2R8AA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
413
structure length
360
Chain Sequence
AGSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 90
structure length 360
sequence length 413
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r8aA00
3DWOX 2R4OA 3BS0A 3PF1A 2R8AA 2R4LA 2R89A 1T1LA 2R4NA 3PGUA 1T16A 3BRZA 3BRYA 3PGRA 2R4PA 3DWNA 2R88A 3PGSA
chains in the Genus database with same CATH superfamily
2F1TA 4PJ0O 3AAEA 3LK3A 5G3AA 3SYBA 4KR4A 3PGUA 4AYID 2ODJA 1BXWA 3UPGA 5JDPA 2YPVA 3SYSA 2AXTO 2FGQX 4QQ1A 2KZ7A 2R4LA 3C5OA 1T1LA 1HXXA 3UU2A 2MNHA 3BRZA 3POXA 4O49A 5E79O 4C00A 1BT9A 3A2SX 3DWNA 3DZMA 2KDYA 3FYXA 2PRNA 3JTYA 5KAFO 3T0SA 3VY9X 4AUIA 5DL6A 3WI4A 4AKMA 3NSGA 1P4TA 2M06A 4PUXA 4RJWA 2X27X 4FESA 4E1SA 1ZHWA 1QJ9A 4IL6O 2KXPA 4FRTA 2K0LA 3WI5A 5AFUK 4BUMX 2XE1A 1H6S1 2N2MA 2IWVA 1PRNA 1T16A 2M07A 1IZNB 2XE5A 3AA7A 3DA4A 3KZIO 3PGRA 3AAAB 4JFBA 4O3WA 3V8UA 3AA0B 4CTDA 2F1CX 3T20A 4AYEC 2Y0LA 2R8AA 3AAAA 3LK41 3SZVA 2W81C 4KR8A 5GTHO 4Z3TA 2ZLDA 1E54A 3O0EA 4KRAA 4LSHA 5G39A 3K19A 2Y0HA 5G38A 3GP6A 1Q9GA 3PF1A 4FT6A 2QTKA 3JCUO 1HXUA 2LHFA 4LSFA 5KAIO 4B61A 3EMNX 1OSMA 2LFUA 4N58A 3SY7A 4G76A 4AKRB 1PHOA 3PORA 4XNKA 1OPFA 2WJRA 4G75A 4U9CA 4FRXA 2PORA 2Y2XA 4FMSA 3RBHA 1MPFA 4N75A 4RLCA 3PRNA 3AA1A 3HOEA 4GHBA 4O4UA 3SZDA 3NJTA 5GV0A 1GFPA 4FQEA 2Y0KA 2R89A 4FSPA 2KXPB 2XTRA 1ZHYA 5B5EO 4GCSA 3PQSA 1BH3A 2KC0A 4FUVA 3LK2A 5T5FA 3VE2A 4AYMC 5AFUL 5IYUA 3HOLA 1IZNA 3AA7B 3KVDD 2XE2A 3POQA 3A0BO 2MHLA 2KZ7B 3T24A 3VY8X 3UAQA 4LSEA 4O3YA 2WJQA 4C69X 4FZMA 4O3ZA 5PRNA 5H2FO 3VZUX 2XG6A 2ERVA 1ZHZA 4AZLA 3SY9A 4RLBA 5G26A 4FZNA 5DL8A 3AA1B 4PR7A 4N74A 4C4VB 4GCPA 5EE2A 4E1TA 8PRNA 3AA6B 2J1NA 3HW9A 5FVNA 2FGRA 1HXTA 4C4VA 7PRNA 1Q9FA 1ZHXA 3VZTX 2Y7SA 2XTQA 4FZLA 4FSOA 3PQUA 4RL9A 4D5UA 3VE1A 3AA0A 3G7GA 5ADXL 1QJPA 3QRCA 1YS5A 2R4PA 3AAEB 3LK3B 4GF4A 2K4TA 4O4XA 1GFQA 3LK2B 4AYDC 3QRAA 1GFNA 1ZHTA 2WVPA 2X9KA 3LK42 5TISO 6PRNA 5ADXK 2R88A 5B66O 3A0HO 4LSIA 4O3XB 3PGSA 3DWOX 2F1VA 4AFKA 4AYNA 2IWWA 1G90A 3HWBA 4RJXA 4D64A 2W80C 4D65A 4F4BA 1S5LO 2XE3A 3AA6A 3POUA 4JCHA 3DA3A 1ORMA 2OMFA 4N59A 3WU2O 5DL5A 4AKRA 2O4VA 2JQYA 3VZWX 2R4NA 2J4UP 1QJ8A 3BRYA 4XNLA 1MM4A 5D5DA 4FOZA 1THQA 4UB6O 2GE4A 2R4OA 1GFOA 3BS0A 1MM5A 2JMMA 2YNKA 4GCQA 1GFMA 4UB8O 2XMXA 2ZFGA 3TZGA 5GTIO 4K3CA 4K3BA 2N2LA 5DL7A
chains in the Genus database with same CATH topology
3DWOX 2R4OA 3BS0A 3PF1A 2R8AA 2R4LA 2R89A 1T1LA 2R4NA 3PGUA 1T16A 3BRZA 3BRYA 3PGRA 2R4PA 3DWNA 2R88A 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWO X;  2R4O A;  3BS0 A;  3PF1 A;  2R8A A;  2R4L A;  2R89 A;  1T1L A;  2R4N A;  3PGU A;  1T16 A;  3BRZ A;  3BRY A;  3PGR A;  2R4P A;  3DWN A;  2R88 A;  3PGS A; 
#chains in the Genus database with same CATH topology
 2F1T A;  4PJ0 O;  3AAE A;  3LK3 A;  5G3A A;  3SYB A;  4KR4 A;  3PGU A;  4AYI D;  2ODJ A;  1BXW A;  3UPG A;  5JDP A;  2YPV A;  3SYS A;  2AXT O;  2FGQ X;  4QQ1 A;  2KZ7 A;  2R4L A;  3C5O A;  1T1L A;  1HXX A;  3UU2 A;  2MNH A;  3BRZ A;  3POX A;  4O49 A;  5E79 O;  4C00 A;  1BT9 A;  3A2S X;  3DWN A;  3DZM A;  2KDY A;  3FYX A;  2PRN A;  3JTY A;  5KAF O;  3T0S A;  3VY9 X;  4AUI A;  5DL6 A;  3WI4 A;  4AKM A;  3NSG A;  1P4T A;  2M06 A;  4PUX A;  4RJW A;  2X27 X;  4FES A;  4E1S A;  1ZHW A;  1QJ9 A;  4IL6 O;  2KXP A;  4FRT A;  2K0L A;  3WI5 A;  5AFU K;  4BUM X;  2XE1 A;  1H6S 1;  2N2M A;  2IWV A;  1PRN A;  1T16 A;  2M07 A;  1IZN B;  2XE5 A;  3AA7 A;  3DA4 A;  3KZI O;  3PGR A;  3AAA B;  4JFB A;  4O3W A;  3V8U A;  3AA0 B;  4CTD A;  2F1C X;  3T20 A;  4AYE C;  2Y0L A;  2R8A A;  3AAA A;  3LK4 1;  3SZV A;  2W81 C;  4KR8 A;  5GTH O;  4Z3T A;  2ZLD A;  1E54 A;  3O0E A;  4KRA A;  4LSH A;  5G39 A;  3K19 A;  2Y0H A;  5G38 A;  3GP6 A;  1Q9G A;  3PF1 A;  4FT6 A;  2QTK A;  3JCU O;  1HXU A;  2LHF A;  4LSF A;  5KAI O;  4B61 A;  3EMN X;  1OSM A;  2LFU A;  4N58 A;  3SY7 A;  4G76 A;  4AKR B;  1PHO A;  3POR A;  4XNK A;  1OPF A;  2WJR A;  4G75 A;  4U9C A;  4FRX A;  2POR A;  2Y2X A;  4FMS A;  3RBH A;  1MPF A;  4N75 A;  4RLC A;  3PRN A;  3AA1 A;  3HOE A;  4GHB A;  4O4U A;  3SZD A;  3NJT A;  5GV0 A;  1GFP A;  4FQE A;  2Y0K A;  2R89 A;  4FSP A;  2KXP B;  2XTR A;  1ZHY A;  5B5E O;  4GCS A;  3PQS A;  1BH3 A;  2KC0 A;  4FUV A;  3LK2 A;  5T5F A;  3VE2 A;  4AYM C;  5AFU L;  5IYU A;  3HOL A;  1IZN A;  3AA7 B;  3KVD D;  2XE2 A;  3POQ A;  3A0B O;  2MHL A;  2KZ7 B;  3T24 A;  3VY8 X;  3UAQ A;  4LSE A;  4O3Y A;  2WJQ A;  4C69 X;  4FZM A;  4O3Z A;  5PRN A;  5H2F O;  3VZU X;  2XG6 A;  2ERV A;  1ZHZ A;  4AZL A;  3SY9 A;  4RLB A;  5G26 A;  4FZN A;  5DL8 A;  3AA1 B;  4PR7 A;  4N74 A;  4C4V B;  4GCP A;  5EE2 A;  4E1T A;  8PRN A;  3AA6 B;  2J1N A;  3HW9 A;  5FVN A;  2FGR A;  1HXT A;  4C4V A;  7PRN A;  1Q9F A;  1ZHX A;  3VZT X;  2Y7S A;  2XTQ A;  4FZL A;  4FSO A;  3PQU A;  4RL9 A;  4D5U A;  3VE1 A;  3AA0 A;  3G7G A;  5ADX L;  1QJP A;  3QRC A;  1YS5 A;  2R4P A;  3AAE B;  3LK3 B;  4GF4 A;  2K4T A;  4O4X A;  1GFQ A;  3LK2 B;  4AYD C;  3QRA A;  1GFN A;  1ZHT A;  2WVP A;  2X9K A;  3LK4 2;  5TIS O;  6PRN A;  5ADX K;  2R88 A;  5B66 O;  3A0H O;  4LSI A;  4O3X B;  3PGS A;  3DWO X;  2F1V A;  4AFK A;  4AYN A;  2IWW A;  1G90 A;  3HWB A;  4RJX A;  4D64 A;  2W80 C;  4D65 A;  4F4B A;  1S5L O;  2XE3 A;  3AA6 A;  3POU A;  4JCH A;  3DA3 A;  1ORM A;  2OMF A;  4N59 A;  3WU2 O;  5DL5 A;  4AKR A;  2O4V A;  2JQY A;  3VZW X;  2R4N A;  2J4U P;  1QJ8 A;  3BRY A;  4XNL A;  1MM4 A;  5D5D A;  4FOZ A;  1THQ A;  4UB6 O;  2GE4 A;  2R4O A;  1GFO A;  3BS0 A;  1MM5 A;  2JMM A;  2YNK A;  4GCQ A;  1GFM A;  4UB8 O;  2XMX A;  2ZFG A;  3TZG A;  5GTI O;  4K3C A;  4K3B A;  2N2L A;  5DL7 A; 
#chains in the Genus database with same CATH homology
 3DWO X;  2R4O A;  3BS0 A;  3PF1 A;  2R8A A;  2R4L A;  2R89 A;  1T1L A;  2R4N A;  3PGU A;  1T16 A;  3BRZ A;  3BRY A;  3PGR A;  2R4P A;  3DWN A;  2R88 A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...