5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
3AA1B 5ADXL 3AA7A 3AA1A 3AAAB 1IZNB 3AA0A 2KZ7A 3LK3A 3AAEB 3AAEA 4AKRA 2KXPA 3AA6B 2KZ7B 3LK2B 3AA0B 3LK42 2KXPB 3AA6A 3AA7B 3LK2A 1IZNA 3AAAA 5ADXK 4AKRB 3LK3B 5AFUL 3LK41 5AFUK
chains in the Genus database with same CATH superfamily
2X66A 3GA8A 2QTKA 1J1JA 2XAGB 2ACXA 3P4SA 1ZEEA 1HS7A 4IDOA 2NW9A 3UPGA 4JI3T 3EMNX 3ZT6A 4NUVA 5JR9B 4AQFC 4GOUA 3CVRA 2WY2A 4U9CA 3KBTA 5ETWA 3AECA 2BVMA 1U4QA 3Q9DA 4C4VA 1I94T 4WBNE 5LHIB 1YQ4A 3KINB 5F5WA 4PAGA 3ZYKA 3RRWA 3RKGA 1WYCA 3LG7A 4GYRA 5LJNA 3ZJ1A 5AQKB 1YKEB 4QHOA 3RYIE 4E1TA 2PTFA 2XASB 2YNKA 3I9YA 3P4WA 3AA6B 1IJ6A 4G63A 2XAHB 3G7GA 3F57A 4ISSA 3M3ZB 1B7TA 4A56A 3PUGA 4FUVA 3LDQB 3PUVF 3OJAA 2C5KT 1NWMX 2BBJA 5LHHB 3KZIO 2WVPA 1LVFA 1THQA 3POQA 2IMLA 2V7JA 3LK42 4GIWA 2UXNB 3RIAA 4DR5T 1AJ3A 4O8SA 4JCHA 3UAQA 4O3WA 3ZC1A 2ZM8A 5LJMA 5L4EA 3SFEA 4KR8A 2YOEA 4UV9B 1KK7A 5JVDE 4QWNB 5C2TA 2XQ3A 3VE2A 3LBXB 1HNZT 3AXJB 3P4RA 2CHNA 3T1HT 3RYFE 4HFIA 3ZSTA 1BR0A 3JC6D 3PUQA 4AKGA 2V5CA 3HKDE 3O1IA 5FXVA 4YSXA 3WI4A 4KHZF 3AEGA 3V5SA 2LOSA 4JI4T 4AUIA 4H9NC 3SYBA 2J1DG 2FJDA 3C51A 4N75A 3AA6A 3DTOA 3A5XA 3OVUA 3UUBA 5CB4E 2IWWA 4GKKT 5G38A 3PJAJ 3KVAA 4PJ0O 2DI4A 3NZPA 3P4QA 5FXWA 2R4LA 3PRNA 3RKOA 4DBRA 3ANWB 2DHRA 3H37A 5LG4A 1ORMA 2JJ9A 3FB2A 5JR9A 3O9XA 2X9XA 4ZZBA 2VWAA 4MALA 4HWCA 1OWAA 2D5UA 5FXXA 2M67A 5HYAA 4IE7A 2W62A 2XQ9A 5L2LA 2YDRA 2VK9A 3B57A 4FOZA 5KXJA 3TLVA 2HPJA 3AE8A 3Q5EA 4CI2B 2JRKA 3VZUX 4PW8A 2X9WA 3HOEA 1FMWA 4N58A 2K4TA 3OYXA 5KMGP 4DV2T 3PQUA 2MAWA 2Y48B 1WFDA 1M62A 2LJLA 3H3AA 3AXJA 3MZKB 4CQIA 2YU2A 4FRTA 1KFYA 5AQRB 1FJGT 2WJQA 1UK5A 2PBIA 3GN5B 3Q5DA 3AE7A 4B3RT 5JDPA 4AKHA 1YKHB 1P4TA 5HXSA 1VOMA 5A1LA 3FZFB 3FBZA 4IE4A 3NRXA 4O49A 4BJMA 3OYZA 4AYDC 2IC9A 2X27X 2CEAA 3L3PA 2X0HA 1IBKT 5HEGA 2ZM2A 3LBXA 4X1KE 3ONLC 4IT4A 5BMVE 1YQ3A 3M65A 4U33A 1S5LO 4GYSA 4FJOA 3CX7B 2XE2A 4A5XA 4FSPA 2VL8A 4DUZT 4U3CA 4IIJE 3J9X1 1BR4A 3UFEA 5EK4A 4X1YE 2JIWA 4C91A 5B66O 4EB6E 4PK4A 2OMFA 3LSVA 5L47A 2QYWA 2KNDA 4ZS3A 2X67A 4DV5T 5FMNA 1QJ8A 2LT3A 5FY1A 5HEOA 2UXCT 4DV4T 2CPTA 3WAKA 5KAFO 3WI3A 4PNIA 3QOFA 4JV5T 4ADZA 2WZHA 4OK0A 4TWFA 4JEUB 3A2SX 4IDQA 4AKIA 5H6QB 4TWHA 4EYYR 5DJQC 4JEHB 5AFUL 5DL8A 2NWBA 2K48A 5FYMA 5ABGA 3V8UA 2XSAA 3AA1B 4X65T 3U3IA 2XQYA 4NXMT 3AE1A 2LE8A 3PUYF 3UU5A 2KXPB 1NAFA 4NUUA 1PHOA 1YW0A 3MJXA 1UX5A 4LFAT 1ZKEA 3HKCE 5HXCA 4JUYA 2XQ7A 2MHLA 4IL4A 4LF4T 2FJAA 3A0HO 4RL9A 2PG8A 4GKJT 1N34T 3BK9A 3IEEA 2YPVA 2K0LA 3POXA 3ZMTB 2Y8DA 4JI8T 4K3BA 4HFCA 5JDQA 4X20E 3S4UA 3UUXB 5DQWA 2V26A 1BH3A 5L3EB 2D0UA 4FT6A 5JDLA 4TX5A 4EEDA 1HF8A 1MNEA 3CK6A 4ZOLE 3RIUC 5HEJA 2YINA 4JI7T 4P0BA 3SRZA 4B3MT 4IGUA 4U2ZA 4H9OC 2IC6A 4LMJA 2XMXA 4DMVA 2KLQA 3NZQA 2UUAT 3WAJA 2PFVA 1Z0PA 3ONXA 2FGQX 5LG3A 2C5IT 3AA1A 1S94A 4Z8XA 4AYMC 3UU3A 2WZIA 2V7MA 2MBGA 2F1CX 4CI1B 3K19A 5L3DB 4PJMA 3VKGA 5LGNB 2ZLDA 5AQGB 4IDZA 4YSZA 4L5GA 3C98B 3T0SA 3AAAB 1HX1B 3UU2A 1XNRT 2YK0A 4IL6O 5BR8T 4YY3T 3RGLA 5HAXA 2V8SV 4YTNA 2AXDS 4QH4A 2ZMAA 4FQEA 2R6GF 4A97A 2LHRA 1KF6A 1O3XA 2WP9A 3K8PC 2BS3A 3ZT7A 5HWYA 3L09A 3CKDA 3FXDB 2VQFT 4HFVA 3OKQA 4JI6T 4CXXA 3B13A 2YKSA 4EYUA 5L4HA 4WZXA 1HTJF 4KMCA 2HN1A 3MK7C 4TNWA 2I59A 3AE3A 4IDPA 5G3AA 5F8PA 3VRAA 4GF4A 4FSOA 2OV9A 4YJ3E 5TISO 2YEVC 4ILUA 2BKOA 1BR1A 2MOZA 5GTHO 4GCSA 4DV1T 1YS5A 3PTRB 5ADXK 1D1CA 2BBHA 2J4GA 3EAMA 3JCUO 3BRZA 3JC6C 2JQHA 1N32T 5AQOB 2V6YB 4DR1T 3A0BO 2EHOC 2KZ7B 4QXBB 3PGSA 2XM1A 3ZCJA 2XAJB 5IYZE 4IL9A 4TZ4C 4OYKA 5CA0E 1IBLT 1QJPA 4ANJA 3AAAA 3R84B 3T24A 4XAXB 3O4XE 3N9NA 2RP4A 2SPCA 2KDYA 4P09A 4BA9A 2XE1A 4UF0A 4DR7T 4HE8A 3FBLA 3FZHB 2B76A 3ABVA 4F4BA 4YXDA 2W80C 5AQMB 2CM0A 4YSYA 2XAFB 4GCPA 2LHNA 5LBMA 2UXDT 4LF8T 1XWMA 1ZHYA 3ONJA 2XHEB 2VQET 4PJJA 4U7IA 4XZCA 1E1HB 3OPCA 4ZI2C 3D0TA 5JRCB 4NIQA 4HFDA 3ZT5A 4TUYE 2X9YA 3ZLIA 3C5OA 1CHUA 4TV9E 4RLBA 2LSGA 4LF6T 4ZI3D 3HWBA 1OEDE 3HKBE 2QVAA 1ZV4X 5F3JA 1SUMB 4DV0T 3QNUA 3EUHA 4U31A 4X1IE 2JMMA 1JNZA 2WCAA 3ETUA 4H63H 1QJ9A 2MNHA 5FVKA 1BXWA 4ASKA 3I9WA 3RLFF 3UULA 1VCSA 1X9BA 3BRYA 2R8AA 2CWYA 1OEDC 2X68A 5JRCA 4GK5E 2WDRA 5AQTB 1WLXA 3VHLA 2KT9A 2CHOA 5AQUB 2HHHT 2YDQA 2EHOA 4EAHA 2IWVA 4JLEA 3UFGA 3TKLB 3PJAA 3ZMVB 1D0YA 1XMQT 1MIYA 4K0UA 3LFMA 4G2AA 2K5BB 4O4UA 3AAEA 4EOZB 4AFKA 4AQGA 4EZHA 2L9QA 3A8YC 5IUXA 3PUWF 3O1HA 4PK5A 3E22E 3PQSA 1U5PA 1HG5A 4DBQA 3VZWX 1NEKA 2CXFA 3FYXA 1DU2A 4KBMB 3RC3A 3AEDA 3SYSA 1WRDA 3AE2A 4L0RA 3I0OA 3G06A 5LGTB 2CCQA 2YU1A 3CMLA 2R88A 4UF0B 3N2KE 2XY8B 4ZI2D 1LKXA 3AEEA 1XDOA 4QXCB 5FKYA 3VY8X 2ODJA 4UIGA 3N2OA 3ZPOA 5FP3A 4K3CA 4X64T 3SS1A 2DNXA 1T1LA 5B5EO 2PRNA 2KMFA 1CUNA 1W09A 1T16A 1SA0E 1XZYA 5HXEA 2A9UA 2IIUA 4BJNA 3C4XA 3ZYLA 1G8XA 1GFNA 3RC8A 3JADA 2OLTA 4WBOA 4AYEC 2H7VC 1OXZA 2KINB 4DR6T 1QLBA 3N9MA 2WB5A 2DCFA 2XTQA 2V7KA 5EK2A 4QXHB 3UTKA 5IYUA 4EZ4A 4DR2T 3ZC0A 3FHNA 1HX8A 2HPLA 5L3CB 3QC9A 3N2GE 3POUA 4LMLA 1VCTA 3AEAA 5C8YE 2E9XA 4B61A 1ZP0A 3IBPA 2XAQB 5HXRA 6PRNA 5AQPB 2UU9T 1X79A 2N2LA 5GTIO 3F2EA 2DLRA 2F4VT 4QKNA 5CJ5A 2UXBT 1FIOA 3EHZA 2VB6A 5D5DA 2E5LT 4FI5A 4DMWA 2J47A 3K1SA 4RJXA 2XE5A 2LFUA 1E7PA 1HNXT 3C64A 3SZVA 5AFUK 4UB6O 4DV7T 5LGUB 2PJQA 1KNPA 1HR0T 4COFA 2M07A 4FZMA 4O2BE 2O4VA 4G75A 2CBIA 1WR6A 2XUEA 5DQVA 3P4PA 2XQ8A 4I50E 4HWHA 1YD8G 1QSDA 2XTLA 4MBQA 5LNKA 3C4WA 1LRZA 4V1Av 4WW0A 2NR4A 4AIUA 5FXZA 2LSKA 3CQCB 4DUYT 2Q9QD 2K24A 2BDEA 4HFBA 2XQ4A 3RIUA 3SY7A 1MMNA 3DWOX 3PURA 3UQ4A 4CN4A 3PUXF 4N59A 4PR7A 2KSRA 3VR8A 4O4JE 3QRCA 4Z3TA 3J7Yq 2RPAA 3QB5K 2Q9QB 2L3LA 3K3OA 2H89A 3TLSA 5FL0A 3BS0A 4LSEA 2XQ6A 5L3BB 3KV6A 3DJBA 3UU4A 5JREA 3AEFA 2XJ7A 4ZI7E 3E0ZA 1WYBA 4DVDA 2LHFA 2M06A 5KX5E 2B1EA 4QH5A 2JMHA 2MPKA 2LM9A 4ZZCA 2PORA 2R4NA 4H9RC 5FL1A 4MHCA 3MXZA 2X0LB 4WNKA 1BR2A 3ZMZB 5JR9C 1W0BA 1GQEA 4H9QC 3L8RA 2BZBA 3UT5E 1LVKA 3KV9A 3K3QC 4EGWA 2VKDA 5KAIO 2WSSV 4PUXA 5M4YA 4HWIB 2WDVA 3BQKA 1EZ3A 5JDMA 8PRNA 2WDQA 2CLYB 4UVCB 3NRYA 3O1JA 2BKPA 2J1NA 5LCYA 1QUUA 4YTMA 5CA1E 3JTYA 3KVDD 2WWVA 4H63V 3L39A 3IHRA 2LLYA 2CE7A 4O3YA 3RPUA 3UU8A 4LMKA 4NXNT 4CZZB 4C4VB 4MLKA 4M1PA 3ZSSA 2Q9QC 2V1DB 3BQIA 3HW9A 3PDYA 4ILCA 2I0MA 3EI0A 3PE0A 3TLWA 4U72A 4E7ZA 2CA5A 2QA7A 3ZMSB 2CXLA 4B6XA 4NPPA 2WJRA 2ZM6T 5FNVE 3KV5A 4H9SE 1D0ZA 5ABHA 3AEBA 2W66A 1FMVA 3TZGA 3N9QA 3SY9A 5JDGA 3NWIA 1OEDA 3RYCE 2NW8A 2A2FX 4O3XB 2BG9A 4YHHT 1OPFA 4B3ST 4RLCA 4ZI3C 1XMOT 5AQLB 1HG2A 4AI6A 1PRNA 2ES0A 3CPZA 5DABA 2F1VA 4FRXA 3K3NA 3UU6A 2ZFGA 3PF1A 3QB5A 3PGUA 2BKNA 2KWHA 3DA4A 3KVBA 4CXWA 2IW5B 2BS2A 3QRAA 3F31A 4PJLA 5JDFA 2D2SA 3SOLA 4FZNA 3JAEA 3O0EA 4H9PC 2W00A 2QGSA 4P0AA 2Q9QA 4YFSA 1HXXA 3SFDA 2WU5A 5HCMA 4F6RC 1VRBA 1ZHWA 3Q2MA 4EXTA 5ADXL 4I0UA 2VVSA 1E54A 2EHOD 3EDUA 1M7KA 2Y2XA 5AQHB 4AKMA 3X1DA 1HCIA 2QRXA 3R6NA 3VE1A 3CQGB 2X9KA 3PV0F 5JDNA 1OSMA 4LF9T 4HTEA 5AQSB 5TAOA 4J2CA 4TNVA 3I1AA 3C4ZA 4IHJE 4RJWA 4ZS2A 4L9IA 1SHZC 4N78D 1HFAA 3P8CD 4OHFA 1KEYA 3VKHA 2CXDA 3AA0B 4FMSA 4AYNA 3NVOA 2VURA 3OBVE 5EE2A 3IF8B 2ZM0A 1MIVA 5LMNT 1N33T 3CWZB 3AVRA 4AYID 5JQGE 1H7CA 2FBWA 4LFCT 1SE7A 3HR0A 2CWOA 2AE9A 2KXPA 1E2AA 2LM2A 1OEDB 3AVSA 5FVLA 1IBMT 2XE3A 1YXRA 3FZMB 1BT9A 3Q5XA 4DV3T 3TLTA 4FZLA 1HXTA 2I6HA 2FJBA 4AISA 4JYAT 2W81C 2FUPA 5LHGB 1MMDA 3N9PA 3RH3A 1IZNA 5LXTE 3FZLB 3AE9A 3B5MA 2CLYC 5T5FA 2N9DA 3N9OA 1GFMA 1MIWA 2VKHA 2E5VA 1JNRA 2J62A 5EK3A 2XQ5A 2DWKA 5HEHA 3TLUA 2JQYA 3PUAA 4JBWF 1MMAA 3E08A 2FJEA 2R89A 4LSIA 1S35A 4PJNA 5PRNA 2CBJA 4JI2T 3VY9X 2WS3A 4EIWA 3HL6A 5FY0A 2NTXA 3KV4A 5GONE 5H2FO 1Q9GA 2BG9E 3ZEFB 2VL0A 4AZLA 4UR9A 4O4XA 2EHOB 1J5ET 4ERRA 1MNDA 3BQLA 3NKZA 2K3WA 2YN6A 5LYJE 4OFZA 4ZHQE 3CX8B 4UB8O 4E7SA 3IA3A 4YTPA 2LKGA 4GCQA 2VVNA 3GMIA 4C90A 4XNKA 4AXPA 2VKOA 5HCJA 3QUJA 2H3RA 1L0VA 2N1GA 2E2AA 3ZMUB 3ZN1B 4D65A 2JPFA 5EZYE 2Y7SA 2N2NA 2G0UA 2CMRA 4O4HE 3VRBA 3GWHA 4QX7B 2W2UA 4OYJA 2L8KA 4I43B 4K0KT 3GP6A 4I4TE 4OX9T 3RBHA 4UELA 4PFOA 4O2AE 4LSHA 3VZTX 2IUBA 3JCFA 1ZHZA 2V6YA 3LK3A 4O3ZA 3GN5A 3NBXX 3RQUA 3A7MA 2WQYA 4CTDA 4HKAA 4AQYT 3EVYA 4LF5T 3RIFA 3FZKB 4ISTA 4XBFB 4HEAA 2J4UP 1D0XA 3PU3A 4HN9A 4JI1T 2V7IA 3ESLA 3N5LA 2K9AA 2Z6EA 4UXNB 1MPFA 1D1AA 4GK0E 3PORA 3ZN0B 5DL7A 4Z91A 4KX6A 2P9BA 2R4OA 2D0TA 1MM5A 3LK2A 3PUSA 5LOVE 2ERVA 2V7LA 1US7B 2XTRA 5J1GA 4C69X 1Q9FA 2LRKA 2R4PA 2M6BA 4AQFA 2CRBA 1T7SA 2JQKA 3DZMA 2WAUA 2XPKA 2H88A 2BVLA 1HNWT 2LRLA 5IHYA 1ZHXA 2XQAA 3Q5WA 1UCUA 2XSBA 1T98A 5ABEA 3JAFA 2Y0KA 4UVBB 4HGAA 1UUSA 2HH7A 3CIRA 5CGMA 4G76A 4AKRA 3LK2B 3AB3B 3C50A 3RRCA 5AQJB 3OTOT 4O4LE 5G26A 3UUNA 3UUMA 5C3JA 5LP6E 4YHJA 1WR0A 5L3FB 1IJ5A 5AQNB 2F1TA 1N36T 2AXTO 4FESA 4IE0A 5KDMC 1IAPA 1IZNB 3AE6A 3T8OA 2KZ7A 4YT0A 5DL5A 4PFPA 2W67A 4TV8E 4D5UA 3CQXC 2NOXA 2KWIB 1GFOA 3EABA 3HI2A 3W15B 3LK41 2WMOA 4P1NA 2ACZA 4IDNA 3PU8A 3MKDA 5AQQB 2C0SA 3VR9A 2A3DA 1HXUA 4F8HA 5L3GB 4UEMA 4KP3C 2N2MA 5G39A 2BG9C 3WU2O 4U7YA 4LSFA 1W0AA 5IWAT 4LFBT 5JDHA 5LB7B 1T72A 5ABFB 4DO0A 5AQIB 1Y01A 4U2YA 1Z8UA 4KHPT 4X66T 3T1YT 5LMUT 1G73A 4KI0F 2UUBT 4O4IE 1ZHTA 3KDSE 2C5JA 2YDSA 4CXYA 2BS4A 2WMNA 1XDPA 1FEWA 3AA0A 3MACA 3DA3A 5J2TE 4MFRA 3AAEB 4WYVA 2ODVA 2V6XA 2UXXB 3ZKRA 2A72A 4U74A 2DL1A 2H7OA 2Y0LA 5HEUA 3RI5A 2W4XA 1UGOA 2M6IA 5FY7A 1MM4A 7PRNA 2WU2A 1UURA 3RYHE 2Y6XA 2Y0HA 4HFEA 2XG6A 3DP7A 1KNRA 2MYSA 2JMKA 2XZEA 3RQWA 1UX4A 2D9DA 2IAKA 5J0ZA 4QQ1A 5JTGA 2XM2A 2OA5A 2KC0A 4BAYB 3AA7A 5ABFA 4B3TT 3HKEE 1Y64B 2RA1A 3KBUA 1NENA 1R8IA 2IDOB 4DR3T 4ILBA 2X51A 3ETVA 4X5TA 3N9LA 4UV8B 4EV6A 3UQ7A 2VKJA 2BG9B 2GE4A 4C00A 5J2UE 5E79O 4QX8B 3RF1A 3LJCA 3PUZF 3V5UA 5FVNA 1XNQT 3VU7H 3ZCIA 3DWNA 5CFBA 2GK9A 2WWUA 1I6ZA 4AKLA 2ODUA 3AE4A 3T20A 2LSYA 1MMGA 5LBQB 2WM9A 4BUMX 4JI5T 5H6RB 2NP9A 2W63A 4XNLA 1H6S1 4GHBA 2E9XC 5JH7E 3HA4A 4A98A 1V9DA 4DIDB 1G90A 2LOPA 4EEBA 2IHR1 4HFHA 2LSIA 3NSGA 2ZLYA 4AKRB 4DNDA 2JQ9A 3QK6A 2HN2A 1ZOYA 2NW7A 3I0QA 3NJTA 3CX6B 3U78A 3FXEB 4I55E 4DR4T 2X9HA 4YLHA 5HWXA 1WCRA 2V5DA 2MTQA 3RHWA 1W9RA 2NTYA 3PGRA 2LKHA 5GV0A 4Q25A 4PK6A 4IE6A 4DV6T 3ZYMA 2E8IA 4ZEYA 3MA9A 4LF7T 2VASA 1GFPA 3KFWX 4IREA 4JI0T 1D1BA 5AQVB 3EDVA 4QH1A 4D64A 2WBLA 4CN1A 4CI3B 3RX6A 5E0OA 4KUMB 3ZJ2A 3ANWA 1GFQA 1T8BA 2X0YA 3HOLA 4Z90A 4IE5A 3P7IA 2UUCT 5HXHA 5DL6A 4ILAA 4X62T 4KR4A 4ZXLA 1J5WA 2LSJA 1ZHCA 3LK3B 2DWGA 4TN7B 5LA6E 2LEHA 2W0GA 3AAIA 2E9XB 4JFBA 4YJ2E 4UVAB 5AQFB 4HWDA 2W61A 4E1SA 2JQQA 3SWHA 2FGRA 3H3MA 4CN6A 3P50A 4HWFA 4TWDA 3AA7B 3SZDA 1KNZA 2E9XD 3AE5A 4N74A 4KRAA 3WI5A
chains in the Genus database with same CATH topology
1Z0PA 3RBHA 3ONXA 4UELA 4PFOA 4WW0A 2X66A 4O2AE 2FGQX 3GA8A 4LSHA 5FXZA 2QTKA 2C5IT 3VZTX 2XAGB 3AA1A 1S94A 2ACXA 4Z8XA 2LSKA 1ZHZA 4AYMC 1ZEEA 3CQCB 1HS7A 3LK3A 4O3ZA 2Q9QD 3GN5A 2NW9A 3UPGA 3NBXX 2V7MA 2K24A 2BDEA 2MBGA 4HKAA 4CI1B 3EVYA 3SY7A 3EMNX 5L3DB 3K19A 4PJMA 1MMNA 4NUVA 5JR9B 3VKGA 3PURA 4AQFC 4ISTA 4XBFB 4HEAA 4GOUA 5LGNB 3CVRA 1D0XA 2ZLDA 4N59A 3PU3A 2J4UP 4HN9A 4IDZA 4O4JE 2V7IA 3J7Yq 3QRCA 4Z3TA 4L5GA 3C98B 2Q9QB 2L3LA 3K3OA 3ESLA 3N5LA 3T0SA 2K9AA 4U9CA 3KBTA 2Z6EA 3AAAB 4UXNB 5ETWA 1MPFA 2BVMA 5L3BB 1U4QA 4LSEA 1D1AA 4GK0E 3Q9DA 3PORA 3ZN0B 5DL7A 3KV6A 3UU2A 3DJBA 2P9BA 2YK0A 4WBNE 5LHIB 5JREA 5HAXA 3KINB 2D0TA 4PAGA 3ZYKA 3RRWA 4ZI7E 1MM5A 3LK2A 3PUSA 2ZMAA 1WYCA 1WYBA 3E0ZA 3LG7A 4DVDA 2LHFA 4GYRA 5LOVE 2M06A 5KX5E 2ERVA 5LJNA 2B1EA 2V7LA 1US7B 2JMHA 3ZJ1A 5J1GA 2XTRA 4C69X 1YKEB 1Q9FA 4QHOA 3RYIE 4E1TA 2LM9A 2LHRA 2PORA 1O3XA 4H9RC 3K8PC 4AQFA 2XASB 5HWYA 2YNKA 3I9YA 4MHCA 3MXZA 3L09A 3CKDA 3FXDB 3AA6B 2X0LB 4WNKA 4HFVA 2WAUA 3OKQA 4CXXA 3B13A 1BR2A 3ZMZB 2BVLA 1IJ6A 4G63A 5JR9C 4EYUA 5IHYA 2XAHB 4D65A 1ZHXA 3G7GA 5GV0A 3F57A 4H9QC 1HTJF 4ISSA 4KMCA 2BZBA 3UT5E 3MK7C 2I59A 3Q5WA 1UCUA 1T98A 1B7TA 4A56A 3PUGA 1LVKA 3KV9A 5F8PA 2Y0KA 4FUVA 3K3QC 3OJAA 4UVBB 2C5KT 1NWMX 2VKDA 2WSSV 4GF4A 4HGAA 4FSOA 5LHHB 5M4YA 4PUXA 4YJ3E 1LVFA 2HH7A 3BQKA 4G76A 1THQA 3POQA 4AKRA 1EZ3A 2YEVC 2V7JA 3LK2B 5JDMA 8PRNA 3AB3B 3LK42 3C50A 1BR1A 2CLYB 2MOZA 4GIWA 2UXNB 4ILUA 4UVCB 3RRCA 4GCSA 3NRYA 4O4LE 3O1JA 5G26A 5JDLA 5LCYA 1QUUA 3UUNA 3UUMA 3PTRB 4O8SA 4YHJA 5CA1E 5LP6E 1YS5A 5L3FB 4JCHA 3JTYA 1D1CA 3UAQA 5ADXK 4O3WA 3ZC1A 3KVDD 1IJ5A 4H63V 2F1TA 2ZM8A 5LJMA 3IHRA 3JC6C 4FESA 4IE0A 5KDMC 4KR8A 1IAPA 1IZNB 2CE7A 4UV9B 3T8OA 2KZ7A 1KK7A 4O3YA 5JVDE 5DL5A 4QWNB 4PFPA 3RPUA 2EHOC 3LBXB 2KZ7B 4QXBB 4TV8E 3VE2A 4D5UA 4CZZB 3CQXC 4MLKA 3RYFE 3ZCJA 4M1PA 2NOXA 2XAJB 1BR0A 5IYZE 2Q9QC 2KWIB 3JC6D 4OYKA 4TZ4C 2V1DB 3BQIA 4ANJA 5CA0E 3PUQA 1QJPA 3R84B 1GFOA 4AKGA 3PDYA 3HKDE 3AAAA 3HW9A 3O1IA 4XAXB 3T24A 5FXVA 3HI2A 3PE0A 3W15B 3LK41 2WMOA 3WI4A 3O4XE 3N9NA 4U72A 2RP4A 3V5SA 2SPCA 2LOSA 3PU8A 3MKDA 4E7ZA 2CA5A 2QA7A 2KDYA 2C0SA 4P09A 4AUIA 4H9NC 2CXLA 3ZMSB 4B6XA 3SYBA 4BA9A 2XE1A 4UF0A 2A3DA 5FNVE 1HXUA 3KV5A 5L3GB 4H9SE 1D0ZA 2J1DG 4HE8A 4UEMA 3FBLA 4KP3C 4F4BA 2N2MA 2W80C 3C51A 3AA6A 3DTOA 2CM0A 3A5XA 1FMVA 2XAFB 5CB4E 3TZGA 3N9QA 4GCPA 3KVAA 3SY9A 2LHNA 5LBMA 5JDGA 2DI4A 4LSFA 3RYCE 3NZPA 1ZHYA 2NW8A 5JDHA 2A2FX 5FXWA 2XHEB 4DO0A 3PRNA 3RKOA 4DBRA 4PJJA 4O3XB 4XZCA 3ANWB 2DHRA 1OPFA 1E1HB 3H37A 5LG4A 4ZI2C 1ORMA 3D0TA 4RLCA 4ZI3C 2JJ9A 4AI6A 1HG2A 3FB2A 1PRNA 2ES0A 3CPZA 5DABA 5JR9A 5JRCB 2F1VA 3O9XA 4FRXA 3K3NA 2X9XA 1G73A 2VWAA 4MALA 4TUYE 2X9YA 4O4IE 3ZLIA 3C5OA 1OWAA 1ZHTA 2D5UA 3KDSE 2C5JA 5FXXA 2M67A 4CXYA 4TV9E 2ZFGA 4RLBA 2LSGA 5HYAA 4IE7A 2W62A 2WMNA 2KWHA 4ZI3D 3DA4A 1FEWA 3KVBA 3AA0A 3HKBE 3MACA 4CXWA 2IW5B 5J2TE 5L2LA 3DA3A 3HWBA 1ZV4X 3F31A 3QRAA 4PJLA 3B57A 2VK9A 4MFRA 5JDFA 2D2SA 3AAEB 5F3JA 4FOZA 3SOLA 4FZNA 2HPJA 2ODVA 2UXXB 3O0EA 4CI2B 2JRKA 3VZUX 3EUHA 4H9PC 2W00A 2QGSA 4P0AA 4PW8A 2X9WA 4X1IE 2JMMA 2Q9QA 2A72A 4U74A 4YFSA 1HXXA 3HOEA 1FMWA 2H7OA 4N58A 3ETUA 3OYXA 4H63H 5KMGP 1QJ9A 1BXWA 2K4TA 2MNHA 2Y0LA 3PQUA 2Y48B 4F6RC 2LJLA 3H3AA 4ASKA 1VRBA 1ZHWA 3I9WA 3MZKB 3Q2MA 2YU2A 3UULA 5FY7A 4CQIA 4EXTA 5ADXL 1MM4A 4FRTA 7PRNA 1E54A 2EHOD 3EDUA 2Y2XA 3RYHE 2Y6XA 2Y0HA 4AKMA 1HCIA 2XG6A 2PBIA 3GN5B 3R6NA 3DP7A 3VE1A 3CQGB 2MYSA 5JDPA 4AKHA 5JDNA 1OSMA 2JMKA 2CWYA 2X68A 4HTEA 1YKHB 5JRCA 5TAOA 1P4TA 4GK5E 1UX4A 4J2CA 5HXSA 1VOMA 1WLXA 5A1LA 3VHLA 2IAKA 2KT9A 3I1AA 1AJ3A 4QQ1A 3FBZA 3C4ZA 4IHJE 2OA5A 2EHOA 4EAHA 4ZS2A 2KC0A 4RJWA 4L9IA 4BAYB 4IE4A 3NRXA 3AA7A 1SHZC 4JLEA 4O49A 4BJMA 3HKEE 1Y64B 3OYZA 4AYDC 4N78D 2IC9A 3TKLB 2RA1A 2X27X 3ZMVB 1D0YA 2CEAA 1MIYA 1HFAA 3KBUA 3L3PA 4K0UA 3LFMA 3P8CD 4G2AA 2K5BB 4O4UA 4OHFA 4EOZB 3AAEA 3VKHA 2X51A 4AFKA 3ETVA 2CXDA 3AA0B 4AQGA 4FMSA 4EZHA 2ZM2A 3LBXA 2L9QA 3N9LA 4UV8B 4AYNA 3O1HA 4PK5A 2VKJA 3E22E 3OBVE 4X1KE 3IF8B 3PQSA 5EE2A 1U5PA 5BMVE 2GE4A 1HG5A 2ZM0A 4DBQA 1MIVA 3M65A 3VZWX 2J1NA 3CWZB 3AVRA 5J2UE 2CXFA 4QX8B 3LJCA 3FYXA 4AYID 5JQGE 3V5UA 1H7CA 4GYSA 4KBMB 5FVNA 3RC3A 4FJOA 3SYSA 1WRDA 4L0RA 3VU7H 3CX7B 3HR0A 2XE2A 2CWOA 3I0OA 4FSPA 5LGTB 2KXPA 3ZCIA 2CCQA 2GK9A 2VL8A 2YU1A 2WWUA 3CMLA 4AKLA 2ODUA 4IIJE 4UF0B 1BR4A 3J9X1 3N2KE 3AVSA 1LKXA 4ZI2D 4QXCB 3VY8X 3T20A 2LSYA 2XE3A 2ODJA 4UIGA 1MMGA 3N2OA 3ZPOA 1BT9A 5LBQB 3UFEA 5FP3A 3Q5XA 3SS1A 2DNXA 5EK4A 2WM9A 4X1YE 4BUMX 2PRNA 5H6RB 4FZLA 1HXTA 4C91A 2KMFA 2NP9A 4PK4A 2W63A 4EB6E 1H6S1 4XNLA 4GHBA 1CUNA 2E9XC 2OMFA 5JH7E 1SA0E 3HA4A 5HXEA 2W81C 2KNDA 1V9DA 4ZS3A 5LHGB 1G90A 4BJNA 2LOPA 1MMDA 3N9PA 3RH3A 3C4XA 3ZYLA 2X67A 2LSIA 5FMNA 1IZNA 5LXTE 3NSGA 1G8XA 2ZLYA 4AKRB 4DNDA 1GFNA 2LT3A 2CLYC 5FY1A 3RC8A 1QJ8A 3QK6A 4WBOA 5T5FA 2N9DA 3N9OA 2NW7A 3WAKA 1GFMA 4AYEC 2H7VC 3WI3A 1MIWA 3I0QA 1OXZA 2VKHA 3CX6B 3U78A 3FXEB 4I55E 5LGUB 4PNIA 5EK3A 2KINB 2DWKA 2X9HA 3PUAA 1MMAA 4YLHA 4ADZA 5HWXA 3N9MA 3E08A 2DCFA 4LSIA 4OK0A 4JEUB 2MTQA 3A2SX 1S35A 2XTQA 2V7KA 4AKIA 5EK2A 4QXHB 4PJNA 3UTKA 5PRNA 5H6QB 2NTYA 3VY9X 5IYUA 4EYYR 4EZ4A 5DJQC 4EIWA 4JEHB 5AFUL 3ZC0A 3FHNA 2NWBA 2K48A 1HX8A 3HL6A 5FYMA 2HPLA 4PK6A 5DL8A 4IE6A 5FY0A 3V8UA 2NTXA 3AA1B 3KV4A 5L3CB 3QC9A 5GONE 3U3IA 2XQYA 3ZYMA 3N2GE 2E8IA 1Q9GA 3POUA 3ZEFB 4AZLA 2LE8A 3MA9A 4O4XA 5C8YE 2VASA 2E9XA 1GFPA 3KFWX 4B61A 2EHOB 1D1BA 3IBPA 2XAQB 4ERRA 5HXRA 2KXPB 6PRNA 1MNDA 3BQLA 3EDVA 1X79A 1NAFA 4NUUA 1PHOA 1YW0A 2N2LA 4D64A 2WBLA 3F2EA 2DLRA 1UX5A 3MJXA 4QKNA 1ZKEA 3HKCE 5LYJE 5HXCA 4JUYA 4OFZA 4CI3B 1FIOA 3CX8B 3RX6A 4ZHQE 2VB6A 4KUMB 5E0OA 5D5DA 3ZJ2A 3ANWA 4FI5A 4DMWA 1GFQA 4E7SA 2MHLA 4RJXA 3HOLA 2XE5A 4RL9A 2PG8A 4GCQA 3GMIA 2YPVA 3BK9A 3IEEA 4IE5A 3C64A 4C90A 3P7IA 2LFUA 4AXPA 5HXHA 4XNKA 2K0LA 2VKOA 5DL6A 4KR4A 3POXA 3ZMTB 3QUJA 2Y8DA 5JDQA 2H3RA 2N1GA 4X20E 3S4UA 3ZMUB 3UUXB 2LSJA 1ZHCA 3LK3B 5DQWA 3SZVA 2V26A 1BH3A 2DWGA 5AFUK 4TN7B 5LA6E 2D0UA 5L3EB 3ZN1B 2LEHA 2W0GA 2PJQA 3AAIA 4TX5A 1HF8A 1MNEA 2JPFA 4ZOLE 2E9XB 4JFBA 2YINA 4YJ2E 2M07A 4UVAB 4P0BA 4FZMA 3SRZA 4O2BE 2W61A 4IGUA 5EZYE 2O4VA 1WR6A 2Y7SA 4G75A 4E1SA 2XUEA 2JQQA 2N2NA 3SWHA 2FGRA 2G0UA 2CMRA 4H9OC 4O4HE 5DQVA 2IC6A 3GWHA 4QX7B 4I50E 2XMXA 4DMVA 1YD8G 1QSDA 4FT6A 2XTLA 2KLQA 3AA7B 4OYJA 3SZDA 2L8KA 4I43B 1KNZA 4MBQA 2E9XD 3NZQA 3C4WA 5LNKA 3GP6A 3WAJA 4KRAA 1LRZA 3WI5A 4V1Av 2PFVA 4I4TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 B;  5ADX L;  3AA7 A;  3AA1 A;  3AAA B;  1IZN B;  3AA0 A;  2KZ7 A;  3LK3 A;  3AAE B;  3AAE A;  4AKR A;  2KXP A;  3AA6 B;  2KZ7 B;  3LK2 B;  3AA0 B;  3LK4 2;  2KXP B;  3AA6 A;  3AA7 B;  3LK2 A;  1IZN A;  3AAA A;  5ADX K;  4AKR B;  3LK3 B;  5AFU L;  3LK4 1;  5AFU K; 
#chains in the Genus database with same CATH topology
 2X66 A;  3GA8 A;  2QTK A;  1J1J A;  2XAG B;  2ACX A;  3P4S A;  1ZEE A;  1HS7 A;  4IDO A;  2NW9 A;  3UPG A;  4JI3 T;  3EMN X;  3ZT6 A;  4NUV A;  5JR9 B;  4AQF C;  4GOU A;  3CVR A;  2WY2 A;  4U9C A;  3KBT A;  5ETW A;  3AEC A;  2BVM A;  1U4Q A;  3Q9D A;  4C4V A;  1I94 T;  4WBN E;  5LHI B;  1YQ4 A;  3KIN B;  5F5W A;  4PAG A;  3ZYK A;  3RRW A;  3RKG A;  1WYC A;  3LG7 A;  4GYR A;  5LJN A;  3ZJ1 A;  5AQK B;  1YKE B;  4QHO A;  3RYI E;  4E1T A;  2PTF A;  2XAS B;  2YNK A;  3I9Y A;  3P4W A;  3AA6 B;  1IJ6 A;  4G63 A;  2XAH B;  3G7G A;  3F57 A;  4ISS A;  3M3Z B;  1B7T A;  4A56 A;  3PUG A;  4FUV A;  3LDQ B;  3PUV F;  3OJA A;  2C5K T;  1NWM X;  2BBJ A;  5LHH B;  3KZI O;  2WVP A;  1LVF A;  1THQ A;  3POQ A;  2IML A;  2V7J A;  3LK4 2;  4GIW A;  2UXN B;  3RIA A;  4DR5 T;  1AJ3 A;  4O8S A;  4JCH A;  3UAQ A;  4O3W A;  3ZC1 A;  2ZM8 A;  5LJM A;  5L4E A;  3SFE A;  4KR8 A;  2YOE A;  4UV9 B;  1KK7 A;  5JVD E;  4QWN B;  5C2T A;  2XQ3 A;  3VE2 A;  3LBX B;  1HNZ T;  3AXJ B;  3P4R A;  2CHN A;  3T1H T;  3RYF E;  4HFI A;  3ZST A;  1BR0 A;  3JC6 D;  3PUQ A;  4AKG A;  2V5C A;  3HKD E;  3O1I A;  5FXV A;  4YSX A;  3WI4 A;  4KHZ F;  3AEG A;  3V5S A;  2LOS A;  4JI4 T;  4AUI A;  4H9N C;  3SYB A;  2J1D G;  2FJD A;  3C51 A;  4N75 A;  3AA6 A;  3DTO A;  3A5X A;  3OVU A;  3UUB A;  5CB4 E;  2IWW A;  4GKK T;  5G38 A;  3PJA J;  3KVA A;  4PJ0 O;  2DI4 A;  3NZP A;  3P4Q A;  5FXW A;  2R4L A;  3PRN A;  3RKO A;  4DBR A;  3ANW B;  2DHR A;  3H37 A;  5LG4 A;  1ORM A;  2JJ9 A;  3FB2 A;  5JR9 A;  3O9X A;  2X9X A;  4ZZB A;  2VWA A;  4MAL A;  4HWC A;  1OWA A;  2D5U A;  5FXX A;  2M67 A;  5HYA A;  4IE7 A;  2W62 A;  2XQ9 A;  5L2L A;  2YDR A;  2VK9 A;  3B57 A;  4FOZ A;  5KXJ A;  3TLV A;  2HPJ A;  3AE8 A;  3Q5E A;  4CI2 B;  2JRK A;  3VZU X;  4PW8 A;  2X9W A;  3HOE A;  1FMW A;  4N58 A;  2K4T A;  3OYX A;  5KMG P;  4DV2 T;  3PQU A;  2MAW A;  2Y48 B;  1WFD A;  1M62 A;  2LJL A;  3H3A A;  3AXJ A;  3MZK B;  4CQI A;  2YU2 A;  4FRT A;  1KFY A;  5AQR B;  1FJG T;  2WJQ A;  1UK5 A;  2PBI A;  3GN5 B;  3Q5D A;  3AE7 A;  4B3R T;  5JDP A;  4AKH A;  1YKH B;  1P4T A;  5HXS A;  1VOM A;  5A1L A;  3FZF B;  3FBZ A;  4IE4 A;  3NRX A;  4O49 A;  4BJM A;  3OYZ A;  4AYD C;  2IC9 A;  2X27 X;  2CEA A;  3L3P A;  2X0H A;  1IBK T;  5HEG A;  2ZM2 A;  3LBX A;  4X1K E;  3ONL C;  4IT4 A;  5BMV E;  1YQ3 A;  3M65 A;  4U33 A;  1S5L O;  4GYS A;  4FJO A;  3CX7 B;  2XE2 A;  4A5X A;  4FSP A;  2VL8 A;  4DUZ T;  4U3C A;  4IIJ E;  3J9X 1;  1BR4 A;  3UFE A;  5EK4 A;  4X1Y E;  2JIW A;  4C91 A;  5B66 O;  4EB6 E;  4PK4 A;  2OMF A;  3LSV A;  5L47 A;  2QYW A;  2KND A;  4ZS3 A;  2X67 A;  4DV5 T;  5FMN A;  1QJ8 A;  2LT3 A;  5FY1 A;  5HEO A;  2UXC T;  4DV4 T;  2CPT A;  3WAK A;  5KAF O;  3WI3 A;  4PNI A;  3QOF A;  4JV5 T;  4ADZ A;  2WZH A;  4OK0 A;  4TWF A;  4JEU B;  3A2S X;  4IDQ A;  4AKI A;  5H6Q B;  4TWH A;  4EYY R;  5DJQ C;  4JEH B;  5AFU L;  5DL8 A;  2NWB A;  2K48 A;  5FYM A;  5ABG A;  3V8U A;  2XSA A;  3AA1 B;  4X65 T;  3U3I A;  2XQY A;  4NXM T;  3AE1 A;  2LE8 A;  3PUY F;  3UU5 A;  2KXP B;  1NAF A;  4NUU A;  1PHO A;  1YW0 A;  3MJX A;  1UX5 A;  4LFA T;  1ZKE A;  3HKC E;  5HXC A;  4JUY A;  2XQ7 A;  2MHL A;  4IL4 A;  4LF4 T;  2FJA A;  3A0H O;  4RL9 A;  2PG8 A;  4GKJ T;  1N34 T;  3BK9 A;  3IEE A;  2YPV A;  2K0L A;  3POX A;  3ZMT B;  2Y8D A;  4JI8 T;  4K3B A;  4HFC A;  5JDQ A;  4X20 E;  3S4U A;  3UUX B;  5DQW A;  2V26 A;  1BH3 A;  5L3E B;  2D0U A;  4FT6 A;  5JDL A;  4TX5 A;  4EED A;  1HF8 A;  1MNE A;  3CK6 A;  4ZOL E;  3RIU C;  5HEJ A;  2YIN A;  4JI7 T;  4P0B A;  3SRZ A;  4B3M T;  4IGU A;  4U2Z A;  4H9O C;  2IC6 A;  4LMJ A;  2XMX A;  4DMV A;  2KLQ A;  3NZQ A;  2UUA T;  3WAJ A;  2PFV A;  1Z0P A;  3ONX A;  2FGQ X;  5LG3 A;  2C5I T;  3AA1 A;  1S94 A;  4Z8X A;  4AYM C;  3UU3 A;  2WZI A;  2V7M A;  2MBG A;  2F1C X;  4CI1 B;  3K19 A;  5L3D B;  4PJM A;  3VKG A;  5LGN B;  2ZLD A;  5AQG B;  4IDZ A;  4YSZ A;  4L5G A;  3C98 B;  3T0S A;  3AAA B;  1HX1 B;  3UU2 A;  1XNR T;  2YK0 A;  4IL6 O;  5BR8 T;  4YY3 T;  3RGL A;  5HAX A;  2V8S V;  4YTN A;  2AXD S;  4QH4 A;  2ZMA A;  4FQE A;  2R6G F;  4A97 A;  2LHR A;  1KF6 A;  1O3X A;  2WP9 A;  3K8P C;  2BS3 A;  3ZT7 A;  5HWY A;  3L09 A;  3CKD A;  3FXD B;  2VQF T;  4HFV A;  3OKQ A;  4JI6 T;  4CXX A;  3B13 A;  2YKS A;  4EYU A;  5L4H A;  4WZX A;  1HTJ F;  4KMC A;  2HN1 A;  3MK7 C;  4TNW A;  2I59 A;  3AE3 A;  4IDP A;  5G3A A;  5F8P A;  3VRA A;  4GF4 A;  4FSO A;  2OV9 A;  4YJ3 E;  5TIS O;  2YEV C;  4ILU A;  2BKO A;  1BR1 A;  2MOZ A;  5GTH O;  4GCS A;  4DV1 T;  1YS5 A;  3PTR B;  5ADX K;  1D1C A;  2BBH A;  2J4G A;  3EAM A;  3JCU O;  3BRZ A;  3JC6 C;  2JQH A;  1N32 T;  5AQO B;  2V6Y B;  4DR1 T;  3A0B O;  2EHO C;  2KZ7 B;  4QXB B;  3PGS A;  2XM1 A;  3ZCJ A;  2XAJ B;  5IYZ E;  4IL9 A;  4TZ4 C;  4OYK A;  5CA0 E;  1IBL T;  1QJP A;  4ANJ A;  3AAA A;  3R84 B;  3T24 A;  4XAX B;  3O4X E;  3N9N A;  2RP4 A;  2SPC A;  2KDY A;  4P09 A;  4BA9 A;  2XE1 A;  4UF0 A;  4DR7 T;  4HE8 A;  3FBL A;  3FZH B;  2B76 A;  3ABV A;  4F4B A;  4YXD A;  2W80 C;  5AQM B;  2CM0 A;  4YSY A;  2XAF B;  4GCP A;  2LHN A;  5LBM A;  2UXD T;  4LF8 T;  1XWM A;  1ZHY A;  3ONJ A;  2XHE B;  2VQE T;  4PJJ A;  4U7I A;  4XZC A;  1E1H B;  3OPC A;  4ZI2 C;  3D0T A;  5JRC B;  4NIQ A;  4HFD A;  3ZT5 A;  4TUY E;  2X9Y A;  3ZLI A;  3C5O A;  1CHU A;  4TV9 E;  4RLB A;  2LSG A;  4LF6 T;  4ZI3 D;  3HWB A;  1OED E;  3HKB E;  2QVA A;  1ZV4 X;  5F3J A;  1SUM B;  4DV0 T;  3QNU A;  3EUH A;  4U31 A;  4X1I E;  2JMM A;  1JNZ A;  2WCA A;  3ETU A;  4H63 H;  1QJ9 A;  2MNH A;  5FVK A;  1BXW A;  4ASK A;  3I9W A;  3RLF F;  3UUL A;  1VCS A;  1X9B A;  3BRY A;  2R8A A;  2CWY A;  1OED C;  2X68 A;  5JRC A;  4GK5 E;  2WDR A;  5AQT B;  1WLX A;  3VHL A;  2KT9 A;  2CHO A;  5AQU B;  2HHH T;  2YDQ A;  2EHO A;  4EAH A;  2IWV A;  4JLE A;  3UFG A;  3TKL B;  3PJA A;  3ZMV B;  1D0Y A;  1XMQ T;  1MIY A;  4K0U A;  3LFM A;  4G2A A;  2K5B B;  4O4U A;  3AAE A;  4EOZ B;  4AFK A;  4AQG A;  4EZH A;  2L9Q A;  3A8Y C;  5IUX A;  3PUW F;  3O1H A;  4PK5 A;  3E22 E;  3PQS A;  1U5P A;  1HG5 A;  4DBQ A;  3VZW X;  1NEK A;  2CXF A;  3FYX A;  1DU2 A;  4KBM B;  3RC3 A;  3AED A;  3SYS A;  1WRD A;  3AE2 A;  4L0R A;  3I0O A;  3G06 A;  5LGT B;  2CCQ A;  2YU1 A;  3CML A;  2R88 A;  4UF0 B;  3N2K E;  2XY8 B;  4ZI2 D;  1LKX A;  3AEE A;  1XDO A;  4QXC B;  5FKY A;  3VY8 X;  2ODJ A;  4UIG A;  3N2O A;  3ZPO A;  5FP3 A;  4K3C A;  4X64 T;  3SS1 A;  2DNX A;  1T1L A;  5B5E O;  2PRN A;  2KMF A;  1CUN A;  1W09 A;  1T16 A;  1SA0 E;  1XZY A;  5HXE A;  2A9U A;  2IIU A;  4BJN A;  3C4X A;  3ZYL A;  1G8X A;  1GFN A;  3RC8 A;  3JAD A;  2OLT A;  4WBO A;  4AYE C;  2H7V C;  1OXZ A;  2KIN B;  4DR6 T;  1QLB A;  3N9M A;  2WB5 A;  2DCF A;  2XTQ A;  2V7K A;  5EK2 A;  4QXH B;  3UTK A;  5IYU A;  4EZ4 A;  4DR2 T;  3ZC0 A;  3FHN A;  1HX8 A;  2HPL A;  5L3C B;  3QC9 A;  3N2G E;  3POU A;  4LML A;  1VCT A;  3AEA A;  5C8Y E;  2E9X A;  4B61 A;  1ZP0 A;  3IBP A;  2XAQ B;  5HXR A;  6PRN A;  5AQP B;  2UU9 T;  1X79 A;  2N2L A;  5GTI O;  3F2E A;  2DLR A;  2F4V T;  4QKN A;  5CJ5 A;  2UXB T;  1FIO A;  3EHZ A;  2VB6 A;  5D5D A;  2E5L T;  4FI5 A;  4DMW A;  2J47 A;  3K1S A;  4RJX A;  2XE5 A;  2LFU A;  1E7P A;  1HNX T;  3C64 A;  3SZV A;  5AFU K;  4UB6 O;  4DV7 T;  5LGU B;  2PJQ A;  1KNP A;  1HR0 T;  4COF A;  2M07 A;  4FZM A;  4O2B E;  2O4V A;  4G75 A;  2CBI A;  1WR6 A;  2XUE A;  5DQV A;  3P4P A;  2XQ8 A;  4I50 E;  4HWH A;  1YD8 G;  1QSD A;  2XTL A;  4MBQ A;  5LNK A;  3C4W A;  1LRZ A;  4V1A v;  4WW0 A;  2NR4 A;  4AIU A;  5FXZ A;  2LSK A;  3CQC B;  4DUY T;  2Q9Q D;  2K24 A;  2BDE A;  4HFB A;  2XQ4 A;  3RIU A;  3SY7 A;  1MMN A;  3DWO X;  3PUR A;  3UQ4 A;  4CN4 A;  3PUX F;  4N59 A;  4PR7 A;  2KSR A;  3VR8 A;  4O4J E;  3QRC A;  4Z3T A;  3J7Y q;  2RPA A;  3QB5 K;  2Q9Q B;  2L3L A;  3K3O A;  2H89 A;  3TLS A;  5FL0 A;  3BS0 A;  4LSE A;  2XQ6 A;  5L3B B;  3KV6 A;  3DJB A;  3UU4 A;  5JRE A;  3AEF A;  2XJ7 A;  4ZI7 E;  3E0Z A;  1WYB A;  4DVD A;  2LHF A;  2M06 A;  5KX5 E;  2B1E A;  4QH5 A;  2JMH A;  2MPK A;  2LM9 A;  4ZZC A;  2POR A;  2R4N A;  4H9R C;  5FL1 A;  4MHC A;  3MXZ A;  2X0L B;  4WNK A;  1BR2 A;  3ZMZ B;  5JR9 C;  1W0B A;  1GQE A;  4H9Q C;  3L8R A;  2BZB A;  3UT5 E;  1LVK A;  3KV9 A;  3K3Q C;  4EGW A;  2VKD A;  5KAI O;  2WSS V;  4PUX A;  5M4Y A;  4HWI B;  2WDV A;  3BQK A;  1EZ3 A;  5JDM A;  8PRN A;  2WDQ A;  2CLY B;  4UVC B;  3NRY A;  3O1J A;  2BKP A;  2J1N A;  5LCY A;  1QUU A;  4YTM A;  5CA1 E;  3JTY A;  3KVD D;  2WWV A;  4H63 V;  3L39 A;  3IHR A;  2LLY A;  2CE7 A;  4O3Y A;  3RPU A;  3UU8 A;  4LMK A;  4NXN T;  4CZZ B;  4C4V B;  4MLK A;  4M1P A;  3ZSS A;  2Q9Q C;  2V1D B;  3BQI A;  3HW9 A;  3PDY A;  4ILC A;  2I0M A;  3EI0 A;  3PE0 A;  3TLW A;  4U72 A;  4E7Z A;  2CA5 A;  2QA7 A;  3ZMS B;  2CXL A;  4B6X A;  4NPP A;  2WJR A;  2ZM6 T;  5FNV E;  3KV5 A;  4H9S E;  1D0Z A;  5ABH A;  3AEB A;  2W66 A;  1FMV A;  3TZG A;  3N9Q A;  3SY9 A;  5JDG A;  3NWI A;  1OED A;  3RYC E;  2NW8 A;  2A2F X;  4O3X B;  2BG9 A;  4YHH T;  1OPF A;  4B3S T;  4RLC A;  4ZI3 C;  1XMO T;  5AQL B;  1HG2 A;  4AI6 A;  1PRN A;  2ES0 A;  3CPZ A;  5DAB A;  2F1V A;  4FRX A;  3K3N A;  3UU6 A;  2ZFG A;  3PF1 A;  3QB5 A;  3PGU A;  2BKN A;  2KWH A;  3DA4 A;  3KVB A;  4CXW A;  2IW5 B;  2BS2 A;  3QRA A;  3F31 A;  4PJL A;  5JDF A;  2D2S A;  3SOL A;  4FZN A;  3JAE A;  3O0E A;  4H9P C;  2W00 A;  2QGS A;  4P0A A;  2Q9Q A;  4YFS A;  1HXX A;  3SFD A;  2WU5 A;  5HCM A;  4F6R C;  1VRB A;  1ZHW A;  3Q2M A;  4EXT A;  5ADX L;  4I0U A;  2VVS A;  1E54 A;  2EHO D;  3EDU A;  1M7K A;  2Y2X A;  5AQH B;  4AKM A;  3X1D A;  1HCI A;  2QRX A;  3R6N A;  3VE1 A;  3CQG B;  2X9K A;  3PV0 F;  5JDN A;  1OSM A;  4LF9 T;  4HTE A;  5AQS B;  5TAO A;  4J2C A;  4TNV A;  3I1A A;  3C4Z A;  4IHJ E;  4RJW A;  4ZS2 A;  4L9I A;  1SHZ C;  4N78 D;  1HFA A;  3P8C D;  4OHF A;  1KEY A;  3VKH A;  2CXD A;  3AA0 B;  4FMS A;  4AYN A;  3NVO A;  2VUR A;  3OBV E;  5EE2 A;  3IF8 B;  2ZM0 A;  1MIV A;  5LMN T;  1N33 T;  3CWZ B;  3AVR A;  4AYI D;  5JQG E;  1H7C A;  2FBW A;  4LFC T;  1SE7 A;  3HR0 A;  2CWO A;  2AE9 A;  2KXP A;  1E2A A;  2LM2 A;  1OED B;  3AVS A;  5FVL A;  1IBM T;  2XE3 A;  1YXR A;  3FZM B;  1BT9 A;  3Q5X A;  4DV3 T;  3TLT A;  4FZL A;  1HXT A;  2I6H A;  2FJB A;  4AIS A;  4JYA T;  2W81 C;  2FUP A;  5LHG B;  1MMD A;  3N9P A;  3RH3 A;  1IZN A;  5LXT E;  3FZL B;  3AE9 A;  3B5M A;  2CLY C;  5T5F A;  2N9D A;  3N9O A;  1GFM A;  1MIW A;  2VKH A;  2E5V A;  1JNR A;  2J62 A;  5EK3 A;  2XQ5 A;  2DWK A;  5HEH A;  3TLU A;  2JQY A;  3PUA A;  4JBW F;  1MMA A;  3E08 A;  2FJE A;  2R89 A;  4LSI A;  1S35 A;  4PJN A;  5PRN A;  2CBJ A;  4JI2 T;  3VY9 X;  2WS3 A;  4EIW A;  3HL6 A;  5FY0 A;  2NTX A;  3KV4 A;  5GON E;  5H2F O;  1Q9G A;  2BG9 E;  3ZEF B;  2VL0 A;  4AZL A;  4UR9 A;  4O4X A;  2EHO B;  1J5E T;  4ERR A;  1MND A;  3BQL A;  3NKZ A;  2K3W A;  2YN6 A;  5LYJ E;  4OFZ A;  4ZHQ E;  3CX8 B;  4UB8 O;  4E7S A;  3IA3 A;  4YTP A;  2LKG A;  4GCQ A;  2VVN A;  3GMI A;  4C90 A;  4XNK A;  4AXP A;  2VKO A;  5HCJ A;  3QUJ A;  2H3R A;  1L0V A;  2N1G A;  2E2A A;  3ZMU B;  3ZN1 B;  4D65 A;  2JPF A;  5EZY E;  2Y7S A;  2N2N A;  2G0U A;  2CMR A;  4O4H E;  3VRB A;  3GWH A;  4QX7 B;  2W2U A;  4OYJ A;  2L8K A;  4I43 B;  4K0K T;  3GP6 A;  4I4T E;  4OX9 T;  3RBH A;  4UEL A;  4PFO A;  4O2A E;  4LSH A;  3VZT X;  2IUB A;  3JCF A;  1ZHZ A;  2V6Y A;  3LK3 A;  4O3Z A;  3GN5 A;  3NBX X;  3RQU A;  3A7M A;  2WQY A;  4CTD A;  4HKA A;  4AQY T;  3EVY A;  4LF5 T;  3RIF A;  3FZK B;  4IST A;  4XBF B;  4HEA A;  2J4U P;  1D0X A;  3PU3 A;  4HN9 A;  4JI1 T;  2V7I A;  3ESL A;  3N5L A;  2K9A A;  2Z6E A;  4UXN B;  1MPF A;  1D1A A;  4GK0 E;  3POR A;  3ZN0 B;  5DL7 A;  4Z91 A;  4KX6 A;  2P9B A;  2R4O A;  2D0T A;  1MM5 A;  3LK2 A;  3PUS A;  5LOV E;  2ERV A;  2V7L A;  1US7 B;  2XTR A;  5J1G A;  4C69 X;  1Q9F A;  2LRK A;  2R4P A;  2M6B A;  4AQF A;  2CRB A;  1T7S A;  2JQK A;  3DZM A;  2WAU A;  2XPK A;  2H88 A;  2BVL A;  1HNW T;  2LRL A;  5IHY A;  1ZHX A;  2XQA A;  3Q5W A;  1UCU A;  2XSB A;  1T98 A;  5ABE A;  3JAF A;  2Y0K A;  4UVB B;  4HGA A;  1UUS A;  2HH7 A;  3CIR A;  5CGM A;  4G76 A;  4AKR A;  3LK2 B;  3AB3 B;  3C50 A;  3RRC A;  5AQJ B;  3OTO T;  4O4L E;  5G26 A;  3UUN A;  3UUM A;  5C3J A;  5LP6 E;  4YHJ A;  1WR0 A;  5L3F B;  1IJ5 A;  5AQN B;  2F1T A;  1N36 T;  2AXT O;  4FES A;  4IE0 A;  5KDM C;  1IAP A;  1IZN B;  3AE6 A;  3T8O A;  2KZ7 A;  4YT0 A;  5DL5 A;  4PFP A;  2W67 A;  4TV8 E;  4D5U A;  3CQX C;  2NOX A;  2KWI B;  1GFO A;  3EAB A;  3HI2 A;  3W15 B;  3LK4 1;  2WMO A;  4P1N A;  2ACZ A;  4IDN A;  3PU8 A;  3MKD A;  5AQQ B;  2C0S A;  3VR9 A;  2A3D A;  1HXU A;  4F8H A;  5L3G B;  4UEM A;  4KP3 C;  2N2M A;  5G39 A;  2BG9 C;  3WU2 O;  4U7Y A;  4LSF A;  1W0A A;  5IWA T;  4LFB T;  5JDH A;  5LB7 B;  1T72 A;  5ABF B;  4DO0 A;  5AQI B;  1Y01 A;  4U2Y A;  1Z8U A;  4KHP T;  4X66 T;  3T1Y T;  5LMU T;  1G73 A;  4KI0 F;  2UUB T;  4O4I E;  1ZHT A;  3KDS E;  2C5J A;  2YDS A;  4CXY A;  2BS4 A;  2WMN A;  1XDP A;  1FEW A;  3AA0 A;  3MAC A;  3DA3 A;  5J2T E;  4MFR A;  3AAE B;  4WYV A;  2ODV A;  2V6X A;  2UXX B;  3ZKR A;  2A72 A;  4U74 A;  2DL1 A;  2H7O A;  2Y0L A;  5HEU A;  3RI5 A;  2W4X A;  1UGO A;  2M6I A;  5FY7 A;  1MM4 A;  7PRN A;  2WU2 A;  1UUR A;  3RYH E;  2Y6X A;  2Y0H A;  4HFE A;  2XG6 A;  3DP7 A;  1KNR A;  2MYS A;  2JMK A;  2XZE A;  3RQW A;  1UX4 A;  2D9D A;  2IAK A;  5J0Z A;  4QQ1 A;  5JTG A;  2XM2 A;  2OA5 A;  2KC0 A;  4BAY B;  3AA7 A;  5ABF A;  4B3T T;  3HKE E;  1Y64 B;  2RA1 A;  3KBU A;  1NEN A;  1R8I A;  2IDO B;  4DR3 T;  4ILB A;  2X51 A;  3ETV A;  4X5T A;  3N9L A;  4UV8 B;  4EV6 A;  3UQ7 A;  2VKJ A;  2BG9 B;  2GE4 A;  4C00 A;  5J2U E;  5E79 O;  4QX8 B;  3RF1 A;  3LJC A;  3PUZ F;  3V5U A;  5FVN A;  1XNQ T;  3VU7 H;  3ZCI A;  3DWN A;  5CFB A;  2GK9 A;  2WWU A;  1I6Z A;  4AKL A;  2ODU A;  3AE4 A;  3T20 A;  2LSY A;  1MMG A;  5LBQ B;  2WM9 A;  4BUM X;  4JI5 T;  5H6R B;  2NP9 A;  2W63 A;  4XNL A;  1H6S 1;  4GHB A;  2E9X C;  5JH7 E;  3HA4 A;  4A98 A;  1V9D A;  4DID B;  1G90 A;  2LOP A;  4EEB A;  2IHR 1;  4HFH A;  2LSI A;  3NSG A;  2ZLY A;  4AKR B;  4DND A;  2JQ9 A;  3QK6 A;  2HN2 A;  1ZOY A;  2NW7 A;  3I0Q A;  3NJT A;  3CX6 B;  3U78 A;  3FXE B;  4I55 E;  4DR4 T;  2X9H A;  4YLH A;  5HWX A;  1WCR A;  2V5D A;  2MTQ A;  3RHW A;  1W9R A;  2NTY A;  3PGR A;  2LKH A;  5GV0 A;  4Q25 A;  4PK6 A;  4IE6 A;  4DV6 T;  3ZYM A;  2E8I A;  4ZEY A;  3MA9 A;  4LF7 T;  2VAS A;  1GFP A;  3KFW X;  4IRE A;  4JI0 T;  1D1B A;  5AQV B;  3EDV A;  4QH1 A;  4D64 A;  2WBL A;  4CN1 A;  4CI3 B;  3RX6 A;  5E0O A;  4KUM B;  3ZJ2 A;  3ANW A;  1GFQ A;  1T8B A;  2X0Y A;  3HOL A;  4Z90 A;  4IE5 A;  3P7I A;  2UUC T;  5HXH A;  5DL6 A;  4ILA A;  4X62 T;  4KR4 A;  4ZXL A;  1J5W A;  2LSJ A;  1ZHC A;  3LK3 B;  2DWG A;  4TN7 B;  5LA6 E;  2LEH A;  2W0G A;  3AAI A;  2E9X B;  4JFB A;  4YJ2 E;  4UVA B;  5AQF B;  4HWD A;  2W61 A;  4E1S A;  2JQQ A;  3SWH A;  2FGR A;  3H3M A;  4CN6 A;  3P50 A;  4HWF A;  4TWD A;  3AA7 B;  3SZD A;  1KNZ A;  2E9X D;  3AE5 A;  4N74 A;  4KRA A;  3WI5 A; 
#chains in the Genus database with same CATH homology
 1Z0P A;  3RBH A;  3ONX A;  4UEL A;  4PFO A;  4WW0 A;  2X66 A;  4O2A E;  2FGQ X;  3GA8 A;  4LSH A;  5FXZ A;  2QTK A;  2C5I T;  3VZT X;  2XAG B;  3AA1 A;  1S94 A;  2ACX A;  4Z8X A;  2LSK A;  1ZHZ A;  4AYM C;  1ZEE A;  3CQC B;  1HS7 A;  3LK3 A;  4O3Z A;  2Q9Q D;  3GN5 A;  2NW9 A;  3UPG A;  3NBX X;  2V7M A;  2K24 A;  2BDE A;  2MBG A;  4HKA A;  4CI1 B;  3EVY A;  3SY7 A;  3EMN X;  5L3D B;  3K19 A;  4PJM A;  1MMN A;  4NUV A;  5JR9 B;  3VKG A;  3PUR A;  4AQF C;  4IST A;  4XBF B;  4HEA A;  4GOU A;  5LGN B;  3CVR A;  1D0X A;  2ZLD A;  4N59 A;  3PU3 A;  2J4U P;  4HN9 A;  4IDZ A;  4O4J E;  2V7I A;  3J7Y q;  3QRC A;  4Z3T A;  4L5G A;  3C98 B;  2Q9Q B;  2L3L A;  3K3O A;  3ESL A;  3N5L A;  3T0S A;  2K9A A;  4U9C A;  3KBT A;  2Z6E A;  3AAA B;  4UXN B;  5ETW A;  1MPF A;  2BVM A;  5L3B B;  1U4Q A;  4LSE A;  1D1A A;  4GK0 E;  3Q9D A;  3POR A;  3ZN0 B;  5DL7 A;  3KV6 A;  3UU2 A;  3DJB A;  2P9B A;  2YK0 A;  4WBN E;  5LHI B;  5JRE A;  5HAX A;  3KIN B;  2D0T A;  4PAG A;  3ZYK A;  3RRW A;  4ZI7 E;  1MM5 A;  3LK2 A;  3PUS A;  2ZMA A;  1WYC A;  1WYB A;  3E0Z A;  3LG7 A;  4DVD A;  2LHF A;  4GYR A;  5LOV E;  2M06 A;  5KX5 E;  2ERV A;  5LJN A;  2B1E A;  2V7L A;  1US7 B;  2JMH A;  3ZJ1 A;  5J1G A;  2XTR A;  4C69 X;  1YKE B;  1Q9F A;  4QHO A;  3RYI E;  4E1T A;  2LM9 A;  2LHR A;  2POR A;  1O3X A;  4H9R C;  3K8P C;  4AQF A;  2XAS B;  5HWY A;  2YNK A;  3I9Y A;  4MHC A;  3MXZ A;  3L09 A;  3CKD A;  3FXD B;  3AA6 B;  2X0L B;  4WNK A;  4HFV A;  2WAU A;  3OKQ A;  4CXX A;  3B13 A;  1BR2 A;  3ZMZ B;  2BVL A;  1IJ6 A;  4G63 A;  5JR9 C;  4EYU A;  5IHY A;  2XAH B;  4D65 A;  1ZHX A;  3G7G A;  5GV0 A;  3F57 A;  4H9Q C;  1HTJ F;  4ISS A;  4KMC A;  2BZB A;  3UT5 E;  3MK7 C;  2I59 A;  3Q5W A;  1UCU A;  1T98 A;  1B7T A;  4A56 A;  3PUG A;  1LVK A;  3KV9 A;  5F8P A;  2Y0K A;  4FUV A;  3K3Q C;  3OJA A;  4UVB B;  2C5K T;  1NWM X;  2VKD A;  2WSS V;  4GF4 A;  4HGA A;  4FSO A;  5LHH B;  5M4Y A;  4PUX A;  4YJ3 E;  1LVF A;  2HH7 A;  3BQK A;  4G76 A;  1THQ A;  3POQ A;  4AKR A;  1EZ3 A;  2YEV C;  2V7J A;  3LK2 B;  5JDM A;  8PRN A;  3AB3 B;  3LK4 2;  3C50 A;  1BR1 A;  2CLY B;  2MOZ A;  4GIW A;  2UXN B;  4ILU A;  4UVC B;  3RRC A;  4GCS A;  3NRY A;  4O4L E;  3O1J A;  5G26 A;  5JDL A;  5LCY A;  1QUU A;  3UUN A;  3UUM A;  3PTR B;  4O8S A;  4YHJ A;  5CA1 E;  5LP6 E;  1YS5 A;  5L3F B;  4JCH A;  3JTY A;  1D1C A;  3UAQ A;  5ADX K;  4O3W A;  3ZC1 A;  3KVD D;  1IJ5 A;  4H63 V;  2F1T A;  2ZM8 A;  5LJM A;  3IHR A;  3JC6 C;  4FES A;  4IE0 A;  5KDM C;  4KR8 A;  1IAP A;  1IZN B;  2CE7 A;  4UV9 B;  3T8O A;  2KZ7 A;  1KK7 A;  4O3Y A;  5JVD E;  5DL5 A;  4QWN B;  4PFP A;  3RPU A;  2EHO C;  3LBX B;  2KZ7 B;  4QXB B;  4TV8 E;  3VE2 A;  4D5U A;  4CZZ B;  3CQX C;  4MLK A;  3RYF E;  3ZCJ A;  4M1P A;  2NOX A;  2XAJ B;  1BR0 A;  5IYZ E;  2Q9Q C;  2KWI B;  3JC6 D;  4OYK A;  4TZ4 C;  2V1D B;  3BQI A;  4ANJ A;  5CA0 E;  3PUQ A;  1QJP A;  3R84 B;  1GFO A;  4AKG A;  3PDY A;  3HKD E;  3AAA A;  3HW9 A;  3O1I A;  4XAX B;  3T24 A;  5FXV A;  3HI2 A;  3PE0 A;  3W15 B;  3LK4 1;  2WMO A;  3WI4 A;  3O4X E;  3N9N A;  4U72 A;  2RP4 A;  3V5S A;  2SPC A;  2LOS A;  3PU8 A;  3MKD A;  4E7Z A;  2CA5 A;  2QA7 A;  2KDY A;  2C0S A;  4P09 A;  4AUI A;  4H9N C;  2CXL A;  3ZMS B;  4B6X A;  3SYB A;  4BA9 A;  2XE1 A;  4UF0 A;  2A3D A;  5FNV E;  1HXU A;  3KV5 A;  5L3G B;  4H9S E;  1D0Z A;  2J1D G;  4HE8 A;  4UEM A;  3FBL A;  4KP3 C;  4F4B A;  2N2M A;  2W80 C;  3C51 A;  3AA6 A;  3DTO A;  2CM0 A;  3A5X A;  1FMV A;  2XAF B;  5CB4 E;  3TZG A;  3N9Q A;  4GCP A;  3KVA A;  3SY9 A;  2LHN A;  5LBM A;  5JDG A;  2DI4 A;  4LSF A;  3RYC E;  3NZP A;  1ZHY A;  2NW8 A;  5JDH A;  2A2F X;  5FXW A;  2XHE B;  4DO0 A;  3PRN A;  3RKO A;  4DBR A;  4PJJ A;  4O3X B;  4XZC A;  3ANW B;  2DHR A;  1OPF A;  1E1H B;  3H37 A;  5LG4 A;  4ZI2 C;  1ORM A;  3D0T A;  4RLC A;  4ZI3 C;  2JJ9 A;  4AI6 A;  1HG2 A;  3FB2 A;  1PRN A;  2ES0 A;  3CPZ A;  5DAB A;  5JR9 A;  5JRC B;  2F1V A;  3O9X A;  4FRX A;  3K3N A;  2X9X A;  1G73 A;  2VWA A;  4MAL A;  4TUY E;  2X9Y A;  4O4I E;  3ZLI A;  3C5O A;  1OWA A;  1ZHT A;  2D5U A;  3KDS E;  2C5J A;  5FXX A;  2M67 A;  4CXY A;  4TV9 E;  2ZFG A;  4RLB A;  2LSG A;  5HYA A;  4IE7 A;  2W62 A;  2WMN A;  2KWH A;  4ZI3 D;  3DA4 A;  1FEW A;  3KVB A;  3AA0 A;  3HKB E;  3MAC A;  4CXW A;  2IW5 B;  5J2T E;  5L2L A;  3DA3 A;  3HWB A;  1ZV4 X;  3F31 A;  3QRA A;  4PJL A;  3B57 A;  2VK9 A;  4MFR A;  5JDF A;  2D2S A;  3AAE B;  5F3J A;  4FOZ A;  3SOL A;  4FZN A;  2HPJ A;  2ODV A;  2UXX B;  3O0E A;  4CI2 B;  2JRK A;  3VZU X;  3EUH A;  4H9P C;  2W00 A;  2QGS A;  4P0A A;  4PW8 A;  2X9W A;  4X1I E;  2JMM A;  2Q9Q A;  2A72 A;  4U74 A;  4YFS A;  1HXX A;  3HOE A;  1FMW A;  2H7O A;  4N58 A;  3ETU A;  3OYX A;  4H63 H;  5KMG P;  1QJ9 A;  1BXW A;  2K4T A;  2MNH A;  2Y0L A;  3PQU A;  2Y48 B;  4F6R C;  2LJL A;  3H3A A;  4ASK A;  1VRB A;  1ZHW A;  3I9W A;  3MZK B;  3Q2M A;  2YU2 A;  3UUL A;  5FY7 A;  4CQI A;  4EXT A;  5ADX L;  1MM4 A;  4FRT A;  7PRN A;  1E54 A;  2EHO D;  3EDU A;  2Y2X A;  3RYH E;  2Y6X A;  2Y0H A;  4AKM A;  1HCI A;  2XG6 A;  2PBI A;  3GN5 B;  3R6N A;  3DP7 A;  3VE1 A;  3CQG B;  2MYS A;  5JDP A;  4AKH A;  5JDN A;  1OSM A;  2JMK A;  2CWY A;  2X68 A;  4HTE A;  1YKH B;  5JRC A;  5TAO A;  1P4T A;  4GK5 E;  1UX4 A;  4J2C A;  5HXS A;  1VOM A;  1WLX A;  5A1L A;  3VHL A;  2IAK A;  2KT9 A;  3I1A A;  1AJ3 A;  4QQ1 A;  3FBZ A;  3C4Z A;  4IHJ E;  2OA5 A;  2EHO A;  4EAH A;  4ZS2 A;  2KC0 A;  4RJW A;  4L9I A;  4BAY B;  4IE4 A;  3NRX A;  3AA7 A;  1SHZ C;  4JLE A;  4O49 A;  4BJM A;  3HKE E;  1Y64 B;  3OYZ A;  4AYD C;  4N78 D;  2IC9 A;  3TKL B;  2RA1 A;  2X27 X;  3ZMV B;  1D0Y A;  2CEA A;  1MIY A;  1HFA A;  3KBU A;  3L3P A;  4K0U A;  3LFM A;  3P8C D;  4G2A A;  2K5B B;  4O4U A;  4OHF A;  4EOZ B;  3AAE A;  3VKH A;  2X51 A;  4AFK A;  3ETV A;  2CXD A;  3AA0 B;  4AQG A;  4FMS A;  4EZH A;  2ZM2 A;  3LBX A;  2L9Q A;  3N9L A;  4UV8 B;  4AYN A;  3O1H A;  4PK5 A;  2VKJ A;  3E22 E;  3OBV E;  4X1K E;  3IF8 B;  3PQS A;  5EE2 A;  1U5P A;  5BMV E;  2GE4 A;  1HG5 A;  2ZM0 A;  4DBQ A;  1MIV A;  3M65 A;  3VZW X;  2J1N A;  3CWZ B;  3AVR A;  5J2U E;  2CXF A;  4QX8 B;  3LJC A;  3FYX A;  4AYI D;  5JQG E;  3V5U A;  1H7C A;  4GYS A;  4KBM B;  5FVN A;  3RC3 A;  4FJO A;  3SYS A;  1WRD A;  4L0R A;  3VU7 H;  3CX7 B;  3HR0 A;  2XE2 A;  2CWO A;  3I0O A;  4FSP A;  5LGT B;  2KXP A;  3ZCI A;  2CCQ A;  2GK9 A;  2VL8 A;  2YU1 A;  2WWU A;  3CML A;  4AKL A;  2ODU A;  4IIJ E;  4UF0 B;  1BR4 A;  3J9X 1;  3N2K E;  3AVS A;  1LKX A;  4ZI2 D;  4QXC B;  3VY8 X;  3T20 A;  2LSY A;  2XE3 A;  2ODJ A;  4UIG A;  1MMG A;  3N2O A;  3ZPO A;  1BT9 A;  5LBQ B;  3UFE A;  5FP3 A;  3Q5X A;  3SS1 A;  2DNX A;  5EK4 A;  2WM9 A;  4X1Y E;  4BUM X;  2PRN A;  5H6R B;  4FZL A;  1HXT A;  4C91 A;  2KMF A;  2NP9 A;  4PK4 A;  2W63 A;  4EB6 E;  1H6S 1;  4XNL A;  4GHB A;  1CUN A;  2E9X C;  2OMF A;  5JH7 E;  1SA0 E;  3HA4 A;  5HXE A;  2W81 C;  2KND A;  1V9D A;  4ZS3 A;  5LHG B;  1G90 A;  4BJN A;  2LOP A;  1MMD A;  3N9P A;  3RH3 A;  3C4X A;  3ZYL A;  2X67 A;  2LSI A;  5FMN A;  1IZN A;  5LXT E;  3NSG A;  1G8X A;  2ZLY A;  4AKR B;  4DND A;  1GFN A;  2LT3 A;  2CLY C;  5FY1 A;  3RC8 A;  1QJ8 A;  3QK6 A;  4WBO A;  5T5F A;  2N9D A;  3N9O A;  2NW7 A;  3WAK A;  1GFM A;  4AYE C;  2H7V C;  3WI3 A;  1MIW A;  3I0Q A;  1OXZ A;  2VKH A;  3CX6 B;  3U78 A;  3FXE B;  4I55 E;  5LGU B;  4PNI A;  5EK3 A;  2KIN B;  2DWK A;  2X9H A;  3PUA A;  1MMA A;  4YLH A;  4ADZ A;  5HWX A;  3N9M A;  3E08 A;  2DCF A;  4LSI A;  4OK0 A;  4JEU B;  2MTQ A;  3A2S X;  1S35 A;  2XTQ A;  2V7K A;  4AKI A;  5EK2 A;  4QXH B;  4PJN A;  3UTK A;  5PRN A;  5H6Q B;  2NTY A;  3VY9 X;  5IYU A;  4EYY R;  4EZ4 A;  5DJQ C;  4EIW A;  4JEH B;  5AFU L;  3ZC0 A;  3FHN A;  2NWB A;  2K48 A;  1HX8 A;  3HL6 A;  5FYM A;  2HPL A;  4PK6 A;  5DL8 A;  4IE6 A;  5FY0 A;  3V8U A;  2NTX A;  3AA1 B;  3KV4 A;  5L3C B;  3QC9 A;  5GON E;  3U3I A;  2XQY A;  3ZYM A;  3N2G E;  2E8I A;  1Q9G A;  3POU A;  3ZEF B;  4AZL A;  2LE8 A;  3MA9 A;  4O4X A;  5C8Y E;  2VAS A;  2E9X A;  1GFP A;  3KFW X;  4B61 A;  2EHO B;  1D1B A;  3IBP A;  2XAQ B;  4ERR A;  5HXR A;  2KXP B;  6PRN A;  1MND A;  3BQL A;  3EDV A;  1X79 A;  1NAF A;  4NUU A;  1PHO A;  1YW0 A;  2N2L A;  4D64 A;  2WBL A;  3F2E A;  2DLR A;  1UX5 A;  3MJX A;  4QKN A;  1ZKE A;  3HKC E;  5LYJ E;  5HXC A;  4JUY A;  4OFZ A;  4CI3 B;  1FIO A;  3CX8 B;  3RX6 A;  4ZHQ E;  2VB6 A;  4KUM B;  5E0O A;  5D5D A;  3ZJ2 A;  3ANW A;  4FI5 A;  4DMW A;  1GFQ A;  4E7S A;  2MHL A;  4RJX A;  3HOL A;  2XE5 A;  4RL9 A;  2PG8 A;  4GCQ A;  3GMI A;  2YPV A;  3BK9 A;  3IEE A;  4IE5 A;  3C64 A;  4C90 A;  3P7I A;  2LFU A;  4AXP A;  5HXH A;  4XNK A;  2K0L A;  2VKO A;  5DL6 A;  4KR4 A;  3POX A;  3ZMT B;  3QUJ A;  2Y8D A;  5JDQ A;  2H3R A;  2N1G A;  4X20 E;  3S4U A;  3ZMU B;  3UUX B;  2LSJ A;  1ZHC A;  3LK3 B;  5DQW A;  3SZV A;  2V26 A;  1BH3 A;  2DWG A;  5AFU K;  4TN7 B;  5LA6 E;  2D0U A;  5L3E B;  3ZN1 B;  2LEH A;  2W0G A;  2PJQ A;  3AAI A;  4TX5 A;  1HF8 A;  1MNE A;  2JPF A;  4ZOL E;  2E9X B;  4JFB A;  2YIN A;  4YJ2 E;  2M07 A;  4UVA B;  4P0B A;  4FZM A;  3SRZ A;  4O2B E;  2W61 A;  4IGU A;  5EZY E;  2O4V A;  1WR6 A;  2Y7S A;  4G75 A;  4E1S A;  2XUE A;  2JQQ A;  2N2N A;  3SWH A;  2FGR A;  2G0U A;  2CMR A;  4H9O C;  4O4H E;  5DQV A;  2IC6 A;  3GWH A;  4QX7 B;  4I50 E;  2XMX A;  4DMV A;  1YD8 G;  1QSD A;  4FT6 A;  2XTL A;  2KLQ A;  3AA7 B;  4OYJ A;  3SZD A;  2L8K A;  4I43 B;  1KNZ A;  4MBQ A;  2E9X D;  3NZQ A;  3C4W A;  5LNK A;  3GP6 A;  3WAJ A;  4KRA A;  1LRZ A;  3WI5 A;  4V1A v;  2PFV A;  4I4T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...