3POUA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, large unit cell
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords OmpF protein
total genus 102
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3pouA00
2QTKA 2XE5A 5DL8A 1HXTA 1GFQA 1OSMA 3JTYA 1GFOA 4FRTA 4AUIA 4FMSA 3VZUX 1PHOA 3EMNX 2ZFGA 1MPFA 4JFBA 4KRAA 2J4UP 2FGRA 2K4TA 1GFNA 2XE1A 4FOZA 3SYSA 5DL7A 3T20A 4GCPA 2XE2A 4LSHA 3A2SX 2ODJA 1H6S1 2FGQX 3K19A 4D64A 1GFPA 4RJXA 1HXXA 7PRNA 8PRNA 3PRNA 3POXA 2ZLDA 2O4VA 2XG6A 3SY9A 2PORA 2Y0HA 3T0SA 3NSGA 3FYXA 4LSIA 3POQA 4C69X 4D65A 4LSFA 3SYBA 3VZTX 4RJWA 2Y0LA 3HW9A 3VY9X 3O0EA 4BUMX 2XE3A 3VY8X 3SZDA 1E54A 5FVNA 1OPFA 4LSEA 3HWBA 4FSOA 4KR4A 2PRNA 3T24A 4KR8A 3UU2A 4GCQA 2OMFA 5DL5A 4FT6A 4FRXA 2Y2XA 2Y0KA 1GFMA 4D5UA 3WI4A 1BH3A 5PRNA 1HXUA 1BT9A 4FSPA 3POUA 1PRNA 3SY7A 5DL6A 3PORA 3VZWX 5JDPA 3UPGA 6PRNA 2J1NA 4GCSA 3WI5A 3SZVA
chains in the Genus database with same CATH superfamily
2MHLA 2QTKA 2XE5A 1HXTA 5DL8A 1GFQA 1OSMA 3JTYA 4G76A 3AA0A 2KXPB 1GFOA 3VE1A 3GP6A 3AAEA 4FRTA 1IZNB 4AUIA 4AYDC 4FMSA 3VZUX 1PHOA 1ZHZA 3EMNX 4N75A 3NJTA 2ZFGA 3LK42 2XTQA 1MPFA 4JFBA 4RLBA 4JCHA 1BXWA 4KRAA 5TISO 4AYNA 1T1LA 6PRNA 5GTHO 2J4UP 3LK2B 2FGRA 2K4TA 1GFNA 2XE1A 3BRYA 5G38A 4GHBA 4FOZA 4AKRA 3SYSA 3TZGA 5DL7A 3AA7A 4C00A 3AA6B 1ZHWA 2ERVA 2F1CX 5T5FA 3T20A 1IZNA 3LK3A 5G26A 4U9CA 4C4VB 2YNKA 2M07A 3LK41 4GCPA 2XE2A 4LSHA 4XNKA 1S5LO 3A2SX 4FUVA 2ODJA 4PUXA 5G39A 1H6S1 2FGQX 3K19A 3HOLA 3PGUA 3UAQA 1GFPA 2F1TA 4D64A 2R4NA 1QJ8A 5B5EO 4FZNA 4FZMA 3BRZA 3PF1A 4RJXA 1QJPA 1HXXA 3LK3B 4C4VA 7PRNA 8PRNA 3AA1A 2AXTO 3PRNA 3KZIO 3AA7B 1YS5A 3DWOX 3POXA 3PQSA 4QQ1A 2ZLDA 4G75A 5IYUA 2O4VA 2XG6A 3DWNA 4K3BA 2R4LA 1ZHYA 4O3WA 2KXPA 3SY9A 2PORA 3QRAA 3KVDD 2Y0HA 2KDYA 4AZLA 3T0SA 2R4OA 3NSGA 3FYXA 4GF4A 1MM4A 2R89A 2WJRA 4AFKA 4LSIA 3POQA 4E1SA 5ADXL 4C69X 3BS0A 3AA1B 4D65A 2LFUA 2WVPA 3LK2A 4LSFA 3A0HO 2KZ7B 3SYBA 3WU2O 4B61A 3VZTX 4RJWA 1MM5A 4AKRB 2Y0LA 3HW9A 3JCUO 5KAIO 1ZHTA 2XTRA 2YPVA 4N58A 4FQEA 3VY9X 3O0EA 2K0LA 1P4TA 3PGSA 5AFUL 4BUMX 2LHFA 3SZVA 1ORMA 2W80C 2XE3A 4RL9A 3VY8X 3SZDA 1E54A 5FVNA 1OPFA 4LSEA 4E1TA 4PR7A 3DA3A 2X27X 3QRCA 2F1VA 4O49A 3G7GA 3HWBA 4FSOA 2JQYA 4KR4A 2PRNA 3AA0B 4FZLA 4KR8A 3T24A 2IWWA 5ADXK 3UU2A 3AAEB 4GCQA 2JMMA 2OMFA 5DL5A 3VE2A 2IWVA 4FT6A 2W81C 3PQUA 4FRXA 4O3YA 2Y2XA 4AYMC 2Y0KA 1GFMA 4D5UA 3WI4A 4O3XB 1QJ9A 4AYEC 4UB8O 2XMXA 1BH3A 5E79O 5PRNA 1HXUA 3HOEA 1G90A 4N74A 1Q9FA 4O4UA 1BT9A 3PGRA 5KAFO 3A0BO 3V8UA 3AAAA 4Z3TA 5EE2A 1T16A 4FSPA 4CTDA 3POUA 5AFUK 3AA6A 4FESA 4K3CA 4RLCA 4UB6O 5H2FO 4N59A 2KZ7A 1PRNA 3SY7A 2WJQA 1THQA 2R8AA 4O3ZA 5DL6A 2R88A 3PORA 3VZWX 4PJ0O 4AKMA 5JDPA 2MNHA 3UPGA 2X9KA 1Q9GA 3AAAB 3C5OA 4IL6O 3DA4A 3DZMA 2R4PA 2J1NA 5G3AA 5B66O 4F4BA 2N2MA 1ZHXA 4XNLA 2GE4A 4GCSA 4AYID 2M06A 2Y7SA 3RBHA 5GV0A 5D5DA 5GTIO 2N2LA 3WI5A 2KC0A 4O4XA
chains in the Genus database with same CATH topology
2MHLA 2QTKA 2XE5A 1HXTA 5DL8A 1GFQA 1OSMA 3JTYA 4G76A 3AA0A 2KXPB 1GFOA 3VE1A 3GP6A 3AAEA 4FRTA 1IZNB 4AUIA 4AYDC 4FMSA 3VZUX 1PHOA 1ZHZA 3EMNX 2ZFGA 3LK42 2XTQA 1MPFA 4JFBA 4RLBA 4JCHA 1BXWA 4KRAA 4AYNA 2J4UP 3LK2B 2FGRA 2K4TA 1GFNA 2XE1A 4GHBA 4FOZA 4AKRA 3SYSA 3TZGA 5DL7A 3AA7A 3AA6B 1ZHWA 2ERVA 5T5FA 3T20A 1IZNA 3LK3A 5G26A 4U9CA 2YNKA 2M07A 3LK41 4GCPA 2XE2A 4LSHA 4XNKA 3A2SX 4FUVA 2ODJA 4PUXA 3UAQA 1H6S1 2FGQX 3K19A 3HOLA 4D64A 1GFPA 2F1TA 1QJ8A 4FZNA 4FZMA 4RJXA 1QJPA 1HXXA 3LK3B 7PRNA 8PRNA 3AA1A 3PRNA 3PQSA 4QQ1A 3AA7B 1YS5A 3POXA 2ZLDA 4G75A 5IYUA 2O4VA 2XG6A 4O3WA 1ZHYA 3SY9A 2KXPA 2PORA 3QRAA 3KVDD 2Y0HA 2KDYA 4AZLA 3T0SA 3NSGA 3FYXA 4GF4A 1MM4A 4AFKA 4LSIA 3POQA 4E1SA 5ADXL 4C69X 3AA1B 4D65A 2LFUA 4LSFA 3LK2A 2KZ7B 3SYBA 4B61A 3VZTX 4RJWA 1MM5A 4AKRB 2Y0LA 3HW9A 1ZHTA 2XTRA 2YPVA 4N58A 5AFUL 3VY9X 3O0EA 2K0LA 1P4TA 4BUMX 2LHFA 3SZVA 1ORMA 2W80C 2XE3A 4RL9A 3VY8X 3SZDA 1E54A 5FVNA 1OPFA 4LSEA 4E1TA 3DA3A 2X27X 3QRCA 2F1VA 4O49A 3G7GA 3HWBA 4FSOA 4KR4A 2PRNA 3AA0B 4FZLA 4KR8A 3T24A 5ADXK 3UU2A 3AAEB 4GCQA 2JMMA 2OMFA 5DL5A 3VE2A 4FT6A 2W81C 3PQUA 4FRXA 4O3YA 2Y2XA 4AYMC 2Y0KA 1GFMA 4D5UA 3WI4A 4O3XB 1QJ9A 4AYEC 2XMXA 1BH3A 5PRNA 1G90A 1HXUA 3HOEA 1Q9FA 4O4UA 1BT9A 3V8UA 3AAAA 4Z3TA 5EE2A 4FSPA 5AFUK 3POUA 3AA6A 4FESA 4RLCA 4N59A 2KZ7A 1PRNA 3SY7A 1THQA 4O3ZA 5DL6A 3PORA 3VZWX 4AKMA 5JDPA 2MNHA 3UPGA 1Q9GA 3AAAB 3C5OA 6PRNA 3DA4A 2J1NA 4F4BA 2N2MA 1ZHXA 4XNLA 2GE4A 4GCSA 4AYID 2M06A 2Y7SA 3RBHA 5GV0A 5D5DA 2N2LA 3WI5A 2KC0A 4O4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTK A;  2XE5 A;  5DL8 A;  1HXT A;  1GFQ A;  1OSM A;  3JTY A;  1GFO A;  4FRT A;  4AUI A;  4FMS A;  3VZU X;  1PHO A;  3EMN X;  2ZFG A;  1MPF A;  4JFB A;  4KRA A;  2J4U P;  2FGR A;  2K4T A;  1GFN A;  2XE1 A;  4FOZ A;  3SYS A;  5DL7 A;  3T20 A;  4GCP A;  2XE2 A;  4LSH A;  3A2S X;  2ODJ A;  1H6S 1;  2FGQ X;  3K19 A;  4D64 A;  1GFP A;  4RJX A;  1HXX A;  7PRN A;  8PRN A;  3PRN A;  3POX A;  2ZLD A;  2O4V A;  2XG6 A;  3SY9 A;  2POR A;  2Y0H A;  3T0S A;  3NSG A;  3FYX A;  4LSI A;  3POQ A;  4C69 X;  4D65 A;  4LSF A;  3SYB A;  3VZT X;  4RJW A;  2Y0L A;  3HW9 A;  3VY9 X;  3O0E A;  4BUM X;  2XE3 A;  3VY8 X;  3SZD A;  1E54 A;  5FVN A;  1OPF A;  4LSE A;  3HWB A;  4FSO A;  4KR4 A;  2PRN A;  3T24 A;  4KR8 A;  3UU2 A;  4GCQ A;  2OMF A;  5DL5 A;  4FT6 A;  4FRX A;  2Y2X A;  2Y0K A;  1GFM A;  4D5U A;  3WI4 A;  1BH3 A;  5PRN A;  1HXU A;  1BT9 A;  4FSP A;  3POU A;  1PRN A;  3SY7 A;  5DL6 A;  3POR A;  3VZW X;  5JDP A;  3UPG A;  6PRN A;  2J1N A;  4GCS A;  3WI5 A;  3SZV A; 
#chains in the Genus database with same CATH topology
 2MHL A;  2QTK A;  2XE5 A;  1HXT A;  5DL8 A;  1GFQ A;  1OSM A;  3JTY A;  4G76 A;  3AA0 A;  2KXP B;  1GFO A;  3VE1 A;  3GP6 A;  3AAE A;  4FRT A;  1IZN B;  4AUI A;  4AYD C;  4FMS A;  3VZU X;  1PHO A;  1ZHZ A;  3EMN X;  4N75 A;  3NJT A;  2ZFG A;  3LK4 2;  2XTQ A;  1MPF A;  4JFB A;  4RLB A;  4JCH A;  1BXW A;  4KRA A;  5TIS O;  4AYN A;  1T1L A;  6PRN A;  5GTH O;  2J4U P;  3LK2 B;  2FGR A;  2K4T A;  1GFN A;  2XE1 A;  3BRY A;  5G38 A;  4GHB A;  4FOZ A;  4AKR A;  3SYS A;  3TZG A;  5DL7 A;  3AA7 A;  4C00 A;  3AA6 B;  1ZHW A;  2ERV A;  2F1C X;  5T5F A;  3T20 A;  1IZN A;  3LK3 A;  5G26 A;  4U9C A;  4C4V B;  2YNK A;  2M07 A;  3LK4 1;  4GCP A;  2XE2 A;  4LSH A;  4XNK A;  1S5L O;  3A2S X;  4FUV A;  2ODJ A;  4PUX A;  5G39 A;  1H6S 1;  2FGQ X;  3K19 A;  3HOL A;  3PGU A;  3UAQ A;  1GFP A;  2F1T A;  4D64 A;  2R4N A;  1QJ8 A;  5B5E O;  4FZN A;  4FZM A;  3BRZ A;  3PF1 A;  4RJX A;  1QJP A;  1HXX A;  3LK3 B;  4C4V A;  7PRN A;  8PRN A;  3AA1 A;  2AXT O;  3PRN A;  3KZI O;  3AA7 B;  1YS5 A;  3DWO X;  3POX A;  3PQS A;  4QQ1 A;  2ZLD A;  4G75 A;  5IYU A;  2O4V A;  2XG6 A;  3DWN A;  4K3B A;  2R4L A;  1ZHY A;  4O3W A;  2KXP A;  3SY9 A;  2POR A;  3QRA A;  3KVD D;  2Y0H A;  2KDY A;  4AZL A;  3T0S A;  2R4O A;  3NSG A;  3FYX A;  4GF4 A;  1MM4 A;  2R89 A;  2WJR A;  4AFK A;  4LSI A;  3POQ A;  4E1S A;  5ADX L;  4C69 X;  3BS0 A;  3AA1 B;  4D65 A;  2LFU A;  2WVP A;  3LK2 A;  4LSF A;  3A0H O;  2KZ7 B;  3SYB A;  3WU2 O;  4B61 A;  3VZT X;  4RJW A;  1MM5 A;  4AKR B;  2Y0L A;  3HW9 A;  3JCU O;  5KAI O;  1ZHT A;  2XTR A;  2YPV A;  4N58 A;  4FQE A;  3VY9 X;  3O0E A;  2K0L A;  1P4T A;  3PGS A;  5AFU L;  4BUM X;  2LHF A;  3SZV A;  1ORM A;  2W80 C;  2XE3 A;  4RL9 A;  3VY8 X;  3SZD A;  1E54 A;  5FVN A;  1OPF A;  4LSE A;  4E1T A;  4PR7 A;  3DA3 A;  2X27 X;  3QRC A;  2F1V A;  4O49 A;  3G7G A;  3HWB A;  4FSO A;  2JQY A;  4KR4 A;  2PRN A;  3AA0 B;  4FZL A;  4KR8 A;  3T24 A;  2IWW A;  5ADX K;  3UU2 A;  3AAE B;  4GCQ A;  2JMM A;  2OMF A;  5DL5 A;  3VE2 A;  2IWV A;  4FT6 A;  2W81 C;  3PQU A;  4FRX A;  4O3Y A;  2Y2X A;  4AYM C;  2Y0K A;  1GFM A;  4D5U A;  3WI4 A;  4O3X B;  1QJ9 A;  4AYE C;  4UB8 O;  2XMX A;  1BH3 A;  5E79 O;  5PRN A;  1HXU A;  3HOE A;  1G90 A;  4N74 A;  1Q9F A;  4O4U A;  1BT9 A;  3PGR A;  5KAF O;  3A0B O;  3V8U A;  3AAA A;  4Z3T A;  5EE2 A;  1T16 A;  4FSP A;  4CTD A;  3POU A;  5AFU K;  3AA6 A;  4FES A;  4K3C A;  4RLC A;  4UB6 O;  5H2F O;  4N59 A;  2KZ7 A;  1PRN A;  3SY7 A;  2WJQ A;  1THQ A;  2R8A A;  4O3Z A;  5DL6 A;  2R88 A;  3POR A;  3VZW X;  4PJ0 O;  4AKM A;  5JDP A;  2MNH A;  3UPG A;  2X9K A;  1Q9G A;  3AAA B;  3C5O A;  4IL6 O;  3DA4 A;  3DZM A;  2R4P A;  2J1N A;  5G3A A;  5B66 O;  4F4B A;  2N2M A;  1ZHX A;  4XNL A;  2GE4 A;  4GCS A;  4AYI D;  2M06 A;  2Y7S A;  3RBH A;  5GV0 A;  5D5D A;  5GTI O;  2N2L A;  3WI5 A;  2KC0 A;  4O4X A; 
#chains in the Genus database with same CATH homology
 2MHL A;  2QTK A;  2XE5 A;  1HXT A;  5DL8 A;  1GFQ A;  1OSM A;  3JTY A;  4G76 A;  3AA0 A;  2KXP B;  1GFO A;  3VE1 A;  3GP6 A;  3AAE A;  4FRT A;  1IZN B;  4AUI A;  4AYD C;  4FMS A;  3VZU X;  1PHO A;  1ZHZ A;  3EMN X;  2ZFG A;  3LK4 2;  2XTQ A;  1MPF A;  4JFB A;  4RLB A;  4JCH A;  1BXW A;  4KRA A;  4AYN A;  2J4U P;  3LK2 B;  2FGR A;  2K4T A;  1GFN A;  2XE1 A;  4GHB A;  4FOZ A;  4AKR A;  3SYS A;  3TZG A;  5DL7 A;  3AA7 A;  3AA6 B;  1ZHW A;  2ERV A;  5T5F A;  3T20 A;  1IZN A;  3LK3 A;  5G26 A;  4U9C A;  2YNK A;  2M07 A;  3LK4 1;  4GCP A;  2XE2 A;  4LSH A;  4XNK A;  3A2S X;  4FUV A;  2ODJ A;  4PUX A;  3UAQ A;  1H6S 1;  2FGQ X;  3K19 A;  3HOL A;  4D64 A;  1GFP A;  2F1T A;  1QJ8 A;  4FZN A;  4FZM A;  4RJX A;  1QJP A;  1HXX A;  3LK3 B;  7PRN A;  8PRN A;  3AA1 A;  3PRN A;  3PQS A;  4QQ1 A;  3AA7 B;  1YS5 A;  3POX A;  2ZLD A;  4G75 A;  5IYU A;  2O4V A;  2XG6 A;  4O3W A;  1ZHY A;  3SY9 A;  2KXP A;  2POR A;  3QRA A;  3KVD D;  2Y0H A;  2KDY A;  4AZL A;  3T0S A;  3NSG A;  3FYX A;  4GF4 A;  1MM4 A;  4AFK A;  4LSI A;  3POQ A;  4E1S A;  5ADX L;  4C69 X;  3AA1 B;  4D65 A;  2LFU A;  4LSF A;  3LK2 A;  2KZ7 B;  3SYB A;  4B61 A;  3VZT X;  4RJW A;  1MM5 A;  4AKR B;  2Y0L A;  3HW9 A;  1ZHT A;  2XTR A;  2YPV A;  4N58 A;  5AFU L;  3VY9 X;  3O0E A;  2K0L A;  1P4T A;  4BUM X;  2LHF A;  3SZV A;  1ORM A;  2W80 C;  2XE3 A;  4RL9 A;  3VY8 X;  3SZD A;  1E54 A;  5FVN A;  1OPF A;  4LSE A;  4E1T A;  3DA3 A;  2X27 X;  3QRC A;  2F1V A;  4O49 A;  3G7G A;  3HWB A;  4FSO A;  4KR4 A;  2PRN A;  3AA0 B;  4FZL A;  4KR8 A;  3T24 A;  5ADX K;  3UU2 A;  3AAE B;  4GCQ A;  2JMM A;  2OMF A;  5DL5 A;  3VE2 A;  4FT6 A;  2W81 C;  3PQU A;  4FRX A;  4O3Y A;  2Y2X A;  4AYM C;  2Y0K A;  1GFM A;  4D5U A;  3WI4 A;  4O3X B;  1QJ9 A;  4AYE C;  2XMX A;  1BH3 A;  5PRN A;  1G90 A;  1HXU A;  3HOE A;  1Q9F A;  4O4U A;  1BT9 A;  3V8U A;  3AAA A;  4Z3T A;  5EE2 A;  4FSP A;  5AFU K;  3POU A;  3AA6 A;  4FES A;  4RLC A;  4N59 A;  2KZ7 A;  1PRN A;  3SY7 A;  1THQ A;  4O3Z A;  5DL6 A;  3POR A;  3VZW X;  4AKM A;  5JDP A;  2MNH A;  3UPG A;  1Q9G A;  3AAA B;  3C5O A;  6PRN A;  3DA4 A;  2J1N A;  4F4B A;  2N2M A;  1ZHX A;  4XNL A;  2GE4 A;  4GCS A;  4AYI D;  2M06 A;  2Y7S A;  3RBH A;  5GV0 A;  5D5D A;  2N2L A;  3WI5 A;  2KC0 A;  4O4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...