2YPVA

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
242
structure length
229
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQILITLESGEFQVYKQSHSALTAFQTEQIMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 57
structure length 229
sequence length 242
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2ypvA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ypvA01
2Y7SA 2KC0A 3PQUA 4O3WA 3UAQA 4AYDC 4AYID 4O3XB 3HOLA 4AYMC 4QQ1A 4O4XA 4O4UA 4U9CA 2LFUA 3VE1A 2YPVA 3PQSA 3KVDD 2KDYA 4O3YA 5EE2A 4AYNA 1YS5A 4O3ZA 3VE2A 2W80C 4O49A 4Z3TA 3HOEA 3V8UA 4AYEC 5T5FA 2W81C
chains in the Genus database with same CATH superfamily
4FRWA 1M6OA 4HZ1A 4UOW0 3QDGE 1IEAB 1LYQA 3RDTB 2EEFA 1GZHA 4KK8D 4JZNA 4WWNA 5I1GL 3A0HO 1TJHL 1AMXA 1YYCA 3LKPA 2BOCB 1IC5L 1W0WB 3G6DH 5CHNA 5E8PA 25C8H 3BEVB 1YMMB 3O11A 4JY6A 4BHUA 5JZ7C 3HW7A 3FHEA 1MNUH 3C6LC 3FRPB 3T0DA 3KG5A 1NAMH 3PWLB 1MELA 1UQSB 1H3WM 1FLRH 5J6HB 1AFVL 1IC0A 1T5WB 4U49A 4LSRL 5L2JB 5EIIB 4P46A 2Y0SA 2HKAA 3VFWA 1RSYA 5B8CB 4N3TA 3X12B 3TIEA 3ULAB 3IMSA 4BK5A 2QQLH 4JFTA 4JO3L 4G7VH 4G9FB 1D5XB 1BF2A 4NNPL 4U1HA 1G6RL 2PPCA 5HYQB 3TBCA 3IGUA 5B38A 3NYKA 3KPNB 4TNVK 4PJ9D 5D71H 4PHXA 3VYPA 3US1A 3RIFK 4Y2OB 1OPGL 5CZVH 3QCTH 3BVVA 4OCWL 2X9WA 4DVBB 1FZJA 3FO9B 43CAA 3ARFA 1MLBA 3RUGF 4AUJA 3OKKB 1A4AA 4U7KA 1KT2A 4RETB 3NFSH 3RWGB 4R8WL 4BSVA 3IB4A 4QR7A 1MCKA 2Q3XA 2YFNA 1G7MA 1EAPB 5IVXB 1KACB 3THML 2A6IA 2VLMD 1OAYL 1BYOA 2AK1H 3PABA 3ZMNA 1I82A 4DGVL 1WTLA 5DEFB 4LSUH 5E00A 2ATPA 1PJWA 5DWUL 2JCCE 5DQJB 4N2CA 4YSUA 2R2HA 4D64A 5J56B 3WHXA 4YSDA 4HIXL 4LVEA 4DO6A 3REVB 4X6BA 5DJAB 2P5WE 5BCAA 3HNTH 5DZJA 4NO5A 4XO8A 5AG8A 1E9OA 5F0PB 1JFHA 3PNWB 1UTDA 1BX2A 2MH4A 4PTUA 4WU5A 2FYYB 4HKBB 1QZ1A 1W15A 4LEOB 1LE9B 1NEZB 2V5SA 3F7PC 2HWZH 4XH2A 4GMSH 4AFKA 4JFVA 3HUJE 2VRAA 3J07A 4L4VA 3UEQA 3N44F 5L6YH 3SB3A 3SE4A 4PJ9A 1QFWH 2ZSVB 2ERVA 4YVUA 5J12C 5GS2H 1E5YA 5CD5C 3ESOA 4FC3E 3LZPA 1DZ0A 1TLMA 3GWJA 2VDKH 3GZKA 4HV8B 4ADGA 4I0CC 4JM2B 2HYMA 1SN0A 2Z35A 1IC7H 2ENSA 2VQ1B 3KCWA 4J28A 3H7BA 4HC1L 4HZAA 2ILLA 1OP3H 3MRQA 3FQNA 1TQBB 3P2BA 3TBYB 2ARJQ 5B1KA 1G5GA 2AAVA 3P2TA 5FCUH 3RWHA 4BZ1L 4RGND 1PCXA 1YN6B 1SJMA 1EPFA 2YXVA 1U58B 2NQDA 4OZ4A 4G42A 3BPCB 3OB0H 2RTTA 4R90H 1S9WA 4XMLL 2JKWA 3QJQB 1CXHA 4G8AC 1A6UH 2VISA 3MACH 1FRGH 4TSCH 3ATFA 2H1LM 4XPAH 5SWZD 1JZ7A 2NLJB 3EYFA 4IM8A 4LPVA 1KGCD 1KXTA 1ND0A 4PLKD 2WVSA 1S9YB 3FUNA 4WFGE 4YO0A 4W70A 5DJ6B 1SOKA 2V9QA 4KRMB 5I1IH 4LCVA 4X6DE 1TU2A 5B4MC 4HG4K 1HN1A 3EJYC 2YOAA 5CSGA 2Z34A 4Z8FL 2WWMC 1D9KD 3QPXH 4PRDB 2PP8A 1SEQH 5IBUG 5LKNA 1NGZA 2L7JA 4AEFA 1L7TL 4A66A 2XSKA 4ZOBA 4QRPB 1QJPA 2VZOA 3QG6A 5AZEH 4G80A 1BQLH 5CGTA 4F80A 3OKDB 3VXME 2AITA 4LK4A 3GJEA 3LEYL 3HE7B 1A02N 2F0CA 3QI9B 4YVNA 2VXSL 4MZRA 2CGYA 1OTUD 4JLRB 1CK0L 5F96H 3RZWA 3DSFL 1SJHB 3ZYIA 3QK0A 3TWYA 2AVFA 4M7JL 3U48A 4H8WH 2AP2A 5AW0B 4L9LB 1N12A 1XCXA 4JPKL 3H42H 3RWDA 4PV9B 3AREA 1QBLL 4ZO7A 3AA7A 4UAOC 1U41A 3FHQA 1E54A 2A9CA 2GT9B 2D0GA 2WCPA 1PD6A 5SWZA 5F71A 4DKTA 3OXRB 2KZKA 5GV0A 1FVEB 4ZXBC 1LE5A 4Q6KA 3WLWC 1I8LA 5TFSH 4YHZL 3DWTA 4DP6X 3O2DH 1UACH 2NY0D 4L29A 4RAHA 4HCIA 5DJ2B 4OCMC 1YMHA 4MKMA 3F05A 4FTVB 4WY7H 5IIEB 2NUTB 5B3JF 5L7XL 4EI6B 1D9KA 1BQRA 4IQHA 3QAZB 1KDJA 3KS0H 4HD9A 4N9OB 1P5UB 3HOGA 4L8CB 5EO9A 3VXTA 1AIZA 3AUWB 2F7OA 4JDZA 4I5BA 1NCWL 1NCHA 3PFQA 4MMXA 1HL5A 1RIUL 2VSCA 1MJJA 4QRFA 2ZT9C 3LZQA 4XNUH 2OTPA 5E1GA 4JN1L 3J2PA 4ENEC 5MHSE 5GISL 3CV5A 1AD0A 3FFCD 2O5YH 3TJHD 5FM4A 2XN9E 4WK4B 1RERA 1ETZB 2FT6A 5DRZB 3GHEH 1D7FA 4AVKA 1KMGA 2CR6A 5ID1A 2MOVA 3H9YA 2OSWA 4D9LH 4E36A 1ZHYA 1ZS8B 1ZT4B 2K8QA 5E2TH 5BJTA 3MBXH 1RCYA 5CEYA 1TPXC 1ICTA 4GF4A 1YJDL 1Q9LA 3BP4A 3DX1A 2NY1C 3WFHA 4HIIA 3NDZE 4NJ9L 4JVPA 4GHBA 1AMYA 1XF5B 1JHTB 5I1DB 4ZOCA 2VTFA 4I7ZC 5F70A 1QD0A 4DFHA 3DC0A 1YA5A 3UBFA 1YVLA 2HX9A 2BSCA 2HFFB 3CSYA 3CFMA 1M7XA 1T0NA 3HAEH 4P3CL 4PRBB 5JMOC 4F2EA 1CFVH 5HGHA 3Q6GH 1J10A 1WCBA 2FUQA 4MA7H 3ZKXC 4APQC 1XZ0B 2G60H 4ZTEA 3K5RA 2X4QB 1YDPA 3EO0B 3IXAA 2V4LA 3PHQA 4JFXB 3V0IA 4Q9RL 1BM7A 4MJ4A 3EGSA 2DEXX 3ARVA 1CD8A 1GSKA 3OJ2C 1CDIA 3QDJD 4OI8A 2OULB 1GVIA 3VFNB 1SDAB 5LWYH 2QHLA 4YEEA 3K8KA 4FABL 1ZTXH 5DHVH 3NZHL 1JZFA 3E6HA 3MDJA 3IDGA 3QUZB 2FX8L 4N8VB 4YLCA 1Q9FA 4KTEH 2BM3A 3QHFL 2BMKA 1ETA1 4F9PA 3FFCA 3QIBB 4JHWH 3DUSB 2O5ZL 3HNVH 3J27A 5D1XD 4CW1A 1UCBH 4AY0A 3GZPA 1CI5A 2D7QA 3P40A 3MV9D 4N0RA 4QRAA 4PI0A 3VXPA 5KJRH 4YSAA 3ESNA 1G7QA 1U3ZA 3FJTA 3NZSA 3QS3A 3MRCA 1KXVC 4LMQI 1I3GH 3MRHA 2Q86B 3A0OA 3NK3A 5TGBA 3VD3A 4FA6A 4ZG1A 4XNZC 4AVJA 1FZKA 5ECJE 1KXHA 4A6YH 4JQIL 4TVPD 2TSBA 4WWKD 4Y19A 8PAZA 2HT4C 3KWVA 3T4AC 3T1WA 2NW2B 3ZMEA 4QXGL 4KKCC 5J11B 2EVFA 4TNFA 2CA4A 3ABGA 3N06B 4YHKH 4LLMB 4HX1B 3SY0B 2WBJD 3QDJA 5TF1H 3ZZQA 1BEYL 2YWYA 2L8AA 3JUYA 3TBTB 3JVGA 4XHJC 3U7AA 4Q2ZB 1NIFA 1C16B 2E5EA 1EBAA 4QHUB 5DLLA 2ENJA 5DUPL 3KPSE 3MOBH 3KNBB 3IJEB 2VUYA 5D1XA 4JFDE 2LLNA 1PQZB 2PTTB 1PNCA 2PPAA 2D31A 1LO4L 1FO0B 3FFDA 3MV9A 2ED9A 3K4ZA 1U8KA 2LLLA 5A2KH 3HS0B 2GJRA 3HZKB 5AL0A 3QRGL 1OWWA 3G6JE 4CGTA 5EU7C 4Z7WF 5F9OL 5BV7H 4QT5A 1XMWA 5B3JE 1AP2A 5E51A 1A1OB 2K9FB 4WNQB 1U8JB 3B5TA 2R2EB 1DBJH 1QKZH 2GSGB 2XJLA 4FNLL 4B9KC 4BSJA 3L6FB 2VGLM 5HTSA 1OAQL 1HKLL 4M03A 1DBBH 1OTSD 3FCSA 2HH0L 3HNSL 2D3VA 1TJHH 1IC5H 3MUUA 1H5BB 3QIWB 4PJ7E 1PGRB 4UDUA 4F2ME 4TUKL 2BIOA 2DTML 2C9SA 3FUFA 1II4E 4JDEA 4ELMF 1NDTA 4L23A 3D69B 1FVCA 3LN4A 7FABL 1VRSA 1RK1A 1EJOL 2VR6A 4AK1A 3NIGB 1HAWA 1AFVH 2AQ3A 3E2HC 4Z7NB 1A5FL 2J8OA 1C1EL 1O7VA 2WBJA 2EDLA 1OSZA 2BCKA 4HEPG 2VAAA 4TULH 2X40A 2MMXA 3IMWA 1VIWA 4U0QB 2BP8A 5FF6A 3S36X 5AW7B 3P9MB 1U3HD 2VC2L 3IU3A 4JO3H 5J3HD 1F11B 3U2SB 4WHYH 2Z4QB 3UYOD 2Q7YA 4IMKA 4NNPH 1EAJA 1NGPL 3DOHA 1KELL 4WVRA 1NCCL 1T1YB 2VL5B 4Y5XA 4AKOA 5BOPA 1IKOP 4LIQL 4ABVA 4MZ2A 3V9EA 4HXBL 4ZW6A 3RB5A 2ICEB 5I30L 3AA1B 5H2FO 2F5BL 2CJSA 2F8XC 4X0KA 3V8OA 5IBLD 1MCCA 1L9QA 2ADGA 4OGAD 5D2LF 3LNEA 3G9VA 2B4CC 1JGIA 1JF6A 3JWNH 2CM6A 1HXYB 4Z95H 5C0BD 3DOSA 1CD1B 3THMH 4WO4B 4YWGL 3MLPA 5IMLA 1RLBA 1U8IB 1SVCP 4WU7A 3NCYP 4I87A 5DWUH 4S1DC 2LHFA 2BSSA 3G5WA 2KDYA 4JHAL 4KJQD 1OGTA 4JO2H 2RQEA 1J8HD 1DTUA 1YY8B 4M1DL 3Q7JA 4PJBA 3UCRA 1V55B 1CZ8L 3D25A 4PLJC 1OCWH 3VX0A 2G9HA 2WC7A 5GIRA 3EIFA 3EGXB 4F7EA 4K5PA 1ZHXA 4UT6L 3SDXB 2ZKWA 3BXNB 5KSAC 1EDQA 1CN4A 2OMZA 2IAMD 4G1MB 1MJ7H 4PPTA 1CYXA 4HSAC 2FO1A 3WO4B 4J5VA 4F1ZA 3CFEA 1GC1C 2E7HA 4I0KA 1A3ZA 1UJ3B 3NP4A 3ZU8A 1LWJA 4NZRL 3ARGA 5H94A 3I6GB 5HYJB 1KGYE 4KVPA 1RI8A 2O61B 4RNRB 4YPJA 3U1QA 3WMSA 3O4OB 3D4GA 4LCUA 3GP6A 2Z6FA 4HULB 3VH8A 5I6NA 4AM0A 4H0HB 3OKNB 4X99A 4XPTH 1PW3A 4PCYA 1RZ7L 3RNKB 5TPWL 2W0FB 2RGSA 3ZHDA 2VWEE 1N64H 3W11D 3ZGIA 3ZTNL 2VLRE 3NZ8B 5EOCL 4E9WA 2VR4A 5C6TL 5C0BA 2BSTA 2R4NA 1NLDL 2XN0A 1Y18B 4M6AA 5JHAA 4DH2A 3N91A 1DLHB 1FHGA 3VDCA 5DZNA 4K3DH 4DZBB 2VITA 3D8MA 1AO7B 1F6AB 3NCJL 4ZUWB 1A2YA 3AAZA 3DROA 2NRDA 3DHUA 4RMSA 5IV2A 5CO1A 1QHOA 1CDBA 1TZGH 1F42A 1TYEB 3TEZA 3QEQE 1TEFA 2FZ3A 2AQRA 4XPBL 1J8HA 4LCCB 5FUZL 3ZHKA 3QNZB 5C07D 5F9DC 1ZLWK 4Z7WE 3QCUL 4S1RL 1BMWA 3APCA 2DJ4A 2E4FA 4YR6B 3PRNA 4K07A 4Y5YC 4EQ2A 1R3IL 5E0FA 2IAMA 2YBGA 4NPJA 1KCUL 2OCFD 4PD4K 4XAWL 4HALA 1S7RB 3DARA 1WC7B 4MJJA 1GFMA 5DFVC 4Z8FH 3ARDC 1JZGA 2AQNA 5MEND 2PLTA 4UMGA 4A2FA 2D7NA 3RY6C 1L7TH 1P7KB 2PW1B 3QVAA 4JM0A 4YDJB 4WFHE 3B6SB 3WKQA 4ELME 4AYMC 4AT6A 4CNIB 1ECYA 1G6RB 3IN2A 3JV6A 1YNTA 2CU9A 1EZVY 2BFVH 3GM8A 4J6RL 4P04A 4BE6A 2E3VA 5E1AB 4TQIA 2VXSH 4PRPD 4XCEA 5FLUA 1UC6A 3OAZK 1CK0H 3WEAA 4ZX6A 1NANI 4EBQL 4NZTL 5FYJL 1AGBA 1JGLL 2AABL 2BSRA 3TBBA 1GHFH 2XG5A 3RFZC 1MHEA 4NFDA 2G75B 1SYSA 3AM8A 4M7JH 1MFDH 4OIBA 4XHQA 1DQIA 4Y1AE 4WEBL 2WLJA 1U8PA 1XH2A 1QBLH 1QFUH 3EUDA 2NUPA 4IKNA 4N8UA 3V4PL 2IPTH 1VFOA 3PQYE 3ULUC 1GGUA 5C07A 5LNEA 1ONQB 2E6PA 1R6VA 3G5ZA 3KLSA 1CJYA 3SYQA 5IEKA 1JERA 4PMFA 4P5MA 3QFDB 4XWOD 1D3CA 1GIGL 1PG7L 4YHZH 1TTUA 2WJ7A 5CKAA 1YQ2A 4O51A 3CDZA 4UOW1 2VDOL 5M95B 2C9XA 2P1YA 5DD6B 5D2LE 5F88A 4RAVA 5DZPA 5E8NA 2Y0KA 1EGJH 5A1AA 4YHYC 1J0JA 2UWEB 4K7PL 5IROD 3TFKC 5MENA 4HAGA 1N9PA 4NNXA 2IQAA 3MVSA 4KJWD 2EXYC 3RTQB 1LQSR 2IGFL 5ETUA 4JANB 1NCWH 1E7VA 4W6YB 3PP4L 2LU7A 3P9WB 3RGBA 5JPMA 3GS7A 5FKPB 1KYAA 1FYTD 5AZ2L 3AQYA 4QCIB 4FQQA 2Y5QA 1NIBA 1I3RB 3ZKQD 1BQHA 4MDRA 4QXUL 4AW7A 4U31A 4Z0BL 2HLFC 4PRPA 3P4NA 2IH8A 5FUCE 4DPCX 3TTYA 3MC0A 3MRBA 1H8LA 5E6ZA 3ISYA 3BT0A 4DEPB 2Y0LA 5KVDH 4J8RB 2D9QB 5F89B 2IH3B 1FIGH 4Y7OC 3RL1B 2WWOA 4G70B 3WV0A 3KPMB 4LOUC 4P9ML 1E30A 3DKHA 3CBKB 3HCVA 2OYLA 2A74C 3AU1B 3O41A 2YK1L 1WBXB 4H1LA 5A6MA 1OE2A 4OIIH 1FUNA 5ANMA 5FUOH 2R8SH 4JE4B 5DK0A 2O6DA 2A73A 2F7IA 3VFGL 3VB9A 2BC4A 2V2WB 4GW4B 1RUKL 5ITBL 2IPKA 2VUOA 4LCYB 2P44B 3GINA 4TKWA 5IJBC 4X9YA 4N75A 3AAAB 5IROA 2NW3A 1KBGL 3QO0A 3X13A 4Z3IA 4EVNB 4K3EL 4LKXB 4PLOB 5D1QB 2JELL 2ZYSA 1UT9A 5GS0L 3L2LA 4FABH 2D2CC 4OLVL 2G0KA 5KSBB 5TE7L 3NZHH 4JFUA 1OT1A 4BWWA 3HRZC 1FYTA 2EVHA 2OI9B 3VE1A 3QHFH 7PCYA 1NDMA 3UTQB 3E9TA 3O3AA 4LSTH 5M94B 1T7XA 3IF1B 4LRNH 4ATWA 1VERA 5E6UB 1XCWA 3SGJA 2WXKA 4IU3B 3IDNA 3FH5A 2Q8AH 4N2GA 4L8SA 4XN9A 1R3KA 2ITCB 2D4DA 4M7LL 3O3BA 4JCLA 1NC4B 2YWZA 4YDVB 3L45A 1FV1B 2QSVA 4HT1L 2Q1EA 5L0QC 1XR8B 4M5YH 3WLBA 3MV11 3G7GA 4HK0B 4PREB 2EVIA 2EILB 3BPLC 1KIQA 5IOPB 5L9DL 4NWUL 5K1NA 4JQIH 1IBGL 4MQXC 3RWIB 1Q0EA 4PJXB 1AZRA 3T8VA 2VSMB 3AY2A 4NI6A 4FUVA 2IWEA 2WQUA 1FGVH 2F1VA 2QGDA 4JJ5B 3UZVA 4Z7UB 3GSNA 4G2AA 3LXUX 4R2GD 1M1XA 3AUVA 3VSQA 2VZVA 4YXLH 5LGHH 3RZCC 3DURB 1ZY9A 4MRCA 7PAZA 3I85A 4L5FL 3KLKA 2EO7A 4JRXA 1BEYH 4JZOA 4YSEA 3OZ9H 3LOWA 1NMBH 2DQFA 4GG8A 3EOBB 3RBSA 1KGUA 3WS3B 2Q87A 3BH8A 5I1LA 2B7DT 2VN6A 3U0WL 5JNYA 1W8EA 4NNYA 4N0YL 4V1DD 1ZXQA 2XMXA 3LY6A 2EDKA 1QTSA 1TETH 4CC4A 2H41A 1T1XB 4FGMA 4GRWF 1TTRA 5E9DD 2XTJC 3RFRA 3N55A 3V6FA 3REWB 3MJGX 2B59A 5FHAL 4IL6O 1RZIA 1G0XA 1CIDA 1SN2A 3FT1A 4OM0L 5T3XE 3BDBA 3HTLX 3HG4A 4MA1C 5F9OH 3EJJX 4NQVB 5IESL 2C7FA 1VGEL 1N2RA 1ZT1B 4FZ8L 3BIKB 3QJUB 4RIRA 2P9RA 3PAYA 5I5IA 4AG4H 1U92B 4IRZA 1L9RA 4O3WA 1HTYA 3DV6B 1OAZL 1WT5A 1Z5HA 3A4EA 1JNNH 1H3UA 3B7RL 1MFVA 1WSST 3EF7A 2XVLA 4YK4C 4GJTB 4ZYKB 4Q9CA 2W9DL 1CG9A 4P3DB 4AIXA 4YEFA 5BZWA 1HKLH 2UWEF 1C8QA 2ESVB 3BESR 3R1GL 4XMPL 3RE0A 1J48A 2HH0H 3HNSH 1JZ8A 5TISO 5DJZA 4B27A 2W07B 4J1UB 4N2NA 3HB3C 1MJUL 4Z7QF 4FMKA 5IF0B 3T71A 3LKSA 1E65A 4WV1B 4FXKC 4TUKH 1T22B 3NIFB 2DTMH 4M5ZH 5IREA 1CFTB 1E6OL 1KENL 5I19L 3D0VA 1OAXL 4F33B 5L2KB 2XQBH 4F7TA 3CH1B 43C9A 3JTSA 3SCMC 5F1IA 2WAHA 2AV7B 3GBEA 3QHZL 1QRNB 3O9WC 4B95C 3T0XA 4X50A 2H3NB 2M2DA 2YRLA 1JXGA 3NT0A 1BZ9A 3OL2A 4HIQA 1JHKL 5J1AA 3GMOB 3VB8A 1GTNA 1DQQB 4LAQL 2KYIA 4ODWA 3MX0B 4NAJA 5AALA 3EDDA 3EOAA 3MLVL 3WJJA 5IBTH 1CI3M 3SKNB 1AIFB 1NSNH 2VC2H 2VXQH 1I1FB 1NOFA 1F2QA 1AZNA 3ECWA 5E9DA 1WZLA 3KPRB 5CEXB 4MNHB 1NCCH 2VLKD 1DQKA 4LLVB 5EUOB 1I9IL 4JPQA 5H37H 4Y1SA 3HI6H 3GIZL 5DRNA 1SBSH 5TDOB 1DEDA 4LEBA 1YN7B 4HXBH 2FT8A 4JKPL 2XXMB 1ORQA 5T1MA 2FEDC 4J27A 3HE6B 2J88L 4H40A 5C0AE 3FS9A 1EFXD 1X6NA 3BUBA 5D8JH 2VJ8A 4X4MA 4TUJA 4NXKA 4U6YB 1PKQE 1Q9KB 4XPFL 3ZT5A 2H32A 5I9QB 2OJEA 5I6KA 3NJMA 3SDCD 5DD1L 1SDDA 5FM5O 32C2B 1AO7E 4XCCL 4FMVA 4I9WD 4U0RB 3QJTB 1JZ2A 1KC5L 1FA4A 3UGXA 2F1EA 3CSBA 4PH8A 1XGUA 3CC5B 4A7GA 3LQZA 3QFJE 5JIQA 5KSBF 4LBEA 3EO9H 2AXGA 1A4CA 2X1WL 4H26B 2YIHA 4IRJC 2BNQB 5E9NA 4LPUA 5SWSB 4BKSC 3CZSA 2E7DA 1CZ8H 4HYTB 2K6ZA 4KR4A 3VJ6A 4OY9A 1G7HA 2VERN 3QC6X 1XGPA 4MSWB 4JGMA 3BMWA 3AS0A 4B9ZA 3V0VB 4L4TB 1DUYB 3MCYA 4IJ3B 4FN0A 1IRAY 1BOGA 4S1QL 3MJ7B 2ALAA 3PXHA 5C2BL 2FIKA 3HG1E 3EYVA 4H5SA 3RNQB 2X0WA 3HFML 2DOCA 1EMTL 2BK8A 4J3BA 4XTRC 1FAKT 1I53A 3MYJA 3PHAA 4H2AA 4BHUI 1HEJC 2QR0B 2VLKA 3A0BO 2F54E 1IGIH 4JR9L 1S8DA 4B50A 5AKSA 2VOTA 2QKIB 3X17A 1MOEA 2IAAC 1MFEH 4IRSA 3VXUE 4UBDC 2FLRT 5IWLC 5TPWH 4ZW5A 5A40E 5AOIA 2G4EA 2P8LB 1EFXA 3L3JB 4GAJL 4DNLA 2DH3A 1D7DA 2YRZA 3U7YL 3D30A 4HK3N 5C6TH 2ZSWA 3HR6A 3VVWA 1NLDH 3MUGB 1PMYA 3OSVA 4Y4KC 1DVYA 3A67L 4NXSA 3SDCA 1DN0A 3PHOB 5DURD 1BF8A 3TZGA 1PZ5A 3I75B 3MLRL 3SE8H 3NCJH 2AEWA 3I6SA 1J0KA 1XGYL 3UJJL 2JCWA 4ZDHA 4LQFH 4P9HL 1BVNT 1YPZA 4FQIL 3VXQA 4GRWE 2YBRA 2F58H 5JPNA 1JHLL 3ZHLA 3FSVA 2WIMA 4AGOA 1MH5B 4LVOB 5HJBA 3UACA 3L17A 4RAUA 5CSZB 2XWJA 5FECA 4UYQA 4WUKH 4S1RH 4QRSB 4A1RA 4PBDA 3VI3A 3N6YA 2DYRB 1W2KT 3WJMB 1FC1A 2D0FA 5LB1A 5J6GB 3CVHA 2X05A 3P4OA 5FYKE 3V0HA 3PWVA 3FRUA 1WAPA 3FBQA 1GGIH 4HIHB 2RFXA 3P9LB 2Q20A 3QUYB 5KSVA 1G9MH 3H9SA 2ZFGA 1J5DA 1KNOB 5ITFA 2ZX6A 2DAVA 3A21A 3VD5A 5DGRA 3B7TA 4ZQKA 1RXLA 4Z7QE 3RVVD 5AVWB 2DD8H 4GAGL 4KKLC 5AKVA 1E8YA 3BT2L 3GSQA 4R26H 1R24B 3ARBC 3NCCB 4N2DA 4ZMLA 1CGWA 1DDTA 1KTDA 1P5VB 3MRIB 2X87A 4NB7A 4AQOA 5IFAH 3PJLA 1KCWA 3DTXA 3X11B 5I1CH 4WJ5A 2OL3L 2CLZB 4L8DA 4Y4HB 3NGBB 2NY3D 4PJHF 4OSUH 5DFTA 5B1CA 5F7DA 4R0LA 5KTEL 3WFEH 1OGSA 4NZTH 1XGTA 5FYJH 4G1EB 2ZUYA 1JGLH 1P1ZA 2AABH 1EH9A 2ZCHL 2V2XB 4MDIA 3DXAE 2VN7A 4YDKL 3RUGB 5GSVA 4DP8X 4WEBH 5JQHC 2VM4A 4TPRH 3BWZA 2AANA 3A6BH 3QUXB 2QVKA 3FSWA 4UUJA 2EADA 3ZL1A 1Z6JT 2HZHA 4XXCA 3V4PH 1N0LA 5EOQH 1FNSH 1C12B 2X4RB 1A22B 3AGWA 3ES6B 4ZSOB 3IAPA 2GI0A 4R5XA 2PWHA 1HQRA 4GKNB 3WNJA 1YCSA 3X14A 3K71B 4DGIL 4HWBL 1PG7H 5T3ZL 2W1NA 2R7EB 1E2WA 3AB0B 1UKQA 4WI6A 2B2XH 4XVUC 5B39A 3D2TA 1YAZA 5I75C 5IQ7L 3TWCL 5IW6B 3TZVC 4CRPA 5FEBA 5K9JH 2MTPA 2FL5A 2NX5E 3AXLB 4O3YA 3WN6A 4P5TB 4DEUA 2WYZA 1GGBH 1KY6A 4K7PH 5F21B 2PCYA 2ROYA 3X1BA 3K6DA 1DJYA 4HCGA 2OMTB 3M86A 1HOEA 4F57H 1AHKA 1AGFB 3I9GL 5TDPA 3W39B 1Q9OB 4X9FA 5B66O 2DIEA 2IANE 2LTQC 4FG0A 5IM7B 3V0GA 5KSBE 3T0BA 3EH1A 1RHHA 1C5CL 2XWRA 3V4VB 4F8TA 3RILA 1I1YA 3OM3B 3N40F 2QZQA 3PNRB 4NDMA 5G2NA 4QXUH 1FAIH 3AXHA 4JPWL 4K3BA 1UENA 1K8DB 5K39A 3W9EA 4MGXA 3ZE0E 4TF4A 3N5AA 3BRZA 4AL8C 5IFHH 5DMKA 3RP1A 4DGUA 4CILA 5CGYC 2Z93B 4BKLB 2A6JA 3T0EC 4E2OA 1F41A 3WKPA 3CZFA 3S3PA 4PJ6A 4P9MH 3NUKA 2LLGA 4XGZA 3T09A 4ANUA 1DJWA 5LBSH 1BBJA 1HJBC 2H2SD 2IALB 2YK1H 1I1AC 3OAYH 3QDGD 1PAZA 1JWMA 4A2GA 5ICZB 1W72L 1DQJA 1F00I 4FHKA 5I8OL 3PIQB 5E2WL 1VACB 3MLTB 4YOKA 1YECL 2CDGA 1NCJA 2XBTA 4JKWA 2ORBH 2HLEB 2W0PA 5EU7E 3BP5A 4JFEE 4I3SL 5ISZD 3WEMA 2CDEA 3U30B 3T5WA 2M83A 4UNTA 1NFDF 3VFGH 3S5LG 5I18H 2FECI 2Z31B 5BMFL 5ITBH 2NY4D 4X4ZA 5D2NB 3R8QA 1ET5A 8FABB 1GZHC 3CK0L 5DK2A 3RY5A 2R1XA 3HC3H 1KBGH 5ECGA 2F18A 4RA0C 1JF1A 2W60B 2JELH 3B7UX 3F04A 1IM9A 3KDPB 5GS0H 1T0MB 3ESMA 3IGFA 4ZMTA 1KGJA 1QQDB 4WLCA 4P2QE 3W2DH 1DZBA 4ACTA 2X12A 3BO8B 2QVFB 1ZLWH 1XF4A 1BT9A 3WHE0 4KR8A 1N8OE 3H9ZA 2XE5A 1BFOB 1NBQA 5ADPL 3O81A 1M2VA 4FNSA 2WBWB 2B1AL 3RJQB 1AZZC 4G6AC 4P46C 2AI0L 2XOTA 1THAA 3N1FC 1H6UA 4E5XG 4NPYA 3FMGL 4LHUD 2DY2A 4PRIE 4F24A 2AVGA 4BK5C 3KPLB 1U0QA 2QGBA 1KPUA 4OLZL 2LU3A 4I48B 2GAZA 5JIIA 2DQJL 4IU2A 4I9XA 2KHAA 2XWTB 5CCKL 4HT1H 1UB6A 4EIGB 1CPUA 2P8PA 2EP6A 3CZLA 3FQUA 3SO3C 1BGXH 1I31A 3ZYJA 1FNFA 3GJFK 2X28A 1HH9B 3MNWA 2J1ZA 4OBRA 2W38A 3IRCA 4Z23A 3ARFC 3U0TA 1L5GB 3WIHH 5LXGL 1WWWX 1L9PA 1JV2A 5ISZA 4ZX3A 4XWGL 3H3BC 3OAZH 3V4PB 4P0DA 2VQTA 1ET7A 1DBML 1LNUA 3GDBA 4PJHE 4LFHD 1I7ZB 4KK8C 1GFNA 4AUYA 2AJVL 3OWRA 4QRTA 2A6DB 4OLUL 3WGUB 2R2BA 5CR8A 1RP9A 3K74B 1CQYA 4L5FH 2BVUA 2I07A 2GE4A 2NXYB 5I6MA 2VDOB 3IBOA 5AW5B 5E94A 3WFZA 1QMUA 4MQSB 2XA8H 3NRPA 4B9JA 4OCNC 1TVBA 3HPJA 4NFBA 4YHNA 1J0YA 4GW1B 3AVEA 3U0WH 2YGOA 1FH5H 1CL7H 4IOFC 2J2ZA 4N0YH 3SBPA 1I7TB 2CKBA 4UQEA 3SJVD 4NO3B 3GBNL 1B90A 3W9DB 4L3EB 1V3KA 1ZAGA 5G4OA 1VEMA 4POUB 4FQXD 3RWFA 3TVMB 2VSKB 3BPOC 3G04A 3LEVH 2G3MA 4IHOA 1AD9B 1JPGB 2A4EA 1ZSDB 4LHUA 5DVMA 2W88A 3HG5A 3RPIA 2WLHA 4S0TD 5TH2A 4Z3HA 5IESH 1VGEH 3BUYA 4FZ8H 1KYDA 1WISA 1B6UA 3ET9F 4XOCA 2N4IA 3EYOB 4PR7A 3LSOA 1WP6A 1OAZH 2IFGA 4RMWA 4GO8A 5JHLA 4PJ9C 2W9DH 4PWKA 2V2TB 3EFDH 2EDNA 3HR5B 3HG3A 4JFYB 3DV4A 1G7LA 1JYWA 5ICUA 3RVWD 1WE5A 1IAKB 3MRRA 5D70L 1VFUA 1VFAA 1XGQA 4EZJA 1V7MH 4FE9A 1KB5A 1MJUH 3PDOA 2P47B 3Q8BA 3CLEL 1Z5YD 2JCCA 3BVNB 2NY5H 4TNWF 2XQYA 2PCFB 2EYTA 5HD8D 2XI9A 3QJFB 4X4YB 1OAXH 1T4KB 1D7BA 2DLHA 2LAGB 4RZCA 3S3BB 3EYQC 4LMQE 2OP4L 2IMMA 4PBWD 3ARSA 4TLSA 5HVHB 5EN3A 4JJHA 4NQTA 4WFGD 3DSNB 1O7DE 1SN5A 5E5LA 1NINA 1JHKH 1CXKA 1ZHZA 3WXVL 2X6UA 4O3XB 1LO5A 1XX9C 4WUUD 1LXMA 1XR9B 4IKIA 5SX4I 3VMOA 4IDLA 3SJVA 4GH7B 5GHWL 1MF2L 2Y7LA 2ZG3A 3U36B 5LLIC 4MVBD 2ZUQC 4FQXA 3HUJA 1I9IH 5D7KD 1NFDE 2CK0L 1MSPA 2G5RA 3DX4A 4MD4A 4LVHC 1WIUA 3B1TA 2XICA 4PTTA 4WEMB 2Z91B 4JKPH 3VRLE 4DN4H 5K9OB 3P77A 4FXGC 3FCTA 3C5ZD 1ED3A 3C2AH 3GMPA 1YEEH 4NZDA 1QFWM 3NACL 3QPQC 2J4WL 3V6BR 3BEWA 1SXAA 2A38A 3GMNB 1JPFA 2H2PD 2B08A 1TCRA 4HJJL 4MXQD 1PZ2A 5D9SB 2GTZB 2JLPA 4LLAA 3CU7A 1RL1A 5IB3B 3JTTA 4KDVA 2CE6A 4GPVA 4XCCH 1H0DB 3TBVB 3C87A 4HXAL 4HUUB 5AAWA 3ZE2B 1WZ1H 3QXAA 1OPFA 3MRDA 1XCTA 3IMBA 3C12A 3ZTEA 1XDTT 2FAUA 3LS4H 2AXJA 1KG0B 4RGNC 1PZAA 2X6BA 2F2HA 1HT6A 4AZ8A 3F5WB 4ZMNA 4LNRB 2Z8SA 4PRHE 5DVPA 3T6XA 5C0EB 1U3JA 2APXA 4L8BA 3ZZLA 4FJYA 4YQXL 4X6DA 4C54A 3VM5A 4C4KT 5C0IB 2C3WA 2IDCA 4XC3L 1HHIA 4HIPA 1TZ8A 5C2BH 4WUUA 1EX0A 3T1FA 4K23L 3HFMH 4UV7L 2DQDH 4MA3A 3QIUB 1WWCA 3KL0A 4DUWA 1I8LC 4NQDB 2H5UA 3D9AL 3CDCA 2XYCA 4EPSA 1QR1B 5LCVA 4YDLC 4AMKL 4YGAB 1C5BH 2WMPA 4OBSA 2QTKA 3F7YB 4J8QA 4ANXA 1MHCA 4UT9L 1KYOJ 2FWOA 1MPAH 3IYLW 4JN2A 1IBDA 4OZHB 4WKZA 3C5ZA 4FD0A 2EDFA 3W56A 1CFQA 6PAZA 1BP3B 1MCPL 1TKWB 4MMXC 4OT1L 4YHIB 4MNGE 3MRMA 2FJFA 5ICXA 1MY7A 1XB6A 3VE2A 3T65B 4WWID 3NA9L 3PDDA 2AJZA 2V7HA 3MLRH 3SDAD 1FVDB 3K8LA 4XP4H 1UHVA 4R7LA 3BIBX 1K4DB 1PL3A 1WBZB 1YYLL 1URIA 4FQIH 1H6TA 3M7OA 4D8OA 1OTUC 1RD6A 1JZ3A 4B60A 4HCRH 4EE2A 3IXTA 4GQZA 1HQ4A 1WS7A 2X44D 5F9JB 3N1QC 3HAEG 4FYTA 4ZSOE 2BP0A 3DJTA 5GJSH 3EDFA 3UIYA 3U6RB 5CZXD 2B39A 2XXCB 4X4KA 2VLJB 3L5HA 4YAQB 5HGBB 5IVZA 1T0OA 3EJTA 5C09E 2QJDA 2XIBA 3QAQA 3ULSB 3IU4L 1SY6A 1ZA3A 3KZ8A 3B2UD 4WTZG 2DMHA 2WKGA 2R2CA 1X5XA 1CTOA 4JRYE 4RL9A 5EOTA 1TJIL 3BZEB 4ONHB 3FU6A 4KTYA 1ZHLA 3EH3B 3D39E 3GO1H 5FGBC 3ABZA 3BCDA 1AHWB 4YDMA 2NY0C 3NA4A 3S96A 2GJ6E 1S3KL 2FWUA 4GAGH 2OMWB 1A6VH 2OPCA 3GEWB 3MFFB 3H56A 4NKDA 3QP3A 4NCDA 4F7PB 5CBEB 5EBWB 5FYJU 1NOAA 2K3TA 2FQDA 3VI4B 4LZKA 4I4WB 4K5NA 2ITDB 1JZIA 2QKSA 4BKTC 2FJGB 1T1LA 4JFPA 2XFGB 5I17B 4OF7A 3E1F1 4XPHH 3CHXA 2ICES 5D7JD 3W0WD 5KTEH 5T33L 5ESQB 3HMWL 4KROB 4BK4A 3MV8B 1BJ1J 3WMQA 4HU8A 1Y0LB 2ZCHH 2MCPH 1KLFA 3NH7H 2J8HA 4D5UA 2ZXAA 4DWHA 2MRYA 3SDAA 4DP4X 2C9AA 4YBLC 2O6FA 2MQGA 5KWYC 3UG4A 2NOYA 2VDLL 1YEJL 3MMEB 4GSQA 1D5ZB 4GNKB 4K9EH 4LASL 4PJIF 5K9KA 2QEJA 3SYBA 1FFNB 5E2VH 2XG6A 4A7VA 1VAHA 3B37A 1JJUA 2VW6A 3VFUA 1G7PB 2AMGA 2W8CA 3MLZH 4HBCH 1DBAL 1ZVHA 5G5DA 1FC2D 1X7SA 2M07A 2VXVL 5EC2B 3WDHA 2EIKB 1E9QB 5T3ZH 1OF2A 3MLSL 3ALXA 3LYRA 1UD6A 3POXA 1MVFA 3TWCH 1ZLSH 3UZQA 5FO7A 5E4OA 3BAEL 3SYPA 2OMYB 1AXSA 2Q7AA 2YPKA 3FO2B 5F7FA 2YA0A 3VGGA 4HOXA 2B4CL 1LLAA 3RGVD 4GKZA 4KI5F 1T3FA 3BH9B 5ESAB 2EC9T 4ISVB 4R4BB 5FO2A 1YEGH 1E5BA 3F65A 1Y6MR 3I9GH 3ZZSA 1MIML 2APWA 2FSEA 4UIMA 3C2SA 1V54B 3MBWB 3QQ4B 5ABZA 4G9FD 4P07A 4N0UB 4TRPL 3SKJL 1QA9A 4PP2B 4JPWH 3M17A 4E9QA 2ZUTA 5D7JA 3W0WA 5L4JA 3H55A 4QY8B 3T0VA 2H3XC 5T3XH 3UERA 4Z78A 1XL6A 4Z7OB 1HSAB 4BUHA 1L9SA 5KAQF 4GUPB 3DVGB 2JIXB 3S98A 4XO5A 3LQAC 4M3KB 5D1XC 1JF5A 4MWFB 5DUBB 4B9YA 2G5BA 1GC1L 5D96C 5BXFA 3KWWA 1N5AA 4GG6A 4L3CA 2WOBA 4XCYA 4IDJL 1Z7JA 4LSSL 4QLWA 1NCGA 1AGCB 3T2PA 6PRNA 4ZZFA 1JK8B 2DJUA 1RUAL 2WLZA 1IEAA 3NPZB 3S4SA 3AS2A 3N43B 4FP8L 4MJIB 3RJOA 5E6RB 5DR5H 1UCTA 5FLVA 3BUPA 4BD4A 5JOPE 1QWHA 2BOCA 4I3SH 1G7JB 5A43C 3B9VA 1RLWA 3BEVA 3JWOH 2A0LC 5ADXL 2WB7A 3KH3A 2ZCKH 4O5LL 4Y2LA 4U3SA 1OF0A 3MOAH 2BERA 3WEBA 1QSZA 1OLLA 1NMCB 4HPYH 5CLWA 1E8WA 4XVTL 1GS7A 2WQ8A 3MRKB 3FRPA 4OZHF 4TNWK 1UQSA 5EWIH 3RGVA 4Y4FB 1J5OL 1IARB 4WWKC 3X3FH 4ADJA 2IPUK 4JY5L 3FN9A 4L37B 1T5KA 3HZ3A 5BQ7B 1T5WA 2XE1A 3KPOB 4BFIA 3MSPA 3B9DA 5L2JA 1GH7A 4A55A 4M9OA 5EIIA 3GMQB 2NNAB 5EEZA 3B2VH 5B8CA 4HLEA 4LOVA 2PETA 1AY1H 2CKNA 4ZFQA 1IAIL 2MWCA 4G9FA 5A2LH 1D5XA 1ADQA 2W94A 1CBVL 5ADPH 2WBJC 3VO0A 2IXQB 4F1SA 3MNVB 4XVSH 2OJZL 5HYQA 1HYSC 4M1GL 1OK8A 4L0YA 2AI0H 5BUGA 4RCAA 4P8QA 3KPNA 3FH7A 1R5WB 3QEHB 3SYAA 3FMGH 2CGRL 4X8JB 4X6CF 1NPUA 3L9YA 3OXSB 2J25A 3C6LB 3PWPE 4DP1X 2DQJH 2DIBA 3FO9A 4IMKC 2BWIA 2OL3B 4DVBA 3T0SA 2OCCB 1XH1A 4J3SA 3OKKA 4NSKB 3DO4A 1DQVA 4Y5XC 5EU6B 3RWGA 5I0ZA 4BUQA 3T24A 1C5DB 1NMAL 1BJMA 3FOMB 1EAPA 3D05A 5IVXA 3UP6A 3ECQA 3NIDF 1QVOB 2LFUA 1D5MB 2F1BA 3G08B 2YD4A 2UY6B 4P99A 5IMKA 5BZXA 4AQ8C 5DEFA 5LXGH 4XN2A 5IY5B 1FBIL 2A77L 5K93A 4S2SB 4LRIC 1KTLB 2EYSB 4P06A 5C0CB 3TJEH 5DQJA 1CLZL 1DBMH 2W95A 4W9IC 1AZUA 3VI4F 1M3IA 2AJVH 3PAUA 4OLUH 3REVA 5DJAA 3DETD 3RVXC 4ODSH 4U1IA 4XP1L 5AKTA 3PNWA 3QQNA 4PJIE 5DWPA 1D5IH 1HH6B 4WTQA 5AW2B 4DGWC 4FZLA 4N25A 4I88A 4FYSA 4WW2F 3IKCB 5EHFA 3RPBA 5CEZE 1YUKB 3L95B 4LSQL 2ZYIA 4WO0A 1LE9A 1NEZA 2ZP8A 5L4IA 3ULUL 3GBNH 5C3TA 5JIHA 2A4CA 2FBRA 4GEIA 2MOGA 4MMZB 3FHAA 4YHML 4AVIA 5I2IB 2HA1A 4QRPD 2VE6A 3CN3A 1M2OA 2X1OA 4YH6A 4G43B 2ZSVA 2WGNB 4K71C 3SQBB 5MI0C 1U3HC 4HV8A 5J3HC 5EDXA 3AS3A 3SY6A 2BWDA 4M02A 3HE7D 4FA7B 2BVTA 2VQ1A 4DOHB 4KI5E 3CDGB 3QI9D 3ERXA 4JY4B 3ISRA 4PJGE 3UBXG 3TBYA 3SQOL 3FYEB 2XWBB 1ORMA 1UM5L 2G30A 2Z8VC 3AT8A 2MQ0A 5D70H 3WO3B 4AM0Q 4H4NA 2DQGL 1YN6A 5IEHB 3VTAA 2O6EA 1U58A 5IBLC 3DDFA 4OGAC 4PW4A 3ZDWA 4X5XB 3BYTA 5IW3A 5IW1A 1ML0A 1NIEA 3BPCA 3G9AB 1GGYA 1W72B 3LKQB 3L4VA 4U33A 5D93B 4KDTA 4FLQA 5J12B 4JGUA 2ZWLT 2XN2A 4BZ2H 3CC1A 2W0LA 2NLJA 4APXB 2B9AA 4QRRB 5IQMA 5KAIO 1F4YL 1L0XA 4GIOA 1S9YA 4UB0L 1Z9OA 1MG2C 1N6UA 1Q90A 1MW3A 4ZFGL 5DJ6A 5BW7C 5I0YA 3CFDB 4KJQC 5FYKH 2R1WB 1PAMA 2ARJB 3WXVH 2BS71 3S37L 4FNTA 4FTVD 3APDA 4PWEA 3T3PF 1G94A 3MCLL 2WXRA 4PRDA 1DJHA 4NQSA 4XN7A 4FT6A 1MF2H 2HP4A 5KBPA 3P73B 2NYKA 3K0YA 3UTTB 3WIIH 1U8MB 2IAMC 5FAAA 1VZHA 2AFNA 3AT0A 3UTZB 4QRPA 3BE1H 3QZBA 5E08L 4WFHD 5HYIA 3WU1A 3OG6B 1RPQA 4RQQB 3OKDA 1OL0A 1YC7A 4OZHE 3HE7A 4DAGL 3BLKA 4KO6A 1WHOA 4QGTA 4YX2H 3QI9A 1A21A 5LNGA 4CVXB 4JLRA 1I85C 2VR9A 2UX7A 5F1SA 2Q10A 3CWGA 1SJHA 5F3HB 2K4WA 4ZO9A 2JFCA 2OX5B 2IG2L 3ILQC 2R29A 4L9LA 2WZ0A 2X4SB 1WFNA 2P8MB 4DESA 4PV9A 1CXEA 3W11C 2YZ8A 3I3DA 3TFBA 3ZE1B 1VEOA 3CX5J 3QG7L 2FNWA 3VXSB 3PQYD 4P2RB 4FYQA 1KGXA 2IV9A 3AM8C 1VFBB 4X6CE 4K5OA 4Z7WA 5DHMC 4MLIA 2J73A 3OXRA 2BRRL 1FVEA 5C7ZA 1YNLL 2PUQT 2J1YA 1LO0L 3GJFH 4YQXH 2E27H 5DJ2A 5DSCB 4FTVA 3QC5X 5IIEA 2NUTA 1E4XI 3VU1A 4EI6A 1E2ZA 1SF3A 2DIAA 3ECBA 1CLOL 3KEDA 3NIDE 2FATL 3O2VL 1P5UA 3D9AH 4G8GB 4KK5D 1HINL 2B20A 2YAQA 3GD1C 3T0WA 4AMKH 4HWEH 1BJ8A 1UURA 5TD4A 3IMVA 2JTYA 2JSFA 3QUZD 4ELMA 3TEYA 1THCA 3CPLB 4WI2A 4ZMZA 5EEWA 3VE0B 3ZRCC 3QIBD 2FCBA 2CO1A 1CF8L 4U1MB 4B5ZA 1ETZA 2ZD0A 3K6SB 5DRZA 3ARPA 4FG2A 1A4KB 4WGVB 1LWHA 5CZRA 2VL4A 1ZS8A 2X41A 1ZT4A 5F7YC 4X0NA 4FHBD 2GPZA 2L0DA 3FKUS 3G7TA 3A6CH 3NA9H 1H8SA 5DO2D 1BG1A 4ZMVA 4NI3A 3SGEI 2VB5A 2ENYA 2F7QA 5KW9L 5I6PA 2HJLB 2WCSA 4UQ2B 4QHNB 4KBPA 4L48A 3J8F7 1ROWA 5EB9A 5BO1L 2ZX9A 1WFJA 5I1DA 1HZKA 4KTGA 4WI9A 5I26A 2ALWA 2GCYB 2A83B 2HVBA 3T2NL 2Y2TA 4OFYD 5JHMA 2HFFA 4IK6A 3QEGL 1HFUA 4PRBA 4AXWB 5I5RA 1U36A 4FFYH 2N7BA 3LIZL 4XO9A 1WH0A 3IU4H 1XZ0A 1KIUA 4HUWB 3AFLA 5DJ8A 5GJTL 2X4QA 3LRSB 3EO0A 2D4FA 5AVVB 4JFXA 2SEBB 1S7WB 4KXZI 3I6KA 2F1CX 4KC3B 4XWOC 1TPXB 2I25N 1EDHA 3UJTH 3KLLA 2DQTL 5GZND 4FZEH 3ZRSA 2WJRA 2XTQA 5FYLE 2QTVA 1YHPA 1IZJA 1S3KH 2NY1B 5KOMC 2YGQA 5LBVA 4HBQA 3QUZA 2FE0A 4N8VA 5C08B 5IROC 2CH8A 4QYOA 3QIBA 4A67A 4KJWC 5EU4B 2I9LB 2RD0A 4HS8L 1ACYL 4AE1A 4FKHA 3KPPB 2QADB 4R7NB 3Q2VA 5D5MB 1AE6H 2OR7A 1DCEA 3ZKXB 4Y2DD 1OARL 1F4WL 3T3PE 3V79C 3PV6B 4XN1A 5KVGE 2K7PA 1BQSA 4LASH 2Q86A 5J6SA 1J1OL 3PL6C 4NO2B 3L54A 4OUUB 3SGJC 5DMJB 1CGVA 3BUIA 4Z3FA 1X5YA 4ZW8A 3ZX1A 4NHUB 4FYRA 3EZJB 1DQTA 2FX9L 4L8SC 4OTXL 1DBAH 4A2HA 4N1CA 5IP4A 1IMHC 3MRPB 1DDHB 2PO6B 4OFYA 1EHAA 2VXVH 2X4NB 2YAMA 1INDL 4PB0H 5IB1B 3WU2O 4OQTH 1EO8L 4DETA 3VQLA 1OB1A 3TURA 1N59B 4OVVA 3LNIA 1K6QL 2NW2A 2EDOA 5T5FA 5I1AB 3VWKB 4FG4A 3MKKA 2B4CH 1OWRM 1AGEB 1BECA 2MFNA 3ETBJ 1MWAH 4HX1A 1DVSA 5H35B 4OUOA 5GRJL 3SY0A 4KKAD 3NRQA 4A68A 1JFQH 3SQOH 1A7RH 4RMVA 3TBTA 5AVRB 2Y25A 4PB9L 1OY3B 2QHRL 1FNHA 4Q2ZA 1MIMH 1X5LA 1QSFE 4HS3B 1C16A 1OZUA 4LF3B 4PS4L 4XNZB 5GRUH 4KO7A 4QHUA 2QZ5A 1N18A 1ZGLM 1CBJA 4HUXB 3KNBA 1KGWA 2P45B 3BFOA 3W5NA 2A6KB 2OW7A 1PQZA 2PTTA 2XY1A 4MB5A 3N2JA 3ZE1F 1JPTL 3HMXA 1FO0A 4J3UA 4F9LA 1AS6A 2YGNA 3HS0A 3HZKA 4NZUL 3T4AB 3AC0A 1VENA 1F58L 4Y2DA 1OOWA 3INOA 4KO5A 3FONB 4Y9EA 1A1OA 2BOLA 2Z7UA 1DSFL 4A38A 2C3XA 4CC4C 3QYNA 4OZIB 4WNQA 1U8JA 1HZHH 2R2EA 2WSKA 4JFSA 3GS0A 2KLSA 2GSGA 4ABUA 4BELD 4LSSH 3QORD 3VDAA 4UNUA 1RUAH 1I9EA 3QBTB 4NQEB 2IQ9H 3RKDD 2EE6A 4FP8H 4WO4D 1X9UA 4AEIL 2VDMB 4J3OF 2DI7A 1AAJA 1EV2E 3AWFA 3ZHNA 1SMAA 1H5BA 4HCFA 3VGHA 3MLYH 4FHJA 1EO5A 4O5LH 3AABA 3NG5A 4LVNC 3PGCB 3D69A 3JV5A 2V0AA 1QP1A 4L4VE 2CUIA 5GGTH 4A2EA 4LSFA 4WHTB 3AITA 2GQHA 4DN3H 2PWGA 3D18B 4JY5H 2CWRA 4MKTA 4Z7AA 3V7AE 5D7IB 5B1JC 5D7LB 3GXTA 4J39A 1G1OA 1BQ5A 3RPKA 5GS1B 1YLBB 1AKJD 4G6FB 1PVHA 4R2GC 3P9MA 5KVEE 2GK0B 12E8L 1KLUB 1L0YA 1F11A 1IFRA 3CTTA 2Z4QA 3LXBA 1K8IB 3MUJA 4M4PA 4HPOL 5HYJD 2D7TL 3VXRB 3IDYC 2ZE0A 1T1YA 2EJ1A 2ODJA 2VL5A 5H37G 2OW6A 1PY9A 3NPSC 1WFOA 1FPTL 4M48L 5AOJA 1ZXKA 3WJJC 4ECNA 4NQXB 4EIZC 5IQ9B 4L18A 5E5RB 4NBXB 2ICEA 3AA1A 2EH8H 4DK6A 1QLEB 5C0AD 1B2WL 5HYSB 2EABA 3OC5A 1IZKA 1NCDH 1HXYA 4OH2A 5BV7C 3L2NA 1V7NL 1T80A 2P26A 1CD1A 1KIPA 4WO4A 2VDLB 1O0VA 1U8IA 1AO7D 4M93B 5BS0B 1HNGA 5JUEL 4WKXA 1OLZA 4X8CA 4BH8B 4LP5A 2A77H 4K7FB 2NY7H 3KS0J 4LLYA 2GY5A 3UAFA 1LDPL 4CTDA 2AKRB 4YFLI 1YY8A 1FDLL 1HL8A 5ID0B 2FH8A 4B97A 3EGXA 2JKLA 3SDXA 3QJHA 5FPIA 4Z3GA 2F53B 3BXNA 1S5HB 2EEBA 4XP1H 3QUML 4G1MA 3O4LB 4LLWB 4E9TA 5I15H 4HUMB 2ODIA 4M56A 4ZMPA 3OR6B 1A7OH 4G5ZL 5DA0B 4EAEA 3CNKA 4OF3A 2CHZA 3KEHA 4JFFB 1ILSA 2IFFH 5HYJA 4GSRA 4N0CD 3LZRA 2O61A 15C8H 4RNRA 3T8XB 4M3HA 1KN4L 1MI5B 1UYWH 3UC0L 3WNLA 4X7DC 4G8EB 3MXVH 3R18A 4HJTA 5DYFA 3HOEA 3OKNA 1WAAA 3V5HB 3RNKA 2J21A 4UTBL 2W0FA 4XCFL 5C0AA 3BFQG 4PLNC 5SWZE 3AG4B 3H8NA 3WY4A 3BWAB 3AQZA 2F08A 3NZ8A 3UTPD 1DEEB 1Y18A 2PYEB 3MJ9L 1DLHA 1AGDB 2JV6A 3BZ4B 3K2IA 1TTFA 2DQGH 1AO7A 1F6AA 2AAAA 4ZUWA 2P5EB 4Z9KB 1OSPH 4UTAL 1SBBA 4KI1A 4HJGB 3V8CA 4HFWB 1B4RA 1I4FB 2YFOA 3QNZA 1RP8A 1UKTA 3N1MC 3SDCC 5TE4H 4ZAKD 4R4FL 1E90A 4D9RE 2FQGA 4AL8L 3BVDB 4PBXA 1HWWA 1BW8A 4EI5C 1EZLA 1F4YH 4YR6A 2N3JA 5JOFB 2GG1A 5JPNC 3GLDA 3UGUA 1AQKL 2V5TA 5CP7B 2F1AA 3QHTC 4NKMB 3S37H 5EIQA 1S7RA 3ATDA 3OJDB 5AFAA 1WC7A 4OZIF 5CCHE 1KJ3L 1PD1A 2YUVA 3B3BA 1HZLA 4ODVH 3UCQA 1GOHA 1PLCA 1KBKA 1HEZA 3K4AA 4M7LT 4O2FB 5D7HA 4XNMB 1P7KA 3ZSTA 2PW1A 2C8NA 4KKBC 3UFIA 1DVQA 3N41B 3OMIB 5E08H 1G7IB 2KT6A 3MROB 1QOKA 5J5EA 1U6AL 2FBJL 3B6SA 4YSQA 2MHAB 1OGPA 5H8DA 4CNIA 1G6RA 4NUJB 2PKDA 1PLBA 2YQGA 4FNQA 1AXTL 5E1AA 3Q6FB 4YZFE 1DUZB 1KBBA 5ABDE 3S8GB 1GPOL 3F7VB 2LU5A 4MJ5B 1KJ2A 2G75A 2Y7OA 3DXAD 2R0WH 3B9AA 2IG2H 3ARDB 3DIFB 3GSVB 3GLZA 4LKCA 1AJ7L 2D3LA 1MCBA 2BVOB 3QG7H 2QVTA 3WNOA 2KS0A 3S4SG 5GZOD 1ONQA 1A6ZB 2V33A 4ZAKA 4DK5A 1PIFA 1GMEA 1UD4A 1VPOH 3QFDA 3SGDI 5CU9A 2FD6L 3DA0A 1JGDB 1DVFD 3FFCE 4RGMB 1YNLH 5AG9A 1LO0H 2UZIH 1PZCA 1DHKA 2NX5D 4FOMA 1NBYA 4PRNB 2J1XA 1J0ZA 3LNGA 4LDOB 4WJG3 5IHBA 2UWEA 5GRXG 3RTQA 3ARXA 5D1QD 5EIIG 3GRBA 1HINH 5D7SH 3K91A 4MHHG 4DVRH 1TZIB 1FSKC 1AS7A 3EJPA 4LSHA 5FKPA 2HRPL 3FTWA 1XB3A 3ML8A 3GC3A 4JK0D 4NUPA 3OSKA 1I3RA 1BYNA 1CF8H 5FWQA 3SBWA 1LK3L 2OM5A 1A0QH 3RVVC 2XIIA 3DGGA 1CDCA 4Y19E 3VX1A 4J8RA 3ABKB 4ZFFA 2IH3A 3DXAA 3RL1A 1F90L 1SM3L 1BVNP 4W4OC 2G2PA 2NYYD 3KPMA 4HC1A 4BDVB 4GKSB 5I1JL 1X3DA 5J06A 5I1HL 1J5HA 5SWQB 2NSXA 2D7PA 2H8PB 1VGKB 3AU1A 3QDJE 5BO1H 5G38A 5GZOA 5GRVL 4BZ1A 3GUTB 1WBXA 3WY1A 1TFHA 3IE9A 3OGCB 4GSDH 4WZ9A 1UD2A 2XWCA 3C8KA 4CBZA 4JFWA 5KBKA 5D7EA 2YRBA 5IJDC 1NANH 3LIZH 5IBUB 2BNRB 4X8XA 1Q9WA 5F1KC 1KPVB 4F7CB 3OLGA 2V2WA 4GW4A 2FH6A 4AJ0A 1MPFA 5AD0B 2FHBA 4DQOH 4LCYA 3DDGA 3FN0L 3MV9E 1NOLA 4M43H 5ALBL 3MAWA 3Q05A 4YGVB 5DK3A 4HISA 4AZUA 4PUBL 4ENZA 2XWZA 1AC6A 4LKXA 3QQDB 5D1QA 1KJMB 1A6TB 5DHYB 2Y36L 3VG0H 3UTOA 5CIPB 5F6IB 3JXAA 5KSBA 2IDTA 1FFRA 4PWHA 1RHFA 1OP5K 2A74B 3SD5A 4Z5RB 3U46B 1TVDA 2ICWB 4UWQB 3UTQA 2WKLA 1KZQA 4A37A 2E8ZA 3TJPA 1YC8A 3ESVF 4D94A 2WUCL 1ACYH 4GCQA 3IF1A 4G5AA 4TVPE 1ZANL 4GI8A 3QXWA 3T04D 2JMRA 1UH4A 3EADA 4IU3A 3W82A 1FZMB 4MXWH 4B41A 3SDYL 5TQ0L 5DL6A 4DZ8A 4XRCB 1GGCL 3STBA 2ITCA 2ZX5A 3Q2CA 2ZCLL 3HRPA 1NC4A 4YLBA 4M6OL 4YDVA 4OZIE 4N86A 1ERNA 2Y06L 1FV1A 5ALCL 2YEZB 2YLKA 1G0DA 1XR8A 2J6EL 2WLKA 4HK0A 2DH2A 2JKIS 1NCNA 4JFHD 4PREA 1OT4A 5EU3B 3S2CA 4OI9A 4IKJA 5IOPA 4OTXH 2ESVD 2FX9H 3V6OE 1SUHA 3HRZB 4LNVA 5E0QA 3RWIA 1O5DT 4PJXA 3D7PA 4LBAA 4KK6D 1QI4A 3FCBA 3MODL 2DLIA 1ZVSB 4GQRA 4JJ5A 2H2SC 2XHNA 1UWGH 4QPEA 1K6QH 3JT2A 5L2KD 4P48A 3C08H 4MB3A 1NL0L 4CDGC 2WY3B 5IMOB 4WJKB 3UBGA 5I16B 1OK0A 1S4IA 3DURA 3LPFA 5IMMB 5G4NA 1QRND 4OF6A 1DSYA 3BN3B 1H8NA 5E5UB 1S7VB 1U4EA 2HX8A 3UZEA 1P6WA 2DM2A 3JBG7 4CSSA 2FO8A 3EOBA 4PS4H 3TBSB 3WS3A 3BPLB 3EAKA 5LG1A 5CEZH 1NJ9B 1YEDB 2AGJL 3CFBB 3H4FA 3OX8B 4AGQA 1FQ9C 2AQQA 2JKTM 4PFEA 5DC0A 4PRAB 5IB4A 3L3DB 1T1XA 1E2VA 4WI0A 3KPRD 3REWA 1JGVH 1WICA 3ULVF 3AMKA 1P69B 2MPVA 1JZ6A 3U9PH 1DR9A 4YN3A 4WCYL 5D72L 1F58H 1RMFL 2YRPA 4KRPB 3S35L 3LNFA 2O6CA 3N85H 3AU0A 4NQVA 1UVQB 1ZT1A 4O02L 3BIKA 2B1OA 1DSFH 2BVPB 3K80A 2BPBA 3U4EB 4AOFA 2DB8A 3DV6A 5HHOB 1ZK9A 2P80D 4HS6B 4M00A 2L3BA 1SXBA 4P3DA 5FGCE 5JW3H 2ESVA 3DGCR 4OZGB 2MIZA 4O2CB 4CAGA 5BZDB 5B1AB 2W07A 3FO1B 4PWFA 3WNNA 4XVJL 4DW2L 4GXVL 1N5YL 5M7QA 5IF0A 1B2YA 1I7RB 2J12B 1PCSA 4WV1A 5I23A 1T22A 3TO4B 1CFTA 1GY1A 3EFOB 4AGNA 5L2KA 5C6WH 2JTDA 4F33A 2BNQD 3POQA 3CH1A 5J4MA 4OLYH 1QATA 4UYPA 1SYVA 5BUAA 1OHZA 3OKMB 1AR2A 4GBXC 4LDCA 2G3XA 2XN1A 3SZDA 1QRNA 2GEEA 3GSOB 3V5KB 2H3NA 4J7RA 1RJCA 4L4TD 5EZIH 2EDXA 4XNXH 4YK4B 3GMOA 3BAWA 3M88A 3QEUA 5KN5B 1E27B 3TYFB 3DVFA 1JGUL 1HNYA 2I7SA 4JDVB 4M3JA 4Y9GA 3SKNA 1AIFA 3NVQA 1I1FA 2LAAA 5C0BE 1FNEB 1P2CB 3MRLB 4HPOH 4P2CG 5G4MA 2APTA 4I13B 2Z1PA 4K73A 2D7TH 3QULB 3KPRA 4MNHA 2ZXWB 4LLVA 5EUOA 4GOSA 4FMFA 4FXKB 1LP9B 4PR5B 1FL3A 1F56A 3NSYA 4LOEA 5TDOA 1HYRC 2AZAA 3DUUB 1YN7A 2CIKB 1QYGH 5F8QC 1J8HE 5DUJA 2WXPA 3SCMB 3MBED 1E4KC 3VD0A 2FBOJ 3KR3L 5GGQL 3WI9A 2GTWA 5DZVA 3O9WB 3IFNH 4FQXC 3LK3B 3CVBA 2EECA 3H53A 4U6YA 1Q9KA 1H3TA 1KCBA 1V7NH 5I24A 2JB5H 3QR0A 4V33A 32C2A 3A47A 4XN8A 5JUEH 4IBUA 3LDBB 4RFNB 3WNPA 5KZCB 1U91A 4Z0XB 3BJ91 1PX8A 4H26A 5DT1L 1MCDA 5HHVL 1A3LL 2BNQA 5SWSA 4LOFA 1FDLH 3RVWC 2DV6A 2EIEA 1B9KA 4OCXL 1XH3B 3D85B 2WVPA 4MSWA 1GZPB 1PG7W 2VH5H 3FOLB 2JJUA 4PJDF 4PRHD 4FCHA 3AADB 1I8IB 3V0VA 2QV2A 4RSVA 4L4TA 1DUYA 5HD8C 1VLXA 2Y72A 1BREA 2AJYL 1M9SA 3KW8A 3MJ7A 2NNFA 1QSEB 3QUYD 3RNQA 1JDAA 2OXHB 3TEUA 4G5ZH 2F74B 3FC8A 5HDRA 2YPLB 3WJLA 2W5PA 5EEUA 3BWUC 1YNKH 4MCYB 1OM3H 2QR0A 2FT7A 4I2XB 4L2YA 1KN4H 3BDYH 4PWIA 3UC0H 4AQZA 4ZTOH 2ZF9A 3QRAA 2QKIA 1E9PB 1O6TA 4IRJB 2LT9A 4N90E 3VFOB 3MBEA 5FK9B 3UYRL 5C07E 5L88H 3N9GL 4UTBH 2ADIB 1J1XH 2WVVA 4MVBC 2P8LA 3L3JA 2AS5M 4P05A 1QAWA 3D4ZA 2MEJB 2LV4A 4XE5B 4KXBA 3MA9L 1U33A 3T08A 3MJ9H 4G6MH 3PHOA 4H88H 3D06A 5CCGE 1T4WA 3I75A 3OLDA 4GQ9L 3EJZD 3FTXA 1IGTA 3QUGA 3DYOA 1S9VB 4U1KB 5MENE 3R19A 3BAXA 3ULVE 4MTMA 2H2PC 1MH5A 4MXQC 1Z9SB 2ZG2A 5CSZA 1X5JA 2B77A 3HZVB 3AXIA 5C70A 1MVUB 3FULA 5KG9A 2I24N 3DVNA 4AL8H 4EZMA 4QRSA 4GMTH 1AZVA 3SODB 1RIHL 4YSSA 4PRHA 1B0GB 3WJMA 5C09D 5J6GA 1E40A 3GBMH 5E9AA 2A9NH 2GHZA 3LQAL 4JGJA 1N3NB 1RU9H 4M61A 4HIHA 3EKCA 3LPOA 4PRPE 3L3GB 4L9DA 3P9LA 1K4CA 3QUYA 4P5TD 4ERSL 1KJ3H 2OBGA 4M7ZC 4PY7B 1D2OA 2LR4A 2WP3T 4Y4KB 1ZLUH 4KY1H 5D4JA 5AWNL 3CIAA 3GTVA 3RX7A 1QABA 3BSZH 2NDFA 3D39D 1I7UB 2HXAA 2W59A 4L0ZA 3WUWG 2PF6A 4OCRL 5FYLH 5CBAB 2XDHA 3PCYA 4NM4L 5AYUL 3GRGA 4G7SB 4FULA 9PCYA 1R24A 2H0EA 2VLLB 2HTKD 3V2AR 1HOCB 5B7EA 3BIAX 5A3ID 1P5VA 3A5VA 3FPXA 4N1HB 1QO3B 4BIKA 1NA8A 1Z2KA 5E8DL 3S88H 2ZJSL 3X11A 1OANA 2CSPA 3BGMB 1AXTH 4AEHL 2CLZA 4TVPL 2V3DA 2ZF8A 4EKJA 4KV5F 4Y4HA 1H3PL 1J8RA 2VYRE 3DX7B 4OCSL 5F7HA 3MJ6A 1A1NB 3FBKA 4G1EA 4IMLB 1CDJA 2V2XA 4IS6B 4MXVF 2FWLB 3RUGA 1HS6A 5KVGH 5EE2A 3VFRB 1R9FA 3WTWA 4JZJC 1AJ7H 1JZJA 2BZCA 2Y2WA 3V8UA 2OR8A 2BH0A 2BP3A 3MRFA 1C12A 2X4RA 3ES6A 4TLKA 1T1ZB 4ZSOA 3ARBB 3LZFL 3SDAC 1PY4A 4GKNA 2DW5A 3K71A 1JDCA 4FZMA 2R7EA 3Q1SL 3R06B 5C09A 4POYA 3ILEA 5JDJA 4JFOB 3UAJD 4OQ1A 1FN4A 3AXLA 3ARUA 4P5TA 3WDIA 3BPNC 3LKNB 4P5KB 4UT6A 4GRLC 3GZOA 4NIKB 5EEXA 3GSRB 3D39A 2OMTA 4AYEC 1IEBB 2EXTA 3QUMB 3DYMA 4U7SA 1R46A 5ERWB 4IBVA 1AGFA 4NT6B 3W39A 3B2UC 2QLVB 5FGSA 5IM7A 1MEXL 2JJTA 1G9MC 2HRPH 2DQIL 2XRAL 4TQEH 1FNGA 3V4VA 1SOSA 4OFIA 1SLXA 5IGXH 2X4UB 4C00A 3QYCA 2O5NA 4AITA 1K8DA 3UPRB 4PJDE 4CMHB 5C9KA 3BRDA 5KANG 4PV1C 4I85A 1FCCA 4GI9A 5I75B 1YEIL 1X5MA 2PR9A 2QVMA 2ZP9A 3IS0X 4JQXC 4LLQB 1AQ8A 2Z93A 3QWNA 1CGSL 1F90H 5B7FA 1MNUL 1MWOA 1BD2B 1M05B 1CFBA 1MFCH 5TF0A 3U7WL 5C0NC 5I1HH 1SLWA 3ILPB 5AW1B 1SJEB 3ZTCC 2UZXB 4JRXE 1ZSHA 2IALA 2M26A 4XO4A 2PXYD 5ICZA 4IW4C 2LTQB 3KYOB 3PIQA 4ES8A 1DQLL 3MLTA 1KBPA 3BC9A 1XTMA 5AYQA 5JOPD 2QQLL 1R34A 1RY7B 2HG5A 1YPZF 4L1BA 2J71A 3D0LA 2R83A 1P84J 2Z31A 2BP5M 1KTJA 5D2NA 2PWDA 4DP2X 8FABA 1BFTA 3GIVB 4DGYL 3HI5H 1JK9B 5D71L 1JPSH 2BIPA 1OHQA 3M45A 4C4VB 2WW8A 2E7BA 5CP3A 3T0EB 3NCBB 4JGNA 5CZVL 2NXYD 3QCTL 3HC4H 1SJVA 3GXPA 2W60A 5DEGA 1TMCB 1Z9MA 3HOLA 4KKPA 3VI3F 4WI3A 1T0MA 2HFEB 1QQDA 3SGKA 2EAEA 2UV3A 4X9BA 3NFSL 5KVEH 1R33A 3RGVC 3SPJA 1I1AB 4A7UA 5DHDA 1BFOA 1CURA 1E43A 1MFMA 4H2CA 1PY0A 3HZMB 4L3ED 1G4RA 3HVDA 1J0IA 4ATTA 4FS0A 2AK1L 3TVMD 1LL1A 1WYJA 4LSUL 3ZDXB 4E41B 2X6VA 5FV1L 1QW9A 4S10A 4JBSA 4G7YL 2K0RA 3LCYA 2CBMA 3SDYH 1SUJA 3R4RA 1FF5A 2H6PB 1GGCH 2ZAIA 1BG9A 4I48A 3DJRA 1L3NA 2V17H 3S36H 2Y06H 4E1TA 4TOYH 1Y1UA 5HHOE 1OW0A 1X5GA 3EDJA 4JM4H 1X7TA 5EFIB 3O11B 3HNTL 5BUPA 4UQ9A 2PXYA 1HH9A 2AQ2A 2KI6A 4ZJ9A 1OV8A 3KJ6L 1VSCA 3B9KB 1LO2H 1L5GA 2BX5A 2WCGA 2BINA 3SKMB 1BAFL 1SHWA 2YSSA 1FCGA 5AFUK 2HWZL 3US9A 4GMSL 5E9DE 4ONFH 5JHDB 2DM7A 3HS9A 4K9JA 1I7ZA 1QEWB 2CBOA 4Y16B 3TIEB 2ATAA 1NBCA 3HG2A 1QFWL 1HHJB 1UEMA 1GS8A 1YAIA 2A6DA 2XVBA 4GIAA 4MXVE 4RMQA 3DPBB 2VDKL 4DFIA 3MV7B 1IC7L 5D4HA 3ZKMC 1LMKA 3FU0A 1B0IA 3SO3B 4GW1A 1J9TA 1QACA 3BUDA 1J1PH 3QH3B 4MYPA 1ROCA 5EOCJ 1I7TA 1JWSB 4KNTA 2YUWA 3KCPB 1DE4B 4NO3A 5FCUL 2YEVB 1JZ5A 3W9DA 4L3EA 3LRGA 2FEEI 3TVMA 1KT2B 4FKKA 4WCYH 5D72H 5T5NF 4HIJB 1AD9A 1BCIA 1JPGA 1ZSDA 3K7UA 1RMFH 4KAQH 3S35H 3RX5A 1BWMA 4ZPTB 1A6UL 3MACL 4J23A 1F1AA 1FRGL 3UYPB 3EYOA 4OJFH 4TSCL 2I9TA 4XPAL 2WD0A 4KI5D 2RJMA 4N5ED 4N6RA 4BM7A 4BGLA 2WXMA 4EN3C 2WVTA 3HWBA 2V2TA 5CM1A 4LSDA 1CR9L 3HR5A 3T8MA 1GTFA 4WSJA 4JFYA 4HJ1A 2R2HB 2FHFA 2XZCH 3LAFA 4FQLL 3VWJC 4RWYL 5I1IL 1IAKA 2Q2LA 3JWDC 2OMUB 3QDAA 1XMEB 2DM3A 3MI6A 4KZCA 3LPWA 4KJPC 4YFLF 2BZ7A 5DC9B 4ACPA 1N5YH 1IAMA 4E1SA 5HJ3B 5BRQA 2Y5EA 3QPXL 3RI5F 5MEOB 4X6BB 3WNKA 1SEQL 1X4YA 3I84A 4LSVH 3VD7A 3BVNA 1TQBC 4X4YA 2R69A 3QJFA 1T4KA 3CFNA 4J2QA 1A9BB 1HI6B 2VLKE 4G7RB 5EN2B 3V9CA 4E9LA 1DFBL 4P2OD 4JO5A 3P4LA 4E42B 1DL7H 1NC2B 4WWPA 5B5EO 4JO1H 2O6PA 4XH2B 1X5IA 5A2JH 1MY5A 1T20B 4QRUB 1HAUA 2MJWA 3UADA 3TN0D 5DTFB 3MXWH 1JGUH 1QSEE 1S7TB 1MCIA 4I18C 3IDIB 3RYMA 1XR9A 5F96L 1TQCB 3QIUD 3IDJA 1MJ8H 4NQDD 3U36A 2YN3A 4AIEA 2EDTA 3ZVVA 3H42L 3UJIL 1LEGB 1YPZE 4FQ1H 2BCMA 2XZAL 4PGJA 3WTUA 1M71B 2Y07L 5EZOL 3U1PA 2C3HA 1UEYA 5JQ6H 2Z91A 3M8OL 5K9OA 1QBAA 4PGEB 2HUEA 3LH8A 3D52A 4ODUA 2VDRH 2ZG1A 5KYXA 3QJVB 3BVUA 2VXTL 3V0WH 4UOQA 3L4CA 2AMUA 2XLLA 3VI3E 4G42B 1OP5H 3TU6A 3GMNA 5TFSL 2XPYA 5SV4A 3O2DL 1UACL 3ARQA 2GTZA 2VISB 2XUWA 4KKRA 4U6VH 5D9SA 5IB3A 4UQDA 4BH7B 1Z3RA 1EUTA 2JQZA 4WY7L 2CHDA 2LFEA 3QJXA 1H0DA 5BOJA 3QI9C 5JO5B 3TBVA 3H9SE 2C26A 2CBPA 2VWEC 3OKOB 2YQBA 3VUAA 3GB7B 4HUUA 2DWSA 1ACXA 1XQ4A 2EICA 4WI5A 1T2QL 2OFQA 1MRCH 1A3LH 5HHVH 5I28A 3OKLB 3HLKA 4P2OA 4MCZB 1E4HA 2NY2B 3BKYH 2IWVA 2FGZA 2VLJD 3F5WA 4LNRA 5C0EA 1UG9A 4FXGB 4JCMA 1TUPA 1MFUA 2O5YL 2R1YB 3MCKB 3KJ4B 1T03L 3CPUA 2AJYH 3GHEL 4NHCL 4JRFA 5B22A 4UIKH 5C0IA 3SDDC 1BF5A 3QG6B 4ZS6D 5CJ5A 4G80B 4LP4A 2GIYA 3EYUH 3QIUA 4QTIH 4NQDA 3NJKA 5CKGA 1QR1A 1RURH 3F7YA 4TLTA 4G6JL 2AXHA 3CFCH 2KL6A 5PAZA 2ZWNA 4Q9QH 3QRCA 4AKRB 4NC1E 4P59H 3QAZC 4OZHA 3UYRH 4F8NA 1MCSA 3L4YA 4EF3A 3GBDA 5C7XL 1AZBA 3O6KH 1TKWA 1JG9A 1L6ZA 1QG3A 4JDTH 3C6SB 3CZNA 3MA9H 4WK2B 3AA7B 3ZQWA 1O7SA 4O02B 5SX4H 4WGWB 1ZE3H 1ASQA 3Q6GL 3MV8D 3T65A 3WXWL 4JEGB 4MA7L 1VFMA 2G60L 4QIRA 1ZGLP 1FVDA 3RX9A 1K4DA 1ESOA 3D0AA 1WBZA 4X7SH 4E9XA 4M8VA 2H1XA 5DEJA 1CE6B 2FSDA 4Z7VB 4YDLB 1WO2A 2XNAA 3GXUB 5DS1A 3UDWA 5LWYL 3NFNB 2Q6WB 4DSYA 1PLAA 5F9JA 4HJEA 2DIJA 3GI8L 2BDNL 3FQRB 5DQDL 1Z0MA 3ESPA 3U6RA 4U1NB 4ELKB 5KS9B 3V0FA 4KTEL 2VLJA 4YAQA 2J1WA 1YEKH 3O3DB 3ULSA 2ZNXA 1G9EA 1UCBL 1UWEH 4P5SA 1B0RB 3J7HA 4AGLA 2Z4TA 1IGCH 4DUVA 1A64A 3BZEA 3LD8C 4X83A 4ONHA 2IH9A 1NWPA 5AWNH 1JYVA 1JNLH 3U9UB 4W9LC 5AB2A 4LGSB 1AHWA 3QCVH 4UB6O 1FIEA 2GC7C 1ZDQA 3FQ1A 3OKYA 2OMWA 4NM4H 5ID1B 3MFFA 4F7PA 5CBEA 5EBWA 2VMJA 4QHPA 1A9EB 1S46A 1M9WA 1OGAB 3VI4A 3EBAA 3LJ3A 4I4WA 2ZJSH 5E8DH 2ITDA 2OSXA 4ZMOA 3HHRB 4KK5C 4MJ2A 4A6YL 2FJGA 4CU8A 3PS6A 4TVPH 3V95A 5I17A 1E4XL 1MRDL 1H3PH 2PABA 4OCSH 3QUZC 5ESQA 3MV8A 1B4LA 1Y0LA 2QPEB 3JSSA 2CRMA 4UQAA 2V8LA 3QIBC 4WW2A 2XZQH 2JIXD 5ABAA 3QZWG 3CSYB 3V4UH 1GAFH 4CJ0A 1BZEA 1D5ZA 1QFHA 1DVZA 1FFNA 1JNHB 2DWEB 2NY0B 1G7PA 1UASA 1JGEB 4UM8B 5DO2C 3IXAB 2JNZA 1JAEA 3CHOA 3L13A 5EC2A 2LABA 4PJ8D 3HEIB 2HRHA 4NUGL 1E9QA 2HTLD 3WFDH 1Q38A 3MOBL 3K6OA 5F9WC 4W9JC 3V5DB 2CLVB 3F7KA 4UILL 1JWUB 2OMYA 3VAEA 3FO2A 1ORSB 3O6LH 3DGDA 4Y4FD 4JQVA 1MAKA 3O2WH 5EZPA 5BV7L 3BH9A 4NQCB 3AG1B 4ISVA 4JNXA 4YBLB 2VMCA 4IGBD 4BFBD 2APVA 1ECZA 5HDBF 3SY9A 2TSAA 1QSFD 4PI2A 4UZUA 5J11C 3D51A 1KIRB 2Z92B 3MBWA 3ZY7A 3PGSA 2XRAH 4WEEA 1ZLVH 3QQ4A 1PG7X 2V8MA 2WWNA 2XG4B 4N0UA 1SVBA 4OB5L 3L7EB 1DBBL 4PP2A 3WKNA 5GZNC 4QMEA 3WIFB 4H8HA 1OAUH 5ISZE 2JJSC 4K7PX 1XL4A 1YEIH 1NIAA 5F7KC 5JZ7D 1HSAA 5E99L 1JL8A 1CGSH 2Z0BA 3C6LD 1VCBC 5CSBA 3DVGA 2JIXA 1ET8A 4MWFA 3EOTH 5DUBA 3U7WH 5DD0L 5EU6D 1LILA 5IFJA 5HPMA 3ARWA 1UGKA 3HS0C 4F9LC 4NBYB 1AGCA 2X3BA 3IJ8A 1JK8A 3B2PA 3BGAA 4Y2DC 3B3IB 2IOIA 2YC1B 3QJZA 4TULL 1HL9A 3APMA 1PYWB 1DQLH 4YUEL 1ZHNB 4PJ8A 4K9EC 2EE2A 5L8KB 1G7JA 4DKAA 5EZJB 3VD2A 3WY3A 4ZX4A 4BZYA 1FNLA 3RDJA 3RI5K 4ZMQA 2NT1A 2OTUA 3MRKA 3Q9QA 4DGYH 1YUHB 4L4VD 1CFSB 2R4LA 4RJWA 4Y4FA 3TM6A 1J0HA 2ZNWA 4J4PD 4L37A 5LXVA 1H5BC 4OLEA 2P49B 3KPOA 3ZDZF 5D1XB 3VXNB 4EXKA 5C0GB 4IGBA 3GMQA 2NNAA 2D31B 5T1KB 4Y2NA 1EHNA 1QSFA 1RFDL 4FCAA 2YD7A 3T6VA 4RA3A 2J8UF 2R4RH 4EUPA 4Z95L 4JFQB 2OYKA 4MBOA 2IXQA 4KKAC 1PLGH 2OA9A 3MNVA 3L1OL 2MOQA 1YZZA 2GUYA 1NFIA 4JPSA 3AA6B 1R5WA 4X8JA 4G7YH 2V7NB 3PAVA 5KS9F 3NFPB 3OXSA 3FYXA 4JO2L 3C6LA 1GYCA 4OI7A 2OL3A 2DMCA 5AOZA 1OCWL 1WLHA 4PGDB 1P4UA 3NRFA 4FNUA 2QGEA 4WWKB 5EU6A 4PQXA 1QNZH 3QXTA 1C5DA 2JQYA 4RRPA 2ZWZA 3CFKB 4N59A 2YA1A 3LMJH 3LEXB 4BCXA 2Q3ZA 1MJ7L 1K72A 1WV7T 1D5MA 2O4EA 3KJ6H 1W80A 2E75C 3T3MB 3ZDYB 2V9RA 4AKQA 2WBJB 2QSCH 2ZOUA 2J5LC 1BAFH 2EYSA 4D0BB 3QORC 5ICYB 4UI2A 3SJVE 2ZXDA 3HPLB 3IPEA 3A2SX 2CR0A 3FZUD 4OJEH 2NR6D 4K8RD 3FPYA 1XSKA 4BE5A 4G72B 4BFOA 1MCLA 4HWBA 2GJZB 2N7SA 3WFCH 3FW6A 4GO9A 4QRRD 3QWQB 4J4PA 3NQIA 2LVCA 2E86A 5SX5K 4XPTL 5I66B 3JWOC 4MNQB 4FNPA 1MAMH 4BQ9A 3STZB 4NS0A 3S3CB 1HH6A 1Z66A 4FXTA 4EO5A 4RBPH 4PVBA 5DMYA 1N64L 4ZZKA 3PF1A 3IKCA 4QKXB 2ISDA 3L95A 5BRZB 1PNDA 4FLHA 1WGVA 1R5IB 3X1GA 3P0YL 2OTWB 1A7PH 2AQPA 4K3DL 1PHOA 3O0EA 2DDQL 4MMZA 5I2IA 2WQWA 4RFOL 2R59A 1RZGB 4R4ND 4ZX5A 4UT7H 4I89A 1IAIM 4G43A 2EO9A 1TZGL 3ARED 4GCSA 3SQBA 3TTSA 4KNQA 2N0KA 1CLYL 1ITCA 3BISA 3VQMA 2F61A 5IMLB 1WIOA 3CDGA 2ZOOA 5FVNA 3O4OC 2OJ1A 3GM0A 4JY4A 1TIUA 1E6JL 3O6MH 5IK3A 5KSUB 1S9XA 3JQOB 1WGOA 1CICB 1CR9H 3F62A 3H9HB 3Q13A 3TBWB 4Q0XL 4GAYB 5HDBE 3S5LB 2Y9RT 1HSBB 4PJBB 5B4MD 5KVFL 4D3CL 4RWYH 4FQLH 1SXSA 3D25B 1NAMB 4PJFB 5IEHA 4WUUE 2HLAB 2NQ3A 4B0MB 4HUCA 1U8QA 2VDNH 3TT1H 3TXAA 4X5XA 5BQDA 4GG6F 1NFKA 4HP5A 1W72A 4ZO8A 3FB6B 2WLIB 1L3WA 2K3HA 3LKQA 2NR6A 5IHZA 2ZXCA 1HHGB 1URLA 1DFBH 2Z0UA 4F20A 1SZNA 1O5PA 4K71B 3CFEB 4NOFA 5D7KE 4D9RD 5I8CB 1U3HB 4LPTA 4APXA 4QRRA 2HJFB 4MAYB 2G9KA 5DYOA 5HHMB 1MFBH 4N26A 1TG8A 1FFOB 3ZW3A 2BFVL 3CFDA 4LARH 4TSAH 2R1WA 3IDMB 1BXXA 4GUQA 3ZJAA 1KYOK 2QMKA 3MV01 2KQMA 4E5XB 3BN9D 5EDSA 4AM0B 2XQYK 3ATAA 3T20A 1GHFL 4W1TA 4G8GD 3UTTA 4J3OD 1MFDL 3GXNA 3UTZA 1MUJB 3HI1A 3UJIH 4F91B 1GW0A 2XZAH 3BVXA 1PZUB 4AVHA 1JXJA 2Y07H 1QHQA 1UM6H 2GITB 4RQQA 5EZOH 3OPZH 1QFUL 2I69A 2IPUG 2IPTL 3M8OH 2NCEA 2XCMC 4H1LH 4KPHH 1UM4L 1WIPA 2EUVA 1E4WH 2RACA 3AAZB 2VXTH 5AOKA 1X5AA