3POUA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, large unit cell
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords OmpF protein
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
total genus 102
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3pouA00
3WI5A 3K19A 1HXUA 2PRNA 5DL8A 2Y0LA 2ZFGA 4GCQA 5JDPA 1BT9A 1PRNA 4FT6A 4LSFA 3SYBA 8PRNA 3JTYA 4LSHA 1GFOA 2J4UP 7PRNA 2Y0KA 4KR8A 3HWBA 3A2SX 4RJXA 3SYSA 3SY9A 1E54A 1OPFA 4GCPA 3T20A 3POUA 3VZWX 1OSMA 5FVNA 4FOZA 3PRNA 3SY7A 2Y2XA 1PHOA 3UPGA 2ZLDA 2Y0HA 2XE5A 4LSIA 2PORA 3FYXA 4FMSA 4GCSA 2J1NA 2QTKA 4D64A 2FGQX 4FRTA 1H6S1 3T0SA 1MPFA 3VZTX 6PRNA 3SZDA 5PRNA 4FSOA 4D65A 3O0EA 1GFNA 3NSGA 3T24A 1BH3A 3VY8X 3HW9A 5DL6A 4RJWA 1GFMA 2XE3A 1HXXA 5DL5A 2ODJA 2FGRA 1GFQA 3PORA 1GFPA 4FSPA 2OMFA 4FRXA 4KRAA 4C69X 2K4TA 2O4VA 3EMNX 2XG6A 5DL7A 4AUIA 3VZUX 2XE1A 1HXTA 4JFBA 4KR4A 3POQA 3SZVA 4LSEA 2XE2A 4D5UA 3POXA 4BUMX 3UU2A 3WI4A 3VY9X
chains in the Genus database with same CATH superfamily
5ADXL 2W80C 3WI5A 3K19A 1HXUA 4N74A 2PRNA 5DL8A 2Y0LA 3KVDD 2ZFGA 4GCQA 5JDPA 1BT9A 1PRNA 4FT6A 1MM5A 4LSFA 2F1TA 3QRCA 3SYBA 1ORMA 3JTYA 4JCHA 4Z3TA 8PRNA 4LSHA 1GFOA 1IZNA 1ZHWA 3DZMA 2Y0KA 3NJTA 4AKMA 7PRNA 1Q9GA 4KR8A 2R88A 5G38A 2M06A 3LK3A 2F1CX 3HWBA 3A2SX 3AA7B 4RJXA 4UB6O 4AYMC 5ADXK 3SYSA 3AA1B 1T16A 3AAAA 4PJ0O 3SY9A 2YNKA 3JCUO 1E54A 3PQSA 1OPFA 1MM4A 3C5OA 4K3BA 4N59A 4GCPA 5KAFO 3RBHA 3PGSA 3T20A 2KXPB 5T5FA 3POUA 3VZWX 1OSMA 5FVNA 3TZGA 4FOZA 4AYDC 3PRNA 3LK41 2R8AA 3VE2A 3SY7A 1THQA 5EE2A 2Y2XA 5B5EO 1PHOA 4UB8O 3BRYA 4GF4A 4C4VA 3UPGA 4XNKA 2KZ7A 2ZLDA 3LK2A 1QJPA 2R4PA 4O3WA 2XTRA 1IZNB 4O4XA 4G75A 3VE1A 2Y0HA 2AXTO 2R4OA 2XE5A 2KC0A 3DWNA 3A0HO 3AA0B 3LK3B 4LSIA 2MNHA 5H2FO 3AAAB 3BS0A 2PORA 4B61A 4O4UA 4IL6O 4AKRA 3WU2O 4XNLA 5GTHO 3FYXA 2J4UP 3HOLA 4PUXA 1T1LA 5IYUA 4FMSA 2WVPA 3AA6A 2M07A 4GCSA 2J1NA 4GHBA 2YPVA 2KDYA 3DWOX 2QTKA 4D64A 5AFUL 2FGQX 4N58A 4FRTA 4U9CA 3BRZA 1Q9FA 1ZHXA 4FQEA 4CTDA 1H6S1 3T0SA 1MPFA 3VZTX 4K3CA 6PRNA 4QQ1A 3SZDA 5PRNA 4AZLA 4C4VB 2KZ7B 4FSOA 3GP6A 3LK2B 4RLCA 3A0BO 1ZHYA 2K0LA 2XMXA 1BXWA 2R4NA 3O0EA 4C00A 4D65A 1ZHZA 1GFNA 2ERVA 3PGRA 2X27X 2WJQA 3NSGA 2F1VA 1BH3A 3T24A 1ZHTA 3VY8X 1P4TA 2W81C 3HW9A 3KZIO 4FESA 5D5DA 5DL6A 4RJWA 4AKRB 1GFMA 1QJ8A 1HXXA 2XE3A 4O49A 3AA6B 5DL5A 3PF1A 2MHLA 2JQYA 2ODJA 2FGRA 3DA3A 1GFQA 3PQUA 4F4BA 2N2MA 5TISO 1QJ9A 4G76A 4E1SA 4RLBA 3AAEA 4FZLA 3PORA 1GFPA 4FZMA 5G39A 5B66O 3DA4A 2LHFA 4FSPA 1G90A 4FUVA 2OMFA 4FRXA 3V8UA 4AYEC 4KRAA 3G7GA 3LK42 1S5LO 4AYID 2K4TA 2O4VA 3EMNX 4C69X 2XTQA 2LFUA 2XG6A 3HOEA 3PGUA 4N75A 4AFKA 5DL7A 4AUIA 4FZNA 3QRAA 5G26A 2N2LA 4O3XB 4PR7A 3VZUX 4E1TA 2XE1A 1HXTA 4JFBA 2R89A 4KR4A 2X9KA 4AYNA 1YS5A 5AFUK 5GTIO 2Y7SA 3AA0A 3POQA 3SZVA 4LSEA 2WJRA 2IWVA 2JMMA 2XE2A 2R4LA 4O3ZA 4D5UA 5KAIO 3AA7A 2GE4A 3AA1A 3UAQA 3POXA 4BUMX 5GV0A 3UU2A 3AAEB 4O3YA 4RL9A 2IWWA 2KXPA 3WI4A 5G3AA 3VY9X 5E79O
chains in the Genus database with same CATH topology
5ADXL 2W80C 3WI5A 3K19A 1HXUA 2PRNA 5DL8A 2Y0LA 3KVDD 2ZFGA 4GCQA 5JDPA 1BT9A 1PRNA 4FT6A 1MM5A 4LSFA 2F1TA 3QRCA 3SYBA 1ORMA 3JTYA 4JCHA 4Z3TA 8PRNA 4LSHA 1GFOA 1IZNA 1ZHWA 4AKMA 2Y0KA 7PRNA 2J4UP 1Q9GA 4KR8A 4E1TA 2M06A 3LK3A 4AYMC 3HWBA 3A2SX 3AA7B 4RJXA 5ADXK 3SYSA 3AA1B 3AAAA 3SY9A 2YNKA 1E54A 3PQSA 1OPFA 1MM4A 3C5OA 4N59A 4GCPA 3RBHA 3T20A 2KXPB 5T5FA 3POUA 3VZWX 1OSMA 5FVNA 3TZGA 4FOZA 4AYDC 3PRNA 3LK41 3VE2A 3SY7A 1THQA 5EE2A 2Y2XA 1PHOA 4GF4A 3UPGA 4XNKA 2KZ7A 2ZLDA 3LK2A 1QJPA 4O3WA 2XTRA 1IZNB 4O4XA 4G75A 3VE1A 2Y0HA 2XE5A 3LK3B 2KC0A 4LSIA 3AA0B 2MNHA 3AAAB 2PORA 4B61A 4O4UA 4AKRA 4XNLA 3FYXA 3HOLA 4PUXA 4FMSA 3AA6A 2M07A 4GCSA 2J1NA 4GHBA 2YPVA 2KDYA 2QTKA 4D64A 5AFUL 2FGQX 4N58A 4FRTA 4U9CA 1Q9FA 1ZHXA 1H6S1 3T0SA 1MPFA 3VZTX 6PRNA 4QQ1A 3SZDA 5PRNA 4AZLA 2KZ7B 4FSOA 3GP6A 3LK2B 4RLCA 1ZHYA 2K0LA 2XMXA 1BXWA 3O0EA 4D65A 1ZHZA 1GFNA 2ERVA 2X27X 3NSGA 2F1VA 1BH3A 3T24A 1ZHTA 3VY8X 1P4TA 2W81C 3HW9A 4FESA 5D5DA 4AKRB 5DL6A 4RJWA 1GFMA 1QJ8A 1HXXA 2XE3A 4O49A 3AA6B 5DL5A 2MHLA 2ODJA 2FGRA 3DA3A 1GFQA 3PQUA 4F4BA 2N2MA 1QJ9A 4G76A 4E1SA 4RLBA 3AAEA 4FZLA 3PORA 1GFPA 4FZMA 3DA4A 2LHFA 4FSPA 1G90A 4FUVA 2OMFA 4FRXA 3V8UA 4AYEC 4KRAA 3G7GA 3LK42 4AYID 2K4TA 2O4VA 3EMNX 4C69X 2XTQA 2LFUA 2XG6A 3HOEA 4AFKA 5IYUA 5DL7A 4AUIA 4FZNA 3QRAA 5G26A 2N2LA 4O3XB 3VZUX 2XE1A 1HXTA 4JFBA 4KR4A 4AYNA 1YS5A 5AFUK 2Y7SA 3AA0A 3POQA 3SZVA 4LSEA 2JMMA 2XE2A 4O3ZA 4D5UA 3AA7A 2GE4A 3AA1A 3UAQA 3POXA 4BUMX 5GV0A 3UU2A 3AAEB 4O3YA 4RL9A 2KXPA 3WI4A 3VY9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WI5 A;  3K19 A;  1HXU A;  2PRN A;  5DL8 A;  2Y0L A;  2ZFG A;  4GCQ A;  5JDP A;  1BT9 A;  1PRN A;  4FT6 A;  4LSF A;  3SYB A;  8PRN A;  3JTY A;  4LSH A;  1GFO A;  2J4U P;  7PRN A;  2Y0K A;  4KR8 A;  3HWB A;  3A2S X;  4RJX A;  3SYS A;  3SY9 A;  1E54 A;  1OPF A;  4GCP A;  3T20 A;  3POU A;  3VZW X;  1OSM A;  5FVN A;  4FOZ A;  3PRN A;  3SY7 A;  2Y2X A;  1PHO A;  3UPG A;  2ZLD A;  2Y0H A;  2XE5 A;  4LSI A;  2POR A;  3FYX A;  4FMS A;  4GCS A;  2J1N A;  2QTK A;  4D64 A;  2FGQ X;  4FRT A;  1H6S 1;  3T0S A;  1MPF A;  3VZT X;  6PRN A;  3SZD A;  5PRN A;  4FSO A;  4D65 A;  3O0E A;  1GFN A;  3NSG A;  3T24 A;  1BH3 A;  3VY8 X;  3HW9 A;  5DL6 A;  4RJW A;  1GFM A;  2XE3 A;  1HXX A;  5DL5 A;  2ODJ A;  2FGR A;  1GFQ A;  3POR A;  1GFP A;  4FSP A;  2OMF A;  4FRX A;  4KRA A;  4C69 X;  2K4T A;  2O4V A;  3EMN X;  2XG6 A;  5DL7 A;  4AUI A;  3VZU X;  2XE1 A;  1HXT A;  4JFB A;  4KR4 A;  3POQ A;  3SZV A;  4LSE A;  2XE2 A;  4D5U A;  3POX A;  4BUM X;  3UU2 A;  3WI4 A;  3VY9 X; 
#chains in the Genus database with same CATH topology
 5ADX L;  2W80 C;  3WI5 A;  3K19 A;  1HXU A;  4N74 A;  2PRN A;  5DL8 A;  2Y0L A;  3KVD D;  2ZFG A;  4GCQ A;  5JDP A;  1BT9 A;  1PRN A;  4FT6 A;  1MM5 A;  4LSF A;  2F1T A;  3QRC A;  3SYB A;  1ORM A;  3JTY A;  4JCH A;  4Z3T A;  8PRN A;  4LSH A;  1GFO A;  1IZN A;  1ZHW A;  3DZM A;  2Y0K A;  3NJT A;  4AKM A;  7PRN A;  1Q9G A;  4KR8 A;  2R88 A;  5G38 A;  2M06 A;  3LK3 A;  2F1C X;  3HWB A;  3A2S X;  3AA7 B;  4RJX A;  4UB6 O;  4AYM C;  5ADX K;  3SYS A;  3AA1 B;  1T16 A;  3AAA A;  4PJ0 O;  3SY9 A;  2YNK A;  3JCU O;  1E54 A;  3PQS A;  1OPF A;  1MM4 A;  3C5O A;  4K3B A;  4N59 A;  4GCP A;  5KAF O;  3RBH A;  3PGS A;  3T20 A;  2KXP B;  5T5F A;  3POU A;  3VZW X;  1OSM A;  5FVN A;  3TZG A;  4FOZ A;  4AYD C;  3PRN A;  3LK4 1;  2R8A A;  3VE2 A;  3SY7 A;  1THQ A;  5EE2 A;  2Y2X A;  5B5E O;  1PHO A;  4UB8 O;  3BRY A;  4GF4 A;  4C4V A;  3UPG A;  4XNK A;  2KZ7 A;  2ZLD A;  3LK2 A;  1QJP A;  2R4P A;  4O3W A;  2XTR A;  1IZN B;  4O4X A;  4G75 A;  3VE1 A;  2Y0H A;  2AXT O;  2R4O A;  2XE5 A;  2KC0 A;  3DWN A;  3A0H O;  3AA0 B;  3LK3 B;  4LSI A;  2MNH A;  5H2F O;  3AAA B;  3BS0 A;  2POR A;  4B61 A;  4O4U A;  4IL6 O;  4AKR A;  3WU2 O;  4XNL A;  5GTH O;  3FYX A;  2J4U P;  3HOL A;  4PUX A;  1T1L A;  5IYU A;  4FMS A;  2WVP A;  3AA6 A;  2M07 A;  4GCS A;  2J1N A;  4GHB A;  2YPV A;  2KDY A;  3DWO X;  2QTK A;  4D64 A;  5AFU L;  2FGQ X;  4N58 A;  4FRT A;  4U9C A;  3BRZ A;  1Q9F A;  1ZHX A;  4FQE A;  4CTD A;  1H6S 1;  3T0S A;  1MPF A;  3VZT X;  4K3C A;  6PRN A;  4QQ1 A;  3SZD A;  5PRN A;  4AZL A;  4C4V B;  2KZ7 B;  4FSO A;  3GP6 A;  3LK2 B;  4RLC A;  3A0B O;  1ZHY A;  2K0L A;  2XMX A;  1BXW A;  2R4N A;  3O0E A;  4C00 A;  4D65 A;  1ZHZ A;  1GFN A;  2ERV A;  3PGR A;  2X27 X;  2WJQ A;  3NSG A;  2F1V A;  1BH3 A;  3T24 A;  1ZHT A;  3VY8 X;  1P4T A;  2W81 C;  3HW9 A;  3KZI O;  4FES A;  5D5D A;  5DL6 A;  4RJW A;  4AKR B;  1GFM A;  1QJ8 A;  1HXX A;  2XE3 A;  4O49 A;  3AA6 B;  5DL5 A;  3PF1 A;  2MHL A;  2JQY A;  2ODJ A;  2FGR A;  3DA3 A;  1GFQ A;  3PQU A;  4F4B A;  2N2M A;  5TIS O;  1QJ9 A;  4G76 A;  4E1S A;  4RLB A;  3AAE A;  4FZL A;  3POR A;  1GFP A;  4FZM A;  5G39 A;  5B66 O;  3DA4 A;  2LHF A;  4FSP A;  1G90 A;  4FUV A;  2OMF A;  4FRX A;  3V8U A;  4AYE C;  4KRA A;  3G7G A;  3LK4 2;  1S5L O;  4AYI D;  2K4T A;  2O4V A;  3EMN X;  4C69 X;  2XTQ A;  2LFU A;  2XG6 A;  3HOE A;  3PGU A;  4N75 A;  4AFK A;  5DL7 A;  4AUI A;  4FZN A;  3QRA A;  5G26 A;  2N2L A;  4O3X B;  4PR7 A;  3VZU X;  4E1T A;  2XE1 A;  1HXT A;  4JFB A;  2R89 A;  4KR4 A;  2X9K A;  4AYN A;  1YS5 A;  5AFU K;  5GTI O;  2Y7S A;  3AA0 A;  3POQ A;  3SZV A;  4LSE A;  2WJR A;  2IWV A;  2JMM A;  2XE2 A;  2R4L A;  4O3Z A;  4D5U A;  5KAI O;  3AA7 A;  2GE4 A;  3AA1 A;  3UAQ A;  3POX A;  4BUM X;  5GV0 A;  3UU2 A;  3AAE B;  4O3Y A;  4RL9 A;  2IWW A;  2KXP A;  3WI4 A;  5G3A A;  3VY9 X;  5E79 O; 
#chains in the Genus database with same CATH homology
 5ADX L;  2W80 C;  3WI5 A;  3K19 A;  1HXU A;  2PRN A;  5DL8 A;  2Y0L A;  3KVD D;  2ZFG A;  4GCQ A;  5JDP A;  1BT9 A;  1PRN A;  4FT6 A;  1MM5 A;  4LSF A;  2F1T A;  3QRC A;  3SYB A;  1ORM A;  3JTY A;  4JCH A;  4Z3T A;  8PRN A;  4LSH A;  1GFO A;  1IZN A;  1ZHW A;  4AKM A;  2Y0K A;  7PRN A;  2J4U P;  1Q9G A;  4KR8 A;  4E1T A;  2M06 A;  3LK3 A;  4AYM C;  3HWB A;  3A2S X;  3AA7 B;  4RJX A;  5ADX K;  3SYS A;  3AA1 B;  3AAA A;  3SY9 A;  2YNK A;  1E54 A;  3PQS A;  1OPF A;  1MM4 A;  3C5O A;  4N59 A;  4GCP A;  3RBH A;  3T20 A;  2KXP B;  5T5F A;  3POU A;  3VZW X;  1OSM A;  5FVN A;  3TZG A;  4FOZ A;  4AYD C;  3PRN A;  3LK4 1;  3VE2 A;  3SY7 A;  1THQ A;  5EE2 A;  2Y2X A;  1PHO A;  4GF4 A;  3UPG A;  4XNK A;  2KZ7 A;  2ZLD A;  3LK2 A;  1QJP A;  4O3W A;  2XTR A;  1IZN B;  4O4X A;  4G75 A;  3VE1 A;  2Y0H A;  2XE5 A;  3LK3 B;  2KC0 A;  4LSI A;  3AA0 B;  2MNH A;  3AAA B;  2POR A;  4B61 A;  4O4U A;  4AKR A;  4XNL A;  3FYX A;  3HOL A;  4PUX A;  4FMS A;  3AA6 A;  2M07 A;  4GCS A;  2J1N A;  4GHB A;  2YPV A;  2KDY A;  2QTK A;  4D64 A;  5AFU L;  2FGQ X;  4N58 A;  4FRT A;  4U9C A;  1Q9F A;  1ZHX A;  1H6S 1;  3T0S A;  1MPF A;  3VZT X;  6PRN A;  4QQ1 A;  3SZD A;  5PRN A;  4AZL A;  2KZ7 B;  4FSO A;  3GP6 A;  3LK2 B;  4RLC A;  1ZHY A;  2K0L A;  2XMX A;  1BXW A;  3O0E A;  4D65 A;  1ZHZ A;  1GFN A;  2ERV A;  2X27 X;  3NSG A;  2F1V A;  1BH3 A;  3T24 A;  1ZHT A;  3VY8 X;  1P4T A;  2W81 C;  3HW9 A;  4FES A;  5D5D A;  4AKR B;  5DL6 A;  4RJW A;  1GFM A;  1QJ8 A;  1HXX A;  2XE3 A;  4O49 A;  3AA6 B;  5DL5 A;  2MHL A;  2ODJ A;  2FGR A;  3DA3 A;  1GFQ A;  3PQU A;  4F4B A;  2N2M A;  1QJ9 A;  4G76 A;  4E1S A;  4RLB A;  3AAE A;  4FZL A;  3POR A;  1GFP A;  4FZM A;  3DA4 A;  2LHF A;  4FSP A;  1G90 A;  4FUV A;  2OMF A;  4FRX A;  3V8U A;  4AYE C;  4KRA A;  3G7G A;  3LK4 2;  4AYI D;  2K4T A;  2O4V A;  3EMN X;  4C69 X;  2XTQ A;  2LFU A;  2XG6 A;  3HOE A;  4AFK A;  5IYU A;  5DL7 A;  4AUI A;  4FZN A;  3QRA A;  5G26 A;  2N2L A;  4O3X B;  3VZU X;  2XE1 A;  1HXT A;  4JFB A;  4KR4 A;  4AYN A;  1YS5 A;  5AFU K;  2Y7S A;  3AA0 A;  3POQ A;  3SZV A;  4LSE A;  2JMM A;  2XE2 A;  4O3Z A;  4D5U A;  3AA7 A;  2GE4 A;  3AA1 A;  3UAQ A;  3POX A;  4BUM X;  5GV0 A;  3UU2 A;  3AAE B;  4O3Y A;  4RL9 A;  2KXP A;  3WI4 A;  3VY9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...