2R8AA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
413
structure length
360
Chain Sequence
AGSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 360
sequence length 413
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r8aA00
2R4LA 3BRYA 1T16A 2R4OA 3DWNA 2R8AA 3PGUA 3DWOX 3BRZA 3PGRA 2R88A 2R4PA 2R89A 3PF1A 3BS0A 1T1LA 3PGSA 2R4NA
chains in the Genus database with same CATH superfamily
1HXXA 3A0HO 2PRNA 3GP6A 3AAEA 4FESA 4RLBA 4BUMX 1MM4A 2XE5A 4AUIA 3DA4A 1MPFA 5ADXK 4C00A 3T24A 4FRXA 3SZDA 2GE4A 1BT9A 3VE2A 3NJTA 4AYDC 4KR8A 5DL6A 3WU2O 1IZNB 3VY8X 1PRNA 3AA7B 1THQA 3AA1A 4QQ1A 2KZ7B 3POQA 2R4PA 2WVPA 1GFOA 2KXPA 3AAAB 2F1CX 3UAQA 2R88A 5GTIO 4GF4A 5KAFO 1ZHTA 5GTHO 2FGRA 4RLCA 4AKRA 6PRNA 4O4UA 1ZHXA 3AA0B 2KDYA 3LK2A 2Y0KA 3AA6B 5G3AA 4GCPA 4F4BA 2XE2A 2N2MA 4K3BA 3V8UA 3UPGA 4Z3TA 4GCQA 2IWWA 3SY9A 1E54A 4D5UA 3VZTX 1ORMA 4O3YA 1G90A 2W80C 2ZLDA 4RJWA 4LSHA 2Y0HA 3BRZA 4FT6A 4XNLA 3HOEA 3LK3B 5D5DA 5DL7A 4CTDA 3PORA 7PRNA 1T1LA 4LSEA 5G38A 5H2FO 2ODJA 8PRNA 2JMMA 4IL6O 4N75A 2W81C 2XTRA 4AYMC 4C4VA 5B5EO 2IWVA 1GFMA 1ZHYA 5JDPA 4FQEA 2XTQA 3DWNA 2YNKA 2XE1A 2J4UP 3VZWX 2F1TA 4AYID 4O49A 3SY7A 4E1TA 4PR7A 5E79O 2AXTO 2R4LA 4GCSA 4RL9A 2KC0A 3AA1B 2WJRA 3G7GA 1IZNA 3AA7A 1MM5A 2KXPB 3DWOX 3O0EA 3POXA 3JTYA 1ZHWA 2MHLA 2X9KA 4UB6O 3VE1A 4FRTA 4G76A 3BS0A 4LSIA 1QJ8A 3LK42 4U9CA 3SYBA 4AKRB 2LHFA 3HWBA 1HXTA 4LSFA 4GHBA 4FMSA 2Y0LA 4KR4A 2XMXA 2XE3A 3LK2B 5PRNA 2MNHA 2Y7SA 5KAIO 4FOZA 3WI5A 1T16A 3QRAA 5G26A 5G39A 4KRAA 4D64A 3UU2A 3RBHA 3SZVA 5AFUL 5IYUA 5TISO 3KZIO 4B61A 1Q9GA 3NSGA 4AKMA 3PGSA 3PQUA 4N74A 1QJ9A 1Q9FA 3AAEB 5GV0A 2ZFGA 2LFUA 5DL5A 5EE2A 2K4TA 1GFPA 4C4VB 1OPFA 2Y2XA 3VZUX 3T20A 2JQYA 1GFNA 1H6S1 1PHOA 4RJXA 4AYNA 4O3XB 4FUVA 2KZ7A 3EMNX 3AAAA 3PGUA 4D65A 2FGQX 3A0BO 1GFQA 2R4OA 3BRYA 3K19A 3POUA 1P4TA 2PORA 2XG6A 4O3ZA 2M07A 3PQSA 5ADXL 4E1SA 4FSOA 3LK41 4AYEC 3SYSA 5T5FA 3DA3A 2J1NA 1BXWA 3PF1A 3PRNA 4FZNA 3AA0A 2F1VA 4FZLA 4FZMA 4UB8O 4N59A 3AA6A 3FYXA 2X27X 5DL8A 1HXUA 3KVDD 2OMFA 3PGRA 5AFUK 3T0SA 3QRCA 4FSPA 4C69X 2R4NA 2YPVA 2K0LA 2O4VA 3DZMA 4JCHA 4K3CA 4N58A 2R8AA 1ZHZA 4O4XA 3WI4A 4AZLA 2R89A 1YS5A 4PUXA 3TZGA 1QJPA 2ERVA 3C5OA 3LK3A 3A2SX 3VY9X 1BH3A 4AFKA 5B66O 2WJQA 2QTKA 2N2LA 1S5LO 3HW9A 5FVNA 3JCUO 4PJ0O 4G75A 2M06A 4O3WA 4JFBA 3HOLA 4XNKA 1OSMA
chains in the Genus database with same CATH topology
2R4LA 3BRYA 1T16A 2R4OA 3DWNA 2R8AA 3PGUA 3DWOX 3BRZA 3PGRA 2R88A 2R4PA 2R89A 3PF1A 3BS0A 1T1LA 3PGSA 2R4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4L A;  3BRY A;  1T16 A;  2R4O A;  3DWN A;  2R8A A;  3PGU A;  3DWO X;  3BRZ A;  3PGR A;  2R88 A;  2R4P A;  2R89 A;  3PF1 A;  3BS0 A;  1T1L A;  3PGS A;  2R4N A; 
#chains in the Genus database with same CATH topology
 1HXX A;  3A0H O;  2PRN A;  3GP6 A;  3AAE A;  4FES A;  4RLB A;  4BUM X;  1MM4 A;  2XE5 A;  4AUI A;  3DA4 A;  1MPF A;  5ADX K;  4C00 A;  3T24 A;  4FRX A;  3SZD A;  2GE4 A;  1BT9 A;  3VE2 A;  3NJT A;  4AYD C;  4KR8 A;  5DL6 A;  3WU2 O;  1IZN B;  3VY8 X;  1PRN A;  3AA7 B;  1THQ A;  3AA1 A;  4QQ1 A;  2KZ7 B;  3POQ A;  2R4P A;  2WVP A;  1GFO A;  2KXP A;  3AAA B;  2F1C X;  3UAQ A;  2R88 A;  5GTI O;  4GF4 A;  5KAF O;  1ZHT A;  5GTH O;  2FGR A;  4RLC A;  4AKR A;  6PRN A;  4O4U A;  1ZHX A;  3AA0 B;  2KDY A;  3LK2 A;  2Y0K A;  3AA6 B;  5G3A A;  4GCP A;  4F4B A;  2XE2 A;  2N2M A;  4K3B A;  3V8U A;  3UPG A;  4Z3T A;  4GCQ A;  2IWW A;  3SY9 A;  1E54 A;  4D5U A;  3VZT X;  1ORM A;  4O3Y A;  1G90 A;  2W80 C;  2ZLD A;  4RJW A;  4LSH A;  2Y0H A;  3BRZ A;  4FT6 A;  4XNL A;  3HOE A;  3LK3 B;  5D5D A;  5DL7 A;  4CTD A;  3POR A;  7PRN A;  1T1L A;  4LSE A;  5G38 A;  5H2F O;  2ODJ A;  8PRN A;  2JMM A;  4IL6 O;  4N75 A;  2W81 C;  2XTR A;  4AYM C;  4C4V A;  5B5E O;  2IWV A;  1GFM A;  1ZHY A;  5JDP A;  4FQE A;  2XTQ A;  3DWN A;  2YNK A;  2XE1 A;  2J4U P;  3VZW X;  2F1T A;  4AYI D;  4O49 A;  3SY7 A;  4E1T A;  4PR7 A;  5E79 O;  2AXT O;  2R4L A;  4GCS A;  4RL9 A;  2KC0 A;  3AA1 B;  2WJR A;  3G7G A;  1IZN A;  3AA7 A;  1MM5 A;  2KXP B;  3DWO X;  3O0E A;  3POX A;  3JTY A;  1ZHW A;  2MHL A;  2X9K A;  4UB6 O;  3VE1 A;  4FRT A;  4G76 A;  3BS0 A;  4LSI A;  1QJ8 A;  3LK4 2;  4U9C A;  3SYB A;  4AKR B;  2LHF A;  3HWB A;  1HXT A;  4LSF A;  4GHB A;  4FMS A;  2Y0L A;  4KR4 A;  2XMX A;  2XE3 A;  3LK2 B;  5PRN A;  2MNH A;  2Y7S A;  5KAI O;  4FOZ A;  3WI5 A;  1T16 A;  3QRA A;  5G26 A;  5G39 A;  4KRA A;  4D64 A;  3UU2 A;  3RBH A;  3SZV A;  5AFU L;  5IYU A;  5TIS O;  3KZI O;  4B61 A;  1Q9G A;  3NSG A;  4AKM A;  3PGS A;  3PQU A;  4N74 A;  1QJ9 A;  1Q9F A;  3AAE B;  5GV0 A;  2ZFG A;  2LFU A;  5DL5 A;  5EE2 A;  2K4T A;  1GFP A;  4C4V B;  1OPF A;  2Y2X A;  3VZU X;  3T20 A;  2JQY A;  1GFN A;  1H6S 1;  1PHO A;  4RJX A;  4AYN A;  4O3X B;  4FUV A;  2KZ7 A;  3EMN X;  3AAA A;  3PGU A;  4D65 A;  2FGQ X;  3A0B O;  1GFQ A;  2R4O A;  3BRY A;  3K19 A;  3POU A;  1P4T A;  2POR A;  2XG6 A;  4O3Z A;  2M07 A;  3PQS A;  5ADX L;  4E1S A;  4FSO A;  3LK4 1;  4AYE C;  3SYS A;  5T5F A;  3DA3 A;  2J1N A;  1BXW A;  3PF1 A;  3PRN A;  4FZN A;  3AA0 A;  2F1V A;  4FZL A;  4FZM A;  4UB8 O;  4N59 A;  3AA6 A;  3FYX A;  2X27 X;  5DL8 A;  1HXU A;  3KVD D;  2OMF A;  3PGR A;  5AFU K;  3T0S A;  3QRC A;  4FSP A;  4C69 X;  2R4N A;  2YPV A;  2K0L A;  2O4V A;  3DZM A;  4JCH A;  4K3C A;  4N58 A;  2R8A A;  1ZHZ A;  4O4X A;  3WI4 A;  4AZL A;  2R89 A;  1YS5 A;  4PUX A;  3TZG A;  1QJP A;  2ERV A;  3C5O A;  3LK3 A;  3A2S X;  3VY9 X;  1BH3 A;  4AFK A;  5B66 O;  2WJQ A;  2QTK A;  2N2L A;  1S5L O;  3HW9 A;  5FVN A;  3JCU O;  4PJ0 O;  4G75 A;  2M06 A;  4O3W A;  4JFB A;  3HOL A;  4XNK A;  1OSM A; 
#chains in the Genus database with same CATH homology
 2R4L A;  3BRY A;  1T16 A;  2R4O A;  3DWN A;  2R8A A;  3PGU A;  3DWO X;  3BRZ A;  3PGR A;  2R88 A;  2R4P A;  2R89 A;  3PF1 A;  3BS0 A;  1T1L A;  3PGS A;  2R4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...