2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Gna2132
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
4QQ1A 5EE2A 4AYID 3PQSA 3PQUA 2KC0A 3VE2A 4U9CA 4O3XB 4O3ZA 4AYMC 3HOLA 2W80C 4O3WA 3HOEA 3UAQA 4O4XA 4AYEC 4Z3TA 4AYDC 5T5FA 2W81C 3VE1A 1YS5A 2Y7SA 4O3YA 2KDYA 4AYNA 4O49A 2LFUA 2YPVA 3V8UA 3KVDD 4O4UA
chains in the Genus database with same CATH superfamily
3S1RI 3KZIO 1N2FA 3LK3B 2OZKA 3RBHA 1GFNA 2M07A 1VQ4Z 2XE3A 1QJ8A 4RLCA 2LHFA 3S2DI 3T24A 3OW2Y 3TE5B 4E32A 3HW9A 1YJN1 2RIQA 1ZHXA 1VQ7Z 4A3GI 1OPFA 3CCR1 2OTJZ 3PRNA 4O3WA 5E79O 1RLYA 3CPWY 3CXCY 1FDIA 4NBDA 2V8KA 1S721 2G2KA 4AYEC 2ERVA 5T5FA 5C4JI 2JA5I 2Y7SA 3A0HO 3PGUA 2YNKA 4N75A 3S1QI 3IF8A 3CC41 4GF4A 5ADXK 1Q822 2Y0KA 3S16I 1Y1WI 3CCLZ 1QF8A 3EMNX 1ORMA 2N2MA 3GTKI 1Q862 2M06A 4BUMX 4E2YA 1KQSZ 3HOVI 3DWNA 3WI5A 2P3YA 4DK1A 3PO3S 4X6AI 1VQL1 3GTPI 1PHOA 1ZHTA 4AYMC 1FDOA 3CCV1 1QXFA 3QWUA 1YI2Z 3FYXA 2IWWA 3CME1 3WI4A 1SIWA 4O4XA 3CCL1 1Q811 1G90A 1YS5A 4NB8A 2DE6A 2NVXI 3SY7A 2JQYA 5B5EO 3CCMZ 5IT9b 3T0SA 1VQLZ 3HKZA 1Q812 3GTGI 2WJRA 1VQPZ 3SZVA 3K7AI 3T4NB 3C5OA 1RNIA 3O0EA 3CCEZ 4K3CA 3I07A 5IYUA 3D2LA 2N2LA 4RVDA 3PQSA 4JCHA 5G39A 2PRNA 3FQMA 3LUSA 2R92I 2X27X 2X9KA 3LK2B 4NOZA 3S1MI 3CQZI 1YITZ 1Q861 2R93I 1ZHZA 2R7ZI 2J6AA 4XX2A 3F3PC 4FOZA 3UAQA 1VQP1 2PMZA 3RZOI 1YHQZ 1Y1VS 3CCSZ 3G6E1 3QRCA 4N74A 2E2HI 3JTYA 2E7ZA 4LSFA 3IFUA 1THQA 2PM9A 4HGZA 1KC81 1WIIA 4AYBA 2PK7A 4FSPA 3NJTA 5DL6A 4AKMA 1Q9FA 2Q4ZA 3NH4A 5DL7A 1LQLA 3DWOX 2HF1A 5IT9f 1QVGY 5A2Qb 2R4NA 3SYSA 4GCQA 4C4VB 2R4LA 3GTMI 3CCRZ 3AA7B 3CCS1 3NDJA 4E2XA 4MD9A 3AAAB 2QTKA 2Y0SA 3MONA 1VQ41 3VE1A 2B63I 4JFBA 2OTL1 2NVYI 4DQYB 3G71Z 4AZLA 1WZNA 1YIJ1 5AFUL 1ZHWA 2NVQI 2QRCB 4D64A 2Y2XA 1JJ2Z 2KXPB 5C44I 1E54A 2FGQX 3SZDA 2RHBA 1Q7Y2 4BBSI 2M48A 3I56Z 4AFKA 1K731 4O3XB 3PO3I 2IV2X 4MD8A 3VZWX 1S5LO 2F1CX 2QEXZ 3I4MI 4RJXA 1RO4A 4UB6O 1PRNA 4A3BI 1S7MA 1Z01A 3IR7A 4FQEA 2R8AA 4MD7A 3H3VJ 1VQ61 3I561 2OTLZ 3CCVZ 4FRTA 4A3KI 3CCM1 3CCJ1 2O4HA 2E9HA 1Q16A 1K8A1 1RO2A 4E33A 1GFOA 1GFPA 1MM5A 3CCU1 1GFMA 1T1LA 1RO0A 1L1OC 3DA4A 3AA0A 3PF1A 4C00A 4NBBA 4QTTA 3FKII 2QEX1 2GU2A 1Q7Y1 3CC4Z 2ODJA 4E30A 4G76A 2VPYA 1M902 5GV0A 2AKLA 3CC7Z 5G38A 4RJWA 3S17I 3TDHB 3VMIA 1JJ2Y 3GP6A 2LIYA 5T6BA 1QVFY 4BXXI 3JCUO 3KIHA 1YHQ1 3JAMf 1QVFZ 3U50C 3CCUZ 4AYID 4LSHA 2WB1A 4A3JI 3CMA1 1OSMA 3AA0B 5AFUK 4EWCA 3GTQI 3SYBA 1DL6A 1I50I 5IP7I 1TWCI 2RPRA 3MZLB 4FZNA 2RT9A 1QVGZ 1ZH1A 2WAQA 2F1VA 1P9NA 1KC82 4RL9A 6PRNA 3CC71 2QREB 5IP9I 2JNYA 4FZMA 4NBGA 2W03A 3P5JB 1YJ9Z 4LSEA 2KXPA 2Y0HA 4MXUA 4RVHA 2E2JI 3D6WA 3POXA 3TZGA 4AYDC 3CC21 3GTLI 4QQ1A 1KQSY 2O4VA 2Y0LA 2JIMA 3RZDI 5B66O 3J80f 3VMHA 4F4BA 5D1OB 1K8A2 5FLXf 2NVTI 3ESWA 1M1K2 4FSOA 2K0LA 5JDPA 2AYDA 2JIOA 2GTIA 3JAMb 1YJ91 4PR7A 3I55Z 1S72Z 5AN9F 2JUBA 4IL6O 3VZTX 4XNLA 3LK41 8PRNA 2XTRA 4A93I 5PRNA 2KDYA 2K5RA 3EEDA 1N8R2 4NBCA 5GTHO 1SFOI 3CCJZ 3PGSA 3CC2Z 4KRAA 4NFRA 3PQUA 2V45A 1VQ6Z 2XE1A 2VUMI 1MM4A 3POUA 2OMFA 2RBLA 3HOUI 3VMGA 3HOLA 1MPFA 4RVFA 5KAFO 5KAIO 1PFTA 2MHLA 4G75A 1YJWZ 3HWBA 1NJI1 3M3YI 5FLXb 4GCSA 3AA1A 2JMOA 2LEXA 3EERA 3J7A4 2ZLDA 2MNHA 3WU2O 1USPA 1VQ71 4TNUA 3S1NI 3GTJI 3PO2I 1IZNB 1X3WA 4NBAA 3BG0B 2KC0A 3NDIA 1Y1VI 3A2SX 3VE2A 2J4UP 2NAPA 3KIFA 2JA6I 3BRYA 3HOXI 1YUKA 4N58A 5ADXL 3GTOI 3CPWZ 3NH5A 3S2HI 3F3FC 2W80C 1P4TA 4A3CI 2KZ7A 4MH4A 1YJW1 1VQMZ 3QRAA 3Q87A 2JS4A 1VQ81 3DA3A 4DGLA 1VQ91 5T64A 2W81C 4A3LI 3CCQ1 3S14I 1USPB 1ML8A 4PJ0O 2OOYB 4KR4A 2V8IA 3KVDD 2EGTA 4S1TA 2KPIA 3DZMA 2JIRA 2VUGA 4QTUA 4FESA 5D5DA 4E1SA 2IZ3A 1KD11 3HOWI 1YI21 2VF1A 1NUIA 1TWGI 3CMEZ 1BXWA 1YUAA 1QJ9A 4PUXA 1TWFI 2F1TA 2FGRA 4NH1C 3CCE1 1WJ2A 2V8JA 3VY9X 3VTNA 2F4MA 3H0GI 4CL1A 2J1NA 2R88A 2M6NA 1JWHC 4KR8A 5FLMI 1NJI2 1ZHYA 1QYPA 3G711 2XE2A 4CTDA 1VQK1 7PRNA 4O49A 1RQFA 1I6HI 3LK2A 4Y52I 4AYNA 4A3DI 4C4VA 4A3II 3GCFA 1ZB9A 5LL6f 4GCPA 5G3AA 4A3MI 1VQOZ 1YIT1 4O3ZA 1Q821 4LSIA 3SY9A 1YJNZ 2YADA 2OOXB 3UU2A 3CXCZ 2OTJ1 2BJOA 2QA41 2JMMA 2V3VA 1X0TA 2QLVB 1ZB8A 2QKDA 1N8R1 3AAEA 3OW2Z 4FRXA 5D1OA 3LK42 4E1TA 3UPGA 4O3YA 2JA8I 1IZNA 1TWHI 1K9M1 2H85A 3PGRA 2YU9I 1HXUA 2P28A 3D9XA 2JIQA 2XE5A 3NSGA 1KRLA 4RVGA 4E2ZA 3VZUX 4GHBA 1GFQA 4NBHA 2KI7B 4N59A 3T20A 4NBEA 2Q51A 5C4XI 1VQO1 1M1K1 1BT9A 1Z03A 2DE7A 2K3RA 3AA7A 3AAAA 2DE5A 3BG1B 4A3EI 3POQA 1VQ5Z 2VPXA 4D65A 3NH8A 4RLBA 3G4SZ 1VQ8Z 1QJPA 5H2FO 1VQ9Z 2WJQA 4NBFA 2HU9A 1YIJZ 3GTMS 4AUIA 4FMSA 5G26A 5D1PA 3CCQZ 2XG6A 1I3QI 3J81b 4MONA 1VLAA 2ZAEB 2XTQA 1H6S1 2JA7I 5TISO 3M4OI 3NFZA 3LK3A 1HXXA 1WW9A 5T67A 3AAEB 5A2Qf 4BY7I 3HOEA 1VQ51 4MRIA 4HGYA 4Z3TA 1VQNZ 1T16A 1K9M2 2GE4A 2R4OA 3BS0A 3CMAZ 1TWAI 2KZ7B 2R89A 2R4PA 4NB9A 1M901 2O53A 4FUVA 4D5UA 2JR6A 5GTIO 3J81f 2LFUA 4C69X 4RS4A 1K732 5CM2M 5EE2A 4B61A 5FVNA 3FQQA 1VQN1 1Y8CA 1W2BZ 2F4OA 1AA6A 4BY1I 3G7GA 1VQKZ 2ZFGA 3IX0A 1TFIA 1K83I 2XMXA 3AA6A 2IZ4A 4AKRA 1VQM1 3HOYI 2WVPA 3I551 1Z02A 2VPZA 4HH4A 1NP6A 4FT6A 2GTHA 2E2II 2I3CA 4BBRI 3S15I 3AA6B 3BRZA 1X3ZA 3K19A 4Y7NI 3CD6Z 4FZLA 4K3BA 1HXTA 2YPVA 4O4UA 3VB9A 2QR1B 3G6EZ 1BH3A 2R6MA 2VPWA 1KD12 4U9CA 3VY8X 1W2BY 2QRDB 1Q9GA 3A0BO 2IWVA 2PORA 5DL5A 3MZKB 4UB8O 2JIPA 4RV9A 4E31A 5DL8A 3PORA 4E2WA 2W04A 2AXTO 5C3EI 3AA1B 3GKQA 3J80b 3G4S1 4A3FI 3HOZI 2K4TA 3I4NI 1WCMI 3CD61 4AKRB 1R9TI 3V8UA 4XNKA 2QA4Z
chains in the Genus database with same CATH topology
3S1RI 1N2FA 3LK3B 2OZKA 3RBHA 1GFNA 2M07A 1VQ4Z 2XE3A 1QJ8A 4RLCA 2LHFA 3S2DI 3T24A 3OW2Y 3TE5B 4E32A 3HW9A 1YJN1 2RIQA 1ZHXA 1VQ7Z 4A3GI 1OPFA 3CCR1 2OTJZ 3PRNA 4O3WA 1RLYA 3CPWY 3CXCY 4NBDA 1S721 2V8KA 2G2KA 4AYEC 2ERVA 5T5FA 5C4JI 2JA5I 2Y7SA 2YNKA 3S1QI 3IF8A 3CC41 4GF4A 5ADXK 1Q822 2Y0KA 3S16I 1Y1WI 3CCLZ 1QF8A 3EMNX 1ORMA 2N2MA 3GTKI 1Q862 2M06A 4BUMX 4E2YA 1KQSZ 3HOVI 3WI5A 2P3YA 4DK1A 3PO3S 4X6AI 1VQL1 3GTPI 1PHOA 1ZHTA 4AYMC 3CCV1 3QWUA 1YI2Z 3FYXA 3CME1 3WI4A 4O4XA 3CCL1 1Q811 1G90A 1YS5A 4NB8A 2DE6A 2NVXI 3SY7A 3CCMZ 5IT9b 3T0SA 1VQLZ 3HKZA 1Q812 3GTGI 1VQPZ 3SZVA 3K7AI 3T4NB 3C5OA 1RNIA 3O0EA 3CCEZ 3I07A 5IYUA 2N2LA 4RVDA 3PQSA 4JCHA 2PRNA 3FQMA 3LUSA 2R92I 2X27X 3LK2B 4NOZA 3S1MI 3CQZI 1YITZ 1Q861 2R93I 1ZHZA 2R7ZI 2J6AA 4XX2A 3F3PC 4FOZA 3UAQA 1VQP1 2PMZA 3RZOI 1YHQZ 1Y1VS 3CCSZ 3G6E1 3QRCA 2E2HI 3JTYA 4LSFA 3IFUA 1THQA 2PM9A 4HGZA 1KC81 1WIIA 4AYBA 2PK7A 4FSPA 5DL6A 4AKMA 1Q9FA 2Q4ZA 3NH4A 5DL7A 1LQLA 2HF1A 5IT9f 1QVGY 5A2Qb 3SYSA 4GCQA 3GTMI 3CCRZ 3AA7B 3CCS1 3NDJA 4E2XA 4MD9A 3AAAB 2QTKA 2Y0SA 3MONA 1VQ41 3VE1A 2B63I 4JFBA 2OTL1 2NVYI 4DQYB 3G71Z 4AZLA 1YIJ1 5AFUL 1ZHWA 2NVQI 2QRCB 4D64A 2Y2XA 1JJ2Z 2KXPB 5C44I 1E54A 2FGQX 3SZDA 1Q7Y2 2RHBA 4BBSI 2M48A 3I56Z 4AFKA 1K731 4O3XB 3PO3I 4MD8A 3VZWX 4RJXA 2QEXZ 3I4MI 1RO4A 1PRNA 4A3BI 1S7MA 1Z01A 4MD7A 3H3VJ 1VQ61 3I561 2OTLZ 3CCVZ 4FRTA 4A3KI 3CCM1 3CCJ1 2O4HA 2E9HA 1K8A1 1RO2A 4E33A 1GFOA 1GFPA 1MM5A 3CCU1 1GFMA 1RO0A 1L1OC 3DA4A 3AA0A 4NBBA 4QTTA 3FKII 2QEX1 2GU2A 1Q7Y1 3CC4Z 2ODJA 4E30A 4G76A 1M902 5GV0A 2AKLA 3CC7Z 4RJWA 3S17I 3TDHB 3VMIA 1JJ2Y 3GP6A 2LIYA 5T6BA 1QVFY 4BXXI 3KIHA 1YHQ1 3JAMf 1QVFZ 3U50C 3CCUZ 4AYID 4LSHA 2WB1A 4A3JI 3CMA1 1OSMA 3AA0B 5AFUK 4EWCA 3GTQI 3SYBA 1DL6A 1I50I 5IP7I 1TWCI 2RPRA 3MZLB 4FZNA 2RT9A 1QVGZ 1ZH1A 2WAQA 2F1VA 1P9NA 1KC82 4RL9A 6PRNA 3CC71 2QREB 5IP9I 2JNYA 4FZMA 4NBGA 2W03A 3P5JB 1YJ9Z 4LSEA 2KXPA 2Y0HA 4MXUA 4RVHA 2E2JI 3D6WA 3POXA 3TZGA 4AYDC 3CC21 3GTLI 4QQ1A 1KQSY 2O4VA 2Y0LA 3RZDI 3J80f 3VMHA 4F4BA 5D1OB 1K8A2 5FLXf 2NVTI 3ESWA 1M1K2 4FSOA 2K0LA 5JDPA 2GTIA 3JAMb 1YJ91 3I55Z 1S72Z 5AN9F 2JUBA 3VZTX 4XNLA 3LK41 8PRNA 2XTRA 4A93I 5PRNA 2KDYA 2K5RA 3EEDA 1N8R2 4NBCA 1SFOI 3CCJZ 3CC2Z 4KRAA 4NFRA 3PQUA 1VQ6Z 2XE1A 2VUMI 1MM4A 3POUA 2OMFA 2RBLA 3HOUI 3VMGA 3HOLA 1MPFA 4RVFA 1PFTA 2MHLA 4G75A 1YJWZ 3HWBA 1NJI1 3M3YI 5FLXb 4GCSA 3AA1A 2JMOA 2ZLDA 3EERA 3J7A4 2MNHA 1USPA 1VQ71 4TNUA 3S1NI 3GTJI 3PO2I 1IZNB 1X3WA 4NBAA 3BG0B 2KC0A 3NDIA 1Y1VI 3A2SX 3VE2A 2J4UP 3KIFA 2JA6I 3HOXI 1YUKA 4N58A 5ADXL 3GTOI 3CPWZ 3NH5A 3S2HI 3F3FC 2W80C 1P4TA 4A3CI 2KZ7A 4MH4A 1YJW1 1VQMZ 3QRAA 3Q87A 2JS4A 1VQ81 3DA3A 4DGLA 1VQ91 5T64A 2W81C 4A3LI 3CCQ1 3S14I 1USPB 1ML8A 2OOYB 4KR4A 2V8IA 3KVDD 2EGTA 4S1TA 2KPIA 2VUGA 4QTUA 4FESA 5D5DA 4E1SA 2IZ3A 1KD11 3HOWI 1YI21 2VF1A 1NUIA 1TWGI 3CMEZ 1BXWA 1YUAA 1QJ9A 4PUXA 1TWFI 2F1TA 2FGRA 4NH1C 3CCE1 2V8JA 3VY9X 3VTNA 2F4MA 3H0GI 4CL1A 2J1NA 2M6NA 1JWHC 4KR8A 5FLMI 1NJI2 1ZHYA 1QYPA 3G711 2XE2A 7PRNA 1VQK1 4O49A 1RQFA 1I6HI 3LK2A 4Y52I 4AYNA 4A3DI 4A3II 3GCFA 1ZB9A 5LL6f 4GCPA 4A3MI 1VQOZ 1YIT1 4O3ZA 1Q821 4LSIA 3SY9A 1YJNZ 2YADA 2OOXB 3UU2A 3CXCZ 2OTJ1 2BJOA 2QA41 2JMMA 1X0TA 2QLVB 1ZB8A 2QKDA 1N8R1 3AAEA 3OW2Z 4FRXA 5D1OA 3LK42 4E1TA 3UPGA 4O3YA 2JA8I 1IZNA 1TWHI 1K9M1 2H85A 2YU9I 1HXUA 2P28A 3D9XA 2XE5A 3NSGA 3VZUX 1KRLA 4RVGA 4E2ZA 4GHBA 1GFQA 4NBHA 2KI7B 4N59A 3T20A 4NBEA 2Q51A 5C4XI 1VQO1 1M1K1 1BT9A 1Z03A 2DE7A 2K3RA 3AA7A 3AAAA 2DE5A 3BG1B 4A3EI 3POQA 1VQ5Z 4D65A 3NH8A 4RLBA 3G4SZ 1VQ8Z 1QJPA 1VQ9Z 4NBFA 2HU9A 1YIJZ 3GTMS 4AUIA 4FMSA 5G26A 5D1PA 3CCQZ 2XG6A 1I3QI 3J81b 4MONA 1VLAA 2ZAEB 2XTQA 1H6S1 2JA7I 3M4OI 3NFZA 3LK3A 1HXXA 1WW9A 5T67A 3AAEB 5A2Qf 4BY7I 3HOEA 1VQ51 4MRIA 4HGYA 4Z3TA 1VQNZ 1K9M2 2GE4A 3CMAZ 1TWAI 2KZ7B 4NB9A 1M901 2O53A 4FUVA 4D5UA 2JR6A 3J81f 2LFUA 4C69X 4RS4A 1K732 5CM2M 5EE2A 4B61A 5FVNA 3FQQA 1VQN1 1W2BZ 2F4OA 4BY1I 3G7GA 1VQKZ 2ZFGA 3IX0A 1TFIA 1K83I 2XMXA 3AA6A 2IZ4A 4AKRA 1VQM1 3HOYI 3I551 1Z02A 4HH4A 1NP6A 4FT6A 2GTHA 2E2II 2I3CA 4BBRI 3S15I 3AA6B 1X3ZA 3K19A 4Y7NI 3CD6Z 4FZLA 1HXTA 2YPVA 4O4UA 3VB9A 2QR1B 3G6EZ 1BH3A 2R6MA 1KD12 4U9CA 3VY8X 1W2BY 2QRDB 1Q9GA 2PORA 5DL5A 3MZKB 4RV9A 4E31A 5DL8A 3PORA 4E2WA 2W04A 5C3EI 3AA1B 3GKQA 3J80b 3G4S1 4A3FI 3HOZI 2K4TA 3I4NI 1WCMI 3CD61 4AKRB 1R9TI 3V8UA 4XNKA 2QA4Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ1 A;  5EE2 A;  4AYI D;  3PQS A;  3PQU A;  2KC0 A;  3VE2 A;  4U9C A;  4O3X B;  4O3Z A;  4AYM C;  3HOL A;  2W80 C;  4O3W A;  3HOE A;  3UAQ A;  4O4X A;  4AYE C;  4Z3T A;  4AYD C;  5T5F A;  2W81 C;  3VE1 A;  1YS5 A;  2Y7S A;  4O3Y A;  2KDY A;  4AYN A;  4O49 A;  2LFU A;  2YPV A;  3V8U A;  3KVD D;  4O4U A; 
#chains in the Genus database with same CATH topology
 3S1R I;  3KZI O;  1N2F A;  3LK3 B;  2OZK A;  3RBH A;  1GFN A;  2M07 A;  1VQ4 Z;  2XE3 A;  1QJ8 A;  4RLC A;  2LHF A;  3S2D I;  3T24 A;  3OW2 Y;  3TE5 B;  4E32 A;  3HW9 A;  1YJN 1;  2RIQ A;  1ZHX A;  1VQ7 Z;  4A3G I;  1OPF A;  3CCR 1;  2OTJ Z;  3PRN A;  4O3W A;  5E79 O;  1RLY A;  3CPW Y;  3CXC Y;  1FDI A;  4NBD A;  2V8K A;  1S72 1;  2G2K A;  4AYE C;  2ERV A;  5T5F A;  5C4J I;  2JA5 I;  2Y7S A;  3A0H O;  3PGU A;  2YNK A;  4N75 A;  3S1Q I;  3IF8 A;  3CC4 1;  4GF4 A;  5ADX K;  1Q82 2;  2Y0K A;  3S16 I;  1Y1W I;  3CCL Z;  1QF8 A;  3EMN X;  1ORM A;  2N2M A;  3GTK I;  1Q86 2;  2M06 A;  4BUM X;  4E2Y A;  1KQS Z;  3HOV I;  3DWN A;  3WI5 A;  2P3Y A;  4DK1 A;  3PO3 S;  4X6A I;  1VQL 1;  3GTP I;  1PHO A;  1ZHT A;  4AYM C;  1FDO A;  3CCV 1;  1QXF A;  3QWU A;  1YI2 Z;  3FYX A;  2IWW A;  3CME 1;  3WI4 A;  1SIW A;  4O4X A;  3CCL 1;  1Q81 1;  1G90 A;  1YS5 A;  4NB8 A;  2DE6 A;  2NVX I;  3SY7 A;  2JQY A;  5B5E O;  3CCM Z;  5IT9 b;  3T0S A;  1VQL Z;  3HKZ A;  1Q81 2;  3GTG I;  2WJR A;  1VQP Z;  3SZV A;  3K7A I;  3T4N B;  3C5O A;  1RNI A;  3O0E A;  3CCE Z;  4K3C A;  3I07 A;  5IYU A;  3D2L A;  2N2L A;  4RVD A;  3PQS A;  4JCH A;  5G39 A;  2PRN A;  3FQM A;  3LUS A;  2R92 I;  2X27 X;  2X9K A;  3LK2 B;  4NOZ A;  3S1M I;  3CQZ I;  1YIT Z;  1Q86 1;  2R93 I;  1ZHZ A;  2R7Z I;  2J6A A;  4XX2 A;  3F3P C;  4FOZ A;  3UAQ A;  1VQP 1;  2PMZ A;  3RZO I;  1YHQ Z;  1Y1V S;  3CCS Z;  3G6E 1;  3QRC A;  4N74 A;  2E2H I;  3JTY A;  2E7Z A;  4LSF A;  3IFU A;  1THQ A;  2PM9 A;  4HGZ A;  1KC8 1;  1WII A;  4AYB A;  2PK7 A;  4FSP A;  3NJT A;  5DL6 A;  4AKM A;  1Q9F A;  2Q4Z A;  3NH4 A;  5DL7 A;  1LQL A;  3DWO X;  2HF1 A;  5IT9 f;  1QVG Y;  5A2Q b;  2R4N A;  3SYS A;  4GCQ A;  4C4V B;  2R4L A;  3GTM I;  3CCR Z;  3AA7 B;  3CCS 1;  3NDJ A;  4E2X A;  4MD9 A;  3AAA B;  2QTK A;  2Y0S A;  3MON A;  1VQ4 1;  3VE1 A;  2B63 I;  4JFB A;  2OTL 1;  2NVY I;  4DQY B;  3G71 Z;  4AZL A;  1WZN A;  1YIJ 1;  5AFU L;  1ZHW A;  2NVQ I;  2QRC B;  4D64 A;  2Y2X A;  1JJ2 Z;  2KXP B;  5C44 I;  1E54 A;  2FGQ X;  3SZD A;  2RHB A;  1Q7Y 2;  4BBS I;  2M48 A;  3I56 Z;  4AFK A;  1K73 1;  4O3X B;  3PO3 I;  2IV2 X;  4MD8 A;  3VZW X;  1S5L O;  2F1C X;  2QEX Z;  3I4M I;  4RJX A;  1RO4 A;  4UB6 O;  1PRN A;  4A3B I;  1S7M A;  1Z01 A;  3IR7 A;  4FQE A;  2R8A A;  4MD7 A;  3H3V J;  1VQ6 1;  3I56 1;  2OTL Z;  3CCV Z;  4FRT A;  4A3K I;  3CCM 1;  3CCJ 1;  2O4H A;  2E9H A;  1Q16 A;  1K8A 1;  1RO2 A;  4E33 A;  1GFO A;  1GFP A;  1MM5 A;  3CCU 1;  1GFM A;  1T1L A;  1RO0 A;  1L1O C;  3DA4 A;  3AA0 A;  3PF1 A;  4C00 A;  4NBB A;  4QTT A;  3FKI I;  2QEX 1;  2GU2 A;  1Q7Y 1;  3CC4 Z;  2ODJ A;  4E30 A;  4G76 A;  2VPY A;  1M90 2;  5GV0 A;  2AKL A;  3CC7 Z;  5G38 A;  4RJW A;  3S17 I;  3TDH B;  3VMI A;  1JJ2 Y;  3GP6 A;  2LIY A;  5T6B A;  1QVF Y;  4BXX I;  3JCU O;  3KIH A;  1YHQ 1;  3JAM f;  1QVF Z;  3U50 C;  3CCU Z;  4AYI D;  4LSH A;  2WB1 A;  4A3J I;  3CMA 1;  1OSM A;  3AA0 B;  5AFU K;  4EWC A;  3GTQ I;  3SYB A;  1DL6 A;  1I50 I;  5IP7 I;  1TWC I;  2RPR A;  3MZL B;  4FZN A;  2RT9 A;  1QVG Z;  1ZH1 A;  2WAQ A;  2F1V A;  1P9N A;  1KC8 2;  4RL9 A;  6PRN A;  3CC7 1;  2QRE B;  5IP9 I;  2JNY A;  4FZM A;  4NBG A;  2W03 A;  3P5J B;  1YJ9 Z;  4LSE A;  2KXP A;  2Y0H A;  4MXU A;  4RVH A;  2E2J I;  3D6W A;  3POX A;  3TZG A;  4AYD C;  3CC2 1;  3GTL I;  4QQ1 A;  1KQS Y;  2O4V A;  2Y0L A;  2JIM A;  3RZD I;  5B66 O;  3J80 f;  3VMH A;  4F4B A;  5D1O B;  1K8A 2;  5FLX f;  2NVT I;  3ESW A;  1M1K 2;  4FSO A;  2K0L A;  5JDP A;  2AYD A;  2JIO A;  2GTI A;  3JAM b;  1YJ9 1;  4PR7 A;  3I55 Z;  1S72 Z;  5AN9 F;  2JUB A;  4IL6 O;  3VZT X;  4XNL A;  3LK4 1;  8PRN A;  2XTR A;  4A93 I;  5PRN A;  2KDY A;  2K5R A;  3EED A;  1N8R 2;  4NBC A;  5GTH O;  1SFO I;  3CCJ Z;  3PGS A;  3CC2 Z;  4KRA A;  4NFR A;  3PQU A;  2V45 A;  1VQ6 Z;  2XE1 A;  2VUM I;  1MM4 A;  3POU A;  2OMF A;  2RBL A;  3HOU I;  3VMG A;  3HOL A;  1MPF A;  4RVF A;  5KAF O;  5KAI O;  1PFT A;  2MHL A;  4G75 A;  1YJW Z;  3HWB A;  1NJI 1;  3M3Y I;  5FLX b;  4GCS A;  3AA1 A;  2JMO A;  2LEX A;  3EER A;  3J7A 4;  2ZLD A;  2MNH A;  3WU2 O;  1USP A;  1VQ7 1;  4TNU A;  3S1N I;  3GTJ I;  3PO2 I;  1IZN B;  1X3W A;  4NBA A;  3BG0 B;  2KC0 A;  3NDI A;  1Y1V I;  3A2S X;  3VE2 A;  2J4U P;  2NAP A;  3KIF A;  2JA6 I;  3BRY A;  3HOX I;  1YUK A;  4N58 A;  5ADX L;  3GTO I;  3CPW Z;  3NH5 A;  3S2H I;  3F3F C;  2W80 C;  1P4T A;  4A3C I;  2KZ7 A;  4MH4 A;  1YJW 1;  1VQM Z;  3QRA A;  3Q87 A;  2JS4 A;  1VQ8 1;  3DA3 A;  4DGL A;  1VQ9 1;  5T64 A;  2W81 C;  4A3L I;  3CCQ 1;  3S14 I;  1USP B;  1ML8 A;  4PJ0 O;  2OOY B;  4KR4 A;  2V8I A;  3KVD D;  2EGT A;  4S1T A;  2KPI A;  3DZM A;  2JIR A;  2VUG A;  4QTU A;  4FES A;  5D5D A;  4E1S A;  2IZ3 A;  1KD1 1;  3HOW I;  1YI2 1;  2VF1 A;  1NUI A;  1TWG I;  3CME Z;  1BXW A;  1YUA A;  1QJ9 A;  4PUX A;  1TWF I;  2F1T A;  2FGR A;  4NH1 C;  3CCE 1;  1WJ2 A;  2V8J A;  3VY9 X;  3VTN A;  2F4M A;  3H0G I;  4CL1 A;  2J1N A;  2R88 A;  2M6N A;  1JWH C;  4KR8 A;  5FLM I;  1NJI 2;  1ZHY A;  1QYP A;  3G71 1;  2XE2 A;  4CTD A;  1VQK 1;  7PRN A;  4O49 A;  1RQF A;  1I6H I;  3LK2 A;  4Y52 I;  4AYN A;  4A3D I;  4C4V A;  4A3I I;  3GCF A;  1ZB9 A;  5LL6 f;  4GCP A;  5G3A A;  4A3M I;  1VQO Z;  1YIT 1;  4O3Z A;  1Q82 1;  4LSI A;  3SY9 A;  1YJN Z;  2YAD A;  2OOX B;  3UU2 A;  3CXC Z;  2OTJ 1;  2BJO A;  2QA4 1;  2JMM A;  2V3V A;  1X0T A;  2QLV B;  1ZB8 A;  2QKD A;  1N8R 1;  3AAE A;  3OW2 Z;  4FRX A;  5D1O A;  3LK4 2;  4E1T A;  3UPG A;  4O3Y A;  2JA8 I;  1IZN A;  1TWH I;  1K9M 1;  2H85 A;  3PGR A;  2YU9 I;  1HXU A;  2P28 A;  3D9X A;  2JIQ A;  2XE5 A;  3NSG A;  1KRL A;  4RVG A;  4E2Z A;  3VZU X;  4GHB A;  1GFQ A;  4NBH A;  2KI7 B;  4N59 A;  3T20 A;  4NBE A;  2Q51 A;  5C4X I;  1VQO 1;  1M1K 1;  1BT9 A;  1Z03 A;  2DE7 A;  2K3R A;  3AA7 A;  3AAA A;  2DE5 A;  3BG1 B;  4A3E I;  3POQ A;  1VQ5 Z;  2VPX A;  4D65 A;  3NH8 A;  4RLB A;  3G4S Z;  1VQ8 Z;  1QJP A;  5H2F O;  1VQ9 Z;  2WJQ A;  4NBF A;  2HU9 A;  1YIJ Z;  3GTM S;  4AUI A;  4FMS A;  5G26 A;  5D1P A;  3CCQ Z;  2XG6 A;  1I3Q I;  3J81 b;  4MON A;  1VLA A;  2ZAE B;  2XTQ A;  1H6S 1;  2JA7 I;  5TIS O;  3M4O I;  3NFZ A;  3LK3 A;  1HXX A;  1WW9 A;  5T67 A;  3AAE B;  5A2Q f;  4BY7 I;  3HOE A;  1VQ5 1;  4MRI A;  4HGY A;  4Z3T A;  1VQN Z;  1T16 A;  1K9M 2;  2GE4 A;  2R4O A;  3BS0 A;  3CMA Z;  1TWA I;  2KZ7 B;  2R89 A;  2R4P A;  4NB9 A;  1M90 1;  2O53 A;  4FUV A;  4D5U A;  2JR6 A;  5GTI O;  3J81 f;  2LFU A;  4C69 X;  4RS4 A;  1K73 2;  5CM2 M;  5EE2 A;  4B61 A;  5FVN A;  3FQQ A;  1VQN 1;  1Y8C A;  1W2B Z;  2F4O A;  1AA6 A;  4BY1 I;  3G7G A;  1VQK Z;  2ZFG A;  3IX0 A;  1TFI A;  1K83 I;  2XMX A;  3AA6 A;  2IZ4 A;  4AKR A;  1VQM 1;  3HOY I;  2WVP A;  3I55 1;  1Z02 A;  2VPZ A;  4HH4 A;  1NP6 A;  4FT6 A;  2GTH A;  2E2I I;  2I3C A;  4BBR I;  3S15 I;  3AA6 B;  3BRZ A;  1X3Z A;  3K19 A;  4Y7N I;  3CD6 Z;  4FZL A;  4K3B A;  1HXT A;  2YPV A;  4O4U A;  3VB9 A;  2QR1 B;  3G6E Z;  1BH3 A;  2R6M A;  2VPW A;  1KD1 2;  4U9C A;  3VY8 X;  1W2B Y;  2QRD B;  1Q9G A;  3A0B O;  2IWV A;  2POR A;  5DL5 A;  3MZK B;  4UB8 O;  2JIP A;  4RV9 A;  4E31 A;  5DL8 A;  3POR A;  4E2W A;  2W04 A;  2AXT O;  5C3E I;  3AA1 B;  3GKQ A;  3J80 b;  3G4S 1;  4A3F I;  3HOZ I;  2K4T A;  3I4N I;  1WCM I;  3CD6 1;  4AKR B;  1R9T I;  3V8U A;  4XNK A;  2QA4 Z; 
#chains in the Genus database with same CATH homology
 3S1R I;  1N2F A;  3LK3 B;  2OZK A;  3RBH A;  1GFN A;  2M07 A;  1VQ4 Z;  2XE3 A;  1QJ8 A;  4RLC A;  2LHF A;  3S2D I;  3T24 A;  3OW2 Y;  3TE5 B;  4E32 A;  3HW9 A;  1YJN 1;  2RIQ A;  1ZHX A;  1VQ7 Z;  4A3G I;  1OPF A;  3CCR 1;  2OTJ Z;  3PRN A;  4O3W A;  1RLY A;  3CPW Y;  3CXC Y;  4NBD A;  1S72 1;  2V8K A;  2G2K A;  4AYE C;  2ERV A;  5T5F A;  5C4J I;  2JA5 I;  2Y7S A;  2YNK A;  3S1Q I;  3IF8 A;  3CC4 1;  4GF4 A;  5ADX K;  1Q82 2;  2Y0K A;  3S16 I;  1Y1W I;  3CCL Z;  1QF8 A;  3EMN X;  1ORM A;  2N2M A;  3GTK I;  1Q86 2;  2M06 A;  4BUM X;  4E2Y A;  1KQS Z;  3HOV I;  3WI5 A;  2P3Y A;  4DK1 A;  3PO3 S;  4X6A I;  1VQL 1;  3GTP I;  1PHO A;  1ZHT A;  4AYM C;  3CCV 1;  3QWU A;  1YI2 Z;  3FYX A;  3CME 1;  3WI4 A;  4O4X A;  3CCL 1;  1Q81 1;  1G90 A;  1YS5 A;  4NB8 A;  2DE6 A;  2NVX I;  3SY7 A;  3CCM Z;  5IT9 b;  3T0S A;  1VQL Z;  3HKZ A;  1Q81 2;  3GTG I;  1VQP Z;  3SZV A;  3K7A I;  3T4N B;  3C5O A;  1RNI A;  3O0E A;  3CCE Z;  3I07 A;  5IYU A;  2N2L A;  4RVD A;  3PQS A;  4JCH A;  2PRN A;  3FQM A;  3LUS A;  2R92 I;  2X27 X;  3LK2 B;  4NOZ A;  3S1M I;  3CQZ I;  1YIT Z;  1Q86 1;  2R93 I;  1ZHZ A;  2R7Z I;  2J6A A;  4XX2 A;  3F3P C;  4FOZ A;  3UAQ A;  1VQP 1;  2PMZ A;  3RZO I;  1YHQ Z;  1Y1V S;  3CCS Z;  3G6E 1;  3QRC A;  2E2H I;  3JTY A;  4LSF A;  3IFU A;  1THQ A;  2PM9 A;  4HGZ A;  1KC8 1;  1WII A;  4AYB A;  2PK7 A;  4FSP A;  5DL6 A;  4AKM A;  1Q9F A;  2Q4Z A;  3NH4 A;  5DL7 A;  1LQL A;  2HF1 A;  5IT9 f;  1QVG Y;  5A2Q b;  3SYS A;  4GCQ A;  3GTM I;  3CCR Z;  3AA7 B;  3CCS 1;  3NDJ A;  4E2X A;  4MD9 A;  3AAA B;  2QTK A;  2Y0S A;  3MON A;  1VQ4 1;  3VE1 A;  2B63 I;  4JFB A;  2OTL 1;  2NVY I;  4DQY B;  3G71 Z;  4AZL A;  1YIJ 1;  5AFU L;  1ZHW A;  2NVQ I;  2QRC B;  4D64 A;  2Y2X A;  1JJ2 Z;  2KXP B;  5C44 I;  1E54 A;  2FGQ X;  3SZD A;  1Q7Y 2;  2RHB A;  4BBS I;  2M48 A;  3I56 Z;  4AFK A;  1K73 1;  4O3X B;  3PO3 I;  4MD8 A;  3VZW X;  4RJX A;  2QEX Z;  3I4M I;  1RO4 A;  1PRN A;  4A3B I;  1S7M A;  1Z01 A;  4MD7 A;  3H3V J;  1VQ6 1;  3I56 1;  2OTL Z;  3CCV Z;  4FRT A;  4A3K I;  3CCM 1;  3CCJ 1;  2O4H A;  2E9H A;  1K8A 1;  1RO2 A;  4E33 A;  1GFO A;  1GFP A;  1MM5 A;  3CCU 1;  1GFM A;  1RO0 A;  1L1O C;  3DA4 A;  3AA0 A;  4NBB A;  4QTT A;  3FKI I;  2QEX 1;  2GU2 A;  1Q7Y 1;  3CC4 Z;  2ODJ A;  4E30 A;  4G76 A;  1M90 2;  5GV0 A;  2AKL A;  3CC7 Z;  4RJW A;  3S17 I;  3TDH B;  3VMI A;  1JJ2 Y;  3GP6 A;  2LIY A;  5T6B A;  1QVF Y;  4BXX I;  3KIH A;  1YHQ 1;  3JAM f;  1QVF Z;  3U50 C;  3CCU Z;  4AYI D;  4LSH A;  2WB1 A;  4A3J I;  3CMA 1;  1OSM A;  3AA0 B;  5AFU K;  4EWC A;  3GTQ I;  3SYB A;  1DL6 A;  1I50 I;  5IP7 I;  1TWC I;  2RPR A;  3MZL B;  4FZN A;  2RT9 A;  1QVG Z;  1ZH1 A;  2WAQ A;  2F1V A;  1P9N A;  1KC8 2;  4RL9 A;  6PRN A;  3CC7 1;  2QRE B;  5IP9 I;  2JNY A;  4FZM A;  4NBG A;  2W03 A;  3P5J B;  1YJ9 Z;  4LSE A;  2KXP A;  2Y0H A;  4MXU A;  4RVH A;  2E2J I;  3D6W A;  3POX A;  3TZG A;  4AYD C;  3CC2 1;  3GTL I;  4QQ1 A;  1KQS Y;  2O4V A;  2Y0L A;  3RZD I;  3J80 f;  3VMH A;  4F4B A;  5D1O B;  1K8A 2;  5FLX f;  2NVT I;  3ESW A;  1M1K 2;  4FSO A;  2K0L A;  5JDP A;  2GTI A;  3JAM b;  1YJ9 1;  3I55 Z;  1S72 Z;  5AN9 F;  2JUB A;  3VZT X;  4XNL A;  3LK4 1;  8PRN A;  2XTR A;  4A93 I;  5PRN A;  2KDY A;  2K5R A;  3EED A;  1N8R 2;  4NBC A;  1SFO I;  3CCJ Z;  3CC2 Z;  4KRA A;  4NFR A;  3PQU A;  1VQ6 Z;  2XE1 A;  2VUM I;  1MM4 A;  3POU A;  2OMF A;  2RBL A;  3HOU I;  3VMG A;  3HOL A;  1MPF A;  4RVF A;  1PFT A;  2MHL A;  4G75 A;  1YJW Z;  3HWB A;  1NJI 1;  3M3Y I;  5FLX b;  4GCS A;  3AA1 A;  2JMO A;  2ZLD A;  3EER A;  3J7A 4;  2MNH A;  1USP A;  1VQ7 1;  4TNU A;  3S1N I;  3GTJ I;  3PO2 I;  1IZN B;  1X3W A;  4NBA A;  3BG0 B;  2KC0 A;  3NDI A;  1Y1V I;  3A2S X;  3VE2 A;  2J4U P;  3KIF A;  2JA6 I;  3HOX I;  1YUK A;  4N58 A;  5ADX L;  3GTO I;  3CPW Z;  3NH5 A;  3S2H I;  3F3F C;  2W80 C;  1P4T A;  4A3C I;  2KZ7 A;  4MH4 A;  1YJW 1;  1VQM Z;  3QRA A;  3Q87 A;  2JS4 A;  1VQ8 1;  3DA3 A;  4DGL A;  1VQ9 1;  5T64 A;  2W81 C;  4A3L I;  3CCQ 1;  3S14 I;  1USP B;  1ML8 A;  2OOY B;  4KR4 A;  2V8I A;  3KVD D;  2EGT A;  4S1T A;  2KPI A;  2VUG A;  4QTU A;  4FES A;  5D5D A;  4E1S A;  2IZ3 A;  1KD1 1;  3HOW I;  1YI2 1;  2VF1 A;  1NUI A;  1TWG I;  3CME Z;  1BXW A;  1YUA A;  1QJ9 A;  4PUX A;  1TWF I;  2F1T A;  2FGR A;  4NH1 C;  3CCE 1;  2V8J A;  3VY9 X;  3VTN A;  2F4M A;  3H0G I;  4CL1 A;  2J1N A;  2M6N A;  1JWH C;  4KR8 A;  5FLM I;  1NJI 2;  1ZHY A;  1QYP A;  3G71 1;  2XE2 A;  7PRN A;  1VQK 1;  4O49 A;  1RQF A;  1I6H I;  3LK2 A;  4Y52 I;  4AYN A;  4A3D I;  4A3I I;  3GCF A;  1ZB9 A;  5LL6 f;  4GCP A;  4A3M I;  1VQO Z;  1YIT 1;  4O3Z A;  1Q82 1;  4LSI A;  3SY9 A;  1YJN Z;  2YAD A;  2OOX B;  3UU2 A;  3CXC Z;  2OTJ 1;  2BJO A;  2QA4 1;  2JMM A;  1X0T A;  2QLV B;  1ZB8 A;  2QKD A;  1N8R 1;  3AAE A;  3OW2 Z;  4FRX A;  5D1O A;  3LK4 2;  4E1T A;  3UPG A;  4O3Y A;  2JA8 I;  1IZN A;  1TWH I;  1K9M 1;  2H85 A;  2YU9 I;  1HXU A;  2P28 A;  3D9X A;  2XE5 A;  3NSG A;  3VZU X;  1KRL A;  4RVG A;  4E2Z A;  4GHB A;  1GFQ A;  4NBH A;  2KI7 B;  4N59 A;  3T20 A;  4NBE A;  2Q51 A;  5C4X I;  1VQO 1;  1M1K 1;  1BT9 A;  1Z03 A;  2DE7 A;  2K3R A;  3AA7 A;  3AAA A;  2DE5 A;  3BG1 B;  4A3E I;  3POQ A;  1VQ5 Z;  4D65 A;  3NH8 A;  4RLB A;  3G4S Z;  1VQ8 Z;  1QJP A;  1VQ9 Z;  4NBF A;  2HU9 A;  1YIJ Z;  3GTM S;  4AUI A;  4FMS A;  5G26 A;  5D1P A;  3CCQ Z;  2XG6 A;  1I3Q I;  3J81 b;  4MON A;  1VLA A;  2ZAE B;  2XTQ A;  1H6S 1;  2JA7 I;  3M4O I;  3NFZ A;  3LK3 A;  1HXX A;  1WW9 A;  5T67 A;  3AAE B;  5A2Q f;  4BY7 I;  3HOE A;  1VQ5 1;  4MRI A;  4HGY A;  4Z3T A;  1VQN Z;  1K9M 2;  2GE4 A;  3CMA Z;  1TWA I;  2KZ7 B;  4NB9 A;  1M90 1;  2O53 A;  4FUV A;  4D5U A;  2JR6 A;  3J81 f;  2LFU A;  4C69 X;  4RS4 A;  1K73 2;  5CM2 M;  5EE2 A;  4B61 A;  5FVN A;  3FQQ A;  1VQN 1;  1W2B Z;  2F4O A;  4BY1 I;  3G7G A;  1VQK Z;  2ZFG A;  3IX0 A;  1TFI A;  1K83 I;  2XMX A;  3AA6 A;  2IZ4 A;  4AKR A;  1VQM 1;  3HOY I;  3I55 1;  1Z02 A;  4HH4 A;  1NP6 A;  4FT6 A;  2GTH A;  2E2I I;  2I3C A;  4BBR I;  3S15 I;  3AA6 B;  1X3Z A;  3K19 A;  4Y7N I;  3CD6 Z;  4FZL A;  1HXT A;  2YPV A;  4O4U A;  3VB9 A;  2QR1 B;  3G6E Z;  1BH3 A;  2R6M A;  1KD1 2;  4U9C A;  3VY8 X;  1W2B Y;  2QRD B;  1Q9G A;  2POR A;  5DL5 A;  3MZK B;  4RV9 A;  4E31 A;  5DL8 A;  3POR A;  4E2W A;  2W04 A;  5C3E I;  3AA1 B;  3GKQ A;  3J80 b;  3G4S 1;  4A3F I;  3HOZ I;  2K4T A;  3I4N I;  1WCM I;  3CD6 1;  4AKR B;  1R9T I;  3V8U A;  4XNK A;  2QA4 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...