3POUA

Crystal structure of e.coli ompf porin in lipidic cubic phase: space group h32, large unit cell
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OmpF protein
publication title Structure of Escherichia coli OmpF porin from lipidic mesophase.
pubmed doi rcsb
molecule tags Membrane protein
total genus 102
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3pouA00
2OMFA 5DL8A 3SY9A 4C69X 4FSPA 1GFOA 2FGRA 4GCQA 3HWBA 3WI5A 5DL6A 4FOZA 3VZTX 2XE1A 5DL7A 3HW9A 1E54A 4RJXA 1PRNA 2XE3A 3T0SA 2PORA 2J1NA 3SYSA 2Y0HA 4LSFA 1BT9A 3VZWX 4GCPA 1PHOA 2XE5A 1HXTA 4FRXA 4FSOA 4BUMX 5FVNA 1MPFA 3SZVA 2XG6A 4AUIA 2ODJA 1BH3A 1OSMA 3O0EA 3UU2A 4KR8A 3POXA 1GFNA 2Y2XA 3VZUX 6PRNA 2FGQX 4FMSA 1HXXA 3VY9X 2Y0KA 2XE2A 5DL5A 3SYBA 2ZFGA 2Y0LA 4LSEA 3FYXA 3PRNA 4GCSA 4KR4A 3SZDA 1OPFA 2PRNA 3POUA 1GFPA 1HXUA 3JTYA 2J4UP 3A2SX 4FRTA 7PRNA 1GFQA 3NSGA 3WI4A 4D65A 4D64A 3PORA 4KRAA 5JDPA 1GFMA 3SY7A 1H6S1 2ZLDA 3EMNX 3VY8X 4LSHA 8PRNA 2K4TA 4FT6A 5PRNA 3UPGA 4D5UA 2QTKA 4JFBA 4LSIA 3T20A 4RJWA 3T24A 3K19A 3POQA 2O4VA
chains in the Genus database with same CATH superfamily
2OMFA 5DL8A 3DA3A 4JCHA 3SY9A 5ADXK 3PGRA 4C69X 2MNHA 3HOEA 4FSPA 4AKRB 2JQYA 2XMXA 3DWNA 4AKMA 3NJTA 3HOLA 1GFOA 2FGRA 4AYDC 5ADXL 3LK42 4XNLA 4GF4A 3AA6A 5GTIO 4GCQA 5G3AA 5IYUA 3BRYA 2WJQA 3HWBA 2N2MA 2R4PA 1ZHZA 1Q9FA 4PR7A 4O3XB 5DL6A 3WI5A 3LK3A 4FOZA 2WVPA 3VZTX 2R4LA 2F1VA 4K3CA 2XE1A 4RL9A 5DL7A 1THQA 3HW9A 3C5OA 5AFUK 4F4BA 1E54A 4RJXA 2MHLA 1PRNA 4XNKA 4E1SA 2KC0A 2X9KA 3A0BO 2XE3A 3AA7B 4E1TA 4Z3TA 4PUXA 2PORA 2J1NA 2YPVA 3T0SA 4N58A 3SYSA 1G90A 3LK2B 2Y0HA 4FUVA 4LSFA 3PGUA 1BT9A 5KAFO 3VZWX 3A0HO 2KZ7B 4GCPA 1PHOA 3AA7A 5E79O 2XE5A 1HXTA 4FRXA 2W81C 2W80C 4U9CA 1ZHWA 4UB6O 5G26A 1MM4A 4FSOA 4BUMX 3QRCA 3LK2A 5FVNA 3T20A 2LFUA 3KZIO 4N74A 1MPFA 4N59A 2YNKA 2X27X 4O4XA 4AKRA 1YS5A 3SZVA 2XG6A 4AUIA 2KXPB 4AZLA 2ODJA 1ZHXA 1BH3A 1ORMA 1S5LO 2N2LA 4G75A 1IZNB 1OSMA 3O0EA 4C00A 1MM5A 3UU2A 1ZHTA 3AAAB 1QJ9A 3DZMA 4KR8A 5H2FO 2WJRA 3POXA 3KVDD 1GFNA 2Y2XA 4O49A 5AFUL 4N75A 3VZUX 1IZNA 2XTQA 6PRNA 2FGQX 4FMSA 2IWWA 3VE1A 1HXXA 3VY9X 5G39A 2Y0KA 2XE2A 3PF1A 4FZLA 2R4OA 2R89A 4PJ0O 5DL5A 3SYBA 3TZGA 3V8UA 1ZHYA 1T1LA 2ZFGA 4GHBA 4O4UA 3AA1B 1Q9GA 2ERVA 3JCUO 5D5DA 2Y0LA 3VE2A 4LSEA 2R88A 2LHFA 5G38A 2M07A 2F1CX 3FYXA 3PRNA 4GCSA 2KZ7A 4KR4A 4AYEC 5B66O 3AA1A 3BS0A 3LK41 3SZDA 3QRAA 4AFKA 1OPFA 2Y7SA 3G7GA 4AYMC 3AA0B 2PRNA 3POUA 1GFPA 1HXUA 3JTYA 3PQSA 2J4UP 3A2SX 5GV0A 3DA4A 4FRTA 4K3BA 7PRNA 3UAQA 2KXPA 1GFQA 3AA6B 3NSGA 3WI4A 4B61A 4D65A 5TISO 5B5EO 3AA0A 3PGSA 4FESA 4G76A 2IWVA 5KAIO 3PORA 3RBHA 4D64A 4FZNA 1QJPA 2XTRA 3AAAA 3LK3B 4KRAA 2R4NA 4RLCA 1GFMA 3SY7A 4AYNA 3GP6A 3BRZA 5JDPA 1H6S1 1T16A 2ZLDA 4O3ZA 2F1TA 3EMNX 4O3YA 3WU2O 4CTDA 2M06A 3VY8X 4LSHA 8PRNA 3AAEB 2K4TA 4FT6A 5PRNA 4C4VB 3UPGA 4D5UA 4O3WA 4RLBA 2K0LA 1QJ8A 5T5FA 2KDYA 2QTKA 2GE4A 3DWOX 4JFBA 4AYID 4LSIA 4FZMA 3AAEA 4QQ1A 3PQUA 4RJWA 4UB8O 5EE2A 3T24A 5GTHO 4C4VA 2JMMA 1P4TA 3K19A 1BXWA 3POQA 2AXTO 4FQEA 2R8AA 2O4VA 4IL6O
chains in the Genus database with same CATH topology
2OMFA 5DL8A 3DA3A 4JCHA 3SY9A 5ADXK 4C69X 2MNHA 3HOEA 4FSPA 4AKRB 2XMXA 4AKMA 3HOLA 1GFOA 2FGRA 4AYDC 5ADXL 3LK42 4XNLA 4GF4A 3AA6A 4GCQA 5IYUA 3HWBA 2N2MA 1ZHZA 1Q9FA 3WI5A 4O3XB 5DL6A 3LK3A 4FOZA 3VZTX 2F1VA 4RL9A 2XE1A 5DL7A 1THQA 3HW9A 3C5OA 5AFUK 4F4BA 1E54A 4RJXA 2MHLA 1PRNA 4XNKA 4E1SA 2KC0A 2XE3A 3AA7B 4E1TA 4Z3TA 4PUXA 2PORA 2J1NA 2YPVA 3T0SA 4N58A 3SYSA 1G90A 3LK2B 2Y0HA 4FUVA 4LSFA 1BT9A 3VZWX 2KZ7B 4GCPA 1PHOA 3AA7A 2XE5A 1HXTA 4FRXA 2W81C 2W80C 4U9CA 1ZHWA 5G26A 1MM4A 4FSOA 4BUMX 3QRCA 3LK2A 5FVNA 2LFUA 1MPFA 4N59A 2YNKA 2X27X 4O4XA 4AKRA 1YS5A 3SZVA 2XG6A 4AUIA 2KXPB 2ODJA 1ZHXA 1BH3A 1ORMA 2N2LA 4G75A 1IZNB 1OSMA 3O0EA 1MM5A 3UU2A 1ZHTA 3AAAB 1QJ9A 4KR8A 3POXA 3KVDD 1GFNA 2Y2XA 4O49A 5AFUL 3VZUX 1IZNA 2XTQA 6PRNA 2FGQX 4FMSA 3VE1A 1HXXA 3VY9X 2Y0KA 2XE2A 4FZLA 5DL5A 3V8UA 3SYBA 3TZGA 1ZHYA 2ZFGA 4O4UA 4GHBA 3AA1B 1Q9GA 2ERVA 3VE2A 5D5DA 2Y0LA 4AYEC 4LSEA 2LHFA 2M07A 3FYXA 3PRNA 4GCSA 2KZ7A 4KR4A 3AA1A 3LK41 3SZDA 3QRAA 4AFKA 1OPFA 2Y7SA 3G7GA 4AYMC 3AA0B 2PRNA 3POUA 1GFPA 1HXUA 3JTYA 3PQSA 2J4UP 3A2SX 5GV0A 3DA4A 4FRTA 7PRNA 3UAQA 2KXPA 1GFQA 3AA6B 3NSGA 3WI4A 4B61A 4D65A 3AA0A 4FESA 4G76A 4D64A 3PORA 3RBHA 4FZNA 1QJPA 2XTRA 3AAAA 3LK3B 4KRAA 4RLCA 4AYNA 1GFMA 3SY7A 4AZLA 3GP6A 5JDPA 1H6S1 2ZLDA 4O3ZA 2F1TA 3EMNX 4O3YA 2M06A 3VY8X 4LSHA 8PRNA 3AAEB 2K4TA 4FT6A 5PRNA 3UPGA 4D5UA 4O3WA 4RLBA 2K0LA 1QJ8A 5T5FA 2KDYA 2QTKA 2GE4A 4JFBA 4AYID 4LSIA 4FZMA 3AAEA 4QQ1A 3PQUA 4RJWA 5EE2A 3T24A 3T20A 2JMMA 1P4TA 3K19A 1BXWA 3POQA 2O4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OMF A;  5DL8 A;  3SY9 A;  4C69 X;  4FSP A;  1GFO A;  2FGR A;  4GCQ A;  3HWB A;  3WI5 A;  5DL6 A;  4FOZ A;  3VZT X;  2XE1 A;  5DL7 A;  3HW9 A;  1E54 A;  4RJX A;  1PRN A;  2XE3 A;  3T0S A;  2POR A;  2J1N A;  3SYS A;  2Y0H A;  4LSF A;  1BT9 A;  3VZW X;  4GCP A;  1PHO A;  2XE5 A;  1HXT A;  4FRX A;  4FSO A;  4BUM X;  5FVN A;  1MPF A;  3SZV A;  2XG6 A;  4AUI A;  2ODJ A;  1BH3 A;  1OSM A;  3O0E A;  3UU2 A;  4KR8 A;  3POX A;  1GFN A;  2Y2X A;  3VZU X;  6PRN A;  2FGQ X;  4FMS A;  1HXX A;  3VY9 X;  2Y0K A;  2XE2 A;  5DL5 A;  3SYB A;  2ZFG A;  2Y0L A;  4LSE A;  3FYX A;  3PRN A;  4GCS A;  4KR4 A;  3SZD A;  1OPF A;  2PRN A;  3POU A;  1GFP A;  1HXU A;  3JTY A;  2J4U P;  3A2S X;  4FRT A;  7PRN A;  1GFQ A;  3NSG A;  3WI4 A;  4D65 A;  4D64 A;  3POR A;  4KRA A;  5JDP A;  1GFM A;  3SY7 A;  1H6S 1;  2ZLD A;  3EMN X;  3VY8 X;  4LSH A;  8PRN A;  2K4T A;  4FT6 A;  5PRN A;  3UPG A;  4D5U A;  2QTK A;  4JFB A;  4LSI A;  3T20 A;  4RJW A;  3T24 A;  3K19 A;  3POQ A;  2O4V A; 
#chains in the Genus database with same CATH topology
 2OMF A;  5DL8 A;  3DA3 A;  4JCH A;  3SY9 A;  5ADX K;  3PGR A;  4C69 X;  2MNH A;  3HOE A;  4FSP A;  4AKR B;  2JQY A;  2XMX A;  3DWN A;  4AKM A;  3NJT A;  3HOL A;  1GFO A;  2FGR A;  4AYD C;  5ADX L;  3LK4 2;  4XNL A;  4GF4 A;  3AA6 A;  5GTI O;  4GCQ A;  5G3A A;  5IYU A;  3BRY A;  2WJQ A;  3HWB A;  2N2M A;  2R4P A;  1ZHZ A;  1Q9F A;  4PR7 A;  4O3X B;  5DL6 A;  3WI5 A;  3LK3 A;  4FOZ A;  2WVP A;  3VZT X;  2R4L A;  2F1V A;  4K3C A;  2XE1 A;  4RL9 A;  5DL7 A;  1THQ A;  3HW9 A;  3C5O A;  5AFU K;  4F4B A;  1E54 A;  4RJX A;  2MHL A;  1PRN A;  4XNK A;  4E1S A;  2KC0 A;  2X9K A;  3A0B O;  2XE3 A;  3AA7 B;  4E1T A;  4Z3T A;  4PUX A;  2POR A;  2J1N A;  2YPV A;  3T0S A;  4N58 A;  3SYS A;  1G90 A;  3LK2 B;  2Y0H A;  4FUV A;  4LSF A;  3PGU A;  1BT9 A;  5KAF O;  3VZW X;  3A0H O;  2KZ7 B;  4GCP A;  1PHO A;  3AA7 A;  5E79 O;  2XE5 A;  1HXT A;  4FRX A;  2W81 C;  2W80 C;  4U9C A;  1ZHW A;  4UB6 O;  5G26 A;  1MM4 A;  4FSO A;  4BUM X;  3QRC A;  3LK2 A;  5FVN A;  3T20 A;  2LFU A;  3KZI O;  4N74 A;  1MPF A;  4N59 A;  2YNK A;  2X27 X;  4O4X A;  4AKR A;  1YS5 A;  3SZV A;  2XG6 A;  4AUI A;  2KXP B;  4AZL A;  2ODJ A;  1ZHX A;  1BH3 A;  1ORM A;  1S5L O;  2N2L A;  4G75 A;  1IZN B;  1OSM A;  3O0E A;  4C00 A;  1MM5 A;  3UU2 A;  1ZHT A;  3AAA B;  1QJ9 A;  3DZM A;  4KR8 A;  5H2F O;  2WJR A;  3POX A;  3KVD D;  1GFN A;  2Y2X A;  4O49 A;  5AFU L;  4N75 A;  3VZU X;  1IZN A;  2XTQ A;  6PRN A;  2FGQ X;  4FMS A;  2IWW A;  3VE1 A;  1HXX A;  3VY9 X;  5G39 A;  2Y0K A;  2XE2 A;  3PF1 A;  4FZL A;  2R4O A;  2R89 A;  4PJ0 O;  5DL5 A;  3SYB A;  3TZG A;  3V8U A;  1ZHY A;  1T1L A;  2ZFG A;  4GHB A;  4O4U A;  3AA1 B;  1Q9G A;  2ERV A;  3JCU O;  5D5D A;  2Y0L A;  3VE2 A;  4LSE A;  2R88 A;  2LHF A;  5G38 A;  2M07 A;  2F1C X;  3FYX A;  3PRN A;  4GCS A;  2KZ7 A;  4KR4 A;  4AYE C;  5B66 O;  3AA1 A;  3BS0 A;  3LK4 1;  3SZD A;  3QRA A;  4AFK A;  1OPF A;  2Y7S A;  3G7G A;  4AYM C;  3AA0 B;  2PRN A;  3POU A;  1GFP A;  1HXU A;  3JTY A;  3PQS A;  2J4U P;  3A2S X;  5GV0 A;  3DA4 A;  4FRT A;  4K3B A;  7PRN A;  3UAQ A;  2KXP A;  1GFQ A;  3AA6 B;  3NSG A;  3WI4 A;  4B61 A;  4D65 A;  5TIS O;  5B5E O;  3AA0 A;  3PGS A;  4FES A;  4G76 A;  2IWV A;  5KAI O;  3POR A;  3RBH A;  4D64 A;  4FZN A;  1QJP A;  2XTR A;  3AAA A;  3LK3 B;  4KRA A;  2R4N A;  4RLC A;  1GFM A;  3SY7 A;  4AYN A;  3GP6 A;  3BRZ A;  5JDP A;  1H6S 1;  1T16 A;  2ZLD A;  4O3Z A;  2F1T A;  3EMN X;  4O3Y A;  3WU2 O;  4CTD A;  2M06 A;  3VY8 X;  4LSH A;  8PRN A;  3AAE B;  2K4T A;  4FT6 A;  5PRN A;  4C4V B;  3UPG A;  4D5U A;  4O3W A;  4RLB A;  2K0L A;  1QJ8 A;  5T5F A;  2KDY A;  2QTK A;  2GE4 A;  3DWO X;  4JFB A;  4AYI D;  4LSI A;  4FZM A;  3AAE A;  4QQ1 A;  3PQU A;  4RJW A;  4UB8 O;  5EE2 A;  3T24 A;  5GTH O;  4C4V A;  2JMM A;  1P4T A;  3K19 A;  1BXW A;  3POQ A;  2AXT O;  4FQE A;  2R8A A;  2O4V A;  4IL6 O; 
#chains in the Genus database with same CATH homology
 2OMF A;  5DL8 A;  3DA3 A;  4JCH A;  3SY9 A;  5ADX K;  4C69 X;  2MNH A;  3HOE A;  4FSP A;  4AKR B;  2XMX A;  4AKM A;  3HOL A;  1GFO A;  2FGR A;  4AYD C;  5ADX L;  3LK4 2;  4XNL A;  4GF4 A;  3AA6 A;  4GCQ A;  5IYU A;  3HWB A;  2N2M A;  1ZHZ A;  1Q9F A;  3WI5 A;  4O3X B;  5DL6 A;  3LK3 A;  4FOZ A;  3VZT X;  2F1V A;  4RL9 A;  2XE1 A;  5DL7 A;  1THQ A;  3HW9 A;  3C5O A;  5AFU K;  4F4B A;  1E54 A;  4RJX A;  2MHL A;  1PRN A;  4XNK A;  4E1S A;  2KC0 A;  2XE3 A;  3AA7 B;  4E1T A;  4Z3T A;  4PUX A;  2POR A;  2J1N A;  2YPV A;  3T0S A;  4N58 A;  3SYS A;  1G90 A;  3LK2 B;  2Y0H A;  4FUV A;  4LSF A;  1BT9 A;  3VZW X;  2KZ7 B;  4GCP A;  1PHO A;  3AA7 A;  2XE5 A;  1HXT A;  4FRX A;  2W81 C;  2W80 C;  4U9C A;  1ZHW A;  5G26 A;  1MM4 A;  4FSO A;  4BUM X;  3QRC A;  3LK2 A;  5FVN A;  2LFU A;  1MPF A;  4N59 A;  2YNK A;  2X27 X;  4O4X A;  4AKR A;  1YS5 A;  3SZV A;  2XG6 A;  4AUI A;  2KXP B;  2ODJ A;  1ZHX A;  1BH3 A;  1ORM A;  2N2L A;  4G75 A;  1IZN B;  1OSM A;  3O0E A;  1MM5 A;  3UU2 A;  1ZHT A;  3AAA B;  1QJ9 A;  4KR8 A;  3POX A;  3KVD D;  1GFN A;  2Y2X A;  4O49 A;  5AFU L;  3VZU X;  1IZN A;  2XTQ A;  6PRN A;  2FGQ X;  4FMS A;  3VE1 A;  1HXX A;  3VY9 X;  2Y0K A;  2XE2 A;  4FZL A;  5DL5 A;  3V8U A;  3SYB A;  3TZG A;  1ZHY A;  2ZFG A;  4O4U A;  4GHB A;  3AA1 B;  1Q9G A;  2ERV A;  3VE2 A;  5D5D A;  2Y0L A;  4AYE C;  4LSE A;  2LHF A;  2M07 A;  3FYX A;  3PRN A;  4GCS A;  2KZ7 A;  4KR4 A;  3AA1 A;  3LK4 1;  3SZD A;  3QRA A;  4AFK A;  1OPF A;  2Y7S A;  3G7G A;  4AYM C;  3AA0 B;  2PRN A;  3POU A;  1GFP A;  1HXU A;  3JTY A;  3PQS A;  2J4U P;  3A2S X;  5GV0 A;  3DA4 A;  4FRT A;  7PRN A;  3UAQ A;  2KXP A;  1GFQ A;  3AA6 B;  3NSG A;  3WI4 A;  4B61 A;  4D65 A;  3AA0 A;  4FES A;  4G76 A;  4D64 A;  3POR A;  3RBH A;  4FZN A;  1QJP A;  2XTR A;  3AAA A;  3LK3 B;  4KRA A;  4RLC A;  4AYN A;  1GFM A;  3SY7 A;  4AZL A;  3GP6 A;  5JDP A;  1H6S 1;  2ZLD A;  4O3Z A;  2F1T A;  3EMN X;  4O3Y A;  2M06 A;  3VY8 X;  4LSH A;  8PRN A;  3AAE B;  2K4T A;  4FT6 A;  5PRN A;  3UPG A;  4D5U A;  4O3W A;  4RLB A;  2K0L A;  1QJ8 A;  5T5F A;  2KDY A;  2QTK A;  2GE4 A;  4JFB A;  4AYI D;  4LSI A;  4FZM A;  3AAE A;  4QQ1 A;  3PQU A;  4RJW A;  5EE2 A;  3T24 A;  3T20 A;  2JMM A;  1P4T A;  3K19 A;  1BXW A;  3POQ A;  2O4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...