2YPVA

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
242
structure length
229
Chain Sequence
GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQILITLESGEFQVYKQSHSALTAFQTEQIMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
total genus 57
structure length 229
sequence length 242
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2ypvA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ypvA01
4QQ1A 5EE2A 4O3XB 4Z3TA 1YS5A 4O3YA 4AYMC 3VE1A 4AYID 5T5FA 2LFUA 4O3ZA 4O4UA 4AYDC 2W80C 4O4XA 4O49A 3PQSA 4O3WA 2W81C 2YPVA 3KVDD 4AYEC 3V8UA 4U9CA 3HOLA 3UAQA 3VE2A 2Y7SA 3HOEA 2KDYA 4AYNA 2KC0A 3PQUA
chains in the Genus database with same CATH superfamily
1J8HD 2CG9X 3KLDA 1HL9A 4LSSH 3LH8A 4G9FD 2V0AA 2IMNA 3VXRE 3U48A 3LQAL 5FECA 3CQQA 3PRZA 4CDGC 2EEDA 4MQTB 4I3RL 4LPWA 1J9TA 2OMTB 2X4OB 5DA4A 4NXKA 3E8UH 4APQA 3QC6X 1EV2E 1OCWH 4GSDH 4HFWA 1DUYA 5CJQH 4B41A 1JZ7A 1HHIB 1HEZA 3MLPA 3ECVA 5J06A 1E4HA 2AAVA 3FT4B 4A2MA 3SODB 5HHXL 5DMGD 2NXZC 2Q87A 1RFDL 2WLYA 1T03L 4Z3GA 5MERB 4D9LL 1JBJA 3TGXA 4MBOA 2DQJH 1IARB 4BHUA 2H1XA 3MREA 3P2DA 2AV7B 2DJ4A 1ORMA 4E9VA 1IM9B 4YSEA 1A7BA 1GC1L 1LP9F 3ULVD 1JNLH 1OPFA 4ZNCD 5TTRA 3FUDA 4NJAH 2PR9A 3QDJD 3MOQA 4P2RA 1XL4A 3WEOA 4OTXH 1S7RB 2ZXEB 4G1EB 3QORB 3AM8C 1QWUA 3K46A 1DJGA 2ITDB 2Z93B 3O9WA 1PMYA 4UTBL 4V1DE 1T1XA 2VZSA 3FFDA 2O1AA 3ECBA 3VFNA 4ZQTA 1DEEB 1NFDB 2H41A 5E5LA 2R23B 1CVRA 2BP0B 3CZKA 4FQXC 3D25A 3HJ0A 4LLVA 5EO1A 5E9AA 1BM7A 5A6MA 1ZDQA 3UGEA 4BSVB 1YEDB 5FUOL 3UZVB 1JHKH 4ZS7L 4Z0XB 6CGTA 4Z7NE 3PABA 2EXWC 4AL8L 1Y0LB 5D7IA 1QJ9A 3RNKA 2ADIB 5I5MA 5CD3A 2ZUVA 4PJDE 3QIUC 4HXAH 3GPEA 3HS0A 5FUZH 4AZLA 4XXDB 4RVBA 5EORL 1KN4L 3R1GL 3N91A 4P3CL 1TR7A 5L88L 2UWEB 4GSUA 4Z3JA 2NY2D 4R7LA 4HIEB 4Z3EA 3K1KC 2GT9A 2OR9H 3IDMB 1KB5B 1NOFA 3BQUB 3EFDH 3AAEB 1ZT4A 5C09D 4K7PL 3FO0H 5A2JH 3ULVH 3TBCA 1QFPA 4Z7WB 1KPUA 1UG9A 5L0QC 4XX1E 4N2IA 1X5LA 2A99A 3DUUB 4GW1A 4MD0B 1UTDA 3LZFH 1X7TA 2BDNH 2QKIA 3PORA 5DRXA 2K4AA 4E41D 3KG5A 5E5MA 6FABH 5EZJA 4YDLC 4P2OA 4K5MA 5B8CC 4UINH 5C0NC 4XCFL 1SJXA 3IDNB 1NC2D 3A3YB 1NSNH 2YMTA 4ISVB 2DQCL 1HXUA 1ZK9A 5C0FB 1I4FB 2I5YH 4NZTH 2AGJL 1CGYA 1N70A 43C9B 1KZQA 1T04B 1PZCA 2YC1A 1G7IB 3O4LE 1D2OA 1ZVSB 2H6PA 5DC0A 2MQGA 5C08D 2I25N 3L6FB 3VJ6A 5GGQH 3OKMA 2JKLA 4L18A 5JW5B 4Q52A 3M46A 5EO0A 5F97E 3R8BB 4P4KA 5I8OH 4GQPH 4XVJH 5DUBB 4TVPE 3QUKA 3ZMRA 4HOXA 2FGRA 4GRLD 2D31B 2W59A 1BYPA 2XFXA 4FTDA 3VGBA 5J6HA 2PXYA 1SJVA 2BHFA 2IDTA 3UYRL 3VWKA 3SYCA 4F9PC 1RHHB 1UGKA 1KXHA 2DQUH 3TBYB 1KTRL 3LVTA 1Y07A 1A9VA 4JPSA 2F8OA 4X5LA 5DHVB 1PD6A 3L3JB 1N5AA 1WHOA 2P8PA 3CDGA 3SKMA 2WXOA 3THMH 5JORA 5C0CD 5IB2B 2EE9A 4QRRE 3PU7A 5D71L 1NANI 2HB0A 3C6LC 1G1YA 4KDTA 1URZA 4DAGH 4LKXB 5DF0A 4ZDHA 1JYNA 1GS7A 2Y6TE 2WO4A 2WYZA 4MMYB 1ACZA 1PG7X 4I0PA 3INUH 3BP4A 1X9UA 4N25A 3EJYD 1NWOA 5CGYD 2DICA 5T3ZE 3CN3A 2HT4C 4PCYA 2PORA 5F0PB 1MM4A 4M4PA 2Y07L 4YZFF 3VY9X 4S1QH 1Q9LA 4DIXA 3L4ZA 3AQZA 3NAAL 4HJJL 4GKSA 5HHOB 1IAII 2CBPA 1KENH 4HH9A 1MCIA 1B0RA 1HXYB 3VE0A 4QR7A 3PP3K 4X5XA 1B4TA 3UJJH 32C2B 2VN7A 4JO4H 1YEHH 2BY2A 3MBEA 4LT7A 1BEXA 3MLWH 4YFLI 1KXTB 3QWOB 2VL5B 5J12C 4M6MH 4JGUA 3L08A 2ORBH 1XH3B 1TLMA 5GPRA 5GZOA 2X70A 2QADB 5E99H 3BN9C 3US9A 1IGCH 3O11A 1LEKA 2HPTA 1A02N 1X4ZA 1R24A 4HFUH 2M1KA 5DK0B 4HCIA 1EZLA 4R83A 2YD6A 2Y5QA 3N42B 2ZOOA 3HPLB 3Q2VA 5FKPA 4AUUA 4G1MA 2EVFA 5D4IA 1LWRA 2G0LA 2UZYA 3ARGC 5FM8A 4GG6E 3F12B 1TOXA 3GLZA 5F6HI 4Y5VB 1VGEL 4WCYH 1MWAB 1QPKA 3QFGA 3BYTA 4AMXA 3WAKA 4PRPA 3NFSH 3BHBB 3VXQA 3HNVH 2WBXA 2VN5A 3RWGB 3S5LA 3RUGE 1D6VH 1IBFA 1DBKL 1WAAA 4PJEE 4B96A 3NVQA 4BFKA 4M8VA 4L1DA 4NN5B 4IBZA 1UWXK 3O3DA 4FXKC 3MCLH 1LD9A 3RGVA 4PR5A 4YHMH 4TN9A 4P4RA 1ZXQA 4LLMA 2FHCA 3GM0A 1JZEA 1NFKA 2ZXWB 4YIQB 4HBCL 3HI6L 1XGYL 2FSDA 4PI0A 2P5WB 1N67A 1KYOJ 4B61A 4IDJH 3CIQA 3D8MA 2N7SA 1NPJA 1P7HL 3LRSA 4TTGA 4HAGA 3UZEA 5KSBB 3FZUC 2BMKB 2IDCA 4BDVB 2NY3C 3BUYA 3HMXL 4UNIA 3TT1L 3L7EB 1FZOA 3MRCA 5DUPH 5TK4A 2BOBA 1HNFA 1TZIB 2MH4A 3EOYG 5D70H 4P0DA 1TUPA 1MFMA 1RU9L 2PYEE 1J87A 1OAYH 1DN0B 3LZRA 3V5KB 4LPCA 4PRBB 2GITB 5ADOL 3L95A 4YHNA 5DJ0A 1HCYA 4MB1A 3T1FA 1DLFL 3D4CA 1IEHA 3EYVB 4Z0BH 4L3ED 2BHZA 3IJ9A 5EZPA 2X0VA 2ZJSH 4OB5H 2VLLA 5IJBC 4ZMAT 4E9XA 4C54A 1QTSA 4CMHB 1Z66A 5FM4A 5GRWA 4OD3H 1P5UC 2OXHA 3IJEA 3QO1B 4Q6YA 3WIIH 4OCMC 3KPOB 3T6VA 3U9UB 1AGEA 4CBPA 2EEFA 6PRNA 1ZHKA 5GGTL 5GS0L 1XGUA 3KYOB 1XD1A 3V6ZA 4A6YB 4YFDB 2ZWSA 1S6NA 3R19A 4E41A 1U2HA 4LARL 3VXSD 5E1QA 1U92A 2VXTH 2ICWA 4PRAA 1J8KA 5KYUA 1NC2A 4DO6A 4U1IB 5LXVA 1UD2A 2WVVA 2YD9A 3MACH 3JTSA 3NPZB 3FRPB 3V7MA 3DGGB 4KAQL 1A47A 3NQKA 4UI2A 2PCXA 4D0CA 3B9AA 5KANG 3V9EA 3VI4E 1RZ7H 3BSZH 4JPVH 4XPGL 4MA7L 4AZ8A 5BQ7B 1ONQA 2QPUA 3IB4A 4N4YB 4KJWC 4NNPL 1HC1A 3CFKA 4M62H 3AM8A 3O2VH 3PAVA 3EOTL 3JWDL 4U31A 4U6HB 4HKBA 3P9LB 1EJFA 1K4CB 4OGXL 1F4YL 1D5ZB 1E5CA 1WBZB 4ODWB 4FQXA 3K2MC 3M8OL 4F5CA 5IIEB 2CGRH 3PHQA 2TRHA 2CMRL 2DJMA 4K3JH 3FTUA 1GY2A 5EB9A 1HCVA 3ARFB 1TZHA 4WWKD 4NO0D 4P9HL 2V5TA 1J1PL 3V2AR 1G0XA 1ZV5A 3U30B 2C3WA 4S2SA 3GMMA 2IADA 3T77A 4BUMX 3IMVA 4ZUUB 3C6SB 2NY3D 3FO1B 3LHPL 1PLGH 2V17L 3HMWH 3QIUA 5H35A 1LEIA 4PG2C 3WNOA 2ZYHA 2A38A 5TE6L 1DBAH 5DJ8B 3TZVB 1J5DA 4GINA 2A6DB 3S3SA 1FNSL 2J21A 5IM7A 5D1ZB 2NY6D 3FAXA 3QDHA 4HEPG 3HPJB 5FW7A 2ODJA 3FQXB 2DF3A 4TUOA 1DN2A 1BEYL 3NJHA 4JDZA 3QW9A 4AXWB 5ALBH 2K8MA 2DM4A 3MV9E 1I8IA 3FO9A 1A7QH 2G4EA 4XVSL 4G76A 4PU2A 3ROOA 5GGUB 4YFEA 3O81A 3IXTA 5DURB 4UTAH 3Q44A 1JNNL 4KRLB 2J71A 3F5WA 3I9GH 5DRZB 1WZKA 1X9QA 4Z7QF 1YLBB 1PVHA 4JJ5B 5AKSA 1AKJB 5F9JB 3OXSA 4IRJC 5B8CA 5EUOE 4QXTB 3DK0A 4H2AA 1I7TA 2XRAH 3MMEB 4D3CL 4N6RA 1PZ5B 4XZUA 1EUTA 2PWHA 4ZS6D 1DSFH 2BJML 4Y8DC 2YD5A 3ALWA 3X13B 3QDGE 1XD0A 3N44B 3W81A 2JVUA 2L7UA 4M48H 1P7QA 3EW3B 3RZCC 2J20A 4H8HA 3NZ8B 3ISYA 1BBDL 2B20A 1KCSL 4JANA 2VH5L 4QI3A 4HC1L 2ZF8A 3Q1SL 1MRCL 3NBNA 1ZHYA 4QHPA 1MEXH 3VXRD 5FO7A 3NCEB 1YQVL 4BZ2H 4DZ8B 2VR7A 1CZ8H 5GSRB 4WUKL 2MCMA 3EXLA 4H8UA 1BIIA 1TJHH 3CBRA 3OQ3B 4PCKA 1IAMA 2ED8A 1ETZA 3B34A 4O4YH 3GJEA 3CHRA 2EIZA 5ECJE 5HDQH 1YG9A 2JNZA 5DFWH 1KG0B 3QRGH 4M8QA 3HC4L 4RMSA 4PGDA 4KZDH 4QO1A 4EVNB 2WQSA 3LPGA 5JIHA 3KJ4B 3ZR6A 3O2WH 4ABUA 5KSAB 2R7EA 3KR3L 2OJEB 3MUGA 4IBYA 4JO2H 4JY5H 5DI8A 3L3IB 35C8H 1T0MB 4Z18A 2RBLA 1OTUD 5INCA 3BWUF 1DBML 4NP4L 3MUHL 2NUPA 5AYUH 4AYDC 1XCQB 4XGZA 4QRPB 1BCIA 2A9CA 3RI5K 3X12B 3C6LA 4QAWA 3BIKA 1C12A 5F1NB 4HKZB 4JM0A 4LOUC 3S36X 4YDVA 2BVQB 4JG9A 3BSZA 1IUZA 5MP6L 2YA1A 4W9ZA 4OM0H 3SKJL 4KRAA 1N7MH 5I1JL 2C9RA 4YBLB 2PPDA 1KPRA 1GSMA 3ASWA 1DQKA 1QI3A 4AJ0A 2XV0A 3DX0A 3FFCB 2FE0A 4WLCA 3B9DA 4NRZA 1PG7H 4FZMA 4RMRA 2XI9A 5HYSG 2R0LL 3FQUB 4JL2A 2BNQA 5DYFA 2K9FB 3LKOB 5CSZB 3UTZA 1V3JA 1ZV2A 2ZD0A 5GRVL 2ICEC 4H8WC 3V0DA 1HH6B 5HVGB 5KBMA 2X7LA 5I1IL 5HDBE 1ZS2A 4AIXA 3VE2A 3ZE0E 3QGVA 3RVVC 4MB5A 4HWZA 1E6JH 4AVIA 5GS3A 3H8NA 2YXWA 5E1AB 1L3WA 3UPRB 1VFAA 3AAAB 5IOPB 5KTEH 5JIIA 3TF4A 4ODVH 3VXSA 4MA1C 4DTGL 3ARGA 1VERA 4JFFE 1M9WA 1BYNA 2E9JA 2ZG3A 2Y6SD 4NQQA 5T5NF 5KBLA 1OO2A 2VN6A 5IBUB 4AQZA 1HINH 4R8WL 1N6VA 4ZAKB 2DIBA 4KITB 1SOKA 1XO8A 2E46A 4IBUA 4OJDH 1OWWA 4ZBJA 3FQ2A 4K4KA 4M7JL 3BKCL 1KTKE 4UTAA 2VKWA 3OLIA 1G9NL 3BIAX 3BO8A 3E1F1 3AWFA 1NAMB 3AQDA 4YX2L 5INDA 5D4HA 4FXKA 1IQWL 4LOEA 1R3JA 2FSEB 2NDGA 1A1OB 4XC1H 1Z32X 4PRNB 5FO2A 4A38A 3T65B 3QPKA 3UFIA 2EXSA 3ARXA 2VXSH 3IF1A 3SGDI 2X2HA 2W07B 3EGSA 4BEIA 5E6IC 1CI3M 1JDAA 4X4XA 2V2TA 4CVXA 4NO0A 2NY4B 1G7JB 4QRAA 5KZCD 3D7PA 1UOKA 3O4LD 4A7VA 2BRRL 1AZUA 3PWPD 4R2GB 4P23D 4LOUD 4HUWA 4IQHA 1BQLL 3PNWB 3G3LA 3AS2A 3KLSA 4I9WE 4KV5E 4UZGA 2OLDA 5E6UB 3OHMB 4LCCB 4GS7B 5IVXB 2D9QB 1EPFA 4JBSA 4J3BA 2RCSH 4BZ2A 3FT2B 1I3GL 2AK4A 2FLRT 1YUHB 3BGMA 4Z23A 4M4RA 3CV5A 2CO2A 3PWJA 1MNUH 4BM7A 3T2PA 2AKRA 1H5BB 4FQ2L 4HU2A 4FTVD 3KL3A 1ZLUK 5FFLA 2ERJB 2BY3A 1AGBB 1MPAL 1SLUA 4M1CC 4ONFL 5BW7C 4OUUB 4RLDA 1OXYA 4XCNA 3AG2B 2R4PA 3RNQB 1U42A 2EIDA 3FCTB 1P5UA 5B7EA 3K71A 1FL6B 4HULB 1U8KB 7PRNA 5K59E 2G3MA 1AR1C 4WF7A 3EO1B 3JT0A 3VM7A 3GO1L 1BQ5A 1N64L 3ZPDA 5ABAA 2FGWL 1K4DA 4QHMA 3DA3A 1SOSA 4HIIB 3CFBA 3FW6A 4AGLA 1BJMA 1SN2A 3SOBL 1I3RB 3IDXH 4KHTH 4N8VG 4R97C 4XVTL 3PV6A 5L9DH 2MPAH 3EJZC 2XOTA 2B1AH 5D8JH 5FGRA 2XZAH 3N0PB 1PD1A 2CLRA 1MLBA 5KVGL 3U0PB 4CC1A 2VDNB 3VXTB 3BESR 4LLYB 3L9RA 1M7DA 5LAXA 5T5FL 4KKLC 5KG9A 1J5OH 3VXRA 5B21A 1KJ2H 5IGXL 5AZUA 1F3DH 3C09B 2OK0L 4TVPH 3HG0A 4JRFA 4KQ3H 5FR3A 3L1EA 3IE9A 3NCYP 4R4FH 4ELKA 1CGSH 4FZLA 3QI9B 2APFA 5B39B 4MD4A 4H8WH 4L1TA 3VCLA 1HWWA 3K6NA 1QLEH 2HX8A 2KL6A 1FGNL 3TO4B 4C4KO 5IQ9A 1BQHG 3D3VE 4MJ4A 2P47B 2VDKB 2VABB 4PG2A 4A7UA 1AG6A 3IGLA 3ATEA 4Q0XH 2JB6B 2O5YL 4U3SB 2DPKA 1S2EA 1ZXKA 1A9EA 2CO7B 4P59H 3TEXA 2P1YA 4DFHA 4LCVA 2V3FA 3VUAA 4U3CA 2AFNA 2XY1A 3D12B 4LLQB 5T3ZH 2EYTA 4GI8A 3IAGC 2C26A 1CE1H 4V1DA 3VFRB 2FYVA 1N8ZA 2IGFL 3QNXB 3R18A 2XE1A 1MJUL 1UD4A 4L4VD 3LK3A 4OLZL 1G7PA 2FJHB 4FG0A 1QNIA 1TFPA 1KB9J 3NIGB 3Q48A 4S1SL 2L4OA 3MRBB 1DQQA 4TRPL 3P9MB 5EU6E 1XIWB 5DGQA 4AEFA 4IRJA 4UT7H 4P2YA 3FRUA 4TSBH 5CBEA 2HLEB 5D7JC 4ZPTB 3II1A 4PJDA 2EINB 2XZCH 3C9NB 5GJTL 1T4KA 3UC0L 4WI0A 2CWRA 4PJHE 1JGEA 4IU3A 4RSVA 3HKZA 2MCAA 4FQ1H 3ME0A 4ZQKB 5AVWB 1EO7A 2TAAA 1A65A 3BRGC 3MQIA 3RZCA 4YWGL 1N6QH 2HTKD 4G42B 3ETTA 2DH3A 1QSFD 3DC0A 1I85C 3LPPA 3QUMB 5I8KH 5J89A 4I77H 3PFUA 3OZ9H 5IK3B 3Q6FA 1CFVH 3GSNB 3PJNA 5A40E 3QCTH 4LSQL 4NDMA 3LKSA 1JPGA 4ACPA 4J3XA 5CN1A 3VD3A 4JAMB 1R3LB 2J44A 1QO3B 1RZFL 3FT0A 3HR5B 4YLBA 4BXVA 2NTSP 3PDOA 4GQ9H 1M6OB 2MPVA 4NQEE 3NZHL 1A4JA 3ILPA 2QGCA 4V2BA 3DUHA 1XF2A 3SPVA 4P3DA 1JD9A 1EUUA 1R5VB 2B5IC 3O8XD 2G75B 3I9PA 1QR1B 3VG9B 3EHBC 2KZ1B 2P49B 2ED9A 2N2MA 1MHCB 5DL6A 1U8LB 3NDYE 3PWNB 3C5SA 3NJGA 5TDPA 1RPUA 2CDGA 4NFCA 3VGHA 1SUJA 1OSEA 1A4CA 1YNLL 4LCWB 4AW4A 1HHHA 3QXDB 5F9WC 2EXYD 5ID0A 4ANUA 1J1OL 1JYXA 1W9XA 3O4LA 4ZW6A 2KQNA 4DP2X 2V4LA 5E2VL 2J1NA 1QNZH 4NUPA 4NM4L 5FKAA 4M6OH 4F7MA 5KSVB 2VM3A 2AJZB 4BUGA 2E6QA 3KPNB 1WUZA 2JELL 4NENB 4HCRH 4NN7B 1KJ2A 4M9OA 2GFBB 3GLAA 3KLAA 4ZXBD 1QFWL 4POUB 2CH8A 3S36H 4Z7VB 4E5XG 4URTB 2BCKB 2E8ZA 1JE6A 3C2AH 3TPKA 2D0GA 4NPYA 5ELIA 5DT1L 3FOMB 4PJXE 3HZYB 2VR5A 3FFOA 2V2WB 5LDUA 2D03H 3M07A 1IFGA 4QRQB 5I73C 2ICEA 4H40A 3HG2A 1S46A 1YC7A 4MA8L 3HFML 3SY0A 4LSUL 4W68A 1F86A 4U0RC 2J72A 3PQYB 1A6VH 3DX1A 4QRRA 5JNYA 1XF3A 2PCFB 1H6S1 4HLZH 5FYKE 4PVBA 1NZRA 4WSGA 3QQ3B 4HUVB 5TPWH 2JJTC 4R84A 2VB5A 4WO0A 4UMGA 3EYSL 3CLFH 1HOCB 3ARDB 1QSED 1TQTA 4PJ7F 4Y2NA 4KNQA 1BZ7B 3WE1A 2WUCH 4TNWF 2YRBA 1JF1A 4HGKC 4OIBA 3T71A 1E5BA 4UB8O 1NCIA 2Y7QA 3P4OB 4TLTA 3T08A 2CJUL 2JB5L 2AQ2A 1BWMA 3ARTA 1NCDH 4PGEB 4KKZA 2GTWA 3LS5H 5D2NB 3MRDB 5F2FA 4N8UA 4N2LA 1IFHL 1IEAA 4M00A 2QGBA 3MRLA 2VAAA 4OY9A 2M26A 3QDGD 2W1NA 5DUMH 3H9SE 3O2DL 4Z9KB 5E6IA 1XB8A 5IEHA 1JJUA 2CA4A 4RAUA 4G8GD 7PCYA 3LKNA 5C0GB 1OGAB 3I75B 3ABLB 1F6LL 2ZCHL 2GG1A 2LFUA 2Y7LA 4UDTB 4FXLA 4NI6A 4I0CC 3IRCA 4GG6A 2I69A 1U8HB 2WJ7A 3TJEH 3FS9A 2G2PA 4HUNB 2GCYB 3H2QA 3AA1A 3ZL4L 4NC0B 2BK8A 1NL0L 5T1MA 4MGXA 1P6AB 3ZE2B 1UM5H 4DQOL 1CYXA 4M5TA 4MAYB 3O6KH 3FOLB 3RUGA 4U1HB 3B6SA 4PJEA 5JDJA 1JV2A 5KJRH 4U3HA 3H9HB 5JUEH 3KL5A 1HZHH 4X6EA 1C1EH 2DQDH 4LNVA 5TE4H 2HVJA 1IBBA 5F9OH 2FQFA 4LEOB 3GTVA 1CT8A 5BW7A 5LCVL 3P3RA 4YE4H 3BVNB 3CFDB 1F1GA 4LAQH 4CVWA 4JQIA 3OKNB 1S5HB 3MRFB 1OGTA 3BP5B 4UT6L 1MN4A 2IH1B 3OWEA 5IJKC 4FRWA 3WLWC 1VGKB 4WDIA 1PQZB 1GGYA 3IXAA 3NRQA 1TNMA 1P2CA 2DQHH 3CZUB 3MXVH 5JTWA 4HWBA 1MXDA 4F2FA 4NQXB 2KC0A 3FT9A 4MHHG 1RK0A 5JO5A 4O02L 3L4WA 4AQAB 3MZGB 4XCEA 2WIIB 4HJIA 1J10A 2WCGA 2VCOA 2K70A 2PYEA 4QRUB 1U91A 1HT6A 4DGWC 5KUKA 1A2YB 4NI3A 3WL9B 5T5NG 3RTQD 4PD4K 3UMTA 4HCRA 1L7TL 4MNHB 4ZOBA 4J6RL 1QTPA 2XXGA 4K5LA 3ES6B 5I16A 2ADGB 3D5OF 4P5TB 3VZWX 7TAAA 5EOTB 3KJ6H 4EI5B 1O7DE 3VRLE 2VC2B 4C56E 3TYGL 5CJ5A 3EG9B 2WUBL 3LIZL 1PIFA 4NP9A 3HI5L 1ZHWA 4HIXL 1IX2A 1D5XA 1BD2E 4N86A 2MFNA 4JY4A 3QJUB 4KJQD 1QA9A 3BJ91 3PHOA 3SDCB 2OL3H 3UO1H 2E7BA 2C4XA 4I18A 1FN4B 2ENQA 5FB8B 2QVMA 4KRPC 4ZOAA 1D5BB 1FORL 3O8XA 5FS5A 4MXVE 4JFFD 3CHOA 4XO4A 3DVIA 3JVGC 4WFFD 2XG5A 4MZIA 1S7SB 1W8EA 4GOSA 2MHAB 3TA4D 4B3EA 1OTTD 3K72B 4GQQA 2PCPB 4BCXA 1GGCH 4XT1C 4JKPL 3VX0A 3K6SB 2KZBA 3KXFE 4G43A 1LK2B 2O6PA 1BXUA 1K8IA 1PKQB 3FHAA 2HH0H 5IWLC 4NKOA 3RVXD 3VI4A 3PS6A 4ZW8A 4BQBA 4I4WA 1OM3H 1SMAA 3KWXA 1GYAA 4DGYH 3NSYA 1MJ8H 2R2CA 2ZUXA 4POZD 5CUSH 2W65B 2VQ1B 5D7SL 2ZUTA 1K6QH 2A6KB 2DH2A 3VWJD 3CSBA 4AC2A 2EE0A 4UV4H 1LE5B 2GJJA 1BOGA 5F88B 2N0MA 1KPVB 2DYRB 2WWOA 4MXQD 3UIYA 4ZXBA 5EIVA 5EOQL 2IPKA 5CINL 2HT3C 1A5FL 2AXGA 1HSAB 1QYGL 3GINA 2VDLL 3PWUA 4HS8L 3I2CH 1DBBL 2AQ3A 2B2XL 2UXTA 3CH1B 3IDIA 3I6KB 3ZDXE 1MIMH 5ISZB 4HCFA 4GMTL 4YDMA 2WQAA 1TJMA 4N0CD 2AXJA 4JRYB 1SQ2N 5TJWK 3WXVH 1ND0A 1NUGA 2ALWA 1Z9SA 3GMRB 4XE0A 1QUPA 4AUYA 4CVZA 5K9OB 2JJSC 1TCMA 3KPMB 5DYOA 2QSVA 4K9EC 3EGXB 1LEGB 3QG6A 5IKCA 5K69A 1I85A 1E5YA 3UJIH 4AITA 4X6CE 1N6UA 3MV9A 4NLAA 5C0EB 1YNTF 1R3IL 2BC4A 3N2JA 1AP2A 4X42A 5ITBH 1I9IH 4YH6A 2BIQA 4NO2B 3ZUNC 5BRZB 4Z7UF 3V10A 2D3NA 3BAEL 3CBKB 3HRZB 1HHGA 3VXMB 1QUNB 3NSCA 3I84A 3VFUB 5E6RB 1E4XH 1P1ZA 4EN3C 2X4QA 5EUOA 1RURH 3TEUA 3H42H 4Y16D 3G5VA 1DYZA 1E4WL 2F54B 1UWGL 3RIFK 3V5DA 1DQJB 1L0PA 4JNXA 2FBRA 4PREB 4KK6C 2HFFA 3QDGA 2LV4A 2FWOA 3F7KA 4OF5A 3CFUA 1L0XA 3FN3A 3N1MC 2XPYA 3UTTE 1ZHZA 1WP6A 4E5XB 5E70A 4QHLA 5CEZD 2KXPB 3HG5A 2D7NA 4X4KA 4B0MB 5HHPB 4DEPC 2PUQT 1WUNT 2WQUA 1P5VB 4NT6A 4AQ1B 5LN8A 2AXHA 1D6EB 4WKZA 4XOAA 4ENZA 2NNRA 3Q43A 1E6OL 4QJ5B 3JWNG 2GSMB 5DZLA 3DI3B 2BW4A 2VDMB 5DZOA 4UDUB 3CU7A 3GM8A 4NAQA 1P9MC 1DZ0A 1B0GB 4R7DA 1WZMA 4XR8C 3CBJB 4TXVB 1P4TA 2D3VA 5H37G 3LQZA 1U93A 5PRNA 4YK4B 5I1KL 4JM2C 1SF5A 3CDCA 1D9KD 4PRIB 4K7FA 4QTIL 2JSFA 2OL3A 3D3VD 3JV4B 4NGHH 2FX8L 2IEPA 3LN4A 3UGUA 3KPLB 4PN6A 1RSYA 3C60B 5ILTL 4TSCL 1THQA 4L48A 4NQVB 5CP7B 4RFEA 5CO1A 1LP9E 4MD5B 2KZKA 4ZJ9A 4JFDE 3KPSD 1CUOA 5M94B 4LLUB 2OSLA 3V5HB 2JJTA 3ARWA 4AZUA 4GF4A 5J6SA 4LSPL 4MJ5B 4X4YB 2JQMA 5DD1H 4OZIF 3SO3C 1AHMA 3N43B 4OLYL 4AEHL 2UUDK 3UGXA 1IGTA 1RI8A 1CL7L 3NJLA 3UYPA 5DJDA 1WFIA 1Q9OB 1U2YA 5FYLD 3EFOB 4N26A 1WBYA 3RTQA 2OBGA 3VI3B 1CO1A 4YR6B 4GO6B 5IMOB 2XIBA 4EN3D 4TUUA 2EZ0C 1K5NA 4Y2OB 4ADJA 4DZBA 5CLXA 5C6TH 3NJMA 2Z7ZA 2Z6FA 1BF5A 4OM1L 3PL6D 4UM9D 2HTLD 2B8OT 3B5HA 2IPUK 5ERWA 4K94L 3I3EA 1LO0H 5ANMB 4AQEA 1S4IA 1X5MA 3N04A 3NCXA 3T8XA 5SWQA 4DKEL 3MRJB 2B15A 5F7DB 1DL7H 3IMSA 3EH2A 4JFFA 5I1CL 4MNQB 2B1HL 4N3UA 1UCBH 4AM0A 3M1BA 4UOZA 4L8CA 1I3UA 1IZKA 2F1TA 2HZHA 4K9EH 2CRYA 5EEYA 2ZWLT 4B50A 1Z5HA 3KGTA 3GMLB 3CX5J 3T6XA 2Y2WA 2ZOLB 3UZQB 3HUJF 2CUMA 4X8JB 3HS9A 5JHLH 1DFXA 4FZNA 4IEFA 2YUZA 1KCRL 1HE8A 5BV7B 1TQBB 3OWRA 3CC5B 4N1CA 1YY8B 3RVTD 4DVBB 1UXSA 4R0LB 3TYFB 3AREB 1IQDB 4G8IA 2LHFA 1GAFH 3HVNA 3PIQB 1JOIA 3VGDA 3VD4A 3F7YA 3SPHA 5AZEH 2OKMA 1EBPA 2VDOL 2H32H 5IJKA 5D7KE 4WI4A 2XU9A 3MX0A 1M1SA 3LSOB 2HT2C 3E0GA 2WLLB 5DEFA 2VMFA 5EC2B 2ICES 4L8DB 3BKJH 3AFLA 2IVFC 2YAQA 2WZPD 3QULB 4FFVD 4JK0D 3SDAC 3QXVA 2X4TA 2ODHA 4ZNEE 2WWMD 2ZLDA 2AJSL 4Y19B 4FMKA 4NZDA 3TO2B 5D2LF 3HB3B 1JTPA 4PV1C 5HYJE 5CP3H 1BFVH 4PJ9D 3INOA 1IAOA 3AAZA 2P8MB 1YYML 4AIZB 3E9UA 3F83A 3NACH 2EZ0D 5C2UB 4YSPA 3LYRA 4GIPD 4X6BB 3OPUA 2J1WA 4HOZA 1XBRA 1QRNB 3BLBA 3X2QB 2CJ3A 3I9IA 4OF8A 4P05A 3RILA 2ITFA 1WZ1H 1YDPA 4V33A 1TO4A 3WSQH 3Q2LA 5FYKD 1E4JA 1FZMB 2N1TE 3EOAA 5DQJA 5I9QC 3WFHA 3VXNA 3GMPB 2CLZA 4K71C 5FM5M 3H0TA 1E8ZA 1PLCA 3L2LA 4Z7OE 5GHWL 3NFPA 3H7BA 3ZVVA 3D06A 1UFGA 1JL8A 4XC3L 3OAYK 3NZSA 3MV01 4YZFE 2YSSA 5IROD 2ZAHA 5BZWA 3ESNA 3VXUB 1FVEA 3VD0A 2DDQH 1DUYB 4HFWB 2Y3NA 1HEZB 4XMUA 3HN8A 4YGAB 3HFFA 5LXGL 4G5ZH 3U9WA 2IMMA 3SPCA 3B9KD 5F7FA 1QJPA 1A7NL 2ZPKH 3D85A 1O7DC 4KTEH 3AT8A 2W9DL 4LB8A 2FT8A 2ARJQ 2FQDA 4EIZC 3QQNA 2Z8RA 4P2AA 2NQCA 3DPDA 2QZ5A 2B77A 3BAJA 1ZLWH 1JHTB 2DTML 2NYKA 2WSDA 3MJWA 2A9DA 4Y4KC 1MF2L 1VENA 1D9KA 2QFPA 4GYBA 1SVBA 3D3VA 3NQIA 4FZEH 1OAQH 3HIZA 2WXHA 4DPBX 5I30H 3OPZL 1CFSA 1Z6JT 3O9WB 1LNUA 4CUCA 1T1XB 4KNTA 3JWOL 2FLMA 2YAFA 4QAMB 3ECBB 1XGRA 1Y1DA 3CZJA 2QTKA 3D09A 3VFNB 3TBSB 3CFTA 4AUIA 2J88L 4M5ZL 3D25B 4LLVB 1I82A 3JYBA 5D4QA 4FCAA 3K6DA 2DEWX 4Y1AB 2XVLA 3A6BH 4QCIB 4LHUB 4TULL 5JHLA 3HAEG 3BAIA 5E9NA 2VZUA 3PABB 3PGFH 4R4NC 1CXKA 3ASOB 3KMDA 4KMTH 2WCSA 5CD3B 1R5WA 2NNXA 2I24N 2DIAA 3SYAA 3CFMA 2JQYA 1J05A 1IKFL 4IRSC 5EWIL 2DWYA 2C9UA 4OCSH 3SDYL 5EU6A 3B5GA 4JB9L 3RPBA 4EN3A 4J3OF 4PRDA 1FH5H 3X1EA 4L2LA 5EFIA 2WHVA 3QUYC 3BPNC 2G5UA 3DXAD 4PJHA 5CKGA 3ULUL 5DS8A 4KROD 5T33L 1ZT4B 3PL6A 1KEMH 5KWYC 3G04A 3GGWB 3K0YA 1KPUB 1CICD 1WEJH 3I6LD 4LGRB 1XXFC 4LIQL 1CXHA 3MRPA 5DC9B 5JHMA 4OCRH 4GW1B 3BMVA 2WTRA 5AB0A 2KERA 1FHNA 4JFYB 3U7YL 1PU0A 4JHAH 4PWIA 3RBSA 3AXHA 2QKIB 1U4FA 5CP3A 3E80A 5DRXB 2VW4A 5E5MB 4OZ4B 4P07A 2OTPA 2CAKA 2XVGA 4JFSA 4P2OB 5AYQA 4EUPG 4M43H 3S88L 3QE5A 5B5EO 4C56D 4UB0L 3MOAL 1E5UI 2EICA 4YSDA 1BDYA 5ID1A 4NQEA 3EAKA 1P9MA 4OIFA 4OCYH 1UD8A 4P5MB 3T0ED 5IF0B 5BOJA 4QDGA 3ATDA 5B1JC 2YC1B 1P84J 3D33A 4RH4A 4JM2A 2EACA 3L5IA 3OKKA 4Y4KD 5IHUL 2H6PB 3EF7A 1ODUA 1Y6KR 2VWEC 4M56A 4KKCD 4H26A 4YHPA 3OKMB 1U8PA 5BS0D 1CDUA 2EP6A 2DYPA 4X5RA 4YBQD 3WYRA 3GSWA 3IGKA 3MKGA 1ZAGA 2VUYA 5EO0B 2CE6A 3MV7E 4P4KB 4DN3H 4DCQA 4BH8A 1G84A 4QOKE 5MENE 3QYMA 5J6HB 5J3HD 2UVFA 3QAQA 2PXYB 3ZRSA 4J12A 6TAAA 4ABWA 1RZKL 4ZO6A 5AVZB 2N01B 1CQKA 3PGRA 5MEQA 2YGQA 2VDQH 2KZWA 5AAWC 2LW3A 3L3GA 4M93B 3VDCA 1ROCA 4APXA 1N5AB 2P8PB 4PJ9A 5AL0A 2I27N 4HIQA 3SKMB 5KYXA 4NQCE 2NNCA 2WLMA 3S34H 1VACA 4PJIF 3ARBC 1S9YA 4PJXA 4I85A 3PP4L 1HCFX 3QEQE 4X5WA 3GHBL 1RP8A 3PGDA 5I5JA 4ZDHB 4RLCA 3NIFB 4TTDD 5FF6A 1WFOA 5C9KA 1YN6A 3EUUA 4MS8C 3AB0C 4ONOA 5FOBA 2O4EA 2HLFD 2V9UA 1Q9LB 5T1LD 3WEBA 1A64A 4GKSB 3V4UL 1SXNA 1OHZA 1KB5L 2AJUH 1NIAA 3VQLA 1T66C 1J8HB 4L29A 3STZB 4X5XB 3H4FA 5D96C 4NKIH 4RIRA 3MBEB 4G9FB 1BVNT 4OIAA 4PVMA 4MBRA 5C0BE 1SJEA 2LLGA 3L4YA 4BCYA 4HUUA 5KW9L 1XGTB 5IROA 5AUMA 2DI8A 2Z1PA 2X70B 4AIEA 4X2UA 1U8IB 4KUCD 2CR6A 2IOIA 2IXQA 2PYFA 4D0DA 3O11B 1LEKB 1NGQH 1B0IA 5C0JA 4AC4A 1H9DA 2DZEA 4HV8A 1R24B 4C59B 2E76C 1HWGB 4TMPA 3D05A 4UZUA 2UX6A 3T4YB 2QVKA 2VOTA 1G94A 4R26H 1IBGL 5FKPB 4G1MB 2A73B 3C5ZD 4E9QA 4E9TA 1VFMA 3ZKXB 4P5RA 3RU8H 3WMPA 3H9SA 1AIZA 1Q9GA 4H13C 1X7QA 3MZTA 5F44A 3UTTD 3ZYJA 1O5DT 3IGAB 4OKVB 2YEVB 2CDFB 3IAQA 3B2PA 3GI8H 1VIWA 2QBWA 2Q7NA 1T0NA 3IRZA 3QDJB 4NRXA 2F9BT 4LL9A 2VDPH 3Q3GB 1ZWIB 3SDAA 3O3DB 2HKFL 4LVOC 3TV8A 1LD9B 1L7IL 3V6FA 4PR5B 2X09A 4HJGB 3S3JA 2AABH 2B4CL 3QQDA 1B2WL 2C3HA 4AEEA 4P4RB 5IT2H 4CC4C 3F05A 3T0XA 5JPMB 5KANI 4KTYA 3EBGA 3MLYL 3IMWA 1DVTA 2YZ8A 2MQ0A 3ARBD 1QW9A 1FGVH 3LRSB 1U2CA 2JCWA 3FB8A 4FFZA 3FUKA 1X5HA 1EX0A 3BUYB 1MAMH 1QLFA 2LU3A 1FZOB 2BS71 3MRCB 2BOBB 3H9ZA 2J2ZA 4OI8A 4M6NH 2FIKB 2UY7A 2R56L 2BLFA 4N0FA 4FG4A 3QEUB 1ZSDA 2GBTA 1ZT1A 2NY2B 2W60A 2Q7AA 1WGVA 3L95B 5D5MF 5DJ0B 2ZKWA 3WFCH 1JERA 3MCKB 4OW6A 4PMFA 3LKRA 4FS0A 5DO8A 2BSRB 2MOGA 3O6MH 2NY1C 2J8UF 2KDYA 2VLLB 1B3JA 4FQJH 4MRCA 4X6FA 5IHZB 4FP8L 4EAEA 3KDMA 3JTTA 4JL1A 1KB3A 5KYWA 2MIZA 1P69B 1CBVH 1YEKL 2AQQA 4FOMA 5FLUA 2OXHB 3IJEB 4X9GA 4Y4FD 2AERT 1UH2A 1AGEB 1JPTL 2KLSA 1FP5A 4PH8A 1ZHKB 1RLWA 4YAQB 3V4VH 1XGUB 4OGYL 4E41B 2ZWNA 5JOPE 4RMTA 1RZGA 5MI0B 4KH9A 3SDDD 1U92B 2QQQA 4PYHA 4C56A 2ICWB 4PRAB 4S10A 5KYUB 1NC2B 1NAKH 4U4IA 1BD2A 3ZQ9A 4K7PX 1AXIB 2ARJB 3MSPA 3ULUF 4NWTL 1RUAL 5IUCA 1D5RA 2CPCA 2VE6B 4AZ8B 4IGBC 4Y4KA 5LG1A 1ONQB 4BUHA 2HX9A 4ZX3A 1IGFL 4HK3J 3CFKB 1WGOA 3I50L 5C08B 1MWAL 5KEZA 5JQHC 4HKBB 2VISA 5BS0A 3KXFA 2JLPA 5CILH 4YDJA 5DEGA 3HKFA 3QZBA 1Q94A 3MBWA 2H0EA 2ZX9A 3PDGA 5B3JE 5I0YA 3PHQB 2Q0ZX 1JUFA 2ENJA 1DEDA 1TZHB 4UOQA 3C08L 4GRLB 4MCYA 4PI2A 3T4AC 3QRFM 2FD6H 3RKDC 2QFRA 4O51B 1MIEH 1G9EA 3HZKB 4WFHD 2FX9H 1VPOH 5EZOH 3GMMB 2IADB 2XN9E 2OSXA 5DEJA 3T77B 4CADA 1ZGLM 2H8PB 2ZCZA 3FSAA 2EDQA 3IJ8A 3QIUB 5CGBA 5H35B 1R75A 1TO5A 4IRSA 4M5SA 5D7KD 3BI9X 4GCQA 3BUDA 4HJUA 1TQUA 5C0CB 2ICCA 4UOJA 3ZTDC 2Y1ZA 2VQUA 1SBSH 1OB0A 3RA7H 4KZ0A 3HJEA 3SGEH 3QUYA 5IQ7L 1IC5L 4GKNA 4PRHE 1JGLH 1WJ3A 1I8IB 3LQAC 1C7SA 1G7LA 3LOWA 4KVPA 2P46B 2CKBB 5HI5C 1KGJA 3ROOB 1NFDF 2C3GA 2FZ3B 3MLUH 5GS2D 4RAVA 1J9RA 3RVWC 1AS8A 1J9QA 1IAIL 1NKOA 5T1LA 3VW3L 5E2WH 3IPEA 5KVEE 1YYLH 3SGEI 3F5WB 3GBMH 4QHNA 3BDBA 4OGAD 4FG2A 3ZIMA 1A21A 4X6CA 4Y2LA 3OXSB 2W9EL 4D8PA 3QJRB 4JFBA 2HKHH 3QAZC 4QXGH 1VEOA 3NFNA 3WU1A 4ZUVA 1A8JH 1CGWA 5E0QA 2QQNL 3LH9A 3D52A 3CLWA 1S9VA 3TIDA 4A6YL 2DMGA 1MCDA 1P7QB 4ABQA 1XT5A 2UWEF 3HBZA 4ADGA 1L9RA 1LQBC 5B1JA 1FSKC 2ZCKH 3NCCB 3WN6A 3QWRA 3U1SH 3WIHH 5FYKU 4ZPVB 5I2IB 2ZZUT 4HEPA 3AA6A 1P0SE 3C5ZA 5IY5B 1IZJA 5FO7B 3RWJA 2CHWA 1V3MA 2FO4A 1FL5A 4Z7WF 3E8VA 4PUBL 3UTTA 1ETZB 1RZQA 1MCFA 3GJEB 2EIZB 1SRDA 3H9YA 2QSCH 4PR7A 4M3KB 4M8QB 3UCRA 2BPBA 4JHUA 4PGDB 2F5AH 3JV6A 3QUZC 3EYUL 3AITA 1TJXA 4AL8C 3ZKMD 4A7QA 1YRKA 3U4EB 4TQEH 1BH3A 2R7EB 3MUGB 5DI8B 5DLLA 4A1RA 1M71A 4Q97A 4WI3A 5AAWA 2CU9A 5AB1A 5INCB 5DD5L 4ZSOB 2NUPB 3FONA 4XGZB 2DBLL 1RUMH 3JZ7A 3RIAK 1FVDA 1DVZA 3ARBA 4X4ME 5I1AA 3C6LB 2A7BA 3KPQA 4XMPH 3TTYA 3BIKB 1C12B 1OVZA 7FABL 2FRGP 4DW2H 1TZGH 5TF0A 3U1QA 2R2HB 4YXKH 2BO0A 3DK2A 3G5XA 4J3OG 2R0KH 1LP9A 1TJGL 3PJSA 3QXWA 5HI5D 1BVNP 3BW9A 1VFBA 4JFDA 4N2KA 3FYIB 2W0KA 2DWDA 1AD9A 4M02A 4NRZB 1G9ML 3BZ4A 4O4UA 3CSGA 1Y6MR 3QXAA 4KXBA 4KZEH 2SEBA 3CVBA 1B6UA 3UTZB 3B3IA 5GXBB 1FCGA 1CR9L 1JFHA 5J7CC 3WJLC 4KKBD 3WNMA 4HKJA 1BHGA 5J12B 3UP1A 1HKLL 5CCKL 2X7LB 5FGSA 3Q01A 2B0SL 3NSDA 5BZXA 4BQ6A 1EHNA 2MQCA 3QNYA 5CEYA 1JAEA 4PW4A 1ZANL 4IOFC 1BQUA 1I1RA 1H3WM 1N4XL 4BFNA 3NABH 2LE9A 5CJXC 1VFAB 4YOKA 1UXWB 4C57C 5A16A 4FXTA 4N87A 4KY1L 2AEWA 5AVXB 3VXSB 4XRCA 3SDDA 3BAXA 3P2TA 2OSYA 1FPTH 4HT1H 5CGTA 4BH7B 3TA3C 2V5RA 1N18A 2LABA 1IC4L 1FFNA 5HYEA 1CVSC 1RZ8A 4IJ3C 5E4EB 1IGYA 4PGJA 1Z9NA 4LPUA 4RBPH 1SVCP 4UV7H 5KSUA 3LQAH 3BO8B 3G9VA 3QUZD 4HHGA 3VXPB 4MX7A 5INDB 3PREA 4I3RH 5DS1A 1I9RL 3RWFA 3V6OE 4M6AA 2EVJA 1YS5A 5HYSA 2NTFA 1PNCA 4CC4A 2OXGA 2OTUA 2AXWA 3IF1B 4KNUA 1JK9A 5CLWA 3EGSB 3K8KA 5HHXH 3FQYA 4W9DC 1RFDH 4X4XB 3IVKA 4WWKB 4G8FB 4NO0B 4CVXB 1T5XA 2YKKA 3BLPX 3QUXC 1T03H 4D9LH 3DGDA 3HE7C 2BP3A 3H2WA 3X1NA 3N42F 2V7HB 2VLME 4NBYB 2P7TA 2NY3B 4JZOA 5FW8A 3G6DL 3G5YA 3QEGL 4WW2B 4ELMB 1NGZB 2Y36H 4DGUA 4N0UB 2AK4B 1KIPA 3BGMB 2NY6B 4LFHG 4M4RB 2F53D 3IFLL 2AXTO 1PX4A 2MTAA 3S37L 3OAUL 4XPFL 4UTBH 2WOBA 4QYOA 2F1VA 2AKRB 4IOIA 4QEGA 1RUKL 3MA7A 5DZAA 3E6FA 1LDPL 4A2DA 4F7EA 1VLXA 4ZNEA 3TS8A 4PP1D 5EULV 4PSPA 1RK1A 4YO0A 5ESQB 1JZ6A 3GRGA 3FU9A 1KLUA 5HYJA 3K71B 3Q0HA 3O3EA 4ZS7H 1OK0A 1RZIA 3FYXA 4FZ8L 4AL8H 5DC2A 2WY3B 4U1NA 1HQRA 3BP6A 3T3MB 1G4MA 5KSBF 5D72L 5LKNA 1CD8A 5A2AA 3D0AA 4EIGB 2OMVA 1JZGA 4N59A 3CFBB 1XGPA 5DJXB 1OT4A 1JCKA 3BWUC 3QIWC 1KN4H 3TA3D 3UBGA 4BA8A 1TSRA 4P3CH 3FTGA 3HC2A 2N0KA 5L88H 1UJ3B 4F2EA 2PN5A 4XP1L 5F1KC 1I7ZA 1E7UA 2CLRB 1F1AA 1MLBB 3LH2L 5DHDA 2A83A 3UL4A 4IGBA 3L9RB 1M7DB 3F04A 1TQVA 2EECA 5LAXB 4K7PH 1IM3D 1GTNA 3MLRH 5KG9B 4PJ7E 3VXRB 3L8QA 5C0BD 4XP5L 2BSBA 1U33A 4YFLF 3VAEA 3RVUC 1BPLB 5BVPL 2K7PA 4AYGA 4F24A 1VRSA 3D4YA 3BQUD 1YECL 3FH7A 1NAML 4M9PA 1XGZA 5AWNL 3T4AA 2B9BA 4ELKB 1Z5LA 1E90A 4NAJA 4MD4B 5SWZD 1IBZA 1G5GA 4XCFH 4GJTB 3MCG1 2R4NA 2FJGA 3AW5A 1N5YL 2DQCH 5IW6A 1BAWA 1AQKL 3ESMA 1YY9D 2AGJH 1YJDC 4LBEA 3ZGHA 4IS6A 5CKAA 3WNNA 4F58L 3FMGL 4N8VA 4CC0A 2WXFA 5CR1A 2C9AA 1SDDA 3HC0A 1UB6A 1RUQL 3MUY1 3DJ9A 1W0YT 1ZVNA 4MCMA 4HIPA 2X53A 4PS4H 1RL1A 3N9GL 2VMCA 1EFXA 2QLVB 3EJTA 2EYTB 2YEZA 2OI9C 4V1DB 3QWNA 2V7NA 4LL4A 3ISRA 1N59B 2WZ6A 1U6AL 1QQDA 5BPPA 1DCEA 3LK3B 4NC1E 3DX8A 1G7PB 3LEVH 3SBWC 5B3NA 3UYRH 4KGJA 4UM8A 1B9ZA 2WAQA 2YN5A 2IGTA 4JJOA 4Z7NB 5GSVA 3CN0A 1CFQB 3FRUB 4J4PD 5CBEB 5I82A 4WEUD 2KLRA 5DDHB 4XO5A 3LKPA 4PJDB 4E42B 3AY4C 3U0WL 2GC7C 1Q9WA 4WI0B 4JFHE 5D71H 2W38A 3ME0B 2R29L 3OKDA 4O2EA 3V0GA 4OJCA 4C4VA 3RZCB 2GUOA 3RDTD 3WNJA 5AOMA 1WHPA 3DBXA 4XN7A 2FECL 5IVZB 3KLHD 1T7VA 4LHJB 3KYMA 3WJMB 4DO4A 2J56A 1GR7A 1P7KA 3ARPA 3STLA 4NCDA 5TQ2L 3T3PF 4JRXE 3JWDC 3DUSA 4NIYE 2ZAGA 3ZZLA 3NEXA 3VGAC 2XWBA 4NHUB 1FDLH 3NAAH 4HJJH 3LKSB 1JPGB 3EKCA 2X6BA 1NLBL 3QJZA 2VDNL 1XTLA 3D1MC 4B53A 3PDOB 1KCVL 1OGPA 2ENYA 3OB0H 3HZ3A 4P9HC 4S11A 5A2IH 3QUZA 3AT0A 1XF2B 3SPVB 4P3DB 5HHOD 3NUKA 3KHOA 1O6SB 2A6JB 3UG3A 1GGUA 4IKIA 3L16A 2ITEA 4U1SB 4Y2DD 4OFQA 4WI5A 2EVHA 4M61B 1UKTA 1V27A 2WXPA 3C5SB 5TDPB 3WIFA 3MXWL 3VU1A 1HHHB 4ZUWA 2CO4A 2J43A 5J56B 5KZCB 5CZRA 2QADD 4QRSA 5L4IA 3O4LB 1U21A 3PWPB 2YMOA 4WRLA 1VGEH 1INEL 3EF4A 1ZS8A 2VDKL 4P23B 5D7HA 1UC6A 2Y4SA 3QARA 4NZUL 2C1OA 4G9DB 1F41A 5D1QE 4H8VA 5FKAB 5CBAB 5LWYL 1PIGA 3FUIA 2ZSVB 3DTUB 5FXCH 1DHKA 4D94A 4RGMC 5C2BL 4AT6A 4F7TA 4OCWH 1DBKH 2H6UA 1KJ2B 3MV7A 4JPQA 3KLAB 1C08A 5F0JB 3WEXA 4QOKA 5MENA 2Q76B 5CR8A 4NPYB 4WSKA 3QFJE 3OMIB 3BD5A 4FTVB 4LU5H 3SB3A 3TL5A 1T2QH 1LMKA 3AUWB 3WJLA 4HBCH 1ZEAL 3WTXA 1XGYH 4FADA 4N0YL 3CDZA 3SY0B 3KH3A 2J5WA 3SBQA 1QLEB 3NCMA 2KBGA 2K3TA 2IDFA 3A67H 4NQCA 2RFXA 4N3TA 4QRRB 5E79O 5I66B 4X6DE 5IMMA 5JNYB 5DD3L 5FWRA 1BXVA 3D18A 4J1UA 3GI9L 2W91A 1FFPA 3D2TA 2HJLB 3QEQA 3HMXH 4ILDA 3ZR5A 5CJXA 3B2MA 1WC7A 5F6IC 1YJDH 3ENEA 3AA0A 2NX5D 3UAJD 3FH5A 4U0QB 3ESPA 2A0LD 1JVLA 2WAHA 4FFWC 3TA3A 1X5ZA 2XTJD 4WAFA 2DD8H 2XWTB 1KTDA 5ADOH 3RWHB 3MHZA 1DLFH 2ZNWA 3DJTA 2BM3A 5KVDL 5FA3A 3QUML 5EBLA 1JF1B 2BXYA 5ESAA 3ARQA 2A9AA 4XNDA 1OY3B 4NC2B 3GSNL 3L4CA 1I1YB 1MW3A 2Y7QB 3P4LA 4PBVC 4OCXL 2FIRT 5JXEC 2I9TA 5C0BA 4XO8A 1GKOA 4ODUB 2GTWB 5IBLD 2IF7A 2H4EA 1LWJA 2VAAB 1RJYA 1KYOK 5GGTH 5GGVL 5ICXA 4CILA 2QPEB 5E6IB 1TYEB 1REIA 4LARH 4RAUB 2HUHA 4XB7A 3LKNB 1S5IH 4ADIA 2V37A 1NA8A 3FTYA 3HE7A 3JV5A 1MZZA 4PY7A 5E8PA 4A2LA 4Z78A 3RY6C 5JQ6L 1R3HA 5DSCA 1E67A 4PGZA 2WNKA 2IDQA 4GG6B 1VZGA 4KAQH 4G6JL 2ZKYA 2XUWA 3AA1B 4PJFF 4XH2A 1LO3L 2X9WA 2GJ6E 4RGNC 5T1MB 1ZY9A 4XPGH 3QZWA 5DGRA 4NNPH 3MYZA 2HPOA 2ZG2A 3RUGB 3B6SB 3DRQA 1JV2B 4WU5B 3JWDH 3A21A 3GQFA 4X6EB 4G6KL 1H8NA 2Z65C 4OGXH 3V6OC 1G7MA 2HVJB 4B9GA 3BC9A 4NYLA 4GXVL 3M8OH 1CT8B 1SOQA 2V8LA 3IBOA 4Y89A 1XVSA 4HPOL 4WV1C 5TDNB 4P9HH 1OGTB 1J1PH 4JZJC 2XA3A 1BA9A 4PBDA 2DQFA 1IAKA 2XXFA 5JPNC 4R9HA 1EHLL 1VFUA 4WDIB 5FCUL 3IXAB 4KK5C 4R96B 1EEUA 1P2CB 3FJTA 1DVFC 4HJ0C 3D07A 3SSGA 4OD1L 4OI7A 1D2PA 4J4PA 4FABL 4K3DH 1TTFA 4LOFA 1GGBH 3DVFA 1OSPH 5TE6H 2AVGA 3N85H 4UQ2A 4XAKE 1RK0B 1FNSH 4JY6B 3SGKC 5K1NA 4HJEA 4XCEB 2W94A 1UADC 4MZ3A 4HXBL 1MZYA 3CLEL 4L2YA 5EOCJ 3RDTA 4Y5XC 2G9KA 1BEYH 1U91B 1MSPA 1IJNA 2FJFA 1S7TA 3MGAA 4G6AD 3ML9A 1YMME 3OC5A 4IBWA 2FO1A 3LN5A 3TNMA 1QSFB 1WA1X 2EDFA 1PJWA 5HY9B 4YXLL 4XVSH 2F1AA 1CWVA 1WRFA 2ZX6A 1BMGA 1ZIAA 4BGDA 4U1GB 3P0VL 1SYSA 2YD1A 1JNNH 2ZE0A 5GRXG 2R15A 3L5JA 4MYPA 1MUJB 4TSAH 3OKLB 2A4EA 2QV4A 3WHXA 5MEPA 2XQ0A 3WD5L 4XAWL 4P2CG 1QA9B 3PHOB 5D93C 1QASA 1XWVA 1D5MB 4K2UL 4NUJB 5HHME 1FWXA 2XACC 3FO2A 2AZUA 3QPQC 4HJSA 4I18B 4LDEB 2K4TA 5HDWA 3O8XB 2BJMH 1SJHA 1RP9A 3HMXA 5HGBA 1PFCA 2KH2B 2QTVA 3JUZA 1AKJD 1EAJA 2R1YA 4EMZA 5KS9E 2FAUA 4G59C 2NY7H 4G72B 1ZHBB 2P5EE 1BBDH 1MI5D 1MVUA 4WHTA 1ML0A 1KCSH 4LEEA 4YBHA 1GJWA 4YMPA 1K8IB 2PWEA 3Q1SH 1K8DA 1MRCH 1PZ3A 3OMAB 3QDAA 4HC1H 4JO8A 3TBTA 3VI4B 4PW3A 5IV2A 1KTLA 1MCCA 1YQVH 3OR7A 3ZW3A 3KNBA 4WUKH 1MRDL 1PS3A 2VXVL 3NYKA 3QJQB 4KI1A 3T0BA 1O0VA 2YXVA 4ETQB 1AJ7L 3HZMA 4K8RL 1P53A 1A6TB 1Q90A 3Q8EA 3HUJE 4K7PY 1FBIL 3UEZA 4G5AA 4D9RD 4ZXBB 2RHEA 1CDJA 4AYEC 2IPKB 4WVRA 3LZPA 3IMUA 3G5WA 4KRMB 4BGLA 2AXGB 4HBQA 3CTTA 4KK5D 4L8SC 3QHFL 3IMRA 5H37H 3AU0A 5DMKA 4KFZC 2XN9A 4L3AA 4MFHA 4NP4H 4AEIL 3AY4A 1PX8A 3QDMD 1NOAA 5BZZA 4XPTH 2VAJA 1ND0B 1Z9SB 4H8QA 3KEHA 2XXCB 3IS0X 5DYOB 5BUGA 3QG6B 5IKCB 5MP6H 1NC4D 3RI5F 4RDQF 4EBQH 2EH7L 5EZLA 3WE6B 4F57L 3QCUH 4YSUA 5I1JH 5A2LH 4JJHA 4PRHA 4R3SA 1N0XL 2HRGA 3LEYL 4LSRL 2XBTA 1OV8A 2BC4B 2R0ZH 3M17A 1AP2B 1IC7L 3F6IA 3P77A 4WQOA 1IKOP 5AD0B 6PCYA 4ZX6A 3WDHA 1M6UA 2R0LH 5J4MA 4IU2B 3UH8A 3NIGF 4PJBE 3DHPA 5F3BA 4FN0A 1HHGB 2DL9A 4QRFA 4F8NA 1E8YA 4RRPG 5C0DA 5I1IH 1I8UA 1ITCA 2BP5M 2GK0A 2X4QB 5EUOB 2VC2L 5DO2C 3V5DB 3GUTA 3PGCA 1U0QA 2EKSA 3M45A 3ZT6A 2HFFB 2R0WL 1ET8A 3L1OH 3QDGB 2FWOB 5LBVA 3OLGA 5F93C 3E38A 2D7MA 3TCLB 4CNIA 4ZG1A 5G5DA 3NCWA 1F2QA 1J0KA 4ICWA 1JI1A 1WO2A 3LJ3A 4DTGH 3S2AA 5EOCL 2VIRB 3FRPG 3PGSA 4QHLB 1T0OA 2XYCA 2VLRD 3LV3A 2IAMD 4FXGC 4LVNC 4R8WH 2DQTL 4NT6B 1PKOA 4WKZB 5TF1L 1F8TL 1NCHA 3JZYA 4GCPA 4XXWC 4M7JH 1Z1WA 1A6UL 3BKCH 3IDYC 2GBUA 2YK1L 3Q7JA 5CM1A 5I76B 4WGWB 15C8L 5CNHA 2YPLD 3HN3A 2DKUA 4YX2H 4UILL 2M83A 4R7DB 1IQWH 1M9SA 5I74C 1NMBL 2I9LA 4PIBA 5BVJA 4HUMB 1EO8H 4ELDA 3FN9A 4Y8AA 1NCTA 2AJVL 1Z9OA 4HUXA 2A9NL 3L3DB 4K7FB 2OL3B 3LN4B 1M7IA 4PD4J 4DERA 3J2PA 3FBQA 4RFEB 5DJYA 5EF2A 2BRRH 4MQ7B 4MA3A 2XVBA 3QISA 4RESB 4X4MA 2E27L 3UTSD 1VZHA 5ITFA 4Y1TA 1BQLH 3MJ9L 4U6YA 3CSFA 1T6WA 2EDRA 5DJ2A 5EPMA 4HF5L 2OSLB 1O6VA 5JIKA 4ZUSA 2V3EA 4MB4A 3EBAA 1IC1A 2BVYA 3GMQA 5D1QC 4Q9QL 4M7ZC 1KBKA 2J6EA 4Y4HC 4TUKH 1I3GH 5T1KA 4CU8A 4ZZFA 4R2GD 3GIZH 1IGTB 4P46C 1U8CA 2EC9U 4HS6A 5I17A 1MFDL 3L3HA 4Z7VF 1TCRA 3RTQB 3Q06A 4TOYL 4I48A 3QQ9C 4M1DL 4XPBH 1DVSA 1L3NA 2F68X 4ONFH 2EDJA 3NIDE 1N8OE 1A1NA 4YC2B 1IGIL 4QGYA 5DJCA 4XNUL 5JXEA 1K5NB 5DMYA 4DZBB 4EDXA 3IRPX 1FRGL 5H37A 4L3FA 5HDBB 4NHCH 3OHXC 1C16A 3DRTA 3VD7A 3ZE0B 5HGHA 2OMWA 4DEUA 1LGVA 3OJVC 3QR2A 1F4WL 3CXDH 2FJSA 5ERWB 3SOBH 3AA7B 4AQEB 3T8XB 4CVUA 3PLYA 2WTPA 1FIGL 3RY6A 3WN5C 2B3RA 5GGSA 3DOIA 4JFFB 4YHLL 2XMXA 4AM0B 3WO4C 3F64A 4MS6A 5LGYA 4L8CB 1GOGA 1ZMYA 4J8RA 4TL5A 4FEMA 1ZLDA 4PJAB 2P44B 4RQQA 1NCCL 3ZMNA 5T5FH 3ILDA 1OP5H 2JH2A 2R89A 2NR6D 3BVVA 1FLTX 4IEFB 4W9GC 5IGXH 1BSIA 3VACA 2OK0H 3V6OA 4ZX5A 7PAZA 2ZNXA 4H1LB 4G8IB 4HIHA 3SYSA 2DQEL 2OZ4L 3ECWA 4KQ4L 3U4BL 3VWJB 2QTEA 2VDML 4MQXC 3QT2A 1KFAL 3O6FD 2F1CX 4WV1A 3F7YB 4G7VH 2GQHA 3W0WD 4JZJA 1T20B 2XPGB 4EZMA 3GXDA 1W80A 5JPNA 1FGNH 3MRMA 4PSRA 5EUKA 5C0AE 1F5WA 2X3AA 2ESVD 4LDLB 4OF7A 4XI5C 2DV6A 1DVFA 5DEFB 5L2KE 4D65A 1GYCA 1OP3H 3WUWB 4DP1X 2F5BL 2QSQA 3B2DC 3QI9D 3MNVA 1EAPA 4LEXL 1IMHC 3SGKA 3IU4H 3L13A 4X9FA 2O5YH 4GP8B 3EMNX 4H0HB 2FATL 1KT2A 5LLIC 3KPPA 4X7TB 2XV3A 3BUIA 4Q2ZA 2APSA 1AHWC 3ZE2F 4EDWL 4Y5XA 4ORZC 1E3FA 4YHZL 4N0RA 4U1JA 1IAOB 3TZGA 1NC4A 2HJKB 1G4RA 3HHMA 2R2BA 4H88L 3AAZB 5FA4B 3B2XA 4P06A 1KIRA 2D4DA 3HAEH 3TONA 1ZLWK 3LK2A 4YSOA 5LBSL 3MLTA 2GSGA 1MJUH 3SDXA 1CTOA 4BFEA 2WSPA 4GW5B 3WI9A 1RIHL 4BSJA 3QQ4A 2BSCA 4S1SH 4E2OA 2CHDA 3B5TA 3HNSL 3MV8E 4TRPH 1D7FA 2D7TL 3DYOA 4JFXA 4PJIE 1CK0L 1D7BA 1S78D 2Q5BA 3TBBA 2GY5A 5D6CB 2HKAA 4N2CA 1MCWW 2YUVA 3WFHB 3VXNB 5GJTH 3UC0H 2CLZB 5TGBA 1IC0A 4KPHL 5LQBL 3WUZA 1TETL 3H0TB 5G4OA 4Y16B 5E08H 1XGQA 3NFPB 4NZ8A 2IH3A 1OCCB 1QBLL 1I1FB 1JPEA 2N2LA 2Z7WA 2YXFA 3O0RL 1ILSA 3ZZQA 4AWJC 2YSSB 5BZWB 3S8GB 4BE6A 1DSWA 1NGWA 2EQDA 5IBUG 1EXGA 3W9EB 2Z3FA 3QFDA 4LSQH 2MHLA 1PY9A 4PJ7A 2J4WL 2ARWA 1RZFH 3CVDA 2ZTBA 4EUPH 2YKLH 1QHPA 4JVPA 4KKAD 4MQXD 2E6JA 4NBXB 4D8OA 3NZHH 1A6ZB 5BV7L 2QHLA 4M8UA 2YPLA 3UAFA 3KLLA 3IDJA 3X11A 4AG4L 4GI6A 3ZDYE 1TENA 3QIBC 1HEHC 4ZMPA 5HI3D 4L8SA 1ACXA 1NCWL 1SHSA 1EWHA 4FQHA 2X9ZA 1I1AC 1D9KB 4NQDE 1CU4H 4FHKA 5BRPA 4U9CA 1NBVL 2X6AA 3D3VB 3PE9A 4N6QA 4H5SA 4NUGL 4DO5A 1JK8B 2Q8AH 2X05A 1CFSB 2P42B 1LNUB 3PNRB 1O9VA 1J1OH 1XGRB 1H3GA 1FCCA 2K0LA 1I9JL 4BFIA 4EZLA 4YSAA 3GTTA 5DHXB 5E2VH 2Y0LA 3KPSB 1BF8A 4X98B 4NM4H 4CMMA 1KTJA 4WUUE 3R7QA 3T9WA 4FE9A 1FA4A 3I85A 2JELH 4JMXA 2IH9A 2Q3ZA 4PQXA 4JGMA 1XH2A 1QFWH 1S9WB 2V9QA 2Y22A 1JHLL 3N0AA 1R5WB 2N4IA 1J05B 3VD2A 1SN0A 1UM4L 5DT1H 3POXA 5F1SA 3VYNA 1GS6X 1WTGT 4RFNB 3SE3C 5AVVB 4G11A 4PVLA 1BW8A 4MA8H 2WZAA 1VFOA 4LSUH 4PRDB 2Z8VC 4Z3TA 4FLRA 5F72S 4EN3B 5EFIB 1QFWI 4FOZA 3DA0A 1UA3A 4XAKD 2YOAA 3CFJA 1OIOA 1RZPA 4PJHB 4PGCB 4BWTA 5DS8B 2APTA 3PL6B 4FQCL 1PF3A 1UUNA 5DFVC 2COQA 3IETB 3QH3A 4MDIB 3MRPB 4HQQL 1TTUA 2HG0A 5D5ME 4LMQI 2DWEA 4NM8H 3MO1A 3PQYD 3EYSH 4PJCA 4UIMA 2J8UE 1YEWA 4YDIL 4FXGA 2OTWA 1M1XA 4JRXA 2IGLA 3O6LL 4ZUTB 2WWKT 4PLKC 5C6WH 3FQWB 5DUJA 1CFBA 4KK8C 3HAEA 2Y0HA 4XXWA 5AZ2L 1QLRA 4N5EC 5K93A 2EDYA 1CB4A 5CD5C 3OJMB 3K3QA 2NR6A 3FCUB 2H47C 2CJUH 2JB5H 3SYBA 1OAUH 2JXMA 1FE8L 2E7MA 3PPSA 1JGDA 3RWEA 4HWEH 1LDSA 4EEEA 1Y1UA 1IFHH 2W9LA 3BOVA 4DJMA 2ZCLL 5I28A 4L1BA 1T1WA 1UT2A 4N2NA 5DQDL 1C8PA 4BQCA 5B39G 3MRHB 4PJ5E 1D5IL 3O2DH 4AGNA 1MW2A 4H26B 4U6VL 3ULUE 5I71C 2W5PA 2ZCHH 3HNTL 3PDDA 3GSWB 4M3JA 4F8PA 2PO6C 4Z7AA 3M7FB 4N90E 5GS1C 4GKZA 2ADFL 1ZVHA 3ZL4H 5MEOB 3DX6A 4W4NA 4L9LC 5IMLA 1U3NA 4FQLH 1NL0H 4NQTA 5D1QA 2Q2LA 4Y4HA 4JQVC 1XTMA 3SCMC 1GPOL 2X1OA 3D0LA 4B6ZA 4DQOH 1HHJA 4P5KA 4RDQG 1NM9A 3QCVL 4P46A 1RJZA 1QFOA 5MHSE 3AJ7A 1CG9B 4CAGA 4EUPA 3OBAA 4HD5A 4APXB 4I1PA 3HLAA 4PJ9B 2D0HA 4W9FC 5KYXB 3LX9A 1VACB 3QFJA 4C8XA 1J0HA 1S9YB 1FF5A 3EADA 5LCVH 4MAYD 2CCLA 2P5PA 1USQA 3VH8B 3TT3H 4OAWA 2PTTA 3PGDB 4CGTA 4UT6H 4XNQA 3MUUA 3OHXA 4IKKA 1JTOA 4N2BA 4KKQA 5AW0B 3IGFA 3ZN6A 4G7YL 4X6DA 1OAKH 1X5YA 1IBHA 3QZNA 4NKDA 5FOBB 2HG5A 4LLDA 1AGFB 1VDGA 2OZNA 2FEDC 4DGVL 1ETA1 4I2XE 1GZHA 2C7FA 3WN5A 4U7SA 5J57B 5DWUL 4FQQA 1MRFL 3F65A 3WNPA 3D34A 4GXUM 5LGHH 3N43F 2L7QA 4XNXL 1NFDE 1OWRM 4N2HA 3VXUE 1VADA 4XTRC 4HUUB 1L7TH 3MNDA 3DDGA 4Q74A 3UERA 5L4JA 4J6RH 2WVUA 2BHYA 2FK9A 2IXQB 2C4FU 4D0DB 3VI3F 2AEIT 4FNQA 5C0JB 1NCGA 3GMOA 1YNTA 4HV8B 4DN4H 1U8MA 3LIZH 4HIXH 5E94B 1FL3A 1MCBA 2YGPA 3OR6A 1S8DA 3RFZC 1PZ2A 4JDEA 2XX0A 1MQ8A 4ZW3A 3O3AA 1OHQA 4HJTA 1BX2B 3H9SB 3NA9H 2GPZA 1X7QB 2UWEE 3S3DB 1MJ7L 3QJVB 4TQIA 1NUDA 5FYJE 3SE9H 4J3OC 1FORH 3VXOB 3KS0J 1LO4L 1ZPLA 2YAHA 1UACL 2E9BA 4N2FA 2OMYA 2YFOA 4G8EA 5E8OA 4ZFZA 4A37A 4PYGA 1JF6A 2C3VB 2DLIA 1CPUA 2WMPA 5KN5B 4EF3A 2R4RL 3TP4A 4RGOH 2LU4A 5I8CA 1RXLA 3GXUB 1BZ9B 1UZ8B 3B2UD 3DI2B 5C07D 4LSSL 5AOIA 3V6FB 1IVLA 3FUFA 4O3WA 2GJ6A 1W2KT 3HHRB 4IRZH 3QQDB 5F9DC 5FHBH 1FH2A 1AIFA 1MCLA 1MFUA 4GSDL 2OCJA 4PJ8C 4HPYL 2EDBA 1ICTA 2NNAB 3SGJC 2G3NA 3HE6D 2EIKB 1XX9C 1ECYA 2K6YA 2KKQA 3EIFA 2JJWA 5EOQH 3LZOA 1HN1A 5CINH 3SYOA 1A5FH 3NGBC 4HS8H 3ZTEA 2M07A 2H0JA 2J2ZB 2VDLH 1WAPA 4FI6A 1DBBH 2B2XH 1BAGA 3QRLA 3O2DA 3BH9A 4JKMA 2YPKB 5IQMA 2JKWA 2P80D 2IIJA 2R4OA 3BP7A 4GMTH 4K94C 3TBVA 2V2XA 4N0FB 2ICWJ 2OW7A 5K1VA 2MCPL 1H0DB 2P8LA 2ZUSA 1MLCB 4GT7A 5I9QB 2W60B 1ORQA 3C5JA 4WW1B 5LDSA 3OX8B 1AVAA 2HRPL 4NJAL 4XBGA 3LKRB 5JR1L 4M5YL 5AQ0A 1JGIA 1P4LA 3LNDA 3DXAB 1UATA 5ISZD 4KROB 3NCJL 2QGEA 4XTRD 1L5GB 3JTTB 1YEEL 5KYWB 5AVYB 3H56A 4OR1A 3CN1A 3V6BR 1YMMA 2N56A 3L7FA 2XICA 1TZAA 1J11A 4HWUA 3NSFA 1P4IL 1MHEA 4Q4IA 3EDFA 5D1XD 2CGYA 3HEIB 1RZGB 2EDWA 5GZND 5TDOA 4XHJD 1ZDSA 3BAEH 4GRMB 4C56B 3HOEA 1ASOA 3NH7L 1ED3A 2A74C 4HXAL 1BD2B 3HW9A 1L9NA 4UT6A 5FUZL 2NXYD 2ZFGA 4A7SA 1DLHB 3QIBA 3GSRA 3T0EB 1E4WH 1X44A 4PW9A 3JBG7 4ANXA 4Y4KB 2YD7A 3SHSA 4AFKA 1BBJA 4EXKA 4FUVA 1JZ4A 5KS9A 3RIFF 3WY1A 2JJVA 4O9HL 2P5EA 2VISB 5BS0B 1AXSB 2VDRH 3KXFB 4JO3L 1B6DA 4YDJB 2F54D 2PR4L 3FO0L 4KH2A 4UOW1 3ULVL 1Q94B 3WI4A 1CFNA 2IALA 4YXHH 1U8NA 2EE2A 4FG6D 4HUCA 5CMAB 4JQXA 1JUFB 5DVLA 4DUWA 5KOMC 1E6OH 6FABL 1T6BX 4S1DD 4PTTA 4CADB 5F7AA 3NN8A 3V0FA 3HUJA 1AD0A 2XFGB 4UINL 2VW6A 3LIZA 5GGRY 3GDBA 1NDMA 2BVPA 2OJ1A 3BE1H 3CZGA 1MW0A 4U1MA 4IRSB 3LN9A 1VF5C 2WN3A 1SMOA 2A77L 4G75A 3LCYA 5C0AD 2I5YL 1HVXA 4QTIH 5L2KD 3V8CA 4ZOEA 3E9TA 3ZDXB 2FX8H 3S7GA 3S3CB 1KACB 2P4AB 5ILTH 2HJFA 4TSCH 3QUYB 3GZKA 2ETWA 1NINA 3BPNB 3P2BA 5AVUB 1ZGLB 4X83A 4AKRA 2VR3A 1OE2A 4J3OH 1G7LB 5GGQL 2VDPB 3Q1EA 4IJTA 4EOWL 5CGMA 4PRID 1JGVL 4AYID 3ZE1E 4NSKA 2Y1YA 4RAVB 5H4ZA 2X1WL 4LSPH 4IRZA 4FNTA 5T1LB 1WV7T 5JXAL 2HFGH 5AVSB 4XVJL 2X10A 1QBAA 2XSKA 3DVNB 4AEHH 1UOWA 4X6CB 3T5WA 1CL7H 4LAJH 3IFOA 4D8PB 1XF5B 3NFNB 4ZUVB 4OVUA 4OLUH 1HZKA 1FUNA 3FCGA 4PCTA 4PJBA 4F7CA 1S9VB 1A3QA 1NIFA 4XWOC 4PGBB 5KSBE 2XA8H 1CL7I 2AANA 4N1EA 1TJIL 2H26A 4OM1H 4OF0A 4DAGL 5DL5A 3C5ZB 3GF8A 4HG4K 1U58A 3R8QA 1CC3A 3FTVA 4K94H 2KZ7A 4OLVH 2FO4B 3Q5OA 4XWGL 4DKEH 4QWWC 3U46A 3UTTB 4KXAA 3TOPA 4QPEA 5I1CH 1K72A 2B1HH 4MJHA 2Y5TA 1ZE3C 1NGXA 3L5XL 3QXTA 3WMQA 2PTVA 4L9LA 5HI4D 4AKQA 1BXXA 4MRBA 4JQVA 3SCMA 3DMMC 4IKNA 5C07A 2ZSWA 2X6UA 3FQNA 4GSXA 4LOVA 1M71B 1Q0YH 4M6ML 4QNPF 1AYOA 1CMOA 5HDLA 1WCBB 1WSST 4QY8B 2BFVH 1IGCL 3GSOA 3ARBB 2YRLA 5I1AB 3KPQB 1X7SA 1AQMA 4JFTA 2VRAA 5BJTA 4RBPK 3G6AA 2WW8A 5CZXC 2VDOH 5BZDB 1ECZA 1KBGL 3KBFA 1HU8A 3CCHA 1INDL 4PPTA 3TFKD 3ULUC 4JG5A 3ETBF 3WCYA 1IL1A 1LP9B 3PJSB 1BVZA 2F74B 3BW9B 4JFDB 3ZT7A 2P80A 2AJXH 3NTCL 2DWDB 4N75A 3NFSL 5BNXD 4WUUD 4H25B 2BWQA 5E7FA 1UM6L 3QXAB 3F01A 2SEBB 4GUQA 5L2JA 2AJ3A 3B3IB 4L4TE 2AJSH 2CKBL 3NA4A 4F27A 3US0A 4HKJB 4GRWF 4WTXA 2XG4A 4QHUA 3QNYB 5CEYB 3E6HA 4XWOD 4KR4A 3S98A 2WVPA 1H8LA 4Y19D 5BMFH 4AIOA 1U8JA 3HB3D 5A16B 4EJ1C 4D9QD 3B7YA 5IEKA 5GZNA 4HZAA 4HX1A 3SDDB 1N0LA 3NIFF 3KYNB 5I15L 1I7RA 5CJOL 3WEMA 5I5IA 1CTNA 1CE6A 3RFZA 3DLQR 3U83A 4ZMXA 5JDPA 1V54B 5E4AA 1YUKB 4YHIB 1FFNB 5DUPL 3G5ZA 5D70L 1RZ8B 1RH8A 4JDVB 1NOLA 3MC0A 4QWWD 3VMOA 3D4GA 3F84A 3JSSA 3VYPA 1IGYB 4JG0H 3KZIO 4TLSA 2FH8A 5GHWH 4EI6A 4PUXA 3KDPB 3QORC 5AW7B 3P3YA 5KSUB 3SBPA 5I0WA 3T3PE 3DV4A 4XC3H 4OZHB 2ZYRA 4XB8A 1RY7B 4LVOB 4B0MM 1SYVA 4UT9A 5HYSB 4TQHA 5KBPA 1PTZA 1IIKA 1KJMA 2JMRA 3H85A 1T1YA 2YJQA 4PB9H 1TYRA 1IV8A 1F6AA 2HRHA 2OXGB 2YD8A 2SODB 1H3VA 1LL1A 2VSCA 4OD3L 1C8QA 1JK9B 3WIIL 4FD0A 4PJ8A 1X5XA 2AJYH 5EBMA 3ZMEA 3V8UA 3SGJA 1T5XB 4APQD 4N58A 5HJBA 3UTPD 3CK0H 4OFYA 3DIFA 3J7HA 1UHVA 4Z95L 2W9DH 2B7DT 1VKXA 3HCVA 4FJ6A 4IBLT 3IDGA 4PJ5D 2FX7H 2P7TB 3C75A 4JZOB 5FFGA 2WB1A 3ESOA 2G60L 2VM4A 1BVOA 4EIBA 1DQDL 2RTTA 4GFTB 5F7HA 2DTMH 3MACL 4AE1A 3CNKA 2ITCA 1JV5A 1S9KC 4JN2A 4LP8A 4Q7DA 3WDIA 4AJWA 1E42A 1OLLA 5C0AA 3L3OB 2NRDA 1PHOA 3ULVF 5L2KA 3MRGB 4JHWL 3UPGA 3I3BA 1YVLA 3OPZH 1RZ7L 4ZW5A 4JPVL 4QKXB 2ZXGA 4QYOB 5DHMC 3DA4A 1B3IA 1ZHLA 2AXFA 2NW2B 2Z35A 3MA7B 4IOIB 3WY4A 4QRBA 4R90L 3T8VA 1V55B 1UYWL 2J88H 4M5ZH 2E9GA 1S3KH 4P2RD 3QB7C 4HALA 1RK1B 1ZE3H 4YO0B 5DRWB 4DK3A 1CS6A 4DT2A 5KYYA 1KLUB 4TULH 1M57B 3O3EB 1RZIB 1EZSA 1ZA6A 2CUIA 4KQ0A 2OP4L 1HQRB 4U1NB 1WA0X 5D6DC 5AVRB 2O30A 5IESL 1RPQA 1U4EA 1FC2D 2I32A 2OMVB 1IKFH 3CMGA 4LEBA 3ZRFC 1QABA 5EWIH 2WP3T 3D87B 1XCXA 4ONGH 3SDYH 2GTZA 3EYOB 3FTGB 4PJIA 4NQUA 4JB9H 1MREH 3GXMA 2NDFA 4QRPE 1XCTB 2HCZX 3GLDA 1I7ZB 1E28A 3HS8A 4GIAA 3V0VA 1OTSD 3LPOA 5I1HH 4YSQA 2OMUB 2OFQA 1JXKA 1BQSA 2A83B 3B43A 3ULUH 1KYDA 1MJJA 4Z7OB 1TEFA 1F4AA 2X3BA 4JREB 4LIQH 2OW6A 2OCCB 4O5LH 5HYQB 2B4CC 2X27X 1A7QL 1UVQA 1ZPUA 3BPCB 3WFZA 3BVDB 2R1WA 4MWFA 3U7YH 4OV5A 1GW0A 3SQBA 1DO5A 2IPTL 3W11D 5DJZB 1HL4A 4TUJB 1N68A 2VQ4A 2JCCE 4IIQA 3S88H 4S0HA 2FBJL 3MOAH 5C71A 3LEXB 1KGYE 3OXRA 2FJGB 2YFNA 5JIDA 1QWHA 5IW6B 2XRAL 1OF2A 4OCNC 1GS8A 4R5VA 3DOHA 4IS6B 4IOSA 5FYJD 4PB0H 5I6MA 1SDDB 4YNYB 5IHUH 5A7EA 2AEOA 1KELL 1UB6B 1TZOA 3GTNA 3E1ZA 4G7SB 4NQDA 4ECNA 3OB0K 1EFXB 4C00A 4PJFE 2YEZB 5C86A 3RB5A 5D9SB 2V7NB 4BZ2L 4D0BA 1NMAH 4LSVL 4FA7B 3WENA 4Z6AT 1CZ8L 5HYFA 4JMNA 3TIEA 3Q05A 3A4AA 1MCOH 4O4YL 4U3XA 5B1AB 2IBGA 4WUUA 3WFDL 2QELA 4WFEE 3L2MA 4JRLA 4AMWA 3L48A 3HTLX 4KO5A 2JI1A 1LO2L 2Y3AA 2K8QA 4ZMQA 1JMZA 1T22B 3LKPB 3O2WL 4Q9CA 3VWKD 2P24A 3WTTA 3BKYL 4NN6B 2WZ5A 1E9PA 3OKDB 1O5PA 2R9HC 3PP4H 4CJ0A 1GRWA 1P6FA 4KMLB 1P84K 3ILQC 3GHBH 4OD2A 4BJLA 5AAPA 2G2RB 2GAZB 3DBXB 4X9IA 3TESA 2IV8A 3HZVA 3WS6A 1QHOA 2DLFL 5LNEA 3KYMB 5EN2A 2XC8A 1HXMA 4Y5VC 4LF3A 1NBZA 3RWIA 3LXCA 3STLB 4DETA 1B4LA 5FYJH 3OJ2C 4OM0L 2XWBB 3DYPA 4ODBD 4TNEA 3GBEA 1KB5H 5ICZA 3FU5A 5G2NA 5D5MA 5A3IC 4I0PD 2ZKXA 3G08B 4K9JA 3R06B 3RB7A 1G6VK 1E50A 1S7XB 2K7QA 3LY6A 1N26A 2J8UA 4NN5C 3SE6A 1XCWA 3QUZB 3FB6B 1S7VA 1XR8A 2AK1L 4WFGE 5A7BA 5KW9H 3DMMA 1SXBA 2ZICA 4WJKB 5IG7B 2ATKA 4JM4L 1RJCA 4IHBA 1A7OL 4JPKL 3MBED 4W9HC 4XBPB 3ZTJG 4S0TD 3MRKA 4F20A 4HETA 1E6JL 1QVOA 3RZWA 5SX5K 3MN8A 2ZOWA 5GZOD 5IJVA 4QRSB 3P3UA 1XF1A 4C83A 3PQSA 3QXUA 4PJ5A 2C7UB 4ZTPL 2C1OB 1OQXA 3UBXB 3EJUA 2H3XC 4XMVA 5JMOC 1C9SA 1T2XA 4KNSA 5EBGA 4QTFA 3V0HA 3F58L 4QRTA 4JS7A 3MV7B 4ZO8A 2WNWA 3WEXB 2F53B 5MENB 1AZBA 2HKFH 2CIKA 2VW7A 1FG9C 3LB6D 5G38A 5C70A 2B4CH 4PRPD 3AGVA 1U3HC 2WLKA 3WGUB 4CMHC 4ZFOA 3FQ4A 3EBIA 4N2MA 2OMTA 2X4OA 4FNSA 3UTOA 2QDVA 3IPFA 4LHUG 3MLYH 1I8AA 3D9AL 2YPVA 2IOMA 3P4MB 2R9HD 1MHPL 3RGVD 2QMKA 2VXQA 1B0WA 2RFXB 2F15A 2BVOB 4NO3A 3U0TA 3ILQD 2OA9A 5IMMB 1DVUA 2X3CA 3D18B 4RL9A 3IE4A 1FFPB 3MJ7A 4ZMOA 1NEZG 2JWYA 3C6EA 3S37X 1WC7B 4UYPA 1UOLA 3QUGA 3AA0B 4E9LA 4XHQA 1T5WA 5B38G 3TA3B 1IM9A 1EZUA 3SOTA 3HHSA 2YARA 4N9OB 1KTDB 3FHQA 3EFFB 5C7XL 3M1CA 2MCG1 3VM5A 2RCSL 5A3ID 4KY2A 3ZKNC 4KKPA 4I2XA 5FA3B 1QKZH 3V7AE 5EBLB 4BFGA 5ESAB 2FWUA 1BMZA 5ICUA 3WS3A 1WFNA 4MNGB 1MNUL 4FQEA 1YSOA 2ITDA 3BXNA 4FP8H 4YPJA 1IM3B 5CZKA 5IW1B 1YEKH 2I9TB 1DEEA