4N74A

Crystal structure of outer membrane protein tama beta-barrel domain in e.coli
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
314
structure length
314
Chain Sequence
TQNTIETGVGYSTDVGPRVKATWKKPWVNSYGHSLTTSTSISAPEQTLDFSYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSGWQRAINLRWSVDHFTQGEITNTTMLFYPGVVISRTRSRGGLMPTWGDSQRYSIDYSNTAWGSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGWIETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSGEAVSDIRRSDFKTGTGVGVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of BamA-mediate Outer Membrane Protein Biogenesis
rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Predicted outer membrane protein and surface antigen
total genus 77
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.50 Mainly Beta Beta Barrel Porin membrane protein fhac: a member of the omp85/tpsb transporter family 4n74A00
3NJTA 4C4VB 4N75A 4N74A 4C4VA 4K3BA 4K3CA 4C00A
chains in the Genus database with same CATH superfamily
3PORA 1BT9A 4C4VB 2GE4A 3T20A 4LSHA 1GFQA 4N75A 1HXXA 5G26A 4IL6O 4UB8O 1QJ8A 2X27X 3RBHA 2R4LA 4KRAA 4O3ZA 2ZFGA 3PGSA 2KDYA 4U9CA 4D64A 3SY9A 3DWNA 5G38A 1H6S1 3JCUO 1ZHTA 2ERVA 3V8UA 2N2MA 1E54A 3VE1A 2ODJA 4K3BA 5ADXK 3VZWX 2R4PA 3LK41 1GFOA 1IZNB 3T0SA 1T1LA 2F1TA 2IWWA 4JCHA 5DL5A 1ZHWA 3A0HO 1S5LO 3LK2A 1GFMA 3AA6A 3K19A 2WJQA 4FZLA 3SY7A 3LK3A 2MNHA 3AA1B 4D65A 4XNLA 5H2FO 5KAFO 5DL8A 3UAQA 2XE3A 1IZNA 1OSMA 2R8AA 2Y0LA 4JFBA 4C00A 4PR7A 2PRNA 3HW9A 2KXPB 4FUVA 5GV0A 3AA6B 4BUMX 4LSIA 1YS5A 2OMFA 3HOEA 1GFNA 2XTQA 1THQA 3BRYA 4AKMA 3KVDD 4AUIA 2XE1A 3POQA 4RJXA 4KR4A 3DA3A 3O0EA 5T5FA 1Q9GA 4AYMC 4AFKA 4N74A 5DL7A 3SZDA 2XTRA 2K4TA 4D5UA 2F1VA 2R4NA 3POUA 1G90A 2YPVA 2FGRA 2XE2A 3EMNX 3PGRA 3UU2A 2J4UP 1GFPA 4AYDC 4G75A 2XE5A 2K0LA 3LK2B 3PQUA 4FSPA 1PRNA 5EE2A 3A0BO 3AAEB 2N2LA 4AYID 1ORMA 2JMMA 3DWOX 4XNKA 4GCPA 2AXTO 2M07A 3VZUX 1MM4A 4CTDA 4FQEA 5FVNA 4GCSA 2PORA 2Y0KA 3AAAB 1QJ9A 4RL9A 1ZHYA 3T24A 3HOLA 2QTKA 5KAIO 7PRNA 1ZHZA 2R4OA 5AFUL 3QRAA 5B5EO 3FYXA 4PUXA 5D5DA 8PRNA 3UPGA 4LSFA 4RLBA 4RLCA 5JDPA 4AKRA 3POXA 4PJ0O 3AA1A 4F4BA 1BH3A 4G76A 4O4UA 3WI5A 2KZ7A 4O3XB 3WU2O 4FSOA 4LSEA 3GP6A 3AA7A 3NJTA 5TISO 3AA0B 3BRZA 2KC0A 2O4VA 3SZVA 2LHFA 1BXWA 4FZMA 5GTIO 2XMXA 2MHLA 3C5OA 4K3CA 4E1SA 5AFUK 1MM5A 4QQ1A 5G3AA 1HXUA 5DL6A 4FRXA 3A2SX 3WI4A 2FGQX 3KZIO 5G39A 3G7GA 2R89A 3BS0A 5IYUA 2F1CX 4KR8A 6PRNA 4AKRB 2YNKA 1OPFA 3PRNA 2J1NA 3LK3B 2W80C 4FT6A 4O4XA 5E79O 3DZMA 3TZGA 2IWVA 2W81C 4C4VA 2WVPA 2JQYA 2Y7SA 3LK42 4GCQA 1Q9FA 2KZ7B 3VE2A 4E1TA 1MPFA 5B66O 3HWBA 4GHBA 5ADXL 2LFUA 4FOZA 4FZNA 3SYBA 2WJRA 4GF4A 5GTHO 4O49A 4AYNA 3VY9X 4UB6O 3AAEA 4Z3TA 3PGUA 2XG6A 4B61A 2M06A 1ZHXA 2ZLDA 1QJPA 4FRTA 2Y2XA 3AAAA 3QRCA 2X9KA 3VY8X 4AYEC 1P4TA 3PQSA 3NSGA 4RJWA 4N59A 5PRNA 2R88A 3AA7B 2Y0HA 3AA0A 4FESA 1HXTA 4N58A 2KXPA 3JTYA 4O3YA 4AZLA 3VZTX 1T16A 4O3WA 3SYSA 3DA4A 3PF1A 4C69X 4FMSA 1PHOA
chains in the Genus database with same CATH topology
3NJTA 4C4VB 4N75A 4N74A 4C4VA 4K3BA 4K3CA 4C00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NJT A;  4C4V B;  4N75 A;  4N74 A;  4C4V A;  4K3B A;  4K3C A;  4C00 A; 
#chains in the Genus database with same CATH topology
 3POR A;  1BT9 A;  4C4V B;  2GE4 A;  3T20 A;  4LSH A;  1GFQ A;  4N75 A;  1HXX A;  5G26 A;  4IL6 O;  4UB8 O;  1QJ8 A;  2X27 X;  3RBH A;  2R4L A;  4KRA A;  4O3Z A;  2ZFG A;  3PGS A;  2KDY A;  4U9C A;  4D64 A;  3SY9 A;  3DWN A;  5G38 A;  1H6S 1;  3JCU O;  1ZHT A;  2ERV A;  3V8U A;  2N2M A;  1E54 A;  3VE1 A;  2ODJ A;  4K3B A;  5ADX K;  3VZW X;  2R4P A;  3LK4 1;  1GFO A;  1IZN B;  3T0S A;  1T1L A;  2F1T A;  2IWW A;  4JCH A;  5DL5 A;  1ZHW A;  3A0H O;  1S5L O;  3LK2 A;  1GFM A;  3AA6 A;  3K19 A;  2WJQ A;  4FZL A;  3SY7 A;  3LK3 A;  2MNH A;  3AA1 B;  4D65 A;  4XNL A;  5H2F O;  5KAF O;  5DL8 A;  3UAQ A;  2XE3 A;  1IZN A;  1OSM A;  2R8A A;  2Y0L A;  4JFB A;  4C00 A;  4PR7 A;  2PRN A;  3HW9 A;  2KXP B;  4FUV A;  5GV0 A;  3AA6 B;  4BUM X;  4LSI A;  1YS5 A;  2OMF A;  3HOE A;  1GFN A;  2XTQ A;  1THQ A;  3BRY A;  4AKM A;  3KVD D;  4AUI A;  2XE1 A;  3POQ A;  4RJX A;  4KR4 A;  3DA3 A;  3O0E A;  5T5F A;  1Q9G A;  4AYM C;  4AFK A;  4N74 A;  5DL7 A;  3SZD A;  2XTR A;  2K4T A;  4D5U A;  2F1V A;  2R4N A;  3POU A;  1G90 A;  2YPV A;  2FGR A;  2XE2 A;  3EMN X;  3PGR A;  3UU2 A;  2J4U P;  1GFP A;  4AYD C;  4G75 A;  2XE5 A;  2K0L A;  3LK2 B;  3PQU A;  4FSP A;  1PRN A;  5EE2 A;  3A0B O;  3AAE B;  2N2L A;  4AYI D;  1ORM A;  2JMM A;  3DWO X;  4XNK A;  4GCP A;  2AXT O;  2M07 A;  3VZU X;  1MM4 A;  4CTD A;  4FQE A;  5FVN A;  4GCS A;  2POR A;  2Y0K A;  3AAA B;  1QJ9 A;  4RL9 A;  1ZHY A;  3T24 A;  3HOL A;  2QTK A;  5KAI O;  7PRN A;  1ZHZ A;  2R4O A;  5AFU L;  3QRA A;  5B5E O;  3FYX A;  4PUX A;  5D5D A;  8PRN A;  3UPG A;  4LSF A;  4RLB A;  4RLC A;  5JDP A;  4AKR A;  3POX A;  4PJ0 O;  3AA1 A;  4F4B A;  1BH3 A;  4G76 A;  4O4U A;  3WI5 A;  2KZ7 A;  4O3X B;  3WU2 O;  4FSO A;  4LSE A;  3GP6 A;  3AA7 A;  3NJT A;  5TIS O;  3AA0 B;  3BRZ A;  2KC0 A;  2O4V A;  3SZV A;  2LHF A;  1BXW A;  4FZM A;  5GTI O;  2XMX A;  2MHL A;  3C5O A;  4K3C A;  4E1S A;  5AFU K;  1MM5 A;  4QQ1 A;  5G3A A;  1HXU A;  5DL6 A;  4FRX A;  3A2S X;  3WI4 A;  2FGQ X;  3KZI O;  5G39 A;  3G7G A;  2R89 A;  3BS0 A;  5IYU A;  2F1C X;  4KR8 A;  6PRN A;  4AKR B;  2YNK A;  1OPF A;  3PRN A;  2J1N A;  3LK3 B;  2W80 C;  4FT6 A;  4O4X A;  5E79 O;  3DZM A;  3TZG A;  2IWV A;  2W81 C;  4C4V A;  2WVP A;  2JQY A;  2Y7S A;  3LK4 2;  4GCQ A;  1Q9F A;  2KZ7 B;  3VE2 A;  4E1T A;  1MPF A;  5B66 O;  3HWB A;  4GHB A;  5ADX L;  2LFU A;  4FOZ A;  4FZN A;  3SYB A;  2WJR A;  4GF4 A;  5GTH O;  4O49 A;  4AYN A;  3VY9 X;  4UB6 O;  3AAE A;  4Z3T A;  3PGU A;  2XG6 A;  4B61 A;  2M06 A;  1ZHX A;  2ZLD A;  1QJP A;  4FRT A;  2Y2X A;  3AAA A;  3QRC A;  2X9K A;  3VY8 X;  4AYE C;  1P4T A;  3PQS A;  3NSG A;  4RJW A;  4N59 A;  5PRN A;  2R88 A;  3AA7 B;  2Y0H A;  3AA0 A;  4FES A;  1HXT A;  4N58 A;  2KXP A;  3JTY A;  4O3Y A;  4AZL A;  3VZT X;  1T16 A;  4O3W A;  3SYS A;  3DA4 A;  3PF1 A;  4C69 X;  4FMS A;  1PHO A; 
#chains in the Genus database with same CATH homology
 3NJT A;  4C4V B;  4N75 A;  4N74 A;  4C4V A;  4K3B A;  4K3C A;  4C00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...