2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gna2132
publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
4O3ZA 1YS5A 4AYMC 3KVDD 4O4UA 4QQ1A 4O3YA 3UAQA 4Z3TA 2W80C 2W81C 3V8UA 4AYID 4AYNA 2YPVA 3PQUA 3HOLA 3VE1A 3HOEA 4U9CA 5T5FA 4AYDC 4O4XA 2KDYA 3PQSA 2LFUA 4AYEC 4O49A 4O3WA 4O3XB 3VE2A 2Y7SA 5EE2A 2KC0A
chains in the Genus database with same CATH superfamily
1USPB 3T24A 3CCEZ 2VPZA 5E79O 3DA4A 4E1SA 3CCJZ 2WJQA 3P5JB 2R93I 3AA1B 1VQM1 2JA8I 3NDJA 1S72Z 1OSMA 4GF4A 1W2BZ 4AYID 1Q821 3H0GI 3HOUI 5D1OA 3PQUA 4KR4A 3HOLA 2E7ZA 3CC2Z 1BH3A 1YHQZ 1VQPZ 3LUSA 2JMMA 3VZUX 4B61A 2R4LA 3POXA 2EGTA 3LK3B 5KAIO 2F1TA 1K83I 2RPRA 3Q87A 3BG0B 3M4OI 2H85A 3HOVI 2OTLZ 3AA7B 3AAEB 2I3CA 2XE2A 2O53A 4NBDA 2JIMA 5TISO 2Q4ZA 3HW9A 2YADA 3WU2O 5B5EO 3J80f 3HKZA 1Y1WI 4A93I 4E33A 4MRIA 4DK1A 4N75A 3HOWI 2IZ3A 1VQO1 4FRTA 3CCQZ 2KDYA 1X3WA 3I4MI 4RL9A 3NSGA 2JIOA 2HU9A 1YJWZ 2XMXA 1NUIA 4E31A 3CC7Z 3DA3A 1TWAI 1VQ4Z 2G2KA 1YIT1 1YUAA 1P9NA 1VQNZ 3NFZA 2AYDA 4FRXA 1VQ91 3CCVZ 3UAQA 3AAAB 3EERA 3FQQA 3D2LA 1VQ51 1YIJZ 2KI7B 3AA7A 4E2XA 3VB9A 1Y1VI 5T64A 4NBAA 2WJRA 3JCUO 4FZNA 4O4XA 2OTJZ 2K0LA 4GHBA 1RO2A 2QRCB 4JCHA 2GTHA 4NBGA 4QTTA 3F3FC 3CCL1 3OW2Y 3S17I 3RZDI 3CCU1 3G6EZ 1JWHC 4BXXI 3CMAZ 1RQFA 2JIPA 5DL6A 3CPWZ 5T67A 4A3GI 3D6WA 4PJ0O 1K9M2 3TE5B 1Q9GA 3LK2B 4RS4A 2QEXZ 2N2LA 2YPVA 3CCM1 3NH5A 2OZKA 2NVYI 3AAAA 4N58A 1L1OC 2R4OA 5C4JI 1K9M1 4Y52I 1QF8A 1GFQA 2JQYA 3A2SX 3SY7A 2W03A 6PRNA 4MH4A 2Y2XA 3TZGA 2QA41 2RBLA 4RVHA 3NH4A 2F4OA 3J80b 2VF1A 3T20A 5H2FO 3RBHA 5IP7I 2NVTI 1KQSY 1Q9FA 1PRNA 2IWWA 3NDIA 5KAFO 1MM4A 4AYNA 2R6MA 5G3AA 1KD12 3DWNA 1JJ2Z 5T5FA 1ZHTA 4FQEA 2IV2X 5G39A 4AZLA 1TFIA 2VPYA 5IYUA 2IWVA 3PGUA 1Y8CA 3CCS1 2P28A 1KD11 1Q16A 3BG1B 4FMSA 2Y0HA 1IZNB 4GCQA 3GTJI 3VMIA 2RIQA 1BT9A 7PRNA 3VTNA 2Y0SA 2RHBA 5AFUK 2AXTO 3O0EA 4C00A 4NB9A 4E32A 1WCMI 5GTHO 3RZOI 1T1LA 1Z03A 4A3LI 3CC41 2JNYA 1X3ZA 4BBRI 2WB1A 1VQ8Z 4C4VA 2ZLDA 5D1PA 3BS0A 3CCE1 1VQMZ 4RVGA 3JAMb 4FZMA 5AFUL 4E2ZA 3FKII 3CQZI 3I07A 1S721 1ZHZA 2PK7A 3MZKB 2KC0A 1W2BY 1GFNA 4NBHA 3CC21 3S1QI 2JIQA 1YHQ1 2MHLA 1VQP1 1QVFZ 1THQA 2MNHA 2F1VA 4O3YA 3AA6B 3G7GA 2JMOA 3VMHA 1H6S1 1OPFA 1ZHYA 1K8A2 3MONA 5IT9f 3T0SA 1HXUA 3GTMS 2QREB 4A3MI 1USPA 4FOZA 2PM9A 3PGRA 1NJI2 4U9CA 3K7AI 3J7A4 3POQA 3QRCA 3AA1A 3G4SZ 1Q812 2OTL1 2R8AA 3QRAA 1K8A1 2JR6A 3I56Z 1QVGZ 2K4TA 3EEDA 5LL6f 1I3QI 3GTKI 1ML8A 1VQKZ 4GCSA 2V3VA 3DZMA 3KIHA 1WW9A 1Q811 4BY7I 3CCQ1 3LK3A 2W80C 4PR7A 2GTIA 1TWFI 1RNIA 2DE7A 2RT9A 2WAQA 1TWCI 3I551 1YITZ 1YJW1 1GFOA 2VPXA 1I50I 3CC71 1P4TA 5A2Qf 4MD7A 2QLVB 1YJ9Z 2NVXI 3AAEA 1VQL1 4AUIA 3A0BO 3AA0B 4A3BI 3UU2A 4AYDC 1WIIA 3FQMA 3VZWX 4AYEC 1VQN1 1AA6A 3CCV1 3GP6A 2R4NA 4HGZA 3DWOX 3PRNA 1I6HI 1SFOI 1M902 2X9KA 1YIJ1 4AKRB 3CMEZ 1VQ61 3JAMf 4LSEA 4O3ZA 2J4UP 4E2YA 5CM2M 2E2II 3BRZA 4PUXA 4XNLA 3MZLB 5AN9F 4Z3TA 2V8JA 2QRDB 3IF8A 2W81C 3PO3S 4D65A 1M901 1SIWA 4G75A 4A3DI 3CCUZ 2M07A 3KZIO 5ADXK 3C5OA 4A3CI 2KZ7B 3EMNX 3G6E1 1ZB8A 3M3YI 4NB8A 2IZ4A 2XE5A 4NBBA 4NBEA 3CMA1 3CCRZ 2O4VA 3HOYI 3FYXA 1VQ71 2R92I 1TWHI 3IR7A 4XNKA 5FVNA 3PGSA 1LQLA 3U50C 2Y7SA 4RLCA 3CPWY 1YI2Z 3G71Z 2PRNA 5IT9b 3GTMI 5ADXL 2LEXA 2JA6I 1E54A 1Z02A 2V8KA 2QTKA 2QA4Z 1PHOA 2KXPB 5JDPA 3CD61 4AYBA 2QKDA 3S14I 4BUMX 1YJN1 4EWCA 1R9TI 2K5RA 3H3VJ 3WI4A 4BY1I 3CXCZ 3S1MI 1HXTA 1YUKA 2LIYA 2WVPA 1RLYA 3LK2A 2Y0LA 4FSOA 2QR1B 4IL6O 5DL8A 4N59A 2GU2A 2JS4A 3KVDD 3SY9A 5D1OB 2E2JI 3I4NI 1ORMA 1JJ2Y 5D5DA 5A2Qb 1ZB9A 3CCSZ 2F4MA 5B66O 4DGLA 1Q862 4S1TA 4KRAA 1VLAA 3ESWA 4NFRA 3S15I 3VZTX 3PQSA 4FUVA 4RV9A 2M06A 3CCJ1 1KC82 2N2MA 1Q861 1RO0A 4O3XB 2KPIA 5PRNA 2Q51A 1RO4A 1DL6A 3HWBA 2GE4A 4G76A 4RLBA 4RJWA 2ZAEB 3PO3I 1VQ81 4MXUA 3S2HI 1KC81 3LK42 4FT6A 1PFTA 2JIRA 1IZNA 5GV0A 2XTRA 2B63I 2PORA 2F1CX 4FSPA 4N74A 2J6AA 3HOEA 1NP6A 4Y7NI 2E2HI 1M1K2 4A3FI 2FGRA 2R89A 3LK41 1QJ8A 3F3PC 1MM5A 3GTLI 2OMFA 1QVFY 1GFMA 5C3EI 4NBCA 1VQOZ 2NVQI 5T6BA 5EE2A 1NJI1 1M1K1 2E9HA 2XG6A 1GFPA 1S7MA 1X0TA 3J81f 4QQ1A 2HF1A 4HH4A 2V8IA 4NOZA 4UB8O 4F4BA 3G4S1 3NH8A 2VUGA 5DL5A 4AFKA 2O4HA 4E2WA 3VY8X 3GTQI 3GTOI 3I561 4C69X 8PRNA 1VQK1 3HOXI 1QVGY 2VUMI 4E1TA 4TNUA 1G90A 1VQ41 4AKMA 3AA6A 2YU9I 1VQ9Z 3PORA 2LFUA 3JTYA 2V45A 3UPGA 3I55Z 1WJ2A 2BJOA 2VPWA 2ERVA 3WI5A 4O49A 4O3WA 2AKLA 1VQ5Z 3S2DI 1VQLZ 1KRLA 2J1NA 1QXFA 5C4XI 1WZNA 1QJPA 1HXXA 3POUA 5FLXf 1YJ91 4MONA 4A3II 4A3KI 4DQYB 4NBFA 2Y0KA 3OW2Z 2OTJ1 1MPFA 5IP9I 3BRYA 3A0HO 3NJTA 4FESA 3QWUA 3CCLZ 4MD9A 1VQ6Z 2FGQX 3IFUA 3S16I 2R7ZI 2XE1A 2JA7I 3T4NB 2YNKA 3CME1 5G26A 2OOXB 4RVFA 5C44I 3PF1A 4QTUA 2M6NA 2OOYB 1ZHWA 5FLMI 3CCMZ 2PMZA 3IX0A 3VE2A 3AA0A 2W04A 2NAPA 1T16A 4XX2A 2QEX1 3SZVA 3GTPI 4O4UA 4NH1C 2P3YA 4D5UA 1QJ9A 2R88A 1N8R2 4UB6O 1VQ7Z 4K3BA 4CL1A 2R4PA 3CCR1 4AKRA 3SYBA 4D64A 2M48A 4BBSI 3GCFA 4FZLA 1KQSZ 2LHFA 1YI21 3SYSA 3G711 1N8R1 1K732 4HGYA 2ZFGA 3K19A 5GTIO 3D9XA 2JA5I 3CD6Z 4K3CA 3GTGI 1YJNZ 3J81b 1ZHXA 2XE3A 1FDIA 3TDHB 2X27X 3PO2I 1YS5A 2KZ7A 4AYMC 2DE6A 4GCPA 4A3EI 1K731 4LSIA 1Q7Y2 4RVDA 4C4VB 5G38A 2XTQA 1ZH1A 5DL7A 4A3JI 4X6AI 3VY9X 3V8UA 4CTDA 3CXCY 2ODJA 4E30A 4KR8A 3GKQA 4MD8A 4LSFA 3VE1A 1Z01A 3KIFA 3S1RI 1N2FA 4RJXA 1Q7Y1 3S1NI 1QYPA 3SZDA 2K3RA 2KXPA 2JUBA 4JFBA 1FDOA 4LSHA 2DE5A 1TWGI 1Y1VS 5FLXb 1S5LO 3VMGA 3CC4Z 3HOZI 1Q822 1BXWA
chains in the Genus database with same CATH topology
1USPB 3T24A 3CCEZ 3DA4A 4E1SA 3CCJZ 3P5JB 2R93I 3AA1B 1VQM1 2JA8I 3NDJA 1S72Z 1OSMA 4GF4A 1W2BZ 4AYID 1Q821 3H0GI 3HOUI 5D1OA 3PQUA 4KR4A 3HOLA 3CC2Z 1BH3A 1YHQZ 1VQPZ 3LUSA 2JMMA 3VZUX 4B61A 3POXA 2EGTA 3LK3B 2F1TA 1K83I 2RPRA 3Q87A 3BG0B 3M4OI 2H85A 3HOVI 2OTLZ 3AA7B 3AAEB 2I3CA 2XE2A 2O53A 4NBDA 2Q4ZA 3HW9A 2YADA 3J80f 3HKZA 1Y1WI 4A93I 4E33A 4MRIA 4DK1A 3HOWI 2IZ3A 1VQO1 4FRTA 3CCQZ 2KDYA 1X3WA 3I4MI 4RL9A 3NSGA 2HU9A 1YJWZ 2XMXA 1NUIA 4E31A 3CC7Z 3DA3A 1TWAI 1VQ4Z 2G2KA 1YIT1 1YUAA 1P9NA 1VQNZ 3NFZA 4FRXA 1VQ91 3CCVZ 3UAQA 3AAAB 3EERA 3FQQA 1VQ51 1YIJZ 2KI7B 3AA7A 4E2XA 3VB9A 1Y1VI 5T64A 4NBAA 4FZNA 4O4XA 2OTJZ 2K0LA 4GHBA 1RO2A 2QRCB 4JCHA 2GTHA 4NBGA 4QTTA 3F3FC 3CCL1 3OW2Y 3S17I 3RZDI 3CCU1 3G6EZ 1JWHC 4BXXI 3CMAZ 1RQFA 5DL6A 3CPWZ 5T67A 4A3GI 3D6WA 1K9M2 3TE5B 1Q9GA 3LK2B 4RS4A 2QEXZ 2N2LA 2YPVA 3CCM1 3NH5A 2OZKA 2NVYI 3AAAA 4N58A 1L1OC 5C4JI 1K9M1 4Y52I 1QF8A 1GFQA 3A2SX 3SY7A 2W03A 6PRNA 4MH4A 2Y2XA 3TZGA 2QA41 2RBLA 4RVHA 3NH4A 2F4OA 3J80b 2VF1A 3T20A 3RBHA 5IP7I 2NVTI 1KQSY 1Q9FA 1PRNA 3NDIA 1MM4A 4AYNA 2R6MA 1KD12 1JJ2Z 5T5FA 1ZHTA 4AZLA 1TFIA 5IYUA 3CCS1 1KD11 2P28A 3BG1B 4FMSA 2Y0HA 1IZNB 4GCQA 3GTJI 3VMIA 2RIQA 1BT9A 7PRNA 3VTNA 2Y0SA 2RHBA 5AFUK 3O0EA 4NB9A 4E32A 1WCMI 3RZOI 1Z03A 4A3LI 3CC41 2JNYA 1X3ZA 4BBRI 2WB1A 1VQ8Z 2ZLDA 5D1PA 3CCE1 1VQMZ 4RVGA 3JAMb 4FZMA 5AFUL 4E2ZA 3FKII 3CQZI 3I07A 1S721 1ZHZA 2PK7A 3MZKB 2KC0A 1W2BY 1GFNA 4NBHA 3CC21 3S1QI 2MHLA 1YHQ1 1VQP1 1QVFZ 1THQA 2MNHA 2F1VA 4O3YA 3AA6B 3G7GA 2JMOA 3VMHA 1H6S1 1OPFA 1ZHYA 1K8A2 3MONA 5IT9f 3T0SA 1HXUA 3GTMS 2QREB 4A3MI 1USPA 4FOZA 2PM9A 1NJI2 4U9CA 3K7AI 3J7A4 3POQA 3QRCA 3AA1A 3G4SZ 1Q812 2OTL1 3QRAA 1K8A1 2JR6A 3I56Z 1QVGZ 2K4TA 3EEDA 5LL6f 1I3QI 3GTKI 1ML8A 1VQKZ 4GCSA 3KIHA 1WW9A 1Q811 4BY7I 3CCQ1 3LK3A 2W80C 2GTIA 1TWFI 1RNIA 2DE7A 2RT9A 2WAQA 1TWCI 3I551 1YITZ 1YJW1 1GFOA 3CC71 1I50I 1P4TA 5A2Qf 4MD7A 2QLVB 1YJ9Z 2NVXI 3AAEA 1VQL1 4AUIA 4F4BA 3AA0B 4A3BI 3UU2A 4AYDC 1WIIA 3FQMA 3VZWX 4AYEC 1VQN1 3CCV1 3GP6A 4HGZA 3PRNA 1I6HI 1SFOI 1M902 1YIJ1 4AKRB 3CMEZ 1VQ61 3JAMf 4LSEA 4O3ZA 2J4UP 4E2YA 5CM2M 2E2II 4PUXA 4XNLA 4Z3TA 3MZLB 5AN9F 2V8JA 2QRDB 3IF8A 2W81C 3PO3S 4D65A 1M901 4G75A 4A3DI 3CCUZ 2M07A 5ADXK 3C5OA 4A3CI 2KZ7B 3EMNX 3G6E1 1ZB8A 3M3YI 4NB8A 2IZ4A 2XE5A 4NBBA 4NBEA 3CMA1 3CCRZ 2O4VA 3HOYI 3FYXA 1VQ71 2R92I 1TWHI 4XNKA 5FVNA 5G26A 1LQLA 3U50C 2Y7SA 4RLCA 3CPWY 1YI2Z 3G71Z 2PRNA 5IT9b 3GTMI 5ADXL 2JA6I 1E54A 1Z02A 2V8KA 2QTKA 2QA4Z 1PHOA 2KXPB 5JDPA 3CD61 4AYBA 2QKDA 3S14I 4BUMX 1YJN1 4EWCA 1R9TI 2K5RA 3H3VJ 3WI4A 4BY1I 3CXCZ 3S1MI 1HXTA 1YUKA 2LIYA 1RLYA 3LK2A 2Y0LA 4FSOA 2QR1B 5DL8A 4N59A 2GU2A 2JS4A 3KVDD 3SY9A 5D1OB 2E2JI 3I4NI 1ORMA 1JJ2Y 5D5DA 5A2Qb 1ZB9A 3CCSZ 2F4MA 4DGLA 1Q862 4S1TA 4KRAA 1VLAA 3ESWA 4NFRA 3S15I 3VZTX 3PQSA 4FUVA 4RV9A 2M06A 3CCJ1 1KC82 2N2MA 1Q861 1RO0A 4O3XB 2KPIA 5PRNA 2Q51A 1RO4A 1DL6A 3HWBA 2GE4A 4G76A 4RLBA 4RJWA 2ZAEB 3PO3I 1VQ81 4MXUA 3S2HI 1KC81 3LK42 4FT6A 1PFTA 1IZNA 5GV0A 2XTRA 2B63I 2PORA 4FSPA 2J6AA 3HOEA 1NP6A 4Y7NI 2E2HI 1M1K2 4A3FI 2FGRA 3LK41 1QJ8A 3F3PC 1MM5A 3GTLI 2OMFA 1QVFY 1GFMA 5C3EI 4NBCA 1VQOZ 2NVQI 5T6BA 5EE2A 1NJI1 1M1K1 2E9HA 2XG6A 1GFPA 1S7MA 1X0TA 3J81f 4QQ1A 2HF1A 4HH4A 2V8IA 4NOZA 3G4S1 3NH8A 2VUGA 5DL5A 4AFKA 2O4HA 4E2WA 3VY8X 3GTQI 3GTOI 3I561 4C69X 8PRNA 1VQK1 3HOXI 1QVGY 2VUMI 4E1TA 4TNUA 1G90A 1VQ41 4AKMA 3AA6A 2YU9I 1VQ9Z 3PORA 2LFUA 3JTYA 3UPGA 3I55Z 2BJOA 2ERVA 3WI5A 4O49A 4O3WA 2AKLA 1VQ5Z 3S2DI 1VQLZ 1KRLA 2J1NA 5C4XI 1QJPA 1HXXA 3POUA 5FLXf 1YJ91 4MONA 4A3II 4A3KI 4DQYB 4NBFA 2Y0KA 3OW2Z 2OTJ1 1MPFA 5IP9I 4FESA 3QWUA 3CCLZ 4MD9A 1VQ6Z 2FGQX 3IFUA 3S16I 2R7ZI 2XE1A 2JA7I 3T4NB 2YNKA 3CME1 2OOXB 4RVFA 5C44I 4QTUA 2M6NA 2OOYB 1ZHWA 5FLMI 3CCMZ 2PMZA 3IX0A 3VE2A 3AA0A 2W04A 4XX2A 2QEX1 3SZVA 3GTPI 4O4UA 4NH1C 2P3YA 4D5UA 1QJ9A 1N8R2 1VQ7Z 4CL1A 3CCR1 4AKRA 3SYBA 4D64A 2M48A 4BBSI 3GCFA 4FZLA 1KQSZ 2LHFA 1YI21 3SYSA 3G711 1N8R1 1K732 4HGYA 2ZFGA 3K19A 3D9XA 2JA5I 3CD6Z 3GTGI 1YJNZ 3J81b 1ZHXA 2XE3A 3TDHB 2X27X 3PO2I 1YS5A 2KZ7A 4AYMC 2DE6A 4GCPA 4A3EI 1K731 4LSIA 1Q7Y2 4RVDA 2XTQA 1ZH1A 5DL7A 4A3JI 4X6AI 3VY9X 3V8UA 3CXCY 2ODJA 4E30A 4KR8A 3GKQA 4MD8A 4LSFA 3VE1A 1Z01A 3KIFA 3S1RI 1N2FA 4RJXA 1Q7Y1 3S1NI 1QYPA 3SZDA 2K3RA 2KXPA 2JUBA 4JFBA 4LSHA 1Y1VS 1TWGI 2DE5A 5FLXb 3VMGA 3CC4Z 3HOZI 1Q822 1BXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Z A;  1YS5 A;  4AYM C;  3KVD D;  4O4U A;  4QQ1 A;  4O3Y A;  3UAQ A;  4Z3T A;  2W80 C;  2W81 C;  3V8U A;  4AYI D;  4AYN A;  2YPV A;  3PQU A;  3HOL A;  3VE1 A;  3HOE A;  4U9C A;  5T5F A;  4AYD C;  4O4X A;  2KDY A;  3PQS A;  2LFU A;  4AYE C;  4O49 A;  4O3W A;  4O3X B;  3VE2 A;  2Y7S A;  5EE2 A;  2KC0 A; 
#chains in the Genus database with same CATH topology
 1USP B;  3T24 A;  3CCE Z;  2VPZ A;  5E79 O;  3DA4 A;  4E1S A;  3CCJ Z;  2WJQ A;  3P5J B;  2R93 I;  3AA1 B;  1VQM 1;  2JA8 I;  3NDJ A;  1S72 Z;  1OSM A;  4GF4 A;  1W2B Z;  4AYI D;  1Q82 1;  3H0G I;  3HOU I;  5D1O A;  3PQU A;  4KR4 A;  3HOL A;  2E7Z A;  3CC2 Z;  1BH3 A;  1YHQ Z;  1VQP Z;  3LUS A;  2JMM A;  3VZU X;  4B61 A;  2R4L A;  3POX A;  2EGT A;  3LK3 B;  5KAI O;  2F1T A;  1K83 I;  2RPR A;  3Q87 A;  3BG0 B;  3M4O I;  2H85 A;  3HOV I;  2OTL Z;  3AA7 B;  3AAE B;  2I3C A;  2XE2 A;  2O53 A;  4NBD A;  2JIM A;  5TIS O;  2Q4Z A;  3HW9 A;  2YAD A;  3WU2 O;  5B5E O;  3J80 f;  3HKZ A;  1Y1W I;  4A93 I;  4E33 A;  4MRI A;  4DK1 A;  4N75 A;  3HOW I;  2IZ3 A;  1VQO 1;  4FRT A;  3CCQ Z;  2KDY A;  1X3W A;  3I4M I;  4RL9 A;  3NSG A;  2JIO A;  2HU9 A;  1YJW Z;  2XMX A;  1NUI A;  4E31 A;  3CC7 Z;  3DA3 A;  1TWA I;  1VQ4 Z;  2G2K A;  1YIT 1;  1YUA A;  1P9N A;  1VQN Z;  3NFZ A;  2AYD A;  4FRX A;  1VQ9 1;  3CCV Z;  3UAQ A;  3AAA B;  3EER A;  3FQQ A;  3D2L A;  1VQ5 1;  1YIJ Z;  2KI7 B;  3AA7 A;  4E2X A;  3VB9 A;  1Y1V I;  5T64 A;  4NBA A;  2WJR A;  3JCU O;  4FZN A;  4O4X A;  2OTJ Z;  2K0L A;  4GHB A;  1RO2 A;  2QRC B;  4JCH A;  2GTH A;  4NBG A;  4QTT A;  3F3F C;  3CCL 1;  3OW2 Y;  3S17 I;  3RZD I;  3CCU 1;  3G6E Z;  1JWH C;  4BXX I;  3CMA Z;  1RQF A;  2JIP A;  5DL6 A;  3CPW Z;  5T67 A;  4A3G I;  3D6W A;  4PJ0 O;  1K9M 2;  3TE5 B;  1Q9G A;  3LK2 B;  4RS4 A;  2QEX Z;  2N2L A;  2YPV A;  3CCM 1;  3NH5 A;  2OZK A;  2NVY I;  3AAA A;  4N58 A;  1L1O C;  2R4O A;  5C4J I;  1K9M 1;  4Y52 I;  1QF8 A;  1GFQ A;  2JQY A;  3A2S X;  3SY7 A;  2W03 A;  6PRN A;  4MH4 A;  2Y2X A;  3TZG A;  2QA4 1;  2RBL A;  4RVH A;  3NH4 A;  2F4O A;  3J80 b;  2VF1 A;  3T20 A;  5H2F O;  3RBH A;  5IP7 I;  2NVT I;  1KQS Y;  1Q9F A;  1PRN A;  2IWW A;  3NDI A;  5KAF O;  1MM4 A;  4AYN A;  2R6M A;  5G3A A;  1KD1 2;  3DWN A;  1JJ2 Z;  5T5F A;  1ZHT A;  4FQE A;  2IV2 X;  5G39 A;  4AZL A;  1TFI A;  2VPY A;  5IYU A;  2IWV A;  3PGU A;  1Y8C A;  3CCS 1;  2P28 A;  1KD1 1;  1Q16 A;  3BG1 B;  4FMS A;  2Y0H A;  1IZN B;  4GCQ A;  3GTJ I;  3VMI A;  2RIQ A;  1BT9 A;  7PRN A;  3VTN A;  2Y0S A;  2RHB A;  5AFU K;  2AXT O;  3O0E A;  4C00 A;  4NB9 A;  4E32 A;  1WCM I;  5GTH O;  3RZO I;  1T1L A;  1Z03 A;  4A3L I;  3CC4 1;  2JNY A;  1X3Z A;  4BBR I;  2WB1 A;  1VQ8 Z;  4C4V A;  2ZLD A;  5D1P A;  3BS0 A;  3CCE 1;  1VQM Z;  4RVG A;  3JAM b;  4FZM A;  5AFU L;  4E2Z A;  3FKI I;  3CQZ I;  3I07 A;  1S72 1;  1ZHZ A;  2PK7 A;  3MZK B;  2KC0 A;  1W2B Y;  1GFN A;  4NBH A;  3CC2 1;  3S1Q I;  2JIQ A;  1YHQ 1;  2MHL A;  1VQP 1;  1QVF Z;  1THQ A;  2MNH A;  2F1V A;  4O3Y A;  3AA6 B;  3G7G A;  2JMO A;  3VMH A;  1H6S 1;  1OPF A;  1ZHY A;  1K8A 2;  3MON A;  5IT9 f;  3T0S A;  1HXU A;  3GTM S;  2QRE B;  4A3M I;  1USP A;  4FOZ A;  2PM9 A;  3PGR A;  1NJI 2;  4U9C A;  3K7A I;  3J7A 4;  3POQ A;  3QRC A;  3AA1 A;  3G4S Z;  1Q81 2;  2OTL 1;  2R8A A;  3QRA A;  1K8A 1;  2JR6 A;  3I56 Z;  1QVG Z;  2K4T A;  3EED A;  5LL6 f;  1I3Q I;  3GTK I;  1ML8 A;  1VQK Z;  4GCS A;  2V3V A;  3DZM A;  3KIH A;  1WW9 A;  1Q81 1;  4BY7 I;  3CCQ 1;  3LK3 A;  2W80 C;  4PR7 A;  2GTI A;  1TWF I;  1RNI A;  2DE7 A;  2RT9 A;  2WAQ A;  1TWC I;  3I55 1;  1YIT Z;  1YJW 1;  1GFO A;  2VPX A;  1I50 I;  3CC7 1;  1P4T A;  5A2Q f;  4MD7 A;  2QLV B;  1YJ9 Z;  2NVX I;  3AAE A;  1VQL 1;  4AUI A;  3A0B O;  3AA0 B;  4A3B I;  3UU2 A;  4AYD C;  1WII A;  3FQM A;  3VZW X;  4AYE C;  1VQN 1;  1AA6 A;  3CCV 1;  3GP6 A;  2R4N A;  4HGZ A;  3DWO X;  3PRN A;  1I6H I;  1SFO I;  1M90 2;  2X9K A;  1YIJ 1;  4AKR B;  3CME Z;  1VQ6 1;  3JAM f;  4LSE A;  4O3Z A;  2J4U P;  4E2Y A;  5CM2 M;  2E2I I;  3BRZ A;  4PUX A;  4XNL A;  3MZL B;  5AN9 F;  4Z3T A;  2V8J A;  2QRD B;  3IF8 A;  2W81 C;  3PO3 S;  4D65 A;  1M90 1;  1SIW A;  4G75 A;  4A3D I;  3CCU Z;  2M07 A;  3KZI O;  5ADX K;  3C5O A;  4A3C I;  2KZ7 B;  3EMN X;  3G6E 1;  1ZB8 A;  3M3Y I;  4NB8 A;  2IZ4 A;  2XE5 A;  4NBB A;  4NBE A;  3CMA 1;  3CCR Z;  2O4V A;  3HOY I;  3FYX A;  1VQ7 1;  2R92 I;  1TWH I;  3IR7 A;  4XNK A;  5FVN A;  3PGS A;  1LQL A;  3U50 C;  2Y7S A;  4RLC A;  3CPW Y;  1YI2 Z;  3G71 Z;  2PRN A;  5IT9 b;  3GTM I;  5ADX L;  2LEX A;  2JA6 I;  1E54 A;  1Z02 A;  2V8K A;  2QTK A;  2QA4 Z;  1PHO A;  2KXP B;  5JDP A;  3CD6 1;  4AYB A;  2QKD A;  3S14 I;  4BUM X;  1YJN 1;  4EWC A;  1R9T I;  2K5R A;  3H3V J;  3WI4 A;  4BY1 I;  3CXC Z;  3S1M I;  1HXT A;  1YUK A;  2LIY A;  2WVP A;  1RLY A;  3LK2 A;  2Y0L A;  4FSO A;  2QR1 B;  4IL6 O;  5DL8 A;  4N59 A;  2GU2 A;  2JS4 A;  3KVD D;  3SY9 A;  5D1O B;  2E2J I;  3I4N I;  1ORM A;  1JJ2 Y;  5D5D A;  5A2Q b;  1ZB9 A;  3CCS Z;  2F4M A;  5B66 O;  4DGL A;  1Q86 2;  4S1T A;  4KRA A;  1VLA A;  3ESW A;  4NFR A;  3S15 I;  3VZT X;  3PQS A;  4FUV A;  4RV9 A;  2M06 A;  3CCJ 1;  1KC8 2;  2N2M A;  1Q86 1;  1RO0 A;  4O3X B;  2KPI A;  5PRN A;  2Q51 A;  1RO4 A;  1DL6 A;  3HWB A;  2GE4 A;  4G76 A;  4RLB A;  4RJW A;  2ZAE B;  3PO3 I;  1VQ8 1;  4MXU A;  3S2H I;  1KC8 1;  3LK4 2;  4FT6 A;  1PFT A;  2JIR A;  1IZN A;  5GV0 A;  2XTR A;  2B63 I;  2POR A;  2F1C X;  4FSP A;  4N74 A;  2J6A A;  3HOE A;  1NP6 A;  4Y7N I;  2E2H I;  1M1K 2;  4A3F I;  2FGR A;  2R89 A;  3LK4 1;  1QJ8 A;  3F3P C;  1MM5 A;  3GTL I;  2OMF A;  1QVF Y;  1GFM A;  5C3E I;  4NBC A;  1VQO Z;  2NVQ I;  5T6B A;  5EE2 A;  1NJI 1;  1M1K 1;  2E9H A;  2XG6 A;  1GFP A;  1S7M A;  1X0T A;  3J81 f;  4QQ1 A;  2HF1 A;  4HH4 A;  2V8I A;  4NOZ A;  4UB8 O;  4F4B A;  3G4S 1;  3NH8 A;  2VUG A;  5DL5 A;  4AFK A;  2O4H A;  4E2W A;  3VY8 X;  3GTQ I;  3GTO I;  3I56 1;  4C69 X;  8PRN A;  1VQK 1;  3HOX I;  1QVG Y;  2VUM I;  4E1T A;  4TNU A;  1G90 A;  1VQ4 1;  4AKM A;  3AA6 A;  2YU9 I;  1VQ9 Z;  3POR A;  2LFU A;  3JTY A;  2V45 A;  3UPG A;  3I55 Z;  1WJ2 A;  2BJO A;  2VPW A;  2ERV A;  3WI5 A;  4O49 A;  4O3W A;  2AKL A;  1VQ5 Z;  3S2D I;  1VQL Z;  1KRL A;  2J1N A;  1QXF A;  5C4X I;  1WZN A;  1QJP A;  1HXX A;  3POU A;  5FLX f;  1YJ9 1;  4MON A;  4A3I I;  4A3K I;  4DQY B;  4NBF A;  2Y0K A;  3OW2 Z;  2OTJ 1;  1MPF A;  5IP9 I;  3BRY A;  3A0H O;  3NJT A;  4FES A;  3QWU A;  3CCL Z;  4MD9 A;  1VQ6 Z;  2FGQ X;  3IFU A;  3S16 I;  2R7Z I;  2XE1 A;  2JA7 I;  3T4N B;  2YNK A;  3CME 1;  5G26 A;  2OOX B;  4RVF A;  5C44 I;  3PF1 A;  4QTU A;  2M6N A;  2OOY B;  1ZHW A;  5FLM I;  3CCM Z;  2PMZ A;  3IX0 A;  3VE2 A;  3AA0 A;  2W04 A;  2NAP A;  1T16 A;  4XX2 A;  2QEX 1;  3SZV A;  3GTP I;  4O4U A;  4NH1 C;  2P3Y A;  4D5U A;  1QJ9 A;  2R88 A;  1N8R 2;  4UB6 O;  1VQ7 Z;  4K3B A;  4CL1 A;  2R4P A;  3CCR 1;  4AKR A;  3SYB A;  4D64 A;  2M48 A;  4BBS I;  3GCF A;  4FZL A;  1KQS Z;  2LHF A;  1YI2 1;  3SYS A;  3G71 1;  1N8R 1;  1K73 2;  4HGY A;  2ZFG A;  3K19 A;  5GTI O;  3D9X A;  2JA5 I;  3CD6 Z;  4K3C A;  3GTG I;  1YJN Z;  3J81 b;  1ZHX A;  2XE3 A;  1FDI A;  3TDH B;  2X27 X;  3PO2 I;  1YS5 A;  2KZ7 A;  4AYM C;  2DE6 A;  4GCP A;  4A3E I;  1K73 1;  4LSI A;  1Q7Y 2;  4RVD A;  4C4V B;  5G38 A;  2XTQ A;  1ZH1 A;  5DL7 A;  4A3J I;  4X6A I;  3VY9 X;  3V8U A;  4CTD A;  3CXC Y;  2ODJ A;  4E30 A;  4KR8 A;  3GKQ A;  4MD8 A;  4LSF A;  3VE1 A;  1Z01 A;  3KIF A;  3S1R I;  1N2F A;  4RJX A;  1Q7Y 1;  3S1N I;  1QYP A;  3SZD A;  2K3R A;  2KXP A;  2JUB A;  4JFB A;  1FDO A;  4LSH A;  2DE5 A;  1TWG I;  1Y1V S;  5FLX b;  1S5L O;  3VMG A;  3CC4 Z;  3HOZ I;  1Q82 2;  1BXW A; 
#chains in the Genus database with same CATH homology
 1USP B;  3T24 A;  3CCE Z;  3DA4 A;  4E1S A;  3CCJ Z;  3P5J B;  2R93 I;  3AA1 B;  1VQM 1;  2JA8 I;  3NDJ A;  1S72 Z;  1OSM A;  4GF4 A;  1W2B Z;  4AYI D;  1Q82 1;  3H0G I;  3HOU I;  5D1O A;  3PQU A;  4KR4 A;  3HOL A;  3CC2 Z;  1BH3 A;  1YHQ Z;  1VQP Z;  3LUS A;  2JMM A;  3VZU X;  4B61 A;  3POX A;  2EGT A;  3LK3 B;  2F1T A;  1K83 I;  2RPR A;  3Q87 A;  3BG0 B;  3M4O I;  2H85 A;  3HOV I;  2OTL Z;  3AA7 B;  3AAE B;  2I3C A;  2XE2 A;  2O53 A;  4NBD A;  2Q4Z A;  3HW9 A;  2YAD A;  3J80 f;  3HKZ A;  1Y1W I;  4A93 I;  4E33 A;  4MRI A;  4DK1 A;  3HOW I;  2IZ3 A;  1VQO 1;  4FRT A;  3CCQ Z;  2KDY A;  1X3W A;  3I4M I;  4RL9 A;  3NSG A;  2HU9 A;  1YJW Z;  2XMX A;  1NUI A;  4E31 A;  3CC7 Z;  3DA3 A;  1TWA I;  1VQ4 Z;  2G2K A;  1YIT 1;  1YUA A;  1P9N A;  1VQN Z;  3NFZ A;  4FRX A;  1VQ9 1;  3CCV Z;  3UAQ A;  3AAA B;  3EER A;  3FQQ A;  1VQ5 1;  1YIJ Z;  2KI7 B;  3AA7 A;  4E2X A;  3VB9 A;  1Y1V I;  5T64 A;  4NBA A;  4FZN A;  4O4X A;  2OTJ Z;  2K0L A;  4GHB A;  1RO2 A;  2QRC B;  4JCH A;  2GTH A;  4NBG A;  4QTT A;  3F3F C;  3CCL 1;  3OW2 Y;  3S17 I;  3RZD I;  3CCU 1;  3G6E Z;  1JWH C;  4BXX I;  3CMA Z;  1RQF A;  5DL6 A;  3CPW Z;  5T67 A;  4A3G I;  3D6W A;  1K9M 2;  3TE5 B;  1Q9G A;  3LK2 B;  4RS4 A;  2QEX Z;  2N2L A;  2YPV A;  3CCM 1;  3NH5 A;  2OZK A;  2NVY I;  3AAA A;  4N58 A;  1L1O C;  5C4J I;  1K9M 1;  4Y52 I;  1QF8 A;  1GFQ A;  3A2S X;  3SY7 A;  2W03 A;  6PRN A;  4MH4 A;  2Y2X A;  3TZG A;  2QA4 1;  2RBL A;  4RVH A;  3NH4 A;  2F4O A;  3J80 b;  2VF1 A;  3T20 A;  3RBH A;  5IP7 I;  2NVT I;  1KQS Y;  1Q9F A;  1PRN A;  3NDI A;  1MM4 A;  4AYN A;  2R6M A;  1KD1 2;  1JJ2 Z;  5T5F A;  1ZHT A;  4AZL A;  1TFI A;  5IYU A;  3CCS 1;  1KD1 1;  2P28 A;  3BG1 B;  4FMS A;  2Y0H A;  1IZN B;  4GCQ A;  3GTJ I;  3VMI A;  2RIQ A;  1BT9 A;  7PRN A;  3VTN A;  2Y0S A;  2RHB A;  5AFU K;  3O0E A;  4NB9 A;  4E32 A;  1WCM I;  3RZO I;  1Z03 A;  4A3L I;  3CC4 1;  2JNY A;  1X3Z A;  4BBR I;  2WB1 A;  1VQ8 Z;  2ZLD A;  5D1P A;  3CCE 1;  1VQM Z;  4RVG A;  3JAM b;  4FZM A;  5AFU L;  4E2Z A;  3FKI I;  3CQZ I;  3I07 A;  1S72 1;  1ZHZ A;  2PK7 A;  3MZK B;  2KC0 A;  1W2B Y;  1GFN A;  4NBH A;  3CC2 1;  3S1Q I;  2MHL A;  1YHQ 1;  1VQP 1;  1QVF Z;  1THQ A;  2MNH A;  2F1V A;  4O3Y A;  3AA6 B;  3G7G A;  2JMO A;  3VMH A;  1H6S 1;  1OPF A;  1ZHY A;  1K8A 2;  3MON A;  5IT9 f;  3T0S A;  1HXU A;  3GTM S;  2QRE B;  4A3M I;  1USP A;  4FOZ A;  2PM9 A;  1NJI 2;  4U9C A;  3K7A I;  3J7A 4;  3POQ A;  3QRC A;  3AA1 A;  3G4S Z;  1Q81 2;  2OTL 1;  3QRA A;  1K8A 1;  2JR6 A;  3I56 Z;  1QVG Z;  2K4T A;  3EED A;  5LL6 f;  1I3Q I;  3GTK I;  1ML8 A;  1VQK Z;  4GCS A;  3KIH A;  1WW9 A;  1Q81 1;  4BY7 I;  3CCQ 1;  3LK3 A;  2W80 C;  2GTI A;  1TWF I;  1RNI A;  2DE7 A;  2RT9 A;  2WAQ A;  1TWC I;  3I55 1;  1YIT Z;  1YJW 1;  1GFO A;  3CC7 1;  1I50 I;  1P4T A;  5A2Q f;  4MD7 A;  2QLV B;  1YJ9 Z;  2NVX I;  3AAE A;  1VQL 1;  4AUI A;  4F4B A;  3AA0 B;  4A3B I;  3UU2 A;  4AYD C;  1WII A;  3FQM A;  3VZW X;  4AYE C;  1VQN 1;  3CCV 1;  3GP6 A;  4HGZ A;  3PRN A;  1I6H I;  1SFO I;  1M90 2;  1YIJ 1;  4AKR B;  3CME Z;  1VQ6 1;  3JAM f;  4LSE A;  4O3Z A;  2J4U P;  4E2Y A;  5CM2 M;  2E2I I;  4PUX A;  4XNL A;  4Z3T A;  3MZL B;  5AN9 F;  2V8J A;  2QRD B;  3IF8 A;  2W81 C;  3PO3 S;  4D65 A;  1M90 1;  4G75 A;  4A3D I;  3CCU Z;  2M07 A;  5ADX K;  3C5O A;  4A3C I;  2KZ7 B;  3EMN X;  3G6E 1;  1ZB8 A;  3M3Y I;  4NB8 A;  2IZ4 A;  2XE5 A;  4NBB A;  4NBE A;  3CMA 1;  3CCR Z;  2O4V A;  3HOY I;  3FYX A;  1VQ7 1;  2R92 I;  1TWH I;  4XNK A;  5FVN A;  5G26 A;  1LQL A;  3U50 C;  2Y7S A;  4RLC A;  3CPW Y;  1YI2 Z;  3G71 Z;  2PRN A;  5IT9 b;  3GTM I;  5ADX L;  2JA6 I;  1E54 A;  1Z02 A;  2V8K A;  2QTK A;  2QA4 Z;  1PHO A;  2KXP B;  5JDP A;  3CD6 1;  4AYB A;  2QKD A;  3S14 I;  4BUM X;  1YJN 1;  4EWC A;  1R9T I;  2K5R A;  3H3V J;  3WI4 A;  4BY1 I;  3CXC Z;  3S1M I;  1HXT A;  1YUK A;  2LIY A;  1RLY A;  3LK2 A;  2Y0L A;  4FSO A;  2QR1 B;  5DL8 A;  4N59 A;  2GU2 A;  2JS4 A;  3KVD D;  3SY9 A;  5D1O B;  2E2J I;  3I4N I;  1ORM A;  1JJ2 Y;  5D5D A;  5A2Q b;  1ZB9 A;  3CCS Z;  2F4M A;  4DGL A;  1Q86 2;  4S1T A;  4KRA A;  1VLA A;  3ESW A;  4NFR A;  3S15 I;  3VZT X;  3PQS A;  4FUV A;  4RV9 A;  2M06 A;  3CCJ 1;  1KC8 2;  2N2M A;  1Q86 1;  1RO0 A;  4O3X B;  2KPI A;  5PRN A;  2Q51 A;  1RO4 A;  1DL6 A;  3HWB A;  2GE4 A;  4G76 A;  4RLB A;  4RJW A;  2ZAE B;  3PO3 I;  1VQ8 1;  4MXU A;  3S2H I;  1KC8 1;  3LK4 2;  4FT6 A;  1PFT A;  1IZN A;  5GV0 A;  2XTR A;  2B63 I;  2POR A;  4FSP A;  2J6A A;  3HOE A;  1NP6 A;  4Y7N I;  2E2H I;  1M1K 2;  4A3F I;  2FGR A;  3LK4 1;  1QJ8 A;  3F3P C;  1MM5 A;  3GTL I;  2OMF A;  1QVF Y;  1GFM A;  5C3E I;  4NBC A;  1VQO Z;  2NVQ I;  5T6B A;  5EE2 A;  1NJI 1;  1M1K 1;  2E9H A;  2XG6 A;  1GFP A;  1S7M A;  1X0T A;  3J81 f;  4QQ1 A;  2HF1 A;  4HH4 A;  2V8I A;  4NOZ A;  3G4S 1;  3NH8 A;  2VUG A;  5DL5 A;  4AFK A;  2O4H A;  4E2W A;  3VY8 X;  3GTQ I;  3GTO I;  3I56 1;  4C69 X;  8PRN A;  1VQK 1;  3HOX I;  1QVG Y;  2VUM I;  4E1T A;  4TNU A;  1G90 A;  1VQ4 1;  4AKM A;  3AA6 A;  2YU9 I;  1VQ9 Z;  3POR A;  2LFU A;  3JTY A;  3UPG A;  3I55 Z;  2BJO A;  2ERV A;  3WI5 A;  4O49 A;  4O3W A;  2AKL A;  1VQ5 Z;  3S2D I;  1VQL Z;  1KRL A;  2J1N A;  5C4X I;  1QJP A;  1HXX A;  3POU A;  5FLX f;  1YJ9 1;  4MON A;  4A3I I;  4A3K I;  4DQY B;  4NBF A;  2Y0K A;  3OW2 Z;  2OTJ 1;  1MPF A;  5IP9 I;  4FES A;  3QWU A;  3CCL Z;  4MD9 A;  1VQ6 Z;  2FGQ X;  3IFU A;  3S16 I;  2R7Z I;  2XE1 A;  2JA7 I;  3T4N B;  2YNK A;  3CME 1;  2OOX B;  4RVF A;  5C44 I;  4QTU A;  2M6N A;  2OOY B;  1ZHW A;  5FLM I;  3CCM Z;  2PMZ A;  3IX0 A;  3VE2 A;  3AA0 A;  2W04 A;  4XX2 A;  2QEX 1;  3SZV A;  3GTP I;  4O4U A;  4NH1 C;  2P3Y A;  4D5U A;  1QJ9 A;  1N8R 2;  1VQ7 Z;  4CL1 A;  3CCR 1;  4AKR A;  3SYB A;  4D64 A;  2M48 A;  4BBS I;  3GCF A;  4FZL A;  1KQS Z;  2LHF A;  1YI2 1;  3SYS A;  3G71 1;  1N8R 1;  1K73 2;  4HGY A;  2ZFG A;  3K19 A;  3D9X A;  2JA5 I;  3CD6 Z;  3GTG I;  1YJN Z;  3J81 b;  1ZHX A;  2XE3 A;  3TDH B;  2X27 X;  3PO2 I;  1YS5 A;  2KZ7 A;  4AYM C;  2DE6 A;  4GCP A;  4A3E I;  1K73 1;  4LSI A;  1Q7Y 2;  4RVD A;  2XTQ A;  1ZH1 A;  5DL7 A;  4A3J I;  4X6A I;  3VY9 X;  3V8U A;  3CXC Y;  2ODJ A;  4E30 A;  4KR8 A;  3GKQ A;  4MD8 A;  4LSF A;  3VE1 A;  1Z01 A;  3KIF A;  3S1R I;  1N2F A;  4RJX A;  1Q7Y 1;  3S1N I;  1QYP A;  3SZD A;  2K3R A;  2KXP A;  2JUB A;  4JFB A;  4LSH A;  1Y1V S;  1TWG I;  2DE5 A;  5FLX b;  3VMG A;  3CC4 Z;  3HOZ I;  1Q82 2;  1BXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...