3POUA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, large unit cell
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OmpF protein
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
molecule tags Membrane protein
total genus 102
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3pouA00
1GFNA 5JDPA 3PORA 4D5UA 4FT6A 1HXXA 4JFBA 3A2SX 4GCPA 2Y0HA 2XE1A 3FYXA 3JTYA 3NSGA 3T20A 3HWBA 1PRNA 4FSOA 3K19A 1GFPA 2K4TA 2XG6A 2XE5A 3SYSA 1GFMA 3UPGA 4C69X 4KR4A 1E54A 1HXTA 4FSPA 2Y2XA 2PRNA 4LSIA 4LSEA 5DL7A 2OMFA 3SY9A 4FMSA 3HW9A 4D65A 4GCQA 6PRNA 4KRAA 2ZLDA 3VY8X 4KR8A 2J1NA 5PRNA 3VY9X 3POUA 3SZVA 1H6S1 2O4VA 1GFOA 3SZDA 8PRNA 4LSHA 3WI4A 1MPFA 2Y0KA 2PORA 2XE3A 2XE2A 3VZWX 1HXUA 4FRTA 4FRXA 2FGQX 3WI5A 3EMNX 3UU2A 3T24A 5FVNA 1OPFA 2ODJA 3O0EA 1PHOA 3T0SA 4GCSA 4RJXA 3PRNA 3VZUX 1BH3A 2Y0LA 2J4UP 4AUIA 3VZTX 2QTKA 4BUMX 2FGRA 4LSFA 5DL6A 4D64A 2ZFGA 5DL5A 3POQA 1BT9A 3SY7A 4RJWA 5DL8A 4FOZA 1GFQA 1OSMA 3POXA 7PRNA 3SYBA
chains in the Genus database with same CATH superfamily
1ZHYA 1GFNA 4QQ1A 5JDPA 3LK2B 2MHLA 5GV0A 3VZWX 1BXWA 2LFUA 3PORA 5T5FA 4D5UA 4FT6A 1HXXA 3JCUO 4JFBA 4O3ZA 2WVPA 4AKRB 3A2SX 1IZNB 4GCPA 3HOEA 2Y0HA 3AA1B 4FZLA 4F4BA 2XE1A 2R8AA 3FYXA 3JTYA 3NSGA 2JMMA 5G3AA 3T20A 3HWBA 1PRNA 4FSOA 3TZGA 2XTQA 4C00A 3QRAA 3K19A 1YS5A 1QJ9A 3AAEB 1GFPA 5GTIO 3BS0A 2K4TA 1MM4A 3PGUA 3AA0B 3PGRA 3KZIO 5G39A 4AFKA 2ERVA 4N58A 1T1LA 2R4LA 3AAAB 2X9KA 2XG6A 3PGSA 4FUVA 1MM5A 4JCHA 4PJ0O 3UAQA 5B66O 5KAFO 4C4VA 1ZHZA 2XE5A 3SYSA 1GFMA 3UPGA 4C69X 4G75A 4KR4A 1E54A 1HXTA 3DA3A 2GE4A 4FSPA 3VE2A 1Q9GA 1P4TA 2Y2XA 1ZHXA 2PRNA 4LSIA 3BRYA 4AYMC 2YNKA 4LSEA 3VE1A 2KZ7A 5DL7A 2OMFA 3SY9A 4FQEA 3LK3A 4FESA 5ADXL 4FMSA 3HW9A 4RL9A 3G7GA 4D65A 4GCQA 2N2LA 4U9CA 6PRNA 2W80C 3AA6A 4KRAA 5H2FO 5G38A 2ZLDA 3DZMA 3VY8X 5D5DA 5G26A 2M07A 3RBHA 4AKMA 4KR8A 2J1NA 3AA7A 1THQA 4O4UA 3A0HO 3LK41 2XMXA 5PRNA 3GP6A 2WJRA 1G90A 2IWVA 3VY9X 4Z3TA 3POUA 3PQUA 3SZVA 2F1CX 1H6S1 1ORMA 1S5LO 2O4VA 4AKRA 1GFOA 3SZDA 8PRNA 3AA1A 4GF4A 1MPFA 4LSHA 3WI4A 4IL6O 2Y0KA 2PORA 4XNKA 2WJQA 2W81C 3QRCA 2XE3A 5E79O 5AFUL 2XE2A 3HOLA 1HXUA 1Q9FA 3AAEA 3NJTA 4FRTA 4XNLA 2F1TA 2KZ7B 2FGQX 4FRXA 4N75A 3WI5A 4RLBA 3EMNX 2M06A 4UB8O 3A0BO 3UU2A 1ZHWA 3AAAA 4O3YA 4CTDA 4K3CA 3AA6B 3T24A 5KAIO 5FVNA 5IYUA 3DWNA 2K0LA 1OPFA 2KXPA 2ODJA 3O0EA 3V8UA 1PHOA 3KVDD 2JQYA 4K3BA 5ADXK 3AA7B 3DA4A 1QJPA 4GCSA 3LK42 3T0SA 4RJXA 3LK2A 4FZMA 4O49A 4E1TA 3PRNA 1QJ8A 2R4PA 3VZUX 4C4VB 1BH3A 2Y0LA 1ZHTA 2J4UP 2R88A 4AUIA 1IZNA 2QTKA 2R4OA 4GHBA 3VZTX 4AZLA 4BUMX 4PUXA 4N59A 2FGRA 2Y7SA 2F1VA 3PQSA 4AYNA 4FZNA 4G76A 5EE2A 5B5EO 4LSFA 4O3XB 2KDYA 5DL6A 4D64A 1T16A 2ZFGA 3POQA 5DL5A 4B61A 4N74A 3AA0A 3BRZA 3LK3B 1BT9A 4AYEC 2MNHA 3SY7A 3DWOX 2R89A 4AYDC 3C5OA 4RJWA 2KC0A 4O4XA 5DL8A 4O3WA 5AFUK 2IWWA 2X27X 4UB6O 2YPVA 1GFQA 4FOZA 2XTRA 1OSMA 2AXTO 3PF1A 3POXA 4PR7A 2LHFA 3WU2O 7PRNA 5TISO 3SYBA 2KXPB 4E1SA 4AYID 2N2MA 2R4NA 5GTHO 4RLCA
chains in the Genus database with same CATH topology
1ZHYA 1GFNA 4QQ1A 5JDPA 3LK2B 2MHLA 5GV0A 1BXWA 2LFUA 3PORA 5T5FA 4D5UA 4FT6A 1HXXA 4JFBA 4O3ZA 4AKRB 3A2SX 1IZNB 4GCPA 3HOEA 2Y0HA 3AA1B 4FZLA 4F4BA 2XE1A 3FYXA 3JTYA 3NSGA 2JMMA 3T20A 3HWBA 1PRNA 4FSOA 3TZGA 2XTQA 3QRAA 3K19A 1QJ9A 3AAEB 1GFPA 4AFKA 2K4TA 1MM4A 3AA0B 2ERVA 4N58A 3AAAB 3UAQA 2XG6A 4JCHA 4FUVA 1MM5A 1ZHZA 2XE5A 3SYSA 1GFMA 3UPGA 4C69X 4G75A 4KR4A 1E54A 1HXTA 3DA3A 2GE4A 4FSPA 3VE2A 1Q9GA 1P4TA 2Y2XA 1ZHXA 2PRNA 4LSIA 4AYMC 2YNKA 4LSEA 3VE1A 2KZ7A 5DL7A 2OMFA 3SY9A 3LK3A 4FESA 5ADXL 4FMSA 3HW9A 4RL9A 3G7GA 4D65A 4GCQA 2N2LA 4U9CA 6PRNA 2W80C 3AA6A 4KRAA 2ZLDA 3VY8X 5D5DA 5G26A 2M07A 3RBHA 4AKMA 4KR8A 2J1NA 3AA7A 1THQA 4O4UA 3LK41 2XMXA 5PRNA 3GP6A 1G90A 3VY9X 4Z3TA 3POUA 3PQUA 3SZVA 1H6S1 1ORMA 4AKRA 2O4VA 1GFOA 3SZDA 8PRNA 3AA1A 4GF4A 1MPFA 4LSHA 3WI4A 2Y0KA 2PORA 4XNKA 2W81C 3QRCA 2XE3A 5AFUL 2XE2A 3HOLA 1HXUA 1Q9FA 3AAEA 4FRTA 4XNLA 3VZWX 2F1TA 2KZ7B 2FGQX 4FRXA 3WI5A 4RLBA 3EMNX 2M06A 3UU2A 1ZHWA 3AAAA 4O3YA 3AA6B 3T24A 5IYUA 5FVNA 2K0LA 1OPFA 2KXPA 2ODJA 3O0EA 3V8UA 1PHOA 3KVDD 5ADXK 3AA7B 3DA4A 1QJPA 4GCSA 3LK42 3T0SA 4RJXA 3LK2A 4FZMA 4O49A 4E1TA 3PRNA 1QJ8A 3VZUX 1BH3A 2Y0LA 1ZHTA 2J4UP 4AUIA 1IZNA 2QTKA 4GHBA 3VZTX 4AZLA 4BUMX 4PUXA 4N59A 2FGRA 2Y7SA 2F1VA 3PQSA 4AYNA 4FZNA 4G76A 5EE2A 4LSFA 4O3XB 2KDYA 5DL6A 4D64A 2ZFGA 5DL5A 3POQA 4B61A 3AA0A 3LK3B 1BT9A 4AYEC 2MNHA 3SY7A 4AYDC 3C5OA 4RJWA 2KC0A 4O4XA 5DL8A 4O3WA 5AFUK 2X27X 2YPVA 1GFQA 4FOZA 2XTRA 1OSMA 3POXA 2LHFA 7PRNA 3SYBA 2KXPB 4E1SA 4AYID 2N2MA 1YS5A 4RLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFN A;  5JDP A;  3POR A;  4D5U A;  4FT6 A;  1HXX A;  4JFB A;  3A2S X;  4GCP A;  2Y0H A;  2XE1 A;  3FYX A;  3JTY A;  3NSG A;  3T20 A;  3HWB A;  1PRN A;  4FSO A;  3K19 A;  1GFP A;  2K4T A;  2XG6 A;  2XE5 A;  3SYS A;  1GFM A;  3UPG A;  4C69 X;  4KR4 A;  1E54 A;  1HXT A;  4FSP A;  2Y2X A;  2PRN A;  4LSI A;  4LSE A;  5DL7 A;  2OMF A;  3SY9 A;  4FMS A;  3HW9 A;  4D65 A;  4GCQ A;  6PRN A;  4KRA A;  2ZLD A;  3VY8 X;  4KR8 A;  2J1N A;  5PRN A;  3VY9 X;  3POU A;  3SZV A;  1H6S 1;  2O4V A;  1GFO A;  3SZD A;  8PRN A;  4LSH A;  3WI4 A;  1MPF A;  2Y0K A;  2POR A;  2XE3 A;  2XE2 A;  3VZW X;  1HXU A;  4FRT A;  4FRX A;  2FGQ X;  3WI5 A;  3EMN X;  3UU2 A;  3T24 A;  5FVN A;  1OPF A;  2ODJ A;  3O0E A;  1PHO A;  3T0S A;  4GCS A;  4RJX A;  3PRN A;  3VZU X;  1BH3 A;  2Y0L A;  2J4U P;  4AUI A;  3VZT X;  2QTK A;  4BUM X;  2FGR A;  4LSF A;  5DL6 A;  4D64 A;  2ZFG A;  5DL5 A;  3POQ A;  1BT9 A;  3SY7 A;  4RJW A;  5DL8 A;  4FOZ A;  1GFQ A;  1OSM A;  3POX A;  7PRN A;  3SYB A; 
#chains in the Genus database with same CATH topology
 1ZHY A;  1GFN A;  4QQ1 A;  5JDP A;  3LK2 B;  2MHL A;  5GV0 A;  3VZW X;  1BXW A;  2LFU A;  3POR A;  5T5F A;  4D5U A;  4FT6 A;  1HXX A;  3JCU O;  4JFB A;  4O3Z A;  2WVP A;  4AKR B;  3A2S X;  1IZN B;  4GCP A;  3HOE A;  2Y0H A;  3AA1 B;  4FZL A;  4F4B A;  2XE1 A;  2R8A A;  3FYX A;  3JTY A;  3NSG A;  2JMM A;  5G3A A;  3T20 A;  3HWB A;  1PRN A;  4FSO A;  3TZG A;  2XTQ A;  4C00 A;  3QRA A;  3K19 A;  1YS5 A;  1QJ9 A;  3AAE B;  1GFP A;  5GTI O;  3BS0 A;  2K4T A;  1MM4 A;  3PGU A;  3AA0 B;  3PGR A;  3KZI O;  5G39 A;  4AFK A;  2ERV A;  4N58 A;  1T1L A;  2R4L A;  3AAA B;  2X9K A;  2XG6 A;  3PGS A;  4FUV A;  1MM5 A;  4JCH A;  4PJ0 O;  3UAQ A;  5B66 O;  5KAF O;  4C4V A;  1ZHZ A;  2XE5 A;  3SYS A;  1GFM A;  3UPG A;  4C69 X;  4G75 A;  4KR4 A;  1E54 A;  1HXT A;  3DA3 A;  2GE4 A;  4FSP A;  3VE2 A;  1Q9G A;  1P4T A;  2Y2X A;  1ZHX A;  2PRN A;  4LSI A;  3BRY A;  4AYM C;  2YNK A;  4LSE A;  3VE1 A;  2KZ7 A;  5DL7 A;  2OMF A;  3SY9 A;  4FQE A;  3LK3 A;  4FES A;  5ADX L;  4FMS A;  3HW9 A;  4RL9 A;  3G7G A;  4D65 A;  4GCQ A;  2N2L A;  4U9C A;  6PRN A;  2W80 C;  3AA6 A;  4KRA A;  5H2F O;  5G38 A;  2ZLD A;  3DZM A;  3VY8 X;  5D5D A;  5G26 A;  2M07 A;  3RBH A;  4AKM A;  4KR8 A;  2J1N A;  3AA7 A;  1THQ A;  4O4U A;  3A0H O;  3LK4 1;  2XMX A;  5PRN A;  3GP6 A;  2WJR A;  1G90 A;  2IWV A;  3VY9 X;  4Z3T A;  3POU A;  3PQU A;  3SZV A;  2F1C X;  1H6S 1;  1ORM A;  1S5L O;  2O4V A;  4AKR A;  1GFO A;  3SZD A;  8PRN A;  3AA1 A;  4GF4 A;  1MPF A;  4LSH A;  3WI4 A;  4IL6 O;  2Y0K A;  2POR A;  4XNK A;  2WJQ A;  2W81 C;  3QRC A;  2XE3 A;  5E79 O;  5AFU L;  2XE2 A;  3HOL A;  1HXU A;  1Q9F A;  3AAE A;  3NJT A;  4FRT A;  4XNL A;  2F1T A;  2KZ7 B;  2FGQ X;  4FRX A;  4N75 A;  3WI5 A;  4RLB A;  3EMN X;  2M06 A;  4UB8 O;  3A0B O;  3UU2 A;  1ZHW A;  3AAA A;  4O3Y A;  4CTD A;  4K3C A;  3AA6 B;  3T24 A;  5KAI O;  5FVN A;  5IYU A;  3DWN A;  2K0L A;  1OPF A;  2KXP A;  2ODJ A;  3O0E A;  3V8U A;  1PHO A;  3KVD D;  2JQY A;  4K3B A;  5ADX K;  3AA7 B;  3DA4 A;  1QJP A;  4GCS A;  3LK4 2;  3T0S A;  4RJX A;  3LK2 A;  4FZM A;  4O49 A;  4E1T A;  3PRN A;  1QJ8 A;  2R4P A;  3VZU X;  4C4V B;  1BH3 A;  2Y0L A;  1ZHT A;  2J4U P;  2R88 A;  4AUI A;  1IZN A;  2QTK A;  2R4O A;  4GHB A;  3VZT X;  4AZL A;  4BUM X;  4PUX A;  4N59 A;  2FGR A;  2Y7S A;  2F1V A;  3PQS A;  4AYN A;  4FZN A;  4G76 A;  5EE2 A;  5B5E O;  4LSF A;  4O3X B;  2KDY A;  5DL6 A;  4D64 A;  1T16 A;  2ZFG A;  3POQ A;  5DL5 A;  4B61 A;  4N74 A;  3AA0 A;  3BRZ A;  3LK3 B;  1BT9 A;  4AYE C;  2MNH A;  3SY7 A;  3DWO X;  2R89 A;  4AYD C;  3C5O A;  4RJW A;  2KC0 A;  4O4X A;  5DL8 A;  4O3W A;  5AFU K;  2IWW A;  2X27 X;  4UB6 O;  2YPV A;  1GFQ A;  4FOZ A;  2XTR A;  1OSM A;  2AXT O;  3PF1 A;  3POX A;  4PR7 A;  2LHF A;  3WU2 O;  7PRN A;  5TIS O;  3SYB A;  2KXP B;  4E1S A;  4AYI D;  2N2M A;  2R4N A;  5GTH O;  4RLC A; 
#chains in the Genus database with same CATH homology
 1ZHY A;  1GFN A;  4QQ1 A;  5JDP A;  3LK2 B;  2MHL A;  5GV0 A;  1BXW A;  2LFU A;  3POR A;  5T5F A;  4D5U A;  4FT6 A;  1HXX A;  4JFB A;  4O3Z A;  4AKR B;  3A2S X;  1IZN B;  4GCP A;  3HOE A;  2Y0H A;  3AA1 B;  4FZL A;  4F4B A;  2XE1 A;  3FYX A;  3JTY A;  3NSG A;  2JMM A;  3T20 A;  3HWB A;  1PRN A;  4FSO A;  3TZG A;  2XTQ A;  3QRA A;  3K19 A;  1QJ9 A;  3AAE B;  1GFP A;  4AFK A;  2K4T A;  1MM4 A;  3AA0 B;  2ERV A;  4N58 A;  3AAA B;  3UAQ A;  2XG6 A;  4JCH A;  4FUV A;  1MM5 A;  1ZHZ A;  2XE5 A;  3SYS A;  1GFM A;  3UPG A;  4C69 X;  4G75 A;  4KR4 A;  1E54 A;  1HXT A;  3DA3 A;  2GE4 A;  4FSP A;  3VE2 A;  1Q9G A;  1P4T A;  2Y2X A;  1ZHX A;  2PRN A;  4LSI A;  4AYM C;  2YNK A;  4LSE A;  3VE1 A;  2KZ7 A;  5DL7 A;  2OMF A;  3SY9 A;  3LK3 A;  4FES A;  5ADX L;  4FMS A;  3HW9 A;  4RL9 A;  3G7G A;  4D65 A;  4GCQ A;  2N2L A;  4U9C A;  6PRN A;  2W80 C;  3AA6 A;  4KRA A;  2ZLD A;  3VY8 X;  5D5D A;  5G26 A;  2M07 A;  3RBH A;  4AKM A;  4KR8 A;  2J1N A;  3AA7 A;  1THQ A;  4O4U A;  3LK4 1;  2XMX A;  5PRN A;  3GP6 A;  1G90 A;  3VY9 X;  4Z3T A;  3POU A;  3PQU A;  3SZV A;  1H6S 1;  1ORM A;  4AKR A;  2O4V A;  1GFO A;  3SZD A;  8PRN A;  3AA1 A;  4GF4 A;  1MPF A;  4LSH A;  3WI4 A;  2Y0K A;  2POR A;  4XNK A;  2W81 C;  3QRC A;  2XE3 A;  5AFU L;  2XE2 A;  3HOL A;  1HXU A;  1Q9F A;  3AAE A;  4FRT A;  4XNL A;  3VZW X;  2F1T A;  2KZ7 B;  2FGQ X;  4FRX A;  3WI5 A;  4RLB A;  3EMN X;  2M06 A;  3UU2 A;  1ZHW A;  3AAA A;  4O3Y A;  3AA6 B;  3T24 A;  5IYU A;  5FVN A;  2K0L A;  1OPF A;  2KXP A;  2ODJ A;  3O0E A;  3V8U A;  1PHO A;  3KVD D;  5ADX K;  3AA7 B;  3DA4 A;  1QJP A;  4GCS A;  3LK4 2;  3T0S A;  4RJX A;  3LK2 A;  4FZM A;  4O49 A;  4E1T A;  3PRN A;  1QJ8 A;  3VZU X;  1BH3 A;  2Y0L A;  1ZHT A;  2J4U P;  4AUI A;  1IZN A;  2QTK A;  4GHB A;  3VZT X;  4AZL A;  4BUM X;  4PUX A;  4N59 A;  2FGR A;  2Y7S A;  2F1V A;  3PQS A;  4AYN A;  4FZN A;  4G76 A;  5EE2 A;  4LSF A;  4O3X B;  2KDY A;  5DL6 A;  4D64 A;  2ZFG A;  5DL5 A;  3POQ A;  4B61 A;  3AA0 A;  3LK3 B;  1BT9 A;  4AYE C;  2MNH A;  3SY7 A;  4AYD C;  3C5O A;  4RJW A;  2KC0 A;  4O4X A;  5DL8 A;  4O3W A;  5AFU K;  2X27 X;  2YPV A;  1GFQ A;  4FOZ A;  2XTR A;  1OSM A;  3POX A;  2LHF A;  7PRN A;  3SYB A;  2KXP B;  4E1S A;  4AYI D;  2N2M A;  1YS5 A;  4RLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...