2R8AA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
413
structure length
360
Chain Sequence
AGSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 90
structure length 360
sequence length 413
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r8aA00
3BRYA 1T16A 1T1LA 2R89A 2R4NA 2R4LA 2R8AA 3BS0A 3PF1A 3DWNA 3DWOX 2R4OA 2R4PA 3PGUA 2R88A 3BRZA 3PGRA 3PGSA
chains in the Genus database with same CATH superfamily
3PQUA 3AA0A 3BRYA 4RJWA 4FRXA 1P4TA 2F1CX 3BS0A 3NJTA 4E1SA 2IWVA 1MM5A 4PJ0O 4AYMC 3FYXA 2XE2A 4K3CA 1GFNA 3PQSA 4RJXA 2W80C 3VE2A 1OPFA 1MM4A 3AA7B 4PR7A 3T24A 5KAIO 4XNKA 1THQA 4C00A 4C4VB 5B5EO 2R4LA 1ZHYA 2JQYA 2M07A 4LSHA 3AA7A 3DWNA 5DL7A 2WJQA 2YPVA 4AZLA 1ORMA 4FT6A 4FZLA 2ODJA 3GP6A 4C69X 5JDPA 2XE1A 1H6S1 1MPFA 5KAFO 4GCPA 4FUVA 4QQ1A 2XTQA 2LFUA 5G39A 3UAQA 3T20A 5AFUK 3LK42 2XMXA 2ZLDA 6PRNA 1HXUA 4FOZA 2FGQX 1PHOA 2KXPB 3DA3A 1GFMA 4LSEA 5DL5A 4AYID 1QJ8A 2Y0KA 5G26A 4RLCA 5GV0A 2Y0LA 5G3AA 3VY8X 1QJPA 1GFOA 2ZFGA 1GFQA 3AAAB 3WI4A 1ZHZA 2XTRA 1BT9A 5E79O 5TISO 3VZUX 1QJ9A 3AAAA 4B61A 4D64A 3HW9A 4IL6O 4G75A 3UU2A 5IYUA 2F1TA 2PRNA 2R4PA 4O3WA 2XG6A 4FESA 5GTHO 3LK2B 4AYDC 4N75A 2X27X 2FGRA 4GF4A 3JTYA 2JMMA 3AA1B 3POQA 2F1VA 3KVDD 4O3YA 4AKRB 4C4VA 4GCQA 2W81C 3HWBA 3T0SA 2Y7SA 3PF1A 4F4BA 5H2FO 2YNKA 1HXXA 2KDYA 8PRNA 2GE4A 4G76A 4AYNA 4FRTA 3PORA 1BXWA 7PRNA 1T16A 3VY9X 3SZDA 3AAEB 3WI5A 1OSMA 2IWWA 3BRZA 1E54A 3HOLA 2XE3A 4U9CA 2J1NA 2Y2XA 2KXPA 3PGRA 5EE2A 3VZTX 4D65A 4PUXA 3SYSA 3KZIO 4RLBA 3VE1A 1ZHXA 1IZNB 1YS5A 3A2SX 3POXA 2ERVA 5PRNA 4AYEC 1BH3A 3POUA 4LSIA 4FZMA 4BUMX 1PRNA 5ADXL 4KR4A 2MNHA 5DL6A 4N59A 4LSFA 3LK2A 3UPGA 3LK3B 1ZHTA 3AA1A 4FMSA 4O4XA 2LHFA 4AUIA 3TZGA 4KRAA 3SZVA 4AKRA 2R4OA 4O3ZA 3WU2O 3RBHA 2AXTO 3HOEA 4RL9A 3DZMA 3EMNX 4O3XB 4AKMA 3O0EA 3C5OA 2Y0HA 3DWOX 2K0LA 3A0HO 4D5UA 3SY7A 2M06A 3A0BO 4AFKA 2N2MA 3V8UA 4Z3TA 3NSGA 3AA6B 4N58A 4FZNA 3AAEA 2WVPA 4JCHA 3JCUO 2R89A 4N74A 3SY9A 3VZWX 3AA6A 5GTIO 4GCSA 2KZ7B 2K4TA 1GFPA 2N2LA 3LK41 3PGUA 2O4VA 1Q9FA 2QTKA 4XNLA 5D5DA 5DL8A 4GHBA 4UB6O 2KZ7A 5T5FA 4K3BA 2KC0A 4O4UA 4JFBA 1IZNA 3K19A 5B66O 1S5LO 2X9KA 3PRNA 3SYBA 5AFUL 4FSOA 2R88A 4CTDA 1ZHWA 4UB8O 5FVNA 4E1TA 3G7GA 2XE5A 3QRAA 2R8AA 5ADXK 2WJRA 1HXTA 4FSPA 4O49A 3LK3A 1G90A 4KR8A 3DA4A 3PGSA 1Q9GA 1T1LA 4FQEA 5G38A 2R4NA 3QRCA 2J4UP 2MHLA 3AA0B 2PORA 2OMFA
chains in the Genus database with same CATH topology
3BRYA 1T16A 1T1LA 2R89A 2R4NA 2R4LA 2R8AA 3BS0A 3PF1A 3DWNA 3DWOX 2R4OA 2R4PA 3PGUA 2R88A 3BRZA 3PGRA 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRY A;  1T16 A;  1T1L A;  2R89 A;  2R4N A;  2R4L A;  2R8A A;  3BS0 A;  3PF1 A;  3DWN A;  3DWO X;  2R4O A;  2R4P A;  3PGU A;  2R88 A;  3BRZ A;  3PGR A;  3PGS A; 
#chains in the Genus database with same CATH topology
 3PQU A;  3AA0 A;  3BRY A;  4RJW A;  4FRX A;  1P4T A;  2F1C X;  3BS0 A;  3NJT A;  4E1S A;  2IWV A;  1MM5 A;  4PJ0 O;  4AYM C;  3FYX A;  2XE2 A;  4K3C A;  1GFN A;  3PQS A;  4RJX A;  2W80 C;  3VE2 A;  1OPF A;  1MM4 A;  3AA7 B;  4PR7 A;  3T24 A;  5KAI O;  4XNK A;  1THQ A;  4C00 A;  4C4V B;  5B5E O;  2R4L A;  1ZHY A;  2JQY A;  2M07 A;  4LSH A;  3AA7 A;  3DWN A;  5DL7 A;  2WJQ A;  2YPV A;  4AZL A;  1ORM A;  4FT6 A;  4FZL A;  2ODJ A;  3GP6 A;  4C69 X;  5JDP A;  2XE1 A;  1H6S 1;  1MPF A;  5KAF O;  4GCP A;  4FUV A;  4QQ1 A;  2XTQ A;  2LFU A;  5G39 A;  3UAQ A;  3T20 A;  5AFU K;  3LK4 2;  2XMX A;  2ZLD A;  6PRN A;  1HXU A;  4FOZ A;  2FGQ X;  1PHO A;  2KXP B;  3DA3 A;  1GFM A;  4LSE A;  5DL5 A;  4AYI D;  1QJ8 A;  2Y0K A;  5G26 A;  4RLC A;  5GV0 A;  2Y0L A;  5G3A A;  3VY8 X;  1QJP A;  1GFO A;  2ZFG A;  1GFQ A;  3AAA B;  3WI4 A;  1ZHZ A;  2XTR A;  1BT9 A;  5E79 O;  5TIS O;  3VZU X;  1QJ9 A;  3AAA A;  4B61 A;  4D64 A;  3HW9 A;  4IL6 O;  4G75 A;  3UU2 A;  5IYU A;  2F1T A;  2PRN A;  2R4P A;  4O3W A;  2XG6 A;  4FES A;  5GTH O;  3LK2 B;  4AYD C;  4N75 A;  2X27 X;  2FGR A;  4GF4 A;  3JTY A;  2JMM A;  3AA1 B;  3POQ A;  2F1V A;  3KVD D;  4O3Y A;  4AKR B;  4C4V A;  4GCQ A;  2W81 C;  3HWB A;  3T0S A;  2Y7S A;  3PF1 A;  4F4B A;  5H2F O;  2YNK A;  1HXX A;  2KDY A;  8PRN A;  2GE4 A;  4G76 A;  4AYN A;  4FRT A;  3POR A;  1BXW A;  7PRN A;  1T16 A;  3VY9 X;  3SZD A;  3AAE B;  3WI5 A;  1OSM A;  2IWW A;  3BRZ A;  1E54 A;  3HOL A;  2XE3 A;  4U9C A;  2J1N A;  2Y2X A;  2KXP A;  3PGR A;  5EE2 A;  3VZT X;  4D65 A;  4PUX A;  3SYS A;  3KZI O;  4RLB A;  3VE1 A;  1ZHX A;  1IZN B;  1YS5 A;  3A2S X;  3POX A;  2ERV A;  5PRN A;  4AYE C;  1BH3 A;  3POU A;  4LSI A;  4FZM A;  4BUM X;  1PRN A;  5ADX L;  4KR4 A;  2MNH A;  5DL6 A;  4N59 A;  4LSF A;  3LK2 A;  3UPG A;  3LK3 B;  1ZHT A;  3AA1 A;  4FMS A;  4O4X A;  2LHF A;  4AUI A;  3TZG A;  4KRA A;  3SZV A;  4AKR A;  2R4O A;  4O3Z A;  3WU2 O;  3RBH A;  2AXT O;  3HOE A;  4RL9 A;  3DZM A;  3EMN X;  4O3X B;  4AKM A;  3O0E A;  3C5O A;  2Y0H A;  3DWO X;  2K0L A;  3A0H O;  4D5U A;  3SY7 A;  2M06 A;  3A0B O;  4AFK A;  2N2M A;  3V8U A;  4Z3T A;  3NSG A;  3AA6 B;  4N58 A;  4FZN A;  3AAE A;  2WVP A;  4JCH A;  3JCU O;  2R89 A;  4N74 A;  3SY9 A;  3VZW X;  3AA6 A;  5GTI O;  4GCS A;  2KZ7 B;  2K4T A;  1GFP A;  2N2L A;  3LK4 1;  3PGU A;  2O4V A;  1Q9F A;  2QTK A;  4XNL A;  5D5D A;  5DL8 A;  4GHB A;  4UB6 O;  2KZ7 A;  5T5F A;  4K3B A;  2KC0 A;  4O4U A;  4JFB A;  1IZN A;  3K19 A;  5B66 O;  1S5L O;  2X9K A;  3PRN A;  3SYB A;  5AFU L;  4FSO A;  2R88 A;  4CTD A;  1ZHW A;  4UB8 O;  5FVN A;  4E1T A;  3G7G A;  2XE5 A;  3QRA A;  2R8A A;  5ADX K;  2WJR A;  1HXT A;  4FSP A;  4O49 A;  3LK3 A;  1G90 A;  4KR8 A;  3DA4 A;  3PGS A;  1Q9G A;  1T1L A;  4FQE A;  5G38 A;  2R4N A;  3QRC A;  2J4U P;  2MHL A;  3AA0 B;  2POR A;  2OMF A; 
#chains in the Genus database with same CATH homology
 3BRY A;  1T16 A;  1T1L A;  2R89 A;  2R4N A;  2R4L A;  2R8A A;  3BS0 A;  3PF1 A;  3DWN A;  3DWO X;  2R4O A;  2R4P A;  3PGU A;  2R88 A;  3BRZ A;  3PGR A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...