2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
molecule keywords Gna2132
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
1YS5A 3HOEA 3UAQA 3PQSA 2KDYA 4O3YA 4AYEC 2W81C 4QQ1A 2LFUA 3VE2A 4O4UA 3VE1A 3PQUA 4O3XB 3KVDD 4O3ZA 2YPVA 2KC0A 4AYNA 2Y7SA 5EE2A 3V8UA 4AYID 4O49A 4Z3TA 3HOLA 4AYMC 2W80C 4U9CA 4O4XA 4AYDC 5T5FA 4O3WA
chains in the Genus database with same CATH superfamily
3M3YI 1ORMA 2X27X 1VQ5Z 4FZMA 5D5DA 5GTHO 3J81b 3AA7B 2NVQI 1PRNA 4GCPA 3PO3I 3VMIA 1VQN1 2XTQA 4E1SA 4NBBA 4RV9A 1NJI2 3CC71 2M6NA 3IR7A 4O3ZA 4FESA 2R4NA 1TFIA 3CCL1 2O4VA 3G711 1Z01A 3G6E1 5DL5A 3VZUX 3CD6Z 3AA6A 3PO3S 3VY8X 1I3QI 4K3BA 3IF8A 3S1RI 1Q812 3KZIO 4TNUA 2AXTO 1FDOA 2ZFGA 2DE5A 2QEX1 5D1OB 4PJ0O 5ADXL 2GU2A 4AYEC 3SY7A 2QA4Z 5IYUA 4KR8A 1KQSZ 2JA6I 2E2II 2R92I 3HOUI 3CCM1 4O3XB 5G39A 1ZHXA 2JR6A 2QKDA 3JTYA 4GCSA 1S72Z 2WJQA 4B61A 4FZNA 1Q9GA 2V8JA 3KIHA 1R9TI 3GTOI 4C00A 2Q4ZA 2JQYA 2W03A 4A3GI 4E31A 4NBDA 5C4JI 1Q9FA 2Y0KA 4RLBA 4E2XA 1Y1VI 2W04A 4D64A 4FT6A 3VTNA 1Y1VS 1SIWA 3CMA1 1ML8A 2F4MA 1TWAI 3LK2A 3RBHA 1VQ4Z 1RNIA 3T24A 3AA1B 3CCJ1 5B5EO 2B63I 3G4S1 2DE6A 3AA6B 1VQ51 2JMMA 3I56Z 3DWOX 2QREB 1YJNZ 3H0GI 4RVGA 1S5LO 3CXCY 4A3DI 3WU2O 4Z3TA 1YHQZ 3JAMf 1ZB9A 4A3CI 3FYXA 3ESWA 2YADA 5T64A 1YHQ1 4BY7I 1NP6A 3SYSA 4Y52I 1WCMI 2OMFA 1RO0A 2WB1A 2E7ZA 3GCFA 1K731 3POQA 3GTPI 2W81C 3BS0A 1BT9A 4NB8A 1P9NA 2J1NA 4FZLA 4A3JI 2N2LA 4BXXI 3I551 3OW2Z 1T1LA 4S1TA 4AKMA 2M06A 1Q862 1KC81 3H3VJ 3BRZA 1M901 2Y7SA 3G7GA 1S7MA 3V8UA 3I4MI 1YITZ 2KXPA 2OTJ1 4G76A 6PRNA 2QRDB 4UB8O 8PRNA 2LIYA 3NDIA 1L1OC 5LL6f 1VQK1 4AKRB 2IV2X 4IL6O 2GTIA 1VQ61 1MM4A 5KAFO 2Y0SA 1X3ZA 3EEDA 3UPGA 4QQ1A 1I6HI 3D9XA 4AKRA 3CCQZ 2R4LA 5DL7A 3AAAA 2KXPB 3SZVA 1K8A2 2F4OA 1YJW1 2K0LA 4JFBA 3LK41 1WZNA 3S1NI 4AYNA 2OOYB 2P3YA 3VB9A 4RL9A 2W80C 1KRLA 1PHOA 2F1CX 3JAMb 1VQ8Z 5IP9I 5FLMI 3T0SA 2OTJZ 4AYDC 3LK2B 1ZHTA 2R6MA 2JIQA 5IP7I 3VZWX 3TZGA 2H85A 3K19A 3I561 4FRTA 2KDYA 3HWBA 5B66O 5C4XI 2IWWA 1GFNA 1KD11 4FQEA 5KAIO 2LFUA 2R93I 4MRIA 2JIPA 4PR7A 1VQNZ 2R88A 1TWGI 2JA8I 1JJ2Z 3MZKB 1VQM1 3T20A 1USPA 1K83I 3NFZA 4A3MI 3VZTX 2PK7A 4BUMX 3CCEZ 1VQLZ 3PRNA 2JNYA 5A2Qb 5DL8A 3CD61 3PO2I 1QYPA 2VPYA 5FLXb 4O3WA 3S14I 5CM2M 3CC21 3CCV1 2E2JI 4Y7NI 1AA6A 1M902 3SZDA 1KC82 3GTGI 2ZLDA 3AAAB 3Q87A 4RVFA 4A3II 1NJI1 2R8AA 1KD12 4A3BI 1QJ8A 3PQUA 4A3LI 4MD7A 2KI7B 5T67A 4E33A 3AA7A 2JIMA 2QTKA 1ZHYA 1K732 1LQLA 4N74A 2Y0HA 4NOZA 4DQYB 3S1QI 1TWHI 4MONA 4C4VB 4LSFA 1YJ91 3EERA 1WW9A 2ERVA 4RVHA 2HU9A 1Q821 5T5FA 2QR1B 2WAQA 3CQZI 1YS5A 3UU2A 4E1TA 1W2BY 2PORA 4O3YA 1SFOI 3FQQA 4BY1I 2XG6A 1W2BZ 3GKQA 1YIJZ 4C4VA 1VQ7Z 1GFMA 3PGSA 2XE2A 2LEXA 3OW2Y 2KPIA 2V3VA 3HOWI 1VQ41 7PRNA 3KVDD 2O4HA 1T16A 2QLVB 2QA41 1P4TA 1KQSY 2RBLA 2NVTI 2JA7I 1Q822 3C5OA 3LUSA 3CXCZ 4KRAA 4AFKA 2EGTA 5DL6A 1YJ9Z 3DA3A 4O4XA 3GTJI 2N2MA 1OSMA 3LK3A 5H2FO 3RZDI 2GTHA 3HKZA 3BG0B 1Q861 1JJ2Y 5D1PA 3AAEA 3A2SX 3UAQA 2NVXI 1Z02A 1YJWZ 2AKLA 1PFTA 3QRCA 4CL1A 3A0BO 1Z03A 1X0TA 3S16I 2NAPA 2HF1A 1RO2A 3FKII 4JCHA 1TWFI 3EMNX 4NBFA 4X6AI 4RVDA 4DGLA 4NFRA 3HW9A 4XNKA 4UB6O 1N8R2 4N58A 4AYID 2NVYI 1RO4A 3CC4Z 1BXWA 5PRNA 3QRAA 5G26A 3BRYA 3CMEZ 2JA5I 4E2ZA 3G6EZ 4FOZA 1E54A 2OZKA 4CTDA 2Q51A 3GTQI 1IZNA 2E9HA 4LSEA 3VE1A 3IFUA 2AYDA 2RHBA 2R4PA 3SY9A 1ZH1A 3AA0A 4RJXA 1QJPA 3S2DI 2XMXA 1MPFA 3AAEB 4D65A 1QVGZ 1WJ2A 2RT9A 2J4UP 1YUKA 2VPWA 3AA0B 4AUIA 2IZ3A 2RPRA 3HOVI 3POXA 1OPFA 1YJN1 2RIQA 3CCS1 3IX0A 3LK42 2V8IA 3S2HI 1K8A1 3PQSA 3S1MI 2J6AA 2YNKA 1QF8A 4FRXA 2X9KA 5GTIO 3VY9X 2OTL1 2F1TA 1Y1WI 4GF4A 2VF1A 2P28A 1VQO1 3F3PC 3PF1A 3SYBA 4FSPA 2YPVA 2F1VA 1ZHZA 2KZ7B 4RJWA 3FQMA 3CPWY 2ODJA 2FGRA 1G90A 2R7ZI 3CCU1 3J80b 1M1K1 3HOLA 4U9CA 1QXFA 2GE4A 1MM5A 4A3FI 1Q7Y2 1YI2Z 3HOZI 1GFPA 5G3AA 1I50I 1HXXA 1FDIA 3GTKI 2XE5A 1H6S1 3G4SZ 3CCJZ 4K3CA 3GTMS 3TDHB 2OTLZ 4O4UA 1VQ6Z 2M48A 2R4OA 3NH5A 2JS4A 3U50C 3DWNA 3LK3B 2VPZA 3I4NI 2VUGA 3NJTA 3P5JB 3AA1A 4G75A 4N59A 2BJOA 4RLCA 4LSIA 5D1OA 2OOXB 4E32A 3O0EA 3S15I 3GTMI 2Y2XA 4A3EI 2I3CA 3NH8A 1QVFZ 3HOEA 4FMSA 1QVGY 5FVNA 2MNHA 3I07A 3NDJA 1ZHWA 1BH3A 2PMZA 1QJ9A 3CCMZ 4NBAA 2KZ7A 3VE2A 3JCUO 3KIFA 1GFOA 1VLAA 1GFQA 3PGRA 4GCQA 1VQ71 4KR4A 2QRCB 4BBRI 3NH4A 4HH4A 3F3FC 4MXUA 3CCSZ 3MONA 4AYBA 3WI4A 4NBGA 4NBEA 3GTLI 1VQKZ 3DA4A 4QTTA 2G2KA 4HGYA 1YUAA 1ZB8A 4BBSI 2MHLA 1N2FA 3CCE1 1VQL1 4XNLA 2R89A 4E2YA 1HXTA 3VMHA 4EWCA 2JMOA 3I55Z 1K9M1 4QTUA 2YU9I 5AFUK 4GHBA 1YIJ1 2XE1A 5AN9F 3MZLB 3J81f 3D2LA 4MH4A 2KC0A 1Q811 3M4OI 5EE2A 3CME1 1DL6A 4A93I 5TISO 4O49A 3PGUA 1WIIA 1VQ9Z 1USPB 3CC41 2FGQX 5A2Qf 3NSGA 1THQA 1VQ91 4PUXA 4FSOA 1IZNB 2PRNA 5C3EI 1S721 4C69X 1N8R1 3S17I 3GP6A 1JWHC 2JUBA 3G71Z 5E79O 1VQOZ 3J80f 3CPWZ 4FUVA 3QWUA 1VQMZ 4D5UA 5IT9b 1VQP1 2IZ4A 1VQPZ 2M07A 4MD8A 3CCR1 1K9M2 2DE7A 5C44I 5GV0A 2V45A 4A3KI 4E30A 3DZMA 1QVFY 5AFUL 4N75A 1HXUA 4NB9A 4LSHA 4NBHA 5IT9f 1TWCI 1RQFA 3CCVZ 1YI21 4NH1C 1Y8CA 1VQ81 2JIRA 2VPXA 3K7AI 2JIOA 1Q7Y1 1Q16A 4XX2A 4HGZA 4E2WA 1M1K2 4DK1A 2K4TA 2Y0LA 1YIT1 3A0HO 3HOXI 3PORA 3D6WA 2XTRA 2PM9A 5G38A 3BG1B 3CCLZ 3TE5B 3CCQ1 1X3WA 3CC7Z 2LHFA 3RZOI 5JDPA 2E2HI 3CCRZ 5FLXf 1NUIA 2IWVA 3WI5A 4AZLA 2VUMI 2XE3A 1RLYA 4NBCA 3CMAZ 3T4NB 3VMGA 3J7A4 2ZAEB 2QEXZ 5ADXK 2K5RA 2K3RA 5T6BA 3CC2Z 4MD9A 4RS4A 3POUA 4AYMC 3HOYI 2WJRA 2V8KA 4F4BA 2WVPA 2O53A 3CCUZ
chains in the Genus database with same CATH topology
3M3YI 1ORMA 2X27X 1VQ5Z 4FZMA 5D5DA 3J81b 3AA7B 2NVQI 1PRNA 4GCPA 3PO3I 3VMIA 1VQN1 2XTQA 4E1SA 4NBBA 4RV9A 1NJI2 3CC71 2M6NA 4O3ZA 4FESA 1TFIA 3CCL1 2O4VA 3G711 1Z01A 3G6E1 5DL5A 3VZUX 3CD6Z 3AA6A 3PO3S 3VY8X 1I3QI 3IF8A 3S1RI 1Q812 4TNUA 2ZFGA 2DE5A 2QEX1 5D1OB 5ADXL 2GU2A 4AYEC 3SY7A 2QA4Z 5IYUA 4KR8A 1KQSZ 2JA6I 2E2II 2R92I 3HOUI 3CCM1 4O3XB 1ZHXA 2JR6A 2QKDA 3JTYA 4GCSA 1S72Z 4B61A 4FZNA 1Q9GA 2V8JA 3KIHA 1R9TI 3GTOI 2Q4ZA 2W03A 4A3GI 4E31A 4NBDA 5C4JI 1Q9FA 2Y0KA 4RLBA 4E2XA 1Y1VI 2W04A 4D64A 4FT6A 3VTNA 1Y1VS 3CMA1 1ML8A 2F4MA 1TWAI 3LK2A 3RBHA 1VQ4Z 1RNIA 3T24A 3AA1B 3CCJ1 2B63I 3G4S1 2DE6A 3AA6B 1VQ51 2JMMA 3I56Z 1YJNZ 2QREB 3H0GI 4RVGA 3CXCY 4A3DI 4Z3TA 1YHQZ 1ZB9A 3JAMf 4A3CI 3FYXA 3ESWA 2YADA 5T64A 1YHQ1 4BY7I 1NP6A 3SYSA 4Y52I 1WCMI 2OMFA 1RO0A 2WB1A 3GCFA 1K731 3POQA 3GTPI 2W81C 1BT9A 4NB8A 1P9NA 2J1NA 4FZLA 4A3JI 2N2LA 4BXXI 3I551 3OW2Z 4AKMA 4S1TA 2M06A 1Q862 1KC81 3H3VJ 1M901 2Y7SA 3G7GA 1S7MA 3V8UA 3I4MI 1YITZ 2KXPA 2OTJ1 4G76A 6PRNA 2QRDB 8PRNA 2LIYA 3NDIA 1L1OC 5LL6f 1VQK1 4AKRB 2GTIA 1VQ61 1MM4A 2Y0SA 1X3ZA 3EEDA 3UPGA 4QQ1A 1I6HI 3D9XA 4AKRA 3CCQZ 5DL7A 3AAAA 2KXPB 3SZVA 1K8A2 2F4OA 1YJW1 2K0LA 4JFBA 3LK41 3S1NI 4AYNA 2OOYB 2P3YA 3VB9A 4RL9A 2W80C 1KRLA 1PHOA 3JAMb 1VQ8Z 5IP9I 5FLMI 3T0SA 2OTJZ 4AYDC 3LK2B 1ZHTA 2R6MA 5IP7I 3VZWX 3TZGA 2H85A 3K19A 3I561 4FRTA 2KDYA 3HWBA 5C4XI 1GFNA 1KD11 2LFUA 2R93I 4MRIA 1VQNZ 1TWGI 2JA8I 1JJ2Z 3MZKB 1VQM1 3T20A 1USPA 1K83I 3NFZA 4A3MI 3VZTX 2PK7A 4BUMX 3CCEZ 1VQLZ 3PRNA 2JNYA 5A2Qb 5DL8A 3CD61 3PO2I 1QYPA 5FLXb 4O3WA 3S14I 5CM2M 3CC21 3CCV1 2E2JI 4Y7NI 1M902 3SZDA 1KC82 3GTGI 2ZLDA 3AAAB 3Q87A 4RVFA 4A3II 1NJI1 1KD12 4A3BI 1QJ8A 3PQUA 4A3LI 4MD7A 2KI7B 5T67A 4E33A 3AA7A 2QTKA 1ZHYA 1K732 1LQLA 2Y0HA 4NOZA 4DQYB 3S1QI 1TWHI 4MONA 4LSFA 1YJ91 3EERA 1WW9A 2ERVA 4RVHA 2HU9A 1Q821 5T5FA 2QR1B 2WAQA 3CQZI 1YS5A 3UU2A 4E1TA 1W2BY 2PORA 4O3YA 1SFOI 3FQQA 4BY1I 2XG6A 1W2BZ 3GKQA 1YIJZ 1VQ7Z 1GFMA 2XE2A 3OW2Y 2KPIA 3HOWI 1VQ41 7PRNA 3KVDD 2O4HA 2QLVB 2QA41 1P4TA 1KQSY 2RBLA 2NVTI 2JA7I 1Q822 3C5OA 3LUSA 3CXCZ 4KRAA 4AFKA 2EGTA 5DL6A 1YJ9Z 3DA3A 4O4XA 3GTJI 2N2MA 1OSMA 3LK3A 3RZDI 2GTHA 3HKZA 3BG0B 1Q861 1JJ2Y 5D1PA 3AAEA 3A2SX 3UAQA 2NVXI 1Z02A 1YJWZ 2AKLA 1PFTA 3QRCA 4CL1A 1Z03A 1X0TA 3S16I 2HF1A 1RO2A 3FKII 4JCHA 1TWFI 3EMNX 4NBFA 4X6AI 4RVDA 4DGLA 4NFRA 3HW9A 4XNKA 1N8R2 4N58A 4AYID 2NVYI 1RO4A 3CC4Z 1BXWA 5PRNA 3QRAA 5G26A 3CMEZ 2JA5I 4E2ZA 3G6EZ 4FOZA 1E54A 2OZKA 2Q51A 3GTQI 1IZNA 2E9HA 4LSEA 3VE1A 3IFUA 2RHBA 3SY9A 1ZH1A 3AA0A 4RJXA 1QJPA 3S2DI 2XMXA 1MPFA 3AAEB 4D65A 1QVGZ 2J4UP 2RT9A 1YUKA 3AA0B 4AUIA 2IZ3A 2RPRA 3HOVI 3POXA 1OPFA 1YJN1 2RIQA 3CCS1 3IX0A 3LK42 2V8IA 3S2HI 1K8A1 3PQSA 3S1MI 2J6AA 2YNKA 1QF8A 4FRXA 3VY9X 2OTL1 2F1TA 1Y1WI 4GF4A 2VF1A 2P28A 1VQO1 3F3PC 3SYBA 4FSPA 2YPVA 2F1VA 1ZHZA 2KZ7B 4RJWA 3FQMA 3CPWY 2ODJA 2FGRA 1G90A 2R7ZI 3CCU1 3J80b 1M1K1 3HOLA 4U9CA 2GE4A 1MM5A 4A3FI 1Q7Y2 1YI2Z 3HOZI 1GFPA 1I50I 1HXXA 3GTKI 2XE5A 1H6S1 3G4SZ 3CCJZ 3GTMS 3TDHB 2OTLZ 4O4UA 1VQ6Z 2M48A 3NH5A 2JS4A 3U50C 3LK3B 3I4NI 2VUGA 3P5JB 3AA1A 4G75A 4N59A 2BJOA 4RLCA 4LSIA 5D1OA 2OOXB 4E32A 3O0EA 3S15I 3GTMI 2Y2XA 4A3EI 2I3CA 3NH8A 1QVFZ 3HOEA 4FMSA 1QVGY 5FVNA 2MNHA 3I07A 3NDJA 1ZHWA 1BH3A 2PMZA 1QJ9A 3CCMZ 4NBAA 2KZ7A 3VE2A 3KIFA 1GFOA 1VLAA 1GFQA 4GCQA 1VQ71 4KR4A 2QRCB 4BBRI 3NH4A 4HH4A 3F3FC 4MXUA 3CCSZ 3MONA 4AYBA 3WI4A 4NBGA 4NBEA 3GTLI 1VQKZ 3DA4A 4QTTA 2G2KA 4HGYA 1YUAA 1ZB8A 4BBSI 2MHLA 1N2FA 3CCE1 1VQL1 4XNLA 4E2YA 1HXTA 3VMHA 4EWCA 2JMOA 3I55Z 1K9M1 4QTUA 2YU9I 5AFUK 4GHBA 1YIJ1 2XE1A 5AN9F 3MZLB 3J81f 4MH4A 2KC0A 1Q811 3M4OI 5EE2A 3CME1 1DL6A 4A93I 4O49A 1WIIA 1VQ9Z 1USPB 3CC41 2FGQX 5A2Qf 3NSGA 1THQA 1VQ91 4PUXA 4FSOA 1IZNB 2PRNA 5C3EI 1S721 4C69X 1N8R1 3S17I 3GP6A 1JWHC 2JUBA 3G71Z 1VQOZ 3J80f 3CPWZ 4FUVA 3QWUA 1VQMZ 4D5UA 5IT9b 1VQP1 2IZ4A 1VQPZ 2M07A 4MD8A 3CCR1 1K9M2 2DE7A 5C44I 5GV0A 4A3KI 4E30A 1QVFY 5AFUL 1HXUA 4NB9A 4LSHA 4NBHA 5IT9f 1TWCI 1RQFA 3CCVZ 1YI21 4NH1C 1VQ81 3K7AI 1Q7Y1 4XX2A 4HGZA 4E2WA 1M1K2 4DK1A 2K4TA 2Y0LA 1YIT1 3PORA 3HOXI 3D6WA 2XTRA 2PM9A 3BG1B 3CCLZ 3TE5B 3CCQ1 1X3WA 3CC7Z 2LHFA 3RZOI 5JDPA 2E2HI 3CCRZ 5FLXf 1NUIA 3WI5A 4AZLA 2VUMI 2XE3A 1RLYA 4NBCA 3CMAZ 3T4NB 3VMGA 3J7A4 2ZAEB 2QEXZ 5ADXK 2K5RA 2K3RA 5T6BA 3CC2Z 4MD9A 4RS4A 3POUA 4AYMC 3HOYI 2V8KA 4F4BA 2O53A 3CCUZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YS5 A;  3HOE A;  3UAQ A;  3PQS A;  2KDY A;  4O3Y A;  4AYE C;  2W81 C;  4QQ1 A;  2LFU A;  3VE2 A;  4O4U A;  3VE1 A;  3PQU A;  4O3X B;  3KVD D;  4O3Z A;  2YPV A;  2KC0 A;  4AYN A;  2Y7S A;  5EE2 A;  3V8U A;  4AYI D;  4O49 A;  4Z3T A;  3HOL A;  4AYM C;  2W80 C;  4U9C A;  4O4X A;  4AYD C;  5T5F A;  4O3W A; 
#chains in the Genus database with same CATH topology
 3M3Y I;  1ORM A;  2X27 X;  1VQ5 Z;  4FZM A;  5D5D A;  5GTH O;  3J81 b;  3AA7 B;  2NVQ I;  1PRN A;  4GCP A;  3PO3 I;  3VMI A;  1VQN 1;  2XTQ A;  4E1S A;  4NBB A;  4RV9 A;  1NJI 2;  3CC7 1;  2M6N A;  3IR7 A;  4O3Z A;  4FES A;  2R4N A;  1TFI A;  3CCL 1;  2O4V A;  3G71 1;  1Z01 A;  3G6E 1;  5DL5 A;  3VZU X;  3CD6 Z;  3AA6 A;  3PO3 S;  3VY8 X;  1I3Q I;  4K3B A;  3IF8 A;  3S1R I;  1Q81 2;  3KZI O;  4TNU A;  2AXT O;  1FDO A;  2ZFG A;  2DE5 A;  2QEX 1;  5D1O B;  4PJ0 O;  5ADX L;  2GU2 A;  4AYE C;  3SY7 A;  2QA4 Z;  5IYU A;  4KR8 A;  1KQS Z;  2JA6 I;  2E2I I;  2R92 I;  3HOU I;  3CCM 1;  4O3X B;  5G39 A;  1ZHX A;  2JR6 A;  2QKD A;  3JTY A;  4GCS A;  1S72 Z;  2WJQ A;  4B61 A;  4FZN A;  1Q9G A;  2V8J A;  3KIH A;  1R9T I;  3GTO I;  4C00 A;  2Q4Z A;  2JQY A;  2W03 A;  4A3G I;  4E31 A;  4NBD A;  5C4J I;  1Q9F A;  2Y0K A;  4RLB A;  4E2X A;  1Y1V I;  2W04 A;  4D64 A;  4FT6 A;  3VTN A;  1Y1V S;  1SIW A;  3CMA 1;  1ML8 A;  2F4M A;  1TWA I;  3LK2 A;  3RBH A;  1VQ4 Z;  1RNI A;  3T24 A;  3AA1 B;  3CCJ 1;  5B5E O;  2B63 I;  3G4S 1;  2DE6 A;  3AA6 B;  1VQ5 1;  2JMM A;  3I56 Z;  3DWO X;  2QRE B;  1YJN Z;  3H0G I;  4RVG A;  1S5L O;  3CXC Y;  4A3D I;  3WU2 O;  4Z3T A;  1YHQ Z;  3JAM f;  1ZB9 A;  4A3C I;  3FYX A;  3ESW A;  2YAD A;  5T64 A;  1YHQ 1;  4BY7 I;  1NP6 A;  3SYS A;  4Y52 I;  1WCM I;  2OMF A;  1RO0 A;  2WB1 A;  2E7Z A;  3GCF A;  1K73 1;  3POQ A;  3GTP I;  2W81 C;  3BS0 A;  1BT9 A;  4NB8 A;  1P9N A;  2J1N A;  4FZL A;  4A3J I;  2N2L A;  4BXX I;  3I55 1;  3OW2 Z;  1T1L A;  4S1T A;  4AKM A;  2M06 A;  1Q86 2;  1KC8 1;  3H3V J;  3BRZ A;  1M90 1;  2Y7S A;  3G7G A;  1S7M A;  3V8U A;  3I4M I;  1YIT Z;  2KXP A;  2OTJ 1;  4G76 A;  6PRN A;  2QRD B;  4UB8 O;  8PRN A;  2LIY A;  3NDI A;  1L1O C;  5LL6 f;  1VQK 1;  4AKR B;  2IV2 X;  4IL6 O;  2GTI A;  1VQ6 1;  1MM4 A;  5KAF O;  2Y0S A;  1X3Z A;  3EED A;  3UPG A;  4QQ1 A;  1I6H I;  3D9X A;  4AKR A;  3CCQ Z;  2R4L A;  5DL7 A;  3AAA A;  2KXP B;  3SZV A;  1K8A 2;  2F4O A;  1YJW 1;  2K0L A;  4JFB A;  3LK4 1;  1WZN A;  3S1N I;  4AYN A;  2OOY B;  2P3Y A;  3VB9 A;  4RL9 A;  2W80 C;  1KRL A;  1PHO A;  2F1C X;  3JAM b;  1VQ8 Z;  5IP9 I;  5FLM I;  3T0S A;  2OTJ Z;  4AYD C;  3LK2 B;  1ZHT A;  2R6M A;  2JIQ A;  5IP7 I;  3VZW X;  3TZG A;  2H85 A;  3K19 A;  3I56 1;  4FRT A;  2KDY A;  3HWB A;  5B66 O;  5C4X I;  2IWW A;  1GFN A;  1KD1 1;  4FQE A;  5KAI O;  2LFU A;  2R93 I;  4MRI A;  2JIP A;  4PR7 A;  1VQN Z;  2R88 A;  1TWG I;  2JA8 I;  1JJ2 Z;  3MZK B;  1VQM 1;  3T20 A;  1USP A;  1K83 I;  3NFZ A;  4A3M I;  3VZT X;  2PK7 A;  4BUM X;  3CCE Z;  1VQL Z;  3PRN A;  2JNY A;  5A2Q b;  5DL8 A;  3CD6 1;  3PO2 I;  1QYP A;  2VPY A;  5FLX b;  4O3W A;  3S14 I;  5CM2 M;  3CC2 1;  3CCV 1;  2E2J I;  4Y7N I;  1AA6 A;  1M90 2;  3SZD A;  1KC8 2;  3GTG I;  2ZLD A;  3AAA B;  3Q87 A;  4RVF A;  4A3I I;  1NJI 1;  2R8A A;  1KD1 2;  4A3B I;  1QJ8 A;  3PQU A;  4A3L I;  4MD7 A;  2KI7 B;  5T67 A;  4E33 A;  3AA7 A;  2JIM A;  2QTK A;  1ZHY A;  1K73 2;  1LQL A;  4N74 A;  2Y0H A;  4NOZ A;  4DQY B;  3S1Q I;  1TWH I;  4MON A;  4C4V B;  4LSF A;  1YJ9 1;  3EER A;  1WW9 A;  2ERV A;  4RVH A;  2HU9 A;  1Q82 1;  5T5F A;  2QR1 B;  2WAQ A;  3CQZ I;  1YS5 A;  3UU2 A;  4E1T A;  1W2B Y;  2POR A;  4O3Y A;  1SFO I;  3FQQ A;  4BY1 I;  2XG6 A;  1W2B Z;  3GKQ A;  1YIJ Z;  4C4V A;  1VQ7 Z;  1GFM A;  3PGS A;  2XE2 A;  2LEX A;  3OW2 Y;  2KPI A;  2V3V A;  3HOW I;  1VQ4 1;  7PRN A;  3KVD D;  2O4H A;  1T16 A;  2QLV B;  2QA4 1;  1P4T A;  1KQS Y;  2RBL A;  2NVT I;  2JA7 I;  1Q82 2;  3C5O A;  3LUS A;  3CXC Z;  4KRA A;  4AFK A;  2EGT A;  5DL6 A;  1YJ9 Z;  3DA3 A;  4O4X A;  3GTJ I;  2N2M A;  1OSM A;  3LK3 A;  5H2F O;  3RZD I;  2GTH A;  3HKZ A;  3BG0 B;  1Q86 1;  1JJ2 Y;  5D1P A;  3AAE A;  3A2S X;  3UAQ A;  2NVX I;  1Z02 A;  1YJW Z;  2AKL A;  1PFT A;  3QRC A;  4CL1 A;  3A0B O;  1Z03 A;  1X0T A;  3S16 I;  2NAP A;  2HF1 A;  1RO2 A;  3FKI I;  4JCH A;  1TWF I;  3EMN X;  4NBF A;  4X6A I;  4RVD A;  4DGL A;  4NFR A;  3HW9 A;  4XNK A;  4UB6 O;  1N8R 2;  4N58 A;  4AYI D;  2NVY I;  1RO4 A;  3CC4 Z;  1BXW A;  5PRN A;  3QRA A;  5G26 A;  3BRY A;  3CME Z;  2JA5 I;  4E2Z A;  3G6E Z;  4FOZ A;  1E54 A;  2OZK A;  4CTD A;  2Q51 A;  3GTQ I;  1IZN A;  2E9H A;  4LSE A;  3VE1 A;  3IFU A;  2AYD A;  2RHB A;  2R4P A;  3SY9 A;  1ZH1 A;  3AA0 A;  4RJX A;  1QJP A;  3S2D I;  2XMX A;  1MPF A;  3AAE B;  4D65 A;  1QVG Z;  1WJ2 A;  2RT9 A;  2J4U P;  1YUK A;  2VPW A;  3AA0 B;  4AUI A;  2IZ3 A;  2RPR A;  3HOV I;  3POX A;  1OPF A;  1YJN 1;  2RIQ A;  3CCS 1;  3IX0 A;  3LK4 2;  2V8I A;  3S2H I;  1K8A 1;  3PQS A;  3S1M I;  2J6A A;  2YNK A;  1QF8 A;  4FRX A;  2X9K A;  5GTI O;  3VY9 X;  2OTL 1;  2F1T A;  1Y1W I;  4GF4 A;  2VF1 A;  2P28 A;  1VQO 1;  3F3P C;  3PF1 A;  3SYB A;  4FSP A;  2YPV A;  2F1V A;  1ZHZ A;  2KZ7 B;  4RJW A;  3FQM A;  3CPW Y;  2ODJ A;  2FGR A;  1G90 A;  2R7Z I;  3CCU 1;  3J80 b;  1M1K 1;  3HOL A;  4U9C A;  1QXF A;  2GE4 A;  1MM5 A;  4A3F I;  1Q7Y 2;  1YI2 Z;  3HOZ I;  1GFP A;  5G3A A;  1I50 I;  1HXX A;  1FDI A;  3GTK I;  2XE5 A;  1H6S 1;  3G4S Z;  3CCJ Z;  4K3C A;  3GTM S;  3TDH B;  2OTL Z;  4O4U A;  1VQ6 Z;  2M48 A;  2R4O A;  3NH5 A;  2JS4 A;  3U50 C;  3DWN A;  3LK3 B;  2VPZ A;  3I4N I;  2VUG A;  3NJT A;  3P5J B;  3AA1 A;  4G75 A;  4N59 A;  2BJO A;  4RLC A;  4LSI A;  5D1O A;  2OOX B;  4E32 A;  3O0E A;  3S15 I;  3GTM I;  2Y2X A;  4A3E I;  2I3C A;  3NH8 A;  1QVF Z;  3HOE A;  4FMS A;  1QVG Y;  5FVN A;  2MNH A;  3I07 A;  3NDJ A;  1ZHW A;  1BH3 A;  2PMZ A;  1QJ9 A;  3CCM Z;  4NBA A;  2KZ7 A;  3VE2 A;  3JCU O;  3KIF A;  1GFO A;  1VLA A;  1GFQ A;  3PGR A;  4GCQ A;  1VQ7 1;  4KR4 A;  2QRC B;  4BBR I;  3NH4 A;  4HH4 A;  3F3F C;  4MXU A;  3CCS Z;  3MON A;  4AYB A;  3WI4 A;  4NBG A;  4NBE A;  3GTL I;  1VQK Z;  3DA4 A;  4QTT A;  2G2K A;  4HGY A;  1YUA A;  1ZB8 A;  4BBS I;  2MHL A;  1N2F A;  3CCE 1;  1VQL 1;  4XNL A;  2R89 A;  4E2Y A;  1HXT A;  3VMH A;  4EWC A;  2JMO A;  3I55 Z;  1K9M 1;  4QTU A;  2YU9 I;  5AFU K;  4GHB A;  1YIJ 1;  2XE1 A;  5AN9 F;  3MZL B;  3J81 f;  3D2L A;  4MH4 A;  2KC0 A;  1Q81 1;  3M4O I;  5EE2 A;  3CME 1;  1DL6 A;  4A93 I;  5TIS O;  4O49 A;  3PGU A;  1WII A;  1VQ9 Z;  1USP B;  3CC4 1;  2FGQ X;  5A2Q f;  3NSG A;  1THQ A;  1VQ9 1;  4PUX A;  4FSO A;  1IZN B;  2PRN A;  5C3E I;  1S72 1;  4C69 X;  1N8R 1;  3S17 I;  3GP6 A;  1JWH C;  2JUB A;  3G71 Z;  5E79 O;  1VQO Z;  3J80 f;  3CPW Z;  4FUV A;  3QWU A;  1VQM Z;  4D5U A;  5IT9 b;  1VQP 1;  2IZ4 A;  1VQP Z;  2M07 A;  4MD8 A;  3CCR 1;  1K9M 2;  2DE7 A;  5C44 I;  5GV0 A;  2V45 A;  4A3K I;  4E30 A;  3DZM A;  1QVF Y;  5AFU L;  4N75 A;  1HXU A;  4NB9 A;  4LSH A;  4NBH A;  5IT9 f;  1TWC I;  1RQF A;  3CCV Z;  1YI2 1;  4NH1 C;  1Y8C A;  1VQ8 1;  2JIR A;  2VPX A;  3K7A I;  2JIO A;  1Q7Y 1;  1Q16 A;  4XX2 A;  4HGZ A;  4E2W A;  1M1K 2;  4DK1 A;  2K4T A;  2Y0L A;  1YIT 1;  3A0H O;  3HOX I;  3POR A;  3D6W A;  2XTR A;  2PM9 A;  5G38 A;  3BG1 B;  3CCL Z;  3TE5 B;  3CCQ 1;  1X3W A;  3CC7 Z;  2LHF A;  3RZO I;  5JDP A;  2E2H I;  3CCR Z;  5FLX f;  1NUI A;  2IWV A;  3WI5 A;  4AZL A;  2VUM I;  2XE3 A;  1RLY A;  4NBC A;  3CMA Z;  3T4N B;  3VMG A;  3J7A 4;  2ZAE B;  2QEX Z;  5ADX K;  2K5R A;  2K3R A;  5T6B A;  3CC2 Z;  4MD9 A;  4RS4 A;  3POU A;  4AYM C;  3HOY I;  2WJR A;  2V8K A;  4F4B A;  2WVP A;  2O53 A;  3CCU Z; 
#chains in the Genus database with same CATH homology
 3M3Y I;  1ORM A;  2X27 X;  1VQ5 Z;  4FZM A;  5D5D A;  3J81 b;  3AA7 B;  2NVQ I;  1PRN A;  4GCP A;  3PO3 I;  3VMI A;  1VQN 1;  2XTQ A;  4E1S A;  4NBB A;  4RV9 A;  1NJI 2;  3CC7 1;  2M6N A;  4O3Z A;  4FES A;  1TFI A;  3CCL 1;  2O4V A;  3G71 1;  1Z01 A;  3G6E 1;  5DL5 A;  3VZU X;  3CD6 Z;  3AA6 A;  3PO3 S;  3VY8 X;  1I3Q I;  3IF8 A;  3S1R I;  1Q81 2;  4TNU A;  2ZFG A;  2DE5 A;  2QEX 1;  5D1O B;  5ADX L;  2GU2 A;  4AYE C;  3SY7 A;  2QA4 Z;  5IYU A;  4KR8 A;  1KQS Z;  2JA6 I;  2E2I I;  2R92 I;  3HOU I;  3CCM 1;  4O3X B;  1ZHX A;  2JR6 A;  2QKD A;  3JTY A;  4GCS A;  1S72 Z;  4B61 A;  4FZN A;  1Q9G A;  2V8J A;  3KIH A;  1R9T I;  3GTO I;  2Q4Z A;  2W03 A;  4A3G I;  4E31 A;  4NBD A;  5C4J I;  1Q9F A;  2Y0K A;  4RLB A;  4E2X A;  1Y1V I;  2W04 A;  4D64 A;  4FT6 A;  3VTN A;  1Y1V S;  3CMA 1;  1ML8 A;  2F4M A;  1TWA I;  3LK2 A;  3RBH A;  1VQ4 Z;  1RNI A;  3T24 A;  3AA1 B;  3CCJ 1;  2B63 I;  3G4S 1;  2DE6 A;  3AA6 B;  1VQ5 1;  2JMM A;  3I56 Z;  1YJN Z;  2QRE B;  3H0G I;  4RVG A;  3CXC Y;  4A3D I;  4Z3T A;  1YHQ Z;  1ZB9 A;  3JAM f;  4A3C I;  3FYX A;  3ESW A;  2YAD A;  5T64 A;  1YHQ 1;  4BY7 I;  1NP6 A;  3SYS A;  4Y52 I;  1WCM I;  2OMF A;  1RO0 A;  2WB1 A;  3GCF A;  1K73 1;  3POQ A;  3GTP I;  2W81 C;  1BT9 A;  4NB8 A;  1P9N A;  2J1N A;  4FZL A;  4A3J I;  2N2L A;  4BXX I;  3I55 1;  3OW2 Z;  4AKM A;  4S1T A;  2M06 A;  1Q86 2;  1KC8 1;  3H3V J;  1M90 1;  2Y7S A;  3G7G A;  1S7M A;  3V8U A;  3I4M I;  1YIT Z;  2KXP A;  2OTJ 1;  4G76 A;  6PRN A;  2QRD B;  8PRN A;  2LIY A;  3NDI A;  1L1O C;  5LL6 f;  1VQK 1;  4AKR B;  2GTI A;  1VQ6 1;  1MM4 A;  2Y0S A;  1X3Z A;  3EED A;  3UPG A;  4QQ1 A;  1I6H I;  3D9X A;  4AKR A;  3CCQ Z;  5DL7 A;  3AAA A;  2KXP B;  3SZV A;  1K8A 2;  2F4O A;  1YJW 1;  2K0L A;  4JFB A;  3LK4 1;  3S1N I;  4AYN A;  2OOY B;  2P3Y A;  3VB9 A;  4RL9 A;  2W80 C;  1KRL A;  1PHO A;  3JAM b;  1VQ8 Z;  5IP9 I;  5FLM I;  3T0S A;  2OTJ Z;  4AYD C;  3LK2 B;  1ZHT A;  2R6M A;  5IP7 I;  3VZW X;  3TZG A;  2H85 A;  3K19 A;  3I56 1;  4FRT A;  2KDY A;  3HWB A;  5C4X I;  1GFN A;  1KD1 1;  2LFU A;  2R93 I;  4MRI A;  1VQN Z;  1TWG I;  2JA8 I;  1JJ2 Z;  3MZK B;  1VQM 1;  3T20 A;  1USP A;  1K83 I;  3NFZ A;  4A3M I;  3VZT X;  2PK7 A;  4BUM X;  3CCE Z;  1VQL Z;  3PRN A;  2JNY A;  5A2Q b;  5DL8 A;  3CD6 1;  3PO2 I;  1QYP A;  5FLX b;  4O3W A;  3S14 I;  5CM2 M;  3CC2 1;  3CCV 1;  2E2J I;  4Y7N I;  1M90 2;  3SZD A;  1KC8 2;  3GTG I;  2ZLD A;  3AAA B;  3Q87 A;  4RVF A;  4A3I I;  1NJI 1;  1KD1 2;  4A3B I;  1QJ8 A;  3PQU A;  4A3L I;  4MD7 A;  2KI7 B;  5T67 A;  4E33 A;  3AA7 A;  2QTK A;  1ZHY A;  1K73 2;  1LQL A;  2Y0H A;  4NOZ A;  4DQY B;  3S1Q I;  1TWH I;  4MON A;  4LSF A;  1YJ9 1;  3EER A;  1WW9 A;  2ERV A;  4RVH A;  2HU9 A;  1Q82 1;  5T5F A;  2QR1 B;  2WAQ A;  3CQZ I;  1YS5 A;  3UU2 A;  4E1T A;  1W2B Y;  2POR A;  4O3Y A;  1SFO I;  3FQQ A;  4BY1 I;  2XG6 A;  1W2B Z;  3GKQ A;  1YIJ Z;  1VQ7 Z;  1GFM A;  2XE2 A;  3OW2 Y;  2KPI A;  3HOW I;  1VQ4 1;  7PRN A;  3KVD D;  2O4H A;  2QLV B;  2QA4 1;  1P4T A;  1KQS Y;  2RBL A;  2NVT I;  2JA7 I;  1Q82 2;  3C5O A;  3LUS A;  3CXC Z;  4KRA A;  4AFK A;  2EGT A;  5DL6 A;  1YJ9 Z;  3DA3 A;  4O4X A;  3GTJ I;  2N2M A;  1OSM A;  3LK3 A;  3RZD I;  2GTH A;  3HKZ A;  3BG0 B;  1Q86 1;  1JJ2 Y;  5D1P A;  3AAE A;  3A2S X;  3UAQ A;  2NVX I;  1Z02 A;  1YJW Z;  2AKL A;  1PFT A;  3QRC A;  4CL1 A;  1Z03 A;  1X0T A;  3S16 I;  2HF1 A;  1RO2 A;  3FKI I;  4JCH A;  1TWF I;  3EMN X;  4NBF A;  4X6A I;  4RVD A;  4DGL A;  4NFR A;  3HW9 A;  4XNK A;  1N8R 2;  4N58 A;  4AYI D;  2NVY I;  1RO4 A;  3CC4 Z;  1BXW A;  5PRN A;  3QRA A;  5G26 A;  3CME Z;  2JA5 I;  4E2Z A;  3G6E Z;  4FOZ A;  1E54 A;  2OZK A;  2Q51 A;  3GTQ I;  1IZN A;  2E9H A;  4LSE A;  3VE1 A;  3IFU A;  2RHB A;  3SY9 A;  1ZH1 A;  3AA0 A;  4RJX A;  1QJP A;  3S2D I;  2XMX A;  1MPF A;  3AAE B;  4D65 A;  1QVG Z;  2J4U P;  2RT9 A;  1YUK A;  3AA0 B;  4AUI A;  2IZ3 A;  2RPR A;  3HOV I;  3POX A;  1OPF A;  1YJN 1;  2RIQ A;  3CCS 1;  3IX0 A;  3LK4 2;  2V8I A;  3S2H I;  1K8A 1;  3PQS A;  3S1M I;  2J6A A;  2YNK A;  1QF8 A;  4FRX A;  3VY9 X;  2OTL 1;  2F1T A;  1Y1W I;  4GF4 A;  2VF1 A;  2P28 A;  1VQO 1;  3F3P C;  3SYB A;  4FSP A;  2YPV A;  2F1V A;  1ZHZ A;  2KZ7 B;  4RJW A;  3FQM A;  3CPW Y;  2ODJ A;  2FGR A;  1G90 A;  2R7Z I;  3CCU 1;  3J80 b;  1M1K 1;  3HOL A;  4U9C A;  2GE4 A;  1MM5 A;  4A3F I;  1Q7Y 2;  1YI2 Z;  3HOZ I;  1GFP A;  1I50 I;  1HXX A;  3GTK I;  2XE5 A;  1H6S 1;  3G4S Z;  3CCJ Z;  3GTM S;  3TDH B;  2OTL Z;  4O4U A;  1VQ6 Z;  2M48 A;  3NH5 A;  2JS4 A;  3U50 C;  3LK3 B;  3I4N I;  2VUG A;  3P5J B;  3AA1 A;  4G75 A;  4N59 A;  2BJO A;  4RLC A;  4LSI A;  5D1O A;  2OOX B;  4E32 A;  3O0E A;  3S15 I;  3GTM I;  2Y2X A;  4A3E I;  2I3C A;  3NH8 A;  1QVF Z;  3HOE A;  4FMS A;  1QVG Y;  5FVN A;  2MNH A;  3I07 A;  3NDJ A;  1ZHW A;  1BH3 A;  2PMZ A;  1QJ9 A;  3CCM Z;  4NBA A;  2KZ7 A;  3VE2 A;  3KIF A;  1GFO A;  1VLA A;  1GFQ A;  4GCQ A;  1VQ7 1;  4KR4 A;  2QRC B;  4BBR I;  3NH4 A;  4HH4 A;  3F3F C;  4MXU A;  3CCS Z;  3MON A;  4AYB A;  3WI4 A;  4NBG A;  4NBE A;  3GTL I;  1VQK Z;  3DA4 A;  4QTT A;  2G2K A;  4HGY A;  1YUA A;  1ZB8 A;  4BBS I;  2MHL A;  1N2F A;  3CCE 1;  1VQL 1;  4XNL A;  4E2Y A;  1HXT A;  3VMH A;  4EWC A;  2JMO A;  3I55 Z;  1K9M 1;  4QTU A;  2YU9 I;  5AFU K;  4GHB A;  1YIJ 1;  2XE1 A;  5AN9 F;  3MZL B;  3J81 f;  4MH4 A;  2KC0 A;  1Q81 1;  3M4O I;  5EE2 A;  3CME 1;  1DL6 A;  4A93 I;  4O49 A;  1WII A;  1VQ9 Z;  1USP B;  3CC4 1;  2FGQ X;  5A2Q f;  3NSG A;  1THQ A;  1VQ9 1;  4PUX A;  4FSO A;  1IZN B;  2PRN A;  5C3E I;  1S72 1;  4C69 X;  1N8R 1;  3S17 I;  3GP6 A;  1JWH C;  2JUB A;  3G71 Z;  1VQO Z;  3J80 f;  3CPW Z;  4FUV A;  3QWU A;  1VQM Z;  4D5U A;  5IT9 b;  1VQP 1;  2IZ4 A;  1VQP Z;  2M07 A;  4MD8 A;  3CCR 1;  1K9M 2;  2DE7 A;  5C44 I;  5GV0 A;  4A3K I;  4E30 A;  1QVF Y;  5AFU L;  1HXU A;  4NB9 A;  4LSH A;  4NBH A;  5IT9 f;  1TWC I;  1RQF A;  3CCV Z;  1YI2 1;  4NH1 C;  1VQ8 1;  3K7A I;  1Q7Y 1;  4XX2 A;  4HGZ A;  4E2W A;  1M1K 2;  4DK1 A;  2K4T A;  2Y0L A;  1YIT 1;  3POR A;  3HOX I;  3D6W A;  2XTR A;  2PM9 A;  3BG1 B;  3CCL Z;  3TE5 B;  3CCQ 1;  1X3W A;  3CC7 Z;  2LHF A;  3RZO I;  5JDP A;  2E2H I;  3CCR Z;  5FLX f;  1NUI A;  3WI5 A;  4AZL A;  2VUM I;  2XE3 A;  1RLY A;  4NBC A;  3CMA Z;  3T4N B;  3VMG A;  3J7A 4;  2ZAE B;  2QEX Z;  5ADX K;  2K5R A;  2K3R A;  5T6B A;  3CC2 Z;  4MD9 A;  4RS4 A;  3POU A;  4AYM C;  3HOY I;  2V8K A;  4F4B A;  2O53 A;  3CCU Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...