2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Gna2132
publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
4U9CA 5EE2A 3HOEA 3PQUA 4O4UA 3V8UA 3PQSA 4AYID 4AYDC 4O4XA 2W80C 3VE1A 3UAQA 4AYNA 2W81C 2LFUA 4O3ZA 2KC0A 4O49A 4O3YA 4O3WA 5T5FA 3VE2A 3KVDD 4Z3TA 1YS5A 3HOLA 4AYMC 2YPVA 4QQ1A 2KDYA 2Y7SA 4O3XB 4AYEC
chains in the Genus database with same CATH superfamily
4X6AI 3S1NI 1ML8A 3TZGA 4BBRI 1Q821 3SY9A 3AAEA 1ZB9A 3AA0B 1K83I 3BG0B 3NDJA 3J80b 1ZH1A 3MZLB 1SIWA 3HOZI 1VQ8Z 2KZ7A 1TWGI 3K19A 3C5OA 3M4OI 2NVXI 1VQNZ 4N59A 2RBLA 4AYNA 3CCQZ 5AN9F 2O53A 3QRCA 1YJWZ 3PO3S 3LK3A 3WU2O 3OW2Z 4AKRA 4PJ0O 1JJ2Y 2K3RA 2X27X 4IL6O 2R4LA 2QREB 4S1TA 3PF1A 5B5EO 4N58A 1VQ41 1N8R1 1BXWA 4FZLA 2F1TA 1I3QI 1QYPA 2E7ZA 4RV9A 1S5LO 1K732 4MH4A 4NBGA 1YJ9Z 2E2HI 2V8KA 4JCHA 3AA6A 3LK42 2RIQA 1VLAA 2W81C 1Y1WI 3HWBA 2OOYB 3P5JB 3VMIA 1Z02A 4N75A 4O3WA 2VUMI 1Q9FA 5GTIO 2OTJZ 4MRIA 5DL7A 4AYMC 2Q4ZA 2OZKA 1THQA 4QQ1A 2Y0LA 3AA7A 1WZNA 1QJ8A 1TWCI 1Q811 3AAAB 3D2LA 1TFIA 3S14I 4A3KI 1W2BY 2V8IA 3I56Z 4E1SA 3NDIA 3CMA1 3DWOX 2X9KA 3BG1B 2W80C 1TWAI 3HOYI 3JCUO 5H2FO 2RHBA 3S1QI 4KRAA 3CCJ1 4BXXI 3CCV1 3MONA 1IZNA 3CCLZ 3D6WA 4NBFA 2XG6A 4RJXA 2VPYA 5G39A 4FESA 2J6AA 2XE1A 2ZAEB 1WIIA 3AA1B 3PRNA 3GCFA 3VY9X 2IV2X 3LK2A 1VQPZ 4E2ZA 4RLCA 2JA5I 3GTLI 1MM5A 1RO4A 2PM9A 4E2XA 3CD61 1T1LA 1GFNA 3NJTA 4NBEA 1VQ71 1GFOA 4E2WA 1VQ4Z 4A3LI 4EWCA 3DWNA 3AAEB 5DL8A 4F4BA 3CCU1 1Q16A 3TE5B 4AZLA 3RZOI 2KZ7B 1HXTA 4FZNA 4FZMA 5DL5A 1TWHI 2NVYI 4A3CI 1WCMI 1VQL1 4BUMX 2RPRA 1P4TA 3LK3B 3SYSA 5ADXL 4A3JI 2XE3A 1QJPA 2IWVA 3OW2Y 4C4VA 2R92I 1ZHTA 5PRNA 3CC21 4AUIA 5A2Qf 1E54A 4NH1C 3CME1 1YHQ1 1G90A 1VQM1 2QRCB 1BT9A 2ZFGA 1JWHC 2VPZA 4A93I 3LUSA 4E2YA 3GTQI 4D64A 2R6MA 4E30A 2JMMA 1ZB8A 4RS4A 1MPFA 5GV0A 1USPB 6PRNA 3G4S1 4FT6A 3AA6B 2KXPA 5A2Qb 2E2JI 1VQKZ 2LEXA 4KR8A 1YI2Z 4RVDA 3PGUA 1WW9A 3FQQA 4E33A 3I07A 1K731 4AYBA 1YIJ1 3LK41 2R4NA 3CC7Z 4E31A 3AA7B 4QTUA 2MNHA 1KC82 3G6E1 4XNKA 3BRYA 2MHLA 2EGTA 2W04A 4HH4A 1RO0A 1WJ2A 3CCMZ 1RQFA 3S1RI 1GFPA 4Z3TA 2JIPA 2QLVB 1VQ9Z 1YJNZ 2QA4Z 1ORMA 2JIQA 1VQ7Z 2PK7A 2QR1B 5D1OA 3VMGA 2DE7A 1IZNB 1K8A2 3GTPI 3TDHB 2HF1A 4FRTA 4FSOA 4G75A 3U50C 3PO2I 2XTQA 4FUVA 1ZHZA 4C00A 1QVGZ 4AYDC 1H6S1 4MONA 3LK2B 1X0TA 5C4XI 3GTMS 3A0HO 1VQLZ 3RZDI 4NBBA 1LQLA 4LSIA 4PUXA 4AFKA 1GFMA 2GTHA 1Y8CA 1VQOZ 3SZVA 4E32A 2LIYA 2VPXA 2G2KA 1KQSZ 3I4NI 4Y7NI 3I55Z 1YIT1 2R93I 5AFUL 4GF4A 4A3GI 2M6NA 4NBAA 3CQZI 4A3BI 3CC4Z 2R7ZI 3RBHA 1RLYA 3PGSA 1M1K2 1BH3A 2Y0SA 4LSEA 5FLMI 2K0LA 3T4NB 4RL9A 2VF1A 1Y1VS 2J1NA 3VZUX 3D9XA 2VPWA 2PORA 4NBDA 3DA4A 2BJOA 4NBHA 3VTNA 2HU9A 2VUGA 5LL6f 3IF8A 4MD7A 3VMHA 5JDPA 3H3VJ 2Y2XA 2OOXB 4RJWA 1X3ZA 3CPWZ 1YS5A 2QEX1 3SZDA 4JFBA 3HOWI 4BY1I 2NVQI 3IFUA 4O3XB 2F1CX 2GTIA 1R9TI 3T24A 1VQ61 5C44I 3QRAA 1Z03A 3S1MI 4GCQA 2WJRA 1NJI2 1PHOA 1PFTA 3FYXA 2E9HA 2R4PA 2ODJA 5FLXf 5T5FA 2M06A 4DGLA 2RT9A 2N2LA 1Q7Y2 4CTDA 1GFQA 3WI4A 4MD9A 1FDIA 3HOLA 1I50I 1VQ81 4AKMA 3PO3I 3S2HI 1VQN1 4AYEC 2R89A 3CCQ1 2JR6A 3F3FC 5G3AA 3POXA 1YJW1 5FLXb 3I4MI 2WJQA 3WI5A 3GTOI 4AKRB 1TWFI 2AYDA 5G38A 4FQEA 4AYID 3GTKI 2QTKA 1KC81 3Q87A 2DE5A 5D1OB 2O4HA 2B63I 2R88A 5G26A 4UB6O 1S721 4O49A 3NFZA 4HGYA 2WB1A 3GTMI 1QF8A 2V45A 3CCS1 1QVGY 3G711 5ADXK 4C69X 1YJ91 3CMAZ 2PRNA 5D5DA 1K8A1 2JNYA 3CCR1 4Y52I 3S15I 2N2MA 4FSPA 3CCJZ 3CCVZ 1QVFZ 2JA7I 3VY8X 1ZHWA 3O0EA 1KQSY 3CCE1 4O4UA 5DL6A 4XX2A 3NH5A 3VZWX 2QEXZ 2OTJ1 4BY7I 1T16A 2ZLDA 4E1TA 3M3YI 2XMXA 2LFUA 4O3ZA 1VQ6Z 3GKQA 2P28A 2V3VA 2GU2A 1S7MA 3CD6Z 3I561 3POUA 1QXFA 1RNIA 4NB9A 2JA8I 3FQMA 1HXUA 4GCPA 2F1VA 2YPVA 3KIFA 4FRXA 3DA3A 2KDYA 3CXCZ 1X3WA 1RO2A 3ESWA 3CCL1 2YU9I 1M1K1 5EE2A 1YUKA 3CCUZ 3CPWY 3V8UA 4RVGA 3PQSA 1Q861 2KPIA 3S16I 2JIMA 2JA6I 5IYUA 3BS0A 4A3DI 2JMOA 1N2FA 2JIOA 1VQP1 4K3CA 2FGRA 2PMZA 2IZ4A 4GHBA 2Y0KA 2OMFA 2W03A 1AA6A 2OTL1 3K7AI 3CC2Z 1M901 4CL1A 2JQYA 5B66O 4FOZA 5TISO 3UU2A 3CMEZ 1YHQZ 2K5RA 1VQMZ 2J4UP 5IP9I 1S72Z 3A0BO 4MD8A 2M07A 4DK1A 1VQ51 4LSHA 2AXTO 3BRZA 5C4JI 2NAPA 3CCSZ 1MM4A 2R4OA 2JUBA 1NJI1 3G71Z 1USPA 2P3YA 2ERVA 2WVPA 3JAMf 3G4SZ 1Q822 3SYBA 2FGQX 3CCRZ 3NH8A 2R8AA 2O4VA 4RVFA 4O4XA 8PRNA 4UB8O 2V8JA 3HOXI 1Q862 3UPGA 3EERA 1Q7Y1 2GE4A 3MZKB 2KI7B 3CCEZ 1QJ9A 3KVDD 5KAFO 4C4VB 5AFUK 1YIJZ 5E79O 3AA0A 5KAIO 4G76A 3JAMb 1M902 3G6EZ 4XNLA 2YADA 1ZHYA 3HOUI 4A3FI 3VB9A 3J81f 2E2II 2H85A 4B61A 5D1PA 3G7GA 4NBCA 2LHFA 3QWUA 3VZTX 1N8R2 4DQYB 3GTGI 3IR7A 3DZMA 1YUAA 3FKII 2KXPB 1VQK1 1DL6A 5T6BA 1JJ2Z 2NVTI 1YI21 3NSGA 5IT9f 3EEDA 3A2SX 4KR4A 1I6HI 1QVFY 4O3YA 1Z01A 4QTTA 2YNKA 2WAQA 3J81b 3T0SA 2I3CA 2DE6A 3CC71 2Y0HA 5C3EI 4NFRA 4N74A 3NH4A 4NB8A 3GP6A 4A3MI 5IT9b 3EMNX 4NOZA 3CCM1 2OTLZ 2XE2A 4U9CA 1Q812 4RLBA 2JS4A 1VQ91 1YJN1 2QA41 1YITZ 3POQA 3T20A 3CXCY 1VQ5Z 1P9NA 3J7A4 3PGRA 1OPFA 5IP7I 1FDOA 1PRNA 2XTRA 2M48A 1KD11 3AAAA 4RVHA 2IZ3A 1ZHXA 1K9M1 4A3EI 1W2BZ 5FVNA 3KIHA 4D5UA 4A3II 3HKZA 4HGZA 3F3PC 5T64A 3JTYA 4GCSA 5CM2M 2XE5A 4FMSA 3SY7A 5T67A 4TNUA 4D65A 1SFOI 1VQO1 3HOEA 3HW9A 3PQUA 3PORA 1L1OC 4MXUA 3AA1A 2QRDB 3GTJI 2AKLA 2QKDA 3H0GI 3I551 3S2DI 1Q9GA 3UAQA 3VE1A 1HXXA 1NUIA 1OSMA 3IX0A 3CC41 2KC0A 2JIRA 3VE2A 3J80f 1Y1VI 4LSFA 2IWWA 5GTHO 1NP6A 2F4MA 2K4TA 1KD12 4PR7A 7PRNA 2F4OA 3S17I 1K9M2 4K3BA 2Y7SA 4BBSI 1KRLA 3KZIO 3HOVI 2Q51A
chains in the Genus database with same CATH topology
4X6AI 3S1NI 1ML8A 3TZGA 4BBRI 1Q821 3SY9A 3AAEA 1ZB9A 3AA0B 1K83I 3BG0B 3NDJA 3J80b 1ZH1A 3MZLB 3HOZI 2KZ7A 1VQ8Z 1TWGI 3K19A 3C5OA 3M4OI 2NVXI 1VQNZ 4N59A 2RBLA 4AYNA 3CCQZ 5AN9F 2O53A 3QRCA 1YJWZ 3PO3S 3LK3A 3OW2Z 4AKRA 1JJ2Y 2K3RA 2X27X 2QREB 4S1TA 4N58A 1VQ41 1N8R1 1BXWA 4FZLA 2F1TA 1I3QI 1QYPA 4RV9A 1K732 4MH4A 4NBGA 1YJ9Z 2E2HI 2V8KA 4JCHA 3AA6A 3LK42 2RIQA 1VLAA 2W81C 1Y1WI 3HWBA 2OOYB 3P5JB 3VMIA 1Z02A 4O3WA 2VUMI 1Q9FA 2OTJZ 4MRIA 5DL7A 4AYMC 2Q4ZA 2OZKA 1THQA 4QQ1A 2Y0LA 3AA7A 1QJ8A 1TWCI 1Q811 3AAAB 1TFIA 3S14I 4A3KI 1W2BY 2V8IA 3I56Z 4E1SA 3NDIA 3CMA1 3BG1B 2W80C 1TWAI 3HOYI 2RHBA 3S1QI 4KRAA 3CCJ1 4BXXI 3CCV1 3MONA 1IZNA 3CCLZ 3D6WA 4NBFA 2XG6A 4RJXA 4FESA 2J6AA 2XE1A 2ZAEB 1WIIA 3AA1B 3PRNA 3GCFA 3VY9X 3LK2A 1VQPZ 4E2ZA 4RLCA 2JA5I 3GTLI 1MM5A 1RO4A 2PM9A 4E2XA 3CD61 1GFNA 4NBEA 1VQ71 1GFOA 4E2WA 1VQ4Z 4A3LI 4EWCA 3AAEB 5DL8A 4F4BA 3CCU1 3TE5B 4AZLA 3RZOI 2KZ7B 1HXTA 4FZNA 4FZMA 5DL5A 1TWHI 2NVYI 4A3CI 1WCMI 1VQL1 4BUMX 2RPRA 1P4TA 3LK3B 3SYSA 5ADXL 4A3JI 2XE3A 1QJPA 3OW2Y 2R92I 1ZHTA 5PRNA 3CC21 4AUIA 5A2Qf 1E54A 4NH1C 3CME1 1YHQ1 1G90A 1VQM1 2QRCB 1BT9A 2ZFGA 1JWHC 4A93I 3LUSA 4E2YA 3GTQI 4D64A 2R6MA 4E30A 2JMMA 1ZB8A 4RS4A 1MPFA 5GV0A 1USPB 6PRNA 3G4S1 4FT6A 3AA6B 2KXPA 5A2Qb 2E2JI 1VQKZ 4KR8A 1YI2Z 4RVDA 1WW9A 3FQQA 4E33A 3I07A 1K731 4AYBA 1YIJ1 3LK41 3CC7Z 4E31A 3AA7B 4QTUA 2MNHA 1KC82 3G6E1 4XNKA 2MHLA 2EGTA 2W04A 4HH4A 1RO0A 3S1RI 3CCMZ 1RQFA 1GFPA 4Z3TA 2QLVB 1VQ9Z 1YJNZ 2QA4Z 1ORMA 1VQ7Z 2PK7A 2QR1B 5D1OA 3VMGA 2DE7A 1IZNB 1K8A2 3GTPI 3TDHB 2HF1A 4FRTA 4FSOA 4G75A 3U50C 3PO2I 2XTQA 4FUVA 1ZHZA 1QVGZ 4AYDC 1H6S1 4MONA 3LK2B 1X0TA 5C4XI 3GTMS 1VQLZ 3RZDI 4NBBA 1LQLA 4LSIA 4PUXA 4AFKA 1GFMA 2GTHA 1VQOZ 3SZVA 4E32A 2LIYA 2G2KA 1KQSZ 3I4NI 4Y7NI 3I55Z 1YIT1 2R93I 5AFUL 4GF4A 4A3GI 2M6NA 4NBAA 3CQZI 4A3BI 3CC4Z 2R7ZI 3RBHA 1RLYA 1M1K2 1BH3A 2Y0SA 4LSEA 5FLMI 2K0LA 3T4NB 4RL9A 2VF1A 1Y1VS 2J1NA 3VZUX 3D9XA 2PORA 4NBDA 3DA4A 2BJOA 4NBHA 3VTNA 2HU9A 2VUGA 5LL6f 3IF8A 4MD7A 3VMHA 5JDPA 3H3VJ 2Y2XA 2OOXB 4RJWA 1X3ZA 3CPWZ 1YS5A 2QEX1 3SZDA 4JFBA 3HOWI 4BY1I 2NVQI 3IFUA 4O3XB 2GTIA 1R9TI 3T24A 1VQ61 5C44I 3QRAA 1Z03A 3S1MI 4GCQA 1NJI2 1PHOA 1PFTA 3FYXA 2E9HA 2ODJA 5FLXf 5T5FA 2M06A 4DGLA 2RT9A 2N2LA 1Q7Y2 1GFQA 3WI4A 4MD9A 3HOLA 1I50I 1VQ81 4AKMA 3PO3I 3S2HI 1VQN1 4AYEC 3CCQ1 2JR6A 3F3FC 3POXA 1YJW1 5FLXb 3I4MI 3WI5A 3GTOI 4AKRB 1TWFI 4AYID 3GTKI 2QTKA 1KC81 3Q87A 2DE5A 5D1OB 2O4HA 2B63I 5G26A 1S721 4O49A 3NFZA 4HGYA 2WB1A 3GTMI 1QF8A 3CCS1 1QVGY 3G711 5ADXK 4C69X 1YJ91 3CMAZ 2PRNA 5D5DA 1K8A1 2JNYA 3CCR1 4Y52I 3S15I 2N2MA 4FSPA 3CCJZ 3CCVZ 1QVFZ 2JA7I 3VY8X 1ZHWA 3O0EA 1KQSY 3CCE1 4O4UA 5DL6A 4XX2A 3NH5A 3VZWX 2QEXZ 2OTJ1 4BY7I 2ZLDA 4E1TA 3M3YI 2XMXA 2LFUA 4O3ZA 1VQ6Z 3GKQA 2P28A 2GU2A 1S7MA 3CD6Z 3I561 3POUA 1RNIA 4NB9A 2JA8I 3FQMA 1HXUA 4GCPA 2F1VA 2YPVA 3KIFA 4FRXA 3DA3A 2KDYA 3CXCZ 1X3WA 1RO2A 3ESWA 3CCL1 2YU9I 1M1K1 5EE2A 1YUKA 3CCUZ 3CPWY 3V8UA 4RVGA 3PQSA 1Q861 2KPIA 3S16I 2JA6I 5IYUA 4A3DI 2JMOA 1N2FA 1VQP1 2FGRA 2PMZA 2IZ4A 4GHBA 2Y0KA 2OMFA 2W03A 2OTL1 3K7AI 3CC2Z 1M901 4CL1A 4FOZA 3UU2A 3CMEZ 1YHQZ 2K5RA 1VQMZ 2J4UP 5IP9I 1S72Z 4MD8A 2M07A 4DK1A 1VQ51 4LSHA 5C4JI 3CCSZ 1MM4A 2JUBA 1NJI1 3G71Z 1USPA 2P3YA 2ERVA 3SYBA 3JAMf 3G4SZ 1Q822 2FGQX 3CCRZ 3NH8A 4O4XA 2O4VA 4RVFA 8PRNA 3UPGA 2V8JA 3HOXI 1Q862 3EERA 1Q7Y1 2GE4A 3MZKB 2KI7B 3CCEZ 1QJ9A 3KVDD 5AFUK 1YIJZ 3AA0A 4G76A 3JAMb 1M902 3G6EZ 4XNLA 2YADA 1ZHYA 3HOUI 4A3FI 3VB9A 3J81f 2E2II 2H85A 4B61A 5D1PA 3G7GA 4NBCA 2LHFA 3QWUA 3VZTX 1N8R2 4DQYB 3GTGI 1YUAA 3FKII 2KXPB 1VQK1 1DL6A 5T6BA 1JJ2Z 2NVTI 1YI21 3NSGA 5IT9f 3EEDA 3A2SX 4KR4A 1I6HI 1QVFY 4O3YA 1Z01A 4QTTA 2YNKA 2WAQA 3J81b 3T0SA 2I3CA 2DE6A 3CC71 2Y0HA 5C3EI 4NFRA 3NH4A 4NB8A 3GP6A 4A3MI 5IT9b 3EMNX 4NOZA 3CCM1 2OTLZ 2XE2A 4U9CA 1Q812 4RLBA 2JS4A 1VQ91 1YJN1 2QA41 1YITZ 3POQA 3T20A 3CXCY 1VQ5Z 1P9NA 3J7A4 1OPFA 5IP7I 2XTRA 1PRNA 2M48A 1KD11 3AAAA 4RVHA 2IZ3A 1ZHXA 1K9M1 4A3EI 1W2BZ 5FVNA 3KIHA 4D5UA 4A3II 3HKZA 4HGZA 3F3PC 5T64A 3JTYA 4GCSA 5CM2M 2XE5A 4FMSA 3SY7A 5T67A 4TNUA 4D65A 1SFOI 1VQO1 3HOEA 3HW9A 3PQUA 3PORA 1L1OC 4MXUA 3AA1A 2QRDB 3GTJI 2AKLA 2QKDA 3H0GI 3I551 3S2DI 1Q9GA 3UAQA 3VE1A 1HXXA 1NUIA 1OSMA 3IX0A 3CC41 2KC0A 3VE2A 3J80f 1Y1VI 4LSFA 1NP6A 2F4MA 2K4TA 1KD12 7PRNA 2F4OA 3S17I 1K9M2 2Y7SA 4BBSI 1KRLA 3HOVI 2Q51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U9C A;  5EE2 A;  3HOE A;  3PQU A;  4O4U A;  3V8U A;  3PQS A;  4AYI D;  4AYD C;  4O4X A;  2W80 C;  3VE1 A;  3UAQ A;  4AYN A;  2W81 C;  2LFU A;  4O3Z A;  2KC0 A;  4O49 A;  4O3Y A;  4O3W A;  5T5F A;  3VE2 A;  3KVD D;  4Z3T A;  1YS5 A;  3HOL A;  4AYM C;  2YPV A;  4QQ1 A;  2KDY A;  2Y7S A;  4O3X B;  4AYE C; 
#chains in the Genus database with same CATH topology
 4X6A I;  3S1N I;  1ML8 A;  3TZG A;  4BBR I;  1Q82 1;  3SY9 A;  3AAE A;  1ZB9 A;  3AA0 B;  1K83 I;  3BG0 B;  3NDJ A;  3J80 b;  1ZH1 A;  3MZL B;  1SIW A;  3HOZ I;  1VQ8 Z;  2KZ7 A;  1TWG I;  3K19 A;  3C5O A;  3M4O I;  2NVX I;  1VQN Z;  4N59 A;  2RBL A;  4AYN A;  3CCQ Z;  5AN9 F;  2O53 A;  3QRC A;  1YJW Z;  3PO3 S;  3LK3 A;  3WU2 O;  3OW2 Z;  4AKR A;  4PJ0 O;  1JJ2 Y;  2K3R A;  2X27 X;  4IL6 O;  2R4L A;  2QRE B;  4S1T A;  3PF1 A;  5B5E O;  4N58 A;  1VQ4 1;  1N8R 1;  1BXW A;  4FZL A;  2F1T A;  1I3Q I;  1QYP A;  2E7Z A;  4RV9 A;  1S5L O;  1K73 2;  4MH4 A;  4NBG A;  1YJ9 Z;  2E2H I;  2V8K A;  4JCH A;  3AA6 A;  3LK4 2;  2RIQ A;  1VLA A;  2W81 C;  1Y1W I;  3HWB A;  2OOY B;  3P5J B;  3VMI A;  1Z02 A;  4N75 A;  4O3W A;  2VUM I;  1Q9F A;  5GTI O;  2OTJ Z;  4MRI A;  5DL7 A;  4AYM C;  2Q4Z A;  2OZK A;  1THQ A;  4QQ1 A;  2Y0L A;  3AA7 A;  1WZN A;  1QJ8 A;  1TWC I;  1Q81 1;  3AAA B;  3D2L A;  1TFI A;  3S14 I;  4A3K I;  1W2B Y;  2V8I A;  3I56 Z;  4E1S A;  3NDI A;  3CMA 1;  3DWO X;  2X9K A;  3BG1 B;  2W80 C;  1TWA I;  3HOY I;  3JCU O;  5H2F O;  2RHB A;  3S1Q I;  4KRA A;  3CCJ 1;  4BXX I;  3CCV 1;  3MON A;  1IZN A;  3CCL Z;  3D6W A;  4NBF A;  2XG6 A;  4RJX A;  2VPY A;  5G39 A;  4FES A;  2J6A A;  2XE1 A;  2ZAE B;  1WII A;  3AA1 B;  3PRN A;  3GCF A;  3VY9 X;  2IV2 X;  3LK2 A;  1VQP Z;  4E2Z A;  4RLC A;  2JA5 I;  3GTL I;  1MM5 A;  1RO4 A;  2PM9 A;  4E2X A;  3CD6 1;  1T1L A;  1GFN A;  3NJT A;  4NBE A;  1VQ7 1;  1GFO A;  4E2W A;  1VQ4 Z;  4A3L I;  4EWC A;  3DWN A;  3AAE B;  5DL8 A;  4F4B A;  3CCU 1;  1Q16 A;  3TE5 B;  4AZL A;  3RZO I;  2KZ7 B;  1HXT A;  4FZN A;  4FZM A;  5DL5 A;  1TWH I;  2NVY I;  4A3C I;  1WCM I;  1VQL 1;  4BUM X;  2RPR A;  1P4T A;  3LK3 B;  3SYS A;  5ADX L;  4A3J I;  2XE3 A;  1QJP A;  2IWV A;  3OW2 Y;  4C4V A;  2R92 I;  1ZHT A;  5PRN A;  3CC2 1;  4AUI A;  5A2Q f;  1E54 A;  4NH1 C;  3CME 1;  1YHQ 1;  1G90 A;  1VQM 1;  2QRC B;  1BT9 A;  2ZFG A;  1JWH C;  2VPZ A;  4A93 I;  3LUS A;  4E2Y A;  3GTQ I;  4D64 A;  2R6M A;  4E30 A;  2JMM A;  1ZB8 A;  4RS4 A;  1MPF A;  5GV0 A;  1USP B;  6PRN A;  3G4S 1;  4FT6 A;  3AA6 B;  2KXP A;  5A2Q b;  2E2J I;  1VQK Z;  2LEX A;  4KR8 A;  1YI2 Z;  4RVD A;  3PGU A;  1WW9 A;  3FQQ A;  4E33 A;  3I07 A;  1K73 1;  4AYB A;  1YIJ 1;  3LK4 1;  2R4N A;  3CC7 Z;  4E31 A;  3AA7 B;  4QTU A;  2MNH A;  1KC8 2;  3G6E 1;  4XNK A;  3BRY A;  2MHL A;  2EGT A;  2W04 A;  4HH4 A;  1RO0 A;  1WJ2 A;  3CCM Z;  1RQF A;  3S1R I;  1GFP A;  4Z3T A;  2JIP A;  2QLV B;  1VQ9 Z;  1YJN Z;  2QA4 Z;  1ORM A;  2JIQ A;  1VQ7 Z;  2PK7 A;  2QR1 B;  5D1O A;  3VMG A;  2DE7 A;  1IZN B;  1K8A 2;  3GTP I;  3TDH B;  2HF1 A;  4FRT A;  4FSO A;  4G75 A;  3U50 C;  3PO2 I;  2XTQ A;  4FUV A;  1ZHZ A;  4C00 A;  1QVG Z;  4AYD C;  1H6S 1;  4MON A;  3LK2 B;  1X0T A;  5C4X I;  3GTM S;  3A0H O;  1VQL Z;  3RZD I;  4NBB A;  1LQL A;  4LSI A;  4PUX A;  4AFK A;  1GFM A;  2GTH A;  1Y8C A;  1VQO Z;  3SZV A;  4E32 A;  2LIY A;  2VPX A;  2G2K A;  1KQS Z;  3I4N I;  4Y7N I;  3I55 Z;  1YIT 1;  2R93 I;  5AFU L;  4GF4 A;  4A3G I;  2M6N A;  4NBA A;  3CQZ I;  4A3B I;  3CC4 Z;  2R7Z I;  3RBH A;  1RLY A;  3PGS A;  1M1K 2;  1BH3 A;  2Y0S A;  4LSE A;  5FLM I;  2K0L A;  3T4N B;  4RL9 A;  2VF1 A;  1Y1V S;  2J1N A;  3VZU X;  3D9X A;  2VPW A;  2POR A;  4NBD A;  3DA4 A;  2BJO A;  4NBH A;  3VTN A;  2HU9 A;  2VUG A;  5LL6 f;  3IF8 A;  4MD7 A;  3VMH A;  5JDP A;  3H3V J;  2Y2X A;  2OOX B;  4RJW A;  1X3Z A;  3CPW Z;  1YS5 A;  2QEX 1;  3SZD A;  4JFB A;  3HOW I;  4BY1 I;  2NVQ I;  3IFU A;  4O3X B;  2F1C X;  2GTI A;  1R9T I;  3T24 A;  1VQ6 1;  5C44 I;  3QRA A;  1Z03 A;  3S1M I;  4GCQ A;  2WJR A;  1NJI 2;  1PHO A;  1PFT A;  3FYX A;  2E9H A;  2R4P A;  2ODJ A;  5FLX f;  5T5F A;  2M06 A;  4DGL A;  2RT9 A;  2N2L A;  1Q7Y 2;  4CTD A;  1GFQ A;  3WI4 A;  4MD9 A;  1FDI A;  3HOL A;  1I50 I;  1VQ8 1;  4AKM A;  3PO3 I;  3S2H I;  1VQN 1;  4AYE C;  2R89 A;  3CCQ 1;  2JR6 A;  3F3F C;  5G3A A;  3POX A;  1YJW 1;  5FLX b;  3I4M I;  2WJQ A;  3WI5 A;  3GTO I;  4AKR B;  1TWF I;  2AYD A;  5G38 A;  4FQE A;  4AYI D;  3GTK I;  2QTK A;  1KC8 1;  3Q87 A;  2DE5 A;  5D1O B;  2O4H A;  2B63 I;  2R88 A;  5G26 A;  4UB6 O;  1S72 1;  4O49 A;  3NFZ A;  4HGY A;  2WB1 A;  3GTM I;  1QF8 A;  2V45 A;  3CCS 1;  1QVG Y;  3G71 1;  5ADX K;  4C69 X;  1YJ9 1;  3CMA Z;  2PRN A;  5D5D A;  1K8A 1;  2JNY A;  3CCR 1;  4Y52 I;  3S15 I;  2N2M A;  4FSP A;  3CCJ Z;  3CCV Z;  1QVF Z;  2JA7 I;  3VY8 X;  1ZHW A;  3O0E A;  1KQS Y;  3CCE 1;  4O4U A;  5DL6 A;  4XX2 A;  3NH5 A;  3VZW X;  2QEX Z;  2OTJ 1;  4BY7 I;  1T16 A;  2ZLD A;  4E1T A;  3M3Y I;  2XMX A;  2LFU A;  4O3Z A;  1VQ6 Z;  3GKQ A;  2P28 A;  2V3V A;  2GU2 A;  1S7M A;  3CD6 Z;  3I56 1;  3POU A;  1QXF A;  1RNI A;  4NB9 A;  2JA8 I;  3FQM A;  1HXU A;  4GCP A;  2F1V A;  2YPV A;  3KIF A;  4FRX A;  3DA3 A;  2KDY A;  3CXC Z;  1X3W A;  1RO2 A;  3ESW A;  3CCL 1;  2YU9 I;  1M1K 1;  5EE2 A;  1YUK A;  3CCU Z;  3CPW Y;  3V8U A;  4RVG A;  3PQS A;  1Q86 1;  2KPI A;  3S16 I;  2JIM A;  2JA6 I;  5IYU A;  3BS0 A;  4A3D I;  2JMO A;  1N2F A;  2JIO A;  1VQP 1;  4K3C A;  2FGR A;  2PMZ A;  2IZ4 A;  4GHB A;  2Y0K A;  2OMF A;  2W03 A;  1AA6 A;  2OTL 1;  3K7A I;  3CC2 Z;  1M90 1;  4CL1 A;  2JQY A;  5B66 O;  4FOZ A;  5TIS O;  3UU2 A;  3CME Z;  1YHQ Z;  2K5R A;  1VQM Z;  2J4U P;  5IP9 I;  1S72 Z;  3A0B O;  4MD8 A;  2M07 A;  4DK1 A;  1VQ5 1;  4LSH A;  2AXT O;  3BRZ A;  5C4J I;  2NAP A;  3CCS Z;  1MM4 A;  2R4O A;  2JUB A;  1NJI 1;  3G71 Z;  1USP A;  2P3Y A;  2ERV A;  2WVP A;  3JAM f;  3G4S Z;  1Q82 2;  3SYB A;  2FGQ X;  3CCR Z;  3NH8 A;  2R8A A;  2O4V A;  4RVF A;  4O4X A;  8PRN A;  4UB8 O;  2V8J A;  3HOX I;  1Q86 2;  3UPG A;  3EER A;  1Q7Y 1;  2GE4 A;  3MZK B;  2KI7 B;  3CCE Z;  1QJ9 A;  3KVD D;  5KAF O;  4C4V B;  5AFU K;  1YIJ Z;  5E79 O;  3AA0 A;  5KAI O;  4G76 A;  3JAM b;  1M90 2;  3G6E Z;  4XNL A;  2YAD A;  1ZHY A;  3HOU I;  4A3F I;  3VB9 A;  3J81 f;  2E2I I;  2H85 A;  4B61 A;  5D1P A;  3G7G A;  4NBC A;  2LHF A;  3QWU A;  3VZT X;  1N8R 2;  4DQY B;  3GTG I;  3IR7 A;  3DZM A;  1YUA A;  3FKI I;  2KXP B;  1VQK 1;  1DL6 A;  5T6B A;  1JJ2 Z;  2NVT I;  1YI2 1;  3NSG A;  5IT9 f;  3EED A;  3A2S X;  4KR4 A;  1I6H I;  1QVF Y;  4O3Y A;  1Z01 A;  4QTT A;  2YNK A;  2WAQ A;  3J81 b;  3T0S A;  2I3C A;  2DE6 A;  3CC7 1;  2Y0H A;  5C3E I;  4NFR A;  4N74 A;  3NH4 A;  4NB8 A;  3GP6 A;  4A3M I;  5IT9 b;  3EMN X;  4NOZ A;  3CCM 1;  2OTL Z;  2XE2 A;  4U9C A;  1Q81 2;  4RLB A;  2JS4 A;  1VQ9 1;  1YJN 1;  2QA4 1;  1YIT Z;  3POQ A;  3T20 A;  3CXC Y;  1VQ5 Z;  1P9N A;  3J7A 4;  3PGR A;  1OPF A;  5IP7 I;  1FDO A;  1PRN A;  2XTR A;  2M48 A;  1KD1 1;  3AAA A;  4RVH A;  2IZ3 A;  1ZHX A;  1K9M 1;  4A3E I;  1W2B Z;  5FVN A;  3KIH A;  4D5U A;  4A3I I;  3HKZ A;  4HGZ A;  3F3P C;  5T64 A;  3JTY A;  4GCS A;  5CM2 M;  2XE5 A;  4FMS A;  3SY7 A;  5T67 A;  4TNU A;  4D65 A;  1SFO I;  1VQO 1;  3HOE A;  3HW9 A;  3PQU A;  3POR A;  1L1O C;  4MXU A;  3AA1 A;  2QRD B;  3GTJ I;  2AKL A;  2QKD A;  3H0G I;  3I55 1;  3S2D I;  1Q9G A;  3UAQ A;  3VE1 A;  1HXX A;  1NUI A;  1OSM A;  3IX0 A;  3CC4 1;  2KC0 A;  2JIR A;  3VE2 A;  3J80 f;  1Y1V I;  4LSF A;  2IWW A;  5GTH O;  1NP6 A;  2F4M A;  2K4T A;  1KD1 2;  4PR7 A;  7PRN A;  2F4O A;  3S17 I;  1K9M 2;  4K3B A;  2Y7S A;  4BBS I;  1KRL A;  3KZI O;  3HOV I;  2Q51 A; 
#chains in the Genus database with same CATH homology
 4X6A I;  3S1N I;  1ML8 A;  3TZG A;  4BBR I;  1Q82 1;  3SY9 A;  3AAE A;  1ZB9 A;  3AA0 B;  1K83 I;  3BG0 B;  3NDJ A;  3J80 b;  1ZH1 A;  3MZL B;  3HOZ I;  2KZ7 A;  1VQ8 Z;  1TWG I;  3K19 A;  3C5O A;  3M4O I;  2NVX I;  1VQN Z;  4N59 A;  2RBL A;  4AYN A;  3CCQ Z;  5AN9 F;  2O53 A;  3QRC A;  1YJW Z;  3PO3 S;  3LK3 A;  3OW2 Z;  4AKR A;  1JJ2 Y;  2K3R A;  2X27 X;  2QRE B;  4S1T A;  4N58 A;  1VQ4 1;  1N8R 1;  1BXW A;  4FZL A;  2F1T A;  1I3Q I;  1QYP A;  4RV9 A;  1K73 2;  4MH4 A;  4NBG A;  1YJ9 Z;  2E2H I;  2V8K A;  4JCH A;  3AA6 A;  3LK4 2;  2RIQ A;  1VLA A;  2W81 C;  1Y1W I;  3HWB A;  2OOY B;  3P5J B;  3VMI A;  1Z02 A;  4O3W A;  2VUM I;  1Q9F A;  2OTJ Z;  4MRI A;  5DL7 A;  4AYM C;  2Q4Z A;  2OZK A;  1THQ A;  4QQ1 A;  2Y0L A;  3AA7 A;  1QJ8 A;  1TWC I;  1Q81 1;  3AAA B;  1TFI A;  3S14 I;  4A3K I;  1W2B Y;  2V8I A;  3I56 Z;  4E1S A;  3NDI A;  3CMA 1;  3BG1 B;  2W80 C;  1TWA I;  3HOY I;  2RHB A;  3S1Q I;  4KRA A;  3CCJ 1;  4BXX I;  3CCV 1;  3MON A;  1IZN A;  3CCL Z;  3D6W A;  4NBF A;  2XG6 A;  4RJX A;  4FES A;  2J6A A;  2XE1 A;  2ZAE B;  1WII A;  3AA1 B;  3PRN A;  3GCF A;  3VY9 X;  3LK2 A;  1VQP Z;  4E2Z A;  4RLC A;  2JA5 I;  3GTL I;  1MM5 A;  1RO4 A;  2PM9 A;  4E2X A;  3CD6 1;  1GFN A;  4NBE A;  1VQ7 1;  1GFO A;  4E2W A;  1VQ4 Z;  4A3L I;  4EWC A;  3AAE B;  5DL8 A;  4F4B A;  3CCU 1;  3TE5 B;  4AZL A;  3RZO I;  2KZ7 B;  1HXT A;  4FZN A;  4FZM A;  5DL5 A;  1TWH I;  2NVY I;  4A3C I;  1WCM I;  1VQL 1;  4BUM X;  2RPR A;  1P4T A;  3LK3 B;  3SYS A;  5ADX L;  4A3J I;  2XE3 A;  1QJP A;  3OW2 Y;  2R92 I;  1ZHT A;  5PRN A;  3CC2 1;  4AUI A;  5A2Q f;  1E54 A;  4NH1 C;  3CME 1;  1YHQ 1;  1G90 A;  1VQM 1;  2QRC B;  1BT9 A;  2ZFG A;  1JWH C;  4A93 I;  3LUS A;  4E2Y A;  3GTQ I;  4D64 A;  2R6M A;  4E30 A;  2JMM A;  1ZB8 A;  4RS4 A;  1MPF A;  5GV0 A;  1USP B;  6PRN A;  3G4S 1;  4FT6 A;  3AA6 B;  2KXP A;  5A2Q b;  2E2J I;  1VQK Z;  4KR8 A;  1YI2 Z;  4RVD A;  1WW9 A;  3FQQ A;  4E33 A;  3I07 A;  1K73 1;  4AYB A;  1YIJ 1;  3LK4 1;  3CC7 Z;  4E31 A;  3AA7 B;  4QTU A;  2MNH A;  1KC8 2;  3G6E 1;  4XNK A;  2MHL A;  2EGT A;  2W04 A;  4HH4 A;  1RO0 A;  3S1R I;  3CCM Z;  1RQF A;  1GFP A;  4Z3T A;  2QLV B;  1VQ9 Z;  1YJN Z;  2QA4 Z;  1ORM A;  1VQ7 Z;  2PK7 A;  2QR1 B;  5D1O A;  3VMG A;  2DE7 A;  1IZN B;  1K8A 2;  3GTP I;  3TDH B;  2HF1 A;  4FRT A;  4FSO A;  4G75 A;  3U50 C;  3PO2 I;  2XTQ A;  4FUV A;  1ZHZ A;  1QVG Z;  4AYD C;  1H6S 1;  4MON A;  3LK2 B;  1X0T A;  5C4X I;  3GTM S;  1VQL Z;  3RZD I;  4NBB A;  1LQL A;  4LSI A;  4PUX A;  4AFK A;  1GFM A;  2GTH A;  1VQO Z;  3SZV A;  4E32 A;  2LIY A;  2G2K A;  1KQS Z;  3I4N I;  4Y7N I;  3I55 Z;  1YIT 1;  2R93 I;  5AFU L;  4GF4 A;  4A3G I;  2M6N A;  4NBA A;  3CQZ I;  4A3B I;  3CC4 Z;  2R7Z I;  3RBH A;  1RLY A;  1M1K 2;  1BH3 A;  2Y0S A;  4LSE A;  5FLM I;  2K0L A;  3T4N B;  4RL9 A;  2VF1 A;  1Y1V S;  2J1N A;  3VZU X;  3D9X A;  2POR A;  4NBD A;  3DA4 A;  2BJO A;  4NBH A;  3VTN A;  2HU9 A;  2VUG A;  5LL6 f;  3IF8 A;  4MD7 A;  3VMH A;  5JDP A;  3H3V J;  2Y2X A;  2OOX B;  4RJW A;  1X3Z A;  3CPW Z;  1YS5 A;  2QEX 1;  3SZD A;  4JFB A;  3HOW I;  4BY1 I;  2NVQ I;  3IFU A;  4O3X B;  2GTI A;  1R9T I;  3T24 A;  1VQ6 1;  5C44 I;  3QRA A;  1Z03 A;  3S1M I;  4GCQ A;  1NJI 2;  1PHO A;  1PFT A;  3FYX A;  2E9H A;  2ODJ A;  5FLX f;  5T5F A;  2M06 A;  4DGL A;  2RT9 A;  2N2L A;  1Q7Y 2;  1GFQ A;  3WI4 A;  4MD9 A;  3HOL A;  1I50 I;  1VQ8 1;  4AKM A;  3PO3 I;  3S2H I;  1VQN 1;  4AYE C;  3CCQ 1;  2JR6 A;  3F3F C;  3POX A;  1YJW 1;  5FLX b;  3I4M I;  3WI5 A;  3GTO I;  4AKR B;  1TWF I;  4AYI D;  3GTK I;  2QTK A;  1KC8 1;  3Q87 A;  2DE5 A;  5D1O B;  2O4H A;  2B63 I;  5G26 A;  1S72 1;  4O49 A;  3NFZ A;  4HGY A;  2WB1 A;  3GTM I;  1QF8 A;  3CCS 1;  1QVG Y;  3G71 1;  5ADX K;  4C69 X;  1YJ9 1;  3CMA Z;  2PRN A;  5D5D A;  1K8A 1;  2JNY A;  3CCR 1;  4Y52 I;  3S15 I;  2N2M A;  4FSP A;  3CCJ Z;  3CCV Z;  1QVF Z;  2JA7 I;  3VY8 X;  1ZHW A;  3O0E A;  1KQS Y;  3CCE 1;  4O4U A;  5DL6 A;  4XX2 A;  3NH5 A;  3VZW X;  2QEX Z;  2OTJ 1;  4BY7 I;  2ZLD A;  4E1T A;  3M3Y I;  2XMX A;  2LFU A;  4O3Z A;  1VQ6 Z;  3GKQ A;  2P28 A;  2GU2 A;  1S7M A;  3CD6 Z;  3I56 1;  3POU A;  1RNI A;  4NB9 A;  2JA8 I;  3FQM A;  1HXU A;  4GCP A;  2F1V A;  2YPV A;  3KIF A;  4FRX A;  3DA3 A;  2KDY A;  3CXC Z;  1X3W A;  1RO2 A;  3ESW A;  3CCL 1;  2YU9 I;  1M1K 1;  5EE2 A;  1YUK A;  3CCU Z;  3CPW Y;  3V8U A;  4RVG A;  3PQS A;  1Q86 1;  2KPI A;  3S16 I;  2JA6 I;  5IYU A;  4A3D I;  2JMO A;  1N2F A;  1VQP 1;  2FGR A;  2PMZ A;  2IZ4 A;  4GHB A;  2Y0K A;  2OMF A;  2W03 A;  2OTL 1;  3K7A I;  3CC2 Z;  1M90 1;  4CL1 A;  4FOZ A;  3UU2 A;  3CME Z;  1YHQ Z;  2K5R A;  1VQM Z;  2J4U P;  5IP9 I;  1S72 Z;  4MD8 A;  2M07 A;  4DK1 A;  1VQ5 1;  4LSH A;  5C4J I;  3CCS Z;  1MM4 A;  2JUB A;  1NJI 1;  3G71 Z;  1USP A;  2P3Y A;  2ERV A;  3SYB A;  3JAM f;  3G4S Z;  1Q82 2;  2FGQ X;  3CCR Z;  3NH8 A;  4O4X A;  2O4V A;  4RVF A;  8PRN A;  3UPG A;  2V8J A;  3HOX I;  1Q86 2;  3EER A;  1Q7Y 1;  2GE4 A;  3MZK B;  2KI7 B;  3CCE Z;  1QJ9 A;  3KVD D;  5AFU K;  1YIJ Z;  3AA0 A;  4G76 A;  3JAM b;  1M90 2;  3G6E Z;  4XNL A;  2YAD A;  1ZHY A;  3HOU I;  4A3F I;  3VB9 A;  3J81 f;  2E2I I;  2H85 A;  4B61 A;  5D1P A;  3G7G A;  4NBC A;  2LHF A;  3QWU A;  3VZT X;  1N8R 2;  4DQY B;  3GTG I;  1YUA A;  3FKI I;  2KXP B;  1VQK 1;  1DL6 A;  5T6B A;  1JJ2 Z;  2NVT I;  1YI2 1;  3NSG A;  5IT9 f;  3EED A;  3A2S X;  4KR4 A;  1I6H I;  1QVF Y;  4O3Y A;  1Z01 A;  4QTT A;  2YNK A;  2WAQ A;  3J81 b;  3T0S A;  2I3C A;  2DE6 A;  3CC7 1;  2Y0H A;  5C3E I;  4NFR A;  3NH4 A;  4NB8 A;  3GP6 A;  4A3M I;  5IT9 b;  3EMN X;  4NOZ A;  3CCM 1;  2OTL Z;  2XE2 A;  4U9C A;  1Q81 2;  4RLB A;  2JS4 A;  1VQ9 1;  1YJN 1;  2QA4 1;  1YIT Z;  3POQ A;  3T20 A;  3CXC Y;  1VQ5 Z;  1P9N A;  3J7A 4;  1OPF A;  5IP7 I;  2XTR A;  1PRN A;  2M48 A;  1KD1 1;  3AAA A;  4RVH A;  2IZ3 A;  1ZHX A;  1K9M 1;  4A3E I;  1W2B Z;  5FVN A;  3KIH A;  4D5U A;  4A3I I;  3HKZ A;  4HGZ A;  3F3P C;  5T64 A;  3JTY A;  4GCS A;  5CM2 M;  2XE5 A;  4FMS A;  3SY7 A;  5T67 A;  4TNU A;  4D65 A;  1SFO I;  1VQO 1;  3HOE A;  3HW9 A;  3PQU A;  3POR A;  1L1O C;  4MXU A;  3AA1 A;  2QRD B;  3GTJ I;  2AKL A;  2QKD A;  3H0G I;  3I55 1;  3S2D I;  1Q9G A;  3UAQ A;  3VE1 A;  1HXX A;  1NUI A;  1OSM A;  3IX0 A;  3CC4 1;  2KC0 A;  3VE2 A;  3J80 f;  1Y1V I;  4LSF A;  1NP6 A;  2F4M A;  2K4T A;  1KD1 2;  7PRN A;  2F4O A;  3S17 I;  1K9M 2;  2Y7S A;  4BBS I;  1KRL A;  3HOV I;  2Q51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...