3PGSA

Phe3gly mutant of ecfadl
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
427
structure length
427
Chain Sequence
AGGQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRAFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAFHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 127
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 3pgsA00
2R4OA 3BS0A 3PF1A 2R4NA 3DWNA 3PGRA 2R88A 2R89A 2R4LA 2R4PA 2R8AA 1T16A 3PGUA 3BRZA 3DWOX 3PGSA 1T1LA 3BRYA
chains in the Genus database with same CATH superfamily
4N75A 4PJ0O 2F1TA 4AYID 4RL9A 3SYBA 1MM5A 2JMMA 3V8UA 2F1VA 2LHFA 3UAQA 2M06A 4AFKA 1GFMA 1ZHWA 4O3WA 2X27X 4AYDC 4UB8O 3UU2A 3VY8X 3PF1A 3SY9A 2JQYA 2Y0LA 3SZVA 3BRZA 1HXUA 4G76A 3PGSA 5GTIO 3JTYA 4N59A 4U9CA 4AKRA 5DL6A 4LSEA 1G90A 3VZUX 4FMSA 4BUMX 1QJPA 2R88A 2OMFA 2KZ7B 3C5OA 2WVPA 3LK3B 2W81C 1E54A 2Y7SA 4FZNA 4FQEA 2LFUA 3T24A 4F4BA 4RJXA 2AXTO 2IWWA 1ORMA 1BH3A 1THQA 3HOEA 3AA6A 5ADXK 3LK41 5KAFO 4FOZA 4PR7A 2J1NA 8PRNA 2ZFGA 2N2LA 3LK2A 2Y2XA 3KVDD 4FRTA 4LSIA 3AA0A 3BRYA 4AKRB 5PRNA 2K4TA 2N2MA 2PORA 3HOLA 1P4TA 2WJQA 2ZLDA 3PGRA 5B5EO 2KZ7A 5E79O 2W80C 3LK3A 4C4VB 3RBHA 2XE3A 3QRCA 3WU2O 3AA7B 2IWVA 5T5FA 4GCQA 4G75A 5IYUA 3AA6B 1T16A 1GFOA 4IL6O 3DWOX 4O49A 5D5DA 3NSGA 3SY7A 2KXPA 3LK2B 4D64A 6PRNA 7PRNA 4FT6A 5G38A 2ODJA 3AA0B 3BS0A 3DA4A 1HXTA 2PRNA 3VY9X 2F1CX 4JFBA 2YPVA 4GCSA 2MHLA 4KR8A 4O4UA 4AZLA 1IZNB 1T1LA 4XNKA 3K19A 3AA7A 4FSPA 3POXA 1ZHZA 1ZHXA 5DL8A 4K3CA 3NJTA 4FSOA 3LK42 3VZTX 5H2FO 5KAIO 2KXPB 1ZHYA 5FVNA 4AKMA 3A0HO 4C4VA 3POQA 5AFUL 3HW9A 3UPGA 5DL7A 1HXXA 1IZNA 3KZIO 2KDYA 2R4OA 3G7GA 3PRNA 4XNLA 1BXWA 2R89A 1MM4A 1BT9A 5G3AA 2M07A 3VE1A 2XMXA 4E1TA 4FESA 5DL5A 3WI4A 4LSHA 2GE4A 1OPFA 4JCHA 2YNKA 3VE2A 3DZMA 3EMNX 4N74A 2K0LA 2R4NA 5GTHO 4C69X 3HWBA 4D5UA 4GF4A 4O3YA 4RLCA 1MPFA 3SZDA 2MNHA 4AYMC 2XE5A 3PORA 4FRXA 1GFNA 2ERVA 2XE2A 1QJ8A 2R8AA 4N58A 3PQSA 4KRAA 4CTDA 3AAEA 4O3ZA 1OSMA 2Y0HA 5AFUK 3VZWX 3WI5A 3QRAA 1GFPA 4PUXA 2QTKA 4O3XB 1ZHTA 1H6S1 1Q9GA 3DA3A 5JDPA 3JCUO 4E1SA 3PGUA 4LSFA 4QQ1A 4K3BA 3O0EA 1Q9FA 2KC0A 3PQUA 3AAAA 3DWNA 4KR4A 3AA1A 1QJ9A 4RJWA 5EE2A 4AUIA 4Z3TA 2R4LA 2R4PA 5TISO 1YS5A 2FGRA 2XE1A 3GP6A 3AAEB 2XTRA 3AA1B 3POUA 2Y0KA 4FUVA 4FZLA 4O4XA 2X9KA 5G26A 2J4UP 3A0BO 4AYEC 2XTQA 4AYNA 5B66O 1PHOA 2O4VA 2WJRA 1PRNA 4C00A 5GV0A 2XG6A 4GCPA 4B61A 2FGQX 4UB6O 4D65A 3AAAB 3FYXA 3TZGA 3T20A 5G39A 4GHBA 3T0SA 4RLBA 1S5LO 4FZMA 3SYSA 3A2SX 1GFQA 5ADXL
chains in the Genus database with same CATH topology
2R4OA 3BS0A 3PF1A 2R4NA 3DWNA 3PGRA 2R88A 2R89A 2R4LA 2R4PA 2R8AA 1T16A 3PGUA 3BRZA 3DWOX 3PGSA 1T1LA 3BRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4O A;  3BS0 A;  3PF1 A;  2R4N A;  3DWN A;  3PGR A;  2R88 A;  2R89 A;  2R4L A;  2R4P A;  2R8A A;  1T16 A;  3PGU A;  3BRZ A;  3DWO X;  3PGS A;  1T1L A;  3BRY A; 
#chains in the Genus database with same CATH topology
 4N75 A;  4PJ0 O;  2F1T A;  4AYI D;  4RL9 A;  3SYB A;  1MM5 A;  2JMM A;  3V8U A;  2F1V A;  2LHF A;  3UAQ A;  2M06 A;  4AFK A;  1GFM A;  1ZHW A;  4O3W A;  2X27 X;  4AYD C;  4UB8 O;  3UU2 A;  3VY8 X;  3PF1 A;  3SY9 A;  2JQY A;  2Y0L A;  3SZV A;  3BRZ A;  1HXU A;  4G76 A;  3PGS A;  5GTI O;  3JTY A;  4N59 A;  4U9C A;  4AKR A;  5DL6 A;  4LSE A;  1G90 A;  3VZU X;  4FMS A;  4BUM X;  1QJP A;  2R88 A;  2OMF A;  2KZ7 B;  3C5O A;  2WVP A;  3LK3 B;  2W81 C;  1E54 A;  2Y7S A;  4FZN A;  4FQE A;  2LFU A;  3T24 A;  4F4B A;  4RJX A;  2AXT O;  2IWW A;  1ORM A;  1BH3 A;  1THQ A;  3HOE A;  3AA6 A;  5ADX K;  3LK4 1;  5KAF O;  4FOZ A;  4PR7 A;  2J1N A;  8PRN A;  2ZFG A;  2N2L A;  3LK2 A;  2Y2X A;  3KVD D;  4FRT A;  4LSI A;  3AA0 A;  3BRY A;  4AKR B;  5PRN A;  2K4T A;  2N2M A;  2POR A;  3HOL A;  1P4T A;  2WJQ A;  2ZLD A;  3PGR A;  5B5E O;  2KZ7 A;  5E79 O;  2W80 C;  3LK3 A;  4C4V B;  3RBH A;  2XE3 A;  3QRC A;  3WU2 O;  3AA7 B;  2IWV A;  5T5F A;  4GCQ A;  4G75 A;  5IYU A;  3AA6 B;  1T16 A;  1GFO A;  4IL6 O;  3DWO X;  4O49 A;  5D5D A;  3NSG A;  3SY7 A;  2KXP A;  3LK2 B;  4D64 A;  6PRN A;  7PRN A;  4FT6 A;  5G38 A;  2ODJ A;  3AA0 B;  3BS0 A;  3DA4 A;  1HXT A;  2PRN A;  3VY9 X;  2F1C X;  4JFB A;  2YPV A;  4GCS A;  2MHL A;  4KR8 A;  4O4U A;  4AZL A;  1IZN B;  1T1L A;  4XNK A;  3K19 A;  3AA7 A;  4FSP A;  3POX A;  1ZHZ A;  1ZHX A;  5DL8 A;  4K3C A;  3NJT A;  4FSO A;  3LK4 2;  3VZT X;  5H2F O;  5KAI O;  2KXP B;  1ZHY A;  5FVN A;  4AKM A;  3A0H O;  4C4V A;  3POQ A;  5AFU L;  3HW9 A;  3UPG A;  5DL7 A;  1HXX A;  1IZN A;  3KZI O;  2KDY A;  2R4O A;  3G7G A;  3PRN A;  4XNL A;  1BXW A;  2R89 A;  1MM4 A;  1BT9 A;  5G3A A;  2M07 A;  3VE1 A;  2XMX A;  4E1T A;  4FES A;  5DL5 A;  3WI4 A;  4LSH A;  2GE4 A;  1OPF A;  4JCH A;  2YNK A;  3VE2 A;  3DZM A;  3EMN X;  4N74 A;  2K0L A;  2R4N A;  5GTH O;  4C69 X;  3HWB A;  4D5U A;  4GF4 A;  4O3Y A;  4RLC A;  1MPF A;  3SZD A;  2MNH A;  4AYM C;  2XE5 A;  3POR A;  4FRX A;  1GFN A;  2ERV A;  2XE2 A;  1QJ8 A;  2R8A A;  4N58 A;  3PQS A;  4KRA A;  4CTD A;  3AAE A;  4O3Z A;  1OSM A;  2Y0H A;  5AFU K;  3VZW X;  3WI5 A;  3QRA A;  1GFP A;  4PUX A;  2QTK A;  4O3X B;  1ZHT A;  1H6S 1;  1Q9G A;  3DA3 A;  5JDP A;  3JCU O;  4E1S A;  3PGU A;  4LSF A;  4QQ1 A;  4K3B A;  3O0E A;  1Q9F A;  2KC0 A;  3PQU A;  3AAA A;  3DWN A;  4KR4 A;  3AA1 A;  1QJ9 A;  4RJW A;  5EE2 A;  4AUI A;  4Z3T A;  2R4L A;  2R4P A;  5TIS O;  1YS5 A;  2FGR A;  2XE1 A;  3GP6 A;  3AAE B;  2XTR A;  3AA1 B;  3POU A;  2Y0K A;  4FUV A;  4FZL A;  4O4X A;  2X9K A;  5G26 A;  2J4U P;  3A0B O;  4AYE C;  2XTQ A;  4AYN A;  5B66 O;  1PHO A;  2O4V A;  2WJR A;  1PRN A;  4C00 A;  5GV0 A;  2XG6 A;  4GCP A;  4B61 A;  2FGQ X;  4UB6 O;  4D65 A;  3AAA B;  3FYX A;  3TZG A;  3T20 A;  5G39 A;  4GHB A;  3T0S A;  4RLB A;  1S5L O;  4FZM A;  3SYS A;  3A2S X;  1GFQ A;  5ADX L; 
#chains in the Genus database with same CATH homology
 2R4O A;  3BS0 A;  3PF1 A;  2R4N A;  3DWN A;  3PGR A;  2R88 A;  2R89 A;  2R4L A;  2R4P A;  2R8A A;  1T16 A;  3PGU A;  3BRZ A;  3DWO X;  3PGS A;  1T1L A;  3BRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...