2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gna2132
publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
4O49A 3PQUA 4O4XA 2YPVA 3VE2A 2W80C 3KVDD 3VE1A 3UAQA 5EE2A 5T5FA 3HOLA 1YS5A 2LFUA 4O3YA 4AYDC 4AYMC 4O3WA 3PQSA 3HOEA 3V8UA 2Y7SA 2KDYA 4U9CA 4Z3TA 4QQ1A 2W81C 2KC0A 4AYNA 4O3XB 4AYEC 4AYID 4O3ZA 4O4UA
chains in the Genus database with same CATH superfamily
2VF1A 4O4XA 3EEDA 2M48A 5A2Qf 2QRDB 3CCEZ 2QKDA 3LK3A 1QF8A 1Q821 1GFQA 3VMIA 3S15I 1ZH1A 2LFUA 1K8A1 1ZB8A 1QJ8A 4XX2A 4C4VA 3G4S1 1SFOI 2IZ3A 4TNUA 3VMHA 1G90A 1HXUA 3O0EA 3LK3B 3CC71 4UB6O 4NBHA 2WJQA 4IL6O 3AA1A 4FUVA 3CCL1 5G26A 1N8R2 2IZ4A 4GF4A 2VPZA 4LSIA 4C4VB 1WZNA 3BG1B 4BBRI 2ZLDA 2KXPA 2JMOA 4NH1C 3S2DI 4NB9A 2OTJZ 4NB8A 2N2LA 4FSPA 3POXA 1VQN1 2QREB 4CTDA 3CCLZ 3AA1B 4E32A 2JA8I 3HOLA 3HOWI 5DL6A 4RJWA 5IP7I 3CCQ1 3FQQA 3IFUA 2Y2XA 2Q4ZA 4EWCA 2KXPB 4U9CA 4MH4A 3CCRZ 2G2KA 3CC21 5ADXK 1WCMI 5GTHO 4A3BI 3S14I 4MRIA 1Y1VI 1S5LO 3CCQZ 4KR4A 4AYID 1ZHYA 4O4UA 3J81b 4Y7NI 2O4VA 3PQUA 3CMAZ 2W03A 4MXUA 4PJ0O 5IT9b 2VPYA 5G3AA 2F1CX 4A3LI 5E79O 1GFNA 3T24A 1BH3A 3JCUO 3HOXI 1RQFA 3J80f 4NBAA 3SZVA 3SY7A 2JR6A 2JIOA 2VPWA 2Y7SA 2LIYA 3S2HI 3D9XA 4Z3TA 1K83I 3S1NI 4AUIA 4E2WA 3J81f 2V8IA 4PR7A 5IYUA 5B5EO 3K7AI 2OOXB 3PO3S 1FDIA 1TWCI 3S1RI 1JJ2Y 1OPFA 3ESWA 2JA7I 1YJW1 4X6AI 1K8A2 2VUMI 1QXFA 1YS5A 4MD7A 4AZLA 3G71Z 2R4OA 4UB8O 4MD9A 3DWNA 3FKII 4NBDA 3CMEZ 3V8UA 3I551 4FZNA 2IWVA 2E7ZA 3LK41 1YUKA 3TE5B 1BT9A 3IF8A 2MHLA 4KR8A 5B66O 3GKQA 1Q811 2OZKA 3I4NI 4DK1A 1TWAI 4S1TA 2Y0LA 4NBEA 2QTKA 4GCQA 3HOZI 1IZNA 3POUA 3A0BO 4BY7I 3M4OI 5D1OA 7PRNA 4GHBA 3DA4A 2H85A 1ORMA 3Q87A 2J1NA 2R7ZI 3T4NB 1HXTA 5T67A 4HGZA 3GTMI 1IZNB 4FQEA 4D65A 3HW9A 3QRAA 3AA6A 3CCUZ 5D1OB 2N2MA 4AFKA 4NBBA 3HOVI 4A3II 3CCE1 2LHFA 2ZFGA 4A3KI 2GE4A 2R93I 3A2SX 4K3BA 5IP9I 4A3GI 4NBGA 1ZHWA 3JTYA 3CXCY 2VPXA 3AA6B 3VE2A 1VQ7Z 2WB1A 3GTJI 1RO4A 2J6AA 3G7GA 3DA3A 3UAQA 3VE1A 5EE2A 2KZ7A 4RVFA 4B61A 2R92I 4GCPA 4FRTA 6PRNA 2JIMA 2AYDA 4JCHA 4E2YA 1ML8A 3H0GI 3F3PC 4RL9A 2JQYA 5D1PA 1S721 1TWHI 1TWFI 2JS4A 3SY9A 2KDYA 3H3VJ 1YHQZ 2YNKA 2IV2X 1WIIA 2OTJ1 2RPRA 1VQMZ 1VQ9Z 2KZ7B 5FLXb 2NVQI 5ADXL 2XE3A 2E9HA 1GFOA 1S72Z 1GFMA 3PGSA 3CD61 3S17I 2R6MA 5GV0A 5AN9F 1JJ2Z 2AXTO 2V45A 2XG6A 3IR7A 3OW2Y 2JA5I 4XNKA 4BUMX 2Y0SA 3CCR1 2AKLA 4RVHA 4N59A 4D5UA 2KPIA 3CD6Z 3NJTA 1VQ81 3LK42 5FLXf 2RIQA 2BJOA 4AKMA 1NP6A 3D2LA 4G76A 1VQKZ 4LSFA 3VZTX 3J80b 3CMA1 1Q812 2ZAEB 3AAEA 2PORA 3UU2A 2WAQA 2JIPA 4E2XA 5TISO 1VQ8Z 2B63I 3D6WA 4E2ZA 1RO0A 2PRNA 4E31A 1YJ91 1I50I 1K731 4RLBA 1RO2A 1L1OC 3CQZI 4BY1I 1BXWA 3GP6A 3AAEB 1TFIA 5C44I 1OSMA 3PO3I 3HWBA 2HF1A 1KQSY 3GTLI 3NH5A 1YJ9Z 2GTIA 1M1K2 3PF1A 3I07A 2R4LA 3PGUA 2PK7A 1VQ6Z 2K3RA 1HXXA 1PRNA 1VQ5Z 2RHBA 3NFZA 3VB9A 3NSGA 4G75A 3I4MI 3VY9X 4RJXA 2M07A 2GTHA 4NFRA 2XTQA 3BRZA 3BG0B 4D64A 3G711 4JFBA 1P9NA 1T16A 5FVNA 5FLMI 4CL1A 3CME1 3GCFA 4E1SA 5C4JI 3CXCZ 3M3YI 2WVPA 1Y8CA 1X0TA 3DWOX 1Y1VS 2V8JA 3POQA 2J4UP 5GTIO 1W2BY 1VQOZ 2QA4Z 2RBLA 1R9TI 1KD12 1Q9FA 3A0HO 1I6HI 3G6EZ 1Z02A 3QRCA 2XE1A 2JIQA 4FT6A 2QR1B 3LK2A 1KRLA 1YUAA 4BBSI 2F4OA 4A3DI 1QJPA 4MONA 3FQMA 1RLYA 3RBHA 3GTQI 2Y0KA 4O49A 1PFTA 5DL8A 3VZWX 4RV9A 3UPGA 3LK2B 2YU9I 4K3CA 3OW2Z 3CCU1 4FMSA 2MNHA 3SYBA 4BXXI 1YIJ1 1FDOA 1H6S1 1QYPA 3CC4Z 1M1K1 2Y0HA 5KAIO 2X9KA 1VQ71 3VY8X 1YIJZ 4MD8A 3GTOI 3JAMf 1E54A 1Q861 3CCS1 3S16I 2F1VA 3K19A 4QTUA 1ZHXA 1SIWA 4FOZA 1K732 3PORA 4N74A 1ZB9A 4C69X 1VLAA 1Q7Y1 4FZLA 3NDJA 3CCJ1 2K5RA 2R4NA 2IWWA 2QRCB 1KC81 1YHQ1 3I56Z 1WW9A 3GTGI 4Y52I 3CCSZ 3CCVZ 1MPFA 1VQM1 1VQ91 1P4TA 2R89A 3FYXA 1KQSZ 4AYDC 1DL6A 2LEXA 4LSEA 3PQSA 4A3CI 1K9M1 4LSHA 4E33A 3CCJZ 1YJN1 5D5DA 4RS4A 3MZKB 1Y1WI 1KD11 4QQ1A 3HOYI 2NVYI 1T1LA 3NH8A 1ZHTA 3CPWY 4AYEC 2P3YA 1YIT1 4QTTA 3KIFA 4O3ZA 5H2FO 1Q9GA 1YJNZ 2O53A 2F1TA 2VUGA 2XTRA 3AA7A 1VQK1 3TDHB 2YADA 4RLCA 1WJ2A 1YITZ 1I3QI 4DGLA 4A3JI 2KI7B 2XE2A 3KIHA 4NBFA 1W2BZ 2E2JI 3P5JB 3AA7B 2ERVA 3CCM1 2W81C 3MONA 1NJI2 3AA0A 3G4SZ 2FGRA 5DL5A 3PRNA 3PGRA 2V8KA 1VQ41 4FESA 3J7A4 3WI4A 3CC7Z 1X3ZA 2E2HI 3RZOI 3CCMZ 3BS0A 3BRYA 3C5OA 1MM5A 1VQ61 5T5FA 3AA0B 4A3MI 1VQ51 2JA6I 3KZIO 2P28A 2JUBA 1VQ4Z 4O3WA 4PUXA 4N75A 5G39A 4RVGA 5KAFO 1S7MA 4RVDA 1VQNZ 1USPA 4N58A 1NUIA 4FRXA 5G38A 2QEX1 4AYNA 1QJ9A 3SZDA 1X3WA 1Q862 2R4PA 2GU2A 2PM9A 5T64A 1PHOA 1QVGY 3DZMA 1Q7Y2 3LUSA 1QVFY 3RZDI 3T20A 4FZMA 3CC2Z 1USPB 2OMFA 1VQO1 2YPVA 2QA41 1KC82 1Q16A 2QEXZ 2RT9A 3G6E1 2K4TA 3KVDD 3S1MI 3HKZA 2OTL1 5CM2M 2FGQX 3QWUA 2M6NA 2HU9A 3NDIA 2V3VA 1Z03A 1K9M2 2JMMA 2XMXA 3MZLB 1VQP1 2E2II 2X27X 1M902 2XE5A 4KRAA 2KC0A 2OTLZ 4DQYB 4O3XB 5IT9f 2DE6A 4AYBA 1MM4A 2JNYA 4A3EI 1N8R1 5LL6f 1NJI1 3VTNA 3F3FC 3CPWZ 3TZGA 3WI5A 2R8AA 4F4BA 2DE7A 1VQPZ 1YI21 2EGTA 3EMNX 1ZHZA 3CC41 1Q822 1Z01A 3IX0A 3JAMb 4C00A 4E1TA 2QLVB 4FSOA 1VQL1 1GFPA 4O3YA 4AYMC 2ODJA 1YI2Z 4HGYA 1RNIA 2O4HA 3T0SA 3EERA 3SYSA 4GCSA 2I3CA 3S1QI 2NAPA 2W04A 1YJWZ 4NOZA 5AFUL 1VQLZ 5DL7A 4AKRA 1N2FA 5JDPA 5PRNA 3I55Z 3I561 5T6BA 2NVTI 3CCV1 2R88A 4XNLA 2K0LA 1AA6A 4A93I 8PRNA 2W80C 2JIRA 4E30A 4AKRB 3WU2O 3GTKI 1THQA 3AAAA 1TWGI 2DE5A 5A2Qb 2NVXI 3HOEA 4NBCA 3VZUX 3NH4A 2WJRA 5AFUK 3VMGA 4HH4A 5C4XI 2PMZA 3HOUI 3GTPI 3AAAB 1LQLA 1M901 2M06A 2F4MA 3PO2I 3U50C 1JWHC 4A3FI 2OOYB 2Q51A 1QVGZ 5C3EI 3GTMS 1QVFZ
chains in the Genus database with same CATH topology
2VF1A 4O4XA 3EEDA 2M48A 5A2Qf 2QRDB 3CCEZ 2QKDA 3LK3A 1QF8A 1Q821 1GFQA 3VMIA 3S15I 1ZH1A 2LFUA 1K8A1 1ZB8A 1QJ8A 4XX2A 3G4S1 1SFOI 2IZ3A 4TNUA 3VMHA 1G90A 1HXUA 3O0EA 3LK3B 3CC71 4NBHA 3AA1A 4FUVA 3CCL1 5G26A 1N8R2 2IZ4A 4GF4A 4LSIA 3BG1B 4BBRI 2ZLDA 2KXPA 2JMOA 4NH1C 3S2DI 4NB9A 2OTJZ 4NB8A 2N2LA 4FSPA 3POXA 1VQN1 2QREB 3CCLZ 3AA1B 4E32A 2JA8I 3HOLA 3HOWI 5DL6A 4RJWA 5IP7I 3CCQ1 3FQQA 3IFUA 2Y2XA 2Q4ZA 4EWCA 2KXPB 4U9CA 4MH4A 3CCRZ 2G2KA 3CC21 5ADXK 1WCMI 4A3BI 3S14I 4MRIA 1Y1VI 4KR4A 3CCQZ 4AYID 1ZHYA 4O4UA 3J81b 4Y7NI 2O4VA 3PQUA 3CMAZ 2W03A 4MXUA 5IT9b 4A3LI 1GFNA 3T24A 1BH3A 3HOXI 1RQFA 3J80f 4NBAA 3SZVA 3SY7A 2JR6A 2Y7SA 2LIYA 3S2HI 3D9XA 4Z3TA 1K83I 3S1NI 4AUIA 4E2WA 3J81f 2V8IA 5IYUA 3K7AI 2OOXB 3PO3S 1TWCI 3S1RI 1JJ2Y 1OPFA 3ESWA 2JA7I 1YJW1 4X6AI 1K8A2 2VUMI 1YS5A 4MD7A 4AZLA 3G71Z 4MD9A 3FKII 4NBDA 3CMEZ 3V8UA 3I551 4FZNA 3LK41 1YUKA 3TE5B 1BT9A 3IF8A 2MHLA 4KR8A 3GKQA 1Q811 2OZKA 3I4NI 4DK1A 1TWAI 4S1TA 2Y0LA 4NBEA 2QTKA 4GCQA 3HOZI 1IZNA 3POUA 4BY7I 3M4OI 5D1OA 7PRNA 4GHBA 3DA4A 2H85A 1ORMA 3Q87A 2J1NA 2R7ZI 3T4NB 1HXTA 5T67A 4HGZA 3GTMI 1IZNB 4D65A 3HW9A 3QRAA 3AA6A 3CCUZ 5D1OB 2N2MA 4AFKA 4NBBA 3HOVI 4A3II 3CCE1 2LHFA 2ZFGA 4A3KI 2GE4A 2R93I 3A2SX 5IP9I 4A3GI 4NBGA 1ZHWA 3JTYA 3CXCY 3AA6B 3VE2A 1VQ7Z 2WB1A 3GTJI 1RO4A 2J6AA 3G7GA 3DA3A 3UAQA 3VE1A 5EE2A 2KZ7A 4RVFA 4B61A 2R92I 4GCPA 4FRTA 6PRNA 4JCHA 4E2YA 1ML8A 3H0GI 3F3PC 4RL9A 5D1PA 1S721 1TWHI 1TWFI 2JS4A 3SY9A 2KDYA 3H3VJ 1YHQZ 2YNKA 1WIIA 2OTJ1 2RPRA 1VQMZ 1VQ9Z 2KZ7B 5FLXb 2NVQI 5ADXL 2XE3A 2E9HA 1GFOA 1S72Z 1GFMA 3CD61 3S17I 2R6MA 5GV0A 5AN9F 1JJ2Z 2XG6A 3OW2Y 4XNKA 2JA5I 4BUMX 2Y0SA 3CCR1 2AKLA 4RVHA 4N59A 4D5UA 2KPIA 3CD6Z 1VQ81 3LK42 2RIQA 5FLXf 2BJOA 4AKMA 1NP6A 4G76A 1VQKZ 4LSFA 3VZTX 3J80b 3CMA1 1Q812 2ZAEB 3AAEA 2PORA 3UU2A 2WAQA 4E2XA 1VQ8Z 2B63I 3D6WA 4E2ZA 1RO0A 2PRNA 4E31A 1YJ91 1I50I 1K731 4RLBA 1RO2A 1L1OC 3CQZI 4BY1I 1BXWA 3GP6A 3AAEB 1TFIA 5C44I 1OSMA 3PO3I 3HWBA 2HF1A 1KQSY 3GTLI 3NH5A 1YJ9Z 2GTIA 1M1K2 3I07A 2PK7A 1VQ6Z 2K3RA 1HXXA 1PRNA 1VQ5Z 2RHBA 3NFZA 3VB9A 3NSGA 4G75A 3I4MI 3VY9X 4RJXA 2M07A 2GTHA 4NFRA 2XTQA 3BG0B 4D64A 3G711 4JFBA 1P9NA 5FVNA 5FLMI 4CL1A 3CME1 3GCFA 4E1SA 5C4JI 3CXCZ 3M3YI 1X0TA 1Y1VS 2V8JA 3POQA 2J4UP 1W2BY 1VQOZ 2QA4Z 2RBLA 1R9TI 1KD12 1Q9FA 3QRCA 1I6HI 3G6EZ 1Z02A 2XE1A 4FT6A 2QR1B 3LK2A 1KRLA 1YUAA 4BBSI 2F4OA 4A3DI 1QJPA 4MONA 3FQMA 1RLYA 3RBHA 3GTQI 2Y0KA 4O49A 1PFTA 5DL8A 3VZWX 4RV9A 3UPGA 3LK2B 2YU9I 3OW2Z 3CCU1 4FMSA 2MNHA 3SYBA 4BXXI 1YIJ1 1H6S1 1QYPA 3CC4Z 1M1K1 2Y0HA 1VQ71 3VY8X 1YIJZ 4MD8A 3GTOI 3JAMf 1E54A 1Q861 3CCS1 3S16I 2F1VA 3K19A 4QTUA 1ZHXA 4FOZA 1K732 3PORA 1ZB9A 4C69X 1VLAA 1Q7Y1 4FZLA 3NDJA 3CCJ1 2K5RA 2QRCB 1KC81 1YHQ1 3I56Z 1WW9A 3GTGI 4Y52I 3CCSZ 3CCVZ 1MPFA 1VQM1 1VQ91 1P4TA 3FYXA 4AYDC 1KQSZ 1DL6A 4LSEA 3PQSA 4A3CI 1K9M1 4LSHA 4E33A 3CCJZ 1YJN1 5D5DA 4RS4A 3MZKB 1Y1WI 1KD11 4QQ1A 3HOYI 2NVYI 3NH8A 1ZHTA 3CPWY 4AYEC 2P3YA 1YIT1 4QTTA 3KIFA 4O3ZA 1Q9GA 1YJNZ 2O53A 2F1TA 2VUGA 2XTRA 3AA7A 1VQK1 3TDHB 2YADA 4RLCA 1YITZ 1I3QI 4DGLA 4A3JI 2KI7B 2XE2A 3KIHA 4NBFA 1W2BZ 2E2JI 3P5JB 3AA7B 2ERVA 3CCM1 2W81C 3MONA 1NJI2 3AA0A 3G4SZ 2FGRA 5DL5A 3PRNA 2V8KA 1VQ41 4FESA 3J7A4 3WI4A 3CC7Z 1X3ZA 2E2HI 3RZOI 3CCMZ 3C5OA 1MM5A 1VQ61 5T5FA 3AA0B 4A3MI 1VQ51 2JA6I 2P28A 2JUBA 1VQ4Z 4O3WA 4PUXA 4RVGA 1S7MA 4RVDA 1VQNZ 1USPA 4N58A 1NUIA 4FRXA 2QEX1 4AYNA 1QJ9A 3SZDA 1X3WA 1Q862 2GU2A 2PM9A 5T64A 1PHOA 1QVGY 1Q7Y2 3LUSA 1QVFY 3RZDI 3T20A 4FZMA 3CC2Z 1USPB 2OMFA 1VQO1 2YPVA 2QA41 1KC82 2QEXZ 2RT9A 3G6E1 2K4TA 3KVDD 3S1MI 3HKZA 2OTL1 5CM2M 2FGQX 3QWUA 2M6NA 2HU9A 3NDIA 2JMMA 1Z03A 1K9M2 2XMXA 3MZLB 1VQP1 2E2II 2X27X 1M902 2XE5A 4KRAA 2KC0A 2OTLZ 4DQYB 4O3XB 5IT9f 2DE6A 4AYBA 1MM4A 2JNYA 4A3EI 1N8R1 5LL6f 1NJI1 3VTNA 3F3FC 3CPWZ 3TZGA 3WI5A 4F4BA 2DE7A 1VQPZ 1YI21 2EGTA 3EMNX 1ZHZA 3CC41 1Q822 1Z01A 3IX0A 3JAMb 4E1TA 2QLVB 4FSOA 1VQL1 1GFPA 4O3YA 4AYMC 2ODJA 1YI2Z 4HGYA 1RNIA 2O4HA 3T0SA 3EERA 3SYSA 4GCSA 2I3CA 3S1QI 2W04A 1YJWZ 4NOZA 5AFUL 1VQLZ 5DL7A 4AKRA 1N2FA 5JDPA 5PRNA 3I55Z 3I561 5T6BA 2NVTI 3CCV1 4XNLA 2K0LA 4A93I 8PRNA 2W80C 4E30A 4AKRB 3GTKI 1THQA 3AAAA 1TWGI 2DE5A 5A2Qb 2NVXI 3HOEA 4NBCA 3VZUX 3NH4A 5AFUK 3VMGA 4HH4A 5C4XI 2PMZA 3HOUI 3GTPI 3AAAB 1LQLA 1M901 2M06A 2F4MA 3PO2I 3U50C 1JWHC 4A3FI 2OOYB 2Q51A 1QVGZ 5C3EI 3GTMS 1QVFZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O49 A;  3PQU A;  4O4X A;  2YPV A;  3VE2 A;  2W80 C;  3KVD D;  3VE1 A;  3UAQ A;  5EE2 A;  5T5F A;  3HOL A;  1YS5 A;  2LFU A;  4O3Y A;  4AYD C;  4AYM C;  4O3W A;  3PQS A;  3HOE A;  3V8U A;  2Y7S A;  2KDY A;  4U9C A;  4Z3T A;  4QQ1 A;  2W81 C;  2KC0 A;  4AYN A;  4O3X B;  4AYE C;  4AYI D;  4O3Z A;  4O4U A; 
#chains in the Genus database with same CATH topology
 2VF1 A;  4O4X A;  3EED A;  2M48 A;  5A2Q f;  2QRD B;  3CCE Z;  2QKD A;  3LK3 A;  1QF8 A;  1Q82 1;  1GFQ A;  3VMI A;  3S15 I;  1ZH1 A;  2LFU A;  1K8A 1;  1ZB8 A;  1QJ8 A;  4XX2 A;  4C4V A;  3G4S 1;  1SFO I;  2IZ3 A;  4TNU A;  3VMH A;  1G90 A;  1HXU A;  3O0E A;  3LK3 B;  3CC7 1;  4UB6 O;  4NBH A;  2WJQ A;  4IL6 O;  3AA1 A;  4FUV A;  3CCL 1;  5G26 A;  1N8R 2;  2IZ4 A;  4GF4 A;  2VPZ A;  4LSI A;  4C4V B;  1WZN A;  3BG1 B;  4BBR I;  2ZLD A;  2KXP A;  2JMO A;  4NH1 C;  3S2D I;  4NB9 A;  2OTJ Z;  4NB8 A;  2N2L A;  4FSP A;  3POX A;  1VQN 1;  2QRE B;  4CTD A;  3CCL Z;  3AA1 B;  4E32 A;  2JA8 I;  3HOL A;  3HOW I;  5DL6 A;  4RJW A;  5IP7 I;  3CCQ 1;  3FQQ A;  3IFU A;  2Y2X A;  2Q4Z A;  4EWC A;  2KXP B;  4U9C A;  4MH4 A;  3CCR Z;  2G2K A;  3CC2 1;  5ADX K;  1WCM I;  5GTH O;  4A3B I;  3S14 I;  4MRI A;  1Y1V I;  1S5L O;  3CCQ Z;  4KR4 A;  4AYI D;  1ZHY A;  4O4U A;  3J81 b;  4Y7N I;  2O4V A;  3PQU A;  3CMA Z;  2W03 A;  4MXU A;  4PJ0 O;  5IT9 b;  2VPY A;  5G3A A;  2F1C X;  4A3L I;  5E79 O;  1GFN A;  3T24 A;  1BH3 A;  3JCU O;  3HOX I;  1RQF A;  3J80 f;  4NBA A;  3SZV A;  3SY7 A;  2JR6 A;  2JIO A;  2VPW A;  2Y7S A;  2LIY A;  3S2H I;  3D9X A;  4Z3T A;  1K83 I;  3S1N I;  4AUI A;  4E2W A;  3J81 f;  2V8I A;  4PR7 A;  5IYU A;  5B5E O;  3K7A I;  2OOX B;  3PO3 S;  1FDI A;  1TWC I;  3S1R I;  1JJ2 Y;  1OPF A;  3ESW A;  2JA7 I;  1YJW 1;  4X6A I;  1K8A 2;  2VUM I;  1QXF A;  1YS5 A;  4MD7 A;  4AZL A;  3G71 Z;  2R4O A;  4UB8 O;  4MD9 A;  3DWN A;  3FKI I;  4NBD A;  3CME Z;  3V8U A;  3I55 1;  4FZN A;  2IWV A;  2E7Z A;  3LK4 1;  1YUK A;  3TE5 B;  1BT9 A;  3IF8 A;  2MHL A;  4KR8 A;  5B66 O;  3GKQ A;  1Q81 1;  2OZK A;  3I4N I;  4DK1 A;  1TWA I;  4S1T A;  2Y0L A;  4NBE A;  2QTK A;  4GCQ A;  3HOZ I;  1IZN A;  3POU A;  3A0B O;  4BY7 I;  3M4O I;  5D1O A;  7PRN A;  4GHB A;  3DA4 A;  2H85 A;  1ORM A;  3Q87 A;  2J1N A;  2R7Z I;  3T4N B;  1HXT A;  5T67 A;  4HGZ A;  3GTM I;  1IZN B;  4FQE A;  4D65 A;  3HW9 A;  3QRA A;  3AA6 A;  3CCU Z;  5D1O B;  2N2M A;  4AFK A;  4NBB A;  3HOV I;  4A3I I;  3CCE 1;  2LHF A;  2ZFG A;  4A3K I;  2GE4 A;  2R93 I;  3A2S X;  4K3B A;  5IP9 I;  4A3G I;  4NBG A;  1ZHW A;  3JTY A;  3CXC Y;  2VPX A;  3AA6 B;  3VE2 A;  1VQ7 Z;  2WB1 A;  3GTJ I;  1RO4 A;  2J6A A;  3G7G A;  3DA3 A;  3UAQ A;  3VE1 A;  5EE2 A;  2KZ7 A;  4RVF A;  4B61 A;  2R92 I;  4GCP A;  4FRT A;  6PRN A;  2JIM A;  2AYD A;  4JCH A;  4E2Y A;  1ML8 A;  3H0G I;  3F3P C;  4RL9 A;  2JQY A;  5D1P A;  1S72 1;  1TWH I;  1TWF I;  2JS4 A;  3SY9 A;  2KDY A;  3H3V J;  1YHQ Z;  2YNK A;  2IV2 X;  1WII A;  2OTJ 1;  2RPR A;  1VQM Z;  1VQ9 Z;  2KZ7 B;  5FLX b;  2NVQ I;  5ADX L;  2XE3 A;  2E9H A;  1GFO A;  1S72 Z;  1GFM A;  3PGS A;  3CD6 1;  3S17 I;  2R6M A;  5GV0 A;  5AN9 F;  1JJ2 Z;  2AXT O;  2V45 A;  2XG6 A;  3IR7 A;  3OW2 Y;  2JA5 I;  4XNK A;  4BUM X;  2Y0S A;  3CCR 1;  2AKL A;  4RVH A;  4N59 A;  4D5U A;  2KPI A;  3CD6 Z;  3NJT A;  1VQ8 1;  3LK4 2;  5FLX f;  2RIQ A;  2BJO A;  4AKM A;  1NP6 A;  3D2L A;  4G76 A;  1VQK Z;  4LSF A;  3VZT X;  3J80 b;  3CMA 1;  1Q81 2;  2ZAE B;  3AAE A;  2POR A;  3UU2 A;  2WAQ A;  2JIP A;  4E2X A;  5TIS O;  1VQ8 Z;  2B63 I;  3D6W A;  4E2Z A;  1RO0 A;  2PRN A;  4E31 A;  1YJ9 1;  1I50 I;  1K73 1;  4RLB A;  1RO2 A;  1L1O C;  3CQZ I;  4BY1 I;  1BXW A;  3GP6 A;  3AAE B;  1TFI A;  5C44 I;  1OSM A;  3PO3 I;  3HWB A;  2HF1 A;  1KQS Y;  3GTL I;  3NH5 A;  1YJ9 Z;  2GTI A;  1M1K 2;  3PF1 A;  3I07 A;  2R4L A;  3PGU A;  2PK7 A;  1VQ6 Z;  2K3R A;  1HXX A;  1PRN A;  1VQ5 Z;  2RHB A;  3NFZ A;  3VB9 A;  3NSG A;  4G75 A;  3I4M I;  3VY9 X;  4RJX A;  2M07 A;  2GTH A;  4NFR A;  2XTQ A;  3BRZ A;  3BG0 B;  4D64 A;  3G71 1;  4JFB A;  1P9N A;  1T16 A;  5FVN A;  5FLM I;  4CL1 A;  3CME 1;  3GCF A;  4E1S A;  5C4J I;  3CXC Z;  3M3Y I;  2WVP A;  1Y8C A;  1X0T A;  3DWO X;  1Y1V S;  2V8J A;  3POQ A;  2J4U P;  5GTI O;  1W2B Y;  1VQO Z;  2QA4 Z;  2RBL A;  1R9T I;  1KD1 2;  1Q9F A;  3A0H O;  1I6H I;  3G6E Z;  1Z02 A;  3QRC A;  2XE1 A;  2JIQ A;  4FT6 A;  2QR1 B;  3LK2 A;  1KRL A;  1YUA A;  4BBS I;  2F4O A;  4A3D I;  1QJP A;  4MON A;  3FQM A;  1RLY A;  3RBH A;  3GTQ I;  2Y0K A;  4O49 A;  1PFT A;  5DL8 A;  3VZW X;  4RV9 A;  3UPG A;  3LK2 B;  2YU9 I;  4K3C A;  3OW2 Z;  3CCU 1;  4FMS A;  2MNH A;  3SYB A;  4BXX I;  1YIJ 1;  1FDO A;  1H6S 1;  1QYP A;  3CC4 Z;  1M1K 1;  2Y0H A;  5KAI O;  2X9K A;  1VQ7 1;  3VY8 X;  1YIJ Z;  4MD8 A;  3GTO I;  3JAM f;  1E54 A;  1Q86 1;  3CCS 1;  3S16 I;  2F1V A;  3K19 A;  4QTU A;  1ZHX A;  1SIW A;  4FOZ A;  1K73 2;  3POR A;  4N74 A;  1ZB9 A;  4C69 X;  1VLA A;  1Q7Y 1;  4FZL A;  3NDJ A;  3CCJ 1;  2K5R A;  2R4N A;  2IWW A;  2QRC B;  1KC8 1;  1YHQ 1;  3I56 Z;  1WW9 A;  3GTG I;  4Y52 I;  3CCS Z;  3CCV Z;  1MPF A;  1VQM 1;  1VQ9 1;  1P4T A;  2R89 A;  3FYX A;  1KQS Z;  4AYD C;  1DL6 A;  2LEX A;  4LSE A;  3PQS A;  4A3C I;  1K9M 1;  4LSH A;  4E33 A;  3CCJ Z;  1YJN 1;  5D5D A;  4RS4 A;  3MZK B;  1Y1W I;  1KD1 1;  4QQ1 A;  3HOY I;  2NVY I;  1T1L A;  3NH8 A;  1ZHT A;  3CPW Y;  4AYE C;  2P3Y A;  1YIT 1;  4QTT A;  3KIF A;  4O3Z A;  5H2F O;  1Q9G A;  1YJN Z;  2O53 A;  2F1T A;  2VUG A;  2XTR A;  3AA7 A;  1VQK 1;  3TDH B;  2YAD A;  4RLC A;  1WJ2 A;  1YIT Z;  1I3Q I;  4DGL A;  4A3J I;  2KI7 B;  2XE2 A;  3KIH A;  4NBF A;  1W2B Z;  2E2J I;  3P5J B;  3AA7 B;  2ERV A;  3CCM 1;  2W81 C;  3MON A;  1NJI 2;  3AA0 A;  3G4S Z;  2FGR A;  5DL5 A;  3PRN A;  3PGR A;  2V8K A;  1VQ4 1;  4FES A;  3J7A 4;  3WI4 A;  3CC7 Z;  1X3Z A;  2E2H I;  3RZO I;  3CCM Z;  3BS0 A;  3BRY A;  3C5O A;  1MM5 A;  1VQ6 1;  5T5F A;  3AA0 B;  4A3M I;  1VQ5 1;  2JA6 I;  3KZI O;  2P28 A;  2JUB A;  1VQ4 Z;  4O3W A;  4PUX A;  4N75 A;  5G39 A;  4RVG A;  5KAF O;  1S7M A;  4RVD A;  1VQN Z;  1USP A;  4N58 A;  1NUI A;  4FRX A;  5G38 A;  2QEX 1;  4AYN A;  1QJ9 A;  3SZD A;  1X3W A;  1Q86 2;  2R4P A;  2GU2 A;  2PM9 A;  5T64 A;  1PHO A;  1QVG Y;  3DZM A;  1Q7Y 2;  3LUS A;  1QVF Y;  3RZD I;  3T20 A;  4FZM A;  3CC2 Z;  1USP B;  2OMF A;  1VQO 1;  2YPV A;  2QA4 1;  1KC8 2;  1Q16 A;  2QEX Z;  2RT9 A;  3G6E 1;  2K4T A;  3KVD D;  3S1M I;  3HKZ A;  2OTL 1;  5CM2 M;  2FGQ X;  3QWU A;  2M6N A;  2HU9 A;  3NDI A;  2V3V A;  1Z03 A;  1K9M 2;  2JMM A;  2XMX A;  3MZL B;  1VQP 1;  2E2I I;  2X27 X;  1M90 2;  2XE5 A;  4KRA A;  2KC0 A;  2OTL Z;  4DQY B;  4O3X B;  5IT9 f;  2DE6 A;  4AYB A;  1MM4 A;  2JNY A;  4A3E I;  1N8R 1;  5LL6 f;  1NJI 1;  3VTN A;  3F3F C;  3CPW Z;  3TZG A;  3WI5 A;  2R8A A;  4F4B A;  2DE7 A;  1VQP Z;  1YI2 1;  2EGT A;  3EMN X;  1ZHZ A;  3CC4 1;  1Q82 2;  1Z01 A;  3IX0 A;  3JAM b;  4C00 A;  4E1T A;  2QLV B;  4FSO A;  1VQL 1;  1GFP A;  4O3Y A;  4AYM C;  2ODJ A;  1YI2 Z;  4HGY A;  1RNI A;  2O4H A;  3T0S A;  3EER A;  3SYS A;  4GCS A;  2I3C A;  3S1Q I;  2NAP A;  2W04 A;  1YJW Z;  4NOZ A;  5AFU L;  1VQL Z;  5DL7 A;  4AKR A;  1N2F A;  5JDP A;  5PRN A;  3I55 Z;  3I56 1;  5T6B A;  2NVT I;  3CCV 1;  2R88 A;  4XNL A;  2K0L A;  1AA6 A;  4A93 I;  8PRN A;  2W80 C;  2JIR A;  4E30 A;  4AKR B;  3WU2 O;  3GTK I;  1THQ A;  3AAA A;  1TWG I;  2DE5 A;  5A2Q b;  2NVX I;  3HOE A;  4NBC A;  3VZU X;  3NH4 A;  2WJR A;  5AFU K;  3VMG A;  4HH4 A;  5C4X I;  2PMZ A;  3HOU I;  3GTP I;  3AAA B;  1LQL A;  1M90 1;  2M06 A;  2F4M A;  3PO2 I;  3U50 C;  1JWH C;  4A3F I;  2OOY B;  2Q51 A;  1QVG Z;  5C3E I;  3GTM S;  1QVF Z; 
#chains in the Genus database with same CATH homology
 2VF1 A;  4O4X A;  3EED A;  2M48 A;  5A2Q f;  2QRD B;  3CCE Z;  2QKD A;  3LK3 A;  1QF8 A;  1Q82 1;  1GFQ A;  3VMI A;  3S15 I;  1ZH1 A;  2LFU A;  1K8A 1;  1ZB8 A;  1QJ8 A;  4XX2 A;  3G4S 1;  1SFO I;  2IZ3 A;  4TNU A;  3VMH A;  1G90 A;  1HXU A;  3O0E A;  3LK3 B;  3CC7 1;  4NBH A;  3AA1 A;  4FUV A;  3CCL 1;  5G26 A;  1N8R 2;  2IZ4 A;  4GF4 A;  4LSI A;  3BG1 B;  4BBR I;  2ZLD A;  2KXP A;  2JMO A;  4NH1 C;  3S2D I;  4NB9 A;  2OTJ Z;  4NB8 A;  2N2L A;  4FSP A;  3POX A;  1VQN 1;  2QRE B;  3CCL Z;  3AA1 B;  4E32 A;  2JA8 I;  3HOL A;  3HOW I;  5DL6 A;  4RJW A;  5IP7 I;  3CCQ 1;  3FQQ A;  3IFU A;  2Y2X A;  2Q4Z A;  4EWC A;  2KXP B;  4U9C A;  4MH4 A;  3CCR Z;  2G2K A;  3CC2 1;  5ADX K;  1WCM I;  4A3B I;  3S14 I;  4MRI A;  1Y1V I;  4KR4 A;  3CCQ Z;  4AYI D;  1ZHY A;  4O4U A;  3J81 b;  4Y7N I;  2O4V A;  3PQU A;  3CMA Z;  2W03 A;  4MXU A;  5IT9 b;  4A3L I;  1GFN A;  3T24 A;  1BH3 A;  3HOX I;  1RQF A;  3J80 f;  4NBA A;  3SZV A;  3SY7 A;  2JR6 A;  2Y7S A;  2LIY A;  3S2H I;  3D9X A;  4Z3T A;  1K83 I;  3S1N I;  4AUI A;  4E2W A;  3J81 f;  2V8I A;  5IYU A;  3K7A I;  2OOX B;  3PO3 S;  1TWC I;  3S1R I;  1JJ2 Y;  1OPF A;  3ESW A;  2JA7 I;  1YJW 1;  4X6A I;  1K8A 2;  2VUM I;  1YS5 A;  4MD7 A;  4AZL A;  3G71 Z;  4MD9 A;  3FKI I;  4NBD A;  3CME Z;  3V8U A;  3I55 1;  4FZN A;  3LK4 1;  1YUK A;  3TE5 B;  1BT9 A;  3IF8 A;  2MHL A;  4KR8 A;  3GKQ A;  1Q81 1;  2OZK A;  3I4N I;  4DK1 A;  1TWA I;  4S1T A;  2Y0L A;  4NBE A;  2QTK A;  4GCQ A;  3HOZ I;  1IZN A;  3POU A;  4BY7 I;  3M4O I;  5D1O A;  7PRN A;  4GHB A;  3DA4 A;  2H85 A;  1ORM A;  3Q87 A;  2J1N A;  2R7Z I;  3T4N B;  1HXT A;  5T67 A;  4HGZ A;  3GTM I;  1IZN B;  4D65 A;  3HW9 A;  3QRA A;  3AA6 A;  3CCU Z;  5D1O B;  2N2M A;  4AFK A;  4NBB A;  3HOV I;  4A3I I;  3CCE 1;  2LHF A;  2ZFG A;  4A3K I;  2GE4 A;  2R93 I;  3A2S X;  5IP9 I;  4A3G I;  4NBG A;  1ZHW A;  3JTY A;  3CXC Y;  3AA6 B;  3VE2 A;  1VQ7 Z;  2WB1 A;  3GTJ I;  1RO4 A;  2J6A A;  3G7G A;  3DA3 A;  3UAQ A;  3VE1 A;  5EE2 A;  2KZ7 A;  4RVF A;  4B61 A;  2R92 I;  4GCP A;  4FRT A;  6PRN A;  4JCH A;  4E2Y A;  1ML8 A;  3H0G I;  3F3P C;  4RL9 A;  5D1P A;  1S72 1;  1TWH I;  1TWF I;  2JS4 A;  3SY9 A;  2KDY A;  3H3V J;  1YHQ Z;  2YNK A;  1WII A;  2OTJ 1;  2RPR A;  1VQM Z;  1VQ9 Z;  2KZ7 B;  5FLX b;  2NVQ I;  5ADX L;  2XE3 A;  2E9H A;  1GFO A;  1S72 Z;  1GFM A;  3CD6 1;  3S17 I;  2R6M A;  5GV0 A;  5AN9 F;  1JJ2 Z;  2XG6 A;  3OW2 Y;  4XNK A;  2JA5 I;  4BUM X;  2Y0S A;  3CCR 1;  2AKL A;  4RVH A;  4N59 A;  4D5U A;  2KPI A;  3CD6 Z;  1VQ8 1;  3LK4 2;  2RIQ A;  5FLX f;  2BJO A;  4AKM A;  1NP6 A;  4G76 A;  1VQK Z;  4LSF A;  3VZT X;  3J80 b;  3CMA 1;  1Q81 2;  2ZAE B;  3AAE A;  2POR A;  3UU2 A;  2WAQ A;  4E2X A;  1VQ8 Z;  2B63 I;  3D6W A;  4E2Z A;  1RO0 A;  2PRN A;  4E31 A;  1YJ9 1;  1I50 I;  1K73 1;  4RLB A;  1RO2 A;  1L1O C;  3CQZ I;  4BY1 I;  1BXW A;  3GP6 A;  3AAE B;  1TFI A;  5C44 I;  1OSM A;  3PO3 I;  3HWB A;  2HF1 A;  1KQS Y;  3GTL I;  3NH5 A;  1YJ9 Z;  2GTI A;  1M1K 2;  3I07 A;  2PK7 A;  1VQ6 Z;  2K3R A;  1HXX A;  1PRN A;  1VQ5 Z;  2RHB A;  3NFZ A;  3VB9 A;  3NSG A;  4G75 A;  3I4M I;  3VY9 X;  4RJX A;  2M07 A;  2GTH A;  4NFR A;  2XTQ A;  3BG0 B;  4D64 A;  3G71 1;  4JFB A;  1P9N A;  5FVN A;  5FLM I;  4CL1 A;  3CME 1;  3GCF A;  4E1S A;  5C4J I;  3CXC Z;  3M3Y I;  1X0T A;  1Y1V S;  2V8J A;  3POQ A;  2J4U P;  1W2B Y;  1VQO Z;  2QA4 Z;  2RBL A;  1R9T I;  1KD1 2;  1Q9F A;  3QRC A;  1I6H I;  3G6E Z;  1Z02 A;  2XE1 A;  4FT6 A;  2QR1 B;  3LK2 A;  1KRL A;  1YUA A;  4BBS I;  2F4O A;  4A3D I;  1QJP A;  4MON A;  3FQM A;  1RLY A;  3RBH A;  3GTQ I;  2Y0K A;  4O49 A;  1PFT A;  5DL8 A;  3VZW X;  4RV9 A;  3UPG A;  3LK2 B;  2YU9 I;  3OW2 Z;  3CCU 1;  4FMS A;  2MNH A;  3SYB A;  4BXX I;  1YIJ 1;  1H6S 1;  1QYP A;  3CC4 Z;  1M1K 1;  2Y0H A;  1VQ7 1;  3VY8 X;  1YIJ Z;  4MD8 A;  3GTO I;  3JAM f;  1E54 A;  1Q86 1;  3CCS 1;  3S16 I;  2F1V A;  3K19 A;  4QTU A;  1ZHX A;  4FOZ A;  1K73 2;  3POR A;  1ZB9 A;  4C69 X;  1VLA A;  1Q7Y 1;  4FZL A;  3NDJ A;  3CCJ 1;  2K5R A;  2QRC B;  1KC8 1;  1YHQ 1;  3I56 Z;  1WW9 A;  3GTG I;  4Y52 I;  3CCS Z;  3CCV Z;  1MPF A;  1VQM 1;  1VQ9 1;  1P4T A;  3FYX A;  4AYD C;  1KQS Z;  1DL6 A;  4LSE A;  3PQS A;  4A3C I;  1K9M 1;  4LSH A;  4E33 A;  3CCJ Z;  1YJN 1;  5D5D A;  4RS4 A;  3MZK B;  1Y1W I;  1KD1 1;  4QQ1 A;  3HOY I;  2NVY I;  3NH8 A;  1ZHT A;  3CPW Y;  4AYE C;  2P3Y A;  1YIT 1;  4QTT A;  3KIF A;  4O3Z A;  1Q9G A;  1YJN Z;  2O53 A;  2F1T A;  2VUG A;  2XTR A;  3AA7 A;  1VQK 1;  3TDH B;  2YAD A;  4RLC A;  1YIT Z;  1I3Q I;  4DGL A;  4A3J I;  2KI7 B;  2XE2 A;  3KIH A;  4NBF A;  1W2B Z;  2E2J I;  3P5J B;  3AA7 B;  2ERV A;  3CCM 1;  2W81 C;  3MON A;  1NJI 2;  3AA0 A;  3G4S Z;  2FGR A;  5DL5 A;  3PRN A;  2V8K A;  1VQ4 1;  4FES A;  3J7A 4;  3WI4 A;  3CC7 Z;  1X3Z A;  2E2H I;  3RZO I;  3CCM Z;  3C5O A;  1MM5 A;  1VQ6 1;  5T5F A;  3AA0 B;  4A3M I;  1VQ5 1;  2JA6 I;  2P28 A;  2JUB A;  1VQ4 Z;  4O3W A;  4PUX A;  4RVG A;  1S7M A;  4RVD A;  1VQN Z;  1USP A;  4N58 A;  1NUI A;  4FRX A;  2QEX 1;  4AYN A;  1QJ9 A;  3SZD A;  1X3W A;  1Q86 2;  2GU2 A;  2PM9 A;  5T64 A;  1PHO A;  1QVG Y;  1Q7Y 2;  3LUS A;  1QVF Y;  3RZD I;  3T20 A;  4FZM A;  3CC2 Z;  1USP B;  2OMF A;  1VQO 1;  2YPV A;  2QA4 1;  1KC8 2;  2QEX Z;  2RT9 A;  3G6E 1;  2K4T A;  3KVD D;  3S1M I;  3HKZ A;  2OTL 1;  5CM2 M;  2FGQ X;  3QWU A;  2M6N A;  2HU9 A;  3NDI A;  2JMM A;  1Z03 A;  1K9M 2;  2XMX A;  3MZL B;  1VQP 1;  2E2I I;  2X27 X;  1M90 2;  2XE5 A;  4KRA A;  2KC0 A;  2OTL Z;  4DQY B;  4O3X B;  5IT9 f;  2DE6 A;  4AYB A;  1MM4 A;  2JNY A;  4A3E I;  1N8R 1;  5LL6 f;  1NJI 1;  3VTN A;  3F3F C;  3CPW Z;  3TZG A;  3WI5 A;  4F4B A;  2DE7 A;  1VQP Z;  1YI2 1;  2EGT A;  3EMN X;  1ZHZ A;  3CC4 1;  1Q82 2;  1Z01 A;  3IX0 A;  3JAM b;  4E1T A;  2QLV B;  4FSO A;  1VQL 1;  1GFP A;  4O3Y A;  4AYM C;  2ODJ A;  1YI2 Z;  4HGY A;  1RNI A;  2O4H A;  3T0S A;  3EER A;  3SYS A;  4GCS A;  2I3C A;  3S1Q I;  2W04 A;  1YJW Z;  4NOZ A;  5AFU L;  1VQL Z;  5DL7 A;  4AKR A;  1N2F A;  5JDP A;  5PRN A;  3I55 Z;  3I56 1;  5T6B A;  2NVT I;  3CCV 1;  4XNL A;  2K0L A;  4A93 I;  8PRN A;  2W80 C;  4E30 A;  4AKR B;  3GTK I;  1THQ A;  3AAA A;  1TWG I;  2DE5 A;  5A2Q b;  2NVX I;  3HOE A;  4NBC A;  3VZU X;  3NH4 A;  5AFU K;  3VMG A;  4HH4 A;  5C4X I;  2PMZ A;  3HOU I;  3GTP I;  3AAA B;  1LQL A;  1M90 1;  2M06 A;  2F4M A;  3PO2 I;  3U50 C;  1JWH C;  4A3F I;  2OOY B;  2Q51 A;  1QVG Z;  5C3E I;  3GTM S;  1QVF Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...