3PGSA

Phe3gly mutant of ecfadl
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
427
Chain Sequence
AGGQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Lipid transport
total genus 127
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pgsA00
2R4NA 3DWOX 3BS0A 2R4LA 2R4OA 2R8AA 3DWNA 3PGRA 2R88A 1T16A 2R89A 3BRZA 3BRYA 3PF1A 3PGUA 3PGSA 1T1LA 2R4PA
chains in the Genus database with same CATH superfamily
2FGRA 2W81C 3DWOX 4LSEA 1GFPA 2R8AA 2XG6A 3K19A 4AYNA 2XMXA 3PF1A 4AYEC 4O4UA 3LK3B 2KDYA 3SZVA 3SZDA 5GV0A 2Y7SA 3A2SX 3AA0A 3PGSA 4AKMA 2PORA 2X27X 3QRCA 5E79O 1GFNA 1QJ8A 4AFKA 2Y0LA 3NSGA 4Z3TA 3PRNA 1PRNA 3LK2B 4FSOA 1S5LO 2XE5A 2ZFGA 1P4TA 4C00A 2JMMA 3DA4A 1QJ9A 7PRNA 1T16A 4FESA 4CTDA 1MPFA 2ERVA 3BRZA 4KRAA 4AKRA 1GFOA 4AZLA 4FRTA 1OSMA 3AA7A 3QRAA 2F1TA 2IWWA 2KZ7B 4GCQA 2R88A 3VE2A 3PQUA 5IYUA 2F1VA 3UU2A 1ZHTA 3A0BO 3LK41 3PQSA 4QQ1A 4UB8O 3VY9X 3VZUX 2XE3A 3AA1A 1BT9A 1E54A 3A0HO 1YS5A 3LK42 2F1CX 3PGRA 4O49A 1ZHYA 2Y0HA 4K3BA 3BRYA 1HXXA 4XNLA 4E1SA 1T1LA 4N58A 3KVDD 3VZTX 3DA3A 1QJPA 4FMSA 2KXPA 5T5FA 2QTKA 2GE4A 3T0SA 3NJTA 3JTYA 4FRXA 4JCHA 4BUMX 3O0EA 4GCPA 4C4VA 4E1TA 4KR4A 2W80C 4D5UA 4FT6A 4N59A 3POUA 5D5DA 3G7GA 4F4BA 3HOEA 3JCUO 5GTHO 3AAAA 4LSIA 4FSPA 2AXTO 2K4TA 2ODJA 3AA6A 5KAIO 5G39A 2Y0KA 4AYDC 5AFUK 4GF4A 4N74A 2OMFA 1ZHXA 4D65A 4U9CA 3VZWX 3V8UA 3VY8X 4B61A 5JDPA 5PRNA 3AA0B 5G3AA 2WVPA 3C5OA 2XTQA 1BH3A 3HW9A 3AAEA 2M06A 4FQEA 4LSFA 2J1NA 3SY9A 5DL7A 3VE1A 4XNKA 4GHBA 5FVNA 3HWBA 3RBHA 3BS0A 3WU2O 4FZLA 4RJWA 5G38A 1ORMA 5AFUL 3LK3A 3GP6A 4KR8A 4UB6O 4GCSA 4AKRB 3DZMA 1OPFA 1GFQA 2FGQX 2N2MA 2O4VA 4O3XB 3AA7B 4RJXA 5B5EO 4G76A 2J4UP 2WJQA 4FOZA 4O3WA 3HOLA 2R89A 3LK2A 5KAFO 2MHLA 3FYXA 5H2FO 1IZNB 4G75A 1Q9FA 2LHFA 3KZIO 3SYSA 1THQA 3AA1B 1ZHWA 5EE2A 5GTIO 4FUVA 3UAQA 4D64A 5DL5A 3POQA 2YNKA 2KZ7A 2ZLDA 1MM5A 4PJ0O 2KXPB 2JQYA 3POXA 4IL6O 3PORA 4O4XA 4PUXA 1HXTA 4AUIA 3TZGA 3PGUA 4O3ZA 2PRNA 5ADXK 8PRNA 4C4VB 1PHOA 5DL6A 2Y2XA 3WI5A 2KC0A 4AYID 1G90A 1BXWA 4C69X 4RLBA 5TISO 2K0LA 2LFUA 2R4PA 2N2LA 2MNHA 3AAAB 4FZNA 2R4NA 5G26A 3AA6B 4PR7A 3SYBA 1MM4A 2X9KA 4AYMC 3UPGA 5DL8A 4FZMA 3SY7A 3WI4A 4RL9A 6PRNA 1ZHZA 4JFBA 5ADXL 4O3YA 2XE2A 1H6S1 2XTRA 1GFMA 1HXUA 4RLCA 3T20A 2R4OA 2R4LA 3DWNA 2WJRA 4N75A 3T24A 5B66O 1Q9GA 3AAEB 2XE1A 4K3CA 1IZNA 2IWVA 4LSHA 2YPVA 3EMNX 2M07A
chains in the Genus database with same CATH topology
2R4NA 3DWOX 3BS0A 2R4LA 2R4OA 2R8AA 3DWNA 3PGRA 2R88A 1T16A 2R89A 3BRZA 3BRYA 3PF1A 3PGUA 3PGSA 1T1LA 2R4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4N A;  3DWO X;  3BS0 A;  2R4L A;  2R4O A;  2R8A A;  3DWN A;  3PGR A;  2R88 A;  1T16 A;  2R89 A;  3BRZ A;  3BRY A;  3PF1 A;  3PGU A;  3PGS A;  1T1L A;  2R4P A; 
#chains in the Genus database with same CATH topology
 2FGR A;  2W81 C;  3DWO X;  4LSE A;  1GFP A;  2R8A A;  2XG6 A;  3K19 A;  4AYN A;  2XMX A;  3PF1 A;  4AYE C;  4O4U A;  3LK3 B;  2KDY A;  3SZV A;  3SZD A;  5GV0 A;  2Y7S A;  3A2S X;  3AA0 A;  3PGS A;  4AKM A;  2POR A;  2X27 X;  3QRC A;  5E79 O;  1GFN A;  1QJ8 A;  4AFK A;  2Y0L A;  3NSG A;  4Z3T A;  3PRN A;  1PRN A;  3LK2 B;  4FSO A;  1S5L O;  2XE5 A;  2ZFG A;  1P4T A;  4C00 A;  2JMM A;  3DA4 A;  1QJ9 A;  7PRN A;  1T16 A;  4FES A;  4CTD A;  1MPF A;  2ERV A;  3BRZ A;  4KRA A;  4AKR A;  1GFO A;  4AZL A;  4FRT A;  1OSM A;  3AA7 A;  3QRA A;  2F1T A;  2IWW A;  2KZ7 B;  4GCQ A;  2R88 A;  3VE2 A;  3PQU A;  5IYU A;  2F1V A;  3UU2 A;  1ZHT A;  3A0B O;  3LK4 1;  3PQS A;  4QQ1 A;  4UB8 O;  3VY9 X;  3VZU X;  2XE3 A;  3AA1 A;  1BT9 A;  1E54 A;  3A0H O;  1YS5 A;  3LK4 2;  2F1C X;  3PGR A;  4O49 A;  1ZHY A;  2Y0H A;  4K3B A;  3BRY A;  1HXX A;  4XNL A;  4E1S A;  1T1L A;  4N58 A;  3KVD D;  3VZT X;  3DA3 A;  1QJP A;  4FMS A;  2KXP A;  5T5F A;  2QTK A;  2GE4 A;  3T0S A;  3NJT A;  3JTY A;  4FRX A;  4JCH A;  4BUM X;  3O0E A;  4GCP A;  4C4V A;  4E1T A;  4KR4 A;  2W80 C;  4D5U A;  4FT6 A;  4N59 A;  3POU A;  5D5D A;  3G7G A;  4F4B A;  3HOE A;  3JCU O;  5GTH O;  3AAA A;  4LSI A;  4FSP A;  2AXT O;  2K4T A;  2ODJ A;  3AA6 A;  5KAI O;  5G39 A;  2Y0K A;  4AYD C;  5AFU K;  4GF4 A;  4N74 A;  2OMF A;  1ZHX A;  4D65 A;  4U9C A;  3VZW X;  3V8U A;  3VY8 X;  4B61 A;  5JDP A;  5PRN A;  3AA0 B;  5G3A A;  2WVP A;  3C5O A;  2XTQ A;  1BH3 A;  3HW9 A;  3AAE A;  2M06 A;  4FQE A;  4LSF A;  2J1N A;  3SY9 A;  5DL7 A;  3VE1 A;  4XNK A;  4GHB A;  5FVN A;  3HWB A;  3RBH A;  3BS0 A;  3WU2 O;  4FZL A;  4RJW A;  5G38 A;  1ORM A;  5AFU L;  3LK3 A;  3GP6 A;  4KR8 A;  4UB6 O;  4GCS A;  4AKR B;  3DZM A;  1OPF A;  1GFQ A;  2FGQ X;  2N2M A;  2O4V A;  4O3X B;  3AA7 B;  4RJX A;  5B5E O;  4G76 A;  2J4U P;  2WJQ A;  4FOZ A;  4O3W A;  3HOL A;  2R89 A;  3LK2 A;  5KAF O;  2MHL A;  3FYX A;  5H2F O;  1IZN B;  4G75 A;  1Q9F A;  2LHF A;  3KZI O;  3SYS A;  1THQ A;  3AA1 B;  1ZHW A;  5EE2 A;  5GTI O;  4FUV A;  3UAQ A;  4D64 A;  5DL5 A;  3POQ A;  2YNK A;  2KZ7 A;  2ZLD A;  1MM5 A;  4PJ0 O;  2KXP B;  2JQY A;  3POX A;  4IL6 O;  3POR A;  4O4X A;  4PUX A;  1HXT A;  4AUI A;  3TZG A;  3PGU A;  4O3Z A;  2PRN A;  5ADX K;  8PRN A;  4C4V B;  1PHO A;  5DL6 A;  2Y2X A;  3WI5 A;  2KC0 A;  4AYI D;  1G90 A;  1BXW A;  4C69 X;  4RLB A;  5TIS O;  2K0L A;  2LFU A;  2R4P A;  2N2L A;  2MNH A;  3AAA B;  4FZN A;  2R4N A;  5G26 A;  3AA6 B;  4PR7 A;  3SYB A;  1MM4 A;  2X9K A;  4AYM C;  3UPG A;  5DL8 A;  4FZM A;  3SY7 A;  3WI4 A;  4RL9 A;  6PRN A;  1ZHZ A;  4JFB A;  5ADX L;  4O3Y A;  2XE2 A;  1H6S 1;  2XTR A;  1GFM A;  1HXU A;  4RLC A;  3T20 A;  2R4O A;  2R4L A;  3DWN A;  2WJR A;  4N75 A;  3T24 A;  5B66 O;  1Q9G A;  3AAE B;  2XE1 A;  4K3C A;  1IZN A;  2IWV A;  4LSH A;  2YPV A;  3EMN X;  2M07 A; 
#chains in the Genus database with same CATH homology
 2R4N A;  3DWO X;  3BS0 A;  2R4L A;  2R4O A;  2R8A A;  3DWN A;  3PGR A;  2R88 A;  1T16 A;  2R89 A;  3BRZ A;  3BRY A;  3PF1 A;  3PGU A;  3PGS A;  1T1L A;  2R4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...