2R8AA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
413
structure length
360
Chain Sequence
b'AGSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Long-chain fatty acid transport protein
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 90
structure length 360
sequence length 413
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r8aA00
2R4LA 3BRYA 3BS0A 2R8AA 2R4NA 3BRZA 3PGSA 3PGRA 3DWNA 2R88A 3PF1A 3DWOX 1T16A 3PGUA 2R4PA 1T1LA 2R89A 2R4OA
chains in the Genus database with same CATH superfamily
1GFMA 1QJ9A 4O3WA 4RL9A 1OPFA 3SYBA 1BXWA 8PRNA 1P4TA 3AA1B 5G26A 2KZ7A 2M06A 4BUMX 1QJPA 2XE5A 4O49A 4UB8O 3LK3A 4LSHA 2W80C 4N75A 2KZ7B 1ZHYA 4AKRA 2JMMA 3K19A 2FGRA 4N59A 5PRNA 3LK3B 2FGQX 4AKRB 2R4PA 1HXTA 1Q9GA 5B66O 1BT9A 3T0SA 3AA7A 4AKMA 2K0LA 2ODJA 4AYEC 3PGSA 2OMFA 1OSMA 2XE3A 3AA0A 4C69X 1PRNA 1T16A 2Y2XA 3POUA 3SY9A 2F1TA 2R89A 3AA7B 5G3AA 1HXXA 3PQSA 4FT6A 5KAFO 3KVDD 2X27X 4AZLA 2XMXA 5DL6A 2PORA 3AA6A 1HXUA 2O4VA 3PGUA 2F1CX 4UB6O 3HWBA 5GTIO 2XE1A 5G39A 4AYID 3AA6B 3POXA 4JFBA 3UAQA 4RJWA 2XTQA 3SYSA 2M07A 4RJXA 3VZUX 4LSIA 4U9CA 5DL5A 3GP6A 3BRYA 4FQEA 4FRXA 2F1VA 1ZHZA 4FZMA 4FSOA 3UU2A 4FMSA 3VY8X 5E79O 3DWOX 1GFPA 3AAAA 3PORA 4O3XB 1YS5A 4O4UA 4AUIA 1T1LA 3LK42 3AAEA 4FSPA 2WJRA 4KR8A 1ORMA 4LSFA 4LSEA 2KXPA 1Q9FA 1MM4A 3AAAB 3QRCA 5KAIO 1MM5A 1BH3A 4PR7A 2ZFGA 3AAEB 3VE2A 4C00A 3NSGA 2PRNA 2YPVA 2KXPB 2MHLA 2ZLDA 3DA3A 4G76A 4PUXA 3VE1A 3VZWX 5ADXK 2JQYA 4QQ1A 2J1NA 1GFQA 3A0BO 2R8AA 4GF4A 4JCHA 3SZDA 2WJQA 5ADXL 3AA0B 3EMNX 2X9KA 4C4VA 2KDYA 4N74A 3TZGA 5GTHO 3C5OA 3BS0A 4E1TA 3G7GA 4C4VB 2N2LA 2YNKA 3FYXA 5H2FO 3DWNA 3LK41 4K3BA 4XNLA 4AFKA 2LHFA 3JTYA 2KC0A 5GV0A 4FRTA 3O0EA 2Y0KA 2MNHA 3SY7A 5DL7A 3T20A 1S5LO 2R4OA 4GHBA 2Y0LA 7PRNA 1H6S1 3A2SX 3KZIO 1PHOA 1MPFA 2GE4A 1GFNA 3PGRA 4GCSA 5G38A 3RBHA 4KR4A 4CTDA 1QJ8A 4GCQA 3VY9X 5D5DA 4PJ0O 1ZHWA 5TISO 3POQA 4B61A 4D65A 4IL6O 3T24A 3HOEA 2R88A 3WI4A 1GFOA 6PRNA 4RLCA 2N2MA 5IYUA 2R4LA 3DA4A 2K4TA 3WU2O 2R4NA 3HOLA 5EE2A 4GCPA 4O4XA 4FESA 4XNKA 4AYNA 2XG6A 4AYMC 2WVPA 4F4BA 4D64A 5AFUL 4O3YA 2LFUA 4D5UA 4FOZA 2QTKA 3V8UA 2ERVA 4Z3TA 5JDPA 3UPGA 3LK2A 5T5FA 5B5EO 4N58A 2J4UP 3WI5A 4E1SA 2IWWA 3SZVA 3LK2B 1ZHXA 4FZLA 3PQUA 5AFUK 4FZNA 4RLBA 1G90A 2XTRA 3NJTA 2IWVA 1E54A 2Y0HA 3BRZA 3PRNA 4AYDC 3PF1A 3JCUO 4G75A 1ZHTA 3DZMA 5FVNA 2W81C 3QRAA 3A0HO 3HW9A 4K3CA 3VZTX 4O3ZA 1IZNA 2AXTO 2Y7SA 1THQA 4KRAA 4FUVA 2XE2A 3AA1A 1IZNB 5DL8A
chains in the Genus database with same CATH topology
2R4LA 3BRYA 3BS0A 2R8AA 2R4NA 3BRZA 3PGSA 3PGRA 3DWNA 2R88A 3PF1A 3DWOX 1T16A 3PGUA 2R4PA 1T1LA 2R89A 2R4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4L A;  3BRY A;  3BS0 A;  2R8A A;  2R4N A;  3BRZ A;  3PGS A;  3PGR A;  3DWN A;  2R88 A;  3PF1 A;  3DWO X;  1T16 A;  3PGU A;  2R4P A;  1T1L A;  2R89 A;  2R4O A; 
#chains in the Genus database with same CATH topology
 1GFM A;  1QJ9 A;  4O3W A;  4RL9 A;  1OPF A;  3SYB A;  1BXW A;  8PRN A;  1P4T A;  3AA1 B;  5G26 A;  2KZ7 A;  2M06 A;  4BUM X;  1QJP A;  2XE5 A;  4O49 A;  4UB8 O;  3LK3 A;  4LSH A;  2W80 C;  4N75 A;  2KZ7 B;  1ZHY A;  4AKR A;  2JMM A;  3K19 A;  2FGR A;  4N59 A;  5PRN A;  3LK3 B;  2FGQ X;  4AKR B;  2R4P A;  1HXT A;  1Q9G A;  5B66 O;  1BT9 A;  3T0S A;  3AA7 A;  4AKM A;  2K0L A;  2ODJ A;  4AYE C;  3PGS A;  2OMF A;  1OSM A;  2XE3 A;  3AA0 A;  4C69 X;  1PRN A;  1T16 A;  2Y2X A;  3POU A;  3SY9 A;  2F1T A;  2R89 A;  3AA7 B;  5G3A A;  1HXX A;  3PQS A;  4FT6 A;  5KAF O;  3KVD D;  2X27 X;  4AZL A;  2XMX A;  5DL6 A;  2POR A;  3AA6 A;  1HXU A;  2O4V A;  3PGU A;  2F1C X;  4UB6 O;  3HWB A;  5GTI O;  2XE1 A;  5G39 A;  4AYI D;  3AA6 B;  3POX A;  4JFB A;  3UAQ A;  4RJW A;  2XTQ A;  3SYS A;  2M07 A;  4RJX A;  3VZU X;  4LSI A;  4U9C A;  5DL5 A;  3GP6 A;  3BRY A;  4FQE A;  4FRX A;  2F1V A;  1ZHZ A;  4FZM A;  4FSO A;  3UU2 A;  4FMS A;  3VY8 X;  5E79 O;  3DWO X;  1GFP A;  3AAA A;  3POR A;  4O3X B;  1YS5 A;  4O4U A;  4AUI A;  1T1L A;  3LK4 2;  3AAE A;  4FSP A;  2WJR A;  4KR8 A;  1ORM A;  4LSF A;  4LSE A;  2KXP A;  1Q9F A;  1MM4 A;  3AAA B;  3QRC A;  5KAI O;  1MM5 A;  1BH3 A;  4PR7 A;  2ZFG A;  3AAE B;  3VE2 A;  4C00 A;  3NSG A;  2PRN A;  2YPV A;  2KXP B;  2MHL A;  2ZLD A;  3DA3 A;  4G76 A;  4PUX A;  3VE1 A;  3VZW X;  5ADX K;  2JQY A;  4QQ1 A;  2J1N A;  1GFQ A;  3A0B O;  2R8A A;  4GF4 A;  4JCH A;  3SZD A;  2WJQ A;  5ADX L;  3AA0 B;  3EMN X;  2X9K A;  4C4V A;  2KDY A;  4N74 A;  3TZG A;  5GTH O;  3C5O A;  3BS0 A;  4E1T A;  3G7G A;  4C4V B;  2N2L A;  2YNK A;  3FYX A;  5H2F O;  3DWN A;  3LK4 1;  4K3B A;  4XNL A;  4AFK A;  2LHF A;  3JTY A;  2KC0 A;  5GV0 A;  4FRT A;  3O0E A;  2Y0K A;  2MNH A;  3SY7 A;  5DL7 A;  3T20 A;  1S5L O;  2R4O A;  4GHB A;  2Y0L A;  7PRN A;  1H6S 1;  3A2S X;  3KZI O;  1PHO A;  1MPF A;  2GE4 A;  1GFN A;  3PGR A;  4GCS A;  5G38 A;  3RBH A;  4KR4 A;  4CTD A;  1QJ8 A;  4GCQ A;  3VY9 X;  5D5D A;  4PJ0 O;  1ZHW A;  5TIS O;  3POQ A;  4B61 A;  4D65 A;  4IL6 O;  3T24 A;  3HOE A;  2R88 A;  3WI4 A;  1GFO A;  6PRN A;  4RLC A;  2N2M A;  5IYU A;  2R4L A;  3DA4 A;  2K4T A;  3WU2 O;  2R4N A;  3HOL A;  5EE2 A;  4GCP A;  4O4X A;  4FES A;  4XNK A;  4AYN A;  2XG6 A;  4AYM C;  2WVP A;  4F4B A;  4D64 A;  5AFU L;  4O3Y A;  2LFU A;  4D5U A;  4FOZ A;  2QTK A;  3V8U A;  2ERV A;  4Z3T A;  5JDP A;  3UPG A;  3LK2 A;  5T5F A;  5B5E O;  4N58 A;  2J4U P;  3WI5 A;  4E1S A;  2IWW A;  3SZV A;  3LK2 B;  1ZHX A;  4FZL A;  3PQU A;  5AFU K;  4FZN A;  4RLB A;  1G90 A;  2XTR A;  3NJT A;  2IWV A;  1E54 A;  2Y0H A;  3BRZ A;  3PRN A;  4AYD C;  3PF1 A;  3JCU O;  4G75 A;  1ZHT A;  3DZM A;  5FVN A;  2W81 C;  3QRA A;  3A0H O;  3HW9 A;  4K3C A;  3VZT X;  4O3Z A;  1IZN A;  2AXT O;  2Y7S A;  1THQ A;  4KRA A;  4FUV A;  2XE2 A;  3AA1 A;  1IZN B;  5DL8 A; 
#chains in the Genus database with same CATH homology
 2R4L A;  3BRY A;  3BS0 A;  2R8A A;  2R4N A;  3BRZ A;  3PGS A;  3PGR A;  3DWN A;  2R88 A;  3PF1 A;  3DWO X;  1T16 A;  3PGU A;  2R4P A;  1T1L A;  2R89 A;  2R4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...