5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
3LK3A 3LK3B 3AA0B 2KXPA 3AA1B 5AFUK 3AA1A 3AAAA 3LK2A 3LK41 3AA0A 3AA7A 3AA7B 2KXPB 1IZNB 5AFUL 4AKRA 3AAEB 2KZ7B 3AA6A 2KZ7A 3AA6B 5ADXL 3AAEA 3LK42 4AKRB 1IZNA 3AAAB 3LK2B 5ADXK
chains in the Genus database with same CATH superfamily
3A2SX 4XNLA 4IDNA 5CA1E 2IUBA 4FUVA 2LT3A 2YDSA 5AQVB 5AQGB 3HKEE 3LDQB 3UU4A 3DTOA 3JAEA 2YNKA 2KSRA 1Z8UA 2W62A 3P8CD 3WI4A 3V5SA 3FZLB 5FXXA 3EAMA 2IAKA 2LSIA 3CQGB 5AQLB 3ZC1A 5AQQB 4GIWA 3FHNA 2CXLA 2C5IT 2WMOA 3A0BO 4JI1T 2XAJB 5HCJA 1O3XA 3PQSA 3L09A 2D0TA 5LGTB 3WU2O 5H6QB 3I9YA 1BH3A 1FJGT 4DR2T 4GK5E 1N33T 2DHRA 4I50E 1PRNA 2X67A 2NR4A 4GOUA 2NTXA 4DV2T 4UVAB 3K1SA 4PFPA 3GMIA 4IL6O 4AYEC 2HH7A 3JTYA 2BVLA 3UU5A 3UT5E 4KI0F 2UUBT 4AQFA 1QJ8A 4NUUA 4HN9A 1FMVA 3K3NA 2IIUA 2ERVA 2LM9A 3ZMZB 3RIAA 5IWAT 2VQET 1ZEEA 3T20A 4QX7B 5KXJA 5LXTE 3H37A 3ZT6A 2X9KA 4GYRA 3QK6A 4P0AA 3C98B 2WS3A 3CPZA 2H88A 4X5TA 2MPKA 2LLYA 5AQKB 4U2YA 2X51A 1U5PA 2QVAA 3WI5A 2LOPA 4UR9A 2XZEA 5HEGA 3UQ4A 4U74A 1Y64B 4U3CA 4H9OC 1MM4A 3TLUA 4EXTA 3PJAJ 5F8PA 1HXXA 3RRCA 4IDQA 3P50A 4TX5A 1XMOT 4FZNA 2LHFA 1MMGA 1H7CA 4UELA 3AA6A 2EHOB 5FVNA 3FZKB 4FSPA 1D0ZA 3AE1A 2D5UA 4Q25A 2LKHA 2JMHA 3ZMVB 4F6RC 4JI3T 4N59A 3ZYMA 2N2MA 5HXRA 4GCPA 4G76A 4IDOA 5AQMB 4O4IE 4AYNA 2N2LA 4CQIA 4B3TT 4AKLA 2YKSA 2AXTO 2K9AA 1ZHCA 1Q9FA 3VR8A 3RGLA 4FRTA 1XNQT 1OEDA 2ZM0A 2HHHT 4DUYT 2XQ3A 2XSBA 1UURA 5DQVA 5LG3A 1B7TA 4FZLA 4KR8A 4FI5A 2WZHA 4JUYA 3A0HO 2R4NA 1KNRA 2BG9C 4P1NA 4RLCA 5B5EO 3SYBA 3LK3B 2LSKA 3ESLA 2LOSA 4NUVA 3T8OA 5LHGB 4OYJA 1KNPA 4IREA 4EYYR 3AA6B 5LHIB 4UXNB 4YJ3E 1IZNA 3B13A 5LYJE 3RLFF 4CXXA 5BMVE 3AECA 3JCUO 5FXWA 2V5CA 1S94A 2CM0A 2QYWA 3AA1B 4K3BA 3OKQA 2KT9A 2VL0A 4YXDA 4D5UA 3CQCB 4DR7T 3T1YT 2BVMA 3PDYA 3AVRA 2PTFA 4X65T 2WU5A 3HL6A 4V1Av 3ZJ2A 3LSVA 2KXPA 1ZHYA 2DWGA 2MYSA 5FVKA 4A98A 3SZDA 3PJAA 3SWHA 1H6S1 1YD8G 3GA8A 3AAEB 4NXNT 2LSJA 2YDRA 4X1YE 1G73A 4PK6A 3DA3A 4HFCA 3PUYF 1CUNA 3HR0A 3DJBA 5DL7A 4LF7T 1VCSA 3N2GE 2XAGB 4PJJA 4JFBA 4O4LE 3RI5A 5L4EA 3K8PC 4K0KT 3AEBA 4ISTA 4O49A 2FGQX 4JV5T 3TZGA 5AQIB 3NJTA 2WMNA 1Y01A 3UPGA 5AQTB 5AQJB 2N1GA 4BA9A 4YSZA 1XMQT 2XQAA 1VRBA 3GWHA 4HFIA 5L4HA 5C2TA 2ZM8A 2WU2A 3RKOA 2L8KA 4I43B 2N9DA 2W67A 4DO0A 3KV4A 3KFWX 2UXCT 4DMWA 3PV0F 3PUZF 3NWIA 1OEDC 3VY8X 3ZPOA 2CWOA 3AE7A 1S35A 2ZM6T 1YXRA 5DL8A 3SFDA 4EZ4A 2KWHA 3RKGA 5LP6E 5CGMA 1UCUA 1MIWA 4MBQA 3R6NA 2M6BA 2ACXA 2VASA 1N36T 1X79A 1EZ3A 7PRNA 3SOLA 2E5LT 2VURA 4FSOA 2CLYB 4DBQA 3RX6A 4H9SE 4NXMT 3PGSA 2GK9A 3FB2A 3HA4A 4IIJE 4BAYB 4UIGA 3OJAA 1KNZA 1YKHB 3HI2A 1G8XA 4PW8A 3AE5A 3A5XA 2VB6A 4TUYE 4C4VB 3ZYLA 5J1GA 4IL4A 4DV5T 2YDQA 2JQYA 4YSXA 4LFCT 1D1BA 4FT6A 3JAFA 2IW5B 1J5WA 1L0VA 2BG9B 4I0UA 5JRCA 1N32T 1MMAA 4LF8T 3PQUA 4HWDA 3OPCA 3VE2A 4C00A 2IWWA 3J9X1 4LSIA 3PUAA 4PR7A 2YK0A 5HXSA 3QC9A 1HX1B 2JMKA 3AA0A 4O4XA 4QHOA 3KINB 2CHOA 1Z0PA 5G3AA 1G90A 2BBHA 4IE5A 2JIWA 5HYAA 2IMLA 5AQNB 2Y0LA 1J5ET 4COFA 3FXEB 4O2AE 4YT0A 3BK9A 1OXZA 1ZOYA 4UB8O 2X0LB 2DCFA 1NENA 2C5JA 5JDFA 2FJEA 3TLVA 5C8YE 4I55E 4C4VA 2I0MA 2YINA 5AQUB 3RHWA 3N2OA 5HEOA 4U2ZA 3ZKRA 5LCYA 4ZEYA 5JDMA 4DR4T 4D64A 3OYXA 3PUQA 4RL9A 3AEDA 3HKBE 4KUMB 4PK4A 3F57A 4TWFA 3VZWX 1PHOA 2D0UA 2NWBA 4U31A 4KRAA 3RBHA 3NKZA 4QQ1A 4KR4A 4FQEA 3LK42 3JC6D 5JR9C 3CQXC 2V7IA 4QH5A 3AE6A 4O4UA 4IE7A 2F4VT 2X66A 4Z8XA 3MACA 4RJWA 2V7JA 3JADA 5AQOB 2BS4A 3PGUA 4LMLA 5KAFO 3AXJA 2V8SV 1HFAA 5LGNB 2QA7A 5JVDE 1HNZT 1BR0A 3O1HA 2OA5A 5FY7A 2VVSA 2XUEA 2LSGA 1XDPA 3PTRB 1WRDA 4ZOLE 3EDVA 4AUIA 3UUMA 2Q9QA 1US7B 3O1IA 4UF0B 3JC6C 2CXDA 4O4HE 5CA0E 2E9XC 2DI4A 3AE4A 3HKCE 2H89A 5L3BB 3ZMTB 4XNKA 5HXEA 4HKAA 2CE7A 3BRZA 4F8HA 3NSGA 3RH3A 3T24A 2YEVC 2IWVA 2CMRA 1V9DA 5PRNA 3DWOX 2M06A 2NW9A 2VL8A 3AEEA 3IHRA 2V6YB 2Y0KA 1ZHZA 4A97A 3AEFA 3Q9DA 4M1PA 5LMNT 2E2AA 3O1JA 3PGRA 3EHZA 1WR0A 4UVBB 3SFEA 3BQKA 3LK2A 2KXPB 4MFRA 1FEWA 1SHZC 2CLYC 4DUZT 1SA0E 3KZIO 2QTKA 2J62A 1I94T 5GV0A 5FXZA 3AAAB 1FMWA 2ACZA 1E54A 4OK0A 3M3ZB 5ADXK 2PFVA 1BR2A 4JI5T 3PU8A 2R4PA 2X9HA 1SUMB 4DR5T 5AFUK 4OHFA 4DIDB 2WZIA 1VOMA 3CKDA 2K0LA 3F31A 3PUXF 5CFBA 3PORA 5JTGA 4DR6T 4E1TA 4ZS2A 4DV4T 2JJ9A 5HXHA 4C69X 5GTHO 3VRAA 5EK3A 4EB6E 5HWYA 5AQFB 1KEYA 3H3AA 2CHNA 4LMKA 3N5LA 2XE3A 4B3ST 4QXCB 4AKIA 2WDRA 4KX6A 2K5BB 4UEMA 1YQ4A 3GN5A 2JPFA 3LG7A 3A8YC 2ZM2A 3RF1A 2Y2XA 3CX7B 3N9PA 4AI6A 4KMCA 2FJBA 3VHLA 4JI6T 3U78A 2W80C 1OEDE 2BS2A 4HWCA 3TLWA 2BKNA 4N78D 5L3DB 4TN7B 1QJ9A 4FESA 3CX8B 2W2UA 5LB7B 1R8IA 2R6GF 3RYHE 4H9QC 3AEGA 2KMFA 3RRWA 2Y8DA 2FGRA 4QH1A 5DABA 3P4WA 2X9WA 1D0YA 2KC0A 1SE7A 4AKMA 3KV5A 3L8RA 4ZZCA 4WZXA 4O4JE 5JR9B 4N58A 4ZI3C 5F5WA 3B5MA 2Z6EA 3EI0A 4IE6A 4ANJA 5C3JA 2R89A 2XTRA 3PF1A 3CMLA 3M65A 3ZLIA 1CHUA 2BKPA 4O8SA 4U7YA 4H9NC 5IUXA 4TZ4C 1JNRA 4IGUA 2HN1A 2XQ5A 3FZFB 3ZN1B 2BS3A 4PAGA 4OX9T 1MIVA 3POUA 3ONJA 2ZLDA 1HCIA 2XE5A 3FZHB 5LMUT 4DV3T 1HR0T 4DNDA 3RQWA 2MOZA 4FZMA 2A72A 1MNDA 2VWAA 4QXBB 3C4XA 5HEJA 3A7MA 3MK7C 5HXCA 2XHEB 5HEHA 3RYIE 2XTQA 2BZBA 5JDQA 2J1DG 2LKGA 1MMNA 4FJOA 3KV6A 3ONLC 3RIUA 3ZMSB 4TV8E 2IHR1 2XTLA 3SS1A 2J1NA 4JI2T 2WSSV 1ZHXA 5CJ5A 3C4ZA 4YTMA 3G7GA 1ZHWA 2E8IA 3ZC0A 2MNHA 4LFBT 3N2KE 3VZUX 5E0OA 2I6HA 4IHJE 1IJ6A 3P4QA 2W00A 4QWNB 2H7OA 2MHLA 4Z91A 4JI8T 1HXTA 3C50A 4HWHA 3N9OA 2LRKA 1JNZA 4Z90A 5CB4E 2KWIB 1KFYA 5L47A 3AE3A 2KDYA 2D2SA 1THQA 5AQPB 2OV9A 4LF9T 1XDOA 2GE4A 3Q5XA 3ZSSA 4AISA 5KDMC 4JBWF 3FBLA 4AQYT 2PBIA 5FL1A 4EZHA 1UK5A 4U9CA 4A56A 2R88A 3WAKA 3AXJB 3BS0A 3SY7A 3OVUA 4CN4A 2D9DA 3FXDB 4H63H 3UU6A 4G63A 2W63A 4DMVA 2V6XA 3QRAA 3GP6A 3KVDD 4AQFC 5AQHB 2XAHB 4AYID 4DV0T 3KVBA 2NW8A 1IBKT 4UB6O 3DWNA 1NWMX 1LVFA 2Y48B 4ZZBA 1HF8A 2ODJA 3RPUA 1BR4A 2K4TA 2SPCA 4HWFA 3P4PA 4AYDC 4YHHT 2XASB 1D1CA 4P09A 5EZYE 2XE2A 3WAJA 4GHBA 3VRBA 4CXWA 3VE1A 5JDGA 2MAWA 3E22E 1ZKEA 5L3GB 3I0QA 4X64T 4WBNE 2K48A 2VKJA 1HX8A 4P0BA 4AFKA 2KZ7B 3FZMB 5FKYA 2R8AA 3ZJ1A 5TISO 2WJRA 2ODVA 2M6IA 4EV6A 5T5FA 2FJAA 2XE1A 5JDLA 3N9MA 4O3YA 4HWIB 1P4TA 4B3MT 2KNDA 5L3EB 3V8UA 4CN6A 4D65A 4O2BE 4AXPA 1HG2A 4X66T 3CIRA 4HFHA 2VKOA 3V5UA 3RC8A 4LSEA 1ORMA 3K19A 3AAEA 3KV9A 2BG9E 2W66A 2X0HA 5JRCB 3P7IA 3UU8A 4Z3TA 3PUSA 3AEAA 5GONE 3CWZB 3OYZA 1YKEB 4K3CA 4ASKA 1LVKA 2FUPA 4JYAT 2JMMA 3ZYKA 1N34T 2J47A 4HFDA 3P4RA 2BG9A 1GFQA 4ZI3D 1Q9GA 2XMXA 3RQUA 3O9XA 3CX6B 2UXXB 4JEUB 3LK3A 3KVAA 2XQ8A 2JRKA 3IEEA 3OTOT 3P4SA 1GFNA 3LBXB 4GKKT 3AA7B 1WLXA 4WBOA 2O4VA 3NBXX 1MM5A 3UFEA 2E5VA 3BRYA 3MA9A 2J4GA 1XZYA 5ABEA 2CRBA 2XM2A 5ABHA 5HWXA 3DA4A 4J2CA 2M67A 4JI7T 4E1SA 3QRCA 4DV7T 1D1AA 5ABGA 2K3WA 4BUMX 1T7SA 2WBLA 2X27X 4UV9B 1LKXA 4UV8B 5HCMA 5BR8T 5EE2A 3VKGA 5B66O 1YS5A 2JQHA 2E9XA 3EVYA 3ZT7A 2W81C 4IL9A 4A5XA 3QNUA 3X1DA 3Q5EA 4TNWA 1AJ3A 2CXFA 2VVNA 3O4XE 5LJMA 3UUNA 2A3DA 2VKDA 4AKRB 1XWMA 3AAIA 4KBMB 3ZN0B 4LF5T 2RA1A 2WQYA 3RC3A 3S4UA 3ZCJA 2F1CX 4PNIA 3KDSE 4IDZA 2WDQA 5G38A 2VQFT 1UX5A 3UFGA 4JCHA 2YOEA 5HEUA 3LBXA 4BJNA 4PUXA 2WDVA 4O3ZA 5IYZE 2M07A 3AB3B 4EGWA 2V7MA 1ZV4X 1XNRT 1UUSA 1HTJF 3HOLA 3VU7H 2I59A 3MZKB 3QUJA 3BQLA 4ISSA 5TAOA 4RJXA 4RLBA 3AA7A 3SZVA 1KF6A 5FNVE 4FOZA 4HTEA 5FVLA 4DR1T 2OLTA 4FRXA 1W0BA 4BJMA 2CA5A 3FYXA 2QRXA 1U4QA 2WWVA 2XQ7A 1HXUA 2EHOD 5AQSB 2BDEA 2UXDT 1WFDA 1IZNB 4LSFA 2R4LA 2V5DA 2X68A 4JI0T 2YU2A 4XAXB 3IF8B 2L3LA 2PORA 1HNWT 3IA3A 2CPTA 2LM2A 5KAIO 1T1LA 3E0ZA 5FXVA 5F3JA 4CN1A 4EOZB 4O3XB 3VY9X 2LFUA 2N2NA 2Q9QC 3TLTA 3W15B 1MNEA 2PG8A 3PUGA 3CK6A 4EIWA 3VKHA 1M7KA 5LA6E 2JQQA 5LOVE 2IC9A 2UXBT 4PJMA 1OEDB 5ABFB 2OMFA 1E7PA 4ILUA 3UULA 2UUAT 3NZPA 5LNKA 5E79O 3UU3A 1KK7A 2WVPA 4HGAA 2QGSA 3F2EA 5AFUL 3POQA 4B61A 4G75A 4ZHQE 2C0SA 3B57A 3MKDA 4IE4A 3K3QC 3MJXA 2UU9T 4OYKA 4XBFB 4LFAT 2NW7A 4GK0E 2DLRA 2PRNA 3PURA 4PFOA 2LEHA 1WYBA 5G26A 3EDUA 1E2AA 2AE9A 2Y0HA 4LSHA 5H2FO 4YTNA 2HPLA 2WCAA 4MALA 5EK2A 2HPJA 1OSMA 2Y7SA 4CI3B 2YPVA 4YJ2E 4QXHB 1I6ZA 3AA0B 4KP3C 4MLKA 5JH7E 1GQEA 4LF6T 3HW9A 2RPAA 4IDPA 4KHZF 3LFMA 2IC6A 1BXWA 2NOXA 3G06A 4L5GA 1QLBA 2P9BA 3ZT5A 4AQGA 4AZLA 3ZMUB 1BT9A 2HN2A 4XZCA 5KMGP 5JDPA 4I4TE 2ES0A 4X1KE 3UUXB 3SRZA 3KBUA 4ZXLA 4ZI2D 1X9BA 2KZ7A 1MMDA 2VKHA 3LJCA 4B3RT 2W61A 4N75A 5LJNA 1MPFA 5LG4A 3J7Yq 4PJLA 3UUBA 4CI2B 4YY3T 1LRZA 2LE8A 5DL5A 1J1JA 3MXZA 5FMNA 3SYSA 4GKJT 4O3WA 5JDHA 2XSAA 4GYSA 2F1TA 3LK2B 3SY9A 4AIUA 1T72A 3H3MA 2XPKA 5GTIO 5H6RB 3I0OA 3L3PA 1HNXT 4HFVA 3UAQA 3ETUA 3QB5K 5JQGE 4C91A 2CCQA 2YN6A 2XQ6A 3UU2A 1T98A 2NP9A 4TWDA 3HKDE 4F4BA 8PRNA 2X9YA 2CBIA 2IDOB 1IAPA 1QJPA 4HFEA 1WYCA 3OBVE 3RYFE 1M62A 3AE2A 4AYMC 2JQKA 4UF0A 3UTKA 2UXNB 1FIOA 5L3CB 2R4OA 3DP7A 4U7IA 3VR9A 1W0AA 5ABFA 4IT4A 3IBPA 2K24A 1ZHTA 4HEAA 5FL0A 3ZSTA 1YQ3A 5IHYA 2WJQA 4JEHB 4YTPA 1W09A 3E08A 2F1VA 4DV1T 3T1HT 3NVOA 4GCSA 4WW0A 5DL6A 2LJLA 5FY0A 2G0UA 4TV9E 3KBTA 4NIQA 4FMSA 3EMNX 5L2LA 2XJ7A 4L9IA 2H3RA 3U3IA 3K3OA 1IBMT 4LMJA 3TKLB 2EHOC 2XAQB 1NEKA 2MBGA 1WCRA 2MTQA 2A9UA 3ANWB 4TWHA 4AKGA 1IJ5A 3GN5B 4ILBA 4ZS3A 5JDNA 3C4WA 2LRLA 4DBRA 2XY8B 3AAAA 2WAUA 4HFBA 4U33A 1D0XA 4HE8A 4YLHA 1WR6A 4ADZA 2ZLYA 2XQ9A 2WB5A 1NAFA 4X1IE 2RP4A 3POXA 4EAHA 4LF4T 2ZFGA 4EEBA 2CBJA 2DL1A 3RIUC 5A1LA 2ODUA 1GFMA 2CEAA 5D5DA 4JLEA 4YSYA 4MHCA 3I1AA 2WWUA 4U72A 4CZZB 2FJDA 1QUUA 1IBLT 1T8BA 5LBMA 2FBWA 3PRNA 4B6XA 4K0UA 1E1HB 2XM1A 3ANWA 1UX4A 4DVDA 3O0EA 2J4UP 3Q5DA 4X20E 5FY1A 2JQ9A 2LSYA 3C51A 2A2FX 1BR1A 2BKOA 3C5OA 2XG6A 2L9QA 2X0YA 5J2UE 3AE8A 3PU3A 4WNKA 4DR3T 2V7LA 2CWYA 5LBQB 4G2AA 2XQYA 2Y6XA 4YHJA 5J2TE 3T0SA 4PK5A 4NPPA 2B76A 1UGOA 5KX5E 3D0TA 4CXYA 1OWAA 2YU1A 3JCFA 3VZTX 2DWKA 3EABA 4E7ZA 1S5LO 4TNVA 1YW0A 2KINB 2V26A 2NTYA 1W9RA 4AKRA 2Q9QD 4OFZA 3ZEFB 2XQ4A 3I9WA 4ERRA 4EEDA 5ADXL 3RIFA 2E9XD 3PUWF 4DV6T 2WP9A 3L39A 4CTDA 1HG5A 4N74A 2ZMAA 4PJNA 2Q9QB 4QX8B 2WM9A 4X62T 2KLQA 4AKHA 4C90A 2UUCT 4ILAA 5G39A 4UVCB 2E9XB 2V1DB 2B1EA 5J0ZA 5M4YA 3RYCE 2LHRA 3Q5WA 3HOEA 3AE9A 6PRNA 5LGUB 1DU2A 4JI4T 2AXDS 3N9NA 2DNXA 1OPFA 4ILCA 3AA1A 5FYMA 5DQWA 1GFPA 2EHOA 5AQRB 5EK4A 4QKNA 2W0GA 2XAFB 5ETWA 4KHPT 4CI1B 3PUVF 3BQIA 3CVRA 4WYVA 3NRYA 2V7KA 1HS7A 3UQ7A 3HWBA 4PJ0O 1VCTA 2V6YA 2W4XA 3DZMA 5IYUA 4YFSA 5JREA 5DJQC 3ETVA 2BBJA 4L0RA 3PE0A 3TLSA 3QOFA 3C64A 3R84B 5FP3A 3ZCIA 3ONXA 4QH4A 2C5KT 3NZQA 4GCQA 3NRXA 5HAXA 3LK41 4EYUA 2PJQA 4ZI2C 3N9LA 5LHHB 1T16A 4E7SA 5L3FB 4H9RC 3FBZA 1QSDA 3AVSA 2WY2A 2X9XA 1GFOA 3Q2MA 3EUHA 4ZI7E 4IE0A 4GF4A 2VK9A 2H7VC 1ZP0A 3WI3A 2LHNA 4H63V 3ABVA 3QB5A 1MIYA 3N9QA 4H9PC 5JR9A
chains in the Genus database with same CATH topology
3A2SX 3J9X1 1BT9A 3WAKA 4XZCA 5KMGP 4LSIA 3PUAA 5JDPA 4I4TE 4XNLA 5CA1E 3SY7A 2ES0A 2LT3A 4FUVA 2YK0A 3FXDB 4H63H 4X1KE 3HKEE 5HXSA 3QC9A 2JMKA 4G63A 3SRZA 3UUXB 3AA0A 2W63A 2YNKA 3DTOA 3KBUA 4DMVA 3QRAA 4O4XA 4QHOA 4ZI2D 3KINB 3GP6A 2W62A 3KVDD 2KZ7A 3P8CD 4AQFC 1Z0PA 1MMDA 3WI4A 2VKHA 2XAHB 3V5SA 3LJCA 4AYID 1G90A 3KVBA 2W61A 5FXXA 2NW8A 5LJNA 1MPFA 5LG4A 2IAKA 2LSIA 3J7Yq 3CQGB 1NWMX 1LVFA 2Y48B 4IE5A 3ZC1A 5HYAA 2Y0LA 4GIWA 4PJLA 1HF8A 3FXEB 2ODJA 3RPUA 3FHNA 4O2AE 2CXLA 1BR4A 3BK9A 1OXZA 4CI2B 2C5IT 2WMOA 2X0LB 2DCFA 2SPCA 2K4TA 1LRZA 2C5JA 4AYDC 5JDFA 2LE8A 2XASB 2XAJB 4I55E 1O3XA 5C8YE 3PQSA 5DL5A 1D1CA 3L09A 3MXZA 2D0TA 2YINA 5FMNA 5LGTB 3SYSA 4XNKA 3N2OA 4P09A 5EZYE 4O3WA 5JDHA 4GYSA 5H6QB 2XE2A 3I9YA 5LCYA 3WAJA 1BH3A 2F1TA 3LK2B 5JDMA 3SY9A 4GHBA 4GK5E 4CXWA 4D64A 2DHRA 3OYXA 3VE1A 3PUQA 5JDGA 4RL9A 5H6RB 3I0OA 4I50E 3HKBE 3L3PA 3E22E 1PRNA 1ZKEA 2X67A 4HFVA 3UAQA 3VE2A 4GOUA 4KUMB 5L3GB 3I0QA 2NTXA 4PK4A 3F57A 4WBNE 4UVAB 3VZWX 2K48A 3ETUA 2VKJA 1HX8A 3GMIA 4P0BA 4PFPA 5JQGE 4AFKA 4C91A 1PHOA 4AYEC 2D0UA 2NWBA 2HH7A 4KRAA 2KZ7B 3RBHA 2CCQA 3JTYA 2BVLA 3ZJ1A 4QQ1A 3UT5E 2ODVA 1T98A 2NP9A 3LK42 4KR4A 5T5FA 3UU2A 2XE1A 3JC6D 3HKDE 5JR9C 4F4BA 5JDLA 3N9MA 4AQFA 3CQXC 1QJ8A 4NUUA 2V7IA 2X9YA 4HN9A 4O3YA 8PRNA 1FMVA 1IAPA 1P4TA 1QJPA 3K3NA 1WYCA 2KNDA 4IE7A 4O4UA 2ERVA 2LM9A 3ZMZB 3OBVE 3RYFE 5L3EB 3V8UA 4D65A 4O2BE 4AXPA 1HG2A 2X66A 4Z8XA 3MACA 4RJWA 1ZEEA 4AYMC 2V7JA 2VKOA 3V5UA 3RC8A 4LSEA 1ORMA 3T20A 4QX7B 4UF0A 3UTKA 2UXNB 5LXTE 3K19A 3H37A 1FIOA 1HFAA 5L3CB 3DP7A 4GYRA 5LGNB 2QA7A 3QK6A 5JVDE 3AAEA 3KV9A 4P0AA 1BR0A 3O1HA 3C98B 5JRCB 3CPZA 2OA5A 5FY7A 3P7IA 4Z3TA 3IBPA 3PUSA 2K24A 5GONE 3CWZB 3OYZA 1YKEB 1ZHTA 2XUEA 4HEAA 2LSGA 3PTRB 2X51A 4ASKA 1U5PA 1WRDA 4ZOLE 5IHYA 3EDVA 4AUIA 4JEHB 1LVKA 3WI5A 3UUMA 2LOPA 3E08A 2JMMA 3ZYKA 2Q9QA 2F1VA 1US7B 4GCSA 4U74A 3O1IA 1Y64B 4WW0A 4UF0B 1GFQA 4ZI3D 2LJLA 5FY0A 5DL6A 1Q9GA 4H9OC 3JC6C 2G0UA 2CXDA 1MM4A 2XMXA 4O4HE 5CA0E 2E9XC 4EXTA 3O9XA 2DI4A 3CX6B 3HKCE 2UXXB 4JEUB 4TV9E 3ZMTB 3KBTA 5L3BB 4FMSA 5HXEA 3LK3A 3EMNX 5F8PA 5L2LA 4HKAA 2CE7A 3KVAA 4L9IA 1HXXA 2H3RA 2JRKA 3IEEA 3K3OA 3RRCA 3U3IA 3NSGA 1GFNA 4TX5A 3TKLB 2EHOC 3RH3A 3LBXB 3T24A 2YEVC 3AA7B 4FZNA 2XAQB 1WLXA 2LHFA 1MMGA 2CMRA 4WBOA 1H7CA 2O4VA 4UELA 1V9DA 3AA6A 3NBXX 5PRNA 2M06A 1MM5A 2NW9A 2MBGA 2VL8A 3UFEA 3MA9A 2EHOB 5FVNA 2MTQA 3IHRA 3ANWB 2Y0KA 4FSPA 5HWXA 1D0ZA 4AKGA 4J2CA 1ZHZA 1IJ5A 3DA4A 2D5UA 2M67A 3GN5B 3Q9DA 4M1PA 4E1SA 3QRCA 1D1AA 3O1JA 2JMHA 4ZS3A 5JDNA 4BUMX 3ZMVB 3C4WA 4F6RC 2WBLA 4UVBB 2X27X 4N59A 3ZYMA 3BQKA 4DBRA 2N2MA 4UV9B 3AAAA 3LK2A 5HXRA 2WAUA 1LKXA 4UV8B 2KXPB 4MFRA 1D0XA 1FEWA 1SHZC 2CLYC 5EE2A 3VKGA 4GCPA 1YS5A 1SA0E 4HE8A 2E9XA 2QTKA 4YLHA 4G76A 1WR6A 4ADZA 3EVYA 2ZLYA 5GV0A 4O4IE 4AYNA 5FXZA 3AAAB 1FMWA 2N2LA 1NAFA 2W81C 4X1IE 2RP4A 4CQIA 4OK0A 4EAHA 1E54A 3POXA 5ADXK 2ZFGA 4AKLA 2PFVA 1BR2A 2K9AA 1ZHCA 1Q9FA 3PU8A 4FRTA 2X9HA 2ZM0A 5A1LA 1AJ3A 2ODUA 5AFUK 1GFMA 2CXFA 4OHFA 2CEAA 5DQVA 5D5DA 4FZLA 1B7TA 4KR8A 4FI5A 1VOMA 3O4XE 3CKDA 5LJMA 2K0LA 3F31A 3PORA 3UUNA 4JUYA 4JLEA 4E1TA 4MHCA 2A3DA 4ZS2A 2VKDA 3I1AA 2WWUA 4U72A 4AKRB 2JJ9A 4CZZB 3AAIA 5HXHA 4C69X 1QUUA 4RLCA 4KBMB 5EK3A 4EB6E 5LBMA 3SYBA 3ZN0B 3LK3B 3PRNA 2RA1A 5HWYA 3RC3A 3S4UA 3ZCJA 3H3AA 4B6XA 2LSKA 4K0UA 4PNIA 1E1HB 3KDSE 4IDZA 3ESLA 2LOSA 4NUVA 3T8OA 3N5LA 5LHGB 2XE3A 3ANWA 4QXCB 1UX4A 1UX5A 4OYJA 4DVDA 4AKIA 3O0EA 2J4UP 4X20E 5FY1A 2K5BB 3AA6B 4EYYR 5LHIB 4UEMA 4JCHA 2LSYA 3GN5A 2JPFA 4UXNB 3LG7A 4YJ3E 3C51A 2A2FX 1BR1A 2ZM2A 1IZNA 3B13A 3CX7B 2Y2XA 3C5OA 5LYJE 3LBXA 4BJNA 3N9PA 4AI6A 2L9QA 2XG6A 4KMCA 4CXXA 4FZMA 5J2UE 5BMVE 3PU3A 4WNKA 4PUXA 3VHLA 5FXWA 2V7LA 1S94A 2CWYA 4G2AA 5LBQB 4O3ZA 2CM0A 3U78A 2W80C 5IYZE 3AA1B 2M07A 2Y6XA 2XQYA 3OKQA 3AB3B 4YHJA 4N78D 5L3DB 5J2TE 3T0SA 4PK5A 2KT9A 4TN7B 4D5UA 3CQCB 1QJ9A 4FESA 2BVMA 2V7MA 1ZV4X 5KX5E 3PDYA 1HTJF 3AVRA 3D0TA 4CXYA 3HOLA 1OWAA 3RKOA 3CX8B 3VU7H 2YU1A 2I59A 3MZKB 4H9QC 3RYHE 3QUJA 3BQLA 2KMFA 3RRWA 2Y8DA 3HL6A 4ISSA 4V1Av 2FGRA 3ZJ2A 3VZTX 2DWKA 5TAOA 4E7ZA 2KXPA 4RJXA 5DABA 2DWGA 2MYSA 1ZHYA 4RLBA 1YW0A 2X9WA 1D0YA 3SZDA 3SWHA 1H6S1 2KINB 3AA7A 3SZVA 2V26A 2KC0A 1YD8G 2NTYA 4AKMA 5FNVE 3GA8A 4AKRA 3AAEB 4FOZA 2LSJA 2Q9QD 4HTEA 4OFZA 3KV5A 3ZEFB 4O4JE 4X1YE 5JR9B 3I9WA 4ERRA 5ADXL 4N58A 1G73A 4ZI3C 4FRXA 4BJMA 2E9XD 2CA5A 2Z6EA 4PK6A 3FYXA 3DA3A 4IE6A 1CUNA 3HR0A 3DJBA 1U4QA 4ANJA 5DL7A 1HG5A 2ZMAA 3N2GE 4PJNA 2XAGB 2XTRA 4PJJA 1HXUA 3CMLA 3M65A 2Q9QB 4JFBA 3ZLIA 2EHOD 4O4LE 2BDEA 4QX8B 2WM9A 3K8PC 4O8SA 2KLQA 4H9NC 4C90A 4AKHA 1IZNB 4LSFA 4ISTA 4TZ4C 4IGUA 4O49A 4UVCB 2E9XB 2X68A 2FGQX 3TZGA 2V1DB 2B1EA 2YU2A 4XAXB 3IF8B 5M4YA 2L3LA 3RYCE 2LHRA 3Q5WA 3ZN1B 2PORA 4PAGA 3HOEA 1MIVA 3POUA 2WMNA 2ZLDA 6PRNA 3UPGA 1HCIA 2XE5A 5LGUB 2N1GA 4BA9A 3N9NA 2DNXA 3E0ZA 1OPFA 5FXVA 3AA1A 5F3JA 4DNDA 2MOZA 1VRBA 2A72A 5FYMA 5DQWA 3GWHA 4EOZB 1GFPA 1MNDA 1HXTA 2LFUA 2EHOA 2N2NA 3VY9X 2VWAA 2Q9QC 4QXBB 2ZM8A 3C4XA 2L8KA 3MK7C 2XHEB 4I43B 5EK4A 4QKNA 2W0GA 2N9DA 2XAFB 1MNEA 5ETWA 5HXCA 3W15B 2PG8A 3RYIE 3PUGA 2XTQA 2BZBA 4DO0A 4EIWA 3KV4A 3KFWX 4CI1B 5JDQA 2J1DG 3VKHA 5LA6E 3BQIA 3CVRA 2JQQA 1MMNA 3NRYA 4DMWA 5LOVE 2IC9A 2V7KA 1HS7A 4FJOA 4PJMA 3KV6A 2OMFA 3VY8X 3ZMSB 3ZPOA 4TV8E 4ILUA 3UULA 2CWOA 3HWBA 2XTLA 3NZPA 1S35A 5LNKA 1KK7A 3SS1A 2J1NA 5IYUA 5DL8A 4HGAA 4YFSA 2QGSA 3F2EA 5JREA 4EZ4A 2KWHA 5AFUL 5DJQC 3POQA 4B61A 4G75A 4ZHQE 2WSSV 2C0SA 3ETVA 3B57A 3MKDA 4IE4A 3K3QC 3MJXA 1ZHXA 4L0RA 5LP6E 3PE0A 3C4ZA 4OYKA 4XBFB 1UCUA 2NW7A 1MIWA 4MBQA 1ZHWA 3C64A 3R84B 3G7GA 4GK0E 3R6NA 2DLRA 2ACXA 2E8IA 2VASA 3ZC0A 2MNHA 5FP3A 3ZCIA 3ONXA 2PRNA 1X79A 3N2KE 3PURA 4PFOA 1EZ3A 7PRNA 3VZUX 2C5KT 2LEHA 3NZQA 5E0OA 1WYBA 3SOLA 4GCQA 5G26A 3EDUA 3NRXA 4IHJE 4FSOA 5HAXA 1IJ6A 2CLYB 3LK41 4EYUA 4DBQA 2PJQA 3RX6A 2W00A 4H9SE 4QWNB 2Y0HA 4LSHA 2GK9A 4ZI2C 2H7OA 3FB2A 2MHLA 3HA4A 2HPLA 3N9LA 5LHHB 4MALA 3C50A 4IIJE 4UIGA 4BAYB 4E7SA 3N9OA 5L3FB 5EK2A 2HPJA 1OSMA 2Y7SA 3OJAA 1KNZA 1YKHB 3HI2A 1G8XA 4H9RC 4PW8A 4CI3B 5CB4E 2YPVA 3FBZA 1QSDA 3AVSA 2KWIB 4YJ2E 3A5XA 2X9XA 4QXHB 2VB6A 4TUYE 1GFOA 3AA0B 4KP3C 3ZYLA 5J1GA 3Q2MA 3EUHA 4MLKA 5JH7E 4ZI7E 3HW9A 2KDYA 2D2SA 4IE0A 1THQA 4GF4A 4O3XB 3LFMA 4FT6A 1D1BA 2VK9A 2H7VC 2IW5B 3WI3A 2GE4A 2IC6A 5JRCA 3Q5XA 1BXWA 2LHNA 1MMAA 4H63V 5KDMC 2NOXA 3FBLA 1MIYA 4L5GA 2PBIA 3PQUA 2P9BA 4EZHA 3N9QA 4H9PC 4AQGA 4AZLA 4U9CA 3ZMUB 5JR9A 4A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK3 A;  3LK3 B;  3AA0 B;  2KXP A;  3AA1 B;  5AFU K;  3AA1 A;  3AAA A;  3LK2 A;  3LK4 1;  3AA0 A;  3AA7 A;  3AA7 B;  2KXP B;  1IZN B;  5AFU L;  4AKR A;  3AAE B;  2KZ7 B;  3AA6 A;  2KZ7 A;  3AA6 B;  5ADX L;  3AAE A;  3LK4 2;  4AKR B;  1IZN A;  3AAA B;  3LK2 B;  5ADX K; 
#chains in the Genus database with same CATH topology
 3A2S X;  4XNL A;  4IDN A;  5CA1 E;  2IUB A;  4FUV A;  2LT3 A;  2YDS A;  5AQV B;  5AQG B;  3HKE E;  3LDQ B;  3UU4 A;  3DTO A;  3JAE A;  2YNK A;  2KSR A;  1Z8U A;  2W62 A;  3P8C D;  3WI4 A;  3V5S A;  3FZL B;  5FXX A;  3EAM A;  2IAK A;  2LSI A;  3CQG B;  5AQL B;  3ZC1 A;  5AQQ B;  4GIW A;  3FHN A;  2CXL A;  2C5I T;  2WMO A;  3A0B O;  4JI1 T;  2XAJ B;  5HCJ A;  1O3X A;  3PQS A;  3L09 A;  2D0T A;  5LGT B;  3WU2 O;  5H6Q B;  3I9Y A;  1BH3 A;  1FJG T;  4DR2 T;  4GK5 E;  1N33 T;  2DHR A;  4I50 E;  1PRN A;  2X67 A;  2NR4 A;  4GOU A;  2NTX A;  4DV2 T;  4UVA B;  3K1S A;  4PFP A;  3GMI A;  4IL6 O;  4AYE C;  2HH7 A;  3JTY A;  2BVL A;  3UU5 A;  3UT5 E;  4KI0 F;  2UUB T;  4AQF A;  1QJ8 A;  4NUU A;  4HN9 A;  1FMV A;  3K3N A;  2IIU A;  2ERV A;  2LM9 A;  3ZMZ B;  3RIA A;  5IWA T;  2VQE T;  1ZEE A;  3T20 A;  4QX7 B;  5KXJ A;  5LXT E;  3H37 A;  3ZT6 A;  2X9K A;  4GYR A;  3QK6 A;  4P0A A;  3C98 B;  2WS3 A;  3CPZ A;  2H88 A;  4X5T A;  2MPK A;  2LLY A;  5AQK B;  4U2Y A;  2X51 A;  1U5P A;  2QVA A;  3WI5 A;  2LOP A;  4UR9 A;  2XZE A;  5HEG A;  3UQ4 A;  4U74 A;  1Y64 B;  4U3C A;  4H9O C;  1MM4 A;  3TLU A;  4EXT A;  3PJA J;  5F8P A;  1HXX A;  3RRC A;  4IDQ A;  3P50 A;  4TX5 A;  1XMO T;  4FZN A;  2LHF A;  1MMG A;  1H7C A;  4UEL A;  3AA6 A;  2EHO B;  5FVN A;  3FZK B;  4FSP A;  1D0Z A;  3AE1 A;  2D5U A;  4Q25 A;  2LKH A;  2JMH A;  3ZMV B;  4F6R C;  4JI3 T;  4N59 A;  3ZYM A;  2N2M A;  5HXR A;  4GCP A;  4G76 A;  4IDO A;  5AQM B;  4O4I E;  4AYN A;  2N2L A;  4CQI A;  4B3T T;  4AKL A;  2YKS A;  2AXT O;  2K9A A;  1ZHC A;  1Q9F A;  3VR8 A;  3RGL A;  4FRT A;  1XNQ T;  1OED A;  2ZM0 A;  2HHH T;  4DUY T;  2XQ3 A;  2XSB A;  1UUR A;  5DQV A;  5LG3 A;  1B7T A;  4FZL A;  4KR8 A;  4FI5 A;  2WZH A;  4JUY A;  3A0H O;  2R4N A;  1KNR A;  2BG9 C;  4P1N A;  4RLC A;  5B5E O;  3SYB A;  3LK3 B;  2LSK A;  3ESL A;  2LOS A;  4NUV A;  3T8O A;  5LHG B;  4OYJ A;  1KNP A;  4IRE A;  4EYY R;  3AA6 B;  5LHI B;  4UXN B;  4YJ3 E;  1IZN A;  3B13 A;  5LYJ E;  3RLF F;  4CXX A;  5BMV E;  3AEC A;  3JCU O;  5FXW A;  2V5C A;  1S94 A;  2CM0 A;  2QYW A;  3AA1 B;  4K3B A;  3OKQ A;  2KT9 A;  2VL0 A;  4YXD A;  4D5U A;  3CQC B;  4DR7 T;  3T1Y T;  2BVM A;  3PDY A;  3AVR A;  2PTF A;  4X65 T;  2WU5 A;  3HL6 A;  4V1A v;  3ZJ2 A;  3LSV A;  2KXP A;  1ZHY A;  2DWG A;  2MYS A;  5FVK A;  4A98 A;  3SZD A;  3PJA A;  3SWH A;  1H6S 1;  1YD8 G;  3GA8 A;  3AAE B;  4NXN T;  2LSJ A;  2YDR A;  4X1Y E;  1G73 A;  4PK6 A;  3DA3 A;  4HFC A;  3PUY F;  1CUN A;  3HR0 A;  3DJB A;  5DL7 A;  4LF7 T;  1VCS A;  3N2G E;  2XAG B;  4PJJ A;  4JFB A;  4O4L E;  3RI5 A;  5L4E A;  3K8P C;  4K0K T;  3AEB A;  4IST A;  4O49 A;  2FGQ X;  4JV5 T;  3TZG A;  5AQI B;  3NJT A;  2WMN A;  1Y01 A;  3UPG A;  5AQT B;  5AQJ B;  2N1G A;  4BA9 A;  4YSZ A;  1XMQ T;  2XQA A;  1VRB A;  3GWH A;  4HFI A;  5L4H A;  5C2T A;  2ZM8 A;  2WU2 A;  3RKO A;  2L8K A;  4I43 B;  2N9D A;  2W67 A;  4DO0 A;  3KV4 A;  3KFW X;  2UXC T;  4DMW A;  3PV0 F;  3PUZ F;  3NWI A;  1OED C;  3VY8 X;  3ZPO A;  2CWO A;  3AE7 A;  1S35 A;  2ZM6 T;  1YXR A;  5DL8 A;  3SFD A;  4EZ4 A;  2KWH A;  3RKG A;  5LP6 E;  5CGM A;  1UCU A;  1MIW A;  4MBQ A;  3R6N A;  2M6B A;  2ACX A;  2VAS A;  1N36 T;  1X79 A;  1EZ3 A;  7PRN A;  3SOL A;  2E5L T;  2VUR A;  4FSO A;  2CLY B;  4DBQ A;  3RX6 A;  4H9S E;  4NXM T;  3PGS A;  2GK9 A;  3FB2 A;  3HA4 A;  4IIJ E;  4BAY B;  4UIG A;  3OJA A;  1KNZ A;  1YKH B;  3HI2 A;  1G8X A;  4PW8 A;  3AE5 A;  3A5X A;  2VB6 A;  4TUY E;  4C4V B;  3ZYL A;  5J1G A;  4IL4 A;  4DV5 T;  2YDQ A;  2JQY A;  4YSX A;  4LFC T;  1D1B A;  4FT6 A;  3JAF A;  2IW5 B;  1J5W A;  1L0V A;  2BG9 B;  4I0U A;  5JRC A;  1N32 T;  1MMA A;  4LF8 T;  3PQU A;  4HWD A;  3OPC A;  3VE2 A;  4C00 A;  2IWW A;  3J9X 1;  4LSI A;  3PUA A;  4PR7 A;  2YK0 A;  5HXS A;  3QC9 A;  1HX1 B;  2JMK A;  3AA0 A;  4O4X A;  4QHO A;  3KIN B;  2CHO A;  1Z0P A;  5G3A A;  1G90 A;  2BBH A;  4IE5 A;  2JIW A;  5HYA A;  2IML A;  5AQN B;  2Y0L A;  1J5E T;  4COF A;  3FXE B;  4O2A E;  4YT0 A;  3BK9 A;  1OXZ A;  1ZOY A;  4UB8 O;  2X0L B;  2DCF A;  1NEN A;  2C5J A;  5JDF A;  2FJE A;  3TLV A;  5C8Y E;  4I55 E;  4C4V A;  2I0M A;  2YIN A;  5AQU B;  3RHW A;  3N2O A;  5HEO A;  4U2Z A;  3ZKR A;  5LCY A;  4ZEY A;  5JDM A;  4DR4 T;  4D64 A;  3OYX A;  3PUQ A;  4RL9 A;  3AED A;  3HKB E;  4KUM B;  4PK4 A;  3F57 A;  4TWF A;  3VZW X;  1PHO A;  2D0U A;  2NWB A;  4U31 A;  4KRA A;  3RBH A;  3NKZ A;  4QQ1 A;  4KR4 A;  4FQE A;  3LK4 2;  3JC6 D;  5JR9 C;  3CQX C;  2V7I A;  4QH5 A;  3AE6 A;  4O4U A;  4IE7 A;  2F4V T;  2X66 A;  4Z8X A;  3MAC A;  4RJW A;  2V7J A;  3JAD A;  5AQO B;  2BS4 A;  3PGU A;  4LML A;  5KAF O;  3AXJ A;  2V8S V;  1HFA A;  5LGN B;  2QA7 A;  5JVD E;  1HNZ T;  1BR0 A;  3O1H A;  2OA5 A;  5FY7 A;  2VVS A;  2XUE A;  2LSG A;  1XDP A;  3PTR B;  1WRD A;  4ZOL E;  3EDV A;  4AUI A;  3UUM A;  2Q9Q A;  1US7 B;  3O1I A;  4UF0 B;  3JC6 C;  2CXD A;  4O4H E;  5CA0 E;  2E9X C;  2DI4 A;  3AE4 A;  3HKC E;  2H89 A;  5L3B B;  3ZMT B;  4XNK A;  5HXE A;  4HKA A;  2CE7 A;  3BRZ A;  4F8H A;  3NSG A;  3RH3 A;  3T24 A;  2YEV C;  2IWV A;  2CMR A;  1V9D A;  5PRN A;  3DWO X;  2M06 A;  2NW9 A;  2VL8 A;  3AEE A;  3IHR A;  2V6Y B;  2Y0K A;  1ZHZ A;  4A97 A;  3AEF A;  3Q9D A;  4M1P A;  5LMN T;  2E2A A;  3O1J A;  3PGR A;  3EHZ A;  1WR0 A;  4UVB B;  3SFE A;  3BQK A;  3LK2 A;  2KXP B;  4MFR A;  1FEW A;  1SHZ C;  2CLY C;  4DUZ T;  1SA0 E;  3KZI O;  2QTK A;  2J62 A;  1I94 T;  5GV0 A;  5FXZ A;  3AAA B;  1FMW A;  2ACZ A;  1E54 A;  4OK0 A;  3M3Z B;  5ADX K;  2PFV A;  1BR2 A;  4JI5 T;  3PU8 A;  2R4P A;  2X9H A;  1SUM B;  4DR5 T;  5AFU K;  4OHF A;  4DID B;  2WZI A;  1VOM A;  3CKD A;  2K0L A;  3F31 A;  3PUX F;  5CFB A;  3POR A;  5JTG A;  4DR6 T;  4E1T A;  4ZS2 A;  4DV4 T;  2JJ9 A;  5HXH A;  4C69 X;  5GTH O;  3VRA A;  5EK3 A;  4EB6 E;  5HWY A;  5AQF B;  1KEY A;  3H3A A;  2CHN A;  4LMK A;  3N5L A;  2XE3 A;  4B3S T;  4QXC B;  4AKI A;  2WDR A;  4KX6 A;  2K5B B;  4UEM A;  1YQ4 A;  3GN5 A;  2JPF A;  3LG7 A;  3A8Y C;  2ZM2 A;  3RF1 A;  2Y2X A;  3CX7 B;  3N9P A;  4AI6 A;  4KMC A;  2FJB A;  3VHL A;  4JI6 T;  3U78 A;  2W80 C;  1OED E;  2BS2 A;  4HWC A;  3TLW A;  2BKN A;  4N78 D;  5L3D B;  4TN7 B;  1QJ9 A;  4FES A;  3CX8 B;  2W2U A;  5LB7 B;  1R8I A;  2R6G F;  3RYH E;  4H9Q C;  3AEG A;  2KMF A;  3RRW A;  2Y8D A;  2FGR A;  4QH1 A;  5DAB A;  3P4W A;  2X9W A;  1D0Y A;  2KC0 A;  1SE7 A;  4AKM A;  3KV5 A;  3L8R A;  4ZZC A;  4WZX A;  4O4J E;  5JR9 B;  4N58 A;  4ZI3 C;  5F5W A;  3B5M A;  2Z6E A;  3EI0 A;  4IE6 A;  4ANJ A;  5C3J A;  2R89 A;  2XTR A;  3PF1 A;  3CML A;  3M65 A;  3ZLI A;  1CHU A;  2BKP A;  4O8S A;  4U7Y A;  4H9N C;  5IUX A;  4TZ4 C;  1JNR A;  4IGU A;  2HN1 A;  2XQ5 A;  3FZF B;  3ZN1 B;  2BS3 A;  4PAG A;  4OX9 T;  1MIV A;  3POU A;  3ONJ A;  2ZLD A;  1HCI A;  2XE5 A;  3FZH B;  5LMU T;  4DV3 T;  1HR0 T;  4DND A;  3RQW A;  2MOZ A;  4FZM A;  2A72 A;  1MND A;  2VWA A;  4QXB B;  3C4X A;  5HEJ A;  3A7M A;  3MK7 C;  5HXC A;  2XHE B;  5HEH A;  3RYI E;  2XTQ A;  2BZB A;  5JDQ A;  2J1D G;  2LKG A;  1MMN A;  4FJO A;  3KV6 A;  3ONL C;  3RIU A;  3ZMS B;  4TV8 E;  2IHR 1;  2XTL A;  3SS1 A;  2J1N A;  4JI2 T;  2WSS V;  1ZHX A;  5CJ5 A;  3C4Z A;  4YTM A;  3G7G A;  1ZHW A;  2E8I A;  3ZC0 A;  2MNH A;  4LFB T;  3N2K E;  3VZU X;  5E0O A;  2I6H A;  4IHJ E;  1IJ6 A;  3P4Q A;  2W00 A;  4QWN B;  2H7O A;  2MHL A;  4Z91 A;  4JI8 T;  1HXT A;  3C50 A;  4HWH A;  3N9O A;  2LRK A;  1JNZ A;  4Z90 A;  5CB4 E;  2KWI B;  1KFY A;  5L47 A;  3AE3 A;  2KDY A;  2D2S A;  1THQ A;  5AQP B;  2OV9 A;  4LF9 T;  1XDO A;  2GE4 A;  3Q5X A;  3ZSS A;  4AIS A;  5KDM C;  4JBW F;  3FBL A;  4AQY T;  2PBI A;  5FL1 A;  4EZH A;  1UK5 A;  4U9C A;  4A56 A;  2R88 A;  3WAK A;  3AXJ B;  3BS0 A;  3SY7 A;  3OVU A;  4CN4 A;  2D9D A;  3FXD B;  4H63 H;  3UU6 A;  4G63 A;  2W63 A;  4DMV A;  2V6X A;  3QRA A;  3GP6 A;  3KVD D;  4AQF C;  5AQH B;  2XAH B;  4AYI D;  4DV0 T;  3KVB A;  2NW8 A;  1IBK T;  4UB6 O;  3DWN A;  1NWM X;  1LVF A;  2Y48 B;  4ZZB A;  1HF8 A;  2ODJ A;  3RPU A;  1BR4 A;  2K4T A;  2SPC A;  4HWF A;  3P4P A;  4AYD C;  4YHH T;  2XAS B;  1D1C A;  4P09 A;  5EZY E;  2XE2 A;  3WAJ A;  4GHB A;  3VRB A;  4CXW A;  3VE1 A;  5JDG A;  2MAW A;  3E22 E;  1ZKE A;  5L3G B;  3I0Q A;  4X64 T;  4WBN E;  2K48 A;  2VKJ A;  1HX8 A;  4P0B A;  4AFK A;  2KZ7 B;  3FZM B;  5FKY A;  2R8A A;  3ZJ1 A;  5TIS O;  2WJR A;  2ODV A;  2M6I A;  4EV6 A;  5T5F A;  2FJA A;  2XE1 A;  5JDL A;  3N9M A;  4O3Y A;  4HWI B;  1P4T A;  4B3M T;  2KND A;  5L3E B;  3V8U A;  4CN6 A;  4D65 A;  4O2B E;  4AXP A;  1HG2 A;  4X66 T;  3CIR A;  4HFH A;  2VKO A;  3V5U A;  3RC8 A;  4LSE A;  1ORM A;  3K19 A;  3AAE A;  3KV9 A;  2BG9 E;  2W66 A;  2X0H A;  5JRC B;  3P7I A;  3UU8 A;  4Z3T A;  3PUS A;  3AEA A;  5GON E;  3CWZ B;  3OYZ A;  1YKE B;  4K3C A;  4ASK A;  1LVK A;  2FUP A;  4JYA T;  2JMM A;  3ZYK A;  1N34 T;  2J47 A;  4HFD A;  3P4R A;  2BG9 A;  1GFQ A;  4ZI3 D;  1Q9G A;  2XMX A;  3RQU A;  3O9X A;  3CX6 B;  2UXX B;  4JEU B;  3LK3 A;  3KVA A;  2XQ8 A;  2JRK A;  3IEE A;  3OTO T;  3P4S A;  1GFN A;  3LBX B;  4GKK T;  3AA7 B;  1WLX A;  4WBO A;  2O4V A;  3NBX X;  1MM5 A;  3UFE A;  2E5V A;  3BRY A;  3MA9 A;  2J4G A;  1XZY A;  5ABE A;  2CRB A;  2XM2 A;  5ABH A;  5HWX A;  3DA4 A;  4J2C A;  2M67 A;  4JI7 T;  4E1S A;  3QRC A;  4DV7 T;  1D1A A;  5ABG A;  2K3W A;  4BUM X;  1T7S A;  2WBL A;  2X27 X;  4UV9 B;  1LKX A;  4UV8 B;  5HCM A;  5BR8 T;  5EE2 A;  3VKG A;  5B66 O;  1YS5 A;  2JQH A;  2E9X A;  3EVY A;  3ZT7 A;  2W81 C;  4IL9 A;  4A5X A;  3QNU A;  3X1D A;  3Q5E A;  4TNW A;  1AJ3 A;  2CXF A;  2VVN A;  3O4X E;  5LJM A;  3UUN A;  2A3D A;  2VKD A;  4AKR B;  1XWM A;  3AAI A;  4KBM B;  3ZN0 B;  4LF5 T;  2RA1 A;  2WQY A;  3RC3 A;  3S4U A;  3ZCJ A;  2F1C X;  4PNI A;  3KDS E;  4IDZ A;  2WDQ A;  5G38 A;  2VQF T;  1UX5 A;  3UFG A;  4JCH A;  2YOE A;  5HEU A;  3LBX A;  4BJN A;  4PUX A;  2WDV A;  4O3Z A;  5IYZ E;  2M07 A;  3AB3 B;  4EGW A;  2V7M A;  1ZV4 X;  1XNR T;  1UUS A;  1HTJ F;  3HOL A;  3VU7 H;  2I59 A;  3MZK B;  3QUJ A;  3BQL A;  4ISS A;  5TAO A;  4RJX A;  4RLB A;  3AA7 A;  3SZV A;  1KF6 A;  5FNV E;  4FOZ A;  4HTE A;  5FVL A;  4DR1 T;  2OLT A;  4FRX A;  1W0B A;  4BJM A;  2CA5 A;  3FYX A;  2QRX A;  1U4Q A;  2WWV A;  2XQ7 A;  1HXU A;  2EHO D;  5AQS B;  2BDE A;  2UXD T;  1WFD A;  1IZN B;  4LSF A;  2R4L A;  2V5D A;  2X68 A;  4JI0 T;  2YU2 A;  4XAX B;  3IF8 B;  2L3L A;  2POR A;  1HNW T;  3IA3 A;  2CPT A;  2LM2 A;  5KAI O;  1T1L A;  3E0Z A;  5FXV A;  5F3J A;  4CN1 A;  4EOZ B;  4O3X B;  3VY9 X;  2LFU A;  2N2N A;  2Q9Q C;  3TLT A;  3W15 B;  1MNE A;  2PG8 A;  3PUG A;  3CK6 A;  4EIW A;  3VKH A;  1M7K A;  5LA6 E;  2JQQ A;  5LOV E;  2IC9 A;  2UXB T;  4PJM A;  1OED B;  5ABF B;  2OMF A;  1E7P A;  4ILU A;  3UUL A;  2UUA T;  3NZP A;  5LNK A;  5E79 O;  3UU3 A;  1KK7 A;  2WVP A;  4HGA A;  2QGS A;  3F2E A;  5AFU L;  3POQ A;  4B61 A;  4G75 A;  4ZHQ E;  2C0S A;  3B57 A;  3MKD A;  4IE4 A;  3K3Q C;  3MJX A;  2UU9 T;  4OYK A;  4XBF B;  4LFA T;  2NW7 A;  4GK0 E;  2DLR A;  2PRN A;  3PUR A;  4PFO A;  2LEH A;  1WYB A;  5G26 A;  3EDU A;  1E2A A;  2AE9 A;  2Y0H A;  4LSH A;  5H2F O;  4YTN A;  2HPL A;  2WCA A;  4MAL A;  5EK2 A;  2HPJ A;  1OSM A;  2Y7S A;  4CI3 B;  2YPV A;  4YJ2 E;  4QXH B;  1I6Z A;  3AA0 B;  4KP3 C;  4MLK A;  5JH7 E;  1GQE A;  4LF6 T;  3HW9 A;  2RPA A;  4IDP A;  4KHZ F;  3LFM A;  2IC6 A;  1BXW A;  2NOX A;  3G06 A;  4L5G A;  1QLB A;  2P9B A;  3ZT5 A;  4AQG A;  4AZL A;  3ZMU B;  1BT9 A;  2HN2 A;  4XZC A;  5KMG P;  5JDP A;  4I4T E;  2ES0 A;  4X1K E;  3UUX B;  3SRZ A;  3KBU A;  4ZXL A;  4ZI2 D;  1X9B A;  2KZ7 A;  1MMD A;  2VKH A;  3LJC A;  4B3R T;  2W61 A;  4N75 A;  5LJN A;  1MPF A;  5LG4 A;  3J7Y q;  4PJL A;  3UUB A;  4CI2 B;  4YY3 T;  1LRZ A;  2LE8 A;  5DL5 A;  1J1J A;  3MXZ A;  5FMN A;  3SYS A;  4GKJ T;  4O3W A;  5JDH A;  2XSA A;  4GYS A;  2F1T A;  3LK2 B;  3SY9 A;  4AIU A;  1T72 A;  3H3M A;  2XPK A;  5GTI O;  5H6R B;  3I0O A;  3L3P A;  1HNX T;  4HFV A;  3UAQ A;  3ETU A;  3QB5 K;  5JQG E;  4C91 A;  2CCQ A;  2YN6 A;  2XQ6 A;  3UU2 A;  1T98 A;  2NP9 A;  4TWD A;  3HKD E;  4F4B A;  8PRN A;  2X9Y A;  2CBI A;  2IDO B;  1IAP A;  1QJP A;  4HFE A;  1WYC A;  3OBV E;  3RYF E;  1M62 A;  3AE2 A;  4AYM C;  2JQK A;  4UF0 A;  3UTK A;  2UXN B;  1FIO A;  5L3C B;  2R4O A;  3DP7 A;  4U7I A;  3VR9 A;  1W0A A;  5ABF A;  4IT4 A;  3IBP A;  2K24 A;  1ZHT A;  4HEA A;  5FL0 A;  3ZST A;  1YQ3 A;  5IHY A;  2WJQ A;  4JEH B;  4YTP A;  1W09 A;  3E08 A;  2F1V A;  4DV1 T;  3T1H T;  3NVO A;  4GCS A;  4WW0 A;  5DL6 A;  2LJL A;  5FY0 A;  2G0U A;  4TV9 E;  3KBT A;  4NIQ A;  4FMS A;  3EMN X;  5L2L A;  2XJ7 A;  4L9I A;  2H3R A;  3U3I A;  3K3O A;  1IBM T;  4LMJ A;  3TKL B;  2EHO C;  2XAQ B;  1NEK A;  2MBG A;  1WCR A;  2MTQ A;  2A9U A;  3ANW B;  4TWH A;  4AKG A;  1IJ5 A;  3GN5 B;  4ILB A;  4ZS3 A;  5JDN A;  3C4W A;  2LRL A;  4DBR A;  2XY8 B;  3AAA A;  2WAU A;  4HFB A;  4U33 A;  1D0X A;  4HE8 A;  4YLH A;  1WR6 A;  4ADZ A;  2ZLY A;  2XQ9 A;  2WB5 A;  1NAF A;  4X1I E;  2RP4 A;  3POX A;  4EAH A;  4LF4 T;  2ZFG A;  4EEB A;  2CBJ A;  2DL1 A;  3RIU C;  5A1L A;  2ODU A;  1GFM A;  2CEA A;  5D5D A;  4JLE A;  4YSY A;  4MHC A;  3I1A A;  2WWU A;  4U72 A;  4CZZ B;  2FJD A;  1QUU A;  1IBL T;  1T8B A;  5LBM A;  2FBW A;  3PRN A;  4B6X A;  4K0U A;  1E1H B;  2XM1 A;  3ANW A;  1UX4 A;  4DVD A;  3O0E A;  2J4U P;  3Q5D A;  4X20 E;  5FY1 A;  2JQ9 A;  2LSY A;  3C51 A;  2A2F X;  1BR1 A;  2BKO A;  3C5O A;  2XG6 A;  2L9Q A;  2X0Y A;  5J2U E;  3AE8 A;  3PU3 A;  4WNK A;  4DR3 T;  2V7L A;  2CWY A;  5LBQ B;  4G2A A;  2XQY A;  2Y6X A;  4YHJ A;  5J2T E;  3T0S A;  4PK5 A;  4NPP A;  2B76 A;  1UGO A;  5KX5 E;  3D0T A;  4CXY A;  1OWA A;  2YU1 A;  3JCF A;  3VZT X;  2DWK A;  3EAB A;  4E7Z A;  1S5L O;  4TNV A;  1YW0 A;  2KIN B;  2V26 A;  2NTY A;  1W9R A;  4AKR A;  2Q9Q D;  4OFZ A;  3ZEF B;  2XQ4 A;  3I9W A;  4ERR A;  4EED A;  5ADX L;  3RIF A;  2E9X D;  3PUW F;  4DV6 T;  2WP9 A;  3L39 A;  4CTD A;  1HG5 A;  4N74 A;  2ZMA A;  4PJN A;  2Q9Q B;  4QX8 B;  2WM9 A;  4X62 T;  2KLQ A;  4AKH A;  4C90 A;  2UUC T;  4ILA A;  5G39 A;  4UVC B;  2E9X B;  2V1D B;  2B1E A;  5J0Z A;  5M4Y A;  3RYC E;  2LHR A;  3Q5W A;  3HOE A;  3AE9 A;  6PRN A;  5LGU B;  1DU2 A;  4JI4 T;  2AXD S;  3N9N A;  2DNX A;  1OPF A;  4ILC A;  3AA1 A;  5FYM A;  5DQW A;  1GFP A;  2EHO A;  5AQR B;  5EK4 A;  4QKN A;  2W0G A;  2XAF B;  5ETW A;  4KHP T;  4CI1 B;  3PUV F;  3BQI A;  3CVR A;  4WYV A;  3NRY A;  2V7K A;  1HS7 A;  3UQ7 A;  3HWB A;  4PJ0 O;  1VCT A;  2V6Y A;  2W4X A;  3DZM A;  5IYU A;  4YFS A;  5JRE A;  5DJQ C;  3ETV A;  2BBJ A;  4L0R A;  3PE0 A;  3TLS A;  3QOF A;  3C64 A;  3R84 B;  5FP3 A;  3ZCI A;  3ONX A;  4QH4 A;  2C5K T;  3NZQ A;  4GCQ A;  3NRX A;  5HAX A;  3LK4 1;  4EYU A;  2PJQ A;  4ZI2 C;  3N9L A;  5LHH B;  1T16 A;  4E7S A;  5L3F B;  4H9R C;  3FBZ A;  1QSD A;  3AVS A;  2WY2 A;  2X9X A;  1GFO A;  3Q2M A;  3EUH A;  4ZI7 E;  4IE0 A;  4GF4 A;  2VK9 A;  2H7V C;  1ZP0 A;  3WI3 A;  2LHN A;  4H63 V;  3ABV A;  3QB5 A;  1MIY A;  3N9Q A;  4H9P C;  5JR9 A; 
#chains in the Genus database with same CATH homology
 3A2S X;  3J9X 1;  1BT9 A;  3WAK A;  4XZC A;  5KMG P;  4LSI A;  3PUA A;  5JDP A;  4I4T E;  4XNL A;  5CA1 E;  3SY7 A;  2ES0 A;  2LT3 A;  4FUV A;  2YK0 A;  3FXD B;  4H63 H;  4X1K E;  3HKE E;  5HXS A;  3QC9 A;  2JMK A;  4G63 A;  3SRZ A;  3UUX B;  3AA0 A;  2W63 A;  2YNK A;  3DTO A;  3KBU A;  4DMV A;  3QRA A;  4O4X A;  4QHO A;  4ZI2 D;  3KIN B;  3GP6 A;  2W62 A;  3KVD D;  2KZ7 A;  3P8C D;  4AQF C;  1Z0P A;  1MMD A;  3WI4 A;  2VKH A;  2XAH B;  3V5S A;  3LJC A;  4AYI D;  1G90 A;  3KVB A;  2W61 A;  5FXX A;  2NW8 A;  5LJN A;  1MPF A;  5LG4 A;  2IAK A;  2LSI A;  3J7Y q;  3CQG B;  1NWM X;  1LVF A;  2Y48 B;  4IE5 A;  3ZC1 A;  5HYA A;  2Y0L A;  4GIW A;  4PJL A;  1HF8 A;  3FXE B;  2ODJ A;  3RPU A;  3FHN A;  4O2A E;  2CXL A;  1BR4 A;  3BK9 A;  1OXZ A;  4CI2 B;  2C5I T;  2WMO A;  2X0L B;  2DCF A;  2SPC A;  2K4T A;  1LRZ A;  2C5J A;  4AYD C;  5JDF A;  2LE8 A;  2XAS B;  2XAJ B;  4I55 E;  1O3X A;  5C8Y E;  3PQS A;  5DL5 A;  1D1C A;  3L09 A;  3MXZ A;  2D0T A;  2YIN A;  5FMN A;  5LGT B;  3SYS A;  4XNK A;  3N2O A;  4P09 A;  5EZY E;  4O3W A;  5JDH A;  4GYS A;  5H6Q B;  2XE2 A;  3I9Y A;  5LCY A;  3WAJ A;  1BH3 A;  2F1T A;  3LK2 B;  5JDM A;  3SY9 A;  4GHB A;  4GK5 E;  4CXW A;  4D64 A;  2DHR A;  3OYX A;  3VE1 A;  3PUQ A;  5JDG A;  4RL9 A;  5H6R B;  3I0O A;  4I50 E;  3HKB E;  3L3P A;  3E22 E;  1PRN A;  1ZKE A;  2X67 A;  4HFV A;  3UAQ A;  3VE2 A;  4GOU A;  4KUM B;  5L3G B;  3I0Q A;  2NTX A;  4PK4 A;  3F57 A;  4WBN E;  4UVA B;  3VZW X;  2K48 A;  3ETU A;  2VKJ A;  1HX8 A;  3GMI A;  4P0B A;  4PFP A;  5JQG E;  4AFK A;  4C91 A;  1PHO A;  4AYE C;  2D0U A;  2NWB A;  2HH7 A;  4KRA A;  2KZ7 B;  3RBH A;  2CCQ A;  3JTY A;  2BVL A;  3ZJ1 A;  4QQ1 A;  3UT5 E;  2ODV A;  1T98 A;  2NP9 A;  3LK4 2;  4KR4 A;  5T5F A;  3UU2 A;  2XE1 A;  3JC6 D;  3HKD E;  5JR9 C;  4F4B A;  5JDL A;  3N9M A;  4AQF A;  3CQX C;  1QJ8 A;  4NUU A;  2V7I A;  2X9Y A;  4HN9 A;  4O3Y A;  8PRN A;  1FMV A;  1IAP A;  1P4T A;  1QJP A;  3K3N A;  1WYC A;  2KND A;  4IE7 A;  4O4U A;  2ERV A;  2LM9 A;  3ZMZ B;  3OBV E;  3RYF E;  5L3E B;  3V8U A;  4D65 A;  4O2B E;  4AXP A;  1HG2 A;  2X66 A;  4Z8X A;  3MAC A;  4RJW A;  1ZEE A;  4AYM C;  2V7J A;  2VKO A;  3V5U A;  3RC8 A;  4LSE A;  1ORM A;  3T20 A;  4QX7 B;  4UF0 A;  3UTK A;  2UXN B;  5LXT E;  3K19 A;  3H37 A;  1FIO A;  1HFA A;  5L3C B;  3DP7 A;  4GYR A;  5LGN B;  2QA7 A;  3QK6 A;  5JVD E;  3AAE A;  3KV9 A;  4P0A A;  1BR0 A;  3O1H A;  3C98 B;  5JRC B;  3CPZ A;  2OA5 A;  5FY7 A;  3P7I A;  4Z3T A;  3IBP A;  3PUS A;  2K24 A;  5GON E;  3CWZ B;  3OYZ A;  1YKE B;  1ZHT A;  2XUE A;  4HEA A;  2LSG A;  3PTR B;  2X51 A;  4ASK A;  1U5P A;  1WRD A;  4ZOL E;  5IHY A;  3EDV A;  4AUI A;  4JEH B;  1LVK A;  3WI5 A;  3UUM A;  2LOP A;  3E08 A;  2JMM A;  3ZYK A;  2Q9Q A;  2F1V A;  1US7 B;  4GCS A;  4U74 A;  3O1I A;  1Y64 B;  4WW0 A;  4UF0 B;  1GFQ A;  4ZI3 D;  2LJL A;  5FY0 A;  5DL6 A;  1Q9G A;  4H9O C;  3JC6 C;  2G0U A;  2CXD A;  1MM4 A;  2XMX A;  4O4H E;  5CA0 E;  2E9X C;  4EXT A;  3O9X A;  2DI4 A;  3CX6 B;  3HKC E;  2UXX B;  4JEU B;  4TV9 E;  3ZMT B;  3KBT A;  5L3B B;  4FMS A;  5HXE A;  3LK3 A;  3EMN X;  5F8P A;  5L2L A;  4HKA A;  2CE7 A;  3KVA A;  4L9I A;  1HXX A;  2H3R A;  2JRK A;  3IEE A;  3K3O A;  3RRC A;  3U3I A;  3NSG A;  1GFN A;  4TX5 A;  3TKL B;  2EHO C;  3RH3 A;  3LBX B;  3T24 A;  2YEV C;  3AA7 B;  4FZN A;  2XAQ B;  1WLX A;  2LHF A;  1MMG A;  2CMR A;  4WBO A;  1H7C A;  2O4V A;  4UEL A;  1V9D A;  3AA6 A;  3NBX X;  5PRN A;  2M06 A;  1MM5 A;  2NW9 A;  2MBG A;  2VL8 A;  3UFE A;  3MA9 A;  2EHO B;  5FVN A;  2MTQ A;  3IHR A;  3ANW B;  2Y0K A;  4FSP A;  5HWX A;  1D0Z A;  4AKG A;  4J2C A;  1ZHZ A;  1IJ5 A;  3DA4 A;  2D5U A;  2M67 A;  3GN5 B;  3Q9D A;  4M1P A;  4E1S A;  3QRC A;  1D1A A;  3O1J A;  2JMH A;  4ZS3 A;  5JDN A;  4BUM X;  3ZMV B;  3C4W A;  4F6R C;  2WBL A;  4UVB B;  2X27 X;  4N59 A;  3ZYM A;  3BQK A;  4DBR A;  2N2M A;  4UV9 B;  3AAA A;  3LK2 A;  5HXR A;  2WAU A;  1LKX A;  4UV8 B;  2KXP B;  4MFR A;  1D0X A;  1FEW A;  1SHZ C;  2CLY C;  5EE2 A;  3VKG A;  4GCP A;  1YS5 A;  1SA0 E;  4HE8 A;  2E9X A;  2QTK A;  4YLH A;  4G76 A;  1WR6 A;  4ADZ A;  3EVY A;  2ZLY A;  5GV0 A;  4O4I E;  4AYN A;  5FXZ A;  3AAA B;  1FMW A;  2N2L A;  1NAF A;  2W81 C;  4X1I E;  2RP4 A;  4CQI A;  4OK0 A;  4EAH A;  1E54 A;  3POX A;  5ADX K;  2ZFG A;  4AKL A;  2PFV A;  1BR2 A;  2K9A A;  1ZHC A;  1Q9F A;  3PU8 A;  4FRT A;  2X9H A;  2ZM0 A;  5A1L A;  1AJ3 A;  2ODU A;  5AFU K;  1GFM A;  2CXF A;  4OHF A;  2CEA A;  5DQV A;  5D5D A;  4FZL A;  1B7T A;  4KR8 A;  4FI5 A;  1VOM A;  3O4X E;  3CKD A;  5LJM A;  2K0L A;  3F31 A;  3POR A;  3UUN A;  4JUY A;  4JLE A;  4E1T A;  4MHC A;  2A3D A;  4ZS2 A;  2VKD A;  3I1A A;  2WWU A;  4U72 A;  4AKR B;  2JJ9 A;  4CZZ B;  3AAI A;  5HXH A;  4C69 X;  1QUU A;  4RLC A;  4KBM B;  5EK3 A;  4EB6 E;  5LBM A;  3SYB A;  3ZN0 B;  3LK3 B;  3PRN A;  2RA1 A;  5HWY A;  3RC3 A;  3S4U A;  3ZCJ A;  3H3A A;  4B6X A;  2LSK A;  4K0U A;  4PNI A;  1E1H B;  3KDS E;  4IDZ A;  3ESL A;  2LOS A;  4NUV A;  3T8O A;  3N5L A;  5LHG B;  2XE3 A;  3ANW A;  4QXC B;  1UX4 A;  1UX5 A;  4OYJ A;  4DVD A;  4AKI A;  3O0E A;  2J4U P;  4X20 E;  5FY1 A;  2K5B B;  3AA6 B;  4EYY R;  5LHI B;  4UEM A;  4JCH A;  2LSY A;  3GN5 A;  2JPF A;  4UXN B;  3LG7 A;  4YJ3 E;  3C51 A;  2A2F X;  1BR1 A;  2ZM2 A;  1IZN A;  3B13 A;  3CX7 B;  2Y2X A;  3C5O A;  5LYJ E;  3LBX A;  4BJN A;  3N9P A;  4AI6 A;  2L9Q A;  2XG6 A;  4KMC A;  4CXX A;  4FZM A;  5J2U E;  5BMV E;  3PU3 A;  4WNK A;  4PUX A;  3VHL A;  5FXW A;  2V7L A;  1S94 A;  2CWY A;  4G2A A;  5LBQ B;  4O3Z A;  2CM0 A;  3U78 A;  2W80 C;  5IYZ E;  3AA1 B;  2M07 A;  2Y6X A;  2XQY A;  3OKQ A;  3AB3 B;  4YHJ A;  4N78 D;  5L3D B;  5J2T E;  3T0S A;  4PK5 A;  2KT9 A;  4TN7 B;  4D5U A;  3CQC B;  1QJ9 A;  4FES A;  2BVM A;  2V7M A;  1ZV4 X;  5KX5 E;  3PDY A;  1HTJ F;  3AVR A;  3D0T A;  4CXY A;  3HOL A;  1OWA A;  3RKO A;  3CX8 B;  3VU7 H;  2YU1 A;  2I59 A;  3MZK B;  4H9Q C;  3RYH E;  3QUJ A;  3BQL A;  2KMF A;  3RRW A;  2Y8D A;  3HL6 A;  4ISS A;  4V1A v;  2FGR A;  3ZJ2 A;  3VZT X;  2DWK A;  5TAO A;  4E7Z A;  2KXP A;  4RJX A;  5DAB A;  2DWG A;  2MYS A;  1ZHY A;  4RLB A;  1YW0 A;  2X9W A;  1D0Y A;  3SZD A;  3SWH A;  1H6S 1;  2KIN B;  3AA7 A;  3SZV A;  2V26 A;  2KC0 A;  1YD8 G;  2NTY A;  4AKM A;  5FNV E;  3GA8 A;  4AKR A;  3AAE B;  4FOZ A;  2LSJ A;  2Q9Q D;  4HTE A;  4OFZ A;  3KV5 A;  3ZEF B;  4O4J E;  4X1Y E;  5JR9 B;  3I9W A;  4ERR A;  5ADX L;  4N58 A;  1G73 A;  4ZI3 C;  4FRX A;  4BJM A;  2E9X D;  2CA5 A;  2Z6E A;  4PK6 A;  3FYX A;  3DA3 A;  4IE6 A;  1CUN A;  3HR0 A;  3DJB A;  1U4Q A;  4ANJ A;  5DL7 A;  1HG5 A;  2ZMA A;  3N2G E;  4PJN A;  2XAG B;  2XTR A;  4PJJ A;  1HXU A;  3CML A;  3M65 A;  2Q9Q B;  4JFB A;  3ZLI A;  2EHO D;  4O4L E;  2BDE A;  4QX8 B;  2WM9 A;  3K8P C;  4O8S A;  2KLQ A;  4H9N C;  4C90 A;  4AKH A;  1IZN B;  4LSF A;  4IST A;  4TZ4 C;  4IGU A;  4O49 A;  4UVC B;  2E9X B;  2X68 A;  2FGQ X;  3TZG A;  2V1D B;  2B1E A;  2YU2 A;  4XAX B;  3IF8 B;  5M4Y A;  2L3L A;  3RYC E;  2LHR A;  3Q5W A;  3ZN1 B;  2POR A;  4PAG A;  3HOE A;  1MIV A;  3POU A;  2WMN A;  2ZLD A;  6PRN A;  3UPG A;  1HCI A;  2XE5 A;  5LGU B;  2N1G A;  4BA9 A;  3N9N A;  2DNX A;  3E0Z A;  1OPF A;  5FXV A;  3AA1 A;  5F3J A;  4DND A;  2MOZ A;  1VRB A;  2A72 A;  5FYM A;  5DQW A;  3GWH A;  4EOZ B;  1GFP A;  1MND A;  1HXT A;  2LFU A;  2EHO A;  2N2N A;  3VY9 X;  2VWA A;  2Q9Q C;  4QXB B;  2ZM8 A;  3C4X A;  2L8K A;  3MK7 C;  2XHE B;  4I43 B;  5EK4 A;  4QKN A;  2W0G A;  2N9D A;  2XAF B;  1MNE A;  5ETW A;  5HXC A;  3W15 B;  2PG8 A;  3RYI E;  3PUG A;  2XTQ A;  2BZB A;  4DO0 A;  4EIW A;  3KV4 A;  3KFW X;  4CI1 B;  5JDQ A;  2J1D G;  3VKH A;  5LA6 E;  3BQI A;  3CVR A;  2JQQ A;  1MMN A;  3NRY A;  4DMW A;  5LOV E;  2IC9 A;  2V7K A;  1HS7 A;  4FJO A;  4PJM A;  3KV6 A;  2OMF A;  3VY8 X;  3ZMS B;  3ZPO A;  4TV8 E;  4ILU A;  3UUL A;  2CWO A;  3HWB A;  2XTL A;  3NZP A;  1S35 A;  5LNK A;  1KK7 A;  3SS1 A;  2J1N A;  5IYU A;  5DL8 A;  4HGA A;  4YFS A;  2QGS A;  3F2E A;  5JRE A;  4EZ4 A;  2KWH A;  5AFU L;  5DJQ C;  3POQ A;  4B61 A;  4G75 A;  4ZHQ E;  2WSS V;  2C0S A;  3ETV A;  3B57 A;  3MKD A;  4IE4 A;  3K3Q C;  3MJX A;  1ZHX A;  4L0R A;  5LP6 E;  3PE0 A;  3C4Z A;  4OYK A;  4XBF B;  1UCU A;  2NW7 A;  1MIW A;  4MBQ A;  1ZHW A;  3C64 A;  3R84 B;  3G7G A;  4GK0 E;  3R6N A;  2DLR A;  2ACX A;  2E8I A;  2VAS A;  3ZC0 A;  2MNH A;  5FP3 A;  3ZCI A;  3ONX A;  2PRN A;  1X79 A;  3N2K E;  3PUR A;  4PFO A;  1EZ3 A;  7PRN A;  3VZU X;  2C5K T;  2LEH A;  3NZQ A;  5E0O A;  1WYB A;  3SOL A;  4GCQ A;  5G26 A;  3EDU A;  3NRX A;  4IHJ E;  4FSO A;  5HAX A;  1IJ6 A;  2CLY B;  3LK4 1;  4EYU A;  4DBQ A;  2PJQ A;  3RX6 A;  2W00 A;  4H9S E;  4QWN B;  2Y0H A;  4LSH A;  2GK9 A;  4ZI2 C;  2H7O A;  3FB2 A;  2MHL A;  3HA4 A;  2HPL A;  3N9L A;  5LHH B;  4MAL A;  3C50 A;  4IIJ E;  4UIG A;  4BAY B;  4E7S A;  3N9O A;  5L3F B;  5EK2 A;  2HPJ A;  1OSM A;  2Y7S A;  3OJA A;  1KNZ A;  1YKH B;  3HI2 A;  1G8X A;  4H9R C;  4PW8 A;  4CI3 B;  5CB4 E;  2YPV A;  3FBZ A;  1QSD A;  3AVS A;  2KWI B;  4YJ2 E;  3A5X A;  2X9X A;  4QXH B;  2VB6 A;  4TUY E;  1GFO A;  3AA0 B;  4KP3 C;  3ZYL A;  5J1G A;  3Q2M A;  3EUH A;  4MLK A;  5JH7 E;  4ZI7 E;  3HW9 A;  2KDY A;  2D2S A;  4IE0 A;  1THQ A;  4GF4 A;  4O3X B;  3LFM A;  4FT6 A;  1D1B A;  2VK9 A;  2H7V C;  2IW5 B;  3WI3 A;  2GE4 A;  2IC6 A;  5JRC A;  3Q5X A;  1BXW A;  2LHN A;  1MMA A;  4H63 V;  5KDM C;  2NOX A;  3FBL A;  1MIY A;  4L5G A;  2PBI A;  3PQU A;  2P9B A;  4EZH A;  3N9Q A;  4H9P C;  4AQG A;  4AZL A;  4U9C A;  3ZMU B;  5JR9 A;  4A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...