2R8AA

Crystal structure of the long-chain fatty acid transporter fadl mutant delta n8
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
413
structure length
360
Chain Sequence
AGSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGQTQQGQALAATANGIDSNTKTAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From the Cover: Ligand-gated diffusion across the bacterial outer membrane.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Long-chain fatty acid transport protein
total genus 90
structure length 360
sequence length 413
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.60 Mainly Beta Beta Barrel Porin Outer membrane protein transport protein (OMPP1/FadL/TodX) 2r8aA00
3BRYA 2R4OA 2R4PA 3PF1A 2R88A 3PGRA 2R89A 3DWNA 2R4LA 3BRZA 3DWOX 3PGUA 3BS0A 1T1LA 1T16A 2R8AA 2R4NA 3PGSA
chains in the Genus database with same CATH superfamily
4AYDC 3PGRA 3PF1A 3DA3A 3AAEB 2IWVA 3TZGA 3VE1A 3WI5A 3DWNA 3PORA 4GF4A 3AA6A 4D5UA 4B61A 2PRNA 5AFUK 3AA0A 5DL5A 2OMFA 2YPVA 3KVDD 2W81C 3SY9A 4LSHA 2WJRA 3VY9X 1HXUA 3HWBA 3VZTX 4C69X 2LFUA 5G26A 3BRZA 3WU2O 4AKRA 4AKMA 2M07A 5G3AA 1T1LA 4JFBA 5JDPA 2KZ7B 2XG6A 3BS0A 3LK3A 2M06A 1ZHXA 2PORA 4GHBA 1H6S1 2ODJA 3K19A 3QRAA 4GCSA 4O3XB 4UB6O 3T24A 4AUIA 1HXXA 4E1SA 4AKRB 4XNKA 4E1TA 4RLCA 4AZLA 1QJPA 2KZ7A 1ZHTA 4LSEA 1G90A 3AA7B 3O0EA 3A2SX 4CTDA 2LHFA 3NSGA 4N75A 5TISO 2Y7SA 4FZNA 3AA7A 4PUXA 4UB8O 2XE3A 1QJ9A 3SY7A 6PRNA 4G75A 3FYXA 3VY8X 3JCUO 3V8UA 5DL6A 4C00A 1BXWA 2R88A 2JMMA 4KR4A 2XTRA 3PGSA 4KR8A 4N59A 3BRYA 4RLBA 5G39A 4O3WA 3RBHA 3VZUX 5ADXK 1MM4A 4D65A 2X27X 4AYMC 3UPGA 5B66O 5H2FO 4Z3TA 3A0HO 2R4LA 2WJQA 5ADXL 2J1NA 5KAFO 2KXPB 2XE5A 2R4PA 2Y2XA 2N2LA 3POXA 2K4TA 3PQSA 1BH3A 4O3YA 1ZHYA 1OSMA 2O4VA 3AA1B 2KDYA 4O3ZA 4IL6O 3JTYA 2XMXA 2F1TA 2FGRA 2KXPA 1YS5A 4AYNA 3T20A 4RJXA 2ZLDA 3UAQA 1Q9GA 4FZLA 2Y0HA 1E54A 3AA6B 4O4UA 3SZVA 2XE2A 1ZHZA 4G76A 5D5DA 1ZHWA 1OPFA 3UU2A 2R89A 2ZFGA 3HOLA 4PJ0O 3WI4A 4KRAA 3PRNA 1GFQA 5GTIO 1GFPA 3SYBA 1QJ8A 5DL7A 8PRNA 4FRXA 4FMSA 2R4OA 3AAEA 1GFNA 3LK42 4AYEC 2W80C 3SZDA 1S5LO 4AFKA 5G38A 4O49A 3AA0B 3GP6A 4D64A 3HOEA 3LK41 4AYID 5AFUL 2MHLA 1GFMA 2F1VA 4GCPA 1MPFA 2KC0A 3G7GA 3VE2A 3PGUA 5B5EO 2FGQX 4F4BA 1T16A 3LK3B 2R8AA 5EE2A 4GCQA 4LSFA 3AAAB 3NJTA 4LSIA 1BT9A 3C5OA 1HXTA 2XTQA 4K3CA 2XE1A 2WVPA 3DWOX 4RJWA 2GE4A 5DL8A 4U9CA 4JCHA 3AAAA 1PRNA 4PR7A 5GTHO 1PHOA 4N74A 3POQA 2ERVA 1MM5A 4FSOA 5GV0A 2QTKA 4RL9A 1Q9FA 3HW9A 2X9KA 4FQEA 4N58A 3T0SA 7PRNA 1IZNB 3DA4A 4O4XA 3PQUA 3POUA 5PRNA 3EMNX 1GFOA 3LK2B 2Y0LA 5E79O 2IWWA 2N2MA 4XNLA 5T5FA 2J4UP 3AA1A 1IZNA 5FVNA 5IYUA 5KAIO 2AXTO 2YNKA 4FZMA 3LK2A 3QRCA 3A0BO 2JQYA 4K3BA 2Y0KA 4BUMX 4QQ1A 2MNHA 3DZMA 4C4VB 4FESA 3VZWX 2R4NA 1P4TA 2K0LA 3SYSA 1ORMA 4FOZA 1THQA 4FT6A 4FRTA 3KZIO 4C4VA 2F1CX 4FSPA 4FUVA
chains in the Genus database with same CATH topology
3BRYA 2R4OA 2R4PA 3PF1A 2R88A 3PGRA 2R89A 3DWNA 2R4LA 3BRZA 3DWOX 3PGUA 3BS0A 1T1LA 1T16A 2R8AA 2R4NA 3PGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRY A;  2R4O A;  2R4P A;  3PF1 A;  2R88 A;  3PGR A;  2R89 A;  3DWN A;  2R4L A;  3BRZ A;  3DWO X;  3PGU A;  3BS0 A;  1T1L A;  1T16 A;  2R8A A;  2R4N A;  3PGS A; 
#chains in the Genus database with same CATH topology
 4AYD C;  3PGR A;  3PF1 A;  3DA3 A;  3AAE B;  2IWV A;  3TZG A;  3VE1 A;  3WI5 A;  3DWN A;  3POR A;  4GF4 A;  3AA6 A;  4D5U A;  4B61 A;  2PRN A;  5AFU K;  3AA0 A;  5DL5 A;  2OMF A;  2YPV A;  3KVD D;  2W81 C;  3SY9 A;  4LSH A;  2WJR A;  3VY9 X;  1HXU A;  3HWB A;  3VZT X;  4C69 X;  2LFU A;  5G26 A;  3BRZ A;  3WU2 O;  4AKR A;  4AKM A;  2M07 A;  5G3A A;  1T1L A;  4JFB A;  5JDP A;  2KZ7 B;  2XG6 A;  3BS0 A;  3LK3 A;  2M06 A;  1ZHX A;  2POR A;  4GHB A;  1H6S 1;  2ODJ A;  3K19 A;  3QRA A;  4GCS A;  4O3X B;  4UB6 O;  3T24 A;  4AUI A;  1HXX A;  4E1S A;  4AKR B;  4XNK A;  4E1T A;  4RLC A;  4AZL A;  1QJP A;  2KZ7 A;  1ZHT A;  4LSE A;  1G90 A;  3AA7 B;  3O0E A;  3A2S X;  4CTD A;  2LHF A;  3NSG A;  4N75 A;  5TIS O;  2Y7S A;  4FZN A;  3AA7 A;  4PUX A;  4UB8 O;  2XE3 A;  1QJ9 A;  3SY7 A;  6PRN A;  4G75 A;  3FYX A;  3VY8 X;  3JCU O;  3V8U A;  5DL6 A;  4C00 A;  1BXW A;  2R88 A;  2JMM A;  4KR4 A;  2XTR A;  3PGS A;  4KR8 A;  4N59 A;  3BRY A;  4RLB A;  5G39 A;  4O3W A;  3RBH A;  3VZU X;  5ADX K;  1MM4 A;  4D65 A;  2X27 X;  4AYM C;  3UPG A;  5B66 O;  5H2F O;  4Z3T A;  3A0H O;  2R4L A;  2WJQ A;  5ADX L;  2J1N A;  5KAF O;  2KXP B;  2XE5 A;  2R4P A;  2Y2X A;  2N2L A;  3POX A;  2K4T A;  3PQS A;  1BH3 A;  4O3Y A;  1ZHY A;  1OSM A;  2O4V A;  3AA1 B;  2KDY A;  4O3Z A;  4IL6 O;  3JTY A;  2XMX A;  2F1T A;  2FGR A;  2KXP A;  1YS5 A;  4AYN A;  3T20 A;  4RJX A;  2ZLD A;  3UAQ A;  1Q9G A;  4FZL A;  2Y0H A;  1E54 A;  3AA6 B;  4O4U A;  3SZV A;  2XE2 A;  1ZHZ A;  4G76 A;  5D5D A;  1ZHW A;  1OPF A;  3UU2 A;  2R89 A;  2ZFG A;  3HOL A;  4PJ0 O;  3WI4 A;  4KRA A;  3PRN A;  1GFQ A;  5GTI O;  1GFP A;  3SYB A;  1QJ8 A;  5DL7 A;  8PRN A;  4FRX A;  4FMS A;  2R4O A;  3AAE A;  1GFN A;  3LK4 2;  4AYE C;  2W80 C;  3SZD A;  1S5L O;  4AFK A;  5G38 A;  4O49 A;  3AA0 B;  3GP6 A;  4D64 A;  3HOE A;  3LK4 1;  4AYI D;  5AFU L;  2MHL A;  1GFM A;  2F1V A;  4GCP A;  1MPF A;  2KC0 A;  3G7G A;  3VE2 A;  3PGU A;  5B5E O;  2FGQ X;  4F4B A;  1T16 A;  3LK3 B;  2R8A A;  5EE2 A;  4GCQ A;  4LSF A;  3AAA B;  3NJT A;  4LSI A;  1BT9 A;  3C5O A;  1HXT A;  2XTQ A;  4K3C A;  2XE1 A;  2WVP A;  3DWO X;  4RJW A;  2GE4 A;  5DL8 A;  4U9C A;  4JCH A;  3AAA A;  1PRN A;  4PR7 A;  5GTH O;  1PHO A;  4N74 A;  3POQ A;  2ERV A;  1MM5 A;  4FSO A;  5GV0 A;  2QTK A;  4RL9 A;  1Q9F A;  3HW9 A;  2X9K A;  4FQE A;  4N58 A;  3T0S A;  7PRN A;  1IZN B;  3DA4 A;  4O4X A;  3PQU A;  3POU A;  5PRN A;  3EMN X;  1GFO A;  3LK2 B;  2Y0L A;  5E79 O;  2IWW A;  2N2M A;  4XNL A;  5T5F A;  2J4U P;  3AA1 A;  1IZN A;  5FVN A;  5IYU A;  5KAI O;  2AXT O;  2YNK A;  4FZM A;  3LK2 A;  3QRC A;  3A0B O;  2JQY A;  4K3B A;  2Y0K A;  4BUM X;  4QQ1 A;  2MNH A;  3DZM A;  4C4V B;  4FES A;  3VZW X;  2R4N A;  1P4T A;  2K0L A;  3SYS A;  1ORM A;  4FOZ A;  1THQ A;  4FT6 A;  4FRT A;  3KZI O;  4C4V A;  2F1C X;  4FSP A;  4FUV A; 
#chains in the Genus database with same CATH homology
 3BRY A;  2R4O A;  2R4P A;  3PF1 A;  2R88 A;  3PGR A;  2R89 A;  3DWN A;  2R4L A;  3BRZ A;  3DWO X;  3PGU A;  3BS0 A;  1T1L A;  1T16 A;  2R8A A;  2R4N A;  3PGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...