS5 A;  2K9A A;  3FB2 A;  4FMS A;  1VOM A;  1NEN A;  5CJ5 A;  1ZP0 A;  2M07 A;  3O1I A;  4HKA A;  1IBK T;  4CZZ B;  3ZYL A;  2WDV A;  2LEH A;  3MJX A;  3MZK B;  4ZZC A;  3FHN A;  4DO0 A;  1KNP A;  1HS7 A;  5JDF A;  5LMU T;  5H6R B;  1M7K A;  3RI5 A;  2CWY A;  2KT9 A;  2B76 A;  4GK5 E;  1ZHT A;  4IDO A;  3T8O A;  4X1K E;  4YJ3 E;  4G2A A;  3PE0 A;  5LBM A;  4ILB A;  2BG9 A;  2KXP B;  3PF1 A;  3N9M A;  2WJR A;  2XQA A;  3NKZ A;  4OYK A;  2XQY A;  3ZMT B;  3PUW F;  3GWH A;  1M62 A;  3P4W A;  3UU3 A;  7PRN A;  3TLV A;  4HWF A;  4DV3 T;  1HXU A;  2CA5 A;  3I9W A;  4DV6 T;  4CTD A;  3UUN A;  2PJQ A;  4CN6 A;  4K0K T;  3VKG A;  4TWH A;  4DR5 T;  1OXZ A;  4EIW A;  3C98 B;  1PHO A;  4JI1 T;  1V9D A;  3UPG A;  3JTY A;  5HXR A;  2CWO A;  3AE6 A;  3RRW A;  5GON E;  5LB7 B;  2Y7S A;  3POU A;  5J2T E;  3RYF E;  3VZW X;  4H9R C;  3TLT A;  2I0M A;  4JI5 T;  3Q5X A;  4PK4 A;  1OED B;  5IUX A;  2LFU A;  4E1T A;  2CMR A;  3VE1 A;  3AEC A;  3T0S A;  2AXT O;  2BKP A;  2D0U A;  5AQQ B;  1PRN A;  3VE2 A;  2Q9Q D;  1E2A A;  2HPJ A;  4PJ0 O;  3RIU C;  3RX6 A;  4X20 E;  3A0B O;  1NEK A;  3MA9 A;  4DR4 T;  4F6R C;  3N2K E;  4N59 A;  1KF6 A;  2R4N A;  2YDR A;  4C69 X;  5DJQ C;  2ZLD A;  5EK3 A;  4PJJ A;  2AXD S;  3C4W A;  4U2Z A;  3PUQ A;  4ILC A;  3P7I A;  1KNZ A;  4O4X A;  5ADX K;  2HN1 A;  2XQ5 A;  4GKJ T;  6PRN A;  3QOF A;  1HX1 B;  5IWA T;  3HA4 A;  4K3C A;  4EAH A;  1T7S A;  3NRX A;  5KDM C;  1S5L O;  3CX8 B;  4F4B A;  4BA9 A;  4BJN A;  2VVS A;  2I6H A;  2XAH B;  1KNR A;  3SZD A;  1XZY A;  5KAF O;  5FVL A;  3FBZ A;  2PRN A;  2NTX A;  4DV2 T;  4OX9 T;  1WR0 A;  3QB5 K;  4E1S A;  3K3N A;  4RJX A;  1IJ6 A;  2KWH A;  3T1H T;  3VZU X;  2R4P A;  5FMN A;  1ZHX A;  2E2A A;  2C0S A;  5HEG A;  2K5B B;  2DLR A;  4L0R A;  4H9Q C;  3OBV E;  5FVN A;  5EE2 A;  5LG4 A;  3PJA J;  3ZT7 A;  4FSP A;  2YU2 A;  4WW0 A;  4LF5 T;  4FQE A;  1UUS A;  5FNV E;  1IZN B;  2IHR 1;  5HEH A;  1H6S 1;  4EGW A;  2K48 A;  2W4X A;  2QTK A;  2J1D G;  1Q9F A;  2XE3 A;  1SHZ C;  2X9K A;  3BQL A;  4HFC A;  2W2U A;  3LSV A;  1MIY A;  4TV8 E;  5DL7 A;  3PGS A;  2JJ9 A;  3R84 B;  2PTF A;  1EZ3 A;  3ZST A;  4I4T E;  5A1L A;  4UXN B;  3ZKR A;  4ADZ A;  4KI0 F;  3RBH A;  1P4T A;  3P50 A;  2X9H A;  3I0Q A;  2KZ7 B;  1YKH B;  2V7I A;  2J4G A;  2V1D B;  2ODV A;  3CQX C;  4HFE A;  2LE8 A;  2XQ4 A;  2CHO A;  2A3D A;  4TX5 A;  4AQF C;  4C91 A;  1VCS A;  3ZJ2 A;  4UR9 A;  1BXW A;  3TKL B;  2R89 A;  2NP9 A;  1E54 A;  5AQF B;  1BT9 A;  3E0Z A;  4ZI3 D;  1Y01 A;  5LOV E;  2D0T A;  2M6I A;  1HXT A;  5LGN B;  1IBL T;  3VU7 H;  4DUZ T;  5L3E B;  4PFO A;  2Y6X A;  4H9N C;  2V26 A;  4TUY E;  5AQS B;  2LKG A;  4O2B E;  4DBR A;  1QUU A;  5LG3 A;  4CN1 A;  2DWK A;  3KV5 A;  5J0Z A;  3L8R A;  3C51 A;  4OFZ A;  4GKK T;  2EHO B;  1FMW A;  3IBP A;  3DA4 A;  2IWV A;  3KFW X;  4EOZ B;  5G26 A;  5JRE A;  2FUP A;  2WCA A;  5KMG P;  2NW8 A;  3K3O A;  2XE1 A;  3PGU A;  4JI3 T;  3VKH A;  3EUH A;  4AKR B;  2WDR A;  3HL6 A;  3IA3 A;  2WZI A;  2BG9 C;  3ONX A;  3HOL A;  3N5L A;  3SFE A;  1W0B A;  5DL6 A;  2WQY A;  2YDS A;  3BRZ A;  1CHU A;  4GCS A;  4EEB A;  3SY9 A;  3X1D A;  5H6Q B;  4YSY A;  3FBL A;  4PUX A;  4QXC B;  2LKH A;  4YFS A;  4PK5 A;  5JDL A;  2QYW A;  2R6G F;  1WCR A;  3UUB A;  5CGM A;  4YTM A;  3C5O A;  4UF0 B;  2PBI A;  1N34 T;  5JR9 B;  4TZ4 C;  1UX4 A;  4KR4 A;  2CEA A;  3DWN A;  4O3Y A;  3PGR A;  3RIU A;  5FVK A;  3PDY A;  4KX6 A;  3RLF F;  2FJE A;  3EAB A;  2FJD A;  1LVK A;  5LJM A;  2X51 A;  3PTR B;  1QJ8 A;  3VR8 A;  4AQY T;  2MBG A;  2NOX A;  3A0H O;  4GOU A;  4U7I A;  4CXY A;  2W67 A;  3PU3 A;  3LBX A;  1WYB A;  3Q5D A;  4JI2 T;  2LM9 A;  2LRK A;  3V8U A;  5ABF B;  3OJA A;  2M6B A;  1G90 A;  3DJB A;  5E79 O;  2FGR A;  1S94 A;  1O3X A;  3UUM A;  5AQJ B;  4QXH B;  3UU2 A;  2V8S V;  4LFB T;  5JRC A;  3AE9 A;  1G8X A;  2N2N A;  2D5U A;  2H88 A;  3CX6 B;  3OPC A;  4QX8 B;  4ZI3 C;  5DL5 A;  5ABE A;  1HG5 A;  5AQK B;  2YPV A;  3GN5 A;  3SS1 A;  3AEF A;  4DR1 T;  4O8S A;  4DV4 T;  3H3A A;  1OED C;  2VKO A;  1XMQ T;  4HWI B;  2YOE A;  3AXJ A;  3E22 E;  2XG6 A;  3W15 B;  5GTI O;  5FXV A;  3KBT A;  3HWB A;  4D5U A;  3JC6 D;  5ABH A;  5D5D A;  3ZN0 B;  5F5W A;  4DR2 T;  3KV9 A;  5CB4 E;  3RGL A;  3HKD E;  4DR6 T;  3DP7 A;  3NZQ A;  3SYS A;  2WVP A;  4IHJ E;  2Y48 B;  5JDM A;  1J5E T;  5HWY A;  2XE2 A;  5FXX A;  1XDP A;  4IT4 A;  5HEO A;  5AQP B;  3O4X E;  4DV1 T;  1MM5 A;  3FXE B;  2SPC A;  4YHJ A;  4LSH A;  4JI4 T;  3NWI A;  5LHI B;  1HG2 A;  3VY9 X;  4KP3 C;  1QJP A;  3DZM A;  2XHE B;  4ZI2 D;  2BS3 A;  1HNZ T;  5PRN A;  3JAF A;  2MYS A;  3P4Q A;  3J7Y q;  3VY8 X;  5LHG B;  4PR7 A;  3L3P A;  3AE7 A;  1ZHY A;  3DWO X;  5FKY A;  3TLS A;  3ZT6 A;  3UU4 A;  5AQN B;  4X64 T;  3PUV F;  2EHO D;  2X9Y A;  3LJC A;  2XE5 A;  4X5T A;  1BR0 A;  3RC3 A;  3M3Z B;  1JNZ A;  3AA0 A;  5B5E O;  4MHC A;  3AAE B;  3OYZ A;  4RLB A;  4FSO A;  1FEW A;  3N9O A;  3WI5 A;  2CPT A;  3PV0 F; 
#chains in the Genus database with same CATH homology
 1PRN A;  3VE2 A;  3ZN1 B;  2Q9Q D;  3HKB E;  1ZHC A;  3LK4 2;  4H9P C;  2HPJ A;  4DMV A;  2XTQ A;  2LJL A;  3RX6 A;  1YKE B;  4X20 E;  3O1J A;  1HF8 A;  4IE6 A;  3M65 A;  1U4Q A;  3MA9 A;  4P0B A;  3ZYK A;  1MM4 A;  3ANW A;  2BVL A;  3CQG B;  3IEE A;  4ZOL E;  4F6R C;  4U74 A;  3POQ A;  1UX5 A;  3N2K E;  4PJM A;  3ZLI A;  3P8C D;  4H63 H;  3GA8 A;  5L3B B;  4FI5 A;  3G7G A;  1D1C A;  3HR0 A;  4N59 A;  4IE0 A;  3AAA B;  4A56 A;  4C69 X;  3LK2 B;  4ILU A;  5DJQ C;  1MMA A;  2ZLD A;  4H9S E;  4XAX B;  2J1N A;  4I55 E;  3PUA A;  4O3Z A;  2M06 A;  3OYX A;  5EK3 A;  4H9O C;  3F2E A;  2WBL A;  4PK6 A;  4PJJ A;  1NAF A;  2L3L A;  3C4W A;  4ZS3 A;  4I43 B;  4RJW A;  4HFV A;  3PUQ A;  3CX7 B;  3V5U A;  2ZMA A;  2CLY B;  3KBU A;  3UT5 E;  3RYC E;  3ETU A;  4LSF A;  5JDG A;  1BR2 A;  3P7I A;  1KNZ A;  2E9X C;  5AFU K;  4O4L E;  4TV9 E;  1G73 A;  4D64 A;  4O4X A;  3QRC A;  5ADX K;  4LSI A;  2W63 A;  1THQ A;  3FYX A;  1MMG A;  4QWN B;  6PRN A;  1BR1 A;  5JDP A;  4AZL A;  1D0Z A;  4ERR A;  3HA4 A;  3ZC0 A;  1T98 A;  4EAH A;  3NRX A;  5DQV A;  3UUX B;  4OHF A;  2V7J A;  2IW5 B;  1U5P A;  1LVF A;  3JC6 C;  5KDM C;  4MLK A;  3CX8 B;  2JMH A;  4F4B A;  1SA0 E;  4CI3 B;  4BA9 A;  4GCQ A;  4AKG A;  4BJN A;  3POX A;  4AXP A;  2XAH B;  3SZD A;  4ANJ A;  1HXX A;  3LK3 A;  2I59 A;  4AQG A;  3KV4 A;  3FBZ A;  2PRN A;  2NTX A;  2X68 A;  4ISS A;  4AKM A;  2RP4 A;  3WAJ A;  4E1S A;  3K3N A;  4G75 A;  4RJX A;  2KND A;  4WBO A;  1IJ6 A;  2KWH A;  3AA6 B;  4E7S A;  3VZU X;  2WAU A;  2X9X A;  2K24 A;  5FMN A;  1ZHX A;  3ESL A;  1NWM X;  4YLH A;  2YU1 A;  4RL9 A;  3WAK A;  2ES0 A;  2C0S A;  1GFM A;  1ORM A;  4GIW A;  3MAC A;  4KRA A;  3HW9 A;  2K5B B;  1Z0P A;  2DLR A;  4UIG A;  5HYA A;  2J4U P;  4AYD C;  4L0R A;  3PQU A;  4H9Q C;  2N9D A;  3OBV E;  5FVN A;  3TZG A;  1HCI A;  5EE2 A;  5LG4 A;  2CLY C;  4O4U A;  4Z3T A;  1FMV A;  4GK0 E;  4FSP A;  3C4Z A;  2YU2 A;  4WW0 A;  4ZI2 C;  3O9X A;  4X1Y E;  5FNV E;  4QXB B;  2JMK A;  4QHO A;  4MFR A;  5LGU B;  4O3X B;  4PAG A;  3UAQ A;  4EYY R;  1IZN B;  4C90 A;  4JCH A;  1WYC A;  4XBF B;  4D65 A;  2CXL A;  3AA0 B;  5DAB A;  5LYJ E;  2ZM0 A;  2VB6 A;  1ZEE A;  3LBX B;  1H6S 1;  5LGT B;  2Y0H A;  5J1G A;  1MMD A;  5HXE A;  2Q9Q A;  2DCF A;  2K48 A;  5HAX A;  2MHL A;  2PG8 A;  3WI3 A;  3ZMS B;  2QTK A;  2J1D G;  1Q9F A;  2VL8 A;  5HWX A;  4IE4 A;  2XE3 A;  3K19 A;  1SHZ C;  2OA5 A;  3BK9 A;  3BQL A;  2EHO C;  3QRA A;  5JDH A;  1MIY A;  4TV8 E;  5DL7 A;  4FJO A;  4HE8 A;  4CQI A;  4ZI7 E;  2JJ9 A;  5FXZ A;  3R84 B;  2NTY A;  2CXF A;  3CQC B;  5L3C B;  4DBQ A;  3A2S X;  2VAS A;  2X9W A;  2E9X B;  1EZ3 A;  3F57 A;  4CI2 B;  4H63 V;  4UVC B;  4I4T E;  2ODU A;  3KVA A;  5A1L A;  4GYR A;  2X66 A;  3AVR A;  2LSG A;  4UXN B;  2ZLY A;  2B1E A;  1MND A;  3RH3 A;  3ZEF B;  3KVD D;  4ADZ A;  2UXN B;  3C64 A;  3O1H A;  4FRX A;  4N58 A;  3RYI E;  2N2L A;  4P09 A;  3A5X A;  2W61 A;  5L3G B;  3RBH A;  1WRD A;  1P4T A;  4HN9 A;  2IAK A;  3CKD A;  3RKO A;  2X9H A;  3K3Q C;  3I0Q A;  2KZ7 B;  4P0A A;  4QQ1 A;  3EVY A;  1YKH B;  2LHR A;  2V7I A;  3N9N A;  4NUV A;  2A2F X;  4X1I E;  2KC0 A;  3NSG A;  4HGA A;  4O2A E;  2V1D B;  3I0O A;  3QC9 A;  2Y2X A;  3L09 A;  2ODV A;  3CQX C;  2LE8 A;  3N9P A;  2NWB A;  4OK0 A;  4EZ4 A;  2A3D A;  2ZM8 A;  3AAE A;  4TX5 A;  4AQF C;  4C91 A;  3AA1 A;  5T5F A;  5JDN A;  5L2L A;  2KMF A;  4JLE A;  3GN5 B;  3NZP A;  4BAY B;  3ZJ2 A;  4FES A;  2P9B A;  4UVA B;  5IHY A;  3ZMZ B;  2K4T A;  1BXW A;  3TKL B;  1IAP A;  2YK0 A;  5F3J A;  2NP9 A;  5EK4 A;  3I9Y A;  2XUE A;  4Z8X A;  5FP3 A;  1E54 A;  2MTQ A;  3PUR A;  4E7Z A;  4UV8 B;  1BT9 A;  3E0Z A;  4ZI3 D;  3Q9D A;  5FXW A;  5IYU A;  2JPF A;  4BJM A;  3AA7 A;  3UFE A;  4O3W A;  5LOV E;  2VWA A;  4FZM A;  3KVB A;  2D0T A;  2L8K A;  3E08 A;  1HXT A;  4IIJ E;  5LGN B;  3VZT X;  2IC9 A;  5IYZ E;  2CCQ A;  2MNH A;  3VU7 H;  5CA1 E;  2W62 A;  2H3R A;  1YD8 G;  4OYJ A;  2KIN B;  1MIW A;  5L3E B;  4PFO A;  2Y6X A;  4H9N C;  2V26 A;  2OMF A;  1BR4 A;  2XTR A;  1WLX A;  4TUY E;  3CML A;  4O49 A;  4DBR A;  4O2B E;  1CUN A;  4YJ2 E;  2BDE A;  2LOP A;  3SYB A;  1QUU A;  4PNI A;  3SRZ A;  1MPF A;  3AAA A;  5LXT E;  5GV0 A;  2DWK A;  4AKL A;  5ETW A;  1QJ9 A;  2DI4 A;  2E8I A;  3B57 A;  3KV5 A;  4U72 A;  3EMN X;  3N2G E;  5DL8 A;  5E0O A;  2V7K A;  5F8P A;  3C51 A;  3DA3 A;  3EDV A;  3ZPO A;  4CI1 B;  2JQQ A;  3UUL A;  1GFP A;  3ETV A;  3PUS A;  4OFZ A;  5JDQ A;  1HTJ F;  5JVD E;  2EHO B;  1FMW A;  3KIN B;  3IBP A;  5FY7 A;  2Y0L A;  2WM9 A;  2Z6E A;  3DA4 A;  2UXX B;  4GHB A;  3OKQ A;  3KFW X;  4PJN A;  4EOZ B;  4V1A v;  5TAO A;  5G26 A;  3N2O A;  4PFP A;  1E1H B;  3AAI A;  1D0Y A;  5JRE A;  4EXT A;  2HH7 A;  4WBN E;  3PRN A;  4AKH A;  4MAL A;  3BQK A;  2NW8 A;  5KMG P;  2W81 C;  2ACX A;  2WWU A;  3K3O A;  3N9Q A;  4AI6 A;  4UVB B;  2XE1 A;  3GP6 A;  2IC6 A;  1D0X A;  3AVS A;  3U3I A;  2LSY A;  4HEA A;  1HX8 A;  2L9Q A;  4O4H E;  4IDZ A;  2QGS A;  3EUH A;  5L3F B;  3EDU A;  5LCY A;  3VKH A;  2KXP A;  3PQS A;  1US7 B;  4KR8 A;  3SZV A;  4AKR B;  3PU8 A;  4FRT A;  3HL6 A;  2YIN A;  3C4X A;  3ONX A;  3HOL A;  3RYH E;  1BH3 A;  3N5L A;  1IJ5 A;  2C5J A;  2LOS A;  4ZS2 A;  5DL6 A;  3LK4 1;  3R6N A;  2XTL A;  1MMN A;  3AB3 B;  5LA6 E;  1FIO A;  4AYI D;  4FT6 A;  3ZC1 A;  5FY1 A;  1OPF A;  2Q9Q B;  2H7V C;  3SY7 A;  4GCS A;  3K8P C;  4GF4 A;  2RA1 A;  3SY9 A;  3VHL A;  5H6Q B;  3AA6 A;  3FBL A;  5AFU L;  1Q9G A;  2XAQ B;  4EYU A;  4QXC B;  2F1T A;  2FGQ X;  4PUX A;  2VKD A;  4PJL A;  4YFS A;  3S4U A;  5ADX L;  4XNK A;  4AYM C;  4PK5 A;  5JDL A;  4KUM B;  3U78 A;  5HXS A;  4FZL A;  4DND A;  3C5O A;  4UF0 B;  2PBI A;  5JR9 B;  4FOZ A;  4KMC A;  2WSS V;  4TZ4 C;  3DTO A;  4FZN A;  2DNX A;  1UX4 A;  4N78 D;  4KR4 A;  4AUI A;  2CEA A;  2PFV A;  4O3Y A;  3LG7 A;  4L5G A;  5FYM A;  2WMO A;  1HFA A;  2POR A;  3PDY A;  3KDS E;  2CM0 A;  4M1P A;  3PUG A;  3ZMV B;  1UCU A;  1LVK A;  2N1G A;  5LJM A;  2X51 A;  3PTR B;  3HOE A;  3ZMU B;  8PRN A;  1QJ8 A;  4JEH B;  1IZN A;  4KBM B;  4AQF A;  2NW7 A;  1ZV4 X;  4WNK A;  3V5S A;  5KX5 E;  4O4J E;  3B13 A;  2ERV A;  2BVM A;  2MBG A;  3SOL A;  2G0U A;  2VKJ A;  2NOX A;  3ANW B;  3CVR A;  4GOU A;  1ZKE A;  4CXY A;  3PU3 A;  3ZCJ A;  3RRC A;  4DMW A;  3LBX A;  4CXW A;  1GFN A;  3POR A;  1WYB A;  3Q5W A;  4B61 A;  2O4V A;  4JUY A;  2XAJ B;  5LBQ B;  2LM9 A;  2H7O A;  4O4I E;  4XZC A;  5M4Y A;  3V8U A;  3CPZ A;  3RPU A;  3J9X 1;  5J2U E;  3T20 A;  2D2S A;  2Q9Q C;  1OWA A;  3OJA A;  1G90 A;  3DJB A;  4UEL A;  3RC8 A;  3HI2 A;  3ZJ1 A;  2FGR A;  2W0G A;  2GE4 A;  3C50 A;  1S94 A;  4DVD A;  2ODJ A;  2KWI B;  2X0L B;  2DWG A;  1YS5 A;  2K9A A;  3FB2 A;  4FMS A;  4G76 A;  1VOM A;  2E9X A;  5LJN A;  1O3X A;  3UUM A;  4TN7 B;  2V7L A;  1YW0 A;  1WR6 A;  4QXH B;  3UU2 A;  2M07 A;  3O1I A;  4HKA A;  2JMM A;  4J2C A;  2F1V A;  4EZH A;  5JRC A;  4CZZ B;  2C5I T;  4NUU A;  5JR9 C;  1G8X A;  1QSD A;  3IF8 B;  3ZYL A;  2N2N A;  2D5U A;  2LEH A;  1AJ3 A;  3CX6 B;  2KZ7 A;  3MJX A;  4QX8 B;  2ZM2 A;  4ZI3 C;  3MZK B;  5DL5 A;  4AKI A;  3QK6 A;  2LSJ A;  3FHN A;  3H37 A;  4DO0 A;  4JFB A;  1D1B A;  1HG5 A;  1HS7 A;  1B7T A;  5JDF A;  2YPV A;  1H7C A;  2E9X D;  5EZY E;  5H6R B;  3GN5 A;  3SS1 A;  2GK9 A;  4O8S A;  3H3A A;  4CXX A;  1GFO A;  3LK3 B;  3IHR A;  2Y0K A;  3LK2 A;  2XAS B;  2VKO A;  2CWY A;  2KT9 A;  3O0E A;  1LRZ A;  1OSM A;  5DQW A;  2XG6 A;  3E22 E;  4GK5 E;  1ZHT A;  1S35 A;  3W15 B;  5JH7 E;  3T8O A;  5FXV A;  3MXZ A;  4X1K E;  3KBT A;  4YJ3 E;  5HXC A;  1ZHZ A;  3HWB A;  4D5U A;  3JC6 D;  2LSI A;  4G2A A;  4G63 A;  4LSE A;  3ZN0 B;  5D5D A;  5EK2 A;  3SWH A;  5LP6 E;  1VRB A;  2N2M A;  3WI4 A;  3PE0 A;  3KV9 A;  4GYS A;  3N9L A;  5LBM A;  5CB4 E;  2QA7 A;  3HKD E;  2Y8D A;  3HKC E;  4JEU B;  2KXP B;  3DP7 A;  3N9M A;  3NZQ A;  4I50 E;  5HXH A;  3SYS A;  3CWZ B;  4IHJ E;  2Y48 B;  5JDM A;  2BZB A;  3BQI A;  2CE7 A;  3LFM A;  2V7M A;  4L9I A;  5HWY A;  2XE2 A;  3T24 A;  3MK7 C;  4OYK A;  3D0T A;  5FXX A;  2XQY A;  4RLC A;  2C5K T;  4XNL A;  3ZMT B;  2K0L A;  2YEV C;  3MKD A;  3GWH A;  3O4X E;  2VKH A;  1MM5 A;  2KDY A;  2KLQ A;  1X79 A;  3FXE B;  2YNK A;  2SPC A;  4YHJ A;  5LHH B;  4LSH A;  4AFK A;  4GCP A;  2NW9 A;  4UV9 B;  2LHF A;  4BUM X;  7PRN A;  5LHI B;  2EHO A;  1HG2 A;  3VY9 X;  4KP3 C;  1QJP A;  2X67 A;  2XHE B;  4IE7 A;  4ZI2 D;  1HXU A;  2DHR A;  5PRN A;  2CA5 A;  3I9W A;  4PW8 A;  2MYS A;  3UUN A;  5BMV E;  2PJQ A;  2XAG B;  2JRK A;  3J7Y q;  3VY8 X;  3VKG A;  2WMN A;  5LHG B;  3L3P A;  2W80 C;  3UTK A;  4QKN A;  1ZHY A;  1OXZ A;  4EIW A;  1KK7 A;  4IST A;  4ZHQ E;  2A72 A;  3C98 B;  4UEM A;  1PHO A;  5L3D B;  1V9D A;  1ZHW A;  3UPG A;  2LT3 A;  3JTY A;  5FY0 A;  3ZYM A;  2M67 A;  4AKR A;  1MIV A;  5HXR A;  3FXD B;  2CWO A;  3RRW A;  5GON E;  4EB6 E;  2X27 X;  2EHO D;  2XAF B;  2CXD A;  2Y7S A;  3POU A;  2HPL A;  2LHN A;  2X9Y A;  1GFQ A;  3LJC A;  2XE5 A;  5J2T E;  3RYF E;  2ZFG A;  4H9R C;  4FUV A;  3VZW X;  4AYE C;  4U9C A;  3HKE E;  1BR0 A;  3RC3 A;  4ASK A;  5CA0 E;  5LNK A;  2VK9 A;  3Q2M A;  3NRY A;  4AYN A;  3AA0 A;  3Q5X A;  4HTE A;  4PK4 A;  2MOZ A;  3AAE B;  3AA1 B;  3OYZ A;  4IGU A;  4MHC A;  2XMX A;  4B6X A;  4RLB A;  1D1A A;  2LSK A;  2W00 A;  3I1A A;  4IE5 A;  5JQG E;  4FSO A;  1FEW A;  2LFU A;  1LKX A;  4E1T A;  2CMR A;  4UF0 A;  4QX7 B;  3NBX X;  3QUJ A;  3GMI A;  3KV6 A;  5JR9 A;  3ZCI A;  3VE1 A;  1Y64 B;  3N9O A;  3WI5 A;  5C8Y E;  1MNE A;  3T0S A;  3AA7 B;  2D0U A;  5JRC B;  4MBQ A;  4K0U A;  3F31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...