3PGSA

Phe3gly mutant of ecfadl
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
427
Chain Sequence
b'AGGQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
total genus 127
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pgsA00
2R8AA 2R4NA 1T1LA 2R4OA 3PGRA 3BRZA 3DWNA 2R89A 1T16A 3BS0A 2R4LA 2R88A 3DWOX 3PGUA 3PF1A 2R4PA 3BRYA 3PGSA
chains in the Genus database with same CATH superfamily
5DL6A 4GCPA 1T1LA 3VE1A 4KRAA 3FYXA 1PRNA 2Y0KA 3AA0A 4XNKA 1GFQA 1HXXA 4FT6A 4FZMA 3PORA 4RJXA 2F1TA 3DA4A 2K4TA 3PGRA 4G76A 4B61A 2IWWA 3VZWX 1ZHXA 5EE2A 5DL7A 4CTDA 2KXPA 4K3CA 1ZHYA 4FQEA 3AAAB 5E79O 1THQA 3SY9A 5GV0A 5JDPA 1YS5A 3NSGA 1ZHWA 2M07A 2Y7SA 3AA7B 1OPFA 2M06A 4FSOA 1PHOA 2WJQA 2XMXA 3HW9A 1Q9FA 3V8UA 2KDYA 5DL5A 1IZNB 4O3YA 3PGUA 4AZLA 2AXTO 3EMNX 4GF4A 2XE1A 2IWVA 2F1VA 3HWBA 4IL6O 3VZUX 1HXUA 2R8AA 5ADXL 3PQUA 5G3AA 3WI4A 3KVDD 4XNLA 1QJ9A 1BT9A 2FGQX 4QQ1A 2FGRA 4G75A 2WVPA 3RBHA 4E1TA 8PRNA 4AYMC 2ZLDA 3VY9X 4C4VB 3NJTA 4LSEA 4FOZA 3TZGA 2JQYA 4AYDC 1OSMA 5PRNA 1QJ8A 3AAEB 3POQA 2XTQA 5G39A 3AAAA 2X9KA 4RL9A 5KAFO 1S5LO 4N58A 1QJPA 3LK2B 4GCQA 3AA6B 6PRNA 4AYEC 2ERVA 3AA7A 4O4UA 5T5FA 1GFMA 2OMFA 2R4LA 4FMSA 4LSIA 1P4TA 4O3WA 2QTKA 5B66O 2O4VA 4O4XA 3T0SA 5H2FO 2X27X 1IZNA 3QRCA 4K3BA 2R4OA 2Y0HA 4PUXA 1MM4A 2XE2A 4RJWA 5ADXK 3DWOX 2YNKA 4O3ZA 2XE5A 4PR7A 4FZLA 3A0HO 3LK3A 3BRYA 4LSHA 4FZNA 4JCHA 2F1CX 2N2LA 2JMMA 4RLBA 3BS0A 4UB8O 4N59A 3A0BO 5KAIO 4AKRB 4BUMX 4C4VA 3HOLA 4GCSA 2GE4A 4UB6O 2MNHA 1HXTA 5TISO 1ZHZA 3A2SX 3PQSA 2LHFA 1BXWA 4RLCA 3C5OA 4N74A 1ZHTA 2R88A 4AFKA 3LK2A 4C00A 3AA6A 3AA1B 2J1NA 3KZIO 3PGSA 3POUA 2XTRA 4D5UA 1GFOA 3DA3A 3G7GA 4KR8A 3JTYA 3SYSA 3SZDA 2YPVA 3O0EA 2J4UP 1BH3A 5B5EO 4D64A 7PRNA 3LK41 4FRTA 2XG6A 4FSPA 5G38A 2KZ7B 2ZFGA 3BRZA 3DWNA 3POXA 5AFUL 5GTHO 3WI5A 1E54A 4LSFA 5D5DA 4JFBA 1H6S1 3SYBA 4AUIA 4AYID 4FUVA 1G90A 2ODJA 3SZVA 4AKRA 4C69X 3PRNA 3VE2A 5G26A 1GFPA 3QRAA 4O49A 4O3XB 1Q9GA 2KC0A 4PJ0O 5GTIO 3AA0B 3VZTX 4D65A 4AYNA 4Z3TA 4N75A 4KR4A 3AAEA 2PRNA 3T24A 2PORA 2N2MA 3PF1A 3AA1A 3T20A 4AKMA 2XE3A 5DL8A 4FRXA 2KXPB 3UPGA 5FVNA 3LK42 2K0LA 4FESA 4F4BA 1GFNA 2R89A 4U9CA 3K19A 3GP6A 1T16A 2R4PA 2R4NA 3WU2O 2MHLA 2KZ7A 2Y2XA 1ORMA 3HOEA 3JCUO 1MPFA 2WJRA 3DZMA 3SY7A 5AFUK 2W81C 3UU2A 2W80C 4GHBA 3VY8X 2Y0LA 4E1SA 2LFUA 5IYUA 3LK3B 3UAQA 1MM5A
chains in the Genus database with same CATH topology
2R8AA 2R4NA 1T1LA 2R4OA 3PGRA 3BRZA 3DWNA 2R89A 1T16A 3BS0A 2R4LA 2R88A 3DWOX 3PGUA 3PF1A 2R4PA 3BRYA 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R8A A;  2R4N A;  1T1L A;  2R4O A;  3PGR A;  3BRZ A;  3DWN A;  2R89 A;  1T16 A;  3BS0 A;  2R4L A;  2R88 A;  3DWO X;  3PGU A;  3PF1 A;  2R4P A;  3BRY A;  3PGS A; 
#chains in the Genus database with same CATH topology
 5DL6 A;  4GCP A;  1T1L A;  3VE1 A;  4KRA A;  3FYX A;  1PRN A;  2Y0K A;  3AA0 A;  4XNK A;  1GFQ A;  1HXX A;  4FT6 A;  4FZM A;  3POR A;  4RJX A;  2F1T A;  3DA4 A;  2K4T A;  3PGR A;  4G76 A;  4B61 A;  2IWW A;  3VZW X;  1ZHX A;  5EE2 A;  5DL7 A;  4CTD A;  2KXP A;  4K3C A;  1ZHY A;  4FQE A;  3AAA B;  5E79 O;  1THQ A;  3SY9 A;  5GV0 A;  5JDP A;  1YS5 A;  3NSG A;  1ZHW A;  2M07 A;  2Y7S A;  3AA7 B;  1OPF A;  2M06 A;  4FSO A;  1PHO A;  2WJQ A;  2XMX A;  3HW9 A;  1Q9F A;  3V8U A;  2KDY A;  5DL5 A;  1IZN B;  4O3Y A;  3PGU A;  4AZL A;  2AXT O;  3EMN X;  4GF4 A;  2XE1 A;  2IWV A;  2F1V A;  3HWB A;  4IL6 O;  3VZU X;  1HXU A;  2R8A A;  5ADX L;  3PQU A;  5G3A A;  3WI4 A;  3KVD D;  4XNL A;  1QJ9 A;  1BT9 A;  2FGQ X;  4QQ1 A;  2FGR A;  4G75 A;  2WVP A;  3RBH A;  4E1T A;  8PRN A;  4AYM C;  2ZLD A;  3VY9 X;  4C4V B;  3NJT A;  4LSE A;  4FOZ A;  3TZG A;  2JQY A;  4AYD C;  1OSM A;  5PRN A;  1QJ8 A;  3AAE B;  3POQ A;  2XTQ A;  5G39 A;  3AAA A;  2X9K A;  4RL9 A;  5KAF O;  1S5L O;  4N58 A;  1QJP A;  3LK2 B;  4GCQ A;  3AA6 B;  6PRN A;  4AYE C;  2ERV A;  3AA7 A;  4O4U A;  5T5F A;  1GFM A;  2OMF A;  2R4L A;  4FMS A;  4LSI A;  1P4T A;  4O3W A;  2QTK A;  5B66 O;  2O4V A;  4O4X A;  3T0S A;  5H2F O;  2X27 X;  1IZN A;  3QRC A;  4K3B A;  2R4O A;  2Y0H A;  4PUX A;  1MM4 A;  2XE2 A;  4RJW A;  5ADX K;  3DWO X;  2YNK A;  4O3Z A;  2XE5 A;  4PR7 A;  4FZL A;  3A0H O;  3LK3 A;  3BRY A;  4LSH A;  4FZN A;  4JCH A;  2F1C X;  2N2L A;  2JMM A;  4RLB A;  3BS0 A;  4UB8 O;  4N59 A;  3A0B O;  5KAI O;  4AKR B;  4BUM X;  4C4V A;  3HOL A;  4GCS A;  2GE4 A;  4UB6 O;  2MNH A;  1HXT A;  5TIS O;  1ZHZ A;  3A2S X;  3PQS A;  2LHF A;  1BXW A;  4RLC A;  3C5O A;  4N74 A;  1ZHT A;  2R88 A;  4AFK A;  3LK2 A;  4C00 A;  3AA6 A;  3AA1 B;  2J1N A;  3KZI O;  3PGS A;  3POU A;  2XTR A;  4D5U A;  1GFO A;  3DA3 A;  3G7G A;  4KR8 A;  3JTY A;  3SYS A;  3SZD A;  2YPV A;  3O0E A;  2J4U P;  1BH3 A;  5B5E O;  4D64 A;  7PRN A;  3LK4 1;  4FRT A;  2XG6 A;  4FSP A;  5G38 A;  2KZ7 B;  2ZFG A;  3BRZ A;  3DWN A;  3POX A;  5AFU L;  5GTH O;  3WI5 A;  1E54 A;  4LSF A;  5D5D A;  4JFB A;  1H6S 1;  3SYB A;  4AUI A;  4AYI D;  4FUV A;  1G90 A;  2ODJ A;  3SZV A;  4AKR A;  4C69 X;  3PRN A;  3VE2 A;  5G26 A;  1GFP A;  3QRA A;  4O49 A;  4O3X B;  1Q9G A;  2KC0 A;  4PJ0 O;  5GTI O;  3AA0 B;  3VZT X;  4D65 A;  4AYN A;  4Z3T A;  4N75 A;  4KR4 A;  3AAE A;  2PRN A;  3T24 A;  2POR A;  2N2M A;  3PF1 A;  3AA1 A;  3T20 A;  4AKM A;  2XE3 A;  5DL8 A;  4FRX A;  2KXP B;  3UPG A;  5FVN A;  3LK4 2;  2K0L A;  4FES A;  4F4B A;  1GFN A;  2R89 A;  4U9C A;  3K19 A;  3GP6 A;  1T16 A;  2R4P A;  2R4N A;  3WU2 O;  2MHL A;  2KZ7 A;  2Y2X A;  1ORM A;  3HOE A;  3JCU O;  1MPF A;  2WJR A;  3DZM A;  3SY7 A;  5AFU K;  2W81 C;  3UU2 A;  2W80 C;  4GHB A;  3VY8 X;  2Y0L A;  4E1S A;  2LFU A;  5IYU A;  3LK3 B;  3UAQ A;  1MM5 A; 
#chains in the Genus database with same CATH homology
 2R8A A;  2R4N A;  1T1L A;  2R4O A;  3PGR A;  3BRZ A;  3DWN A;  2R89 A;  1T16 A;  3BS0 A;  2R4L A;  2R88 A;  3DWO X;  3PGU A;  3PF1 A;  2R4P A;  3BRY A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...