5ADXL

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVDVIPDNPKFQQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ACTIN RELATED PROTEIN 1
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
total genus 71
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5adxL01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 5adxL02
3AA1A 3LK2B 3LK2A 5AFUL 5AFUK 3AAAB 2KZ7B 3AAAA 3AA0B 2KZ7A 1IZNB 4AKRB 3AA0A 3AA7B 1IZNA 3AA7A 4AKRA 3LK3B 5ADXL 3LK42 3LK3A 5ADXK 3AA6B 3AAEB 2KXPB 3AA6A 3LK41 3AA1B 3AAEA 2KXPA
chains in the Genus database with same CATH superfamily
4UIGA 2LLYA 2D0TA 1MM4A 5JR9A 4I0UA 4ZI2C 1UURA 4GIWA 4YXDA 1HG5A 2VKOA 3VKHA 5EK4A 4AXPA 2WMNA 5FL0A 4JCHA 1IBLT 3DA4A 1VOMA 1MIWA 2E2AA 5H6RB 3ABVA 2E8IA 2C5IT 4YY3T 3KV9A 2BG9B 4KRAA 3PRNA 2ZFGA 5EK2A 4O2AE 2VL0A 5KAFO 3UUMA 3AVSA 4U2ZA 4LSHA 4FJOA 1S5LO 4CN1A 4OYKA 1IAPA 2XTLA 2AXDS 3EDVA 2V7KA 3AEGA 3ZT7A 3PJAJ 1SE7A 3AA7A 2B76A 2X0HA 1HXUA 1MMGA 2QGSA 4TN7B 4AYMC 3TLWA 3FB2A 1D0ZA 4ZI7E 3PUVF 3PGSA 3CWZB 1NAFA 4O4HE 4GKKT 1NWMX 4Z91A 5F5WA 3RI5A 2XQ7A 2F1TA 5C2TA 4U33A 3ZYMA 4DV5T 1ZOYA 2LJLA 1W0BA 4G63A 2O4VA 4EZHA 3AAAA 1NENA 3M3ZB 2LOPA 5L2LA 3T1HT 5AQQB 2I0MA 5KAIO 3P50A 2W2UA 4JYAT 3CQGB 5LMNT 3FZHB 3FXEB 4K0UA 2BS4A 2LRKA 3RKOA 1HX8A 3AA1B 5ABGA 2EHOC 3Q5DA 3FBLA 4H9SE 5G38A 2KWIB 5JDLA 2OA5A 4TNVA 3RRCA 2ODVA 4PJLA 5HEOA 4IDZA 2CEAA 2KINB 2FJAA 3SWHA 3AEDA 5ADXK 4P1NA 2KSRA 1HNXT 3AAEB 2BVMA 3FZFB 2XM2A 3A0HO 4XZCA 3EABA 3J9X1 2AXTO 2F1VA 3JADA 5G39A 1ZHZA 2M6IA 1HX1B 3BRZA 1X9BA 4X1YE 3V5SA 4AKIA 4U3CA 2CE7A 2KZ7B 2K3WA 4OFZA 5HWYA 1P4TA 4EAHA 5DL8A 3UU8A 2X9XA 3KBUA 2PTFA 2J4GA 3RKGA 2RPAA 3SYBA 3JAEA 4AYDC 5LHIB 4FUVA 5L3DB 2M67A 5FVNA 3SZVA 4PJJA 2LHFA 3VR8A 5HWXA 4FRXA 2XQ3A 5AQOB 3JTYA 1OEDA 6PRNA 2CXLA 4LF8T 2F1CX 3MKDA 1YXRA 2XTRA 4HFIA 3BS0A 3HWBA 1D1AA 3FHNA 3HKCE 5LJMA 3N9PA 3ONXA 5AQIB 4A56A 4IDNA 3DWOX 4HN9A 3RIFA 1DU2A 3HKBE 1G73A 1HXXA 3JC6C 5M4YA 4O3WA 4UEMA 3L39A 3IHRA 2CA5A 3RX6A 3AE8A 3PUZF 2N9DA 4AKRB 3UQ4A 3RLFF 1UCUA 3ESLA 4AKMA 4DR2T 5LG3A 2L9QA 3V5UA 2VKJA 4BJMA 1SA0E 4RJXA 2Y48B 1MPFA 3C51A 3UUBA 3MACA 4HGAA 5DQVA 4AKLA 3G06A 3AXJA 3NRYA 3OVUA 1ORMA 5JDFA 3LK3A 1V9DA 3FBZA 2H7VC 5GV0A 1W0AA 2DL1A 3KVDD 3UTKA 2LM2A 4DNDA 2M07A 4X66T 4QXBB 4I4TE 2V6YB 5LJNA 5LMUT 4UF0A 1MIYA 1VCTA 3N2KE 2W0GA 3PDYA 3ZT5A 2KXPB 5AQMB 4PW8A 2MBGA 4QQ1A 3N9QA 2ZMAA 2KDYA 5LCYA 4I50E 5LB7B 3OYXA 3TZGA 2LSIA 2NW7A 3RGLA 2W62A 3A2SX 1FIOA 4ZOLE 5JREA 4X64T 2CCQA 2M06A 4DMVA 3RYHE 4YTPA 4H9RC 5JDMA 2PG8A 4DR3T 1YQ4A 2BDEA 5JRCA 3JAFA 2BBJA 4EYUA 4HFVA 3RPUA 2X0LB 5GTIO 5FKYA 2Y0KA 3KINB 3QK6A 2XE1A 4JI8T 1HTJF 3IBPA 5ADXL 2XSAA 3ZMSB 4PK4A 4DV4T 1VCSA 1FEWA 1HXTA 4LFAT 3GMIA 2M6BA 4UVBB 2N1GA 4ADZA 4AZLA 3PUQA 3ZYKA 4DV6T 1G90A 2MTQA 1N34T 4G76A 3PGUA 2V7LA 4AQGA 1US7B 2VURA 4YSXA 1XZYA 2WB5A 1HS7A 4RL9A 1J1JA 4LF4T 2R4PA 2NR4A 3QUJA 2X0YA 3RIUA 2WBLA 2X66A 4HFDA 1XNQT 5GTHO 3DP7A 4I55E 3DA3A 4QKNA 4YHHT 4H9NC 3F31A 1IZNA 1E54A 4RLBA 2VASA 4IE6A 2FJDA 4PFOA 2WSSV 5CGMA 2A2FX 5H2FO 4L9IA 3PQUA 4FRTA 2DWKA 2C0SA 2W63A 3UFGA 3CMLA 3K3NA 1PRNA 1XMOT 1T8BA 1XNRT 1OEDE 4KX6A 3AE4A 1Q9GA 3VE1A 3HOEA 3ZPOA 2J47A 4DR1T 2KC0A 4YFSA 4B3MT 3HKDE 4YJ2E 2XG6A 4O8SA 4ZZBA 4DMWA 5FL1A 3A7MA 1QLBA 4JFBA 2X67A 3PQSA 4JV5T 3V8UA 2PJQA 4CN6A 3NZQA 3FZKB 1L0VA 4PR7A 3I9WA 2MPKA 2D5UA 4AKGA 3GN5A 4U7IA 2JRKA 1J5WA 2LKHA 4E7SA 5AQLB 2W80C 1WR0A 5KMGP 4E7ZA 2JJ9A 3MXZA 1GQEA 4IGUA 1BXWA 1T7SA 2ZM2A 3BQLA 4IDOA 4PK6A 4UELA 3FZLB 2RA1A 4AQYT 1KK7A 4HWFA 4N58A 4YHJA 1FMVA 3P4PA 3N9OA 4GK0E 2JMHA 3AEFA 2YKSA 4GYSA 4X1IE 4O3XB 1S94A 4F6RC 1UX4A 2BKPA 4QHOA 4M1PA 4CN4A 1M7KA 4AISA 1I6ZA 5L4HA 3UULA 3AEBA 2JPFA 5L4EA 4TV9E 1OWAA 4JUYA 5LXTE 1BT9A 2J1NA 4MBQA 3OYZA 3ZMZB 4JI0T 3TLSA 5LOVE 4AUIA 4ANJA 2XQYA 3UU4A 4AI6A 3N9MA 5J2UE 3B5MA 1BR2A 1O3XA 4C00A 3PUAA 2FGQX 1GFOA 1WCRA 5HEGA 4FZMA 2IMLA 4GF4A 4TX5A 1R8IA 1Y01A 5L3FB 5JR9B 3K19A 2KMFA 5DQWA 5L3EB 3BK9A 3G7GA 4C91A 2EHOA 4XNLA 2W81C 5JH7E 1IJ5A 4U31A 4KBMB 3AB3B 4G2AA 2QTKA 3ANWA 2XUEA 3S4UA 4YSZA 5BMVE 4X65T 3SYSA 2VKDA 2X9KA 4WYVA 1YD8G 4FQEA 2JIWA 4K0KT 4QH4A 3U3IA 3B57A 1T98A 2X51A 5FXXA 3PV0F 4LSIA 2WJQA 3UUXB 3ZJ1A 2MNHA 2FGRA 5LYJE 3N2OA 2KLQA 5JDNA 3AA0A 2BZBA 4KR8A 4LF7T 4B6XA 5F3JA 4D5UA 4OK0A 4F8HA 3KVBA 3A0BO 5AQGB 4CZZB 2KT9A 5F8PA 1OXZA 4HWDA 4IT4A 4ZI3C 2YU2A 2NOXA 2WVPA 3AEEA 2Q9QC 3AAAB 2E9XC 2WAUA 3VZTX 1KNZA 2WP9A 3PORA 3HA4A 2V7IA 4Z8XA 4X20E 5AQRB 1IJ6A 4DUZT 4LF6T 3UQ7A 1BR0A 5FY7A 2LSGA 3WAJA 3IA3A 3PU3A 4K3CA 4J2CA 3D0TA 2WY2A 5LGTB 2ODJA 5JR9C 2LM9A 1D1BA 3HI2A 4GCQA 4X62T 3QB5K 3WI5A 3CIRA 3POUA 2UXNB 5CA0E 1EZ3A 2XE3A 4MHCA 1MNDA 2R89A 3C98B 3OBVE 1LRZA 1IBKT 2Y6XA 3FZMB 3NVOA 4WNKA 4DV7T 3T8OA 3R6NA 3RBHA 5AQNB 2BG9C 3AECA 3KVAA 2UU9T 1BR1A 2XSBA 4IDQA 2JMKA 2WJRA 3I0QA 4IIJE 4EGWA 2W4XA 1N33T 5AQVB 4UB6O 2V1DB 3LBXA 2ZLYA 3PGRA 1OEDB 1J5ET 1XDPA 4TNWA 5ABFA 5PRNA 2QRXA 3W15B 1U4QA 2E5LT 3DJBA 5FP3A 4TZ4C 3BRYA 5LP6E 2C5JA 2YDQA 5T5FA 2XZEA 1B7TA 4IE7A 4NUVA 2HN1A 5LBMA 3H3MA 3EI0A 5AQTB 4WBNE 3H3AA 4CI1B 4AFKA 3RYFE 4KHZF 2Y2XA 2LEHA 3CK6A 5A1LA 2X9YA 4O3ZA 5LG4A 3GA8A 4U2YA 3Q2MA 5JVDE 4DR6T 2YPVA 3PE0A 3SY7A 5KX5E 1LVKA 4NXMT 2UUCT 5LHGB 4KR4A 2XE2A 4ISSA 4H63V 2F4VT 5L3BB 5DL7A 4JBWF 3SFDA 1ZHYA 3NWIA 2XY8B 4UVCB 2N2LA 3AXJB 1KNRA 3I9YA 5AQSB 2DHRA 2OLTA 5FNVE 3LK3B 3C64A 4ZI2D 3GWHA 2ZM0A 3EAMA 3U78A 3CKDA 3VRBA 3KBTA 3VZWX 4TWHA 2CPTA 1UX5A 2JQKA 2Z6EA 2UXDT 3NBXX 4KUMB 2W61A 3KV4A 4I43B 4PJ0O 4ILCA 3JCUO 1ZHWA 3FYXA 4AQFC 5AQUB 1WFDA 5FXVA 1T16A 3N2GE 2XAHB 5HAXA 4BA9A 4YLHA 3LK2A 4UB8O 5DL6A 4IL9A 4O4LE 3WAKA 3RQUA 4CI2B 2XMXA 2G0UA 4A5XA 2FBWA 3ETVA 1I94T 4RLCA 4O4JE 3OPCA 5LA6E 2IAKA 3KV5A 2HHHT 2CBIA 2W67A 3PUWF 4DO0A 1YS5A 3QC9A 5JRCB 2YU1A 2J1DG 4PUXA 2C5KT 1WYCA 3P7IA 2LKGA 4TUYE 1KF6A 4COFA 4GK5E 2CM0A 3Q5WA 4OHFA 4XBFB 2L3LA 2LSYA 3ZKRA 1N36T 1UK5A 3RQWA 2XE5A 5H6QB 1HCIA 3P4SA 2WZHA 2J62A 2E9XD 3CPZA 2GK9A 4TWDA 4OX9T 5IWAT 4Q25A 3ZMUB 1Z0PA 4FZNA 3QNUA 2YDRA 4A98A 2A9UA 2EHOD 1QSDA 2B1EA 2KWHA 4EV6A 3VKGA 3M65A 4FT6A 5IYZE 2K48A 4JEHB 4IE0A 3ZC1A 3IEEA 4LF9T 5CB4E 1E7PA 4ZXLA 4HWHA 5J1GA 3F57A 4FESA 4JI5T 4B61A 5ETWA 2X9WA 1IZNB 5JDHA 2HPJA 2VL8A 4XNKA 3Q5XA 1YKEB 4Z90A 4QWNB 4FSOA 3ONLC 2JQ9A 2LSJA 4LSFA 1MNEA 8PRNA 1WLXA 1HF8A 3AE6A 4FI5A 3TLUA 2D2SA 1W9RA 2CWOA 5AQJB 4G75A 2LRLA 1H7CA 1IBMT 4DVDA 3DZMA 5IUXA 2H7OA 4BUMX 3NZPA 2V8SV 4HFCA 3C4ZA 2CHOA 2HH7A 3AA6A 3CX8B 5CA1E 3T24A 4N59A 3LJCA 5AFUK 4HE8A 1ZV4X 3OJAA 1HNWT 1ZHTA 5JDPA 2X27X 1KEYA 3AAIA 2XAFB 3NRXA 1KNPA 4ILUA 1E2AA 3SZDA 3VY8X 4TWFA 5AQHB 2I6HA 3P4QA 4DV1T 1XDOA 1YW0A 2R88A 4DV2T 3SFEA 3F2EA 4ZEYA 4PJMA 5HXSA 3AE1A 1LVFA 1XWMA 2YINA 2IC9A 2NTXA 4UV9B 3LDQB 3JC6D 1VRBA 4TV8E 2BS3A 4PNIA 3ZT6A 5HCMA 3GN5B 3E0ZA 3TLVA 3VZUX 4HWCA 4AKHA 4HKAA 1MM5A 1H6S1 3RYCE 2QVAA 2CMRA 2K0LA 2VWAA 3PU8A 5KDMC 2YNKA 3HR0A 4N74A 5TISO 3X1DA 3ZSTA 1ZKEA 1JNRA 3KFWX 2K9AA 2CXDA 2XTQA 4QXCB 3WU2O 1ZP0A 2ACXA 2R4NA 3CX7B 4BJNA 7PRNA 3O0EA 3AE5A 3AE7A 2N2MA 1U5PA 2V5DA 5CJ5A 3Q5EA 2K24A 3I1AA 4YJ3E 4O4XA 5J2TE 5AQPB 2X68A 4JI2T 2WMOA 2WQYA 3QB5A 3AE9A 4YTMA 4ASKA 2WS3A 3QOFA 5D5DA 4QX7B 3EHZA 3O4XE 3BQIA 5FXWA 2Q9QA 1XMQT 3ZYLA 2V7MA 2E9XA 4JI3T 2UXXB 4DV3T 2V6XA 4H9OC 2MYSA 4EZ4A 5LBQB 4LFCT 2ZM8A 1GFMA 3LFMA 2EHOB 1MMDA 4JI6T 2XAJB 2L8KA 4NUUA 4C4VA 2IW5B 2LT3A 4OYJA 3POQA 2H89A 3N9NA 3PTRB 4X5TA 3ANWB 3VE2A 1HG2A 4YTNA 3VHLA 2BKOA 3CQCB 2WDQA 4N78D 3KDSE 2VK9A 2BBHA 3RC3A 4MFRA 5L47A 3E22E 4JI7T 3VY9X 2VVNA 3TKLB 3LG7A 3UU2A 4EYYR 3ETUA 4WW0A 4A97A 5E79O 2ZM6T 1D0XA 4O2BE 3GP6A 2BS2A 1OPFA 1QUUA 2FUPA 2CLYB 2BG9A 3AA0B 4WBOA 3AA7B 3T20A 1S35A 5C8YE 3QRAA 4C69X 4YT0A 1CHUA 2LFUA 1KFYA 1OSMA 4UVAB 3MK7C 5FXZA 3O1IA 3ZEFB 3O1HA 2MAWA 5AFUL 5B66O 4DR7T 3VU7H 2ES0A 4LF5T 4DIDB 3ZCJA 1T1LA 3LSVA 4GKJT 5GONE 3NSGA 5FVLA 3ZN0B 2N2NA 3HOLA 4EXTA 4ILAA 3RIAA 2IWWA 3RF1A 3UPGA 4U72A 2XQ9A 2UUAT 2XM1A 2ACZA 3AEAA 3HKEE 2UUBT 2IUBA 3E08A 2CRBA 3IF8B 1YQ3A 3AVRA 3K3QC 4JI1T 2XQ4A 1N32T 3AA1A 3PUSA 2HPLA 1MIVA 4EIWA 4MALA 4O4UA 2YN6A 3A5XA 3ZJ2A 4FZLA 4CQIA 2J4UP 1FMWA 3PUYF 3VR9A 3TLTA 3AAEA 2X9HA 5FY1A 1ZHCA 4DBRA 2A3DA 2A72A 3Q9DA 3K8PC 4V1Av 2YDSA 2BKNA 3LBXB 2KZ7A 3K3OA 2XHEB 2BVLA 3AE2A 4CTDA 5E0OA 4IHJE 2CLYC 1ZEEA 1BR4A 1AJ3A 5HYAA 4K3BA 5ABFB 4N75A 4H63H 5KXJA 4DR5T 2DWGA 4WZXA 3MA9A 5ABEA 2DLRA 5B5EO 4CXYA 4AQFA 3L3PA 4EB6E 5JTGA 1HR0T 4DR4T 4LMKA 3H37A 2WWUA 3OKQA 3OTOT 1QJPA 3PURA 4QH5A 2DI4A 2SPCA 4P09A 2IC6A 5JDGA 2W00A 3MZKB 3J7Yq 5FVKA 4EOZB 5AQFB 2QA7A 5DABA 5C3JA 2V5CA 2IDOB 4DUYT 4IL6O 1PHOA 1BH3A 2XJ7A 3UAQA 4O3YA 2DCFA 4X1KE 5EK3A 2JQYA 4AYEC 4NPPA 3UU6A 2CXFA 2XASB 2WM9A 3ZLIA 4UR9A 3POXA 2HN2A 2WWVA 3PUGA 3O1JA 4FSPA 1HNZT 3RYIE 4D64A 1MMAA 2IWVA 4ERRA 4XAXB 4AKRA 3KV6A 1M62A 4IE4A 4C90A 1HFAA 4O4IE 2OV9A 2WCAA 2H88A 2KNDA 3A8YC 1E1HB 4IREA 2JQQA 3NKZA 4RJWA 3EUHA 4CXWA 1Z8UA 4UF0B 2NTYA 4E1SA 3AE3A 3N9LA 4GHBA 5HCJA 3RRWA 3SOLA 3LK2B 2I59A 3C4XA 4HTEA 1OEDC 1D0YA 3ONJA 3UUNA 2BG9E 1SUMB 2YK0A 3HW9A 4ZS2A 4ILBA 4KI0F 2V6YA 1GFPA 1THQA 2Y0HA 4HEAA 2WU5A 3EVYA 2QYWA 4LMJA 4GOUA 3QRCA 3JCFA 2UXBT 3LK41 4FMSA 5L3CB 2KXPA 3I0OA 1JNZA 5LGUB 3HL6A 1QJ9A 4IL4A 3UU3A 3EMNX 5HXEA 1FJGT 4L5GA 5LNKA 1UUSA 4ZZCA 5JDQA 4ZI3D 1X79A 4JEUB 2Q9QD 2V26A 2XQAA 5EE2A 5CFBA 2XAQB 1G8XA 2WDVA 3KZIO 1Y64B 5J0ZA 4KMCA 4U74A 4H9PC 3C50A 2IIUA 5FMNA 3P4WA 3PUXF 1ZHXA 4PK5A 3LK42 5DJQC 5G3AA 1Q9FA 1LKXA 2W66A 2IHR1 3P8CD 4HFHA 4P0BA 2ERVA 2NW9A 2CWYA 4UV8B 2K5BB 4B3RT 3ZSSA 2PORA 2ODUA 4B3TT 2UXCT 1T72A 2CBJA 3UFEA 4MLKA 2E5VA 3CVRA 5HEJA 5DL5A 2OMFA 3WI3A 5IHYA 4AIUA 1W09A 2VB6A 3R84B 3DWNA 4LSEA 4L0RA 2LOSA 3AA6B 2R8AA 4KP3C 1GFQA 3WI4A 2JMMA 2NW8A 2ZLDA 4QXHB 2PFVA 5HXRA 4GCPA 3ZN1B 2LHRA 3ZCIA 5HEUA 2NP9A 4PFPA 3T1YT 4ZHQE 2XPKA 1QJ8A 4U9CA 2XQ5A 4B3ST 3SRZA 1WRDA 1MMNA 4E1TA 3C5OA 2LSKA 1WYBA 2VQET 1GFNA 3DTOA 3RHWA 4GYRA 4LFBT 3CQXC 3L09A 3RH3A 5JQGE 2WDRA 5LGNB 2R4OA 3EDUA 3MJXA 2V7JA 3N5LA 4QH1A 3L8RA 5HXHA 4DV0T 2Y7SA 4BAYB 3UU5A 2XQ8A 4EEBA 3C4WA 5AQKB 5FYMA 2DNXA 4NIQA 5EZYE 4ISTA 2LHNA 1SHZC 4IDPA 3RIUC 4F4BA 3PJAA 4QX8B 5L3GB 2VVSA 1UGOA 1CUNA 2WU2A 2K4TA 3NJTA 3B13A 4HFBA 3RC8A 5HEHA 2Y8DA 4PJNA 2XQ6A 4PAGA 4CI3B 2GE4A 2VKHA 4YSYA 5FY0A 1NEKA 4UXNB 2YEVC 2MHLA 2D9DA 4FOZA 3UT5E 2RP4A 3ZMVB 5ABHA 3ZC0A 4D65A 2D0UA 4CXXA 3K1SA 2JQHA 3FXDB 2MOZA 4IE5A 5IYUA 5BR8T 4KHPT 5G26A 4DBQA 2NWBA 3O9XA 4HWIB 4EEDA 2YOEA 4U7YA 3T0SA 4H9QC 4HFEA 3SS1A 2FJEA 2P9BA 4LMLA 1D1CA 2Q9QB 3CX6B 5HXCA 3VRAA 2VQFT 2E9XB 3SY9A 4P0AA 4O49A 4JLEA 2CHNA 2H3RA 2LE8A 2AE9A 5LHHB 2R6GF 1YKHB 4JI4T 2PBIA 1WR6A 3PF1A 4C4VB 4Z3TA 3ZMTB 4AYNA 2XAGB 4AYID 3BQKA 3P4RA 4NXNT 2R4LA 2FJBA 5TAOA 2PRNA 4GCSA 2WZIA 4ZS3A 2Y0LA
chains in the Genus database with same CATH topology
3N2GE 2XAHB 4UIGA 5FY1A 1ZHCA 4YLHA 5HAXA 4BA9A 2D0TA 4DBRA 1MM4A 3LK2A 2KC0A 2A3DA 2A72A 3Q9DA 3K8PC 5JR9A 4ZI2C 4GIWA 1HG5A 2VKOA 3VKHA 4V1Av 4O4LE 4YFSA 3WAKA 5DL6A 5EK4A 4AXPA 4CI2B 2WMNA 3LBXB 2XMXA 2G0UA 2KZ7A 4JCHA 3HKDE 3DA4A 1VOMA 3ETVA 4YJ2E 4RLCA 4O4JE 3K3OA 2XHEB 2BVLA 1MIWA 2XG6A 5LA6E 5E0OA 4IHJE 2CLYC 1ZEEA 4O8SA 1BR4A 1AJ3A 2IAKA 3KV5A 5HYAA 4DMWA 4DO0A 1YS5A 3QC9A 5JRCB 4H63H 2YU1A 2DWGA 2J1DG 5H6RB 3MA9A 4PUXA 2C5KT 2DLRA 1WYCA 3P7IA 2E8IA 2C5IT 4CXYA 4AQFA 3KV9A 4TUYE 4JFBA 2X67A 3L3PA 3PQSA 4EB6E 4GK5E 4KRAA 3PRNA 2CM0A 3Q5WA 3H37A 4OHFA 2WWUA 4XBFB 2ZFGA 3V8UA 2L3LA 5EK2A 2LSYA 3OKQA 2PJQA 3NZQA 4O2AE 1QJPA 2XE5A 3PURA 3UUMA 2DI4A 3AVSA 3I9WA 2SPCA 5H6QB 4P09A 1HCIA 2IC6A 5JDGA 2D5UA 2W00A 2E9XD 3MZKB 3J7Yq 3CPZA 2GK9A 4FJOA 4AKGA 4LSHA 4EOZB 2QA7A 3GN5A 5DABA 3ZMUB 2JRKA 4OYKA 1IAPA 2XTLA 4E7SA 3VE1A 2W80C 1Z0PA 3EDVA 2V7KA 5KMGP 4E7ZA 1BH3A 2JJ9A 3MXZA 1PHOA 4FZNA 3UAQA 4IGUA 4O3YA 1BXWA 2DCFA 2ZM2A 4X1KE 3AA7A 2EHOD 3BQLA 4PK6A 4UELA 1QSDA 2B1EA 1HXUA 1MMGA 2QGSA 4TN7B 2KWHA 4AYMC 5EK3A 2RA1A 3VKGA 3FB2A 1D0ZA 1KK7A 3M65A 4ZI7E 4YHJA 4N58A 4AYEC 1FMVA 4FT6A 5IYZE 3CWZB 1NAFA 2CXFA 2XASB 2WM9A 2K48A 3N9OA 1NWMX 4JEHB 4O4HE 3ZLIA 4IE0A 3ZC1A 3IEEA 4GK0E 2F1TA 5CB4E 2JMHA 5J1GA 3POXA 3ZYMA 4GYSA 3F57A 4X1IE 4FESA 3PUGA 4O3XB 4B61A 1S94A 2LJLA 4F6RC 1UX4A 3O1JA 5ETWA 4FSPA 3RYIE 3AAAA 4G63A 2O4VA 2X9WA 4EZHA 4D64A 4QHOA 1MMAA 1IZNB 2LOPA 4M1PA 5L2LA 4ERRA 4XAXB 4AKRA 5JDHA 2HPJA 2VL8A 3CQGB 3Q5XA 4XNKA 3KV6A 4IE4A 3UULA 3FXEB 1YKEB 1HFAA 4C90A 2JPFA 4K0UA 4QWNB 1OWAA 4TV9E 4FSOA 4O4IE 4JUYA 5LXTE 1BT9A 2J1NA 3RKOA 4MBQA 1HX8A 3OYZA 2LSJA 3ZMZB 3AA1B 4LSFA 2EHOC 1MNEA 2KNDA 8PRNA 1E1HB 1WLXA 2JQQA 5LOVE 1HF8A 4AUIA 3FBLA 4H9SE 2XQYA 4ANJA 4FI5A 4RJWA 2KWIB 5JDLA 4AI6A 3EUHA 3N9MA 5J2UE 1BR2A 1O3XA 2OA5A 2D2SA 2ODVA 3RRCA 4CXWA 4PJLA 2CWOA 4G75A 3PUAA 4IDZA 2FGQX 2CEAA 1H7CA 4UF0B 2NTYA 4DVDA 1GFOA 2KINB 3SWHA 4FZMA 2H7OA 4BUMX 3NZPA 4E1SA 5ADXK 3C4ZA 2HH7A 4GF4A 4TX5A 3AAEB 2BVMA 3N9LA 3CX8B 3AA6A 4GHBA 5CA1E 3RRWA 3T24A 4N59A 3LJCA 4XZCA 3SOLA 3LK2B 3J9X1 2I59A 5L3FB 3C4XA 2F1VA 1ZHZA 5JR9B 3K19A 2KMFA 5DQWA 5L3EB 4HTEA 3BK9A 1D0YA 4HE8A 5AFUK 4X1YE 1ZV4X 3V5SA 3UUNA 3G7GA 4AKIA 3OJAA 2CE7A 2YK0A 2KZ7B 4C91A 1ZHTA 3HW9A 4ZS2A 2X27X 4OFZA 5HWYA 5JDPA 2EHOA 3AAIA 1P4TA 2XAFB 1GFPA 3NRXA 4EAHA 5DL8A 4XNLA 1THQA 2W81C 5JH7E 4ILUA 1IJ5A 2Y0HA 4HEAA 3EVYA 4GOUA 2X9XA 3SZDA 4KBMB 3KBUA 3VY8X 3QRCA 3AB3B 4G2AA 3LK41 2QTKA 1YW0A 3ANWA 4FMSA 5L3CB 2KXPA 3I0OA 2XUEA 3S4UA 3SYBA 3F2EA 4PJMA 5BMVE 5HXSA 5LGUB 4AYDC 3SYSA 2VKDA 3HL6A 5LHIB 4FUVA 1LVFA 2YINA 2IC9A 1YD8G 5L3DB 2M67A 1QJ9A 2NTXA 5FVNA 3SZVA 4UV9B 4PJJA 3JC6D 2LHFA 3EMNX 1VRBA 5HWXA 4FRXA 4TV8E 5HXEA 4PNIA 4L5GA 5LNKA 2YNKA 3U3IA 5JDQA 3JTYA 3B57A 4ZI3D 6PRNA 2CXLA 1X79A 1T98A 2X51A 5FXXA 4JEUB 2Q9QD 4LSIA 2V26A 3UUXB 3MKDA 5EE2A 3GN5B 2XTRA 3ZJ1A 2MNHA 2FGRA 3E0ZA 5LYJE 3HWBA 3VZUX 1D1AA 3FHNA 2XAQB 1G8XA 3HKCE 3N2OA 2KLQA 5LJMA 4AKHA 3N9PA 3ONXA 1Y64B 4A56A 4KMCA 4U74A 5JDNA 4H9PC 4HN9A 3AA0A 4HKAA 2BZBA 3C50A 4KR8A 5FMNA 3HKBE 4B6XA 1ZHXA 1G73A 5F3JA 1MM5A 4PK5A 4D5UA 3LK42 4OK0A 5DJQC 1HXXA 3JC6C 1H6S1 3RYCE 2CMRA 1Q9FA 3KVBA 2K0LA 1LKXA 2VWAA 3PU8A 4P0BA 3P8CD 2KT9A 4UEMA 3HR0A 4CZZB 5KDMC 5M4YA 2ERVA 4O3WA 2NW9A 2CWYA 5F8PA 1OXZA 3IHRA 4UV8B 2CA5A 3RX6A 4ZI3C 1ZKEA 2YU2A 2K5BB 2NOXA 3KFWX 2N9DA 2K9AA 2Q9QC 2CXDA 3AAAB 4QXCB 2XTQA 2ACXA 2PORA 2E9XC 2ODUA 2WAUA 3CX7B 3VZTX 4BJNA 7PRNA 4AKRB 3O0EA 1UCUA 3ESLA 1KNZA 4AKMA 2L9QA 3UFEA 4MLKA 2N2MA 1U5PA 3PORA 3HA4A 2V7IA 4Z8XA 3V5UA 3CVRA 4X20E 2VKJA 2K24A 3I1AA 4BJMA 4YJ3E 5DL5A 4O4XA 1SA0E 2OMFA 1IJ6A 3WI3A 5IHYA 2Y48B 1MPFA 3C51A 4RJXA 5J2TE 1BR0A 5FY7A 2LSGA 3WAJA 2VB6A 2X68A 3MACA 3R84B 4HGAA 3PU3A 2WMOA 4J2CA 5DQVA 4AKLA 3D0TA 4LSEA 4L0RA 4ASKA 3NRYA 5LGTB 2ODJA 5D5DA 4QX7B 5JR9C 1ORMA 3O4XE 5FXWA 2LM9A 3BQIA 5JDFA 2LOSA 3LK3A 1D1BA 1V9DA 2Q9QA 3AA6B 3HI2A 3ZYLA 3FBZA 2V7MA 2E9XA 4KP3C 4GCQA 2H7VC 2UXXB 1GFQA 2JMMA 3WI4A 2NW8A 5GV0A 2ZLDA 4QXHB 3KVDD 3UTKA 2PFVA 4H9OC 5HXRA 2MYSA 3WI5A 4GCPA 4EZ4A 5LBQB 3ZN1B 2LHRA 4DNDA 2M07A 3POUA 4QXBB 2UXNB 2ZM8A 3ZCIA 5CA0E 1GFMA 1EZ3A 3LFMA 2NP9A 2XE3A 4PFPA 4I4TE 2EHOB 1MNDA 4MHCA 1MMDA 2XAJB 5LJNA 2L8KA 4NUUA 4ZHQE 3C98B 3OBVE 1QJ8A 1LRZA 4U9CA 4UF0A 2IW5B 1MIYA 2Y6XA 2LT3A 4OYJA 3POQA 4WNKA 3N2KE 3SRZA 1WRDA 2W0GA 3N9NA 3PTRB 3R6NA 1MMNA 3T8OA 3PDYA 3RBHA 3ANWB 4E1TA 2KXPB 3VE2A 1HG2A 3C5OA 2LSKA 3VHLA 3KVAA 1WYBA 1BR1A 1GFNA 3DTOA 3CQCB 4PW8A 2MBGA 2JMKA 4QQ1A 3N9QA 2ZMAA 2KDYA 4N78D 4GYRA 3KDSE 2VK9A 3I0QA 4IIJE 3RC3A 3CQXC 3L09A 5LCYA 4MFRA 4I50E 3RH3A 3OYXA 3TZGA 3E22E 2LSIA 5JQGE 2NW7A 5LGNB 2V1DB 3EDUA 3LBXA 2W62A 3A2SX 2ZLYA 3MJXA 3VY9X 3TKLB 2V7JA 3LG7A 1FIOA 3UU2A 4ZOLE 4EYYR 5JREA 2CCQA 3ETUA 4WW0A 3N5LA 2M06A 4DMVA 5HXHA 3RYHE 2Y7SA 4BAYB 4H9RC 5JDMA 5PRNA 2PG8A 1D0XA 2BDEA 5JRCA 3C4WA 4O2BE 3GP6A 5FYMA 3W15B 1QUUA 2DNXA 1OPFA 4EYUA 1U4QA 2CLYB 4HFVA 5EZYE 3RPUA 4ISTA 2LHNA 2X0LB 3DJBA 5FP3A 1SHZC 4F4BA 4TZ4C 4QX8B 2Y0KA 3AA0B 4WBOA 5L3GB 3KINB 5LP6E 2C5JA 3QK6A 2XE1A 3AA7B 3T20A 1CUNA 1S35A 5C8YE 2K4TA 1HTJF 3QRAA 3IBPA 3B13A 4C69X 3RC8A 2Y0LA 5T5FA 5ADXL 1B7TA 4IE7A 4NUVA 2Y8DA 3ZMSB 4PJNA 4PK4A 5LBMA 2LFUA 4PAGA 1OSMA 4CI3B 2GE4A 1FEWA 4UVAB 2VKHA 1HXTA 3MK7C 5FY0A 4WBNE 3GMIA 5FXZA 4UXNB 2YEVC 2MHLA 3O1IA 3H3AA 3ZEFB 3O1HA 4UVBB 4CI1B 2N1GA 3RYFE 4ADZA 4FOZA 5AFUL 4AFKA 3UT5E 4AZLA 3PUQA 3ZYKA 2Y2XA 2RP4A 2LEHA 3ZMVB 1G90A 2MTQA 3ZC0A 4G76A 3VU7H 4D65A 2D0UA 4CXXA 2ES0A 2V7LA 5A1LA 2X9YA 4AQGA 3FXDB 2MOZA 1US7B 4IE5A 5LG4A 4O3ZA 3GA8A 4RL9A 5IYUA 3ZCJA 1HS7A 5GONE 3NSGA 3Q2MA 3QUJA 5G26A 5JVDE 3ZN0B 4DBQA 2YPVA 2NWBA 3PE0A 3SY7A 2WBLA 2N2NA 3O9XA 2X66A 5KX5E 1LVKA 3HOLA 4EXTA 5LHGB 4KR4A 2XE2A 3DP7A 3UPGA 4I55E 4ISSA 3T0SA 4H63V 3DA3A 4H9QC 4U72A 5L3BB 5DL7A 4QKNA 3SS1A 4H9NC 1ZHYA 2N2LA 4UVCB 3HKEE 3I9YA 2P9BA 3F31A 1IZNA 1E54A 2DHRA 1D1CA 3LK3B 5FNVE 2Q9QB 3CX6B 5HXCA 4RLBA 3E08A 3C64A 2E9XB 2VASA 3IF8B 3SY9A 4ZI2D 3GWHA 2ZM0A 4IE6A 3AVRA 3K3QC 4PFOA 4P0AA 2WSSV 3AA1A 4O49A 4JLEA 3U78A 2A2FX 3CKDA 3PUSA 2HPLA 1MIVA 3KBTA 4L9IA 4EIWA 3PQUA 3VZWX 1UX5A 2H3RA 2LE8A 2DWKA 4MALA 5LHHB 2Z6EA 2C0SA 2W63A 4FRTA 3CMLA 3K3NA 3NBXX 1PRNA 4O4UA 1YKHB 2W61A 3KV4A 3A5XA 2PBIA 4KUMB 1WR6A 4I43B 3ZJ2A 4FZLA 1ZHWA 4Z3TA 3ZMTB 4AYNA 3FYXA 2XAGB 4AQFC 4CQIA 4AYID 3BQKA 2J4UP 1Q9GA 1FMWA 2PRNA 5TAOA 4GCSA 5FXVA 3AAEA 4ZS3A 3HOEA 2X9HA 3ZPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA1 A;  3LK2 B;  3LK2 A;  5AFU L;  5AFU K;  3AAA B;  2KZ7 B;  3AAA A;  3AA0 B;  2KZ7 A;  1IZN B;  4AKR B;  3AA0 A;  3AA7 B;  1IZN A;  3AA7 A;  4AKR A;  3LK3 B;  5ADX L;  3LK4 2;  3LK3 A;  5ADX K;  3AA6 B;  3AAE B;  2KXP B;  3AA6 A;  3LK4 1;  3AA1 B;  3AAE A;  2KXP A; 
#chains in the Genus database with same CATH topology
 4UIG A;  2LLY A;  2D0T A;  1MM4 A;  5JR9 A;  4I0U A;  4ZI2 C;  1UUR A;  4GIW A;  4YXD A;  1HG5 A;  2VKO A;  3VKH A;  5EK4 A;  4AXP A;  2WMN A;  5FL0 A;  4JCH A;  1IBL T;  3DA4 A;  1VOM A;  1MIW A;  2E2A A;  5H6R B;  3ABV A;  2E8I A;  2C5I T;  4YY3 T;  3KV9 A;  2BG9 B;  4KRA A;  3PRN A;  2ZFG A;  5EK2 A;  4O2A E;  2VL0 A;  5KAF O;  3UUM A;  3AVS A;  4U2Z A;  4LSH A;  4FJO A;  1S5L O;  4CN1 A;  4OYK A;  1IAP A;  2XTL A;  2AXD S;  3EDV A;  2V7K A;  3AEG A;  3ZT7 A;  3PJA J;  1SE7 A;  3AA7 A;  2B76 A;  2X0H A;  1HXU A;  1MMG A;  2QGS A;  4TN7 B;  4AYM C;  3TLW A;  3FB2 A;  1D0Z A;  4ZI7 E;  3PUV F;  3PGS A;  3CWZ B;  1NAF A;  4O4H E;  4GKK T;  1NWM X;  4Z91 A;  5F5W A;  3RI5 A;  2XQ7 A;  2F1T A;  5C2T A;  4U33 A;  3ZYM A;  4DV5 T;  1ZOY A;  2LJL A;  1W0B A;  4G63 A;  2O4V A;  4EZH A;  3AAA A;  1NEN A;  3M3Z B;  2LOP A;  5L2L A;  3T1H T;  5AQQ B;  2I0M A;  5KAI O;  3P50 A;  2W2U A;  4JYA T;  3CQG B;  5LMN T;  3FZH B;  3FXE B;  4K0U A;  2BS4 A;  2LRK A;  3RKO A;  1HX8 A;  3AA1 B;  5ABG A;  2EHO C;  3Q5D A;  3FBL A;  4H9S E;  5G38 A;  2KWI B;  5JDL A;  2OA5 A;  4TNV A;  3RRC A;  2ODV A;  4PJL A;  5HEO A;  4IDZ A;  2CEA A;  2KIN B;  2FJA A;  3SWH A;  3AED A;  5ADX K;  4P1N A;  2KSR A;  1HNX T;  3AAE B;  2BVM A;  3FZF B;  2XM2 A;  3A0H O;  4XZC A;  3EAB A;  3J9X 1;  2AXT O;  2F1V A;  3JAD A;  5G39 A;  1ZHZ A;  2M6I A;  1HX1 B;  3BRZ A;  1X9B A;  4X1Y E;  3V5S A;  4AKI A;  4U3C A;  2CE7 A;  2KZ7 B;  2K3W A;  4OFZ A;  5HWY A;  1P4T A;  4EAH A;  5DL8 A;  3UU8 A;  2X9X A;  3KBU A;  2PTF A;  2J4G A;  3RKG A;  2RPA A;  3SYB A;  3JAE A;  4AYD C;  5LHI B;  4FUV A;  5L3D B;  2M67 A;  5FVN A;  3SZV A;  4PJJ A;  2LHF A;  3VR8 A;  5HWX A;  4FRX A;  2XQ3 A;  5AQO B;  3JTY A;  1OED A;  6PRN A;  2CXL A;  4LF8 T;  2F1C X;  3MKD A;  1YXR A;  2XTR A;  4HFI A;  3BS0 A;  3HWB A;  1D1A A;  3FHN A;  3HKC E;  5LJM A;  3N9P A;  3ONX A;  5AQI B;  4A56 A;  4IDN A;  3DWO X;  4HN9 A;  3RIF A;  1DU2 A;  3HKB E;  1G73 A;  1HXX A;  3JC6 C;  5M4Y A;  4O3W A;  4UEM A;  3L39 A;  3IHR A;  2CA5 A;  3RX6 A;  3AE8 A;  3PUZ F;  2N9D A;  4AKR B;  3UQ4 A;  3RLF F;  1UCU A;  3ESL A;  4AKM A;  4DR2 T;  5LG3 A;  2L9Q A;  3V5U A;  2VKJ A;  4BJM A;  1SA0 E;  4RJX A;  2Y48 B;  1MPF A;  3C51 A;  3UUB A;  3MAC A;  4HGA A;  5DQV A;  4AKL A;  3G06 A;  3AXJ A;  3NRY A;  3OVU A;  1ORM A;  5JDF A;  3LK3 A;  1V9D A;  3FBZ A;  2H7V C;  5GV0 A;  1W0A A;  2DL1 A;  3KVD D;  3UTK A;  2LM2 A;  4DND A;  2M07 A;  4X66 T;  4QXB B;  4I4T E;  2V6Y B;  5LJN A;  5LMU T;  4UF0 A;  1MIY A;  1VCT A;  3N2K E;  2W0G A;  3PDY A;  3ZT5 A;  2KXP B;  5AQM B;  4PW8 A;  2MBG A;  4QQ1 A;  3N9Q A;  2ZMA A;  2KDY A;  5LCY A;  4I50 E;  5LB7 B;  3OYX A;  3TZG A;  2LSI A;  2NW7 A;  3RGL A;  2W62 A;  3A2S X;  1FIO A;  4ZOL E;  5JRE A;  4X64 T;  2CCQ A;  2M06 A;  4DMV A;  3RYH E;  4YTP A;  4H9R C;  5JDM A;  2PG8 A;  4DR3 T;  1YQ4 A;  2BDE A;  5JRC A;  3JAF A;  2BBJ A;  4EYU A;  4HFV A;  3RPU A;  2X0L B;  5GTI O;  5FKY A;  2Y0K A;  3KIN B;  3QK6 A;  2XE1 A;  4JI8 T;  1HTJ F;  3IBP A;  5ADX L;  2XSA A;  3ZMS B;  4PK4 A;  4DV4 T;  1VCS A;  1FEW A;  1HXT A;  4LFA T;  3GMI A;  2M6B A;  4UVB B;  2N1G A;  4ADZ A;  4AZL A;  3PUQ A;  3ZYK A;  4DV6 T;  1G90 A;  2MTQ A;  1N34 T;  4G76 A;  3PGU A;  2V7L A;  4AQG A;  1US7 B;  2VUR A;  4YSX A;  1XZY A;  2WB5 A;  1HS7 A;  4RL9 A;  1J1J A;  4LF4 T;  2R4P A;  2NR4 A;  3QUJ A;  2X0Y A;  3RIU A;  2WBL A;  2X66 A;  4HFD A;  1XNQ T;  5GTH O;  3DP7 A;  4I55 E;  3DA3 A;  4QKN A;  4YHH T;  4H9N C;  3F31 A;  1IZN A;  1E54 A;  4RLB A;  2VAS A;  4IE6 A;  2FJD A;  4PFO A;  2WSS V;  5CGM A;  2A2F X;  5H2F O;  4L9I A;  3PQU A;  4FRT A;  2DWK A;  2C0S A;  2W63 A;  3UFG A;  3CML A;  3K3N A;  1PRN A;  1XMO T;  1T8B A;  1XNR T;  1OED E;  4KX6 A;  3AE4 A;  1Q9G A;  3VE1 A;  3HOE A;  3ZPO A;  2J47 A;  4DR1 T;  2KC0 A;  4YFS A;  4B3M T;  3HKD E;  4YJ2 E;  2XG6 A;  4O8S A;  4ZZB A;  4DMW A;  5FL1 A;  3A7M A;  1QLB A;  4JFB A;  2X67 A;  3PQS A;  4JV5 T;  3V8U A;  2PJQ A;  4CN6 A;  3NZQ A;  3FZK B;  1L0V A;  4PR7 A;  3I9W A;  2MPK A;  2D5U A;  4AKG A;  3GN5 A;  4U7I A;  2JRK A;  1J5W A;  2LKH A;  4E7S A;  5AQL B;  2W80 C;  1WR0 A;  5KMG P;  4E7Z A;  2JJ9 A;  3MXZ A;  1GQE A;  4IGU A;  1BXW A;  1T7S A;  2ZM2 A;  3BQL A;  4IDO A;  4PK6 A;  4UEL A;  3FZL B;  2RA1 A;  4AQY T;  1KK7 A;  4HWF A;  4N58 A;  4YHJ A;  1FMV A;  3P4P A;  3N9O A;  4GK0 E;  2JMH A;  3AEF A;  2YKS A;  4GYS A;  4X1I E;  4O3X B;  1S94 A;  4F6R C;  1UX4 A;  2BKP A;  4QHO A;  4M1P A;  4CN4 A;  1M7K A;  4AIS A;  1I6Z A;  5L4H A;  3UUL A;  3AEB A;  2JPF A;  5L4E A;  4TV9 E;  1OWA A;  4JUY A;  5LXT E;  1BT9 A;  2J1N A;  4MBQ A;  3OYZ A;  3ZMZ B;  4JI0 T;  3TLS A;  5LOV E;  4AUI A;  4ANJ A;  2XQY A;  3UU4 A;  4AI6 A;  3N9M A;  5J2U E;  3B5M A;  1BR2 A;  1O3X A;  4C00 A;  3PUA A;  2FGQ X;  1GFO A;  1WCR A;  5HEG A;  4FZM A;  2IML A;  4GF4 A;  4TX5 A;  1R8I A;  1Y01 A;  5L3F B;  5JR9 B;  3K19 A;  2KMF A;  5DQW A;  5L3E B;  3BK9 A;  3G7G A;  4C91 A;  2EHO A;  4XNL A;  2W81 C;  5JH7 E;  1IJ5 A;  4U31 A;  4KBM B;  3AB3 B;  4G2A A;  2QTK A;  3ANW A;  2XUE A;  3S4U A;  4YSZ A;  5BMV E;  4X65 T;  3SYS A;  2VKD A;  2X9K A;  4WYV A;  1YD8 G;  4FQE A;  2JIW A;  4K0K T;  4QH4 A;  3U3I A;  3B57 A;  1T98 A;  2X51 A;  5FXX A;  3PV0 F;  4LSI A;  2WJQ A;  3UUX B;  3ZJ1 A;  2MNH A;  2FGR A;  5LYJ E;  3N2O A;  2KLQ A;  5JDN A;  3AA0 A;  2BZB A;  4KR8 A;  4LF7 T;  4B6X A;  5F3J A;  4D5U A;  4OK0 A;  4F8H A;  3KVB A;  3A0B O;  5AQG B;  4CZZ B;  2KT9 A;  5F8P A;  1OXZ A;  4HWD A;  4IT4 A;  4ZI3 C;  2YU2 A;  2NOX A;  2WVP A;  3AEE A;  2Q9Q C;  3AAA B;  2E9X C;  2WAU A;  3VZT X;  1KNZ A;  2WP9 A;  3POR A;  3HA4 A;  2V7I A;  4Z8X A;  4X20 E;  5AQR B;  1IJ6 A;  4DUZ T;  4LF6 T;  3UQ7 A;  1BR0 A;  5FY7 A;  2LSG A;  3WAJ A;  3IA3 A;  3PU3 A;  4K3C A;  4J2C A;  3D0T A;  2WY2 A;  5LGT B;  2ODJ A;  5JR9 C;  2LM9 A;  1D1B A;  3HI2 A;  4GCQ A;  4X62 T;  3QB5 K;  3WI5 A;  3CIR A;  3POU A;  2UXN B;  5CA0 E;  1EZ3 A;  2XE3 A;  4MHC A;  1MND A;  2R89 A;  3C98 B;  3OBV E;  1LRZ A;  1IBK T;  2Y6X A;  3FZM B;  3NVO A;  4WNK A;  4DV7 T;  3T8O A;  3R6N A;  3RBH A;  5AQN B;  2BG9 C;  3AEC A;  3KVA A;  2UU9 T;  1BR1 A;  2XSB A;  4IDQ A;  2JMK A;  2WJR A;  3I0Q A;  4IIJ E;  4EGW A;  2W4X A;  1N33 T;  5AQV B;  4UB6 O;  2V1D B;  3LBX A;  2ZLY A;  3PGR A;  1OED B;  1J5E T;  1XDP A;  4TNW A;  5ABF A;  5PRN A;  2QRX A;  3W15 B;  1U4Q A;  2E5L T;  3DJB A;  5FP3 A;  4TZ4 C;  3BRY A;  5LP6 E;  2C5J A;  2YDQ A;  5T5F A;  2XZE A;  1B7T A;  4IE7 A;  4NUV A;  2HN1 A;  5LBM A;  3H3M A;  3EI0 A;  5AQT B;  4WBN E;  3H3A A;  4CI1 B;  4AFK A;  3RYF E;  4KHZ F;  2Y2X A;  2LEH A;  3CK6 A;  5A1L A;  2X9Y A;  4O3Z A;  5LG4 A;  3GA8 A;  4U2Y A;  3Q2M A;  5JVD E;  4DR6 T;  2YPV A;  3PE0 A;  3SY7 A;  5KX5 E;  1LVK A;  4NXM T;  2UUC T;  5LHG B;  4KR4 A;  2XE2 A;  4ISS A;  4H63 V;  2F4V T;  5L3B B;  5DL7 A;  4JBW F;  3SFD A;  1ZHY A;  3NWI A;  2XY8 B;  4UVC B;  2N2L A;  3AXJ B;  1KNR A;  3I9Y A;  5AQS B;  2DHR A;  2OLT A;  5FNV E;  3LK3 B;  3C64 A;  4ZI2 D;  3GWH A;  2ZM0 A;  3EAM A;  3U78 A;  3CKD A;  3VRB A;  3KBT A;  3VZW X;  4TWH A;  2CPT A;  1UX5 A;  2JQK A;  2Z6E A;  2UXD T;  3NBX X;  4KUM B;  2W61 A;  3KV4 A;  4I43 B;  4PJ0 O;  4ILC A;  3JCU O;  1ZHW A;  3FYX A;  4AQF C;  5AQU B;  1WFD A;  5FXV A;  1T16 A;  3N2G E;  2XAH B;  5HAX A;  4BA9 A;  4YLH A;  3LK2 A;  4UB8 O;  5DL6 A;  4IL9 A;  4O4L E;  3WAK A;  3RQU A;  4CI2 B;  2XMX A;  2G0U A;  4A5X A;  2FBW A;  3ETV A;  1I94 T;  4RLC A;  4O4J E;  3OPC A;  5LA6 E;  2IAK A;  3KV5 A;  2HHH T;  2CBI A;  2W67 A;  3PUW F;  4DO0 A;  1YS5 A;  3QC9 A;  5JRC B;  2YU1 A;  2J1D G;  4PUX A;  2C5K T;  1WYC A;  3P7I A;  2LKG A;  4TUY E;  1KF6 A;  4COF A;  4GK5 E;  2CM0 A;  3Q5W A;  4OHF A;  4XBF B;  2L3L A;  2LSY A;  3ZKR A;  1N36 T;  1UK5 A;  3RQW A;  2XE5 A;  5H6Q B;  1HCI A;  3P4S A;  2WZH A;  2J62 A;  2E9X D;  3CPZ A;  2GK9 A;  4TWD A;  4OX9 T;  5IWA T;  4Q25 A;  3ZMU B;  1Z0P A;  4FZN A;  3QNU A;  2YDR A;  4A98 A;  2A9U A;  2EHO D;  1QSD A;  2B1E A;  2KWH A;  4EV6 A;  3VKG A;  3M65 A;  4FT6 A;  5IYZ E;  2K48 A;  4JEH B;  4IE0 A;  3ZC1 A;  3IEE A;  4LF9 T;  5CB4 E;  1E7P A;  4ZXL A;  4HWH A;  5J1G A;  3F57 A;  4FES A;  4JI5 T;  4B61 A;  5ETW A;  2X9W A;  1IZN B;  5JDH A;  2HPJ A;  2VL8 A;  4XNK A;  3Q5X A;  1YKE B;  4Z90 A;  4QWN B;  4FSO A;  3ONL C;  2JQ9 A;  2LSJ A;  4LSF A;  1MNE A;  8PRN A;  1WLX A;  1HF8 A;  3AE6 A;  4FI5 A;  3TLU A;  2D2S A;  1W9R A;  2CWO A;  5AQJ B;  4G75 A;  2LRL A;  1H7C A;  1IBM T;  4DVD A;  3DZM A;  5IUX A;  2H7O A;  4BUM X;  3NZP A;  2V8S V;  4HFC A;  3C4Z A;  2CHO A;  2HH7 A;  3AA6 A;  3CX8 B;  5CA1 E;  3T24 A;  4N59 A;  3LJC A;  5AFU K;  4HE8 A;  1ZV4 X;  3OJA A;  1HNW T;  1ZHT A;  5JDP A;  2X27 X;  1KEY A;  3AAI A;  2XAF B;  3NRX A;  1KNP A;  4ILU A;  1E2A A;  3SZD A;  3VY8 X;  4TWF A;  5AQH B;  2I6H A;  3P4Q A;  4DV1 T;  1XDO A;  1YW0 A;  2R88 A;  4DV2 T;  3SFE A;  3F2E A;  4ZEY A;  4PJM A;  5HXS A;  3AE1 A;  1LVF A;  1XWM A;  2YIN A;  2IC9 A;  2NTX A;  4UV9 B;  3LDQ B;  3JC6 D;  1VRB A;  4TV8 E;  2BS3 A;  4PNI A;  3ZT6 A;  5HCM A;  3GN5 B;  3E0Z A;  3TLV A;  3VZU X;  4HWC A;  4AKH A;  4HKA A;  1MM5 A;  1H6S 1;  3RYC E;  2QVA A;  2CMR A;  2K0L A;  2VWA A;  3PU8 A;  5KDM C;  2YNK A;  3HR0 A;  4N74 A;  5TIS O;  3X1D A;  3ZST A;  1ZKE A;  1JNR A;  3KFW X;  2K9A A;  2CXD A;  2XTQ A;  4QXC B;  3WU2 O;  1ZP0 A;  2ACX A;  2R4N A;  3CX7 B;  4BJN A;  7PRN A;  3O0E A;  3AE5 A;  3AE7 A;  2N2M A;  1U5P A;  2V5D A;  5CJ5 A;  3Q5E A;  2K24 A;  3I1A A;  4YJ3 E;  4O4X A;  5J2T E;  5AQP B;  2X68 A;  4JI2 T;  2WMO A;  2WQY A;  3QB5 A;  3AE9 A;  4YTM A;  4ASK A;  2WS3 A;  3QOF A;  5D5D A;  4QX7 B;  3EHZ A;  3O4X E;  3BQI A;  5FXW A;  2Q9Q A;  1XMQ T;  3ZYL A;  2V7M A;  2E9X A;  4JI3 T;  2UXX B;  4DV3 T;  2V6X A;  4H9O C;  2MYS A;  4EZ4 A;  5LBQ B;  4LFC T;  2ZM8 A;  1GFM A;  3LFM A;  2EHO B;  1MMD A;  4JI6 T;  2XAJ B;  2L8K A;  4NUU A;  4C4V A;  2IW5 B;  2LT3 A;  4OYJ A;  3POQ A;  2H89 A;  3N9N A;  3PTR B;  4X5T A;  3ANW B;  3VE2 A;  1HG2 A;  4YTN A;  3VHL A;  2BKO A;  3CQC B;  2WDQ A;  4N78 D;  3KDS E;  2VK9 A;  2BBH A;  3RC3 A;  4MFR A;  5L47 A;  3E22 E;  4JI7 T;  3VY9 X;  2VVN A;  3TKL B;  3LG7 A;  3UU2 A;  4EYY R;  3ETU A;  4WW0 A;  4A97 A;  5E79 O;  2ZM6 T;  1D0X A;  4O2B E;  3GP6 A;  2BS2 A;  1OPF A;  1QUU A;  2FUP A;  2CLY B;  2BG9 A;  3AA0 B;  4WBO A;  3AA7 B;  3T20 A;  1S35 A;  5C8Y E;  3QRA A;  4C69 X;  4YT0 A;  1CHU A;  2LFU A;  1KFY A;  1OSM A;  4UVA B;  3MK7 C;  5FXZ A;  3O1I A;  3ZEF B;  3O1H A;  2MAW A;  5AFU L;  5B66 O;  4DR7 T;  3VU7 H;  2ES0 A;  4LF5 T;  4DID B;  3ZCJ A;  1T1L A;  3LSV A;  4GKJ T;  5GON E;  3NSG A;  5FVL A;  3ZN0 B;  2N2N A;  3HOL A;  4EXT A;  4ILA A;  3RIA A;  2IWW A;  3RF1 A;  3UPG A;  4U72 A;  2XQ9 A;  2UUA T;  2XM1 A;  2ACZ A;  3AEA A;  3HKE E;  2UUB T;  2IUB A;  3E08 A;  2CRB A;  3IF8 B;  1YQ3 A;  3AVR A;  3K3Q C;  4JI1 T;  2XQ4 A;  1N32 T;  3AA1 A;  3PUS A;  2HPL A;  1MIV A;  4EIW A;  4MAL A;  4O4U A;  2YN6 A;  3A5X A;  3ZJ2 A;  4FZL A;  4CQI A;  2J4U P;  1FMW A;  3PUY F;  3VR9 A;  3TLT A;  3AAE A;  2X9H A;  5FY1 A;  1ZHC A;  4DBR A;  2A3D A;  2A72 A;  3Q9D A;  3K8P C;  4V1A v;  2YDS A;  2BKN A;  3LBX B;  2KZ7 A;  3K3O A;  2XHE B;  2BVL A;  3AE2 A;  4CTD A;  5E0O A;  4IHJ E;  2CLY C;  1ZEE A;  1BR4 A;  1AJ3 A;  5HYA A;  4K3B A;  5ABF B;  4N75 A;  4H63 H;  5KXJ A;  4DR5 T;  2DWG A;  4WZX A;  3MA9 A;  5ABE A;  2DLR A;  5B5E O;  4CXY A;  4AQF A;  3L3P A;  4EB6 E;  5JTG A;  1HR0 T;  4DR4 T;  4LMK A;  3H37 A;  2WWU A;  3OKQ A;  3OTO T;  1QJP A;  3PUR A;  4QH5 A;  2DI4 A;  2SPC A;  4P09 A;  2IC6 A;  5JDG A;  2W00 A;  3MZK B;  3J7Y q;  5FVK A;  4EOZ B;  5AQF B;  2QA7 A;  5DAB A;  5C3J A;  2V5C A;  2IDO B;  4DUY T;  4IL6 O;  1PHO A;  1BH3 A;  2XJ7 A;  3UAQ A;  4O3Y A;  2DCF A;  4X1K E;  5EK3 A;  2JQY A;  4AYE C;  4NPP A;  3UU6 A;  2CXF A;  2XAS B;  2WM9 A;  3ZLI A;  4UR9 A;  3POX A;  2HN2 A;  2WWV A;  3PUG A;  3O1J A;  4FSP A;  1HNZ T;  3RYI E;  4D64 A;  1MMA A;  2IWV A;  4ERR A;  4XAX B;  4AKR A;  3KV6 A;  1M62 A;  4IE4 A;  4C90 A;  1HFA A;  4O4I E;  2OV9 A;  2WCA A;  2H88 A;  2KND A;  3A8Y C;  1E1H B;  4IRE A;  2JQQ A;  3NKZ A;  4RJW A;  3EUH A;  4CXW A;  1Z8U A;  4UF0 B;  2NTY A;  4E1S A;  3AE3 A;  3N9L A;  4GHB A;  5HCJ A;  3RRW A;  3SOL A;  3LK2 B;  2I59 A;  3C4X A;  4HTE A;  1OED C;  1D0Y A;  3ONJ A;  3UUN A;  2BG9 E;  1SUM B;  2YK0 A;  3HW9 A;  4ZS2 A;  4ILB A;  4KI0 F;  2V6Y A;  1GFP A;  1THQ A;  2Y0H A;  4HEA A;  2WU5 A;  3EVY A;  2QYW A;  4LMJ A;  4GOU A;  3QRC A;  3JCF A;  2UXB T;  3LK4 1;  4FMS A;  5L3C B;  2KXP A;  3I0O A;  1JNZ A;  5LGU B;  3HL6 A;  1QJ9 A;  4IL4 A;  3UU3 A;  3EMN X;  5HXE A;  1FJG T;  4L5G A;  5LNK A;  1UUS A;  4ZZC A;  5JDQ A;  4ZI3 D;  1X79 A;  4JEU B;  2Q9Q D;  2V26 A;  2XQA A;  5EE2 A;  5CFB A;  2XAQ B;  1G8X A;  2WDV A;  3KZI O;  1Y64 B;  5J0Z A;  4KMC A;  4U74 A;  4H9P C;  3C50 A;  2IIU A;  5FMN A;  3P4W A;  3PUX F;  1ZHX A;  4PK5 A;  3LK4 2;  5DJQ C;  5G3A A;  1Q9F A;  1LKX A;  2W66 A;  2IHR 1;  3P8C D;  4HFH A;  4P0B A;  2ERV A;  2NW9 A;  2CWY A;  4UV8 B;  2K5B B;  4B3R T;  3ZSS A;  2POR A;  2ODU A;  4B3T T;  2UXC T;  1T72 A;  2CBJ A;  3UFE A;  4MLK A;  2E5V A;  3CVR A;  5HEJ A;  5DL5 A;  2OMF A;  3WI3 A;  5IHY A;  4AIU A;  1W09 A;  2VB6 A;  3R84 B;  3DWN A;  4LSE A;  4L0R A;  2LOS A;  3AA6 B;  2R8A A;  4KP3 C;  1GFQ A;  3WI4 A;  2JMM A;  2NW8 A;  2ZLD A;  4QXH B;  2PFV A;  5HXR A;  4GCP A;  3ZN1 B;  2LHR A;  3ZCI A;  5HEU A;  2NP9 A;  4PFP A;  3T1Y T;  4ZHQ E;  2XPK A;  1QJ8 A;  4U9C A;  2XQ5 A;  4B3S T;  3SRZ A;  1WRD A;  1MMN A;  4E1T A;  3C5O A;  2LSK A;  1WYB A;  2VQE T;  1GFN A;  3DTO A;  3RHW A;  4GYR A;  4LFB T;  3CQX C;  3L09 A;  3RH3 A;  5JQG E;  2WDR A;  5LGN B;  2R4O A;  3EDU A;  3MJX A;  2V7J A;  3N5L A;  4QH1 A;  3L8R A;  5HXH A;  4DV0 T;  2Y7S A;  4BAY B;  3UU5 A;  2XQ8 A;  4EEB A;  3C4W A;  5AQK B;  5FYM A;  2DNX A;  4NIQ A;  5EZY E;  4IST A;  2LHN A;  1SHZ C;  4IDP A;  3RIU C;  4F4B A;  3PJA A;  4QX8 B;  5L3G B;  2VVS A;  1UGO A;  1CUN A;  2WU2 A;  2K4T A;  3NJT A;  3B13 A;  4HFB A;  3RC8 A;  5HEH A;  2Y8D A;  4PJN A;  2XQ6 A;  4PAG A;  4CI3 B;  2GE4 A;  2VKH A;  4YSY A;  5FY0 A;  1NEK A;  4UXN B;  2YEV C;  2MHL A;  2D9D A;  4FOZ A;  3UT5 E;  2RP4 A;  3ZMV B;  5ABH A;  3ZC0 A;  4D65 A;  2D0U A;  4CXX A;  3K1S A;  2JQH A;  3FXD B;  2MOZ A;  4IE5 A;  5IYU A;  5BR8 T;  4KHP T;  5G26 A;  4DBQ A;  2NWB A;  3O9X A;  4HWI B;  4EED A;  2YOE A;  4U7Y A;  3T0S A;  4H9Q C;  4HFE A;  3SS1 A;  2FJE A;  2P9B A;  4LML A;  1D1C A;  2Q9Q B;  3CX6 B;  5HXC A;  3VRA A;  2VQF T;  2E9X B;  3SY9 A;  4P0A A;  4O49 A;  4JLE A;  2CHN A;  2H3R A;  2LE8 A;  2AE9 A;  5LHH B;  2R6G F;  1YKH B;  4JI4 T;  2PBI A;  1WR6 A;  3PF1 A;  4C4V B;  4Z3T A;  3ZMT B;  4AYN A;  2XAG B;  4AYI D;  3BQK A;  3P4R A;  4NXN T;  2R4L A;  2FJB A;  5TAO A;  2PRN A;  4GCS A;  2WZI A;  4ZS3 A;  2Y0L A; 
#chains in the Genus database with same CATH homology
 3N2G E;  2XAH B;  4UIG A;  5FY1 A;  1ZHC A;  4YLH A;  5HAX A;  4BA9 A;  2D0T A;  4DBR A;  1MM4 A;  3LK2 A;  2KC0 A;  2A3D A;  2A72 A;  3Q9D A;  3K8P C;  5JR9 A;  4ZI2 C;  4GIW A;  1HG5 A;  2VKO A;  3VKH A;  4V1A v;  4O4L E;  4YFS A;  3WAK A;  5DL6 A;  5EK4 A;  4AXP A;  4CI2 B;  2WMN A;  3LBX B;  2XMX A;  2G0U A;  2KZ7 A;  4JCH A;  3HKD E;  3DA4 A;  1VOM A;  3ETV A;  4YJ2 E;  4RLC A;  4O4J E;  3K3O A;  2XHE B;  2BVL A;  1MIW A;  2XG6 A;  5LA6 E;  5E0O A;  4IHJ E;  2CLY C;  1ZEE A;  4O8S A;  1BR4 A;  1AJ3 A;  2IAK A;  3KV5 A;  5HYA A;  4DMW A;  4DO0 A;  1YS5 A;  3QC9 A;  5JRC B;  4H63 H;  2YU1 A;  2DWG A;  2J1D G;  5H6R B;  3MA9 A;  4PUX A;  2C5K T;  2DLR A;  1WYC A;  3P7I A;  2E8I A;  2C5I T;  4CXY A;  4AQF A;  3KV9 A;  4TUY E;  4JFB A;  2X67 A;  3L3P A;  3PQS A;  4EB6 E;  4GK5 E;  4KRA A;  3PRN A;  2CM0 A;  3Q5W A;  3H37 A;  4OHF A;  2WWU A;  4XBF B;  2ZFG A;  3V8U A;  2L3L A;  5EK2 A;  2LSY A;  3OKQ A;  2PJQ A;  3NZQ A;  4O2A E;  1QJP A;  2XE5 A;  3PUR A;  3UUM A;  2DI4 A;  3AVS A;  3I9W A;  2SPC A;  5H6Q B;  4P09 A;  1HCI A;  2IC6 A;  5JDG A;  2D5U A;  2W00 A;  2E9X D;  3MZK B;  3J7Y q;  3CPZ A;  2GK9 A;  4FJO A;  4AKG A;  4LSH A;  4EOZ B;  2QA7 A;  3GN5 A;  5DAB A;  3ZMU B;  2JRK A;  4OYK A;  1IAP A;  2XTL A;  4E7S A;  3VE1 A;  2W80 C;  1Z0P A;  3EDV A;  2V7K A;  5KMG P;  4E7Z A;  1BH3 A;  2JJ9 A;  3MXZ A;  1PHO A;  4FZN A;  3UAQ A;  4IGU A;  4O3Y A;  1BXW A;  2DCF A;  2ZM2 A;  4X1K E;  3AA7 A;  2EHO D;  3BQL A;  4PK6 A;  4UEL A;  1QSD A;  2B1E A;  1HXU A;  1MMG A;  2QGS A;  4TN7 B;  2KWH A;  4AYM C;  5EK3 A;  2RA1 A;  3VKG A;  3FB2 A;  1D0Z A;  1KK7 A;  3M65 A;  4ZI7 E;  4YHJ A;  4N58 A;  4AYE C;  1FMV A;  4FT6 A;  5IYZ E;  3CWZ B;  1NAF A;  2CXF A;  2XAS B;  2WM9 A;  2K48 A;  3N9O A;  1NWM X;  4JEH B;  4O4H E;  3ZLI A;  4IE0 A;  3ZC1 A;  3IEE A;  4GK0 E;  2F1T A;  5CB4 E;  2JMH A;  5J1G A;  3POX A;  3ZYM A;  4GYS A;  3F57 A;  4X1I E;  4FES A;  3PUG A;  4O3X B;  4B61 A;  1S94 A;  2LJL A;  4F6R C;  1UX4 A;  3O1J A;  5ETW A;  4FSP A;  3RYI E;  3AAA A;  4G63 A;  2O4V A;  2X9W A;  4EZH A;  4D64 A;  4QHO A;  1MMA A;  1IZN B;  2LOP A;  4M1P A;  5L2L A;  4ERR A;  4XAX B;  4AKR A;  5JDH A;  2HPJ A;  2VL8 A;  3CQG B;  3Q5X A;  4XNK A;  3KV6 A;  4IE4 A;  3UUL A;  3FXE B;  1YKE B;  1HFA A;  4C90 A;  2JPF A;  4K0U A;  4QWN B;  1OWA A;  4TV9 E;  4FSO A;  4O4I E;  4JUY A;  5LXT E;  1BT9 A;  2J1N A;  3RKO A;  4MBQ A;  1HX8 A;  3OYZ A;  2LSJ A;  3ZMZ B;  3AA1 B;  4LSF A;  2EHO C;  1MNE A;  2KND A;  8PRN A;  1E1H B;  1WLX A;  2JQQ A;  5LOV E;  1HF8 A;  4AUI A;  3FBL A;  4H9S E;  2XQY A;  4ANJ A;  4FI5 A;  4RJW A;  2KWI B;  5JDL A;  4AI6 A;  3EUH A;  3N9M A;  5J2U E;  1BR2 A;  1O3X A;  2OA5 A;  2D2S A;  2ODV A;  3RRC A;  4CXW A;  4PJL A;  2CWO A;  4G75 A;  3PUA A;  4IDZ A;  2FGQ X;  2CEA A;  1H7C A;  4UF0 B;  2NTY A;  4DVD A;  1GFO A;  2KIN B;  3SWH A;  4FZM A;  2H7O A;  4BUM X;  3NZP A;  4E1S A;  5ADX K;  3C4Z A;  2HH7 A;  4GF4 A;  4TX5 A;  3AAE B;  2BVM A;  3N9L A;  3CX8 B;  3AA6 A;  4GHB A;  5CA1 E;  3RRW A;  3T24 A;  4N59 A;  3LJC A;  4XZC A;  3SOL A;  3LK2 B;  3J9X 1;  2I59 A;  5L3F B;  3C4X A;  2F1V A;  1ZHZ A;  5JR9 B;  3K19 A;  2KMF A;  5DQW A;  5L3E B;  4HTE A;  3BK9 A;  1D0Y A;  4HE8 A;  5AFU K;  4X1Y E;  1ZV4 X;  3V5S A;  3UUN A;  3G7G A;  4AKI A;  3OJA A;  2CE7 A;  2YK0 A;  2KZ7 B;  4C91 A;  1ZHT A;  3HW9 A;  4ZS2 A;  2X27 X;  4OFZ A;  5HWY A;  5JDP A;  2EHO A;  3AAI A;  1P4T A;  2XAF B;  1GFP A;  3NRX A;  4EAH A;  5DL8 A;  4XNL A;  1THQ A;  2W81 C;  5JH7 E;  4ILU A;  1IJ5 A;  2Y0H A;  4HEA A;  3EVY A;  4GOU A;  2X9X A;  3SZD A;  4KBM B;  3KBU A;  3VY8 X;  3QRC A;  3AB3 B;  4G2A A;  3LK4 1;  2QTK A;  1YW0 A;  3ANW A;  4FMS A;  5L3C B;  2KXP A;  3I0O A;  2XUE A;  3S4U A;  3SYB A;  3F2E A;  4PJM A;  5BMV E;  5HXS A;  5LGU B;  4AYD C;  3SYS A;  2VKD A;  3HL6 A;  5LHI B;  4FUV A;  1LVF A;  2YIN A;  2IC9 A;  1YD8 G;  5L3D B;  2M67 A;  1QJ9 A;  2NTX A;  5FVN A;  3SZV A;  4UV9 B;  4PJJ A;  3JC6 D;  2LHF A;  3EMN X;  1VRB A;  5HWX A;  4FRX A;  4TV8 E;  5HXE A;  4PNI A;  4L5G A;  5LNK A;  2YNK A;  3U3I A;  5JDQ A;  3JTY A;  3B57 A;  4ZI3 D;  6PRN A;  2CXL A;  1X79 A;  1T98 A;  2X51 A;  5FXX A;  4JEU B;  2Q9Q D;  4LSI A;  2V26 A;  3UUX B;  3MKD A;  5EE2 A;  3GN5 B;  2XTR A;  3ZJ1 A;  2MNH A;  2FGR A;  3E0Z A;  5LYJ E;  3HWB A;  3VZU X;  1D1A A;  3FHN A;  2XAQ B;  1G8X A;  3HKC E;  3N2O A;  2KLQ A;  5LJM A;  4AKH A;  3N9P A;  3ONX A;  1Y64 B;  4A56 A;  4KMC A;  4U74 A;  5JDN A;  4H9P C;  4HN9 A;  3AA0 A;  4HKA A;  2BZB A;  3C50 A;  4KR8 A;  5FMN A;  3HKB E;  4B6X A;  1ZHX A;  1G73 A;  5F3J A;  1MM5 A;  4PK5 A;  4D5U A;  3LK4 2;  4OK0 A;  5DJQ C;  1HXX A;  3JC6 C;  1H6S 1;  3RYC E;  2CMR A;  1Q9F A;  3KVB A;  2K0L A;  1LKX A;  2VWA A;  3PU8 A;  4P0B A;  3P8C D;  2KT9 A;  4UEM A;  3HR0 A;  4CZZ B;  5KDM C;  5M4Y A;  2ERV A;  4O3W A;  2NW9 A;  2CWY A;  5F8P A;  1OXZ A;  3IHR A;  4UV8 B;  2CA5 A;  3RX6 A;  4ZI3 C;  1ZKE A;  2YU2 A;  2K5B B;  2NOX A;  3KFW X;  2N9D A;  2K9A A;  2Q9Q C;  2CXD A;  3AAA B;  4QXC B;  2XTQ A;  2ACX A;  2POR A;  2E9X C;  2ODU A;  2WAU A;  3CX7 B;  3VZT X;  4BJN A;  7PRN A;  4AKR B;  3O0E A;  1UCU A;  3ESL A;  1KNZ A;  4AKM A;  2L9Q A;  3UFE A;  4MLK A;  2N2M A;  1U5P A;  3POR A;  3HA4 A;  2V7I A;  4Z8X A;  3V5U A;  3CVR A;  4X20 E;  2VKJ A;  2K24 A;  3I1A A;  4BJM A;  4YJ3 E;  5DL5 A;  4O4X A;  1SA0 E;  2OMF A;  1IJ6 A;  3WI3 A;  5IHY A;  2Y48 B;  1MPF A;  3C51 A;  4RJX A;  5J2T E;  1BR0 A;  5FY7 A;  2LSG A;  3WAJ A;  2VB6 A;  2X68 A;  3MAC A;  3R84 B;  4HGA A;  3PU3 A;  2WMO A;  4J2C A;  5DQV A;  4AKL A;  3D0T A;  4LSE A;  4L0R A;  4ASK A;  3NRY A;  5LGT B;  2ODJ A;  5D5D A;  4QX7 B;  5JR9 C;  1ORM A;  3O4X E;  5FXW A;  2LM9 A;  3BQI A;  5JDF A;  2LOS A;  3LK3 A;  1D1B A;  1V9D A;  2Q9Q A;  3AA6 B;  3HI2 A;  3ZYL A;  3FBZ A;  2V7M A;  2E9X A;  4KP3 C;  4GCQ A;  2H7V C;  2UXX B;  1GFQ A;  2JMM A;  3WI4 A;  2NW8 A;  5GV0 A;  2ZLD A;  4QXH B;  3KVD D;  3UTK A;  2PFV A;  4H9O C;  5HXR A;  2MYS A;  3WI5 A;  4GCP A;  4EZ4 A;  5LBQ B;  3ZN1 B;  2LHR A;  4DND A;  2M07 A;  3POU A;  4QXB B;  2UXN B;  2ZM8 A;  3ZCI A;  5CA0 E;  1GFM A;  1EZ3 A;  3LFM A;  2NP9 A;  2XE3 A;  4PFP A;  4I4T E;  2EHO B;  1MND A;  4MHC A;  1MMD A;  2XAJ B;  5LJN A;  2L8K A;  4NUU A;  4ZHQ E;  3C98 B;  3OBV E;  1QJ8 A;  1LRZ A;  4U9C A;  4UF0 A;  2IW5 B;  1MIY A;  2Y6X A;  2LT3 A;  4OYJ A;  3POQ A;  4WNK A;  3N2K E;  3SRZ A;  1WRD A;  2W0G A;  3N9N A;  3PTR B;  3R6N A;  1MMN A;  3T8O A;  3PDY A;  3RBH A;  3ANW B;  4E1T A;  2KXP B;  3VE2 A;  1HG2 A;  3C5O A;  2LSK A;  3VHL A;  3KVA A;  1WYB A;  1BR1 A;  1GFN A;  3DTO A;  3CQC B;  4PW8 A;  2MBG A;  2JMK A;  4QQ1 A;  3N9Q A;  2ZMA A;  2KDY A;  4N78 D;  4GYR A;  3KDS E;  2VK9 A;  3I0Q A;  4IIJ E;  3RC3 A;  3CQX C;  3L09 A;  5LCY A;  4MFR A;  4I50 E;  3RH3 A;  3OYX A;  3TZG A;  3E22 E;  2LSI A;  5JQG E;  2NW7 A;  5LGN B;  2V1D B;  3EDU A;  3LBX A;  2W62 A;  3A2S X;  2ZLY A;  3MJX A;  3VY9 X;  3TKL B;  2V7J A;  3LG7 A;  1FIO A;  3UU2 A;  4ZOL E;  4EYY R;  5JRE A;  2CCQ A;  3ETU A;  4WW0 A;  3N5L A;  2M06 A;  4DMV A;  5HXH A;  3RYH E;  2Y7S A;  4BAY B;  4H9R C;  5JDM A;  5PRN A;  2PG8 A;  1D0X A;  2BDE A;  5JRC A;  3C4W A;  4O2B E;  3GP6 A;  5FYM A;  3W15 B;  1QUU A;  2DNX A;  1OPF A;  4EYU A;  1U4Q A;  2CLY B;  4HFV A;  5EZY E;  3RPU A;  4IST A;  2LHN A;  2X0L B;  3DJB A;  5FP3 A;  1SHZ C;  4F4B A;  4TZ4 C;  4QX8 B;  2Y0K A;  3AA0 B;  4WBO A;  5L3G B;  3KIN B;  5LP6 E;  2C5J A;  3QK6 A;  2XE1 A;  3AA7 B;  3T20 A;  1CUN A;  1S35 A;  5C8Y E;  2K4T A;  1HTJ F;  3QRA A;  3IBP A;  3B13 A;  4C69 X;  3RC8 A;  2Y0L A;  5T5F A;  5ADX L;  1B7T A;  4IE7 A;  4NUV A;  2Y8D A;  3ZMS B;  4PJN A;  4PK4 A;  5LBM A;  2LFU A;  4PAG A;  1OSM A;  4CI3 B;  2GE4 A;  1FEW A;  4UVA B;  2VKH A;  1HXT A;  3MK7 C;  5FY0 A;  4WBN E;  3GMI A;  5FXZ A;  4UXN B;  2YEV C;  2MHL A;  3O1I A;  3H3A A;  3ZEF B;  3O1H A;  4UVB B;  4CI1 B;  2N1G A;  3RYF E;  4ADZ A;  4FOZ A;  5AFU L;  4AFK A;  3UT5 E;  4AZL A;  3PUQ A;  3ZYK A;  2Y2X A;  2RP4 A;  2LEH A;  3ZMV B;  1G90 A;  2MTQ A;  3ZC0 A;  4G76 A;  3VU7 H;  4D65 A;  2D0U A;  4CXX A;  2ES0 A;  2V7L A;  5A1L A;  2X9Y A;  4AQG A;  3FXD B;  2MOZ A;  1US7 B;  4IE5 A;  5LG4 A;  4O3Z A;  3GA8 A;  4RL9 A;  5IYU A;  3ZCJ A;  1HS7 A;  5GON E;  3NSG A;  3Q2M A;  3QUJ A;  5G26 A;  5JVD E;  3ZN0 B;  4DBQ A;  2YPV A;  2NWB A;  3PE0 A;  3SY7 A;  2WBL A;  2N2N A;  3O9X A;  2X66 A;  5KX5 E;  1LVK A;  3HOL A;  4EXT A;  5LHG B;  4KR4 A;  2XE2 A;  3DP7 A;  3UPG A;  4I55 E;  4ISS A;  3T0S A;  4H63 V;  3DA3 A;  4H9Q C;  4U72 A;  5L3B B;  5DL7 A;  4QKN A;  3SS1 A;  4H9N C;  1ZHY A;  2N2L A;  4UVC B;  3HKE E;  3I9Y A;  2P9B A;  3F31 A;  1IZN A;  1E54 A;  2DHR A;  1D1C A;  3LK3 B;  5FNV E;  2Q9Q B;  3CX6 B;  5HXC A;  4RLB A;  3E08 A;  3C64 A;  2E9X B;  2VAS A;  3IF8 B;  3SY9 A;  4ZI2 D;  3GWH A;  2ZM0 A;  4IE6 A;  3AVR A;  3K3Q C;  4PFO A;  4P0A A;  2WSS V;  3AA1 A;  4O49 A;  4JLE A;  3U78 A;  2A2F X;  3CKD A;  3PUS A;  2HPL A;  1MIV A;  3KBT A;  4L9I A;  4EIW A;  3PQU A;  3VZW X;  1UX5 A;  2H3R A;  2LE8 A;  2DWK A;  4MAL A;  5LHH B;  2Z6E A;  2C0S A;  2W63 A;  4FRT A;  3CML A;  3K3N A;  3NBX X;  1PRN A;  4O4U A;  1YKH B;  2W61 A;  3KV4 A;  3A5X A;  2PBI A;  4KUM B;  1WR6 A;  4I43 B;  3ZJ2 A;  4FZL A;  1ZHW A;  4Z3T A;  3ZMT B;  4AYN A;  3FYX A;  2XAG B;  4AQF C;  4CQI A;  4AYI D;  3BQK A;  2J4U P;  1Q9G A;  1FMW A;  2PRN A;  5TAO A;  4GCS A;  5FXV A;  3AAE A;  4ZS3 A;  3HOE A;  2X9H A;  3ZPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...