2LFUA

The structure of a n. meningitides protein targeted for vaccine development
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
160
structure length
160
Chain Sequence
b'NIFAPEGNYRYLTYGAEKLPGGSYALRVQGEPAKGEMLAGTAVYNGEVLHFHTENGRPYPTRGRFAAKVDFGSKSVDGIIDSGDDLHMGTQKFKAAIDGNGFKGTWTENGGGDVSGRFYGPAGEEVAGKYSYRPTDAEKGGFGVFAGKKEQDLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gna2132
publication title Structure of the C-terminal Domain of Neisseria Heparin Binding Antigen (NHBA), One of the Main Antigens of a Novel Vaccine against Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Membrane protein
total genus 22
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2011-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01298 TbpB_B_D C-lobe and N-lobe beta barrels of Tf-binding protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.380 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2lfuA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2lfuA02
3VE2A 2Y7SA 4U9CA 4AYDC 3KVDD 2W81C 3PQUA 1YS5A 3VE1A 2LFUA 3V8UA 2KC0A 4AYID 4Z3TA 4O3XB 3PQSA 2W80C 3HOLA 4QQ1A 4AYMC 2KDYA 4O3WA 4O3ZA 4AYNA 2YPVA 4AYEC 3UAQA 4O49A 5EE2A 4O4UA 5T5FA 4O3YA 4O4XA 3HOEA
chains in the Genus database with same CATH superfamily
1X3ZA 2PORA 2Y7SA 1VQMZ 2XTRA 3LK3A 4PJ0O 2VUGA 5GTHO 4NBAA 3I55Z 1Q862 4FESA 1NJI2 3G4S1 1Q861 3D2LA 2OOXB 1NJI1 1MM5A 1L1OC 3AAEA 3AA7A 4AKRB 4RVDA 4NBEA 4E1SA 2QTKA 3NH4A 2V3VA 2QEX1 3G4SZ 3DA3A 3POUA 1HXTA 2F1TA 3S1QI 3UPGA 2JA5I 5FLXf 3CCS1 3GTLI 5IP9I 1PHOA 5AFUL 5AFUK 3VZUX 5TISO 2QEXZ 3AA1B 4XNLA 2Y0SA 2O53A 1S5LO 3FYXA 5ADXL 3CCSZ 2LHFA 4DQYB 1QYPA 2EGTA 2YNKA 3EEDA 3VE1A 4MRIA 2KZ7B 4A3FI 1SFOI 2M06A 2F1VA 1Q9FA 2WB1A 2R8AA 3BS0A 1YI2Z 3PO2I 4E2XA 3NDIA 1QJ8A 3NJTA 2QRCB 4FZNA 4CTDA 2VPWA 4HH4A 4DGLA 2R89A 3CQZI 1N8R2 3CPWY 2E2II 1ZHTA 1Q822 2BJOA 1K83I 4N75A 3G711 3CCU1 1Q821 4A3KI 2KXPA 4AYBA 3KIFA 3AA0B 2JQYA 2Y0KA 5FVNA 2XMXA 5FLXb 3G71Z 3CCUZ 1VQL1 3HOXI 3M3YI 3CPWZ 4FZMA 2OTJZ 4NBDA 3J81f 2Q51A 4E2WA 2QREB 2VUMI 1ZH1A 1VQLZ 2KDYA 2QKDA 4O3WA 1DL6A 3DWNA 2JIMA 4RJXA 1LQLA 2P28A 1Z01A 1BH3A 3IFUA 3QRCA 4O49A 5DL8A 3CCE1 1X0TA 3PGUA 5GTIO 1THQA 2GTHA 4BBRI 1K8A2 3SYBA 4FT6A 2QR1B 4FSOA 1K8A1 5D1PA 4GHBA 5G38A 4AUIA 2V8KA 3VMGA 3CCEZ 1IZNA 3EMNX 4E31A 1AA6A 3SYSA 2AYDA 3VTNA 4Z3TA 1E54A 2V8IA 4AFKA 3RZDI 4RJWA 2K3RA 2ZLDA 3VMIA 2W04A 1USPB 3HOWI 4G76A 3WU2O 3LK2B 2OMFA 1FDOA 3J81b 2JA8I 1VQN1 3H0GI 3S1NI 2JIRA 3CMA1 2Y2XA 3GTKI 1Q7Y2 1ORMA 2WAQA 3SZVA 4KRAA 2F1CX 1RO2A 3RBHA 5DL7A 3J7A4 2QA41 1KQSY 1VQNZ 2QLVB 5IYUA 4AYID 3CMAZ 3PGRA 2R4PA 4FOZA 4HGYA 3PQSA 1GFMA 4N58A 4QQ1A 2GU2A 3TZGA 3BG0B 3HKZA 3LK3B 5E79O 4AYNA 3I56Z 3AAAA 2R88A 3S1MI 3H3VJ 1VQ71 5DL6A 5IT9b 3VMHA 4MD9A 1KQSZ 3AAEB 3KIHA 1YJWZ 3AA7B 5T64A 1ZHYA 3QRAA 1RLYA 1K9M2 4AZLA 4E1TA 1K9M1 1VQ7Z 5G3AA 1GFOA 1WJ2A 8PRNA 3JTYA 1YS5A 4JCHA 2X27X 1VLAA 4MONA 3GTJI 2XE2A 3C5OA 2O4HA 2WJRA 3JCUO 1RNIA 4E33A 2Q4ZA 2JIPA 1GFQA 3CC21 4Y52I 1NUIA 1YUKA 3D6WA 3K7AI 1OPFA 2JIQA 4FSPA 2W03A 2NAPA 6PRNA 1T16A 2JA7I 2V45A 3CCJ1 1Z03A 3CC2Z 4UB8O 2DE6A 4K3CA 2HF1A 3T24A 3Q87A 3PRNA 3F3PC 4A3EI 3A0BO 5D5DA 4E32A 5JDPA 3MZKB 5ADXK 5D1OA 4D64A 1WIIA 2OOYB 3CCJZ 2ERVA 3IX0A 1NP6A 2KC0A 3PO3I 3FKII 5LL6f 4MH4A 1S721 3WI5A 3DWOX 3CC71 1ZHZA 2V8JA 4NBHA 2RIQA 2R4OA 2E2JI 4GF4A 4BY7I 5B5EO 4NBGA 2E2HI 3IR7A 1N8R1 3GTQI 3J80b 4A3LI 4RLCA 3S2DI 3MZLB 3CC7Z 2IZ3A 4O3YA 2XE5A 1I6HI 1ZB9A 2IZ4A 1RQFA 4AKRA 1H6S1 5FLMI 2VPZA 4FMSA 2NVXI 2R6MA 2M48A 4A3CI 1JWHC 1RO0A 1YJ91 1PRNA 3A2SX 3HWBA 4LSFA 4RS4A 4A3BI 2R4NA 3BG1B 4N59A 1QJ9A 3CCV1 4RVGA 1Q9GA 3AA1A 3HOLA 1YJ9Z 1MM4A 4HGZA 1TWCI 4RVHA 1IZNB 2R93I 5B66O 2DE5A 1Y1WI 4RV9A 4BXXI 3CCVZ 1KC82 3AA6B 4MD7A 2M6NA 3PO3S 3S14I 2MNHA 2NVYI 1QVFY 1M902 1KRLA 2JUBA 2R92I 3VE2A 4NFRA 4NBCA 4EWCA 4D5UA 2N2LA 3PORA 1S7MA 3M4OI 2LFUA 2Y0LA 3SY9A 3DZMA 4RL9A 3FQQA 2N2MA 5IT9f 2GTIA 2LIYA 2RBLA 3CD61 3AA0A 1VQ41 4G75A 1QVFZ 2YADA 1TWGI 1RO4A 4NBFA 4DK1A 2PK7A 3UAQA 1VQO1 3WI4A 5CM2M 1VQP1 4O4UA 4D65A 3BRZA 1VQ4Z 3S16I 5T5FA 3HOVI 4FQEA 1W2BY 2K5RA 2AXTO 3P5JB 4K3BA 1ZB8A 1WCMI 1VQOZ 1Q7Y1 1VQPZ 4B61A 3CCR1 2GE4A 1Y8CA 2RT9A 1VQK1 2JR6A 3G7GA 2W80C 2XE3A 3K19A 4XX2A 2VF1A 3EERA 3F3FC 3CCRZ 2QA4Z 2MHLA 1I50I 1VQ51 1VQKZ 1W2BZ 5GV0A 4A3DI 3CCQ1 4LSHA 1X3WA 1GFPA 4C4VA 1SIWA 2E9HA 3VB9A 2P3YA 1VQ5Z 7PRNA 3CCQZ 3CXCY 2ZFGA 4NH1C 3T0SA 2ODJA 1USPA 1VQ91 4CL1A 4X6AI 1QVGY 3PQUA 1ML8A 3ESWA 3VZTX 2JMOA 4GCQA 1HXXA 5KAFO 5H2FO 3CCL1 4A3II 3J80f 4IL6O 4NB9A 1VQ9Z 1M1K2 2X9KA 4N74A 1BXWA 3RZOI 2ZAEB 5IP7I 2XTQA 5D1OB 3DA4A 4C69X 3CCLZ 3GKQA 3CXCZ 2LEXA 2YPVA 3S15I 1Z02A 1WZNA 3FQMA 3JAMf 3GTPI 2O4VA 1QVGZ 2E7ZA 3TE5B 2NVTI 1PFTA 1QJPA 1ZHWA 3NDJA 1JJ2Y 4XNKA 3HOEA 1QXFA 1YJN1 3G6E1 2XE1A 2W81C 2FGQX 3OW2Y 3GTGI 4BUMX 2IV2X 4AKMA 2H85A 1YJNZ 4BY1I 2YU9I 2F4OA 2PMZA 3G6EZ 2KXPB 1WW9A 5T6BA 3POQA 1JJ2Z 4LSIA 4A3MI 1BT9A 1YIT1 3S2HI 4RLBA 3U50C 3I4MI 1N2FA 1S72Z 3GTMI 1Q16A 3OW2Z 1YUAA 4O4XA 4JFBA 4A3GI 1YI21 2PM9A 5KAIO 1YITZ 4E2ZA 4A3JI 2B63I 2IWVA 4E2YA 1FDIA 5G39A 3V8UA 3JAMb 4KR4A 4BBSI 1HXUA 4O3XB 2OTL1 3LUSA 4AYMC 2J4UP 2QRDB 4A93I 3KZIO 1GFNA 3SZDA 1P4TA 2OTLZ 2VPYA 3O0EA 5AN9F 2KZ7A 3TDHB 1KC81 1T1LA 1I3QI 3IF8A 3HOUI 5C4JI 1K732 2Y0HA 2OTJ1 3NFZA 1Y1VI 1K731 1M901 3GCFA 4AYDC 1G90A 2XG6A 4GCPA 1P9NA 1Q812 4UB6O 3CC41 2F4MA 3T4NB 1Q811 3HOZI 2R7ZI 2KI7B 2K4TA 2FGRA 5PRNA 3GTMS 2M07A 5C4XI 2I3CA 4LSEA 1YHQ1 2J1NA 3GP6A 3CC4Z 3GTOI 3VZWX 3S1RI 2RPRA 3PGSA 4GCSA 1YHQZ 3BRYA 2PRNA 3POXA 3CD6Z 2R4LA 1R9TI 2DE7A 1QF8A 1ZHXA 3HOYI 2JS4A 4U9CA 5DL5A 3A0HO 5C3EI 3AA6A 3HW9A 5A2Qf 4C00A 3AAAB 4C4VB 2KPIA 4S1TA 4FZLA 2JA6I 3I07A 1YIJ1 3S17I 4FRTA 4NB8A 4TNUA 3PF1A 1Y1VS 4E30A 3CME1 2IWWA 3NH5A 2JNYA 1VQ81 4O3ZA 2NVQI 1YIJZ 4AYEC 4FRXA 1OSMA 3CMEZ 4RVFA 1KD12 2JIOA 2WVPA 3VY9X 2OZKA 1KD11 4F4BA 1VQ61 2WJQA 3LK42 3NSGA 4MD8A 1VQ8Z 3LK41 3CCM1 5T67A 5C44I 3I4NI 4FUVA 3KVDD 4QTUA 2RHBA 3VY8X 1MPFA 3MONA 4PR7A 1VQ6Z 3LK2A 4MXUA 2VPXA 2J6AA 3I561 2HU9A 3CCMZ 3UU2A 2JMMA 1TFIA 1TWHI 3T20A 3QWUA 1M1K1 1YJW1 1TWFI 3SY7A 4KR8A 5A2Qb 5G26A 2K0LA 4QTTA 2G2KA 4NOZA 1TWAI 1VQM1 4PUXA 5EE2A 4NBBA 2AKLA 3NH8A 3I551 3D9XA 4Y7NI
chains in the Genus database with same CATH topology
1X3ZA 2PORA 2Y7SA 1VQMZ 2XTRA 3LK3A 2VUGA 4NBAA 3I55Z 1Q862 4FESA 1NJI2 3G4S1 1Q861 1MM5A 2OOXB 1NJI1 1L1OC 3AAEA 3AA7A 4AKRB 4RVDA 4NBEA 4E1SA 2QTKA 3NH4A 3DA3A 2QEX1 3G4SZ 3POUA 1HXTA 2F1TA 3S1QI 3UPGA 2JA5I 5FLXf 3CCS1 3GTLI 5IP9I 1PHOA 5AFUL 5AFUK 3VZUX 2QEXZ 3AA1B 4XNLA 2Y0SA 2O53A 3FYXA 5ADXL 3CCSZ 2LHFA 4DQYB 1QYPA 2EGTA 2YNKA 3EEDA 3VE1A 4MRIA 2KZ7B 4A3FI 1SFOI 2M06A 2F1VA 1Q9FA 2WB1A 1YI2Z 3PO2I 4E2XA 3NDIA 1QJ8A 2QRCB 4FZNA 4HH4A 4DGLA 3CQZI 1N8R2 3CPWY 2E2II 1ZHTA 1Q822 2BJOA 1K83I 3G711 3CCU1 1Q821 4A3KI 2KXPA 4AYBA 3KIFA 3AA0B 2Y0KA 5FVNA 2XMXA 5FLXb 3G71Z 3CCUZ 1VQL1 3HOXI 3M3YI 3CPWZ 4FZMA 2OTJZ 4NBDA 3J81f 2Q51A 4E2WA 2QREB 2VUMI 1ZH1A 1VQLZ 2KDYA 2QKDA 4O3WA 1DL6A 4RJXA 1LQLA 2P28A 1Z01A 1BH3A 3IFUA 3QRCA 4O49A 5DL8A 3CCE1 1X0TA 1THQA 2GTHA 4BBRI 1K8A2 3SYBA 4FT6A 2QR1B 4FSOA 1K8A1 5D1PA 4GHBA 4AUIA 2V8KA 3VMGA 3CCEZ 1IZNA 3EMNX 4E31A 3SYSA 3VTNA 4Z3TA 1E54A 2V8IA 4AFKA 3RZDI 4RJWA 2K3RA 2ZLDA 3VMIA 2W04A 1USPB 3HOWI 4G76A 3LK2B 2OMFA 3J81b 2JA8I 1VQN1 3H0GI 3S1NI 3CMA1 2Y2XA 3GTKI 1Q7Y2 1ORMA 2WAQA 3SZVA 4KRAA 3RBHA 1RO2A 5DL7A 3J7A4 2QA41 1KQSY 1VQNZ 2QLVB 5IYUA 4AYID 3CMAZ 4FOZA 4HGYA 3PQSA 1GFMA 4N58A 4QQ1A 2GU2A 3TZGA 3BG0B 3HKZA 3LK3B 4AYNA 3I56Z 3AAAA 3S1MI 3H3VJ 1VQ71 5DL6A 5IT9b 3VMHA 4MD9A 1KQSZ 3AAEB 3KIHA 1YJWZ 3AA7B 5T64A 1ZHYA 3QRAA 1RLYA 1K9M2 4AZLA 4E1TA 1K9M1 1VQ7Z 8PRNA 1GFOA 3JTYA 1YS5A 4JCHA 2X27X 1VLAA 4MONA 3GTJI 2XE2A 3C5OA 2O4HA 1RNIA 4E33A 2Q4ZA 1GFQA 3CC21 4Y52I 1NUIA 1YUKA 3D6WA 3K7AI 1OPFA 4FSPA 2W03A 6PRNA 2JA7I 3CCJ1 1Z03A 3CC2Z 2DE6A 2HF1A 3T24A 3Q87A 3PRNA 3F3PC 4A3EI 5D5DA 4E32A 5JDPA 3MZKB 5ADXK 5D1OA 4D64A 1WIIA 2OOYB 3CCJZ 2ERVA 3IX0A 1NP6A 2KC0A 3PO3I 3FKII 5LL6f 4MH4A 1S721 3WI5A 3CC71 1ZHZA 2V8JA 4NBHA 2RIQA 2E2JI 4GF4A 4BY7I 4NBGA 2E2HI 4A3LI 1N8R1 3GTQI 3J80b 4RLCA 3S2DI 3MZLB 3CC7Z 2IZ3A 4O3YA 2XE5A 1I6HI 1ZB9A 2IZ4A 1RQFA 4AKRA 1H6S1 5FLMI 4FMSA 2NVXI 2R6MA 2M48A 4A3CI 1JWHC 1RO0A 1YJ91 1PRNA 3A2SX 3HWBA 4LSFA 4RS4A 4A3BI 3BG1B 4N59A 1QJ9A 3CCV1 4RVGA 1Q9GA 3AA1A 3HOLA 1YJ9Z 1MM4A 4HGZA 1TWCI 4RVHA 1IZNB 2R93I 2DE5A 1Y1WI 4RV9A 4BXXI 3CCVZ 1KC82 3AA6B 4MD7A 2M6NA 3PO3S 3S14I 2MNHA 2NVYI 1QVFY 1M902 1KRLA 2JUBA 2R92I 3VE2A 4NFRA 4NBCA 4EWCA 4D5UA 2N2LA 3PORA 1S7MA 3M4OI 2LFUA 2Y0LA 3SY9A 4RL9A 3FQQA 2N2MA 5IT9f 2GTIA 2LIYA 2RBLA 3CD61 3AA0A 1VQ41 4G75A 1QVFZ 2YADA 1TWGI 1RO4A 4NBFA 4DK1A 2PK7A 3UAQA 1VQO1 3WI4A 5CM2M 1VQP1 4O4UA 4D65A 1VQ4Z 3S16I 5T5FA 3HOVI 1W2BY 2K5RA 3P5JB 1ZB8A 1WCMI 1VQOZ 1Q7Y1 1VQPZ 4B61A 3CCR1 2GE4A 1VQK1 2RT9A 2JR6A 3G7GA 2W80C 2XE3A 3K19A 4XX2A 2VF1A 3EERA 3F3FC 3CCRZ 2QA4Z 2MHLA 1I50I 1VQ51 1VQKZ 1W2BZ 5GV0A 4A3DI 3CCQ1 4LSHA 1X3WA 1GFPA 2E9HA 3VB9A 2P3YA 1VQ5Z 7PRNA 3CCQZ 3CXCY 2ZFGA 4NH1C 3T0SA 2ODJA 1USPA 1VQ91 4CL1A 4X6AI 1QVGY 3PQUA 1ML8A 3ESWA 3VZTX 2JMOA 4GCQA 1HXXA 3CCL1 4A3II 3J80f 4NB9A 1VQ9Z 1M1K2 1BXWA 3RZOI 2ZAEB 5IP7I 2XTQA 5D1OB 3DA4A 4C69X 3CCLZ 3GKQA 3CXCZ 2YPVA 3S15I 1Z02A 3FQMA 3JAMf 3GTPI 2O4VA 1QVGZ 2NVTI 3TE5B 1PFTA 1QJPA 1ZHWA 3NDJA 1JJ2Y 4XNKA 3HOEA 1YJN1 3G6E1 2XE1A 2W81C 2FGQX 3OW2Y 3GTGI 4BUMX 4AKMA 2H85A 1YJNZ 4BY1I 2YU9I 2F4OA 2PMZA 3G6EZ 2KXPB 1WW9A 5T6BA 3POQA 1JJ2Z 4LSIA 4A3MI 1BT9A 1YIT1 3S2HI 4RLBA 3U50C 3I4MI 1N2FA 1S72Z 3GTMI 3OW2Z 1YUAA 4O4XA 4JFBA 4A3GI 1YI21 2PM9A 1YITZ 4E2ZA 4A3JI 2B63I 4E2YA 3V8UA 3JAMb 4KR4A 4BBSI 1HXUA 4O3XB 2OTL1 3LUSA 4AYMC 2J4UP 2QRDB 4A93I 1GFNA 3SZDA 1P4TA 2OTLZ 3O0EA 5AN9F 2KZ7A 3TDHB 1KC81 1I3QI 3IF8A 3HOUI 5C4JI 1K732 2Y0HA 2OTJ1 3NFZA 1Y1VI 1K731 1M901 3GCFA 4AYDC 1G90A 2XG6A 4GCPA 1P9NA 1Q812 3CC41 2F4MA 3T4NB 1Q811 3HOZI 2R7ZI 2KI7B 2K4TA 2FGRA 5PRNA 3GTMS 2M07A 5C4XI 2I3CA 4LSEA 1YHQ1 2J1NA 3GP6A 3CC4Z 3GTOI 3VZWX 3S1RI 2RPRA 4GCSA 1YHQZ 2PRNA 3POXA 3CD6Z 1R9TI 2DE7A 1QF8A 1ZHXA 3HOYI 2JS4A 4U9CA 5DL5A 5C3EI 3AA6A 3HW9A 5A2Qf 3AAAB 2KPIA 4S1TA 4FZLA 2JA6I 3I07A 1YIJ1 3S17I 4FRTA 4NB8A 4TNUA 1Y1VS 4E30A 3CME1 3NH5A 2JNYA 1VQ81 4O3ZA 2NVQI 1YIJZ 4AYEC 4FRXA 1OSMA 3CMEZ 4RVFA 1KD12 3VY9X 2OZKA 1KD11 4F4BA 1VQ61 3LK42 3NSGA 4MD8A 1VQ8Z 3LK41 3CCM1 5T67A 5C44I 3I4NI 4FUVA 3KVDD 4QTUA 2RHBA 3VY8X 1MPFA 3MONA 1VQ6Z 3LK2A 4MXUA 2J6AA 3I561 2HU9A 3CCMZ 3UU2A 2JMMA 1TFIA 1TWHI 3T20A 3QWUA 1M1K1 1YJW1 1TWFI 3SY7A 4KR8A 5A2Qb 5G26A 2K0LA 4QTTA 2G2KA 4NOZA 1TWAI 1VQM1 4PUXA 5EE2A 4NBBA 2AKLA 3NH8A 3I551 3D9XA 4Y7NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE2 A;  2Y7S A;  4U9C A;  4AYD C;  3KVD D;  2W81 C;  3PQU A;  1YS5 A;  3VE1 A;  2LFU A;  3V8U A;  2KC0 A;  4AYI D;  4Z3T A;  4O3X B;  3PQS A;  2W80 C;  3HOL A;  4QQ1 A;  4AYM C;  2KDY A;  4O3W A;  4O3Z A;  4AYN A;  2YPV A;  4AYE C;  3UAQ A;  4O49 A;  5EE2 A;  4O4U A;  5T5F A;  4O3Y A;  4O4X A;  3HOE A; 
#chains in the Genus database with same CATH topology
 1X3Z A;  2POR A;  2Y7S A;  1VQM Z;  2XTR A;  3LK3 A;  4PJ0 O;  2VUG A;  5GTH O;  4NBA A;  3I55 Z;  1Q86 2;  4FES A;  1NJI 2;  3G4S 1;  1Q86 1;  3D2L A;  2OOX B;  1NJI 1;  1MM5 A;  1L1O C;  3AAE A;  3AA7 A;  4AKR B;  4RVD A;  4NBE A;  4E1S A;  2QTK A;  3NH4 A;  2V3V A;  2QEX 1;  3G4S Z;  3DA3 A;  3POU A;  1HXT A;  2F1T A;  3S1Q I;  3UPG A;  2JA5 I;  5FLX f;  3CCS 1;  3GTL I;  5IP9 I;  1PHO A;  5AFU L;  5AFU K;  3VZU X;  5TIS O;  2QEX Z;  3AA1 B;  4XNL A;  2Y0S A;  2O53 A;  1S5L O;  3FYX A;  5ADX L;  3CCS Z;  2LHF A;  4DQY B;  1QYP A;  2EGT A;  2YNK A;  3EED A;  3VE1 A;  4MRI A;  2KZ7 B;  4A3F I;  1SFO I;  2M06 A;  2F1V A;  1Q9F A;  2WB1 A;  2R8A A;  3BS0 A;  1YI2 Z;  3PO2 I;  4E2X A;  3NDI A;  1QJ8 A;  3NJT A;  2QRC B;  4FZN A;  4CTD A;  2VPW A;  4HH4 A;  4DGL A;  2R89 A;  3CQZ I;  1N8R 2;  3CPW Y;  2E2I I;  1ZHT A;  1Q82 2;  2BJO A;  1K83 I;  4N75 A;  3G71 1;  3CCU 1;  1Q82 1;  4A3K I;  2KXP A;  4AYB A;  3KIF A;  3AA0 B;  2JQY A;  2Y0K A;  5FVN A;  2XMX A;  5FLX b;  3G71 Z;  3CCU Z;  1VQL 1;  3HOX I;  3M3Y I;  3CPW Z;  4FZM A;  2OTJ Z;  4NBD A;  3J81 f;  2Q51 A;  4E2W A;  2QRE B;  2VUM I;  1ZH1 A;  1VQL Z;  2KDY A;  2QKD A;  4O3W A;  1DL6 A;  3DWN A;  2JIM A;  4RJX A;  1LQL A;  2P28 A;  1Z01 A;  1BH3 A;  3IFU A;  3QRC A;  4O49 A;  5DL8 A;  3CCE 1;  1X0T A;  3PGU A;  5GTI O;  1THQ A;  2GTH A;  4BBR I;  1K8A 2;  3SYB A;  4FT6 A;  2QR1 B;  4FSO A;  1K8A 1;  5D1P A;  4GHB A;  5G38 A;  4AUI A;  2V8K A;  3VMG A;  3CCE Z;  1IZN A;  3EMN X;  4E31 A;  1AA6 A;  3SYS A;  2AYD A;  3VTN A;  4Z3T A;  1E54 A;  2V8I A;  4AFK A;  3RZD I;  4RJW A;  2K3R A;  2ZLD A;  3VMI A;  2W04 A;  1USP B;  3HOW I;  4G76 A;  3WU2 O;  3LK2 B;  2OMF A;  1FDO A;  3J81 b;  2JA8 I;  1VQN 1;  3H0G I;  3S1N I;  2JIR A;  3CMA 1;  2Y2X A;  3GTK I;  1Q7Y 2;  1ORM A;  2WAQ A;  3SZV A;  4KRA A;  2F1C X;  1RO2 A;  3RBH A;  5DL7 A;  3J7A 4;  2QA4 1;  1KQS Y;  1VQN Z;  2QLV B;  5IYU A;  4AYI D;  3CMA Z;  3PGR A;  2R4P A;  4FOZ A;  4HGY A;  3PQS A;  1GFM A;  4N58 A;  4QQ1 A;  2GU2 A;  3TZG A;  3BG0 B;  3HKZ A;  3LK3 B;  5E79 O;  4AYN A;  3I56 Z;  3AAA A;  2R88 A;  3S1M I;  3H3V J;  1VQ7 1;  5DL6 A;  5IT9 b;  3VMH A;  4MD9 A;  1KQS Z;  3AAE B;  3KIH A;  1YJW Z;  3AA7 B;  5T64 A;  1ZHY A;  3QRA A;  1RLY A;  1K9M 2;  4AZL A;  4E1T A;  1K9M 1;  1VQ7 Z;  5G3A A;  1GFO A;  1WJ2 A;  8PRN A;  3JTY A;  1YS5 A;  4JCH A;  2X27 X;  1VLA A;  4MON A;  3GTJ I;  2XE2 A;  3C5O A;  2O4H A;  2WJR A;  3JCU O;  1RNI A;  4E33 A;  2Q4Z A;  2JIP A;  1GFQ A;  3CC2 1;  4Y52 I;  1NUI A;  1YUK A;  3D6W A;  3K7A I;  1OPF A;  2JIQ A;  4FSP A;  2W03 A;  2NAP A;  6PRN A;  1T16 A;  2JA7 I;  2V45 A;  3CCJ 1;  1Z03 A;  3CC2 Z;  4UB8 O;  2DE6 A;  4K3C A;  2HF1 A;  3T24 A;  3Q87 A;  3PRN A;  3F3P C;  4A3E I;  3A0B O;  5D5D A;  4E32 A;  5JDP A;  3MZK B;  5ADX K;  5D1O A;  4D64 A;  1WII A;  2OOY B;  3CCJ Z;  2ERV A;  3IX0 A;  1NP6 A;  2KC0 A;  3PO3 I;  3FKI I;  5LL6 f;  4MH4 A;  1S72 1;  3WI5 A;  3DWO X;  3CC7 1;  1ZHZ A;  2V8J A;  4NBH A;  2RIQ A;  2R4O A;  2E2J I;  4GF4 A;  4BY7 I;  5B5E O;  4NBG A;  2E2H I;  3IR7 A;  1N8R 1;  3GTQ I;  3J80 b;  4A3L I;  4RLC A;  3S2D I;  3MZL B;  3CC7 Z;  2IZ3 A;  4O3Y A;  2XE5 A;  1I6H I;  1ZB9 A;  2IZ4 A;  1RQF A;  4AKR A;  1H6S 1;  5FLM I;  2VPZ A;  4FMS A;  2NVX I;  2R6M A;  2M48 A;  4A3C I;  1JWH C;  1RO0 A;  1YJ9 1;  1PRN A;  3A2S X;  3HWB A;  4LSF A;  4RS4 A;  4A3B I;  2R4N A;  3BG1 B;  4N59 A;  1QJ9 A;  3CCV 1;  4RVG A;  1Q9G A;  3AA1 A;  3HOL A;  1YJ9 Z;  1MM4 A;  4HGZ A;  1TWC I;  4RVH A;  1IZN B;  2R93 I;  5B66 O;  2DE5 A;  1Y1W I;  4RV9 A;  4BXX I;  3CCV Z;  1KC8 2;  3AA6 B;  4MD7 A;  2M6N A;  3PO3 S;  3S14 I;  2MNH A;  2NVY I;  1QVF Y;  1M90 2;  1KRL A;  2JUB A;  2R92 I;  3VE2 A;  4NFR A;  4NBC A;  4EWC A;  4D5U A;  2N2L A;  3POR A;  1S7M A;  3M4O I;  2LFU A;  2Y0L A;  3SY9 A;  3DZM A;  4RL9 A;  3FQQ A;  2N2M A;  5IT9 f;  2GTI A;  2LIY A;  2RBL A;  3CD6 1;  3AA0 A;  1VQ4 1;  4G75 A;  1QVF Z;  2YAD A;  1TWG I;  1RO4 A;  4NBF A;  4DK1 A;  2PK7 A;  3UAQ A;  1VQO 1;  3WI4 A;  5CM2 M;  1VQP 1;  4O4U A;  4D65 A;  3BRZ A;  1VQ4 Z;  3S16 I;  5T5F A;  3HOV I;  4FQE A;  1W2B Y;  2K5R A;  2AXT O;  3P5J B;  4K3B A;  1ZB8 A;  1WCM I;  1VQO Z;  1Q7Y 1;  1VQP Z;  4B61 A;  3CCR 1;  2GE4 A;  1Y8C A;  2RT9 A;  1VQK 1;  2JR6 A;  3G7G A;  2W80 C;  2XE3 A;  3K19 A;  4XX2 A;  2VF1 A;  3EER A;  3F3F C;  3CCR Z;  2QA4 Z;  2MHL A;  1I50 I;  1VQ5 1;  1VQK Z;  1W2B Z;  5GV0 A;  4A3D I;  3CCQ 1;  4LSH A;  1X3W A;  1GFP A;  4C4V A;  1SIW A;  2E9H A;  3VB9 A;  2P3Y A;  1VQ5 Z;  7PRN A;  3CCQ Z;  3CXC Y;  2ZFG A;  4NH1 C;  3T0S A;  2ODJ A;  1USP A;  1VQ9 1;  4CL1 A;  4X6A I;  1QVG Y;  3PQU A;  1ML8 A;  3ESW A;  3VZT X;  2JMO A;  4GCQ A;  1HXX A;  5KAF O;  5H2F O;  3CCL 1;  4A3I I;  3J80 f;  4IL6 O;  4NB9 A;  1VQ9 Z;  1M1K 2;  2X9K A;  4N74 A;  1BXW A;  3RZO I;  2ZAE B;  5IP7 I;  2XTQ A;  5D1O B;  3DA4 A;  4C69 X;  3CCL Z;  3GKQ A;  3CXC Z;  2LEX A;  2YPV A;  3S15 I;  1Z02 A;  1WZN A;  3FQM A;  3JAM f;  3GTP I;  2O4V A;  1QVG Z;  2E7Z A;  3TE5 B;  2NVT I;  1PFT A;  1QJP A;  1ZHW A;  3NDJ A;  1JJ2 Y;  4XNK A;  3HOE A;  1QXF A;  1YJN 1;  3G6E 1;  2XE1 A;  2W81 C;  2FGQ X;  3OW2 Y;  3GTG I;  4BUM X;  2IV2 X;  4AKM A;  2H85 A;  1YJN Z;  4BY1 I;  2YU9 I;  2F4O A;  2PMZ A;  3G6E Z;  2KXP B;  1WW9 A;  5T6B A;  3POQ A;  1JJ2 Z;  4LSI A;  4A3M I;  1BT9 A;  1YIT 1;  3S2H I;  4RLB A;  3U50 C;  3I4M I;  1N2F A;  1S72 Z;  3GTM I;  1Q16 A;  3OW2 Z;  1YUA A;  4O4X A;  4JFB A;  4A3G I;  1YI2 1;  2PM9 A;  5KAI O;  1YIT Z;  4E2Z A;  4A3J I;  2B63 I;  2IWV A;  4E2Y A;  1FDI A;  5G39 A;  3V8U A;  3JAM b;  4KR4 A;  4BBS I;  1HXU A;  4O3X B;  2OTL 1;  3LUS A;  4AYM C;  2J4U P;  2QRD B;  4A93 I;  3KZI O;  1GFN A;  3SZD A;  1P4T A;  2OTL Z;  2VPY A;  3O0E A;  5AN9 F;  2KZ7 A;  3TDH B;  1KC8 1;  1T1L A;  1I3Q I;  3IF8 A;  3HOU I;  5C4J I;  1K73 2;  2Y0H A;  2OTJ 1;  3NFZ A;  1Y1V I;  1K73 1;  1M90 1;  3GCF A;  4AYD C;  1G90 A;  2XG6 A;  4GCP A;  1P9N A;  1Q81 2;  4UB6 O;  3CC4 1;  2F4M A;  3T4N B;  1Q81 1;  3HOZ I;  2R7Z I;  2KI7 B;  2K4T A;  2FGR A;  5PRN A;  3GTM S;  2M07 A;  5C4X I;  2I3C A;  4LSE A;  1YHQ 1;  2J1N A;  3GP6 A;  3CC4 Z;  3GTO I;  3VZW X;  3S1R I;  2RPR A;  3PGS A;  4GCS A;  1YHQ Z;  3BRY A;  2PRN A;  3POX A;  3CD6 Z;  2R4L A;  1R9T I;  2DE7 A;  1QF8 A;  1ZHX A;  3HOY I;  2JS4 A;  4U9C A;  5DL5 A;  3A0H O;  5C3E I;  3AA6 A;  3HW9 A;  5A2Q f;  4C00 A;  3AAA B;  4C4V B;  2KPI A;  4S1T A;  4FZL A;  2JA6 I;  3I07 A;  1YIJ 1;  3S17 I;  4FRT A;  4NB8 A;  4TNU A;  3PF1 A;  1Y1V S;  4E30 A;  3CME 1;  2IWW A;  3NH5 A;  2JNY A;  1VQ8 1;  4O3Z A;  2NVQ I;  1YIJ Z;  4AYE C;  4FRX A;  1OSM A;  3CME Z;  4RVF A;  1KD1 2;  2JIO A;  2WVP A;  3VY9 X;  2OZK A;  1KD1 1;  4F4B A;  1VQ6 1;  2WJQ A;  3LK4 2;  3NSG A;  4MD8 A;  1VQ8 Z;  3LK4 1;  3CCM 1;  5T67 A;  5C44 I;  3I4N I;  4FUV A;  3KVD D;  4QTU A;  2RHB A;  3VY8 X;  1MPF A;  3MON A;  4PR7 A;  1VQ6 Z;  3LK2 A;  4MXU A;  2VPX A;  2J6A A;  3I56 1;  2HU9 A;  3CCM Z;  3UU2 A;  2JMM A;  1TFI A;  1TWH I;  3T20 A;  3QWU A;  1M1K 1;  1YJW 1;  1TWF I;  3SY7 A;  4KR8 A;  5A2Q b;  5G26 A;  2K0L A;  4QTT A;  2G2K A;  4NOZ A;  1TWA I;  1VQM 1;  4PUX A;  5EE2 A;  4NBB A;  2AKL A;  3NH8 A;  3I55 1;  3D9X A;  4Y7N I; 
#chains in the Genus database with same CATH homology
 1X3Z A;  2POR A;  2Y7S A;  1VQM Z;  2XTR A;  3LK3 A;  2VUG A;  4NBA A;  3I55 Z;  1Q86 2;  4FES A;  1NJI 2;  3G4S 1;  1Q86 1;  1MM5 A;  2OOX B;  1NJI 1;  1L1O C;  3AAE A;  3AA7 A;  4AKR B;  4RVD A;  4NBE A;  4E1S A;  2QTK A;  3NH4 A;  3DA3 A;  2QEX 1;  3G4S Z;  3POU A;  1HXT A;  2F1T A;  3S1Q I;  3UPG A;  2JA5 I;  5FLX f;  3CCS 1;  3GTL I;  5IP9 I;  1PHO A;  5AFU L;  5AFU K;  3VZU X;  2QEX Z;  3AA1 B;  4XNL A;  2Y0S A;  2O53 A;  3FYX A;  5ADX L;  3CCS Z;  2LHF A;  4DQY B;  1QYP A;  2EGT A;  2YNK A;  3EED A;  3VE1 A;  4MRI A;  2KZ7 B;  4A3F I;  1SFO I;  2M06 A;  2F1V A;  1Q9F A;  2WB1 A;  1YI2 Z;  3PO2 I;  4E2X A;  3NDI A;  1QJ8 A;  2QRC B;  4FZN A;  4HH4 A;  4DGL A;  3CQZ I;  1N8R 2;  3CPW Y;  2E2I I;  1ZHT A;  1Q82 2;  2BJO A;  1K83 I;  3G71 1;  3CCU 1;  1Q82 1;  4A3K I;  2KXP A;  4AYB A;  3KIF A;  3AA0 B;  2Y0K A;  5FVN A;  2XMX A;  5FLX b;  3G71 Z;  3CCU Z;  1VQL 1;  3HOX I;  3M3Y I;  3CPW Z;  4FZM A;  2OTJ Z;  4NBD A;  3J81 f;  2Q51 A;  4E2W A;  2QRE B;  2VUM I;  1ZH1 A;  1VQL Z;  2KDY A;  2QKD A;  4O3W A;  1DL6 A;  4RJX A;  1LQL A;  2P28 A;  1Z01 A;  1BH3 A;  3IFU A;  3QRC A;  4O49 A;  5DL8 A;  3CCE 1;  1X0T A;  1THQ A;  2GTH A;  4BBR I;  1K8A 2;  3SYB A;  4FT6 A;  2QR1 B;  4FSO A;  1K8A 1;  5D1P A;  4GHB A;  4AUI A;  2V8K A;  3VMG A;  3CCE Z;  1IZN A;  3EMN X;  4E31 A;  3SYS A;  3VTN A;  4Z3T A;  1E54 A;  2V8I A;  4AFK A;  3RZD I;  4RJW A;  2K3R A;  2ZLD A;  3VMI A;  2W04 A;  1USP B;  3HOW I;  4G76 A;  3LK2 B;  2OMF A;  3J81 b;  2JA8 I;  1VQN 1;  3H0G I;  3S1N I;  3CMA 1;  2Y2X A;  3GTK I;  1Q7Y 2;  1ORM A;  2WAQ A;  3SZV A;  4KRA A;  3RBH A;  1RO2 A;  5DL7 A;  3J7A 4;  2QA4 1;  1KQS Y;  1VQN Z;  2QLV B;  5IYU A;  4AYI D;  3CMA Z;  4FOZ A;  4HGY A;  3PQS A;  1GFM A;  4N58 A;  4QQ1 A;  2GU2 A;  3TZG A;  3BG0 B;  3HKZ A;  3LK3 B;  4AYN A;  3I56 Z;  3AAA A;  3S1M I;  3H3V J;  1VQ7 1;  5DL6 A;  5IT9 b;  3VMH A;  4MD9 A;  1KQS Z;  3AAE B;  3KIH A;  1YJW Z;  3AA7 B;  5T64 A;  1ZHY A;  3QRA A;  1RLY A;  1K9M 2;  4AZL A;  4E1T A;  1K9M 1;  1VQ7 Z;  8PRN A;  1GFO A;  3JTY A;  1YS5 A;  4JCH A;  2X27 X;  1VLA A;  4MON A;  3GTJ I;  2XE2 A;  3C5O A;  2O4H A;  1RNI A;  4E33 A;  2Q4Z A;  1GFQ A;  3CC2 1;  4Y52 I;  1NUI A;  1YUK A;  3D6W A;  3K7A I;  1OPF A;  4FSP A;  2W03 A;  6PRN A;  2JA7 I;  3CCJ 1;  1Z03 A;  3CC2 Z;  2DE6 A;  2HF1 A;  3T24 A;  3Q87 A;  3PRN A;  3F3P C;  4A3E I;  5D5D A;  4E32 A;  5JDP A;  3MZK B;  5ADX K;  5D1O A;  4D64 A;  1WII A;  2OOY B;  3CCJ Z;  2ERV A;  3IX0 A;  1NP6 A;  2KC0 A;  3PO3 I;  3FKI I;  5LL6 f;  4MH4 A;  1S72 1;  3WI5 A;  3CC7 1;  1ZHZ A;  2V8J A;  4NBH A;  2RIQ A;  2E2J I;  4GF4 A;  4BY7 I;  4NBG A;  2E2H I;  4A3L I;  1N8R 1;  3GTQ I;  3J80 b;  4RLC A;  3S2D I;  3MZL B;  3CC7 Z;  2IZ3 A;  4O3Y A;  2XE5 A;  1I6H I;  1ZB9 A;  2IZ4 A;  1RQF A;  4AKR A;  1H6S 1;  5FLM I;  4FMS A;  2NVX I;  2R6M A;  2M48 A;  4A3C I;  1JWH C;  1RO0 A;  1YJ9 1;  1PRN A;  3A2S X;  3HWB A;  4LSF A;  4RS4 A;  4A3B I;  3BG1 B;  4N59 A;  1QJ9 A;  3CCV 1;  4RVG A;  1Q9G A;  3AA1 A;  3HOL A;  1YJ9 Z;  1MM4 A;  4HGZ A;  1TWC I;  4RVH A;  1IZN B;  2R93 I;  2DE5 A;  1Y1W I;  4RV9 A;  4BXX I;  3CCV Z;  1KC8 2;  3AA6 B;  4MD7 A;  2M6N A;  3PO3 S;  3S14 I;  2MNH A;  2NVY I;  1QVF Y;  1M90 2;  1KRL A;  2JUB A;  2R92 I;  3VE2 A;  4NFR A;  4NBC A;  4EWC A;  4D5U A;  2N2L A;  3POR A;  1S7M A;  3M4O I;  2LFU A;  2Y0L A;  3SY9 A;  4RL9 A;  3FQQ A;  2N2M A;  5IT9 f;  2GTI A;  2LIY A;  2RBL A;  3CD6 1;  3AA0 A;  1VQ4 1;  4G75 A;  1QVF Z;  2YAD A;  1TWG I;  1RO4 A;  4NBF A;  4DK1 A;  2PK7 A;  3UAQ A;  1VQO 1;  3WI4 A;  5CM2 M;  1VQP 1;  4O4U A;  4D65 A;  1VQ4 Z;  3S16 I;  5T5F A;  3HOV I;  1W2B Y;  2K5R A;  3P5J B;  1ZB8 A;  1WCM I;  1VQO Z;  1Q7Y 1;  1VQP Z;  4B61 A;  3CCR 1;  2GE4 A;  1VQK 1;  2RT9 A;  2JR6 A;  3G7G A;  2W80 C;  2XE3 A;  3K19 A;  4XX2 A;  2VF1 A;  3EER A;  3F3F C;  3CCR Z;  2QA4 Z;  2MHL A;  1I50 I;  1VQ5 1;  1VQK Z;  1W2B Z;  5GV0 A;  4A3D I;  3CCQ 1;  4LSH A;  1X3W A;  1GFP A;  2E9H A;  3VB9 A;  2P3Y A;  1VQ5 Z;  7PRN A;  3CCQ Z;  3CXC Y;  2ZFG A;  4NH1 C;  3T0S A;  2ODJ A;  1USP A;  1VQ9 1;  4CL1 A;  4X6A I;  1QVG Y;  3PQU A;  1ML8 A;  3ESW A;  3VZT X;  2JMO A;  4GCQ A;  1HXX A;  3CCL 1;  4A3I I;  3J80 f;  4NB9 A;  1VQ9 Z;  1M1K 2;  1BXW A;  3RZO I;  2ZAE B;  5IP7 I;  2XTQ A;  5D1O B;  3DA4 A;  4C69 X;  3CCL Z;  3GKQ A;  3CXC Z;  2YPV A;  3S15 I;  1Z02 A;  3FQM A;  3JAM f;  3GTP I;  2O4V A;  1QVG Z;  2NVT I;  3TE5 B;  1PFT A;  1QJP A;  1ZHW A;  3NDJ A;  1JJ2 Y;  4XNK A;  3HOE A;  1YJN 1;  3G6E 1;  2XE1 A;  2W81 C;  2FGQ X;  3OW2 Y;  3GTG I;  4BUM X;  4AKM A;  2H85 A;  1YJN Z;  4BY1 I;  2YU9 I;  2F4O A;  2PMZ A;  3G6E Z;  2KXP B;  1WW9 A;  5T6B A;  3POQ A;  1JJ2 Z;  4LSI A;  4A3M I;  1BT9 A;  1YIT 1;  3S2H I;  4RLB A;  3U50 C;  3I4M I;  1N2F A;  1S72 Z;  3GTM I;  3OW2 Z;  1YUA A;  4O4X A;  4JFB A;  4A3G I;  1YI2 1;  2PM9 A;  1YIT Z;  4E2Z A;  4A3J I;  2B63 I;  4E2Y A;  3V8U A;  3JAM b;  4KR4 A;  4BBS I;  1HXU A;  4O3X B;  2OTL 1;  3LUS A;  4AYM C;  2J4U P;  2QRD B;  4A93 I;  1GFN A;  3SZD A;  1P4T A;  2OTL Z;  3O0E A;  5AN9 F;  2KZ7 A;  3TDH B;  1KC8 1;  1I3Q I;  3IF8 A;  3HOU I;  5C4J I;  1K73 2;  2Y0H A;  2OTJ 1;  3NFZ A;  1Y1V I;  1K73 1;  1M90 1;  3GCF A;  4AYD C;  1G90 A;  2XG6 A;  4GCP A;  1P9N A;  1Q81 2;  3CC4 1;  2F4M A;  3T4N B;  1Q81 1;  3HOZ I;  2R7Z I;  2KI7 B;  2K4T A;  2FGR A;  5PRN A;  3GTM S;  2M07 A;  5C4X I;  2I3C A;  4LSE A;  1YHQ 1;  2J1N A;  3GP6 A;  3CC4 Z;  3GTO I;  3VZW X;  3S1R I;  2RPR A;  4GCS A;  1YHQ Z;  2PRN A;  3POX A;  3CD6 Z;  1R9T I;  2DE7 A;  1QF8 A;  1ZHX A;  3HOY I;  2JS4 A;  4U9C A;  5DL5 A;  5C3E I;  3AA6 A;  3HW9 A;  5A2Q f;  3AAA B;  2KPI A;  4S1T A;  4FZL A;  2JA6 I;  3I07 A;  1YIJ 1;  3S17 I;  4FRT A;  4NB8 A;  4TNU A;  1Y1V S;  4E30 A;  3CME 1;  3NH5 A;  2JNY A;  1VQ8 1;  4O3Z A;  2NVQ I;  1YIJ Z;  4AYE C;  4FRX A;  1OSM A;  3CME Z;  4RVF A;  1KD1 2;  3VY9 X;  2OZK A;  1KD1 1;  4F4B A;  1VQ6 1;  3LK4 2;  3NSG A;  4MD8 A;  1VQ8 Z;  3LK4 1;  3CCM 1;  5T67 A;  5C44 I;  3I4N I;  4FUV A;  3KVD D;  4QTU A;  2RHB A;  3VY8 X;  1MPF A;  3MON A;  1VQ6 Z;  3LK2 A;  4MXU A;  2J6A A;  3I56 1;  2HU9 A;  3CCM Z;  3UU2 A;  2JMM A;  1TFI A;  1TWH I;  3T20 A;  3QWU A;  1M1K 1;  1YJW 1;  1TWF I;  3SY7 A;  4KR8 A;  5A2Q b;  5G26 A;  2K0L A;  4QTT A;  2G2K A;  4NOZ A;  1TWA I;  1VQM 1;  4PUX A;  5EE2 A;  4NBB A;  2AKL A;  3NH8 A;  3I55 1;  3D9X A;  4Y7N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...