2YPVA

Crystal structure of the meningococcal vaccine antigen factor h binding protein in complex with a bactericidal antibody
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
242
structure length
229
Chain Sequence
b'GLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSRFDFIRQILITLESGEFQVYKQSHSALTAFQTEQIMVAKRQFRIGDIAGEHTSFDKLPEGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYNQAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOPROTEIN
publication title Defining a Protective Epitope on Factor H Binding Protein, a Key Meningococcal Virulence Factor and Vaccine Antigen.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 57
structure length 229
sequence length 242
ec nomenclature
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 2ypvA02
2.60.40.1980 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ypvA01
4AYID 4O4XA 3PQUA 1YS5A 3V8UA 4O3WA 3VE2A 4AYEC 4AYNA 3HOEA 4O49A 5T5FA 4U9CA 5EE2A 4QQ1A 2KC0A 2W81C 3PQSA 2Y7SA 3HOLA 2YPVA 4AYMC 2KDYA 3VE1A 4AYDC 2W80C 4O3ZA 3KVDD 4O3XB 4O3YA 4O4UA 3UAQA 2LFUA 4Z3TA
chains in the Genus database with same CATH superfamily
5ESVA 4GT7A 3HPJA 4NRYA 1B9ZA 2KPNA 3NQKA 3T4AC 4LLUB 4JM4L 1YEJH 2BXYA 3HPLB 3MLXH 4X7SH 2XWDA 3TZVB 4C56E 1AOZA 1DO5A 1LILA 1BZDA 5CZXC 5PRNA 4FQLH 4QXTB 4I0KA 1UOKA 5DS8B 3U0PA 3BVXA 2V17H 3V7AE 3BQUC 2E86A 4ZFZB 1F11A 4PP2B 3W82A 3IFLH 2OMBA 3G5VB 3ILDA 2FO4A 3PGDB 1F4XL 4GO6B 1BAFL 1P4BH 4UDUA 3NA4A 4QTIH 4DPAX 3NRPA 1KJVB 2X9KA 4M1DL 2NLJA 1A22B 3ESNA 1JD9A 1DQJA 3VWJA 4Y4KD 1I3UA 2I60L 1BCIA 4I9WD 4WUUA 3NK3A 2NXYD 4F91B 1OT4A 3EW3B 3EJJX 1NAML 3OZKA 3CJJA 3X12A 5A3IC 5T3ZE 2OMYA 4HKXA 1E7VA 3VXNA 3RIFK 5CD5C 2WUCH 4URTB 3WFBH 3DI2B 1Q4NX 3FRPB 4EIBA 1C9SA 2Y06L 4FQ2L 2HFFA 3FTZA 3W0WB 2Z93B 4LVHB 5GGRB 4ZS6D 2RMNA 4YPGA 3HWBA 2WOYA 1LEKB 2XQBL 2WINA 4JRLA 3ZL4L 3ARDA 3SE4C 3ZT7A 5I19H 3L8QA 1J5OL 1NC4B 1N19A 3N42F 2EQDA 4PRPB 5AAMA 1KIPB 3V0VA 5INDB 4B0MB 3QB7C 1G9ML 2YBGA 3ZUNC 1JHKH 4P23A 5E03A 3KGTA 3MRJA 5IR1B 4L1BA 2M83A 4GKLA 4NRXA 4OZFB 5DEGA 4JHZA 4KJWD 5DXWA 4R4NC 1NCWL 5KJ4A 2EC9T 1ZGLB 5EN2B 3IAPA 4M7ZB 4U1GB 1DVXA 3AXLA 5EORL 2B14A 4UBDC 3U25A 2C5DC 3MLPA 4YBQC 4FRTA 3BUIA 4DGVL 1KIUB 2QSVA 2JLLA 2IGTA 3QUXA 4FFWC 4BE6A 4OR1A 5B3SB 2JKIS 2XETA 3PORA 5HHME 3GJEA 4HQQL 1CPUA 2FD6L 5EU5A 2HT4D 3HVDA 4UUJB 2QSTA 5B7FA 2VR7A 2JJVA 5DUMH 3JBG7 3Q0HA 3QA3A 4OT1H 3N2JA 3QCTL 1K5WA 1OVZA 3QQNA 1FNGA 3V0DA 4Q74A 2HSIA 3KNBA 5DDHB 3MV11 3TIDA 2R7EA 2ZX8A 3MREA 4JFFB 5L2KD 1LEGA 3B7YA 5MEQA 3K0YA 3PIQB 4R90H 2VZOA 3IFPB 6PCYA 4J4PC 1BMGA 4AGOA 4Z3HA 2FX9H 3M86A 4DP1X 3TWCL 2QADB 3F00A 4FTDA 4GI8A 2CHNA 3MCLH 1JPTL 5B3JE 1Z6JT 3D0LB 3S96A 3LKPB 2ENPA 1X5XA 1NEZA 3EJUA 3GC3A 5D2LE 3DJTA 3N41B 4NENB 3D39A 3ZTNL 1MFAL 2YAEA 1OAZH 2EECA 4AK1A 1MQKH 1NL0H 2YD7A 4OLWH 4X6EB 5J56B 3OR7A 2VXUL 3DBXA 2YRPA 2NRDA 4JG1L 3N43F 3FRPG 3WIAA 4ACTA 2VLMD 5DMGD 6PRNA 3VXRE 1S7XA 1LO4L 2ZOOA 4M29A 1ZV9A 3TU6A 4MNGA 3GHPA 4LPTA 1T2XA 1X9UA 5B1AB 1U8KB 2FBJL 3SDAD 2H2PC 4QRQA 3RFZB 2W91A 3FZUD 3U1SL 2Z7YA 3GO1H 3T3PF 4ODSL 1F8TL 4DO4A 4UQCA 2X0WA 3ZZ1A 3ATEA 3GXFA 2XWJB 3KDMA 1XMEB 2HTKC 2FJFB 4PTTB 5E5LA 2R8AA 1TSHA 5B4MD 5BS0D 3QUZA 3VFWA 4OZFG 3BWUF 1R5VB 3F7LA 4FABH 3VWKC 2R83A 2N2MA 2VDRL 2YPLA 4K7PL 2PTTA 4IMKC 4A37A 3CXDL 4ETQB 4OCLC 3SKOB 3JWOH 2DWDB 3QQDA 4UB6O 1BVLA 2A4ZA 1WIUA 4I4WA 4UZUA 3TVMD 1TTRA 4ZX4A 4X6FA 1WZKA 2VZ3A 2BWIA 1BIIA 4JBSA 3AAAB 3N91A 5FWRA 3ZDYE 4YSOA 4XNKA 3GMMA 4NJ9L 2P45B 3HZKB 5IVZA 5JMOC 2IAMA 1TJGL 1I3GH 4XP1L 3L9RA 1AKJB 3WJJA 5B39B 4X9HA 2WY3B 4XBPB 5KBLA 1VAHA 3IK2A 4XO9A 1QUPA 4X7TB 8CGTA 1PZDA 2PCPA 1P7HL 1PS3A 3FO1B 2E9WA 2X27X 2DOCA 3LIZL 4FXLA 2F8VA 5A2LH 1B4TA 4R6UA 3D4ZA 2BSSB 2Z0UA 3ABMB 5CU5A 2GCYB 3FO9B 3G5ZA 4HWEL 4XO5A 4IBYA 3IDIA 3ORJA 3PHSA 3MUGA 4HWBL 3AG4B 1CD9B 2QV4A 4PJ8C 4X2UA 5G5DA 1HT6A 1XIWD 3NACL 2APVA 3D3VB 4JM2F 3OAYK 4E1TA 3K2UH 2Z7WA 5DHDA 4EJ1C 3CFBB 3PNWA 3QI9A 3AS1A 3ZOAA 4P8QA 2ZXAA 2V5SA 4PJDF 2LAGB 4H26B 5KANI 2NX5A 3EH4B 2CXKA 2CO6B 2C7FA 2H6OA 3TV8A 4P9HL 4XXWC 5T1KD 2VLJA 4JM0A 4NX0A 4CVZA 1IC1A 1CE1L 1FO0L 1N5AB 3IDNA 3O0RH 4HV8A 5TQ0L 4I3SH 3NFNB 4UV7L 1WH0A 3TEZA 3S97C 5HDBE 1SBSL 3QR0A 5GS0H 2QGEA 5ERWA 1HCFX 2VSCA 3B9KD 3L5IA 4HF5L 3AADB 1EK3A 4UILH 5DJDB 1AHWB 5AZEL 4M48H 4Y4FC 5AW7B 1Y18B 1QO3B 1TF4A 2F53E 3VFNB 2FR4A 1T5WA 1QR4A 2V8LA 4I2XA 4LE8A 5F6HJ 3C5SB 2H2SC 3MRKB 2WZ5A 5AW2B 4IIQC 3WLBA 4AQAA 3LEXB 1U8CA 3KYKL 4RAVA 4PY8I 4PB9L 3F6JA 1E2ZA 2G5BA 1JPGB 2YEZB 3EBGA 3Q1SL 5E94A 5HHMB 4Y2DC 1DTUA 1GSKA 4QHMA 4QIRA 1F6LL 2FO8A 1CDUA 2WYTA 5FYKD 1MRDL 2EE6A 3WO3B 3BWZA 3OF6D 4GPVA 4HKZB 1NCAL 1AR1C 5D4QA 3ZHDA 5FHBH 2CMRH 5ILTL 3V7AG 5B39G 3TBSA 4NWTL 1IJ9A 1YN7B 4XNLA 1T7XA 4GKNB 4GKSA 3E3QC 1FVDB 2WSDA 4HDIB 4EAEA 3K5RA 5DJYA 1AD9B 5I18H 1SXBA 4W9HC 1UUSA 3FF7A 3NFPB 5DRWA 5AW8B 1KELL 3KLAB 3REVA 1NGPH 2BOCB 3BIKB 4HUWA 5I17A 3EBIA 4QEGA 3BZEB 1XH2A 3D25B 5I82A 1M6OB 5D2LB 1R4XA 1RSFA 1IBFA 5JOFB 2QJDA 3U4BH 5KYYA 1WFMA 1QI4A 4NQCE 5IBTH 4FFVC 5DD0L 2XXFA 3P4NB 1W0VA 2X4RB 5C0BE 4WHTA 4GRLA 5CP3H 4BSVB 1PG7H 2VMCA 4KVPA 5C0EA 5HDRA 3VXRB 3GSVB 3QJUB 1JZ2A 5IROA 1CXFA 3P0GB 2B9BA 2GW5A 2WO3B 4JQIL 4U31A 4JPIB 1ECZA 1N7MH 2XN9E 4PJGF 1UCBL 3GUFA 3NESA 4ES8A 1RZGB 4DZ8B 2DICA 4OFYA 5DVPA 3VXPB 5TE7H 3TN0D 4OSUL 5GZNC 5EPMB 3R06B 5KAIO 4R3SA 4HPOH 1QSFE 3QIBA 4Y5YB 3QZWB 2BP8B 1AQDB 4LFHD 3U2IA 2ZUTA 1QTYT 1L5GA 2C1OA 1HXMB 3L2MA 4LT7A 4MLSA 2R2CA 4HS8L 1SJEB 4ALAH 1KACB 4UQ3A 1S7RB 4P2OD 4FJYA 4B60A 4NHCL 5C0FA 2JIXD 2XY1A 1DBBL 3D2UB 1IL1A 1QFOA 4IJ3B 2OJEB 3C8KB 3LXBA 1DCLA 1S5IH 4LCYA 4MJ5B 3ZDYB 1GW0A 1IAKA 3SPVA 5C0RH 1AGFA 1AGBB 1A1OB 2VDPH 2YPVL 4BXSV 3O6FD 3K8LA 1OAJA 3BEWB 1NSNH 1NLDH 1Z9OA 4E42B 2AVGA 3B9AA 4LK4A 2IWEA 4XVUC 4ABQA 4LCVA 3BKML 3OB8A 7PAZA 1QJ9A 3ULUL 1KPVB 3Q5YA 1I7ZB 4F2MA 3A23A 1EEUA 1BZEA 3DTDA 5F1SA 4C54A 3DARA 5JPNB 3PS6A 3L16A 4HUCA 3B5GA 1AD0B 4KK8C 4N2BA 2LLGA 1SHMA 2AQ2A 4J3OF 5DHVH 1RJCA 3FHEA 4LRNH 4Y2OB 1MCNA 4YDNA 1KIQA 1KTJA 4RCAA 4C55A 4APQB 5GZOD 1TYEB 2Y1VA 5I5MA 4NNPL 4O2CB 2ZSVA 3ULVD 2BWQA 3IJHA 1NFIB 3KMDA 5GHWL 5FKPA 1AFVL 2HAZA 4ENED 4YHOH 3OX8B 2G4GA 4RETB 3QUGA 4U49A 3V4VB 4N4YB 4WK0B 3ARBD 1XF4B 1RMFL 4TSCL 3TL5A 5F72S 1FA4A 4M6NL 3CZFA 1PD0A 2W81C 2WD0A 1OOAA 4M1CC 1KGXA 4M6ML 4MA7L 4JKWA 1NEUA 3KEHA 3PCYA 1L7IL 2OTPA 5DMJB 4JN2B 1IEAB 2QEJA 4PD4J 4Z7UA 1M71B 3ROOA 43C9A 5HDBB 4N85A 3ECWA 1RXLA 2HN7B 1RZIB 2FEEI 4S1QL 2XUWA 3QZWG 5DJZA 2F53B 4OQTH 3VSTA 4NERA 5E8PB 3IB4A 2RAMA 3TCTA 4Z5RA 5D7IF 4HK0B 3RPIA 3PHOB 4BH8B 4WFHD 3GBMH 4PJFE 2QQKH 5K9JL 5C08E 4TNWF 5DWPA 1J9QA 1H5BA 4JHWL 3DO4A 5KYWB 1MZZA 4DP8X 4FFYA 4FHJA 1EEZB 4KOCA 4A2GA 3RVWD 5LGHH 3OKEA 4D3CH 4LLAA 4BHUI 4AQOA 5DVNA 3PJSB 3WNLA 2PP7A 1RPKA 2EE2A 3VFUB 3WEMA 8PAZA 4QY8B 5DA0B 4AKOA 1DBMH 4TUJA 2CO7A 3VXQA 4WSGA 1FJ1B 4N0UB 5FKAB 5LAXB 4QRPD 4AK2A 1K5NB 3GIVB 1OW0C 4I8DA 2IC2A 4PGEB 4P4KD 2NY2B 2HT2D 5ACZB 2GSIA 4PJ5D 1BD2D 2G3NA 2G75A 2PW2A 4KVNH 3RHWK 2FQGA 5H37G 1A7OH 5KVEL 3HI6H 3C5ZB 2MCG1 5SWQA 2HG5B 2XE5A 1RLBA 4NPKA 5IWLA 1T21B 3HNVH 4NQCB 4O3YA 5C0IB 2A0LD 5JDPA 5IY5B 1KTLA 5C0BB 1XZWA 4OZIE 4TQEH 2G0KA 3T0BA 4WI3A 4XXDB 5MI0B 4ZW5A 2O5XH 2MKLC 3MBEC 4F3FB 1E2WA 1KY6A 4F92B 5TD4A 1OM3L 5GRWA 4H8WC 3T1FB 2BDNL 2XN9B 2WXFA 5T3ZL 2GJ6D 4P5TC 3TLRA 4GLRH 4QJ5B 2AXJA 1YJDC 2A9DA 2KL6A 1OQXA 5J9PB 4XNUH 2R23A 2XIDA 4AVJA 5DRNB 3B1TA 1THQA 3CFKB 1HWGB 2X2UA 2QR0B 1ADQA 5F9DC 4LVNB 1QSFB 2FEDD 1E28B 3V6OC 1P53A 3GGWB 1NM9A 1UD4A 4W4OA 2JKXA 5AB9A 2ZONA 5DFVC 5CUSL 3S4SB 3FUFA 2NT0A 1G7MA 4Z23A 4YSUA 4A39A 1EDYA 4G80A 5ENWB 1U93A 4ZSOE 5AVSB 1QZ1A 4HXAL 5IJBC 3CBKB 2CG9X 3K4AA 3PAUA 4XT1C 5J7CC 1HL9A 4K3EH 1HXKA 4MA3B 5DL6A 4Y4HA 2N59A 4R26L 5L9DL 1XX9C 4OQ1A 1AP2A 4R0LA 3GMRA 1OGPA 5EU4B 3GI9H 3WFDH 3K71B 3QDGD 1K4CA 2L04A 4JZNB 2ADIB 3QJHB 1TKWA 3M8OL 3AREC 5HVHB 3UTOA 2PR4H 3O3DB 4E9YA 4TTDD 1GGBL 4XCYB 4U4BA 2BVOB 3A0BO 2VDQH 1LP9A 4XAWH 1JOIA 1R47A 3BT0A 5D1XA 4CDHA 2NZ9C 4KTGA 1ET7A 1ASPA 4YO0B 3HAEH 3NIGE 4XNQB 3IFOB 1SHSA 4RZKA 5IV2B 4Z3GA 3ZTEA 2I9TA 1YMME 1MM4A 4OJFH 4K5PA 4X8GA 1SNRA 1TTBA 3CFQA 2FEEL 1WWAX 3OLGA 2KPWA 2K8MA 3UZVB 4RGND 3M1OA 2CPUA 2GIMA 3BZFB 1J0HA 5JHLH 4PJDE 1Y0LB 4GH7B 5A7EA 2X2IA 2VXVH 1D5MB 1Y1UA 1JV5B 4RGOL 5FCUL 4PJXF 5D5MA 5DRXA 2OL3A 1PW3A 4S2SB 3NT0A 2BY2A 1R3JB 3N42B 1DDHB 1WBXB 4DP9X 2OMVB 2XQYG 2HLFD 3HOLA 1XEUA 2PYED 1GCFA 2X4PB 1AGEA 2A6DB 1J10A 8FABA 5LAPA 4IQHA 4BFKA 4IK7A 4PJ9C 3U6RB 3U4EA 3E2HB 4UB0L 3V0FA 4AV4A 1BXXA 1TETL 3VI4A 4U1IA 3QJQB 5G4OA 3O3AB 1VGKA 5AVUB 3S4SG 3LB6D 4PBDA 2Z92A 5E6IA 1W8NA 3L95A 1MCPH 5C08B 5IEHB 2WGNB 1WBYB 2NMSA 3H9SA 4N2GA 5EU7C 1BQHA 4MZ2A 2DDQL 4JFDE 3S34L 5I1JL 1M1SA 2VQTA 4YNYA 2ADYA 4OGYL 4LPWA 1RP9A 1EDHA 4W9KC 1MCCA 3CSBA 2A9CA 3JT0A 4M8RA 1IM3D 2CIIA 4X5WA 3NABH 3STZB 2X41A 3WOVA 4U3SB 1OAXL 5BRZE 2VLRB 1FL3A 5GGSA 3W57A 2W8CA 5KSAD 3X11B 1KGUA 1OK8A 3P73B 4TRPH 2FHBA 4AMKL 4J23A 3TA3A 2Y24A 2ZIDA 1GGCL 3NCEB 3ZDWA 2C34A 3O8XC 4YDJB 3HS0C 3RA7H 3L4TA 2Y7NA 1KEML 1F4YH 4GKZA 4KK6D 1FFTB 4Z7NF 3FQUA 3MODL 1HEJC 3MTXA 1Q72H 4R83A 3UG5A 3BUYB 3AWFA 3VG0L 3CZKA 2YD8A 2EEXA 2IDQA 2AEPH 2IH3A 4CMHC 1AQMA 4LBEB 1H3WM 2VT0A 4MS6A 1NCCH 2Y9RT 4LRIC 1UGKA 4IYKA 5BO0D 2HZHA 5CMAA 4NWUL 2UZIL 3RUGA 1NUNB 3SO3C 5I0YA 1UXWA 4LQFL 5DUPL 3UDWA 5G38A 3E1ZA 1TZHB 5EF3A 1U8MA 5HJDA 2EYRA 7CGTA 5E6SB 2QKIC 1HH6B 3M17A 4G7RB 3FTWA 4TQHA 4LCWA 5FA3B 5FF6A 3T3PB 4LLMA 5D70H 2J1WA 3MJ6A 5HYSA 1FORL 1CT8A 1RZKC 3JV4A 1RPUA 5F7NC 1N67A 3GFUA 3VFOA 5HYQA 2PO6A 1W9XA 2DYPA 4TULH 4UTBL 4BCYA 2AK4A 4FZEH 4M7KL 1AGDB 4C4VA 4NN5B 4DSYA 4AFKA 5JZ7D 2BMKB 1KXVA 2I7SA 4KJPC 4MAYA 3QORD 2OYPA 3M6DA 5FGCE 4U0RC 1N59A 2D3VA 2FATH 1U2CA 1E5ZA 3I9IA 5T33H 3V4VL 4ZQKA 4K3HA 4OGAC 3WD5L 2M8XA 1I1YB 5C0CA 3O9WA 2P24B 1BVKA 1WTGT 1JFQH 1MPAL 4ELMA 4YQXH 1F02I 4MQ7B 3TH3T 1O9WA 1TQSA 3J27A 5EUKA 1JZIA 3HHRB 1Q9LA 5EFIA 2P5ED 4JQVC 3W39B 5IKCB 5ANMA 1K2DB 5HGGS 2CR6A 2ICWA 1HZLA 1A4KB 1FIEA 3LH9A 1MIMH 4L5FH 3T0DA 1RUML 3G6AA 4LKCA 4JPKH 4AG4L 5CBEA 2XG5B 3VSUA 3FUNA 4PRDA 1XH3A 1I7RA 4R5VA 5T1DL 2CNZA 4AI7A 3H6JA 1IVTA 1MVFA 1A21A 2LW3A 4UMGA 1QLFB 1P5UB 2R0ZH 2XTJC 4BUHA 5J6HB 3SPIA 3TS8A 4PRAA 4ZTOH 3ZKNC 3BZ4B 1X9LA 3DMMD 3RAJH 4L3ED 4AT6B 3ZRCC 1HAWA 1BBJB 2JQZA 4EOWH 5FB8A 3HBGA 1QBML 1YMMB 4KKQA 2BFGA 2E7CA 4XO3A 2F8OA 1T4KA 2Y6SD 2O5YH 3DX1A 1TVDA 3RJDA 3MACL 3RY6A 2XZQH 1WZMA 1YS5A 2WVVB 3D7PA 3CVCA 4PJDB 4UIKL 3P3RA 2FCBA 1V3LA 3UTTE 1CICC 4H13C 5E79O 1KN4H 4UAOC 3CHQA 1HZKA 2YOAA 3R19A 2B08A 1HVXA 4GSUA 2B7DT 3C8HA 4BFIB 4MCZA 3ET9F 4N2MA 1CB4A 4KPHL 3UAJA 2YIHA 3WY1A 1R34A 1DQLH 1TYRA 1IAIM 1U92A 2V2WA 4JJ5B 4J3SA 4PRHE 3GBDA 2NXZB 5I6KA 1G6RH 3I3DA 1GZQB 3SDYH 3SKMA 3RDTD 4NOBA 2AJ3A 1U8LB 3QIWD 4QLWA 2A77L 5E5MA 4IOIB 3CWGA 4GW1B 1V55B 1L3WA 4G6JH 5D7IE 3WKMH 2WLIB 4A7TA 1MIEH 2AV7B 2WXJA 4GAJL 1ZHWA 1HSAB 4XOBA 1QQDA 3BVNA 3B9EA 3KJ6L 4AZ8B 1DVYA 5J12B 2IWKA 1Q0YL 4LPCA 5IHUL 1SM3L 2W0FA 5IB1B 1PSKH 3ARWA 1GTFA 1BYPA 3MFFB 2XOTA 1A8JH 1T80A 1ZV5A 2AFNA 4PMFA 2O6DA 4OM0L 5D1QA 3QAQA 5TJWK 5C0DB 4GT0A 4HGMA 1QHOA 2R0WH 2AXGA 3DOIA 2N7AA 4WUUD 3HG0A 5FW7A 4ZZKA 5BRZB 2ZUXA 1A14L 1AJ7H 4DGYH 2KXPB 1CK0L 3N9GH 3NEOA 4RDBA 5CJQH 1PZ2A 2CLRA 3UTPE 3AAEB 3CIAA 1OTSC 2J5LB 5EO9A 3MV7D 2RQEA 1AXSB 2OV0A 4AQZA 1RJZB 1D9KA 4A7QA 1R3HB 5IHZB 2UXVA 4Z7IA 5GGTA 2Y3AA 2I9LA 3CFEA 5K9KA 1S7UB 4HCGA 1CXIA 1OTUC 1EZVX 5FYLD 5FA4A 5DR5H 4HUVB 3IETA 1L7TL 2DQIH 1MAJA 1RK7A 2PMZA 3BQUD 5F71A 3W1ZA 3AY4A 5FX3A 4QHLB 1Z32X 3ZHLA 4DQOL 2CUIA 3OKDA 4NT6A 3SKJL 2BC4B 1RZJL 4I3GA 1S9WB 1J9CT 3FU5A 4P23D 2P8PA 5AVQB 4QRBA 4J3BA 2DBLL 4JY5H 2Y69B 2Z4QA 4XXCA 4PJGB 3INOA 3M1BA 2DQUL 2EYTA 4YGAB 1XGUB 2ALAA 1WIPA 1E9OA 5EWIL 4MYWB 3DPBA 2GY7B 4LDLB 5A3ID 1HQ4B 4FYTA 3L3DA 4R97B 2F19L 5CD5D 2CRZA 3AU1B 1T83A 2F54D 4DVBA 5HHQA 5D1ZA 5FGCB 4JMXA 3RZCA 1VACB 2F58L 3D05A 1JHLL 3ULVH 2DIBA 2GUOA 4U1MA 1X6LA 1VSCA 3D4CA 1G9HA 4H20L 1JCVA 4PJHF 1XCXA 1H6EA 2DBJA 4IS6A 4L29A 5FO9A 4DKDC 4EUPH 3PP3K 3C9NA 4Y5VB 5IEKB 2NYYC 1R24B 5JHDD 1EQWA 1JK8B 2SODB 3BUTA 4AKPA 3T20A 1T0MA 4KUZH 1BECA 1BQRA 4EZLA 1M1XA 3G5XA 3NIDE 5ITFA 1EZUA 1LTXA 4X9IA 5JMRA 1U3NA 1OB1A 5ICXA 3LRHA 4PJAF 4HUKB 4U1HA 4PUBH 1AO7E 1S3RA 3TJHC 1A9BA 3DK0A 1MHHB 1JZFA 1O7DC 5DD6B 4UBDD 5DU7A 2DJSA 2V2XB 3BH8A 4YBQD 3FUMA 5D8JL 5DD5L 3WN5B 4FFWD 3RWHB 1YLBB 4KX9A 1X5LA 3BPOB 1LEIB 1Z9MA 5G2NA 32C2B 3L9EA 5L8LB 1ORMA 4Z8FH 3GI8L 5I2IB 2VL5B 4AJYV 1A9EA 4YUEL 5IF0B 4IRSA 1KGCD 1H15B 3HMXH 4OVVA 4ODTL 3SYSA 1A6AB 2ITCA 2XKNB 2LFGA 1FNHA 1UA7A 4PJXE 3D1MC 2RFXA 3UEZA 2B3IA 5TDOA 1WLHA 4M93C 4J4PD 3REWB 2WC7A 4WW2A 1KBKA 4N5EC 5KYUA 1K85A 3WIIL 1R3KA 1N10A 4QRUA 4HEME 4UQ9A 3QUZD 5T8IA 4QRRE 5DEJA 3WY2A 2WO4A 1INEH 2ZYRA 4CAGA 4OF8A 3HUJE 2AJZA 4NQSA 3MRDB 4R2GB 4WV1A 2E27L 4PRHB 1KCSH 2LHFA 2GABA 3TT3L 3QJSB 2HPOA 2YKLL 1T7ZA 1I4FA 1AQKH 3QHZH 4FF9A 5D7IB 3DGGB 4KDTC 1EEQA 3IMWA 5F9OL 1ZHNB 1J1OH 4A7UA 1W8EA 3HRPA 4OZHE 2WLJA 2VLLB 2H2PD 3LQMA 1XT5A 4QJ3B 3NYKA 4W93A 3C6LC 3FONA 4YHKH 1I9RL 2OP4L 4K23H 1RU9H 3IPFA 1HYSC 1DLFH 3IAQA 1R3LA 3QG7L 4RFOH 5T1MB 4JZJB 3FULA 1DZ0A 1TVHB 1RUQL 3GSUB 4LNRA 5JPMB 4EKXA 1ID2A 3VWKD 3B34A 2AV1B 1T7WA 2VR9A 4S1RH 4M61B 5TH2A 3H2PA 2IMMA 1ZA6B 2ATPA 4HUXA 3SDDA 2XX1A 1SVCP 1A64A 1A5FH 4EMZA 3T2NH 1ZJAA 4L8SA 4ZFGL 4H2CA 1RZ7H 1YEIH 2GC4C 4WI6A 4W6YB 4J3OG 2WQSA 4LCCA 4MCYA 1B0RA 4GW5A 1T1LA 1WWWX 1YEJL 3MLXL 1VJSA 3BP7B 2XRAH 3R7QA 2I25N 2IJ0C 3SQRA 5SWZE 3JV6B 3QVAA 15C8H 4FQLL 5IBUB 2PXYA 3RGBA 1OP5K 4R84A 2V17L 1CFTA 4Z3FA 3MLTB 4AYDC 4G8FB 4QXUH 1K8DA 1MXDA 2GEQA 3IFLL 3MMEA 2QQNH 2YSTA 1P4BL 4FTVD 1UFGA 2XPZA 1O5DT 3QJVB 4QTIL 4W6WB 4A6YH 4DO6A 5IB2B 1KC5H 3LIZA 4H8QA 5EEVA 4CW1A 3F2LA 3FT4B 4PJ8D 4IBWA 3RY5A 3WS6C 2WTPA 1L6XA 4I88A 1S9VA 3HE7B 3EO9H 4HWBA 2FZ3A 4Z78B 4QCIA 3D0AA 4K07A 5GS3A 5FFGA 4JEGB 5FYJU 4NSKA 4LSFA 4NC2B 4MASA 1U8OA 2WNKA 2NYKA 4IU3A 1X5GA 1HL4A 3QEUB 3LK3A 4OJCA 5IB5A 2WUCL 2HVBA 1ZLUK 4I5BB 3BC9A 3UAFA 1OM9A 4LPXA 5K1JA 1QTSA 4NRZB 4PJ7A 5EEZA 4K94C 1IEBA 4GSXA 2EDWA 2EKSA 3M1CA 2ZT9C 1WZ1H 3A22A 2HB0A 1FO0A 3A6CH 2NCMA 3KPSA 3EYUL 3W38A 1Z5LA 5I19L 3CMGA 1ZDSA 1AMXA 3NIDB 1JZHA 2LU4A 4XRCA 4Y5XB 4BGDA 4X6CA 4FOZA 1ULVA 4HUMB 5IMMB 3ULVF 1FN4A 3L7FA 2H2SD 1M2VA 4FKEA 4ONHB 1AO7B 2EP6A 1JHKL 4NQXA 4AMWA 4RA3A 1REIA 3TBYB 3IF1A 3TIEA 4RIRB 4PWHA 5GISH 2HFTA 2CXGA 2VDPB 1K72A 4FFTA 4FQXC 1HXUA 1EVUA 2X7LA 5E9AA 5CCJA 4FERA 4RL9A 4Y2DD 4R7NA 3QBTB 3NBNA 1RIVH 4Y9BA 3L1GA 3FQTB 5F7MC 4LSHA 3ATFA 3F04A 3OLIA 5AVRB 2AABH 2Z31A 1E65A 4XMLH 1AR1D 2GAZA 4JKPH 1QLRB 1QVOB 1UH3A 5E2WH 5F9WB 4D8PB 5JQIB 2I5YH 5I8KH 2A6JB 4Y1AE 2ZCHH 2EXTA 4PJXB 5I1HH 1KLFA 2DN7A 3H42H 4FHBD 5HHNB 4H4NA 4NHUA 5DUML 4WSJA 5IBUG 5HYEA 4RMRA 5MEND 4OT1L 3ZYIA 1VRSA 1GW6A 1P2CB 2LOEA 4P3DB 1G9NC 3BQVA 5DGQA 1I31A 1AGCA 4R90L 3HUJB 1D6EB 3FBKA 5T3XD 3TZVA 3V4UH 2OA9A 3ETBJ 1OSZA 5DJCB 2FX9L 4ZW6A 2A83A 5L2KE 4FFVD 3NN8A 4QXTA 5DS8A 3MCLL 4N2KA 2NY5H 4MA8H 5DQJB 2E47A 4FQQA 4BCXA 4AKRB 4ZFZA 1A6ZB 4PP2A 3WDIA 4YX2H 1URLA 4BCZA 3G5VA 4I18B 4HVBA 3PGDA 2R1YA 1H3TA 1OAZL 3DV6B 3ZMRA 1NL0L 4OLWL 1KJVA 3F84A 3OXRB 5AAPA 2X4QB 3IJSA 4AL8H 2XYCA 1AKPA 4GY4A 2I85A 2YSSB 1ZVYA 2F0CA 3JWNG 2XKSA 3TJPA 2E46A 2FBRA 1T89C 3GRWA 5GZND 3UYOD 3B56A 3KBPA 3EOYG 4FHKA 4P57B 2W88A 2YWYA 4NXKA 2VLME 2VR4A 2G2RB 3LZPA 4HOMA 3AMKA 3W3BA 4PG9B 5CJBA 5FC9A 4YHZH 4FZNA 2HYMA 2X1WL 3FRPA 4YXHH 4P46B 1RD6A 5EG6C 3US1A 3RL2B 3VD1A 2ISDA 4RSYA 5GGRA 4Z7NB 2VCOA 4FABL 5FWQA 3TO4A 3ETTA 1TTFA 2AXWA 4AGPA 2MQGA 4PRPA 3RVTC 1HH9B 4HIHB 3IYLW 3ZIYA 5BS0E 1KIPA 3UBXG 3QIUB 4PWIA 5INDA 3TGXA 3JWOL 4J3WA 2IANA 3OC5A 3RGVC 3X14B 3GM0A 5IR1A 4TNEA 5SWZB 3WIHH 3MRPB 4OZFA 2BPBA 1L6PA 1XFPA 2H1LM 1J9SA 5HGAB 3TBTB 1ZGLA 5EN2A 1I3GL 3A0OA 1S5HB 1UQSA 1E27A 1HINL 2AXHA 4KK8D 1CUOA 1KIUA 4LSTH 4XPTH 5IFHH 5B1JA 3O3BB 4AM0Q 1AXTH 2Q87A 3IT8D 4FA6A 1AR2A 1JDCA 4UUJA 3FFCD 2IPUK 2ZICA 2MQCA 2XWTB 1GRWA 3OAZH 3P3SA 1I8KB 1SMAA 2ZXWB 4XMWA 5DFWH 1F2QA 4HWUA 3SODB 5DDHA 2ZWKA 1P7KB 3DNKA 1YEFH 4JFFA 2JTYA 2PWFA 5IW6B 3MOAH 3WI9A 4Y4KB 3MRHB 1IFHH 3WCYA 3IFPA 3ARFC 4RFNC 2NXYB 2AC0A 2X1QA 4JREB 3X1FA 3K2UL 1UA6H 2HRGA 2DWYA 4ZRGA 4A7GA 3L4WA 1XH1A 3DIVA 3SYBA 1YEKH 4M1CD 2EDXA 4M6AA 1UWXK 3NIFF 4JE4B 3D0LA 1H6S1 2F1BA 3LKPA 3NCXA 4JZOB 4EE2A 3D34A 3PWLB 4NENA 4OJYA 3WTSA 3V4PB 3VD5A 5ISZE 3LV3B 3UGUA 3O0RL 4KO5A 3IAGC 2MRYA 4I3SL 3WU1A 4HT1H 1GFOA 5GV0A 1VF5C 4XOEA 3Q05A 1DP0A 2XN2A 2CM5A 4LEEA 3VDAA 5GS0L 1D5ZB 4UILL 4S1DC 2DB8A 3L3HB 4HAFA 4I1PA 1KCUH 3CSGA 1U58B 4PVNA 1U8KA 3RFZA 3MLVH 3VI3A 5EH1A 2VTFA 1DQIA 3UROR 4MQSB 1SDAB 4DH2A 3IVKB 2VXQA 5FHAH 4ORZC 4D8OA 2WQVA 4F1SA 2VDQB 4Z77B 1T22B 4UQ2B 1AIFB 4PTTA 3PGUA 1FL6B 2ERJB 3IGUA 3IWUA 1Y7VA 1OB0A 3GTNA 4WEEA 1CFQB 1R5VA 4FD0A 5BV7H 1SF3A 1E6OH 5JOEA 3PXLA 4GSQA 5AFUK 1H3PL 5FHBL 2CMRL 1CDYA 4ETQA 3IMTA 1OXYA 1BLIA 1A4BA 4X5LA 5KSBF 3NSJA 1UB5A 2DWDA 3DYMA 4ZNEA 3A4FA 1DVFB 1TCMA 2YLKA 3DJZA 4HJSA 4I85A 4JG0H 3MUHL 4E9XA 4F58H 5I18L 2AMGA 5AVTB 5IMLB 5L2KB 2Q76B 3GMQB 3ZMNA 3BKYH 3DHMA 3HZKA 4NQTA 5FYLH 2F68X 1NGPL 4C00A 4DPCX 1AKJA 2OR8A 5B39A 1IAMA 3W9DA 4XBPA 1QNZH 4AYMC 4JDZB 3J07A 3U4BL 1F4AA 3MBED 2HVKA 4X7TA 1C1EH 5EB9A 1LHZA 4L2LA 2FH8A 2VITA 1LDPH 4K3CA 5D93B 2C9VA 3FO1A 1FP5A 1P4TA 1SHXA 4XO4A 3SE6A 3QQ9D 1PG7L 4FXGC 2CRMA 2BSSA 1RURH 1FLRH 2K6ZA 2KZ7A 4P5TD 2GCYA 2KZBA 3FO9A 5ETUB 2X4NB 3WEOA 1ZDQA 1RAMA 3D87B 3EFDH 3DHPA 5TDNB 2J57A 2ZX6A 1N7ML 2BIQA 3WNKA 3D3VA 1FGVH 1EA9C 5TE7L 5KWYC 5DFVD 5BZWA 3DZMA 3U6XS 3SDAB 4E36A 1WAAA 1YYML 3FSVA 4HPOL 5F21B 1BLNA 1B2WH 1AVAA 3JVGA 4E5XG 5CGTA 5F7KC 2KLTA 2CO6A 3SKNB 4BGLA 4BK5C 1IC7H 4WZ9A 1KULA 2HA1A 3BS0A 3VU1A 5E9NA 5JDJA 1LO2H 1Z0MA 3FB8B 2P5WD 3L13A 2J4WH 3WJLA 2ITDB 3NFNA 5AW4B 5BS0B 2HUHA 1TQBC 1ZGLP 5AVXB 2FGWH 2ZUQB 2KLRA 2EVIA 4AIEA 2KERA 4OCSH 3LHPH 5ACMA 3OGOE 1JIBA 5DJDA 1AHWA 2B3RA 3OHXC 4GLRI 1Y18A 1QO3A 1S5IL 3H3PH 2OJ1A 3VFNA 1QRND 3TYGL 5JW4M 5C0RL 5AOMA 3CHOA 3EYOB 3FAXA 2VDPL 2NZ9D 1NTDA 3TVMB 4JCHA 2F7OA 1NSNL 3LEXA 1MCWW 1XB8A 2HRHA 5F7EH 2YEZA 1JPGA 1IU1A 2ATKB 4JAMB 1IAII 4RDQF 4XVJH 4Q6YA 1SUHA 2FB4H 5JW4N 3MNZA 4Y8DC 1OPGH 5DI8A 4HKZA 1LK3H 3BLBA 3C6EA 1WS7A 2J21A 3LPPA 2FSDA 2XWBB 4RQQB 4EZMA 3SPGA 4NPJA 4R96B 4NJAH 1YN7A 4GKNA 1UZ8B 1FVDA 4HDIA 1GFNA 4LRNL 1QAWA 3UTZB 1AD9A 1TJMA 4FL4B 3UO8B 3KWVA 3QR1A 2APFA 4IOSA 3TA3D 5BO1H 4RBPH 1NIEA 4HMCA 3GXNA 3A5VA 3BDBA 3EOBB 3KLAA 4PCSA 4YHOL 4GKOA 1XIWB 3BIKA 1KTKE 4OUOA 4A63A 3BZEA 3D25A 5M95B 1M6OA 5I75B 5JA8B 2CBPA 4PJ9D 3TOPA 1UWGH 4N8UA 5D4HA 1INQB 1L3NA 1CG9A 5JOFA 2CNYA 3SDXE 3CG8A 2EO1A 3FAWA 4XNZC 3P40A 4BHUA 3P4NA 1U8JB 2X4RA 4WHCA 4BSVA 2DD8H 1R75A 2WNGA 1OHZA 5H2BB 3OPZH 3C60C 1RL1A 4MA1B 4KROC 3GSVA 5HHPB 5T1KB 3BE1H 1WD8A 3NJMA 3DRQB 1CQYA 5F44A 4D9RD 3QWOB 1NDTA 2BSEA 2Z34A 4TNVF 3VCLA 4JPIA 5F7YC 2BCMA 2E6PA 4HHWA 3VXUE 3GBLA 4KUCD 1RZGA 1KTBA 4HBCH 3B9KB 1DR9A 3VRIB 3GBML 2QQKL 4WY7H 2X10A 2IDCA 2OMXB 3WENA 5EPMA 3R06A 2J4UP 2WCGA 2R2BA 4JG9A 3KLHC 1OOWA 3UG3A 4Y5YA 3QZWA 2BHUA 2DYPD 1AQDA 2X89A 3H54A 2BP3A 5LGHL 1ACZA 4D3CL 1XF2B 4JO2H 1FAKT 3O8XD 5L4JA 4A04A 1BJ1J 1HXMA 2FLRT 1WO2A 4IBTA 4NO0A 1N3NB 4KXCA 4MMZC 2JELH 4NYLB 43CAB 1SJEA 3C5XA 3T3ME 5CWSB 4ZTPH 4HP5A 1S7RA 5CJ5A 2BNQD 1GYVA 1DBML 1YEDB 2KH2B 3QRLA 3E8VA 4NNXB 3B7RL 3TF4A 3D2UA 1B3JA 1NQBA 2XZZA 1ND0B 5L4FA 2NQ3A 4MD0A 1MLCA 3C8KA 2WZPA 5I76B 4MJ5A 4Z9KB 4E9WA 5DC4B 5F7WC 1A1OA 1M7IB 3EDDA 5ICZA 2ICEC 4BDVB 3AQDA 5H8DA 4CSPA 1A7OL 2BRRL 3ZL2A 3MV8E 4FNTA 2QSCH 4IIZA 5DT1H 3E1F1 4PGZA 3E80A 4K8RC 3HNVL 1G6RB 4PSRA 4WK2B 2D7TH 1KPVA 4PJ5E 3B7TA 5E7BA 4OFQA 1OCWH 4HD9A 4TQEL 1I9IL 3AW5A 5JPNA 2VRAA 4MYPA 2O5XL 4PRNB 1N0XH 1FGNH 3CVHA 1VADB 5H37A 5E2TH 5CGYC 3SBWA 1Z9NA 3T0XA 4KJPD 3KL5A 1VZIA 1PRNA 3Q8FA 1LWHA 2FWOB 2NNCA 4JL2A 3ZQWA 5A7BA 4Y2OA 4UTBA 1DYZA 2ORBH 4XN2A 4APQA 2YJLA 1A7QH 2VSDA 4O2CA 4OGAD 4XNUL 3DIFB 2YXWA 4PG2A 2NTFB 4BA0A 1NFIA 1U95B 2FBOJ 3OX8A 2GJ6E 1FFPB 1KB3A 3V4VA 1F5WA 1VIWA 1XF4A 3HJ0A 3TN0B 1IAIL 4AEEA 5CNHA 4ODBD 5BOZG 2MNWA 1OP4A 5FO7B 1C12B 1M71A 4Y9GA 3EFFB 4F9PC 2WLHA 3N5AA 4H0IA 4K3EL 3QJFA 2LLLA 3LDBC 4J39A 1G9EA 1V7NH 4BQCA 2XTJD 2Z7UA 4P2OB 4OM1L 3GI9L 2JIXB 3WFDL 4ZX5A 1YNLH 3ZKND 4HK0A 3TF7C 2BX5A 3PHOA 4MJ2A 4K7FB 4BH8A 3S8WA 1ZCRA 4NN6C 2AQ1A 2PR4L 2CRYA 2BS71 5KYWA 3MRNB 4XAWL 3EBAA 2VDQL 3SY9A 2XFXB 3O6FB 3OB0K 3MRLB 1CIDA 1EEZA 3QDGE 3MYJB 1CLOH 2BIMA 2K9UA 4PRIE 1MWAL 3PJSA 1Q90A 3VE1A 3QT2A 3WMPA 1CICD 2CCVA 4OJFL 1YECH 2ADFH 2H8PA 2K8QA 4U7KA 3VFUA 4AXWB 1ZT4B 2D7PA 2ZAIA 4L8BB 3TBVB 3U79A 2YAFA 4OAWB 4ANXA 4N0UA 5FKAA 5LAXA 2JCCF 2QSQA 5I0DA 1K5NA 4PPTA 5JHLL 1UJ3C 3GIVA 4L18A 4PS4H 1IAOB 3NIFE 3UERA 4UDTB 2VXVL 4PGEA 4QWWC 2LTQB 4W6XB 3G08B 2R2HB 3F05A 2FL5A 4KRLB 5ACZA 4WU5B 2QQQA 3WLWC 4LP8A 1UZ6E 3C5ZA 3LRSA 4LLDB 2HG5A 5DZJA 1T21A 4NQCA 5C0IA 3RBSA 2R4RH 3P4OB 3RQ3A 4LIQH 5C0BA 4EUPB 4F1ZA 3ARBB 1QA9B 3OJDB 3FQ4A 5EC1B 1UWEH 2D2OA 4TNGA 4ZO6A 2ED8A 3LS4H 4F3FA 1T1ZA 3FCTA 4L3AA 4HIXH 4O4YH 3SGKA 5BXFB 4YZWA 2EDTA 2XQYA 3STBA 3BH9B 3T1FA 4N59A 1MFEL 3SYCA 3DX3A 3N85H 2XN9A 3NSDA 3CFTA 4TLTA 2JJWA 2O30A 3MRMB 5EC2B 1PAMA 3LIUA 1MCPL 4LLWB 4AE1A 4X4ZA 4LFHG 1H0DB 1JYNA 3CFKA 3ILQC 5ADOH 5F8RC 2QR0A 1F3DJ 5F7DB 1QSFA 3QRGH 4X6DF 1E28A 4NAJA 4AIOA 1WPCA 4M5SA 1OTSD 4S0TD 1M7UA 1PY0A 3Q3GB 3F58H 3NABL 1NCHA 3S4SA 5GGSY 2HX8A 5D1ZD 4X5PA 4BV1A 1JVKA 3T3MB 4ELKA 3RZCD 2H32H 3FOLB 4TRPL 5HDQL 5ENWA 4R9HA 3F85A 3HLAA 3K6SB 5JIMA 4MSWB 2P46B 1OTUD 3PLYA 3A21A 3ZDZF 2Y0SA 1CXLA 2YD5A 3RA7L 1VEOA 4MA3A 1F4YL 2PWGA 4TN9A 4JL1A 3WIFB 1C08B 3K19A 5EU4A 3K71A 1SQMA 2YMOA 4Z7WF 4JDEA 4QRPB 2G9HB 2ADIA 3QJHA 4AQ1B 3I6SA 2AEPL 3QO1A 4JANA 2XVBA 4P4KB 2O72A 2EO9A 4XCYA 2BVOA 2JKWA 4XMXA 2W0PA 4PJ5B 1BD2B 4KNTA 4ZZFA 1ES0B 4YO0A 2WJ5A 3KXFE 4XNQA 4NO5B 1MZYA 3I50H 3V0GA 1FZOB 5C0GB 3FB6A 1QHPA 3T4YB 4L1LA 1J1XH 3OMAB 3QHTC 3GDBA 3MU3A 5AB1A 4DVRH 2ZP0T 5D70L 2UUDK 4WFED 5CLTA 3KEDA 5E1QA 1A4JB 1NMCB 3UZVA 1V10A 1KB5H 1TG8A 3BZFA 1SXCA 4TULL 1TMQA 3WUWB 1D5MA 4FFYH 4IRSD 3SBRA 4N2EA 2OQJB 1KDJA 1CTNA 2GJ6B 2FHCA 1VB9A 1YRKA 4S2SA 3WAJA 2FATL 4G5ZH 5T33L 3P0YH 4YS4A 2NYYD 2XE1A 2N7BA 2OMVA 3EZ8A 3RIKA 3PL6C 1Q9WB 5HI3C 1YY8B 1JFQL 2Y22A 4MXVF 4R7VA 2X4PA 2A6DA 2OMTB 4BKLB 2R1WB 3CK0H 1KGYE 4V33A 3OJVC 1TQUA 1MIML 5J1AB 3ASNB 4XH2B 4X80H 3TJHD 1AYOA 2WGXA 4BFJA 5D72H 3O3AA 3WI4A 1WFJA 1QFUH 3L9YA 1E50A 4H0GA 3LZLA 4UYQA 4UOQA 1JDDA 4Y9CA 1WBYA 4MB1A 4XWOC 1S46A 4G8GD 2R0ZL 1QR1B 5CP7B 3RZWA 3QDGB 3CLWA 4ZTOL 1IKNA 3L3OC 3RAJL 3CZUB 3STLB 2IPTH 5IBLC 4PRIB 1OEZW 3S5ZA 3STZA 3CQFA 3PABB 2UX7A 3O4LD 3QFJE 1NBZA 4U3SA 3RVXD 2FYVA 2W9DH 2YWZA 1FQ9C 2VLRA 2WP3T 3V0WH 3X11A 3P73A 4N5ED 4A6YB 1IIKA 1NGYA 4FQIL 4YOKA 2O5YL 4ZUTA 2XZQL 2IVFC 4CC0A 5C7XH 4HW6A 1OP3H 3RURA 5PAZA 5A2AA 1LO3H 3NIFB 3T0EE 1Q0EA 2V3EA 4OZGE 3RKPA 3SGJA 3NJGA 1KN4L 1MCBA 1BWWA 1EO8L 2CDFA 3P54A 1U6AH 4PJ0O 1WTLA 2WLNA 2YMXH 4RGNB 1JZ8A 5GRUH 1RHHB 4GW4B 4R7LA 3BUYA 4FZMA 3PY9A 3JTBA 4XVTH 1BQ5A 1EXHA 4J8QA 4LBEA 3OXSA 1DQLL 1EFXA 1ZLWK 2CCWA 1G6RL 3SDYL 4JO1H 5LJYH 1I8MB 3WUWG 4G1MB 4L1TA 2K78A 5D71H 4G42B 1HH6A 1MREH 3BD5A 2YD1A 5FA3A 2GI7A 2EE9A 4G6JL 3WKML 5DZLA 1ZLSH 3C6LD 4H8WH 1EZSA 1MIEL 4F5CA 2FGRA 2M07A 1XB6A 2X28A 1HYSD 5TGBB 3AA0A 4X9FA 1GC1C 4WEUD 1AGDA 1UFUA 1PSKL 5CCHE 2W80C 3RWIA 2BMKA 1F13A 3KVDD 3GJFK 3LOWA 3CBRA 2ENYA 4F9LC 5J13C 1QASA 2R0WL 1U8NB 4POUB 4YHYB 1EV2E 2HX7A 4BQ9A 1QOKA 2P24A 4ZUVA 1AJ7L 3KBFA 4DGYL 3N9GL 4MQ7A 3BVVA 5CJQL 4GCPA 4FQ1L 1MFBL 1W16A 5I16B 5E4EB 2HUEA 5CM1A 1SDDB 4WUUE 4ANVA 1MDTA 3W39A 5IKCA 1K2DA 5AOKA 1A4KA 4W9FC 5IMOA 5KSAB 2OL3H 3FRUB 1CO1A 3EJCA 3HW7A 4XE5B 4NN7B 2LVCA 2XG5A 1IUZA 3NPSC 3PGFH 3ZHKA 4F15B 2VLKD 3FO0H 4D9LL 5DR5L 3KPSD 4TTGA 1OLZA 3HS9A 2ODIA 2DQIL 4JRWA 1Y6KR 1QLFA 1P5UA 2HJKA 5J6HA 1ACYH 3VD4A 5CJ8A 4LARH 1DBKH 4AYNA 1AHKA 3SGEH 3BZ4A 3V5DB 1Z3RA 4AT6A 3VH8B 3DWOX 2WPGA 2GE4A 2G3ZA 4UNIA 4JY5L 1ZHKB 3SY7A 1PVHA 1M56B 2WN2A 1GCYA 1YMMA 5GGUB 2APSA 2A4CA 2DQDH 2IMNA 3BN9C 4JM2A 2WKGA 2QZ5A 1MJ7H 2H47C 3HG1D 2NNAB 4L9LB 2HMIC 2WVVA 3UABA 4PJDA 1JE6A 1ZHBB 5LCVA 2EIZB 2ENSA 4ZBJA 1UOWA 3QDHA 1ZAGA 3DROB 4DKTA 4Q89A 1ZHYA 4BFIA 5GXBB 3APDA 1E42A 2X2YA 4M5YH 3NCCB 2ED9A 3BX7C 1SY6L 3ULVL 2YXFA 1XSJA 4JJ5A 3QORB 5CAYB 2NY4C 3GUTB 3KS0J 1GZQA 3CHXA 4YLBA 2DI8A 3CXHJ 3GF8A 1U8LA 2ROYA 3BSZH 4BD4A 3ES6B 4BINA 3BDXA 4IOIA 4BSJA 4GW1A 3H9HB 3FXIC 4KUZL 5TTRA 5I8CB 4PV9A 3CHRA 2D2CC 3WSQH 2AV7A 2X5PA 2P5EB 1HSAA 4FMFA 5JHDE 1OKEA 4AZ8A 4KJQC 4F37K 4K9EH 2ICWJ 4ZOCA 5IB1A 2RALA 1KMGA 2VUOA 2D0HA 1S8DB 4M9OA 3FS9A 5C0DA 2Q9OA 2OI9B 3D39E 3BUBA 1N2RB 3ZRFC 2BWDA 1VKXB 1TTAA 5DJ8B 4Z8FL 2KXPA 1E8XA 1GS8A 3CVBA 3DMMB 5A2KH 2JCCE 4L3EB 3AAEA 4YBLB 3B2VH 3VU2A 1X5AA 1DJXA 3F01A 3K4DA 3LQAC 1FNLA 1AXSA 3KYAA 2B1HH 3EO0B 4JGMA 4E9TA 4F4BA 1RCYA 4P5MB 4OZGB 5IHZA 4ZMYA 4KRPC 1HCYA 4IHOB 2EDKA 1S7UA 4R5XA 3V7MA 4V11A 5DJ6B 4HUVA 1INEL 1KN2H 2XWCA 3BJLA 2F1CX 5SWSD 4GNKB 4OIIL 3U7YH 2VYRE 4QHLA 4DP7X 1KCSL 2BC4A 1DSWA 2XTLA 2WXLA 3I6KB 1NUFA 2BJMH 2IAND 2HKHH 1ZT1B 4U33A 5LNGA 4X8CA 4MLIA 1AQKL 1P1ZB 3QHZL 5ESVB 4PJGA 3GNMH 3HPJB 1XGUA 5E8EB 4RESB 3RDTB 3MXWH 1J1OL 1KPRB 1RZKH 3G5YB 3NCJH 3QIWB 4Q52A 1FZJA 2YS4A 4X9YA 1HQ4A 4NXSA 4W9LC 2FYYB 4NM4H 2BY1A 3ENEA 4X6DE 3PGSA 1E0OB 5KG9A 4JFOB 3QFGA 1JF1B 2OLDA 3GS4A 1W15A 5AEAA 4J28A 4YHKL 2DM4A 1W72H 1W6WA 1RU9L 4K23L 4M8VA 1RZ8B 4QUOA 2OW6A 2X38A 5C07D 1DLFL 1HEZB 4HLZG 4N87A 4RFOL 2BVEA 3LTVA 5A16B 1OAKH 1D5XA 3CFNA 2NLJB 3ZDZE 2BERA 1DQJB 3FQRB 4LL4A 4RDQG 4S1RL 3OJMB 3RVTD 4HOXA 4Y5VA 5K39A 5IEKA 4O2EB 4NAQA 2DV6A 3K1KC 2N3JA 4WUUB 2Y0HA 5JXEC 1JK8A 5BV7B 3IMBA 4K7PY 1XQ4A 1A5FL 5D7KD 3RGVD 1DVSA 3T2NL 1TDQA 3O6MH 1GS7A 2OMYB 4WJKB 1AE6H 1RZ7L 1YEIL 1E9QB 3MV7B 3VXNB 3BGAA 2P80D 3EF7A 3T4AB 3NJHA 1L9PA 2HFFB 5CCKH 1MHHA 2ZF9A 2XRAL 4JFTA 2IDTA 3DYOA 1S7SB 1UH2A 1NINA 2E5EA 15C8L 2E7BA 5JYLA 4BFFA 4YPGB 3BO8A 5F7LB 5AL8A 5CR1A 1MELA 4PYGA 3ZYJA 2VLJE 3BQUB 4HKJA 1LEIA 2EUVA 1SVBA 4QXUL 5I2IA 2VL5A 4P2RD 1KLUB 5IF0A 2QQNL 1OAQH 5I23A 1CF8H 1N8ZB 1OWWA 1H15A 1MCOH 3B8YA 4IGBA 4P23B 1E4HA 1KC5L 4H5SA 4NUGH 4OCYH 1A6AA 5FFOA 5AAWA 2XKNA 4LLVB 5DEGB 3FO2B 4WO4C 5CS7A 3ARFD 1XR8A 2ZOWA 3SDCC 1XGQB 3QWRD 2WWMC 4XMUA 1KDIA 3SY0B 2EDFA 3JXAA 1Q9KA 1BZ8A 3GS0A 2C9AA 3HG2A 2Q3AA 3IFNH 1AANA 4WU7A 3MRDA 2E75C 1WG3A 3QUXB 4QXWA 4BZ1H 3IKCB 1L9MA 3GJEB 1Z9SA 8PRNA 5EU5B 4B27A 1BZQK 1E3XA 1RLWA 1JWMA 2L0DA 2NY0C 4JN1H 4X7FC 5D7IA 1WZ1L 2Q6WB 3A6CL 1LE5B 3Q6FB 3G6DH 2K0LA 4S1DD 2V3DA 1ZHNA 5KSVB 1DO6A 5JHDB 4WDIB 2B8OT 4WFGD 1PL3A 3R4RA 4EVNB 2QV2A 3BIBX 1L9TA 3BHBB 1ZMYA 3DSNB 2MOGA 5E2JA 2BCKB 2C4XA 4FNLH 4U1KB 5GISL 5HXMA 4CSZA 2CA3A 4JKNA 4ZMVA 5T1MA 2P1YA 1U3HC 2CHZA 1RIVL 3RIAK 1TVHA 3GSUA 5K9QG 5JPMA 2AABL 4JCMA 4XMLL 2XC8A 4QRAA 3VXSD 2JCCB 4JKPL 4M61A 2AAAA 2I5YL 3LPGA 5I8KL 4OUUB 3SOTA 2LAAA 3SPCA 5DJ2A 1R0AH 1XH0A 2ZCHL 4UI2A 5I1HL 3H42L 2Q86A 3GEWB 3RKDC 5E70A 2OW7A 1S5LO 4H1LH 1SYSB 4OF7A 5CEYB 4NP9A 4ERSH 4K3BA 3KYOB 4K5MA 5HHOD 2FIRT 5MENE 3HZYB 3V4UL 3JWNC 4JUSA 4YVNA 1H3GA 3FN9A 3QUZB 5FK9B 3SJVD 2A9MH 2GBTA 1E4WH 2IG2H 4OIAA 3FU3A 1ZK5A 2NY5L 1JL8A 1PNCA 5E99H 1G7PA 4G8FA 2B20A 4PLJC 3AWGA 4WI5A 4YX2L 3L4VA 1NC2D 2ZG2A 4LIQE 3F5WB 1QHQA 4I4WB 3WYRA 5CP3A 5IB2A 5J6GA 3T77A 5C7ZA 1N8OE 4X6FB 1E5BA 4OFPA 4DOHE 4AL8L 1NJ9A 3FT4A 4X6DB 3VX1A 4HG4J 1BYNA 2QDWA 3GMMB 3HE7A 4WUKH 5EF2A 5IESL 5DL7A 5E6ZA 5LBSH 4Z78A 5F1OB 4Y8AA 4NOFA 3D06A 1TJIH 3IXTB 1WEJH 3EJYC 3QEUA 1CD0A 1IQDB 4OCNC 4F2ME 4YHZL 3ZDZB 4I5BA 2ARJQ 4YXHL 1G1OA 1JI1A 1K8IB 5IVXF 4NRZA 1MCLA 2HVJB 5GGRY 3ZDXE 3B9VA 4RWHA 3KYMA 3L08A 3L3GB 4HLEA 3POQA 1KXTB 4XC1H 2WXKA 3GKZA 2X6VA 1T0OA 5G5DB 3MJGX 2H6PA 3CQPA 4Y5XA 1M7XA 4I89A 5IMMA 1BG1A 2DPKA 5I8OH 3ZKXC 1B0GB 3QI9B 4ONHA 3GSXB 3N55A 3PXHA 1KGJA 1TXKA 3FQNB 3TBYA 4I0PC 3WIHL 3DUSB 2BOBB 3MPCA 1O75A 2QGCA 1BREA 1O9ZA 4F7EB 2PF6A 3CNKA 3J7HA 3QJTB 4GP4B 2CAKA 4YL4A 2Q8BH 4ADJA 2EUWA 4CVZB 1CGXA 3N0PB 2TSAA 3FQTA 2O6EA 3IDNB 4Y19D 2DEYX 3UBXA 2BW5A 3GHBH 4RAUB 3S36H 3V0EA 2DQEH 5AWNH 4Z7UE 4XPTL 1QLRA 2DMGA 2E9IA 5IFHL 4D8PA 1AXTL 2CCLA 3KGUA 3KPRA 4UF7C 3IU4H 1NGQH 3I9GH 4PJXA 3BMWA 2FR4B 2A9NH 4FFZL 5HHNA 1JF6A 1P2CA 1U42A 4AQAB 5MERB 2EXYC 4HEMA 4P3DA 4RAVB 4EI0A 1YEFL 2QKSA 4PJ8B 4TSAH 3MOAL 4P9HC 5F6IB 1U8IB 3HC3H 2G5BB 1D6EA 3QEGH 2GITA 4E9QA 5B3NA 1TTUA 3AT8A 4NO0D 2XZCH 5DJCA 1K3ZA 3UH8A 1UA6L 2AITA 2OYKA 2CBQA 3FT2B 1YEKL 2ZQKA 3WNIA 4XMTA 4K55A 4S10A 3VVWA 1L0QA 1A6ZA 1HI6B 2NR6A 3C60D 3RTQC 3U0WH 4KROD 3TBSB 1BW8A 4F80A 1IGCH 2FEJA 1XGZA 5DJYB 3DV6A 3GMNB 3II2A 2CHWA 3OXRA 5HI4C 2X4QA 3GB7B 4HT1L 3S7GA 1SJVA 5DRWB 3D4GA 5DD1H 4K3GA 2YSSA 2DRUA 1CFMA 4YN3A 1GAFH 3K81A 1ZA3A 4GBXC 4OQTA 4XODA 4Z7VF 4LAJH 4DN3H 1KCUL 4P57A 2YN3A 3KLHD 4R4FH 3MLVL 4DTGH 4IIQB 1DJZA 1L0PA 2PP9A 2G2RA 3HBPA 4FMKA 5F0PB 1W0VB 3O6KH 5FHAL 1KF9B 1YEWA 4PG9A 4WHTB 4GRLB 4RNRB 1B0IA 4QXGH 3RL2A 2PTUA 4XBGB 4Y2DB 4AZUA 4NQUA 2KC0A 2DKUA 2I7OA 2VQ1B 3PAVA 3KPNB 3RG1C 1JHTB 3GEFA 1E6OL 1AR1B 2BNRD 5E23A 2J2ZB 1WT5A 1HH9A 2V5MA 1J9RA 4HIHA 4WTWA 4DUWA 1SJHA 1A6TB 3LKQB 4OBSA 3PP4H 3L4ZA 5I1EH 2BIPA 5MENB 4LSUL 3X14A 4JG0L 4F58L 4FI7A 2WJRA 3EGXB 3MRPA 4KJYA 1HOCB 2VRKA 3VM7A 1MDAA 3H2WA 1ADWA 3BKYL 3TBTA 1FV1B 3VRJB 3RI5F 1OARH 1PYWA 1QNZL 3GLDA 4EXPX 2X9YA 2OMUA 5FIEA 2D3LA 1C1EL 1MY7A 2WVSA 3O3BA 4X4XA 2NUPA 5C0FB 5CGYD 1LDPL 5HYIA 3IMUA 4W4NA 4NKIH 3AA6B 2R69A 3CE1A 1V8HA 2XWTA 1RURL 1FLRL 1IAKB 1TNNA 5E6YA 1SN5A 3PWJB 1I8KA 3IKKA 4U6YA 1UM5H 4F20A 4LGSB 1VEMA 2EIEA 5IW6A 2IFGA 3BSGA 4Y4KA 1M9WA 4KXDA 4TLSA 3MRHA 2X6CA 2CKNA 1FGVL 2BIHA 3SPJA 4OLUH 1PZAA 5D1XE 2F18A 4F2MB 4WJ5B 1SEBB 3K46A 1O5PA 1QJPA 4MDRA 4LLYB 2J55A 1B2WL 4ILDA 4F24A 4OI8A 1FNEB 4JZOA 3Q2WA 3QCUH 5ALBH 3PWLA 2O5ZH 1DJIA 1EJ8A 1IC7L 3BLKA 4OFIA 3V4PA 3K6OA 4MJID 4KXBA 3ZHFA 3LV3A 3I6LD 1LO2L 1KIQB 2H32B 3WN6A 4CSTA 2J4WL 3B6SB 4PBWD 4UQAA 5EIIB 5BVPH 4RRPG 5I6NA 5E24E 1MWOA 2FGWL 3A0HO 3OG6B 1D5ZA 4OCSL 5FKPB 3MV9D 4E5XA 2ADGA 3ARVA 5A43C 2P5WE 3D33A 1X7QB 4FZ8H 2CPCA 2PCXA 3H3PL 1KTCA 1U58A 3QNYA 3OKNB 4AUIA 3JT2A 3UJIL 1PFOA 5DUBA 4KWUA 5CFHA 2JB6B 4APXA 3RDTA 5BW7A 2X6MA 5D7EA 2A6KA 3QRBA 3IVKA 1UYWH 5F89B 4O9HH 5F7EL 4Z77A 1QRNE 3EADA 43C9B 1GYWA 1T22A 4JFXB 4UQ2A 4XVJL 1AIFA 1F4WH 3W2DH 1FL6A 2ZOTA 3AB0C 4PCTA 3WEXB 1ZSDB 6TAAA 1WICA 1PQZB 2OYMA 5E8OA 5MHSE 1CFQA 2LU7A 1OPGL 3UXFA 2Q7YB 1LK3L 4MXWH 2QADC 1KIRB 3LK41 4BQ8A 5ITBH 3IE9A 1OALA 2MNJB 3D85D 4MQXC 5K33A 4QWWD 1CYXA 2E74C 1G9NH 1IRAY 3BWAB 4NJAL 1JI2A 1CGUA 5C8JB 1KB5B 4XO8A 3H9SE 3RL1B 3VJ6A 3GMLB 2H45A 3WLWD 2P48B 5BQDA 1V54B 4A7VA 2GTWB 5IMLA 3AXHA 4ZPTA 1AACA 5BO1L 5L2KA 3GMQA 2WIMA 4KKLC 2VDOH 2OM5A 3PGRA 3SY6A 4HUNB 4GG6F 4JDZA 1UWGL 1FZMB 1HEHC 2QBWA 3VXQB 2MCPH 4JFHD 1NIBA 2ERVA 3LRLA 4PY8J 1ED3A 1NBVH 1HJCA 2EDQA 5F1NB 3DX9B 4IBSA 3U6XA 3BE1L 5ETUA 5LG1A 2X4NA 3MQIA 2OX5A 5E9DD 3WGUB 4KMQA 2OS7A 5BPPA 3ILQD 5TDNA 1YQVH 2GJPA 4XCNA 2FT8A 2WYHA 5MEOB 5D7LD 5C09D 3U7WH 4L8DB 4O2FA 4QHNB 2C3VB 5HGBB 1QACA 2LE9A 5EIIG 4WY7L 5B22A 3RUGE 1D6VH 3D30A 1HNFA 4KC3B 3SDAA 1F2XK 2V0AA 3PREA 1J05B 4LCWE 1AZZC 4OJDH 3SKNA 5I6XC 5L2JB 1AH1A 2J3SA 2XV2A 3NRQA 2GT9A 1JGIA 1KNOB 2JELL 1IBZA 4XX5A 4FRXA 2ITDA 4P9MH 4ZTPL 2AK4E 3JSSA 2K6WA 4W1TA 2ZWYA 4GQZA 2X09A 1YNKH 4PS7A 3IBEA 4HMDA 2FT6A 3EYOA 4J3UA 4HK3N 2BNQE 3D8MA 5C0CE 3B8SA 3TVMA 2C9SA 5KJ7E 1SHWA 4ELME 3WNOA 5CEZD 1MRCH 1G7MB 5C3TA 4XMPH 1J8KA 2YGPA 1G7IB 3HG5A 2QSCL 5DT1L 5MP6H 3IJ8A 4XBMA 1U93B 3RNKB 2ATKA 4JAMA 1G43A 2D7TL 3POCA 1XDTT 3FW6A 5ANME 1XSKA 4FNQA 4A2FA 1OCWL 2NY6C 3KWTA 3D51A 3IPBA 2X88A 4AYBA 3MBEB 3O41B 1LO0H 1N0XL 3EUUA 1AP2B 1FGNL 4N0RA 4R0LB 5F88A 4AM0B 4CVWA 5FR3A 5KTEL 1MW3A 2R29H 2XWBA 4RQQA 5E2TL 1BA9A 2PWHA 3VZUX 3CCHB 4UM9A 4BZ2H 1ROCA 1UZ8A 2VXQH 3RIFF 4PJHA 3UTZA 3KE0A 3Q8EA 3ZSTA 2ORBL 5IVXE 1A7QL 4WGVB 2XPGB 5CSGA 3PL6D 4WFFE 5HI3D 1A0QH 4IDLA 3TNMB 1OHQA 1E3ZA 3EOBA 2EZ0C 4JHUA 5I0WA 1SN0A 2W9LA 1XIWA 2HLEB 3OV6A 4O4UA 1NWOA 2CJUH 2E3VA 4P48A 4XVOA 1GJIA 4PVLA 3FB5B 5F3HB 1N68A 2DQTH 1BVNP 1CTOA 2PTVA 3KW7A 5D9SB 1INQA 4CRPA 2QVTA 1XMWA 4JKKA 5KVDH 2WYIA 4PJAA 1QFWH 4QRSA 3IS1X 3AM8C 1U8JA 1RV6X 5LGKA 1CLZH 1P5VB 1H6UA 1F6FB 2AQNA 4CGTA 4OB5H 3DXAA 4N90E 5H2BA 2FWLB 5T1KA 2ZKWA 1EERB 3F3HA 2ZCZA 2OL3B 2P5WB 3DRQA 4JHAH 3D6GA 3P69A 4XWOD 3QWOA 2X4OB 1V7NL 3EGDA 1BFVH 1LMKA 2EINB 5GJTH 5ABAA 3MKKA 4K5NA 2BM3A 1BYOA 3HNTH 5JXAH 1V7MH 1YNLL 2DKSA 5DGRA 5E8NB 5IBLD 3B9KA 1AGEB 3NSGA 2G60H 4WKXA 3UYRH 4O4XA 5IK3B 1QRNB 8FABB 3VYPA 2XTJE 4JUTA 5KBPA 1T1XB 2YFNA 3U4EB 2XE3A 2A74C 1CBJA 2R2EB 4MXQD 2OULB 1CGTA 1IGMH 4HJ0C 4KKNA 1XF2A 1CLOL 4KRAA 4A66A 4BFNA 4J7RA 3VSQA 1DDTA 4AW4A 2V7HB 2E4TA 1LJMA 3ARQA 1YUKB 1VGKB 1N3NA 4UU9B 2J1YA 4NYLA 2XA3A 4K71C 2EH7L 2Z92B 5CWSA 3IDJB 1YEDA 4NNXA 2CBOA 3OF6A 5CINH 4EN3C 3EYVA 4YNYB 5GS2H 2E7LC 1I75A 4PS4L 2AK1H 1EVTC 5D1QE 5I76A 3IJYB 4X5WB 2PCYA 2X3CA 1M7IA 1MFNA 4UCFA 1GVIA 3QAZC 1GPOH 1SMOA 1Q9OB 1ZANH 4BDVA 3FFDA 4KMLB 4NKMB 3DVNA 4N1CA 3T2PA 1ZHZA 2Y3NA 4YE0A 2ZPKH 4HETA 3TA3B 3UPCA 4EBQL 2D3JA 3CZLA 2R4RL 4LIQL 4NC0B 1MFMA 5E0QA 2Y2YA 4H40A 4BSWB 4PJ9B 4GKZB 1UWEL 4Z7VE 3HZMA 1JUFB 4Z3JA 3LS4L 4J27A 1VADA 3HHSA 4HIXL 4O4YL 3V0AC 4EDWH 2X2HA 2RH0A 3RDJA 2IH3B 2FWOA 3ZT6A 2BXZA 5AFAA 5KVMC 4MZIA 1INDH 2CO3A 2XWZA 3RB7A 1WIOA 3DIFA 4HHAB 4ZJ9A 4QF1A 2IOIA 4IK6A 5A6MA 5CSZB 5EEWA 1U95A 1MNNA 3SE9H 5ADOL 1XF1A 3QRGL 1FFPA 1FFQA 4NKOB 4JK0D 2VQ4A 4IJ3C 3TN0A 2P3YA 4LLMB 4LSQH 3F58L 4FXKA 1CT8B 4FX5A 1LK2B 5HYSB 1EAOA 3VFOB 3S35H 5FO7A 2DYPB 2PO6B 1C12A 3APCA 4P2QD 5CKGA 4LOFA 4L4TD 3O8XB 4U1NB 5IIEB 3HS0B 3UZEC 2VXSH 3ZZQA 4TYUA 4BBWA 5KUKA 4KKPA 1S9YB 3P9LA 3CH1B 4P2OA 2BNQB 5B1KA 5AKSA 1CQKA 2JIXA 3O9WB 3L9BA 4IKKA 4K7FA 4ELMB 3AT9A 4HFUH 4CMHB 2P42B 2G0LA 1WA1X 1Q9LB 4N2FA 2MCAA 3X1GA 2XFXA 3O6FA 4MBOA 1RUPH 5FO8B 3BN9D 3MRLA 2RTTA 3FU0A 3OZ9H 4H8HA 3MYJA 2N7SA 1PBYA 3O4OB 4ZYKA 2E56A 4LKCB 3FCSB 2CJ3A 3Q6GH 1W91A 2NDGA 3ASWA 4ZAKC 4NB7A 2HMID 3I50L 2QKIB 2H9GB 5A2CA 1FFRA 1J1XL 5CR8A 4DVRL 4J2QA 4L8BA 4P99A 2J20A 4JPSA 4KXZH 5AW9B 3TBVA 1ZGLM 2Y7OA 4OAWA 1ZLEA 5IVXB 5ICYB 4WCYH 1OPFA 1IAOA 4PRAB 4TXVB 4UDTA 4FFYL 2VM9A 4WFEE 1W72B 3G08A 1RZQA 2R2HA 2NY4D 4U0RB 4D7PA 4NZJA 5GZOA 3OKYA 4WU5A 3QDMD 1EUUA 4G5ZL 2VW7A 5JNYB 2C9PA 3SGEI 2OKMA 4AIZB 4F8TA 1XCQB 3LZOA 4NZUH 4JRFA 3BP4B 1QA9A 3OJDA 5EC1A 3CK0L 3AS0A 2DL2A 5I73C 2EACA 4IKLA 3D48R 4XNAA 4KJQD 2R88A 1C5CH 3HR5A 5BXFA 4X80L 4MCZB 2Y5TB 3QNFA 2DM7A 3BH9A 5D72L 1IZJA 3OGCA 1QWNA 1OGTB 2JF1A 3GRGA 2IWWA 1U92B 1QFUL 2V2WB 3MRMA 2BFVH 2BZCA 1U36A 2DI9A 4LLWA 3HLKA 3SKMB 1H0DA 4OF3A 1M4KA 5T5NF 2XTJB 5GRXG 4JFZH 3U4AA 5F7DA 4AGLA 1X5YA 1EANA 5E5MB 5I6PA 2VAJA 3MZTA 1Y6MR 3BIAX 4JR9H 1P6FA 4KNSA 3CVHH 5DLLA 2IPTL 1B4JL 3O2VH 4CU8A 5H37H 5C0JA 3FYXA 4QO1A 3ZE0E 3U83A 4FP8L 1FVEB 3GK8H 2W9DL 1DQMH 2O61B 3V0WL 3HMXA 2XIIA 3ML9A 2X1XR 4KRPD 4NI6A 3QULB 1SJMA 4HWZA 4OGQC 1R3IH 2ZG1A 4NQDD 3IGLA 3K6SA 3OL2A 4NKQB 1D7FA 4AJ0A 3MHZA 5C7XL 4CUCA 1A3QA 1PIFA 3MC0A 1LO3L 1CICB 1KT2A 4UAOB 5D1QB 1WFUA 3EJSA 2B59B 3WIFA 1C08A 2ZWLT 1KBPA 1U6AL 2AXGB 4CMMA 4GUQA 2YMXL 5GRUL 3ATDA 4QRPA 4GQQA 2BVYA 2G9HA 4MD4B 4Z0BH 1FBIH 4PCYA 4XVTL 4AQ1A 2K6YA 2LHAA 3ARRA 3RWDA 4YAQA 1NIAA 2PCFB 2KDYA 3FUKA 1Y07A 3GSOB 4D2NA 2YGVA 2BSTB 1TZAA 5CJOH 1L9QA 1BD2A 1QFWM 2DWEB 5GRVL 5EUOF 1ES0A 3QG6B 4JO1L 5JO5B 4DUVA 3QNZA 4NO5A 4Z7VB 1BX2B 1IB5A 5D71L 1FZOA 3CFEB 5K9KB 1U0QA 1UM4H 5C0GA 4FLHA 1MREL 3T4YA 1UXMA 1ZLSL 5KBKA 3IETB 1CI3M 4FKHA 1A4JA 4H8WL 2QFRA 4J3OD 4MMYA 1JV2A 3HRZC 2ZCLH 5JOPD 4WGKA 5IHWA 3OKDB 3WUWA 4NT6B 1JGUL 2OQJA 3FJTA 4IGBD 2P8PB 1BQSA 2VJ0A 2VDLL 2Z4QB 1EJOH 1MFCH 3M1BB 4CJ1A 4DK6A 3QUYC 2QLYA 3CFJB 1BEXA 3IMVA 3DPBB 1AHMA 1Q9WA 1YY8A 7TAAA 2OMTA 2FX7H 3B4NA 4BKLA 2YZ1A 5GIRB 1MAKA 1CGWA 5HVHC 3CZGA 2HKAA 2WVPA 5DYOB 5D1ZB 5HHQB 5EZPA 5J1AA 4XH2A 2CO2A 1RIUH 3RZCB 2YK1H 2OL3L 3DX0A 4H1LB 3SQOH 2EJ1A 5AB0A 4U1MB 2IBZY 3PGFL 3FO0L 2HFEB 4N9OB 3FTVA 4GXVH 3S37X 3V6ZB 3OD3A 3CN4A 1QR1A 1OGAD 5CP7A 1SBBA 5IJKA 1ACYL 2WIIA 2VWEE 3QDGA 4LARL 2YD4A 1DBKL 3D18B 3STLA 5ANHA 4HCIA 3KPSE 2FT7A 1M1XB 2OTUA 3MUY1 1MVUB 3G5XB 4FQEA 2JFCA 5ITFB 5GGVY 2CDGB 4X6CE 4FSOA 4WO4D 1B6DA 3EGSB 4ONFH 2DQDL 3SDCD 4A6YA 2WWMD 1GY2A 1MJ7L 3MCKB 1VESA 1F1DA 3BH8B 3FHAA 4GI9A 4P59H 5KW9H 2AQSA 4ZW8A 1X4ZA 1R19A 3ZR6A 4Q6KA 3SBQA 4ES9A 1BM3H 4JHVA 3CZJA 2YUWA 1HILA 3NDZE 4GO9A 4AYEC 1RHHA 4GW4A 2AJUL 2X4SB 4M5YL 3S3BB 5F1IB 4IRSB 4KU1A 1JTTA 4PGCA 2NY0D 1BP3B 3K6FA 2ITCB 1C7TA 2JH2A 4NQVA 1I8MA 4G1MA 1G4RA 2BRQA 4G42A 2OJZL 3NOIA 2PYEA 4UINL 3THMH 4QRUB 4JLRB 3MRQB 2P4AB 4I9XA 5LBGA 3P2TA 3UEQA 4POYA 5L88H 4JGJA 3LKOB 2ZWSA 4GQPH 4FNSA 4LO9A 2AJZB 3WSQL 4NQSB 4WV1B 2VJ8A 5TGBA 1H6TA 2Q3XA 5FECA 4K9EL 1LO5B 1U3HD 4IKNA 2X6UA 1E8ZA 2XCMC 3HN5A 3OBAA 5FDWB 1NKRA 4HHGA 1Y6NR 2ZD0A 1NDGB 2BSBA 1G5GA 1I4FB 1A2YB 4MMXC 2IV8A 3UCQA 3ZE0B 4RH4A 1U8NA 4H1LG 3AJ7A 3J2PA 4G8GB 5KSBA 4DT2A 5GTHO 3WELA 2IFFH 1IM3A 3B2VL 1AS7A 5I16A 1SDDA 1BOYA 2DTSA 1JZ5A 1G6VK 3KZ8A 2B1HL 2DKMA 3O4LB 4K5LA 4DFIA 4HGKC 1X9QA 4M93B 5HY9A 4GG6B 5D2NC 4NZ8A 4EEEA 3FHQA 1E40A 1T1WB 4YSTA 3RHWF 3AGWA 4ZXBA 5EOQL 1KN2L 5I28A 4HH9A 2VNCA 3LZFH 5TH2B 3FTUA 3H0TA 3VMPA 2ATPB 4HUXB 1KJ2A 4PLJD 2B5IC 3SDDB 3FSOA 4HSAC 3VAEA 5C3LD 3TXAA 3V5DA 3VH8A 3BLPX 4NLAA 3LH8A 2BJML 4AEHH 5CEZH 2O93L 3V5KB 5KVFH 1NFDF 5SX5K 4NN5C 3EDKA 1ZHKA 4LOVA 1FIGL 4LCCB 1A6PA 4PRPE 1T0PB 4QHUB 1E43A 2JJSA 3D4YA 2W65A 3GNML 1B0RB 2X87A 4JB9H 4G70B 4PMEA 3FKUS 9CGTA 3MXWL 1RZKL 2IANE 3NCJL 5D1ZI 1ASQA 1JG9A 2NNAA 4L9LA 1BV8A 2R4SL 3H3KA 4NM4L 1ZHBA 3LK42 3UJTH 2Q2LA 3SD2A 2EIZA 1CURA 3EJYD 2IGFH 4UANA 3C6LB 4U3CA 3P30H 3FPYA 1A65A 3KPRD 1EO5A 4X8XA 3DROA 5HVWA 1XHHA 4NQED 2GPZA 5G3AA 5EMYA 1LE9B 2G2NA 4F8QA 4XHJC 3MMEB 2BVPB 3CN0A 4WI0A 3ULUE 4Y1TA 3N04A 4XX1G 1KCRH 3MLWH 2WLKA 1OAKL 3QORA 3GUTA 4PS3A 4G1EA 3MX0B 4ADIA 5CF3A 4F7PB 1WV7T 4YIQA 5C07E 1S9VB 1DBJL 3JTTB 3TO2B 3ES6A 4L4VD 5F7FA 3GMPB 4RZCB 3NUKA 4X8JB 2WXIA 4JFFE 3NJTA 3O6ML 5I8CA 1MHCB 1AE6L 2ZXQA 4I0PD 5FOJA 3OMZA 2H3KA 1TQCC 2P5EA 4RJXA 5D4IA 3LK3B 5IB5B 4LCUB 1ILSA 5KEZA 2DQCH 1WWBX 2YN5A 2WTRA 2NR6D 3CDGB 4JDTH 4MDJA 4NLHA 4XCFH 3TBBA 2D3NA 4GQ9H 1NGZA 1G90A 3WIHA 2E7MA 3GTTA 2VN5A 1S8DA 4PR5B 4UMSA 1QKZH 3T08A 2C4FU 3KPSB 2YMTA 4M5ZH 4AC2A 1N2RA 1NBQA 4LVEA 3QWQB 1VKXA 3ATBA 5DJ8A 1ROWA 1IV8A 4P5KB 3JUZA 4JFPA 4X0KB 3DMMA 1OAQL 4L3EA 1CF8L 2F7IA 3PWNB 4F7CB 1PTZA 3B5TA 4XPFL 2EXYD 4NQXB 1MCOL 2DM2A 1CFSB 3EO0A 3NZUA 4NUGL 4OCYL 4QOKD 3LH2H 1BFTA 4P2RE 1A02N 4HGWB 4NIYE 4ODUB 3VI3E 1JYVA 4IHOA 4JG5A 4R7NB 2VERN 1OAUL 5EHFA 3HG1B 4M7LT 4BIKA 3RVVC 5DJ6A 2YAPA 3IFNL 3ZQ9A 1NCNA 3P2BA 5DURD 3QGVA 1KYFA 2D9QB 2NNRA 4N3UA 2BSCA 1P7BA 4BJLA 4DHLA 4HC1A 5KZCD 4P5RA 1KLFB 2BY3A 2QMJA 3I6KA 3TX4A 5J12C 4RLDA 4N2DA 4TUOA 5HI4D 1SMDA 3IDXH 4GMTH 1P1ZA 4JN1L 5KVDE 3U46A 2J8UF 2EDNA 3NZHH 3T6ZA 5E8EA 4PREB 3VUAA 4C4KT 1AGCB 3BVTA 3G6DL 3DPDA 1WWCA 4GBXD 4ZDHB 1KPRA 1P84J 3G5YA 4WIQA 3RB5A 3QIWA 3KBHE 5J11C 1OSZB 1I85C 1E5YA 1MW1A 1S3KH 3JYBA 3NGBC 4B95C 2FYYA 3FSZA 3QCVH 3JCUO 4BRVA 2A83B 5I74C 4ZQTA 4FADA 4JFOA 4MD5A 3NN8B 1JF1A 3SYAA 3WTXA 3N0AA 1J0KA 5KVEE 4KY1H 4FNLL 1MPFA 1Q94B 1RZ8A 1RUKH 4FQQB 2Z6FA 4O5LH 4WFGE 2XBTA 4YE4H 5AKVA 3UP6A 1HEZA 2GC7C 2LGNA 1GFPA 1A7RH 5GGVH 2R1YB 3HCVB 3X1BA 4XNBA 4KITB 5KYNA 5A16A 1XSIA 3IJSB 3BEVA 1F90H 5FUOL 3FQRA 1A1MB 4YHNA 3VM5A 1ETZB 3S5LG 5EBGA 2ODHA 3US0A 4H25B 4O2EA 4FQCH 5LCVH 4ANKA 1R0AL 1BF2A 3WKQA 4JS7A 3VY8X 3ATAA 3LHAA 3T5WA 1E9QA 3SOBH 3MV7A 4E68A 3D3VE 3C2AH 4LSPH 4E9RA 2LV4A 3QZOA 3T4AA 4ERSL 3II3A 2WBJC 4M7LH 1E90A 3ECBA 3S5YA 3U0TB 3BAYA 1ZHTA 1WAAE 3DJ9A 3PPSA 2B16A 3D2TA 4OGXH 1S7SA 2H0JA 3OWRA 3TT1H 2A9ML 3TO4B 2EUZA 2VDOB 1E4WL 4JFQB 2IG2L 4JRXA 5SWSB 3BQUA 3GBNH 3L5WB 3WFHB 5E99L 2W95A 3KS0H 2ALWA 1KLUA 4FJ6A 3LQZA 2XV6B 4PWJA 1N8ZA 1IEHA 1PDKB 3H9YA 2IANB 5GS1C 3Q2CA 2DS4A 5LNEA 2NQDA 1DJGA 4LLVA 3PP3H 3FO2A 4BFGA 3BYYA 4AVIA 2F5AH 1XGQA 4WUKL 3SY0A 1HJBC 3LNHA 5LBSL 1YPZF 1S78C 4W9DC 3I6GB 1UQSB 3PF1A 1E27B 2IALB 3AC0A 4IM8A 1TJIL 3CFIC 1VFUA 1WEJL 2F54A 2K7PA 2FX8H 3IKCA 3S3PA 3VFSB 1EWHA 1WZLA 4ZS7H 2XJLA 3CFDA 3P02A 5C07B 2WLYA 2XBZA 4Q56A 3MZGB 2JK5B 1T16A 5HYJD 5GRJH 2EH8H 3A4DA 2Q6WA 3SE4A 2YO3A 1LE5A 2KZKA 3Q6FA 2AQRA 1F58H 4XC1L 3F6IA 4ICWA 4PJCF 3WN5C 5KSVA 3IGFA 3MAWA 4O02H 5JHDA 4WDIA 2EE3A 3BPOC 5I8OL 4EVNA 4HBQA 3RGVB 1JZDC 1WQVT 1MCFA 2GBVA 3KD4A 3WKPA 3BHBA 3DSNA 3QJXA 4NCDA 4PLOB 1ZHLB 2BCKA 3UMNA 4U1KA 5EEUA 3IBOA 4GS7B 4AH2B 4XP6H 1JDAA 4WKZA 1IM9A 5KAQF 1OO2A 2Q8BL 4KV5F 5K59F 3MI6A 4HIQA 4CN1A 5F7AA 3MGOB 3GHBL 4QKTA 3M45A 3S36L 4IL6O 2DQEL 2F1AA 2WM0A 1HTYA 2JCCA 2ZOUA 5AWNL 3KCPB 1XB3A 1EAJA 2ZG3A 3DX4A 4MQXD 3RNQA 3RWCA 4LLQB 2XWEA 4OUUA 2V33A 2WKOF 3IU4L 1NGQL 1QFHA 3I9GL 4P2RB 5D7SH 1KEGH 2A9NL 3PAZA 1IBHA 4FG2A 4PJBF 4KZEH 1ONQB 5DJAB 3VI3B 5HVFB 2RCSH 4P05A 1SYSA 5I6MA 2X6AA 1UEMA 5CEYA 3ARYA 1S7VA 3KYOA 4Z7OF 5HBBA 4TSAL 2NYZA 3SSGA 1WAPA 1BGXH 3QEGL 3ARFB 4RFNB 3HZYA 4J4PA 1L9SA 2XZCL 3K2KA