4N74A

Crystal structure of outer membrane protein tama beta-barrel domain in e.coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
314
structure length
314
Chain Sequence
TQNTIETGVGYSTDVGPRVKATWKKPWVNSYGHSLTTSTSISAPEQTLDFSYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSGWQRAINLRWSVDHFTQGEITNTTMLFYPGVVISRTRSRGGLMPTWGDSQRYSIDYSNTAWGSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSGEAVSDIRRSDFKTGTGVGVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Predicted outer membrane protein and surface antigen
publication title Structural Basis of BamA-mediate Outer Membrane Protein Biogenesis
rcsb
source organism Escherichia coli
total genus 77
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4n74A00
4C4VA 4C00A 4N75A 4K3BA 4N74A 3NJTA 4K3CA 4C4VB
chains in the Genus database with same CATH superfamily
1YS5A 3POQA 1GFOA 3DWNA 3T20A 4LSEA 4GCQA 4RJWA 2W81C 3BRZA 1BH3A 2F1TA 3JCUO 4O3XB 1GFPA 1ZHXA 2Y0HA 4GCSA 4XNKA 3SZVA 4AKRB 6PRNA 1T1LA 3VE2A 3PQSA 3GP6A 5FVNA 2X9KA 4N74A 4AYDC 4G75A 4KR8A 1T16A 2KZ7B 3VY9X 4AYEC 3AAEB 3V8UA 2R4OA 1QJPA 5GTIO 3AA7B 3JTYA 2O4VA 2YPVA 3LK2A 2OMFA 4IL6O 4O4XA 2Y2XA 2ZFGA 4GCPA 3BRYA 5E79O 3K19A 2XE5A 2ERVA 4FUVA 4GF4A 4FRTA 2M06A 1BXWA 4FMSA 2KDYA 5GV0A 4FQEA 4UB6O 3AA1A 4AZLA 3SY9A 5B5EO 2IWWA 4E1SA 2KXPA 4XNLA 4E1TA 3LK3B 2R8AA 1GFQA 2WJQA 5G38A 5KAIO 3AA6B 2R4PA 1MM5A 3FYXA 1HXTA 2K0LA 4FOZA 4RJXA 5D5DA 1P4TA 5DL5A 3VY8X 4AKRA 5ADXL 4RLCA 5GTHO 2PORA 2J4UP 3C5OA 2QTKA 3KZIO 5H2FO 2XE3A 3POXA 3QRCA 2XTQA 3VZWX 2KZ7A 2MHLA 3A0BO 1ZHZA 1GFMA 1ZHTA 2Y0LA 1OPFA 2JQYA 3AAEA 3PGUA 2MNHA 4GHBA 3DWOX 4O4UA 1IZNB 4BUMX 3AA7A 4FESA 1E54A 2R89A 4O3ZA 5DL6A 4FZLA 3SY7A 5B66O 1HXUA 4JCHA 4AYNA 4N59A 4FRXA 3NSGA 3PRNA 3BS0A 4QQ1A 5TISO 3PGSA 4RLBA 2XG6A 5JDPA 5DL7A 2XE2A 4N58A 3T0SA 2WJRA 2PRNA 4B61A 2FGQX 1THQA 1QJ9A 5PRNA 3HOLA 3LK3A 1ZHYA 3PF1A 3A0HO 3POUA 5AFUL 4RL9A 3AA6A 4D65A 2M07A 4C69X 2X27X 2F1VA 3AAAB 4AYID 3SYSA 1MM4A 3G7GA 3LK42 1ORMA 2GE4A 4JFBA 5KAFO 4AYMC 4FZNA 4O3WA 2ODJA 4Z3TA 5ADXK 8PRNA 2ZLDA 1PHOA 1Q9GA 3EMNX 3DA3A 4O49A 3T24A 3UU2A 4LSHA 1IZNA 3WU2O 2N2MA 4LSFA 4C00A 2JMMA 4FZMA 3LK41 3HWBA 1OSMA 4KRAA 3UPGA 2WVPA 2R88A 5G3AA 2AXTO 3SYBA 3VZUX 2XE1A 7PRNA 2LFUA 4AKMA 3VZTX 4D5UA 3WI5A 3QRAA 3DA4A 1MPFA 2K4TA 1PRNA 2Y7SA 4N75A 5G39A 3HW9A 4CTDA 3NJTA 3AA0B 3DZMA 3AA0A 4AFKA 3A2SX 3KVDD 2KC0A 4FSPA 4K3CA 1Q9FA 4C4VB 4C4VA 4D64A 1HXXA 4KR4A 1S5LO 4O3YA 4FT6A 3PGRA 2FGRA 3UAQA 3SZDA 1H6S1 3VE1A 2W80C 5AFUK 3AAAA 3O0EA 3RBHA 2N2LA 2J1NA 3WI4A 4AUIA 1QJ8A 3TZGA 1G90A 2F1CX 2XTRA 3LK2B 2R4LA 3PQUA 4LSIA 5EE2A 4G76A 5G26A 1ZHWA 4PUXA 5DL8A 5T5FA 5IYUA 2Y0KA 3PORA 4PJ0O 2YNKA 3HOEA 2IWVA 2LHFA 1BT9A 4K3BA 4UB8O 3AA1B 2R4NA 1GFNA 4FSOA 4U9CA 4F4BA 2KXPB 2XMXA 4PR7A
chains in the Genus database with same CATH topology
4C4VA 4C00A 4N75A 4K3BA 4N74A 3NJTA 4K3CA 4C4VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C4V A;  4C00 A;  4N75 A;  4K3B A;  4N74 A;  3NJT A;  4K3C A;  4C4V B; 
#chains in the Genus database with same CATH topology
 1YS5 A;  3POQ A;  1GFO A;  3DWN A;  3T20 A;  4LSE A;  4GCQ A;  4RJW A;  2W81 C;  3BRZ A;  1BH3 A;  2F1T A;  3JCU O;  4O3X B;  1GFP A;  1ZHX A;  2Y0H A;  4GCS A;  4XNK A;  3SZV A;  4AKR B;  6PRN A;  1T1L A;  3VE2 A;  3PQS A;  3GP6 A;  5FVN A;  2X9K A;  4N74 A;  4AYD C;  4G75 A;  4KR8 A;  1T16 A;  2KZ7 B;  3VY9 X;  4AYE C;  3AAE B;  3V8U A;  2R4O A;  1QJP A;  5GTI O;  3AA7 B;  3JTY A;  2O4V A;  2YPV A;  3LK2 A;  2OMF A;  4IL6 O;  4O4X A;  2Y2X A;  2ZFG A;  4GCP A;  3BRY A;  5E79 O;  3K19 A;  2XE5 A;  2ERV A;  4FUV A;  4GF4 A;  4FRT A;  2M06 A;  1BXW A;  4FMS A;  2KDY A;  5GV0 A;  4FQE A;  4UB6 O;  3AA1 A;  4AZL A;  3SY9 A;  5B5E O;  2IWW A;  4E1S A;  2KXP A;  4XNL A;  4E1T A;  3LK3 B;  2R8A A;  1GFQ A;  2WJQ A;  5G38 A;  5KAI O;  3AA6 B;  2R4P A;  1MM5 A;  3FYX A;  1HXT A;  2K0L A;  4FOZ A;  4RJX A;  5D5D A;  1P4T A;  5DL5 A;  3VY8 X;  4AKR A;  5ADX L;  4RLC A;  5GTH O;  2POR A;  2J4U P;  3C5O A;  2QTK A;  3KZI O;  5H2F O;  2XE3 A;  3POX A;  3QRC A;  2XTQ A;  3VZW X;  2KZ7 A;  2MHL A;  3A0B O;  1ZHZ A;  1GFM A;  1ZHT A;  2Y0L A;  1OPF A;  2JQY A;  3AAE A;  3PGU A;  2MNH A;  4GHB A;  3DWO X;  4O4U A;  1IZN B;  4BUM X;  3AA7 A;  4FES A;  1E54 A;  2R89 A;  4O3Z A;  5DL6 A;  4FZL A;  3SY7 A;  5B66 O;  1HXU A;  4JCH A;  4AYN A;  4N59 A;  4FRX A;  3NSG A;  3PRN A;  3BS0 A;  4QQ1 A;  5TIS O;  3PGS A;  4RLB A;  2XG6 A;  5JDP A;  5DL7 A;  2XE2 A;  4N58 A;  3T0S A;  2WJR A;  2PRN A;  4B61 A;  2FGQ X;  1THQ A;  1QJ9 A;  5PRN A;  3HOL A;  3LK3 A;  1ZHY A;  3PF1 A;  3A0H O;  3POU A;  5AFU L;  4RL9 A;  3AA6 A;  4D65 A;  2M07 A;  4C69 X;  2X27 X;  2F1V A;  3AAA B;  4AYI D;  3SYS A;  1MM4 A;  3G7G A;  3LK4 2;  1ORM A;  2GE4 A;  4JFB A;  5KAF O;  4AYM C;  4FZN A;  4O3W A;  2ODJ A;  4Z3T A;  5ADX K;  8PRN A;  2ZLD A;  1PHO A;  1Q9G A;  3EMN X;  3DA3 A;  4O49 A;  3T24 A;  3UU2 A;  4LSH A;  1IZN A;  3WU2 O;  2N2M A;  4LSF A;  4C00 A;  2JMM A;  4FZM A;  3LK4 1;  3HWB A;  1OSM A;  4KRA A;  3UPG A;  2WVP A;  2R88 A;  5G3A A;  2AXT O;  3SYB A;  3VZU X;  2XE1 A;  7PRN A;  2LFU A;  4AKM A;  3VZT X;  4D5U A;  3WI5 A;  3QRA A;  3DA4 A;  1MPF A;  2K4T A;  1PRN A;  2Y7S A;  4N75 A;  5G39 A;  3HW9 A;  4CTD A;  3NJT A;  3AA0 B;  3DZM A;  3AA0 A;  4AFK A;  3A2S X;  3KVD D;  2KC0 A;  4FSP A;  4K3C A;  1Q9F A;  4C4V B;  4C4V A;  4D64 A;  1HXX A;  4KR4 A;  1S5L O;  4O3Y A;  4FT6 A;  3PGR A;  2FGR A;  3UAQ A;  3SZD A;  1H6S 1;  3VE1 A;  2W80 C;  5AFU K;  3AAA A;  3O0E A;  3RBH A;  2N2L A;  2J1N A;  3WI4 A;  4AUI A;  1QJ8 A;  3TZG A;  1G90 A;  2F1C X;  2XTR A;  3LK2 B;  2R4L A;  3PQU A;  4LSI A;  5EE2 A;  4G76 A;  5G26 A;  1ZHW A;  4PUX A;  5DL8 A;  5T5F A;  5IYU A;  2Y0K A;  3POR A;  4PJ0 O;  2YNK A;  3HOE A;  2IWV A;  2LHF A;  1BT9 A;  4K3B A;  4UB8 O;  3AA1 B;  2R4N A;  1GFN A;  4FSO A;  4U9C A;  4F4B A;  2KXP B;  2XMX A;  4PR7 A; 
#chains in the Genus database with same CATH homology
 4C4V A;  4C00 A;  4N75 A;  4K3B A;  4N74 A;  3NJT A;  4K3C A;  4C4V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...