2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
3AA7A 1IZNB 4AKRB 3LK3B 1IZNA 4AKRA 2KXPA 3AAEA 2KXPB 3AA0A 3AAAA 5ADXL 3LK41 5ADXK 3LK2B 3AA1A 3AA1B 3LK2A 3AA7B 2KZ7B 2KZ7A 3LK42 3LK3A 3AA6A 3AAAB 3AA6B 3AAEB 5AFUL 5AFUK 3AA0B
chains in the Genus database with same CATH superfamily
5KLIC 1I94T 3P7IA 4FT6A 3PURA 3M3ZB 2E75D 1NU1G 2I8DA 2K48A 3Q9DA 3H1JJ 3CCJP 2R4PA 2E9XC 2C0XA 2D2CB 1N32T 5GTIO 2YDSA 3A3YB 4L9IA 1KB9H 4DVDA 3MUDA 5LHGB 2BDEA 4D64A 5ADXK 3L75G 2WU2A 4IDPA 1FMVA 1OXZA 3H1JG 1SA0E 2QJKC 3N9OA 2XQ6A 2KZJA 1JY2O 3O0EA 1SQVE 3ZCIA 2QSIA 5L4EA 5FVNA 2ZMAA 1X0TA 1ZOYA 2UXNB 3EFFK 5CA0E 4NXNT 2J62A 3RGUA 5G26A 3B5NB 2IX7C 3H1ID 1SQBD 3KZIE 3UTKA 2XHEB 4O9BA 2FGRA 2K3WA 5AW5B 5AVZB 4DBRA 8PRNA 1GL2C 2J4UP 3ONXA 2A06E 3L4FA 1NU1K 4IE5A 3CQXC 3MHVA 2XM1A 3PGRA 1SQBK 4L74A 3WU2H 1HG2A 2I6HA 2NTYA 4O49A 3HOLA 2YNKA 1ZHCA 3CVRA 1H0TB 4G63A 1JO5A 3ANWA 1FEWA 5AVSB 4TZ4C 4DR2T 3TNUA 3CXHH 1HNXT 1GDTA 1J1DC 4Z3TA 5BU5A 3ZT6A 4WY4A 3H1IG 4ZZBA 4O4LE 2E2AA 2MBGA 4J2CA 2ACXA 1KZUB 1IBKT 2W81C 4UVBB 3UU4A 2XG6A 4U3FG 4UB8H 4JI0T 4AYDC 1G2CB 5JDFA 5B5EO 2ZFCA 4IDQA 2Z4EA 3DA3A 3AE6A 3BRVB 3EDVA 2WAUA 1EQ7A 2Y0HA 2OYHC 1NENA 1SQPE 4GKGA 5LGTB 1SQXE 1J2JB 3JCUH 4PV1D 2XTRA 1QUUA 1XDOA 2G3AA 4ILAA 2FBWA 2UU9T 4QH5A 3P32A 5ETWA 3H1JE 2V7LA 2QJYB 4U3FD 3AEBC 2XASB 4X1KE 1L0LE 2X9KA 1VRBA 2M8RA 1Q9FA 5HEHA 2CBJA 3LK3A 2B88A 5APTA 3RGLA 2Q7CA 1S9KD 3HL6A 4QWNB 3HTKA 5FVKA 3AEFA 4I55E 5AQNB 4F4BA 2OTLP 3PRNA 1SQXK 3LIDA 4OVNF 1G73A 2E5LT 3CPWO 1URQB 2YXQB 2N9BA 4FZNA 1W2EA 1SQXD 1WT6A 3HD7C 4WWIA 1LTJA 3UQ7A 1D1CA 2O1JA 2KOGA 3ZN0B 2XTLA 4LC1A 4DJGA 1FZGA 3LBXA 4GK0E 3MUDC 1E7PA 3P8CD 2B9BA 2QG4A 2X68A 3WU2E 1KFYA 5KLVG 3HR0A 3L71E 1LNQA 4HFCA 5EK2A 4GKJT 3PU8A 3CWBG 3IN6A 4O4IE 5HCMA 1XNRT 2IWWA 1BE3E 2V6XA 4ZNCA 3PGUA 4K0UA 2F1TA 1YBKA 5FNVE 2V1DB 3KXDA 3PUSA 3H1IJ 5IYZE 5TISH 2E5TA 2PRRA 3RPUA 5CMZA 1GFQA 3RX6A 2LT3A 2W4XA 2WCAA 3ABVC 4BWNA 1CUNA 4PW8A 5CCGC 1RHZB 3AEEC 2Y2XA 3PUZF 4UV8B 4OK0A 4CI3B 3P8CE 1XMOT 1ZHWA 2H43A 4QXBB 1T2KC 4B86A 1HUCA 3AE3C 1KILD 3V6IA 3VP9A 3JC6D 2K0LA 2HPLA 1TU3F 1WCRA 3ZCJA 1Q9GA 2RN0A 4GCSA 2OYIC 3R6NA 3UQ4A 3S4UA 3HKCE 1YITP 5EE2A 2A3DA 3CCRP 2N2NA 4DMVA 5C3JA 5C2TA 1WFDA 4WZXA 2X51A 2FJBA 2D0TA 4H63V 1HJ0A 3FWNA 5FMNA 2KZIA 3NWIA 3RBHA 3GHGC 2Q9IA 4BJNA 1NTKD 1PP9G 1S5LH 2JWAA 1USDA 4NUVA 4IL4A 2N1TA 5AQKB 2R89A 3L71D 1YKEB 5APQA 1DU2A 3AE9A 3TF5A 2Y0DA 5LA6E 1JNRA 3PHLA 1MFTA 3SOLA 2LKGA 1KYOD 2YMYA 3USSA 3TKLB 3C51A 4EZ4A 3ZC0A 4P1NA 1LTJC 3UUNA 2OMFA 3PGSA 1NKZB 2ZM2A 4XFJA 4FSOA 4LF5T 3RK3C 4D6TD 4U72A 2NZ2A 1NGMB 4N74A 4ZI3D 4BJMA 4LMJA 1QX8A 5IYUA 3G06A 2Q9QD 3L71G 2YPVA 4YTPC 3SYBA 2JWDA 1NTZG 3FBLA 1BGYJ 4KR8A 1YTZT 3AE8A 5AVWB 2WSFJ 1U7JA 1J1EB 4UB6O 3FXEB 3QRAA 1FE6A 3AXJA 3PUGA 3OYXA 2XJ7A 1MMAA 1YS5A 1UIXA 1LT9A 1DH3A 2QA4P 2XQ4A 3MZKB 3P4RA 2C5JA 5KAIO 3H1LE 4OFZA 4OGQB 3DJBA 4W7YA 1GFPA 3GN5B 4N59A 3H1JD 3LJCA 5G39A 2MTQA 1FZEA 4AYID 2XE3A 2R44A 1LVKA 3LK2A 2BCCJ 3HWBA 5LG3A 3M9BA 4RLCA 1M1KQ 5ABEA 2W90A 3SZVA 3LK42 3Q5EA 5B66H 4H9PC 3TLSA 1DEBA 3MZWB 2WZHA 2X9YA 4GIFA 2JMMA 3D0TA 2XM2A 4IL6H 1LWUC 2N9YB 4XA4A 4NIQA 1PGPA 3H1LJ 4YSYA 4FSPA 3W15B 1IFMA 2VURA 3V5UA 3AE4A 3NZQA 1Q2NA 5AVQB 2SPCA 4WW0A 1LJ2A 3N2KE 1EXJA 3EABA 4LFCT 3L39A 2MJZA 4HWFA 2WWUA 3PTRB 1V9DA 1RQUA 3BCCG 1H8AA 5DJTB 4DV2T 4JI4T 1KV4A 1SQPG 2YKSA 2LHRA 2L5GB 1KMIZ 2IZ0A 1QLED 1JCDA 2W27A 3KVBA 4QQ1A 2Y6XA 1FS0E 2K37A 1Y64B 2R32A 5JQGE 1GFOA 2W2UA 3M06A 3M9HA 4TUYE 1M56D 3O6QB 1ZHTA 3VY9X 3H37A 2PFXA 5FYMA 2E5VA 2QYWA 3CQCB 5B5EE 2ERVA 1G90A 4KJMA 2QVAA 4PK4A 4A5XA 4A98A 3H1KE 3PUAA 4D5UA 4GYSA 1WRGA 5JR9A 1RF1B 1D0ZA 4GCQA 2XDJA 4EI2A 5FVLA 3TK1A 3OBVE 2N2MA 1SQVG 1W2BO 2BBHA 4XE5B 3ESLA 1IC2A 4ZZCA 1QJ9A 3CX5D 4CXXA 2H89A 1E54A 3RIAA 4TLFA 1SFCB 5KAFH 2GM4A 4GHBA 1ZP0A 2LSJA 3GF7A 1EZVG 3A7MA 4L0RA 5LNKA 1NTMJ 3VR9A 5DQVA 3I0QA 3A8YC 3FYXA 4AKMA 4DV4T 3T20A 3H1LD 1H89A 2BBJA 4LSHA 3GLMA 1YQ4A 3ZMSB 2RKLA 2C5KT 3PUQA 3SYSA 1IZNB 2OGUA 3JCUE 3KINB 4DR6T 1J5ET 3C8VA 3BQIA 2HR3A 2NW7A 4HEAA 2OYHB 1GL2A 3GN5A 3T97B 2MKVA 3JAFA 2M07A 3L75D 1N8RQ 4YJ2E 2MYSA 3AA1B 2Y48B 3VE2A 2UUAT 2POHA 5KLVK 4LMLA 3IBPA 1OEDB 4JI6T 3M0DA 2I1KA 3RHWA 2BVMA 4HFIA 2J1DG 2Z6EA 1YQ3C 3OAKA 4KT0J 3BCCJ 2XQAA 4JEUB 3RRCA 5BMVE 4PJ0O 3H25A 2IAKA 4GCPA 4WBAA 1ZV4X 1P84D 2XAGB 5AVUB 1QSDA 3LG7A 1IFNA 1Y01A 5LXTE 3II6A 2XMXA 2OYOA 2VWAA 3GP6A 2WT7B 4O4UA 2WVRA 2W80C 4AYEC 2Q3EA 4H44D 1PHOA 1PGOA 3AE1C 5AQLB 4XNLA 5ABHA 1HF9A 1NTKK 1VF5D 1N73B 3VU7H 3PV0F 1D1BA 4F8HA 5KAFE 1OSMA 3FZKB 4PJJA 2KLUA 3SY7A 2R88A 2WDVA 3CX5E 2O4VA 3AE8C 3TGUJ 3RI5A 2IFNA 3AB3B 3Q5PA 5E79H 3N4XA 3EHZA 1VQMP 1EDJA 4AKRA 1AVYA 5IUXA 4C7NA 1S72P 2YDRA 1RH5B 2KXPB 1BSHA 3ZSSA 4V1Av 3KDSE 5DL7A 5KLVJ 1VQ7P 3ZLIA 5EFWB 1HJBA 1OMIA 1P84E 1L4AD 2IC9A 3VZTX 2E75C 3KVAA 2PGDA 1AVOA 1VQPP 2XQ8A 3QB5A 1M8OB 1JM0A 1T1LA 2LHFA 2ZLYA 1ZN5A 3AAIA 5LG4A 2XQ9A 1KNRA 2AEFA 2XAHB 2IYOA 3UUMA 2WWWA 4HKZH 2WY2A 2QEXP 1JY3P 3VZUX 4X1YE 2OV9A 2V7QH 3HE5B 2WMNA 3VN0A 3MP7B 5AQHB 3GMIA 1R5LA 2KYVA 1SQQE 5L3BB 1FZCB 4C46A 2UXXB 5AW8B 1FZFA 5L3EB 2D0UA 4KHZF 3RQWA 1W5CE 3Q2YA 4BAYB 2E74B 3BVHA 5DL8A 1PL5A 1GFMA 5AQQB 2N1GA 4PD4D 1ZW0A 3RK2C 3PUXF 3NXSA 3RF1A 4AI6A 5AW1B 2O01J 2BCCE 1M7LA 4AYCA 4C7NB 2X66A 4PK5A 1HTJF 1VCTA 5FP3A 1UX4A 4YTPA 2FXPA 5ABFA 3RK2D 1M7KA 3E22E 2YKOA 3H1KD 3QNUA 4TV8E 3UAQA 2ZVNB 1OIPA 4OYKA 2LR2A 3IA3A 2Y8DA 2JJLA 2A45G 2VL0A 2BASA 4Y28J 1HH0A 3MD0A 3CCSP 3BS0A 3K5BA 2QGSA 2E74D 4BXLA 1M90Q 1KILA 2W61A 1FC2C 2K5BB 4DR7T 3JTYA 4JFBA 2ES0A 1G8XA 3OKQA 5FY0A 2H88A 4UB8E 5F3JA 3VR8A 3N9PA 1L0LD 3Q5WA 2W6JH 3J7Yq 4AKIA 2QM8A 1HX1B 3CWZB 3CK6A 2CHNA 2IC6A 2E76B 4QX7B 1S3JA 3AEAC 1UGOA 4CXYA 4O2AE 3E1RA 3Q5RA 1VQKP 2IYPA 4K3AA 1T8ZA 2X0YA 2YU2A 2BG9C 1XWMA 3TYYA 4IFFA 4JEHB 1KC8Q 2NR4A 2V26A 1E79H 4N6JA 1NWMX 4OX9T 4UELA 3AE9C 4OGQD 2D2SA 5LGNB 4FUVA 4I7ZC 3V4QA 3CKDA 1SE7A 1ZMEC 3AE5A 2NWBA 3BRZA 1YI2P 4GDOA 1MIYA 1CI6B 2WQYA 2Q6QA 3QH9A 3QB5K 4EXTA 2KUBA 4YPCA 2YKPA 3V4WA 3AECA 2QJPB 1SFCA 4AYMC 3AE7C 4L76A 1VQ8P 1Q86Q 4U33A 2XAJB 4C00A 3HD7D 1S2EA 3N7NA 3VZWX 4C69X 2V7MA 1YQ3A 5GTHE 2FFDC 1SQVK 4DO0A 4YSZA 4UF0A 2OQQA 1KF6A 4PJMA 1X22A 4GK5E 1N2DC 1IO4A 5KXJA 5H2FE 2VASA 4DR5T 4ISSA 3A2SX 3HUSB 2OYIB 1BDCA 1LT1A 4GIWA 4E1SA 1NAFA 3B13A 3WI5A 2LEHA 2IW5B 3H1KG 3AA6A 5EK3A 1ZEEA 2JO1A 1IFJA 1VDFA 2WSCH 3RK3B 5B5EH 4O4XA 4Y99B 4U2ZA 4GKKT 2PTFA 4ASVA 4I43B 1LTJB 2WVPA 1WLXA 2ZYGA 1XTGB 1OX3A 3VMAA 1IFPA 1UX5A 2E75B 5B66O 3HD7B 2L9QA 2VB6A 2KS1A 4IDZA 3OVUA 1SFCC 1FOSE 3W67A 5TISE 4A56A 2C0SA 3FGAD 1KEYA 3CX7B 2E5YA 3UUXB 5LYJE 2R5DA 1T2KD 1KYOE 3TLVA 4AYNA 3UIAA 4AFKA 1S5LX 2ZYAA 4E7SA 2DHRA 3JC6C 2CHOA 2J58A 3SSUA 2H7HA 1LP1B 4IOIH 2BS4A 1J1DB 3A0HO 2NPSD 3L35A 4EEBA 2BS2A 5AQFB 4PUXA 2XPKA 2L91A 1GK4A 5AQIB 4D65A 2YNYA 4PAGA 3KV6A 1ZV8A 2QJYC 2NPSC 2NW9A 2IBZE 4X20E 2LSIA 1A02J 2QA7A 2W00A 1HWTC 4K0KT 1L0LJ 1R8EA 4FESA 2A45H 3RC3A 5TAOA 1LTBC 4O3YA 4O3WA 1N7LA 5KMGP 1JY2N 2KXPA 2X0LB 3B4SA 3P4PA 1S9KE 2KWHA 4AISA 1ZOYC 1FU1A 1SQPJ 3FZHB 1HGZA 3HI2A 3ZN1B 2XQ5A 2V5CA 5CCGA 2FYNC 3N9NA 3RKOA 1E5WA 1HF8A 3H1HD 1MV8A 3LW5H 4RLBA 3RK3D 3C4ZA 1NVOA 4JBWF 3AVRA 5L3GB 1BR4A 4YT0A 3Q2MA 4HFBA 5CCHD 3JAEA 5LBMA 1S5LO 4I50E 3POUA 2BS3A 1T8BA 1GQEA 1Y47A 4BRYB 3CCQP 2MPKA 4MALA 3V5SA 3AE7A 3ZMVB 1BE3J 2Q9QC 3K3NA 1VL2A 2JMHA 3H6PA 2KB7P 4Z90A 4FRTA 4B3TT 5HXRA 2XU6A 2F1VA 3PUWF 2KC0A 2XTQA 4CQIA 1BCCG 2C9LY 3IAOA 1Z56A 5L2LA 3WAKA 4H9NC 2WT7A 2EHOA 2P9BA 4PK6A 4DBQA 3JSVC 3KFWX 3CCUP 3B57A 5HXCA 3O9XA 2XUEA 1S35A 5AVVB 1X9BA 1ORMA 1K9MQ 5JDPA 4ILBA 1AJYA 1BGYD 3SS1A 3U3IA 1GL2D 5JDQA 4OYJA 5FL1A 1IFDA 4AQRD 4AKRB 3PU3A 1YYCA 4W80A 2SPZA 4H9QC 4YLHA 4COFA 2OYHA 1GW3A 3C1LA 5LOVE 1XMQT 2JQKA 1ZHXA 2EHOC 1X79B 2Q3IA 4HFHA 2H8PD 3U59A 4BA9A 2V6YA 2ZM8A 4CXWA 1L0NJ 3UT5E 1USEA 2KNCB 1KTMA 2RMZA 1MIVA 1EZVE 2XZRA 4N78D 5CJ4A 4HJGH 1WYBA 2Y0KA 3VRBA 2HODA 1LTGC 3HTKB 4EZHA 3TNUB 3S1KA 3GMAA 2PBIA 4MLKA 5AQUB 4DCKA 3ANWB 1N33T 1N36T 5E79E 4YTNA 3EAMA 3T1YT 2NW8A 2YKQA 1US7B 1M1JC 4GF4A 2JEEA 1BH3A 1SQPD 1YKHB 1XTCC 2LM9A 3Q5DA 5CA1E 4RJXA 4EIWA 3CCMP 2O01N 3L73G 2W67A 2IWVA 4LF4T 2P2UA 1Q90D 4IE6A 2LOPA 2E42A 1MMDA 3OTOT 1SP4A 1EXIA 2ZT9C 3I1AA 3GHGA 2M3EA 3LIEA 3N9QA 4PD4E 3N2OA 4OHFA 2KDYA 4OWFA 2JRKA 3KZIO 3IEEA 5DJUB 3AAAA 5ADXL 3D6ZA 4PV1C 4WVZA 1JMBA 1KQFB 3AA1A 3PJAJ 3ZT7A 3FZLB 2FYNB 2IDOB 3HUSC 2I1JA 1AFOA 4FQEA 2N1TD 2WMMA 4ANJA 3OA7A 3MXZA 2X27X 4KBMB 3B5NC 5APWA 2WSSV 1NYHA 3CWBJ 4ASKA 3POQA 2R3CA 2XKMA 4JBZA 2E9XA 1P84I 2O1KA 4ZOLE 1EDKA 5C39A 4DV6T 4E7ZA 3PORA 1BSNA 3T0SA 1GK6A 1KILB 5KKZC 2YEVC 1K73Q 1OVRA 1WYCA 1NEKA 4XNKA 1KB9I 2AXTH 5JDLA 1YIJP 3CMEP 1H6S1 2YINA 1ZLLA 1VCSA 3FZFB 4AUWA 3AAAB 4U7JA 5KLIB 3RH3A 1UUSA 1JY2P 2LE8A 4TNVA 2K9AA 1I6ZA 3RRWA 2WPQA 1YW0A 3O1JA 1SQPK 2CWOA 2FJEA 1Q82Q 2KZ7B 3Q5SA 1M1JB 3CX8B 3L37A 3IR9A 3CPZA 4HFVA 4I6MC 3K3OA 2RA1A 1D0XA 3X1DA 4DV1T 4MN4C 1JUNA 1NTKJ 2MNHA 1JTHB 4B3MT 3SWHA 1EDIA 2BKOA 2XAFB 5J1GA 3EI0A 2CK3H 3MTUE 3NRYA 1CZQA 4HYTB 5CCGD 3BQLA 2K9JA 3K8PC 2CXLA 1PIXA 4DV3T 2ZM6T 4JI2T 3V2RA 3VMXA 2C9NY 3M0AA 2KK7A 5APUA 2IHR1 2ODUA 3NVOA 4H0LD 3J9X1 4DV7T 1PPJD 4C90A 2NP9A 5CCHA 2DNXA 3A7OA 2V7IA 3AEGA 1FJKA 4X65T 2D9DA 1KILC 3L74E 4PD4H 4GOUA 3B8EB 4IGUA 1HS7A 4HFDA 2FFDB 4YY3T 3AE4C 4H0LC 4U3FJ 3E08A 5LP6E 3L3PA 2CPSA 4CI2B 3LFMA 2F1CX 1N73A 4DT0A 1NTME 1Z8UA 2KS1B 2CE7A 3P4WA 1KYOH 4YXWH 3CCVP 2CA5A 4ASWA 4WNKA 3ZYKA 1HNZT 3LK2B 4QHOA 4O8SA 1N7SA 4E1TA 2CPBA 1K05A 5DJQC 4F6RC 4O4HE 3C64A 1KD1Q 2JQYA 1SQQK 4PJNA 1YD8G 3IF8B 2E8IA 3UUBA 3OJAB 2OTJP 4TWDA 2ZXXA 3V2NA 5AW2B 1N34T 1GTWA 1U5PA 2I59A 2WDQA 5G3AA 4H9OC 4U31A 1QVFO 2Q9QB 4TV9E 1SQQD 3WUTA 1FJGT 1D1AA 3HE4A 4ZMDA 1S94A 4KI0F 2CXFA 1NTMK 4IDOA 2V7QJ 3HKBE 2EHOB 5HEGA 3CCEP 3T8OA 3PJAA 3SY9A 3HRNA 2PRNA 3BK9A 2A2FX 3VKHA 1FZBA 4NPFX 2KI7B 3POXA 2W0GA 4L5GA 4CN1A 2AXTO 1PP9D 2W6BA 2FYUK 1ZR4A 3KYQA 3ZC1A 3M9QA 3Q3DA 2LRLA 1RF1A 2CMRA 5A1LA 3L09A 4IL6E 3VKGA 3T97A 1MM5A 2A45I 1VQLP 3H1HE 1MZ9A 5AQTB 2HLOA 4NPPA 2FYUD 2JQ9A 2CPTA 3TDKA 4OH8B 4YTMA 2UUBT 3TLUA 1NHLA 2YOEA 3A0BO 1YHQP 4WYVA 2DW3A 1IJ6A 3A5XA 2ZT9B 4LMKA 5JRCA 2P10A 1OPFA 4IE4A 2HPCB 5AVYB 2XQ7A 4XZCA 3I9WA 1UIIA 5GTIE 5HCJA 1N86A 4FRXA 3IF4A 2LRKA 4PFPA 3RC8A 3V5BA 4QH1A 1KYOI 1KQSO 1R5SA 4PJ0H 4IDNA 3T1HT 1NTKE 2FYUG 2CLYC 5KJ7A 5CBNA 1T72A 3N2GE 2JIWA 4HE8A 1M57D 1SLQA 3KHUA 1NTZE 3CIRA 1NWQA 3O8ZA 3NJTA 2ZJSE 1XDPA 2ODJA 4GOFA 1MFZA 4EB6E 3P4SA 2P67A 3SWYA 4PD4I 5L47A 2PORA 4U2YA 4DMWA 1JY3N 1P4TA 2M6BA 4KUMB 3KV4A 2LJLA 3RL0B 4Y99C 4AXPA 2ODVA 2IZ1A 4EGWA 2JP3A 4XBFB 5JDGA 1SQBE 3AE1A 1H88A 1KB9D 1QL1A 3ZYLA 1FAVA 3OPCA 3JCFA 1GD2E 2WPRA 2FXOA 4KHXA 2WBLA 2UUCT 4AKGA 2CCQA 1BGYE 3CXHD 4GOEA 3HE4B 4U7IA 3GG2A 3H32A 4LSIA 1KNZA 1L4AA 5BU8B 5KJ7C 4ERRA 1KQGB 4DR3T 3L73J 2JDIH 4ZKPA 3AE6C 4Z1MH 4U9CA 2A72A 5H6QB 5H2FO 4M1PA 4LF9T 1G1IA 1IFIA 1SQBJ 2XY8B 4P09A 4IE7A 4AQFC 2AEMA 3EFGA 3HUSA 5AW9B 2ITAA 2FGQX 2FJAA 5GTIH 2UXCT 3DTOA 3SFDC 3B5NA 3VMYA 2VK9A 2IBZD 2P1JA 2PP6A 3BCCD 1R8IA 2XNXA 3CXHE 3AA6B 4JI1T 4NXMT 3QWOC 4JYCA 3N5LA 2F4VT 2OYIA 3KV9A 3EUHA 2O3JA 4H13B 2O01H 3K19A 4IE0A 3RKGA 1S1CX 1URQD 3UPGA 3IHRA 3N9MA 3OW2O 5FY1A 4X66T 3EVYA 2M6IA 4RJWA 2CWYA 3C5OA 4LFBT 5K5GB 1SQVJ 2XV5A 3RBXA 4BUMX 3A0BE 2M67A 5APXA 4ZS3A 3U1AA 1WR6A 1P84H 1CHUA 3VHLA 5CFBA 2E76D 3JCUO 2WSFH 2BKNA 2VVSA 4NUUA 4P0BA 4ADZA 2LSKA 2KSRA 3ZMZB 2H89C 4PNIA 1NAYA 2LKMA 2AE9A 4PFOA 4IT4A 2UXDT 2LFUA 4K3CA 1OEDE 2R4OA 1Y9BA 3MKDA 2PFVA 4WY4B 3CC7P 1ZKEA 3LSVA 2KWIB 4HWIB 4ZI2C 5APSA 1N7SD 2BCCD 3HE5A 5FXVA 3RL0D 1VF5C 4TN7B 3R4YA 2B1EA 5HXEA 2J1NA 4HKAA 5LJMA 2GE4A 2XNDH 1FZCA 1LTSC 2RPAA 5AQPB 1U57A 3ZDMA 4I0UA 4KMCA 4YHHT 1NKNA 3EQ2A 1KNPA 2X9WA 1ZRTD 4H44C 1FMWA 5DL5A 2Y0EA 3ZYMA 1JCCA 4AIUA 3O4XE 4CN4A 2WMOA 4WB4A 5G38A 3V8UA 1L4AC 2YO2A 3CX6B 4H9SE 4MFRA 2LXCB 3TLWA 2IIUA 1X79A 5CCHC 4DR4T 4C91A 1PP9E 3I5CA 5J2TE 1BE3D 5TJHA 2C5IT 2ZM0A 3H1HG 2ZYDA 3RL0g 5LB7B 4NPDA 4DR1T 2WP9A 5ABFB 3AE5C 4R4MA 4EYYR 2E9XD 1LTTC 4AQYT 3O1HA 3H1KJ 2BG9B 2IBZG 2B87B 4DNDA 4AUIA 4XAXB 5AVTB 2YU1A 4YFSA 2GUSA 3NBXX 1NTZJ 3AEBA 3C98B 3CQGB 4O2BE 2HN1A 2V4HA 2VRSA 2FFDA 5CHXA 1PV3A 1BR0A 2QM7A 3EMNX 2WSEH 3R2PA 5LMNT 1RE3A 2R5BA 3QRCA 2A06G 4U3FE 3A0HH 5AQSB 1HXTA 2K9JB 1BGYG 1SQXJ 2XQYA 5DL6A 3GHGB 4QXCB 4DUYT 3A0BH 5JR9B 4DZOA 3D70A 1IJ5A 3QC9A 2IDBA 2HPJA 2VQFT 5L8RJ 1GU5A 4KX6A 4PV1B 5KLVE 3LDQB 4N75A 2NRGA 2HPCA 5FL0A 3O6QA 3I55P 2K24A 2KZ7A 2FBWC 4AZLA 5HEOA 1YQ4C 2FYUE 2V6YB 4Q25A 5KTBA 1OW8A 5GONE 3DZMA 5AFUL 3E1IA 1THQA 2Y0LA 4ILUA 5HXSA 3S4RA 2FXMA 4X64T 3VOPA 3JADA 5HYAA 2K4TA 4GYRA 4AKHA 1QL2A 2ACZA 4ZXLA 4H9RC 3RK2B 4JV5T 3TGUE 2M06A 5FXWA 3RYFE 3ZPOA 2E74C 5GTHH 2BG9A 4KRAA 2DWKA 1OEDC 4U74A 2YO3A 5C8YE 4DOJA 1M62A 4UR9A 1FZCC 3L75E 2ZT9D 2GA1A 1Z0PA 2GK9A 5APVA 3EWKA 4PJ0E 3TSIA 5HWYA 1AQ5A 4ZEYA 3DWOX 3SZDA 1HG5A 2LHNA 2W83C 3E7KA 1DEEG 5KLVD 2KSEA 1CW5A 1AA0A 3CWBD 3AEFC 1VOMA 4IIJE 2VQET 2WITA 1IZNA 2W62A 1NTKG 1BCCJ 3L72D 1UCUA 1SVFA 3MIWA 1RF0C 5L4HA 4MHCA 1BR1A 1T7SA 1U4QA 4B3RT 2P58A 4YXDA 3B5ND 1E2AA 3AEDA 2UXBT 5H6RB 4CPGA 4FZMA 3L70G 4ILCA 4IFMA 1LP1A 3JC22 3PE0A 5H2FH 2BEZF 4IL6X 3KDPB 3G3ZA 2R4NA 3L70E 4QXHB 1L4AB 3AE2C 1MKMA 2DI4A 1URQA 5GV0A 3SWFA 5AW6B 4HN9A 1OW6A 3F89A 1T16A 2Z5HA 4LGDE 4D6TG 1O3XA 1XZYA 4QH4A 5FXXA 4LSEA 2OLTA 3UU6A 3KPEA 3M65A 3AAEA 4NPEA 3ZMUB 3AA0A 2CM0A 1KQLA 3PH0A 3CD6P 4HWCA 1L0NG 2XQ3A 4X1IE 4D6TJ 1RF1C 5AW4B 3ETVA 1PPJE 5LCYA 3AA7B 1PGQA 1QJ8A 4UV9B 3SWKA 2C0WA 3L70D 4IL6O 1FJPA 2WPVB 1S4XA 1L0LG 1MPFA 4UVCB 5JREA 4PJLA 1MM4A 2AXTE 3GF3A 2R3SA 3CX5I 2NTXA 4GT1A 3ABVA 2WDRA 3FWLA 1SFCD 1SQQG 2YDQA 1GW4A 3NSGA 5F8PA 3SFEA 5AVRB 3UU5A 1MUUA 4ZKUA 3HD7A 5LMUT 3F2EA 3FXDA 4JI8T 1JB0J 3NZPA 4FZLA 2LSYA 4GODA 2H88C 5FY7A 4QKNA 3H32B 2GUVA 4AQFA 1KN7A 3ZSTA 3NTNA 5FXZA 5M4YA 5AW0B 1UK5A 2YN6A 5LHHB 5FKYA 2KP8A 3RIUA 4I7ZB 1IK9A 1EZVI 3ZEFB 3CXHI 3V2QA 3VY8X 3L72G 3CWBE 4CN6A 1VQNP 1RE4C 2Q1KA 1QEXA 2W66A 3CC4P 3B5MA 3VYIA 2FUPA 4B61A 3UU2A 3M91A 1JEKA 2V8SV 4Z91A 1WR0A 5AVXB 3SFEC 1HNWT 1HTLC 2RP4A 4QMAA 3AA7A 4JYBA 4O3ZA 1RF0A 2XE1A 3UULA 3N9LA 1FOSF 2RH0A 2X67A 3TZGA 2NPSA 1Y8AA 3AEDC 4HH2A 1KFMA 1IK7A 3C4XA 4IL9A 1EZ3A 2ZVOB 2IPPA 4UVAB 1KORA 4RJTA 3UFEA 2J59M 2VL8A 2XAQB 3AAEB 4WBOA 2QIWA 1MMNA 4X62T 1AV1A 1JNZA 3AECC 2Y9YA 2PG8A 2XZEA 4N78E 3FZMB 2VVNA 2R6GF 4X5TA 1DIPA 5JTGA 5KDMC 3OYZA 2ZFGA 3L74D 4CZZB 5IHYA 1EDLA 4ZI3C 4FOZA 3ITKA 5HWXA 2PAJA 2M0BA 2J4GA 2MOZA 4DV5T 3HKDE 5LJNA 1W0BA 2A9UA 3PJSK 1KK7A 2G0UA 2N1TB 1BT9A 3QOFA 2BKPA 2QJPC 4HWDA 1LRZA 4Z8XA 4EAHA 3DWNA 3RBZA 3A0HE 1ZP0C 3PUVF 4RESB 3MACA 2N9DA 2X0HA 2PJQA 1YJ9P 3ETUA 2Y7SA 1PP9J 3MA9A 5JRCB 2WPSA 4JI7T 2LLYA 2QE7H 3L36A 3L72E 4L73A 3P8MC 2EHOD 1LKXA 2MHLA 2KLQA 3I56P 5JVDE 5JH7E 2QTKA 5JR9C 3AEEA 3GW6A 1J5WA 3RLFF 2FYUJ 2KNCA 7PRNA 2MAWA 1LGHB 5J2UE 3TGUG 3T24A 2KLVA 4LF8T 3G4SP 1HVVA 4UEMA 1JNMA 4TT3H 2QJKB 3RQUA 3MJXA 3I0OA 3R84B 3AXJB 2OTKE 2WSEJ 1BXWA 1HBWA 1EZVD 3VE1A 2X9HA 3VMZA 4KR4A 3WI4A 5GTHO 3ZJ2A 1L2PA 2LM2A 4RO0A 4H13C 1NJIQ 4JYAT 1NTMG 2UWJE 3BQKA 5AW3B 4JI3T 2BEQD 3L8RA 1N73C 1HCIA 3L74J 3DP7A 1WMKA 1GZLA 4G2AA 1UURA 1D0YA 2L8KA 4H13D 2HFED 3CC2P 1FDMA 1T3JA 4BRYA 5E79O 2ZXEB 4R4LA 1VF5B 4K35A 2WB5A 2WU5A 4DIDB 1XNQT 1HXXA 3PRJA 1SUMB 2IMLA 3DA4A 1GU4A 4LSFA 1MIWA 1L0NE 1NU1E 2G8YA 1HX8A 2BG9E 2R8AA 3E0ZA 4K3BA 1VQ4P 2N1TC 4O3XB 2Q9QA 5L3DB 1M1JA 2LXBA 2WM9A 4HFEA 1SQBG 4KP3C 1L0VA 1ZHYA 2HYNA 3U1CA 4H0LB 4LF7T 1RY3A 3K3QC 1J1EC 2ZAEB 4C4VB 3FB2A 4JUYA 1BCCD 3VRAA 1X9VA 1U7MA 1LTIC 2CEAA 3AEAA 1RE3C 1G1JA 3B71A 3Q1MA 1BE3G 1BDDA 5KAIH 2LSGA 5L3CB 4ZS2A 1LVFA 1VQ6P 4HTEA 4UB8O 3H1HJ 2CXDA 1W0AA 2JJ9A 1L0NK 3RK3E 4LFAT 4KHPT 3K1SA 4LF6T 3L73D 2BVLA 1QVGO 3F57A 4TX5A 5PRNA 2FY8A 3AEGC 2CBIA 3ZT5A 1BCCE 1ZRTE 1L0ND 1CI6A 1W09A 3ZJ1A 4MBQA 5HEJA 2B89A 5CJ0A 1PGJA 3F5HA 2KSJA 3F31A 2CRBA 2B76A 2WS3A 5JDHA 3P50A 4ISTA 3ZKRA 4U3CA 3PF1A 5EK4A 5LBQB 3BRTB 2P7JA 4HWHA 4JCHA 1NTZK 3L70J 1T98A 4EOZB 6PRNA 1W9RA 3OJAA 1FBMA 2QRXA 4A7PA 4HB1A 3WUVA 1YXRA 1FZAA 1X8YA 2IFMA 5E0OA 2K1AA 3KVDD 4PR7A 1KB9E 4UB6H 3CCLP 2BCCG 4B3ST 3PLNA 3H1IE 4IHJE 4WY4D 1A02F 2XE5A 4JPZB 3G6EP 1RQVA 3L73E 5AQOB 1KFNA 2VKHA 2K9YA 1EC5A 2DLRA 4YXDC 4CI1B 4DUZT 4WY4C 3EDUA 1Q81Q 1GL2B 4M3LA 1LT9B 1FDIA 3I9YA 2Q5UA 1OVUA 2K88A 3WMM0 1IAPA 3AE2A 3QUJA 2YIUC 1MNDA 1H0TA 5IWAT 1LTAC 3LK41 1Q7YQ 1HGVA 1RE4A 3BRYA 3GWHA 5D5DA 1IJDB 2FJDA 1VQOP 4L75A 4ZHQE 4FI5A 1SS1A 3RYIE 4EOTA 4AKLA 5BR8T 5AQMB 3CX5H 3FX0A 3RYHE 2KIKA 2WZ7A 3D71A 1BR2A 1IBLT 2LOSA 5DABA 3V2PA 2E9XB 1HXUA 3QK6A 2XE2A 1FDOA 2N2LA 5EZYE 3RYCE 3PQSA 3L71J 5KAIE 3BCCE 5DQWA 2Z5IA 1PPJG 2HODB 2B87A 3CMAP 1NTZD 3C4WA 2JR8A 5AQVB 2A06D 2DWGA 2H7VC 4RL9A 1IBMT 1K8AQ 2JQHA 5F5WA 1D7MA 1OZHA 3HW9A 4U7YA 3HKEE 2YXRB 2L3LA 5BVZA 4H63H 2KMFA 2KT9A 5CBOA 4N58A 2HH7A 1QLBA 3PQUA 2V5DA 4FJOA 4YSXA 3WI3A 1QGKB 2AXCA 4DV0T 3CL3D 3IFMA 4C7RA 3MK7C 5J0ZA 2NPSB 1VPCA 4UIGA 3FXDB 3PUYF 1JY3O 3CI9A 3M0DC 5AQGB 3H3AA 4EEDA 3WAJA 3NMDA 1FIOA 2WTYA 3A5TA 3H3MA 1NH4A 2V7JA 4QX8B 1ZXGA 1L0LK 2M5AB 3CLQA 1PFIA 2JMKA 5L3FB 2J5UA 5LHIB 2IBZI 3A2AA 4IFDK 3NFQA 3CMLA 1KILE 3AE3A 1PZQA 2HHHT 2Y0CA 2I0MA 1JOCA 3LW5J 3FXEA 3Q5XA 1OW7A 2WJRA 2H7OA 1YJNP 3UU8A 1AQTA 3G7GA 2WSCJ 1LWUB 1DD4A 3ONJA 2D2CC 4H44B 5CJ5A 3P7KA 2WWVA 2J47A 5JDMA 1T3UA 2AEJA 1B7TA 2D2CD 2WJQA 2XSBA 4HGAA 1J1JA 4EV6A 3GA8A 5HAXA 3WUUA 4JF7A 4TWHA 2WZIA 2H3RA 1GMJA 3G71P 1H7CA 1OWAA 3MGNA 5ABGA 1JTHA 3HOEA 3L72J 5KJ7D 4N3YB 5KKZB 1SQXG 2JQQA 4TNWA 5AW7B 1NTMD 4OGQC 2YIUB 1SQVD 3AA0B 3TLTA 4C4VA 2VKJA 1N7SB 2ZLDA 3KBTA 1S5LE 5HEUA 5M1BA 3G9RA 3ZMTB 3WU2O 3LK3B 2KINB 1LT9C 5LGUB 3NRXA 3PTZA 2X9XA 2R4LA 2K3RA 3VTPC 2Y9ZA 3HA4A 2XSAA 4YJ3E 4TWFA 4P0AA 2OARA 4ZI7E 1ZR2A 4JQ0D 4A97A 1CSBA 3KQGA 1K04A 1NU1D 1GFNA 4WBNE 3C50A 3LBXB 5HXHA 1PRNA 1SQQJ 2OA5A 3L75J 2M3BA 2FYZA 5JDNA 2AXDS 2IUBA 2E76C 3UU3A 2W6AA 3NKZA 4EDFA 4AQGA 1LWUA 2WQYC 3L74G 3C9IA 1MMGA 2YMKA 3SFDA 2WSSH 1URQC 4I1LA 3KZIH 3AVSA 3U78A 2W63A 5AQRB 3SRZA 3FBZA 2HG5D 1OEDA 1OFCX 3PP5A 4JI5T 1SHZC 3BASA 3FHNA 3ONLC 1E1HB 2YK0A 3W68A 4D6TE 4UF0B 4ZI2D 2DL1A 1N7SC 2V7KA 1VQ9P 1NOHA 4JLEA 2M5AA 3KV5A 5TISO 4YHJA 1YJWP 1WRDA 2W8ZA 1MNEA 1DX7A 2NOXA 5T5FA 2VKDA 1G2CA 2LKHA 4O4JE 3P4QA 5B66E 4IREA 4UB6E 5CB4E 2DCFA 1DD3A 4CTDA 2BZBA 2FKWB 3VP8A 3RL0C 1QJPA 4I2LC 2D5UA 5AFUK 1ZHZA 4B6XA 2HN2A 5CGMA 5KAFO 3RIFA 3D6YA 2KNDA 4I4TE 4LLHA 3S9OA 2JKVA 4UXNB 3UFGA 3PDYA 1YTZI 1T6AA 5AQJB 4FMSA 5KX5E 2JPFA 3KBUA 4G76A 3TGUD 4EYUA 2CLYB 2E43A 5APYA 4G75A 3O1IA 4W7ZA 1NO4A 1HR0T 1NU1J 4RKUJ 1VQ5P 1JMMA 3BATA 4EYYQ 1HFAA 2VKOA 1OVVA 4EIJA 1AJ3A 3H1LG 3RIUC
chains in the Genus database with same CATH topology
3UUMA 3P7IA 4FT6A 3PURA 1U5PA 2I59A 2K48A 2PG8A 3Q9DA 4H9OC 2E9XC 2Q9QB 4TV9E 1D1AA 4L9IA 3VZUX 4X1YE 4DVDA 5LHGB 2BDEA 1S94A 2WMNA 5KDMC 4D64A 3OYZA 2CXFA 3GMIA 2ZFGA 4CZZB 5IHYA 5ADXK 1FMVA 5L3BB 3HKBE 1OXZA 1SA0E 2EHOB 2UXXB 4ZI3C 4FOZA 3N9OA 5L3EB 2D0UA 3T8OA 5HWXA 3O0EA 3SY9A 2PRNA 4BAYB 3BK9A 2A2FX 2MOZA 3VKHA 3ZCIA 3HKDE 5LJNA 5DL8A 1KK7A 1GFMA 3POXA 2G0UA 2W0GA 4L5GA 1BT9A 5FVNA 2N1GA 2ZMAA 2UXNB 5CA0E 1LRZA 4AI6A 4Z8XA 4EAHA 5G26A 3ZC1A 2X66A 4PK5A 3UTKA 2XHEB 2CMRA 5A1LA 1HTJF 3L09A 3MACA 1UX4A 2N9DA 5FP3A 2PJQA 4DBRA 2FGRA 8PRNA 2J4UP 3ONXA 1MM5A 3ETUA 4IE5A 2Y7SA 3CQXC 3E22E 3MA9A 5JRCB 3UAQA 4TV8E 2NTYA 1HG2A 4OYKA 2Y8DA 4O49A 3HOLA 2YNKA 1ZHCA 3CVRA 4G63A 3ANWA 1IJ6A 2EHOD 1FEWA 1LKXA 2MHLA 2KLQA 3A5XA 4TZ4C 5JRCA 2QGSA 5JVDE 5JH7E 1OPFA 4IE4A 5JR9C 2QTKA 4Z3TA 2W61A 2K5BB 4XZCA 3I9WA 3JTYA 4FRXA 4O4LE 2MBGA 4JFBA 7PRNA 2ES0A 4J2CA 4PFPA 3RC8A 1G8XA 2ACXA 2W81C 4UVBB 5J2UE 3OKQA 2XG6A 5FY0A 3T24A 4AYDC 2CLYC 5F3JA 3N2GE 3N9PA 5JDFA 4HE8A 3Q5WA 4UEMA 3J7Yq 4AKIA 3MJXA 3I0OA 3DA3A 3CWZB 3R84B 1BXWA 3EDVA 3VE1A 2X9HA 2ODJA 2WAUA 2IC6A 2Y0HA 4KR4A 4EB6E 4QX7B 3WI4A 3ZJ2A 5LGTB 4CXYA 4O2AE 2PORA 4DMWA 1P4TA 4KUMB 3BQKA 3KV4A 1QUUA 2XTRA 2LJLA 1HCIA 2YU2A 3DP7A 4G2AA 2ODVA 4AXPA 4JEHB 4XBFB 5JDGA 5ETWA 2V7LA 3VKGA 2V26A 1D0YA 1NWMX 2L8KA 3ZYLA 4X1KE 2XASB 4UELA 2D2SA 1VRBA 5LGNB 1HXXA 4FUVA 1Q9FA 2WBLA 3CKDA 4AKGA 2CCQA 3DA4A 2NWBA 3LK3A 4LSFA 1MIWA 1MIYA 4QWNB 3HL6A 1HX8A 4EXTA 4LSIA 1KNZA 4I55E 3E0ZA 4F4BA 4AYMC 4O3XB 4ERRA 2Q9QA 5L3DB 2WM9A 2XAJB 4KP3C 3PRNA 1ZHYA 3VZWX 4C69X 1G73A 2V7MA 2A72A 5H6QB 4U9CA 3K3QC 4M1PA 4DO0A 4UF0A 4P09A 4IE7A 4AQFC 3FB2A 4JUYA 4PJMA 4GK5E 4FZNA 2CEAA 2VASA 4ISSA 3A2SX 4GIWA 2FGQX 3DTOA 1NAFA 4E1SA 3B13A 1D1CA 2LEHA 2IW5B 3WI5A 2VK9A 2LSGA 3AA6A 5L3CB 4ZS2A 1LVFA 5EK3A 3ZN0B 1ZEEA 2XTLA 3AA6B 4HTEA 2CXDA 3LBXA 4GK0E 2JJ9A 4O4XA 3N5LA 4TX5A 2BVLA 3F57A 3KV9A 3EUHA 3P8CD 4I43B 5PRNA 2X68A 1WLXA 3K19A 4IE0A 3UPGA 3HR0A 5EK2A 1UX5A 3IHRA 3N9MA 5FY1A 3EVYA 3PU8A 4O4IE 2L9QA 3ZJ1A 2VB6A 4RJWA 2CWYA 4MBQA 3C5OA 3F31A 4IDZA 4K0UA 2F1TA 5FNVE 2V1DB 4BUMX 2M67A 3PUSA 4ZS3A 1WR6A 4ISTA 5IYZE 5JDHA 3VHLA 3RPUA 4A56A 2C0SA 3CX7B 5EK4A 4NUUA 5LBQB 4P0BA 1GFQA 3RX6A 3UUXB 4ADZA 2LSKA 2LT3A 3ZMZB 5LYJE 4JCHA 4AYNA 4AFKA 1T98A 4PNIA 4PFOA 4EOZB 6PRNA 3OJAA 4PW8A 1CUNA 4E7SA 2DHRA 2LFUA 2Y2XA 3JC6C 4UV8B 4OK0A 4CI3B 5E0OA 1ZHWA 3MKDA 2PFVA 4QXBB 3KVDD 1ZKEA 2KWIB 4PUXA 4ZI2C 3JC6D 5FXVA 4IHJE 2XE5A 4D65A 4TN7B 2B1EA 5HXEA 2HPLA 2J1NA 4PAGA 2K0LA 3KV6A 4HKAA 1Q9GA 5LJMA 3ZCJA 2GE4A 2VKHA 4GCSA 2NW9A 3R6NA 2DLRA 3S4UA 3HKCE 4KMCA 5EE2A 4X20E 2A3DA 4CI1B 2LSIA 3EDUA 2QA7A 2N2NA 4DMVA 2W00A 2X9WA 3I9YA 2X51A 2D0TA 4H63V 5FMNA 4FESA 1FMWA 3RC3A 5DL5A 3ZYMA 3O4XE 5TAOA 3RBHA 2WMOA 4O3YA 4O3WA 4BJNA 3V8UA 1IAPA 5KMGP 3QUJA 2KXPA 1MNDA 2X0LB 3CX6B 4H9SE 4NUVA 4MFRA 2KWHA 1YKEB 3LK41 1X79A 4AUIA 3GWHA 5D5DA 3HI2A 3ZN1B 4C91A 5J2TE 3RKOA 3N9NA 2C5IT 4ZHQE 2ZM0A 4FI5A 1HF8A 5LA6E 3RYIE 4AKLA 4RLBA 3C4ZA 4EYYR 3RYHE 3SOLA 2E9XD 3AVRA 5L3GB 1BR4A 1BR2A 2LOSA 3Q2MA 5LBMA 3TKLB 3C51A 3O1HA 4I50E 4EZ4A 3ZC0A 3POUA 5DABA 3UUNA 2OMFA 3V5SA 4MALA 4DNDA 3ZMVB 2ZM2A 4XAXB 2YU1A 4YFSA 2E9XB 2Q9QC 3NBXX 3QK6A 1HXUA 2XE2A 4FSOA 4U72A 3K3NA 2N2LA 5EZYE 2JMHA 3C98B 3RYCE 3CQGB 4ZI3D 3PQSA 4BJMA 4O2BE 5HXRA 4FRTA 5DQWA 2F1VA 5IYUA 2KC0A 2XTQA 2Q9QD 2YPVA 4CQIA 3SYBA 1BR0A 3FBLA 3EMNX 4KR8A 5L2LA 3C4WA 3WAKA 4H9NC 2EHOA 2P9BA 4PK6A 4DBQA 2DWGA 3QRCA 2H7VC 3FXEB 3QRAA 4RL9A 3KFWX 3B57A 5HXCA 3O9XA 2XUEA 3PUGA 1S35A 1HXTA 3OYXA 1ORMA 3HW9A 3HKEE 1MMAA 5JDPA 1YS5A 2L3LA 3U3IA 3SS1A 4H63H 2XQYA 2KMFA 2KT9A 5DL6A 3MZKB 4QXCB 4OYJA 5JDQA 2C5JA 4OFZA 4AKRB 3DJBA 4N58A 3PU3A 2HH7A 5JR9B 1GFPA 1IJ5A 3PQUA 4H9QC 3GN5B 3QC9A 4FJOA 4YLHA 4N59A 3WI3A 3LJCA 2MTQA 5LOVE 2HPJA 1ZHXA 4AYID 2EHOC 2XE3A 3MK7C 1LVKA 3LK2A 4BA9A 3HWBA 4UIGA 3FXDB 4RLCA 2K24A 2KZ7A 2ZM8A 4CXWA 3SZVA 4AZLA 3LK42 3H3AA 3UT5E 3WAJA 4H9PC 1FIOA 1MIVA 5GONE 4N78D 5AFUL 2X9YA 1WYBA 1THQA 2Y0KA 4ILUA 5HXSA 2Y0LA 2JMMA 3D0TA 4EZHA 5HYAA 4GYRA 4AKHA 2V7JA 4QX8B 2K4TA 2PBIA 4H9RC 4MLKA 4FSPA 3W15B 3V5UA 3NZQA 2JMKA 5L3FB 3ANWB 5LHIB 2M06A 2SPCA 4WW0A 3CMLA 5FXWA 3RYFE 3ZPOA 3N2KE 4KRAA 2NW8A 1US7B 2DWKA 2WWUA 3PTRB 1V9DA 4U74A 5C8YE 4GF4A 1BH3A 1YKHB 2LM9A 5CA1E 2LHRA 4RJXA 4EIWA 1Z0PA 2GK9A 3Q5XA 3KVBA 4QQ1A 2H7OA 5HWYA 2Y6XA 3G7GA 3SZDA 1HG5A 2LOPA 2LHNA 1MMDA 4IE6A 1Y64B 3I1AA 5JQGE 1GFOA 3N9QA 2KDYA 1VOMA 3N2OA 4IIJE 4OHFA 4TUYE 2JRKA 5JDMA 3H37A 3IEEA 2W62A 1IZNA 1ZHTA 5FYMA 3VY9X 1UCUA 1B7TA 3CQCB 4MHCA 1BR1A 2ERVA 1U4QA 3AAAA 1G90A 5ADXL 4HGAA 4PK4A 3GA8A 5HAXA 3AA1A 3PUAA 4D5UA 2H3RA 5H6RB 3HOEA 1H7CA 1OWAA 4GYSA 5JR9A 4FZMA 3PE0A 4ANJA 2JQQA 1D0ZA 4GCQA 3MXZA 2X27X 4KBMB 3OBVE 4QXHB 2WSSV 2N2MA 3AA0B 2DI4A 4ASKA 3POQA 2VKJA 2ZLDA 3KBTA 5GV0A 4HN9A 3ESLA 2E9XA 1O3XA 3ZMTB 3LK3B 4ZOLE 2KINB 1QJ9A 5FXXA 4LSEA 4CXXA 5LGUB 3M65A 3NRXA 3AAEA 4E7ZA 3PORA 2X9XA 3ZMUB 1E54A 3AA0A 3T0SA 2CM0A 3HA4A 4GHBA 2YEVC 4X1IE 2LSJA 1WYCA 3ETVA 4YJ3E 4XNKA 5LCYA 5JDLA 3AA7B 4L0RA 4P0AA 4ZI7E 1QJ8A 4UV9B 5LNKA 1H6S1 5DQVA 2YINA 3I0QA 1MPFA 4UVCB 5JREA 1GFNA 3FYXA 4PJLA 1MM4A 4WBNE 3C50A 4AKMA 3LBXB 3AAAB 5HXHA 3T20A 1PRNA 4LSHA 2NTXA 2OA5A 3ZMSB 3RH3A 2C5KT 3PUQA 5JDNA 3SYSA 1IZNB 2LE8A 3KINB 2K9AA 3BQIA 2NW7A 4HEAA 3RRWA 5F8PA 3NSGA 1YW0A 3GN5A 3O1JA 4AQGA 2CWOA 2M07A 1MMGA 3F2EA 4YJ2E 2MYSA 3AA1B 2Y48B 2KZ7B 3VE2A 3NZPA 3AVSA 4FZLA 2LSYA 3U78A 2W63A 3SRZA 3CX8B 3IBPA 5FY7A 3FBZA 4QKNA 3CPZA 4HFVA 3K3OA 2RA1A 2BVMA 1D0XA 1SHZC 2J1DG 3FHNA 2Z6EA 1E1HB 2YK0A 4JEUB 4UF0B 4ZI2D 5BMVE 3RRCA 2V7KA 4GCPA 2IAKA 4AQFA 2MNHA 1ZV4X 2XAGB 1QSDA 5FXZA 3LG7A 4JLEA 3SWHA 5M4YA 2XAFB 3KV5A 5J1GA 4YHJA 1WRDA 5LHHB 5LXTE 1MNEA 3NRYA 2XMXA 2NOXA 3BQLA 2VWAA 3K8PC 3ZEFB 2CXLA 2VKDA 5T5FA 3VY8X 4O4JE 3GP6A 2ODUA 3J9X1 4O4UA 2W80C 4AYEC 4C90A 2NP9A 1PHOA 2DNXA 2V7IA 5CB4E 2DCFA 4XNLA 4GOUA 2BZBA 4IGUA 1HS7A 3UU2A 4B61A 3VU7H 1QJPA 1D1BA 2D5UA 1OSMA 5AFUK 1ZHZA 4PJJA 3SY7A 4B6XA 2O4VA 2RP4A 3AA7A 2KNDA 3E08A 4I4TE 3AB3B 5LP6E 3L3PA 4UXNB 4O3ZA 4CI2B 4AKRA 3LFMA 2XE1A 3UULA 3PDYA 2KXPB 4FMSA 2CE7A 3N9LA 2JPFA 4V1Av 3KBUA 5KX5E 2CA5A 3KDSE 4G76A 4WNKA 3ZYKA 5DL7A 3ZLIA 2X67A 3TZGA 3LK2B 4EYUA 2CLYB 4QHOA 4G75A 4O8SA 3O1IA 4E1TA 5DJQC 3C4XA 2IC9A 3VZTX 4F6RC 3KVAA 4O4HE 1EZ3A 3C64A 1HFAA 2LHFA 4UVAB 2VKOA 3UFEA 2ZLYA 3AAIA 2VL8A 2XAQB 3AAEB 4PJNA 4WBOA 5LG4A 1AJ3A 1YD8G 1MMNA 3IF8B 2E8IA 2XAHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 A;  1IZN B;  4AKR B;  3LK3 B;  1IZN A;  4AKR A;  2KXP A;  3AAE A;  2KXP B;  3AA0 A;  3AAA A;  5ADX L;  3LK4 1;  5ADX K;  3LK2 B;  3AA1 A;  3AA1 B;  3LK2 A;  3AA7 B;  2KZ7 B;  2KZ7 A;  3LK4 2;  3LK3 A;  3AA6 A;  3AAA B;  3AA6 B;  3AAE B;  5AFU L;  5AFU K;  3AA0 B; 
#chains in the Genus database with same CATH topology
 5KLI C;  1I94 T;  3P7I A;  4FT6 A;  3PUR A;  3M3Z B;  2E75 D;  1NU1 G;  2I8D A;  2K48 A;  3Q9D A;  3H1J J;  3CCJ P;  2R4P A;  2E9X C;  2C0X A;  2D2C B;  1N32 T;  5GTI O;  2YDS A;  3A3Y B;  4L9I A;  1KB9 H;  4DVD A;  3MUD A;  5LHG B;  2BDE A;  4D64 A;  5ADX K;  3L75 G;  2WU2 A;  4IDP A;  1FMV A;  1OXZ A;  3H1J G;  1SA0 E;  2QJK C;  3N9O A;  2XQ6 A;  2KZJ A;  1JY2 O;  3O0E A;  1SQV E;  3ZCI A;  2QSI A;  5L4E A;  5FVN A;  2ZMA A;  1X0T A;  1ZOY A;  2UXN B;  3EFF K;  5CA0 E;  4NXN T;  2J62 A;  3RGU A;  5G26 A;  3B5N B;  2IX7 C;  3H1I D;  1SQB D;  3KZI E;  3UTK A;  2XHE B;  4O9B A;  2FGR A;  2K3W A;  5AW5 B;  5AVZ B;  4DBR A;  8PRN A;  1GL2 C;  2J4U P;  3ONX A;  2A06 E;  3L4F A;  1NU1 K;  4IE5 A;  3CQX C;  3MHV A;  2XM1 A;  3PGR A;  1SQB K;  4L74 A;  3WU2 H;  1HG2 A;  2I6H A;  2NTY A;  4O49 A;  3HOL A;  2YNK A;  1ZHC A;  3CVR A;  1H0T B;  4G63 A;  1JO5 A;  3ANW A;  1FEW A;  5AVS B;  4TZ4 C;  4DR2 T;  3TNU A;  3CXH H;  1HNX T;  1GDT A;  1J1D C;  4Z3T A;  5BU5 A;  3ZT6 A;  4WY4 A;  3H1I G;  4ZZB A;  4O4L E;  2E2A A;  2MBG A;  4J2C A;  2ACX A;  1KZU B;  1IBK T;  2W81 C;  4UVB B;  3UU4 A;  2XG6 A;  4U3F G;  4UB8 H;  4JI0 T;  4AYD C;  1G2C B;  5JDF A;  5B5E O;  2ZFC A;  4IDQ A;  2Z4E A;  3DA3 A;  3AE6 A;  3BRV B;  3EDV A;  2WAU A;  1EQ7 A;  2Y0H A;  2OYH C;  1NEN A;  1SQP E;  4GKG A;  5LGT B;  1SQX E;  1J2J B;  3JCU H;  4PV1 D;  2XTR A;  1QUU A;  1XDO A;  2G3A A;  4ILA A;  2FBW A;  2UU9 T;  4QH5 A;  3P32 A;  5ETW A;  3H1J E;  2V7L A;  2QJY B;  4U3F D;  3AEB C;  2XAS B;  4X1K E;  1L0L E;  2X9K A;  1VRB A;  2M8R A;  1Q9F A;  5HEH A;  2CBJ A;  3LK3 A;  2B88 A;  5APT A;  3RGL A;  2Q7C A;  1S9K D;  3HL6 A;  4QWN B;  3HTK A;  5FVK A;  3AEF A;  4I55 E;  5AQN B;  4F4B A;  2OTL P;  3PRN A;  1SQX K;  3LID A;  4OVN F;  1G73 A;  2E5L T;  3CPW O;  1URQ B;  2YXQ B;  2N9B A;  4FZN A;  1W2E A;  1SQX D;  1WT6 A;  3HD7 C;  4WWI A;  1LTJ A;  3UQ7 A;  1D1C A;  2O1J A;  2KOG A;  3ZN0 B;  2XTL A;  4LC1 A;  4DJG A;  1FZG A;  3LBX A;  4GK0 E;  3MUD C;  1E7P A;  3P8C D;  2B9B A;  2QG4 A;  2X68 A;  3WU2 E;  1KFY A;  5KLV G;  3HR0 A;  3L71 E;  1LNQ A;  4HFC A;  5EK2 A;  4GKJ T;  3PU8 A;  3CWB G;  3IN6 A;  4O4I E;  5HCM A;  1XNR T;  2IWW A;  1BE3 E;  2V6X A;  4ZNC A;  3PGU A;  4K0U A;  2F1T A;  1YBK A;  5FNV E;  2V1D B;  3KXD A;  3PUS A;  3H1I J;  5IYZ E;  5TIS H;  2E5T A;  2PRR A;  3RPU A;  5CMZ A;  1GFQ A;  3RX6 A;  2LT3 A;  2W4X A;  2WCA A;  3ABV C;  4BWN A;  1CUN A;  4PW8 A;  5CCG C;  1RHZ B;  3AEE C;  2Y2X A;  3PUZ F;  4UV8 B;  4OK0 A;  4CI3 B;  3P8C E;  1XMO T;  1ZHW A;  2H43 A;  4QXB B;  1T2K C;  4B86 A;  1HUC A;  3AE3 C;  1KIL D;  3V6I A;  3VP9 A;  3JC6 D;  2K0L A;  2HPL A;  1TU3 F;  1WCR A;  3ZCJ A;  1Q9G A;  2RN0 A;  4GCS A;  2OYI C;  3R6N A;  3UQ4 A;  3S4U A;  3HKC E;  1YIT P;  5EE2 A;  2A3D A;  3CCR P;  2N2N A;  4DMV A;  5C3J A;  5C2T A;  1WFD A;  4WZX A;  2X51 A;  2FJB A;  2D0T A;  4H63 V;  1HJ0 A;  3FWN A;  5FMN A;  2KZI A;  3NWI A;  3RBH A;  3GHG C;  2Q9I A;  4BJN A;  1NTK D;  1PP9 G;  1S5L H;  2JWA A;  1USD A;  4NUV A;  4IL4 A;  2N1T A;  5AQK B;  2R89 A;  3L71 D;  1YKE B;  5APQ A;  1DU2 A;  3AE9 A;  3TF5 A;  2Y0D A;  5LA6 E;  1JNR A;  3PHL A;  1MFT A;  3SOL A;  2LKG A;  1KYO D;  2YMY A;  3USS A;  3TKL B;  3C51 A;  4EZ4 A;  3ZC0 A;  4P1N A;  1LTJ C;  3UUN A;  2OMF A;  3PGS A;  1NKZ B;  2ZM2 A;  4XFJ A;  4FSO A;  4LF5 T;  3RK3 C;  4D6T D;  4U72 A;  2NZ2 A;  1NGM B;  4N74 A;  4ZI3 D;  4BJM A;  4LMJ A;  1QX8 A;  5IYU A;  3G06 A;  2Q9Q D;  3L71 G;  2YPV A;  4YTP C;  3SYB A;  2JWD A;  1NTZ G;  3FBL A;  1BGY J;  4KR8 A;  1YTZ T;  3AE8 A;  5AVW B;  2WSF J;  1U7J A;  1J1E B;  4UB6 O;  3FXE B;  3QRA A;  1FE6 A;  3AXJ A;  3PUG A;  3OYX A;  2XJ7 A;  1MMA A;  1YS5 A;  1UIX A;  1LT9 A;  1DH3 A;  2QA4 P;  2XQ4 A;  3MZK B;  3P4R A;  2C5J A;  5KAI O;  3H1L E;  4OFZ A;  4OGQ B;  3DJB A;  4W7Y A;  1GFP A;  3GN5 B;  4N59 A;  3H1J D;  3LJC A;  5G39 A;  2MTQ A;  1FZE A;  4AYI D;  2XE3 A;  2R44 A;  1LVK A;  3LK2 A;  2BCC J;  3HWB A;  5LG3 A;  3M9B A;  4RLC A;  1M1K Q;  5ABE A;  2W90 A;  3SZV A;  3LK4 2;  3Q5E A;  5B66 H;  4H9P C;  3TLS A;  1DEB A;  3MZW B;  2WZH A;  2X9Y A;  4GIF A;  2JMM A;  3D0T A;  2XM2 A;  4IL6 H;  1LWU C;  2N9Y B;  4XA4 A;  4NIQ A;  1PGP A;  3H1L J;  4YSY A;  4FSP A;  3W15 B;  1IFM A;  2VUR A;  3V5U A;  3AE4 A;  3NZQ A;  1Q2N A;  5AVQ B;  2SPC A;  4WW0 A;  1LJ2 A;  3N2K E;  1EXJ A;  3EAB A;  4LFC T;  3L39 A;  2MJZ A;  4HWF A;  2WWU A;  3PTR B;  1V9D A;  1RQU A;  3BCC G;  1H8A A;  5DJT B;  4DV2 T;  4JI4 T;  1KV4 A;  1SQP G;  2YKS A;  2LHR A;  2L5G B;  1KMI Z;  2IZ0 A;  1QLE D;  1JCD A;  2W27 A;  3KVB A;  4QQ1 A;  2Y6X A;  1FS0 E;  2K37 A;  1Y64 B;  2R32 A;  5JQG E;  1GFO A;  2W2U A;  3M06 A;  3M9H A;  4TUY E;  1M56 D;  3O6Q B;  1ZHT A;  3VY9 X;  3H37 A;  2PFX A;  5FYM A;  2E5V A;  2QYW A;  3CQC B;  5B5E E;  2ERV A;  1G90 A;  4KJM A;  2QVA A;  4PK4 A;  4A5X A;  4A98 A;  3H1K E;  3PUA A;  4D5U A;  4GYS A;  1WRG A;  5JR9 A;  1RF1 B;  1D0Z A;  4GCQ A;  2XDJ A;  4EI2 A;  5FVL A;  3TK1 A;  3OBV E;  2N2M A;  1SQV G;  1W2B O;  2BBH A;  4XE5 B;  3ESL A;  1IC2 A;  4ZZC A;  1QJ9 A;  3CX5 D;  4CXX A;  2H89 A;  1E54 A;  3RIA A;  4TLF A;  1SFC B;  5KAF H;  2GM4 A;  4GHB A;  1ZP0 A;  2LSJ A;  3GF7 A;  1EZV G;  3A7M A;  4L0R A;  5LNK A;  1NTM J;  3VR9 A;  5DQV A;  3I0Q A;  3A8Y C;  3FYX A;  4AKM A;  4DV4 T;  3T20 A;  3H1L D;  1H89 A;  2BBJ A;  4LSH A;  3GLM A;  1YQ4 A;  3ZMS B;  2RKL A;  2C5K T;  3PUQ A;  3SYS A;  1IZN B;  2OGU A;  3JCU E;  3KIN B;  4DR6 T;  1J5E T;  3C8V A;  3BQI A;  2HR3 A;  2NW7 A;  4HEA A;  2OYH B;  1GL2 A;  3GN5 A;  3T97 B;  2MKV A;  3JAF A;  2M07 A;  3L75 D;  1N8R Q;  4YJ2 E;  2MYS A;  3AA1 B;  2Y48 B;  3VE2 A;  2UUA T;  2POH A;  5KLV K;  4LML A;  3IBP A;  1OED B;  4JI6 T;  3M0D A;  2I1K A;  3RHW A;  2BVM A;  4HFI A;  2J1D G;  2Z6E A;  1YQ3 C;  3OAK A;  4KT0 J;  3BCC J;  2XQA A;  4JEU B;  3RRC A;  5BMV E;  4PJ0 O;  3H25 A;  2IAK A;  4GCP A;  4WBA A;  1ZV4 X;  1P84 D;  2XAG B;  5AVU B;  1QSD A;  3LG7 A;  1IFN A;  1Y01 A;  5LXT E;  3II6 A;  2XMX A;  2OYO A;  2VWA A;  3GP6 A;  2WT7 B;  4O4U A;  2WVR A;  2W80 C;  4AYE C;  2Q3E A;  4H44 D;  1PHO A;  1PGO A;  3AE1 C;  5AQL B;  4XNL A;  5ABH A;  1HF9 A;  1NTK K;  1VF5 D;  1N73 B;  3VU7 H;  3PV0 F;  1D1B A;  4F8H A;  5KAF E;  1OSM A;  3FZK B;  4PJJ A;  2KLU A;  3SY7 A;  2R88 A;  2WDV A;  3CX5 E;  2O4V A;  3AE8 C;  3TGU J;  3RI5 A;  2IFN A;  3AB3 B;  3Q5P A;  5E79 H;  3N4X A;  3EHZ A;  1VQM P;  1EDJ A;  4AKR A;  1AVY A;  5IUX A;  4C7N A;  1S72 P;  2YDR A;  1RH5 B;  2KXP B;  1BSH A;  3ZSS A;  4V1A v;  3KDS E;  5DL7 A;  5KLV J;  1VQ7 P;  3ZLI A;  5EFW B;  1HJB A;  1OMI A;  1P84 E;  1L4A D;  2IC9 A;  3VZT X;  2E75 C;  3KVA A;  2PGD A;  1AVO A;  1VQP P;  2XQ8 A;  3QB5 A;  1M8O B;  1JM0 A;  1T1L A;  2LHF A;  2ZLY A;  1ZN5 A;  3AAI A;  5LG4 A;  2XQ9 A;  1KNR A;  2AEF A;  2XAH B;  2IYO A;  3UUM A;  2WWW A;  4HKZ H;  2WY2 A;  2QEX P;  1JY3 P;  3VZU X;  4X1Y E;  2OV9 A;  2V7Q H;  3HE5 B;  2WMN A;  3VN0 A;  3MP7 B;  5AQH B;  3GMI A;  1R5L A;  2KYV A;  1SQQ E;  5L3B B;  1FZC B;  4C46 A;  2UXX B;  5AW8 B;  1FZF A;  5L3E B;  2D0U A;  4KHZ F;  3RQW A;  1W5C E;  3Q2Y A;  4BAY B;  2E74 B;  3BVH A;  5DL8 A;  1PL5 A;  1GFM A;  5AQQ B;  2N1G A;  4PD4 D;  1ZW0 A;  3RK2 C;  3PUX F;  3NXS A;  3RF1 A;  4AI6 A;  5AW1 B;  2O01 J;  2BCC E;  1M7L A;  4AYC A;  4C7N B;  2X66 A;  4PK5 A;  1HTJ F;  1VCT A;  5FP3 A;  1UX4 A;  4YTP A;  2FXP A;  5ABF A;  3RK2 D;  1M7K A;  3E22 E;  2YKO A;  3H1K D;  3QNU A;  4TV8 E;  3UAQ A;  2ZVN B;  1OIP A;  4OYK A;  2LR2 A;  3IA3 A;  2Y8D A;  2JJL A;  2A45 G;  2VL0 A;  2BAS A;  4Y28 J;  1HH0 A;  3MD0 A;  3CCS P;  3BS0 A;  3K5B A;  2QGS A;  2E74 D;  4BXL A;  1M90 Q;  1KIL A;  2W61 A;  1FC2 C;  2K5B B;  4DR7 T;  3JTY A;  4JFB A;  2ES0 A;  1G8X A;  3OKQ A;  5FY0 A;  2H88 A;  4UB8 E;  5F3J A;  3VR8 A;  3N9P A;  1L0L D;  3Q5W A;  2W6J H;  3J7Y q;  4AKI A;  2QM8 A;  1HX1 B;  3CWZ B;  3CK6 A;  2CHN A;  2IC6 A;  2E76 B;  4QX7 B;  1S3J A;  3AEA C;  1UGO A;  4CXY A;  4O2A E;  3E1R A;  3Q5R A;  1VQK P;  2IYP A;  4K3A A;  1T8Z A;  2X0Y A;  2YU2 A;  2BG9 C;  1XWM A;  3TYY A;  4IFF A;  4JEH B;  1KC8 Q;  2NR4 A;  2V26 A;  1E79 H;  4N6J A;  1NWM X;  4OX9 T;  4UEL A;  3AE9 C;  4OGQ D;  2D2S A;  5LGN B;  4FUV A;  4I7Z C;  3V4Q A;  3CKD A;  1SE7 A;  1ZME C;  3AE5 A;  2NWB A;  3BRZ A;  1YI2 P;  4GDO A;  1MIY A;  1CI6 B;  2WQY A;  2Q6Q A;  3QH9 A;  3QB5 K;  4EXT A;  2KUB A;  4YPC A;  2YKP A;  3V4W A;  3AEC A;  2QJP B;  1SFC A;  4AYM C;  3AE7 C;  4L76 A;  1VQ8 P;  1Q86 Q;  4U33 A;  2XAJ B;  4C00 A;  3HD7 D;  1S2E A;  3N7N A;  3VZW X;  4C69 X;  2V7M A;  1YQ3 A;  5GTH E;  2FFD C;  1SQV K;  4DO0 A;  4YSZ A;  4UF0 A;  2OQQ A;  1KF6 A;  4PJM A;  1X22 A;  4GK5 E;  1N2D C;  1IO4 A;  5KXJ A;  5H2F E;  2VAS A;  4DR5 T;  4ISS A;  3A2S X;  3HUS B;  2OYI B;  1BDC A;  1LT1 A;  4GIW A;  4E1S A;  1NAF A;  3B13 A;  3WI5 A;  2LEH A;  2IW5 B;  3H1K G;  3AA6 A;  5EK3 A;  1ZEE A;  2JO1 A;  1IFJ A;  1VDF A;  2WSC H;  3RK3 B;  5B5E H;  4O4X A;  4Y99 B;  4U2Z A;  4GKK T;  2PTF A;  4ASV A;  4I43 B;  1LTJ B;  2WVP A;  1WLX A;  2ZYG A;  1XTG B;  1OX3 A;  3VMA A;  1IFP A;  1UX5 A;  2E75 B;  5B66 O;  3HD7 B;  2L9Q A;  2VB6 A;  2KS1 A;  4IDZ A;  3OVU A;  1SFC C;  1FOS E;  3W67 A;  5TIS E;  4A56 A;  2C0S A;  3FGA D;  1KEY A;  3CX7 B;  2E5Y A;  3UUX B;  5LYJ E;  2R5D A;  1T2K D;  1KYO E;  3TLV A;  4AYN A;  3UIA A;  4AFK A;  1S5L X;  2ZYA A;  4E7S A;  2DHR A;  3JC6 C;  2CHO A;  2J58 A;  3SSU A;  2H7H A;  1LP1 B;  4IOI H;  2BS4 A;  1J1D B;  3A0H O;  2NPS D;  3L35 A;  4EEB A;  2BS2 A;  5AQF B;  4PUX A;  2XPK A;  2L91 A;  1GK4 A;  5AQI B;  4D65 A;  2YNY A;  4PAG A;  3KV6 A;  1ZV8 A;  2QJY C;  2NPS C;  2NW9 A;  2IBZ E;  4X20 E;  2LSI A;  1A02 J;  2QA7 A;  2W00 A;  1HWT C;  4K0K T;  1L0L J;  1R8E A;  4FES A;  2A45 H;  3RC3 A;  5TAO A;  1LTB C;  4O3Y A;  4O3W A;  1N7L A;  5KMG P;  1JY2 N;  2KXP A;  2X0L B;  3B4S A;  3P4P A;  1S9K E;  2KWH A;  4AIS A;  1ZOY C;  1FU1 A;  1SQP J;  3FZH B;  1HGZ A;  3HI2 A;  3ZN1 B;  2XQ5 A;  2V5C A;  5CCG A;  2FYN C;  3N9N A;  3RKO A;  1E5W A;  1HF8 A;  3H1H D;  1MV8 A;  3LW5 H;  4RLB A;  3RK3 D;  3C4Z A;  1NVO A;  4JBW F;  3AVR A;  5L3G B;  1BR4 A;  4YT0 A;  3Q2M A;  4HFB A;  5CCH D;  3JAE A;  5LBM A;  1S5L O;  4I50 E;  3POU A;  2BS3 A;  1T8B A;  1GQE A;  1Y47 A;  4BRY B;  3CCQ P;  2MPK A;  4MAL A;  3V5S A;  3AE7 A;  3ZMV B;  1BE3 J;  2Q9Q C;  3K3N A;  1VL2 A;  2JMH A;  3H6P A;  2KB7 P;  4Z90 A;  4FRT A;  4B3T T;  5HXR A;  2XU6 A;  2F1V A;  3PUW F;  2KC0 A;  2XTQ A;  4CQI A;  1BCC G;  2C9L Y;  3IAO A;  1Z56 A;  5L2L A;  3WAK A;  4H9N C;  2WT7 A;  2EHO A;  2P9B A;  4PK6 A;  4DBQ A;  3JSV C;  3KFW X;  3CCU P;  3B57 A;  5HXC A;  3O9X A;  2XUE A;  1S35 A;  5AVV B;  1X9B A;  1ORM A;  1K9M Q;  5JDP A;  4ILB A;  1AJY A;  1BGY D;  3SS1 A;  3U3I A;  1GL2 D;  5JDQ A;  4OYJ A;  5FL1 A;  1IFD A;  4AQR D;  4AKR B;  3PU3 A;  1YYC A;  4W80 A;  2SPZ A;  4H9Q C;  4YLH A;  4COF A;  2OYH A;  1GW3 A;  3C1L A;  5LOV E;  1XMQ T;  2JQK A;  1ZHX A;  2EHO C;  1X79 B;  2Q3I A;  4HFH A;  2H8P D;  3U59 A;  4BA9 A;  2V6Y A;  2ZM8 A;  4CXW A;  1L0N J;  3UT5 E;  1USE A;  2KNC B;  1KTM A;  2RMZ A;  1MIV A;  1EZV E;  2XZR A;  4N78 D;  5CJ4 A;  4HJG H;  1WYB A;  2Y0K A;  3VRB A;  2HOD A;  1LTG C;  3HTK B;  4EZH A;  3TNU B;  3S1K A;  3GMA A;  2PBI A;  4MLK A;  5AQU B;  4DCK A;  3ANW B;  1N33 T;  1N36 T;  5E79 E;  4YTN A;  3EAM A;  3T1Y T;  2NW8 A;  2YKQ A;  1US7 B;  1M1J C;  4GF4 A;  2JEE A;  1BH3 A;  1SQP D;  1YKH B;  1XTC C;  2LM9 A;  3Q5D A;  5CA1 E;  4RJX A;  4EIW A;  3CCM P;  2O01 N;  3L73 G;  2W67 A;  2IWV A;  4LF4 T;  2P2U A;  1Q90 D;  4IE6 A;  2LOP A;  2E42 A;  1MMD A;  3OTO T;  1SP4 A;  1EXI A;  2ZT9 C;  3I1A A;  3GHG A;  2M3E A;  3LIE A;  3N9Q A;  4PD4 E;  3N2O A;  4OHF A;  2KDY A;  4OWF A;  2JRK A;  3KZI O;  3IEE A;  5DJU B;  3AAA A;  5ADX L;  3D6Z A;  4PV1 C;  4WVZ A;  1JMB A;  1KQF B;  3AA1 A;  3PJA J;  3ZT7 A;  3FZL B;  2FYN B;  2IDO B;  3HUS C;  2I1J A;  1AFO A;  4FQE A;  2N1T D;  2WMM A;  4ANJ A;  3OA7 A;  3MXZ A;  2X27 X;  4KBM B;  3B5N C;  5APW A;  2WSS V;  1NYH A;  3CWB J;  4ASK A;  3POQ A;  2R3C A;  2XKM A;  4JBZ A;  2E9X A;  1P84 I;  2O1K A;  4ZOL E;  1EDK A;  5C39 A;  4DV6 T;  4E7Z A;  3POR A;  1BSN A;  3T0S A;  1GK6 A;  1KIL B;  5KKZ C;  2YEV C;  1K73 Q;  1OVR A;  1WYC A;  1NEK A;  4XNK A;  1KB9 I;  2AXT H;  5JDL A;  1YIJ P;  3CME P;  1H6S 1;  2YIN A;  1ZLL A;  1VCS A;  3FZF B;  4AUW A;  3AAA B;  4U7J A;  5KLI B;  3RH3 A;  1UUS A;  1JY2 P;  2LE8 A;  4TNV A;  2K9A A;  1I6Z A;  3RRW A;  2WPQ A;  1YW0 A;  3O1J A;  1SQP K;  2CWO A;  2FJE A;  1Q82 Q;  2KZ7 B;  3Q5S A;  1M1J B;  3CX8 B;  3L37 A;  3IR9 A;  3CPZ A;  4HFV A;  4I6M C;  3K3O A;  2RA1 A;  1D0X A;  3X1D A;  4DV1 T;  4MN4 C;  1JUN A;  1NTK J;  2MNH A;  1JTH B;  4B3M T;  3SWH A;  1EDI A;  2BKO A;  2XAF B;  5J1G A;  3EI0 A;  2CK3 H;  3MTU E;  3NRY A;  1CZQ A;  4HYT B;  5CCG D;  3BQL A;  2K9J A;  3K8P C;  2CXL A;  1PIX A;  4DV3 T;  2ZM6 T;  4JI2 T;  3V2R A;  3VMX A;  2C9N Y;  3M0A A;  2KK7 A;  5APU A;  2IHR 1;  2ODU A;  3NVO A;  4H0L D;  3J9X 1;  4DV7 T;  1PPJ D;  4C90 A;  2NP9 A;  5CCH A;  2DNX A;  3A7O A;  2V7I A;  3AEG A;  1FJK A;  4X65 T;  2D9D A;  1KIL C;  3L74 E;  4PD4 H;  4GOU A;  3B8E B;  4IGU A;  1HS7 A;  4HFD A;  2FFD B;  4YY3 T;  3AE4 C;  4H0L C;  4U3F J;  3E08 A;  5LP6 E;  3L3P A;  2CPS A;  4CI2 B;  3LFM A;  2F1C X;  1N73 A;  4DT0 A;  1NTM E;  1Z8U A;  2KS1 B;  2CE7 A;  3P4W A;  1KYO H;  4YXW H;  3CCV P;  2CA5 A;  4ASW A;  4WNK A;  3ZYK A;  1HNZ T;  3LK2 B;  4QHO A;  4O8S A;  1N7S A;  4E1T A;  2CPB A;  1K05 A;  5DJQ C;  4F6R C;  4O4H E;  3C64 A;  1KD1 Q;  2JQY A;  1SQQ K;  4PJN A;  1YD8 G;  3IF8 B;  2E8I A;  3UUB A;  3OJA B;  2OTJ P;  4TWD A;  2ZXX A;  3V2N A;  5AW2 B;  1N34 T;  1GTW A;  1U5P A;  2I59 A;  2WDQ A;  5G3A A;  4H9O C;  4U31 A;  1QVF O;  2Q9Q B;  4TV9 E;  1SQQ D;  3WUT A;  1FJG T;  1D1A A;  3HE4 A;  4ZMD A;  1S94 A;  4KI0 F;  2CXF A;  1NTM K;  4IDO A;  2V7Q J;  3HKB E;  2EHO B;  5HEG A;  3CCE P;  3T8O A;  3PJA A;  3SY9 A;  3HRN A;  2PRN A;  3BK9 A;  2A2F X;  3VKH A;  1FZB A;  4NPF X;  2KI7 B;  3POX A;  2W0G A;  4L5G A;  4CN1 A;  2AXT O;  1PP9 D;  2W6B A;  2FYU K;  1ZR4 A;  3KYQ A;  3ZC1 A;  3M9Q A;  3Q3D A;  2LRL A;  1RF1 A;  2CMR A;  5A1L A;  3L09 A;  4IL6 E;  3VKG A;  3T97 A;  1MM5 A;  2A45 I;  1VQL P;  3H1H E;  1MZ9 A;  5AQT B;  2HLO A;  4NPP A;  2FYU D;  2JQ9 A;  2CPT A;  3TDK A;  4OH8 B;  4YTM A;  2UUB T;  3TLU A;  1NHL A;  2YOE A;  3A0B O;  1YHQ P;  4WYV A;  2DW3 A;  1IJ6 A;  3A5X A;  2ZT9 B;  4LMK A;  5JRC A;  2P10 A;  1OPF A;  4IE4 A;  2HPC B;  5AVY B;  2XQ7 A;  4XZC A;  3I9W A;  1UII A;  5GTI E;  5HCJ A;  1N86 A;  4FRX A;  3IF4 A;  2LRK A;  4PFP A;  3RC8 A;  3V5B A;  4QH1 A;  1KYO I;  1KQS O;  1R5S A;  4PJ0 H;  4IDN A;  3T1H T;  1NTK E;  2FYU G;  2CLY C;  5KJ7 A;  5CBN A;  1T72 A;  3N2G E;  2JIW A;  4HE8 A;  1M57 D;  1SLQ A;  3KHU A;  1NTZ E;  3CIR A;  1NWQ A;  3O8Z A;  3NJT A;  2ZJS E;  1XDP A;  2ODJ A;  4GOF A;  1MFZ A;  4EB6 E;  3P4S A;  2P67 A;  3SWY A;  4PD4 I;  5L47 A;  2POR A;  4U2Y A;  4DMW A;  1JY3 N;  1P4T A;  2M6B A;  4KUM B;  3KV4 A;  2LJL A;  3RL0 B;  4Y99 C;  4AXP A;  2ODV A;  2IZ1 A;  4EGW A;  2JP3 A;  4XBF B;  5JDG A;  1SQB E;  3AE1 A;  1H88 A;  1KB9 D;  1QL1 A;  3ZYL A;  1FAV A;  3OPC A;  3JCF A;  1GD2 E;  2WPR A;  2FXO A;  4KHX A;  2WBL A;  2UUC T;  4AKG A;  2CCQ A;  1BGY E;  3CXH D;  4GOE A;  3HE4 B;  4U7I A;  3GG2 A;  3H32 A;  4LSI A;  1KNZ A;  1L4A A;  5BU8 B;  5KJ7 C;  4ERR A;  1KQG B;  4DR3 T;  3L73 J;  2JDI H;  4ZKP A;  3AE6 C;  4Z1M H;  4U9C A;  2A72 A;  5H6Q B;  5H2F O;  4M1P A;  4LF9 T;  1G1I A;  1IFI A;  1SQB J;  2XY8 B;  4P09 A;  4IE7 A;  4AQF C;  2AEM A;  3EFG A;  3HUS A;  5AW9 B;  2ITA A;  2FGQ X;  2FJA A;  5GTI H;  2UXC T;  3DTO A;  3SFD C;  3B5N A;  3VMY A;  2VK9 A;  2IBZ D;  2P1J A;  2PP6 A;  3BCC D;  1R8I A;  2XNX A;  3CXH E;  3AA6 B;  4JI1 T;  4NXM T;  3QWO C;  4JYC A;  3N5L A;  2F4V T;  2OYI A;  3KV9 A;  3EUH A;  2O3J A;  4H13 B;  2O01 H;  3K19 A;  4IE0 A;  3RKG A;  1S1C X;  1URQ D;  3UPG A;  3IHR A;  3N9M A;  3OW2 O;  5FY1 A;  4X66 T;  3EVY A;  2M6I A;  4RJW A;  2CWY A;  3C5O A;  4LFB T;  5K5G B;  1SQV J;  2XV5 A;  3RBX A;  4BUM X;  3A0B E;  2M67 A;  5APX A;  4ZS3 A;  3U1A A;  1WR6 A;  1P84 H;  1CHU A;  3VHL A;  5CFB A;  2E76 D;  3JCU O;  2WSF H;  2BKN A;  2VVS A;  4NUU A;  4P0B A;  4ADZ A;  2LSK A;  2KSR A;  3ZMZ B;  2H89 C;  4PNI A;  1NAY A;  2LKM A;  2AE9 A;  4PFO A;  4IT4 A;  2UXD T;  2LFU A;  4K3C A;  1OED E;  2R4O A;  1Y9B A;  3MKD A;  2PFV A;  4WY4 B;  3CC7 P;  1ZKE A;  3LSV A;  2KWI B;  4HWI B;  4ZI2 C;  5APS A;  1N7S D;  2BCC D;  3HE5 A;  5FXV A;  3RL0 D;  1VF5 C;  4TN7 B;  3R4Y A;  2B1E A;  5HXE A;  2J1N A;  4HKA A;  5LJM A;  2GE4 A;  2XND H;  1FZC A;  1LTS C;  2RPA A;  5AQP B;  1U57 A;  3ZDM A;  4I0U A;  4KMC A;  4YHH T;  1NKN A;  3EQ2 A;  1KNP A;  2X9W A;  1ZRT D;  4H44 C;  1FMW A;  5DL5 A;  2Y0E A;  3ZYM A;  1JCC A;  4AIU A;  3O4X E;  4CN4 A;  2WMO A;  4WB4 A;  5G38 A;  3V8U A;  1L4A C;  2YO2 A;  3CX6 B;  4H9S E;  4MFR A;  2LXC B;  3TLW A;  2IIU A;  1X79 A;  5CCH C;  4DR4 T;  4C91 A;  1PP9 E;  3I5C A;  5J2T E;  1BE3 D;  5TJH A;  2C5I T;  2ZM0 A;  3H1H G;  2ZYD A;  3RL0 g;  5LB7 B;  4NPD A;  4DR1 T;  2WP9 A;  5ABF B;  3AE5 C;  4R4M A;  4EYY R;  2E9X D;  1LTT C;  4AQY T;  3O1H A;  3H1K J;  2BG9 B;  2IBZ G;  2B87 B;  4DND A;  4AUI A;  4XAX B;  5AVT B;  2YU1 A;  4YFS A;  2GUS A;  3NBX X;  1NTZ J;  3AEB A;  3C98 B;  3CQG B;  4O2B E;  2HN1 A;  2V4H A;  2VRS A;  2FFD A;  5CHX A;  1PV3 A;  1BR0 A;  2QM7 A;  3EMN X;  2WSE H;  3R2P A;  5LMN T;  1RE3 A;  2R5B A;  3QRC A;  2A06 G;  4U3F E;  3A0H H;  5AQS B;  1HXT A;  2K9J B;  1BGY G;  1SQX J;  2XQY A;  5DL6 A;  3GHG B;  4QXC B;  4DUY T;  3A0B H;  5JR9 B;  4DZO A;  3D70 A;  1IJ5 A;  3QC9 A;  2IDB A;  2HPJ A;  2VQF T;  5L8R J;  1GU5 A;  4KX6 A;  4PV1 B;  5KLV E;  3LDQ B;  4N75 A;  2NRG A;  2HPC A;  5FL0 A;  3O6Q A;  3I55 P;  2K24 A;  2KZ7 A;  2FBW C;  4AZL A;  5HEO A;  1YQ4 C;  2FYU E;  2V6Y B;  4Q25 A;  5KTB A;  1OW8 A;  5GON E;  3DZM A;  5AFU L;  3E1I A;  1THQ A;  2Y0L A;  4ILU A;  5HXS A;  3S4R A;  2FXM A;  4X64 T;  3VOP A;  3JAD A;  5HYA A;  2K4T A;  4GYR A;  4AKH A;  1QL2 A;  2ACZ A;  4ZXL A;  4H9R C;  3RK2 B;  4JV5 T;  3TGU E;  2M06 A;  5FXW A;  3RYF E;  3ZPO A;  2E74 C;  5GTH H;  2BG9 A;  4KRA A;  2DWK A;  1OED C;  4U74 A;  2YO3 A;  5C8Y E;  4DOJ A;  1M62 A;  4UR9 A;  1FZC C;  3L75 E;  2ZT9 D;  2GA1 A;  1Z0P A;  2GK9 A;  5APV A;  3EWK A;  4PJ0 E;  3TSI A;  5HWY A;  1AQ5 A;  4ZEY A;  3DWO X;  3SZD A;  1HG5 A;  2LHN A;  2W83 C;  3E7K A;  1DEE G;  5KLV D;  2KSE A;  1CW5 A;  1AA0 A;  3CWB D;  3AEF C;  1VOM A;  4IIJ E;  2VQE T;  2WIT A;  1IZN A;  2W62 A;  1NTK G;  1BCC J;  3L72 D;  1UCU A;  1SVF A;  3MIW A;  1RF0 C;  5L4H A;  4MHC A;  1BR1 A;  1T7S A;  1U4Q A;  4B3R T;  2P58 A;  4YXD A;  3B5N D;  1E2A A;  3AED A;  2UXB T;  5H6R B;  4CPG A;  4FZM A;  3L70 G;  4ILC A;  4IFM A;  1LP1 A;  3JC2 2;  3PE0 A;  5H2F H;  2BEZ F;  4IL6 X;  3KDP B;  3G3Z A;  2R4N A;  3L70 E;  4QXH B;  1L4A B;  3AE2 C;  1MKM A;  2DI4 A;  1URQ A;  5GV0 A;  3SWF A;  5AW6 B;  4HN9 A;  1OW6 A;  3F89 A;  1T16 A;  2Z5H A;  4LGD E;  4D6T G;  1O3X A;  1XZY A;  4QH4 A;  5FXX A;  4LSE A;  2OLT A;  3UU6 A;  3KPE A;  3M65 A;  3AAE A;  4NPE A;  3ZMU B;  3AA0 A;  2CM0 A;  1KQL A;  3PH0 A;  3CD6 P;  4HWC A;  1L0N G;  2XQ3 A;  4X1I E;  4D6T J;  1RF1 C;  5AW4 B;  3ETV A;  1PPJ E;  5LCY A;  3AA7 B;  1PGQ A;  1QJ8 A;  4UV9 B;  3SWK A;  2C0W A;  3L70 D;  4IL6 O;  1FJP A;  2WPV B;  1S4X A;  1L0L G;  1MPF A;  4UVC B;  5JRE A;  4PJL A;  1MM4 A;  2AXT E;  3GF3 A;  2R3S A;  3CX5 I;  2NTX A;  4GT1 A;  3ABV A;  2WDR A;  3FWL A;  1SFC D;  1SQQ G;  2YDQ A;  1GW4 A;  3NSG A;  5F8P A;  3SFE A;  5AVR B;  3UU5 A;  1MUU A;  4ZKU A;  3HD7 A;  5LMU T;  3F2E A;  3FXD A;  4JI8 T;  1JB0 J;  3NZP A;  4FZL A;  2LSY A;  4GOD A;  2H88 C;  5FY7 A;  4QKN A;  3H32 B;  2GUV A;  4AQF A;  1KN7 A;  3ZST A;  3NTN A;  5FXZ A;  5M4Y A;  5AW0 B;  1UK5 A;  2YN6 A;  5LHH B;  5FKY A;  2KP8 A;  3RIU A;  4I7Z B;  1IK9 A;  1EZV I;  3ZEF B;  3CXH I;  3V2Q A;  3VY8 X;  3L72 G;  3CWB E;  4CN6 A;  1VQN P;  1RE4 C;  2Q1K A;  1QEX A;  2W66 A;  3CC4 P;  3B5M A;  3VYI A;  2FUP A;  4B61 A;  3UU2 A;  3M91 A;  1JEK A;  2V8S V;  4Z91 A;  1WR0 A;  5AVX B;  3SFE C;  1HNW T;  1HTL C;  2RP4 A;  4QMA A;  3AA7 A;  4JYB A;  4O3Z A;  1RF0 A;  2XE1 A;  3UUL A;  3N9L A;  1FOS F;  2RH0 A;  2X67 A;  3TZG A;  2NPS A;  1Y8A A;  3AED C;  4HH2 A;  1KFM A;  1IK7 A;  3C4X A;  4IL9 A;  1EZ3 A;  2ZVO B;  2IPP A;  4UVA B;  1KOR A;  4RJT A;  3UFE A;  2J59 M;  2VL8 A;  2XAQ B;  3AAE B;  4WBO A;  2QIW A;  1MMN A;  4X62 T;  1AV1 A;  1JNZ A;  3AEC C;  2Y9Y A;  2PG8 A;  2XZE A;  4N78 E;  3FZM B;  2VVN A;  2R6G F;  4X5T A;  1DIP A;  5JTG A;  5KDM C;  3OYZ A;  2ZFG A;  3L74 D;  4CZZ B;  5IHY A;  1EDL A;  4ZI3 C;  4FOZ A;  3ITK A;  5HWX A;  2PAJ A;  2M0B A;  2J4G A;  2MOZ A;  4DV5 T;  3HKD E;  5LJN A;  1W0B A;  2A9U A;  3PJS K;  1KK7 A;  2G0U A;  2N1T B;  1BT9 A;  3QOF A;  2BKP A;  2QJP C;  4HWD A;  1LRZ A;  4Z8X A;  4EAH A;  3DWN A;  3RBZ A;  3A0H E;  1ZP0 C;  3PUV F;  4RES B;  3MAC A;  2N9D A;  2X0H A;  2PJQ A;  1YJ9 P;  3ETU A;  2Y7S A;  1PP9 J;  3MA9 A;  5JRC B;  2WPS A;  4JI7 T;  2LLY A;  2QE7 H;  3L36 A;  3L72 E;  4L73 A;  3P8M C;  2EHO D;  1LKX A;  2MHL A;  2KLQ A;  3I56 P;  5JVD E;  5JH7 E;  2QTK A;  5JR9 C;  3AEE A;  3GW6 A;  1J5W A;  3RLF F;  2FYU J;  2KNC A;  7PRN A;  2MAW A;  1LGH B;  5J2U E;  3TGU G;  3T24 A;  2KLV A;  4LF8 T;  3G4S P;  1HVV A;  4UEM A;  1JNM A;  4TT3 H;  2QJK B;  3RQU A;  3MJX A;  3I0O A;  3R84 B;  3AXJ B;  2OTK E;  2WSE J;  1BXW A;  1HBW A;  1EZV D;  3VE1 A;  2X9H A;  3VMZ A;  4KR4 A;  3WI4 A;  5GTH O;  3ZJ2 A;  1L2P A;  2LM2 A;  4RO0 A;  4H13 C;  1NJI Q;  4JYA T;  1NTM G;  2UWJ E;  3BQK A;  5AW3 B;  4JI3 T;  2BEQ D;  3L8R A;  1N73 C;  1HCI A;  3L74 J;  3DP7 A;  1WMK A;  1GZL A;  4G2A A;  1UUR A;  1D0Y A;  2L8K A;  4H13 D;  2HFE D;  3CC2 P;  1FDM A;  1T3J A;  4BRY A;  5E79 O;  2ZXE B;  4R4L A;  1VF5 B;  4K35 A;  2WB5 A;  2WU5 A;  4DID B;  1XNQ T;  1HXX A;  3PRJ A;  1SUM B;  2IML A;  3DA4 A;  1GU4 A;  4LSF A;  1MIW A;  1L0N E;  1NU1 E;  2G8Y A;  1HX8 A;  2BG9 E;  2R8A A;  3E0Z A;  4K3B A;  1VQ4 P;  2N1T C;  4O3X B;  2Q9Q A;  5L3D B;  1M1J A;  2LXB A;  2WM9 A;  4HFE A;  1SQB G;  4KP3 C;  1L0V A;  1ZHY A;  2HYN A;  3U1C A;  4H0L B;  4LF7 T;  1RY3 A;  3K3Q C;  1J1E C;  2ZAE B;  4C4V B;  3FB2 A;  4JUY A;  1BCC D;  3VRA A;  1X9V A;  1U7M A;  1LTI C;  2CEA A;  3AEA A;  1RE3 C;  1G1J A;  3B71 A;  3Q1M A;  1BE3 G;  1BDD A;  5KAI H;  2LSG A;  5L3C B;  4ZS2 A;  1LVF A;  1VQ6 P;  4HTE A;  4UB8 O;  3H1H J;  2CXD A;  1W0A A;  2JJ9 A;  1L0N K;  3RK3 E;  4LFA T;  4KHP T;  3K1S A;  4LF6 T;  3L73 D;  2BVL A;  1QVG O;  3F57 A;  4TX5 A;  5PRN A;  2FY8 A;  3AEG C;  2CBI A;  3ZT5 A;  1BCC E;  1ZRT E;  1L0N D;  1CI6 A;  1W09 A;  3ZJ1 A;  4MBQ A;  5HEJ A;  2B89 A;  5CJ0 A;  1PGJ A;  3F5H A;  2KSJ A;  3F31 A;  2CRB A;  2B76 A;  2WS3 A;  5JDH A;  3P50 A;  4IST A;  3ZKR A;  4U3C A;  3PF1 A;  5EK4 A;  5LBQ B;  3BRT B;  2P7J A;  4HWH A;  4JCH A;  1NTZ K;  3L70 J;  1T98 A;  4EOZ B;  6PRN A;  1W9R A;  3OJA A;  1FBM A;  2QRX A;  4A7P A;  4HB1 A;  3WUV A;  1YXR A;  1FZA A;  1X8Y A;  2IFM A;  5E0O A;  2K1A A;  3KVD D;  4PR7 A;  1KB9 E;  4UB6 H;  3CCL P;  2BCC G;  4B3S T;  3PLN A;  3H1I E;  4IHJ E;  4WY4 D;  1A02 F;  2XE5 A;  4JPZ B;  3G6E P;  1RQV A;  3L73 E;  5AQO B;  1KFN A;  2VKH A;  2K9Y A;  1EC5 A;  2DLR A;  4YXD C;  4CI1 B;  4DUZ T;  4WY4 C;  3EDU A;  1Q81 Q;  1GL2 B;  4M3L A;  1LT9 B;  1FDI A;  3I9Y A;  2Q5U A;  1OVU A;  2K88 A;  3WMM 0;  1IAP A;  3AE2 A;  3QUJ A;  2YIU C;  1MND A;  1H0T A;  5IWA T;  1LTA C;  3LK4 1;  1Q7Y Q;  1HGV A;  1RE4 A;  3BRY A;  3GWH A;  5D5D A;  1IJD B;  2FJD A;  1VQO P;  4L75 A;  4ZHQ E;  4FI5 A;  1SS1 A;  3RYI E;  4EOT A;  4AKL A;  5BR8 T;  5AQM B;  3CX5 H;  3FX0 A;  3RYH E;  2KIK A;  2WZ7 A;  3D71 A;  1BR2 A;  1IBL T;  2LOS A;  5DAB A;  3V2P A;  2E9X B;  1HXU A;  3QK6 A;  2XE2 A;  1FDO A;  2N2L A;  5EZY E;  3RYC E;  3PQS A;  3L71 J;  5KAI E;  3BCC E;  5DQW A;  2Z5I A;  1PPJ G;  2HOD B;  2B87 A;  3CMA P;  1NTZ D;  3C4W A;  2JR8 A;  5AQV B;  2A06 D;  2DWG A;  2H7V C;  4RL9 A;  1IBM T;  1K8A Q;  2JQH A;  5F5W A;  1D7M A;  1OZH A;  3HW9 A;  4U7Y A;  3HKE E;  2YXR B;  2L3L A;  5BVZ A;  4H63 H;  2KMF A;  2KT9 A;  5CBO A;  4N58 A;  2HH7 A;  1QLB A;  3PQU A;  2V5D A;  4FJO A;  4YSX A;  3WI3 A;  1QGK B;  2AXC A;  4DV0 T;  3CL3 D;  3IFM A;  4C7R A;  3MK7 C;  5J0Z A;  2NPS B;  1VPC A;  4UIG A;  3FXD B;  3PUY F;  1JY3 O;  3CI9 A;  3M0D C;  5AQG B;  3H3A A;  4EED A;  3WAJ A;  3NMD A;  1FIO A;  2WTY A;  3A5T A;  3H3M A;  1NH4 A;  2V7J A;  4QX8 B;  1ZXG A;  1L0L K;  2M5A B;  3CLQ A;  1PFI A;  2JMK A;  5L3F B;  2J5U A;  5LHI B;  2IBZ I;  3A2A A;  4IFD K;  3NFQ A;  3CML A;  1KIL E;  3AE3 A;  1PZQ A;  2HHH T;  2Y0C A;  2I0M A;  1JOC A;  3LW5 J;  3FXE A;  3Q5X A;  1OW7 A;  2WJR A;  2H7O A;  1YJN P;  3UU8 A;  1AQT A;  3G7G A;  2WSC J;  1LWU B;  1DD4 A;  3ONJ A;  2D2C C;  4H44 B;  5CJ5 A;  3P7K A;  2WWV A;  2J47 A;  5JDM A;  1T3U A;  2AEJ A;  1B7T A;  2D2C D;  2WJQ A;  2XSB A;  4HGA A;  1J1J A;  4EV6 A;  3GA8 A;  5HAX A;  3WUU A;  4JF7 A;  4TWH A;  2WZI A;  2H3R A;  1GMJ A;  3G71 P;  1H7C A;  1OWA A;  3MGN A;  5ABG A;  1JTH A;  3HOE A;  3L72 J;  5KJ7 D;  4N3Y B;  5KKZ B;  1SQX G;  2JQQ A;  4TNW A;  5AW7 B;  1NTM D;  4OGQ C;  2YIU B;  1SQV D;  3AA0 B;  3TLT A;  4C4V A;  2VKJ A;  1N7S B;  2ZLD A;  3KBT A;  1S5L E;  5HEU A;  5M1B A;  3G9R A;  3ZMT B;  3WU2 O;  3LK3 B;  2KIN B;  1LT9 C;  5LGU B;  3NRX A;  3PTZ A;  2X9X A;  2R4L A;  2K3R A;  3VTP C;  2Y9Z A;  3HA4 A;  2XSA A;  4YJ3 E;  4TWF A;  4P0A A;  2OAR A;  4ZI7 E;  1ZR2 A;  4JQ0 D;  4A97 A;  1CSB A;  3KQG A;  1K04 A;  1NU1 D;  1GFN A;  4WBN E;  3C50 A;  3LBX B;  5HXH A;  1PRN A;  1SQQ J;  2OA5 A;  3L75 J;  2M3B A;  2FYZ A;  5JDN A;  2AXD S;  2IUB A;  2E76 C;  3UU3 A;  2W6A A;  3NKZ A;  4EDF A;  4AQG A;  1LWU A;  2WQY C;  3L74 G;  3C9I A;  1MMG A;  2YMK A;  3SFD A;  2WSS H;  1URQ C;  4I1L A;  3KZI H;  3AVS A;  3U78 A;  2W63 A;  5AQR B;  3SRZ A;  3FBZ A;  2HG5 D;  1OED A;  1OFC X;  3PP5 A;  4JI5 T;  1SHZ C;  3BAS A;  3FHN A;  3ONL C;  1E1H B;  2YK0 A;  3W68 A;  4D6T E;  4UF0 B;  4ZI2 D;  2DL1 A;  1N7S C;  2V7K A;  1VQ9 P;  1NOH A;  4JLE A;  2M5A A;  3KV5 A;  5TIS O;  4YHJ A;  1YJW P;  1WRD A;  2W8Z A;  1MNE A;  1DX7 A;  2NOX A;  5T5F A;  2VKD A;  1G2C A;  2LKH A;  4O4J E;  3P4Q A;  5B66 E;  4IRE A;  4UB6 E;  5CB4 E;  2DCF A;  1DD3 A;  4CTD A;  2BZB A;  2FKW B;  3VP8 A;  3RL0 C;  1QJP A;  4I2L C;  2D5U A;  5AFU K;  1ZHZ A;  4B6X A;  2HN2 A;  5CGM A;  5KAF O;  3RIF A;  3D6Y A;  2KND A;  4I4T E;  4LLH A;  3S9O A;  2JKV A;  4UXN B;  3UFG A;  3PDY A;  1YTZ I;  1T6A A;  5AQJ B;  4FMS A;  5KX5 E;  2JPF A;  3KBU A;  4G76 A;  3TGU D;  4EYU A;  2CLY B;  2E43 A;  5APY A;  4G75 A;  3O1I A;  4W7Z A;  1NO4 A;  1HR0 T;  1NU1 J;  4RKU J;  1VQ5 P;  1JMM A;  3BAT A;  4EYY Q;  1HFA A;  2VKO A;  1OVV A;  4EIJ A;  1AJ3 A;  3H1L G;  3RIU C; 
#chains in the Genus database with same CATH homology
 3UUM A;  3P7I A;  4FT6 A;  3PUR A;  1U5P A;  2I59 A;  2K48 A;  2PG8 A;  3Q9D A;  4H9O C;  2E9X C;  2Q9Q B;  4TV9 E;  1D1A A;  4L9I A;  3VZU X;  4X1Y E;  4DVD A;  5LHG B;  2BDE A;  1S94 A;  2WMN A;  5KDM C;  4D64 A;  3OYZ A;  2CXF A;  3GMI A;  2ZFG A;  4CZZ B;  5IHY A;  5ADX K;  1FMV A;  5L3B B;  3HKB E;  1OXZ A;  1SA0 E;  2EHO B;  2UXX B;  4ZI3 C;  4FOZ A;  3N9O A;  5L3E B;  2D0U A;  3T8O A;  5HWX A;  3O0E A;  3SY9 A;  2PRN A;  4BAY B;  3BK9 A;  2A2F X;  2MOZ A;  3VKH A;  3ZCI A;  3HKD E;  5LJN A;  5DL8 A;  1KK7 A;  1GFM A;  3POX A;  2G0U A;  2W0G A;  4L5G A;  1BT9 A;  5FVN A;  2N1G A;  2ZMA A;  2UXN B;  5CA0 E;  1LRZ A;  4AI6 A;  4Z8X A;  4EAH A;  5G26 A;  3ZC1 A;  2X66 A;  4PK5 A;  3UTK A;  2XHE B;  2CMR A;  5A1L A;  1HTJ F;  3L09 A;  3MAC A;  1UX4 A;  2N9D A;  5FP3 A;  2PJQ A;  4DBR A;  2FGR A;  8PRN A;  2J4U P;  3ONX A;  1MM5 A;  3ETU A;  4IE5 A;  2Y7S A;  3CQX C;  3E22 E;  3MA9 A;  5JRC B;  3UAQ A;  4TV8 E;  2NTY A;  1HG2 A;  4OYK A;  2Y8D A;  4O49 A;  3HOL A;  2YNK A;  1ZHC A;  3CVR A;  4G63 A;  3ANW A;  1IJ6 A;  2EHO D;  1FEW A;  1LKX A;  2MHL A;  2KLQ A;  3A5X A;  4TZ4 C;  5JRC A;  2QGS A;  5JVD E;  5JH7 E;  1OPF A;  4IE4 A;  5JR9 C;  2QTK A;  4Z3T A;  2W61 A;  2K5B B;  4XZC A;  3I9W A;  3JTY A;  4FRX A;  4O4L E;  2MBG A;  4JFB A;  7PRN A;  2ES0 A;  4J2C A;  4PFP A;  3RC8 A;  1G8X A;  2ACX A;  2W81 C;  4UVB B;  5J2U E;  3OKQ A;  2XG6 A;  5FY0 A;  3T24 A;  4AYD C;  2CLY C;  5F3J A;  3N2G E;  3N9P A;  5JDF A;  4HE8 A;  3Q5W A;  4UEM A;  3J7Y q;  4AKI A;  3MJX A;  3I0O A;  3DA3 A;  3CWZ B;  3R84 B;  1BXW A;  3EDV A;  3VE1 A;  2X9H A;  2ODJ A;  2WAU A;  2IC6 A;  2Y0H A;  4KR4 A;  4EB6 E;  4QX7 B;  3WI4 A;  3ZJ2 A;  5LGT B;  4CXY A;  4O2A E;  2POR A;  4DMW A;  1P4T A;  4KUM B;  3BQK A;  3KV4 A;  1QUU A;  2XTR A;  2LJL A;  1HCI A;  2YU2 A;  3DP7 A;  4G2A A;  2ODV A;  4AXP A;  4JEH B;  4XBF B;  5JDG A;  5ETW A;  2V7L A;  3VKG A;  2V26 A;  1D0Y A;  1NWM X;  2L8K A;  3ZYL A;  4X1K E;  2XAS B;  4UEL A;  2D2S A;  1VRB A;  5LGN B;  1HXX A;  4FUV A;  1Q9F A;  2WBL A;  3CKD A;  4AKG A;  2CCQ A;  3DA4 A;  2NWB A;  3LK3 A;  4LSF A;  1MIW A;  1MIY A;  4QWN B;  3HL6 A;  1HX8 A;  4EXT A;  4LSI A;  1KNZ A;  4I55 E;  3E0Z A;  4F4B A;  4AYM C;  4O3X B;  4ERR A;  2Q9Q A;  5L3D B;  2WM9 A;  2XAJ B;  4KP3 C;  3PRN A;  1ZHY A;  3VZW X;  4C69 X;  1G73 A;  2V7M A;  2A72 A;  5H6Q B;  4U9C A;  3K3Q C;  4M1P A;  4DO0 A;  4UF0 A;  4P09 A;  4IE7 A;  4AQF C;  3FB2 A;  4JUY A;  4PJM A;  4GK5 E;  4FZN A;  2CEA A;  2VAS A;  4ISS A;  3A2S X;  4GIW A;  2FGQ X;  3DTO A;  1NAF A;  4E1S A;  3B13 A;  1D1C A;  2LEH A;  2IW5 B;  3WI5 A;  2VK9 A;  2LSG A;  3AA6 A;  5L3C B;  4ZS2 A;  1LVF A;  5EK3 A;  3ZN0 B;  1ZEE A;  2XTL A;  3AA6 B;  4HTE A;  2CXD A;  3LBX A;  4GK0 E;  2JJ9 A;  4O4X A;  3N5L A;  4TX5 A;  2BVL A;  3F57 A;  3KV9 A;  3EUH A;  3P8C D;  4I43 B;  5PRN A;  2X68 A;  1WLX A;  3K19 A;  4IE0 A;  3UPG A;  3HR0 A;  5EK2 A;  1UX5 A;  3IHR A;  3N9M A;  5FY1 A;  3EVY A;  3PU8 A;  4O4I E;  2L9Q A;  3ZJ1 A;  2VB6 A;  4RJW A;  2CWY A;  4MBQ A;  3C5O A;  3F31 A;  4IDZ A;  4K0U A;  2F1T A;  5FNV E;  2V1D B;  4BUM X;  2M67 A;  3PUS A;  4ZS3 A;  1WR6 A;  4IST A;  5IYZ E;  5JDH A;  3VHL A;  3RPU A;  4A56 A;  2C0S A;  3CX7 B;  5EK4 A;  4NUU A;  5LBQ B;  4P0B A;  1GFQ A;  3RX6 A;  3UUX B;  4ADZ A;  2LSK A;  2LT3 A;  3ZMZ B;  5LYJ E;  4JCH A;  4AYN A;  4AFK A;  1T98 A;  4PNI A;  4PFO A;  4EOZ B;  6PRN A;  3OJA A;  4PW8 A;  1CUN A;  4E7S A;  2DHR A;  2LFU A;  2Y2X A;  3JC6 C;  4UV8 B;  4OK0 A;  4CI3 B;  5E0O A;  1ZHW A;  3MKD A;  2PFV A;  4QXB B;  3KVD D;  1ZKE A;  2KWI B;  4PUX A;  4ZI2 C;  3JC6 D;  5FXV A;  4IHJ E;  2XE5 A;  4D65 A;  4TN7 B;  2B1E A;  5HXE A;  2HPL A;  2J1N A;  4PAG A;  2K0L A;  3KV6 A;  4HKA A;  1Q9G A;  5LJM A;  3ZCJ A;  2GE4 A;  2VKH A;  4GCS A;  2NW9 A;  3R6N A;  2DLR A;  3S4U A;  3HKC E;  4KMC A;  5EE2 A;  4X20 E;  2A3D A;  4CI1 B;  2LSI A;  3EDU A;  2QA7 A;  2N2N A;  4DMV A;  2W00 A;  2X9W A;  3I9Y A;  2X51 A;  2D0T A;  4H63 V;  5FMN A;  4FES A;  1FMW A;  3RC3 A;  5DL5 A;  3ZYM A;  3O4X E;  5TAO A;  3RBH A;  2WMO A;  4O3Y A;  4O3W A;  4BJN A;  3V8U A;  1IAP A;  5KMG P;  3QUJ A;  2KXP A;  1MND A;  2X0L B;  3CX6 B;  4H9S E;  4NUV A;  4MFR A;  2KWH A;  1YKE B;  3LK4 1;  1X79 A;  4AUI A;  3GWH A;  5D5D A;  3HI2 A;  3ZN1 B;  4C91 A;  5J2T E;  3RKO A;  3N9N A;  2C5I T;  4ZHQ E;  2ZM0 A;  4FI5 A;  1HF8 A;  5LA6 E;  3RYI E;  4AKL A;  4RLB A;  3C4Z A;  4EYY R;  3RYH E;  3SOL A;  2E9X D;  3AVR A;  5L3G B;  1BR4 A;  1BR2 A;  2LOS A;  3Q2M A;  5LBM A;  3TKL B;  3C51 A;  3O1H A;  4I50 E;  4EZ4 A;  3ZC0 A;  3POU A;  5DAB A;  3UUN A;  2OMF A;  3V5S A;  4MAL A;  4DND A;  3ZMV B;  2ZM2 A;  4XAX B;  2YU1 A;  4YFS A;  2E9X B;  2Q9Q C;  3NBX X;  3QK6 A;  1HXU A;  2XE2 A;  4FSO A;  4U72 A;  3K3N A;  2N2L A;  5EZY E;  2JMH A;  3C98 B;  3RYC E;  3CQG B;  4ZI3 D;  3PQS A;  4BJM A;  4O2B E;  5HXR A;  4FRT A;  5DQW A;  2F1V A;  5IYU A;  2KC0 A;  2XTQ A;  2Q9Q D;  2YPV A;  4CQI A;  3SYB A;  1BR0 A;  3FBL A;  3EMN X;  4KR8 A;  5L2L A;  3C4W A;  3WAK A;  4H9N C;  2EHO A;  2P9B A;  4PK6 A;  4DBQ A;  2DWG A;  3QRC A;  2H7V C;  3FXE B;  3QRA A;  4RL9 A;  3KFW X;  3B57 A;  5HXC A;  3O9X A;  2XUE A;  3PUG A;  1S35 A;  1HXT A;  3OYX A;  1ORM A;  3HW9 A;  3HKE E;  1MMA A;  5JDP A;  1YS5 A;  2L3L A;  3U3I A;  3SS1 A;  4H63 H;  2XQY A;  2KMF A;  2KT9 A;  5DL6 A;  3MZK B;  4QXC B;  4OYJ A;  5JDQ A;  2C5J A;  4OFZ A;  4AKR B;  3DJB A;  4N58 A;  3PU3 A;  2HH7 A;  5JR9 B;  1GFP A;  1IJ5 A;  3PQU A;  4H9Q C;  3GN5 B;  3QC9 A;  4FJO A;  4YLH A;  4N59 A;  3WI3 A;  3LJC A;  2MTQ A;  5LOV E;  2HPJ A;  1ZHX A;  4AYI D;  2EHO C;  2XE3 A;  3MK7 C;  1LVK A;  3LK2 A;  4BA9 A;  3HWB A;  4UIG A;  3FXD B;  4RLC A;  2K24 A;  2KZ7 A;  2ZM8 A;  4CXW A;  3SZV A;  4AZL A;  3LK4 2;  3H3A A;  3UT5 E;  3WAJ A;  4H9P C;  1FIO A;  1MIV A;  5GON E;  4N78 D;  5AFU L;  2X9Y A;  1WYB A;  1THQ A;  2Y0K A;  4ILU A;  5HXS A;  2Y0L A;  2JMM A;  3D0T A;  4EZH A;  5HYA A;  4GYR A;  4AKH A;  2V7J A;  4QX8 B;  2K4T A;  2PBI A;  4H9R C;  4MLK A;  4FSP A;  3W15 B;  3V5U A;  3NZQ A;  2JMK A;  5L3F B;  3ANW B;  5LHI B;  2M06 A;  2SPC A;  4WW0 A;  3CML A;  5FXW A;  3RYF E;  3ZPO A;  3N2K E;  4KRA A;  2NW8 A;  1US7 B;  2DWK A;  2WWU A;  3PTR B;  1V9D A;  4U74 A;  5C8Y E;  4GF4 A;  1BH3 A;  1YKH B;  2LM9 A;  5CA1 E;  2LHR A;  4RJX A;  4EIW A;  1Z0P A;  2GK9 A;  3Q5X A;  3KVB A;  4QQ1 A;  2H7O A;  5HWY A;  2Y6X A;  3G7G A;  3SZD A;  1HG5 A;  2LOP A;  2LHN A;  1MMD A;  4IE6 A;  1Y64 B;  3I1A A;  5JQG E;  1GFO A;  3N9Q A;  2KDY A;  1VOM A;  3N2O A;  4IIJ E;  4OHF A;  4TUY E;  2JRK A;  5JDM A;  3H37 A;  3IEE A;  2W62 A;  1IZN A;  1ZHT A;  5FYM A;  3VY9 X;  1UCU A;  1B7T A;  3CQC B;  4MHC A;  1BR1 A;  2ERV A;  1U4Q A;  3AAA A;  1G90 A;  5ADX L;  4HGA A;  4PK4 A;  3GA8 A;  5HAX A;  3AA1 A;  3PUA A;  4D5U A;  2H3R A;  5H6R B;  3HOE A;  1H7C A;  1OWA A;  4GYS A;  5JR9 A;  4FZM A;  3PE0 A;  4ANJ A;  2JQQ A;  1D0Z A;  4GCQ A;  3MXZ A;  2X27 X;  4KBM B;  3OBV E;  4QXH B;  2WSS V;  2N2M A;  3AA0 B;  2DI4 A;  4ASK A;  3POQ A;  2VKJ A;  2ZLD A;  3KBT A;  5GV0 A;  4HN9 A;  3ESL A;  2E9X A;  1O3X A;  3ZMT B;  3LK3 B;  4ZOL E;  2KIN B;  1QJ9 A;  5FXX A;  4LSE A;  4CXX A;  5LGU B;  3M65 A;  3NRX A;  3AAE A;  4E7Z A;  3POR A;  2X9X A;  3ZMU B;  1E54 A;  3AA0 A;  3T0S A;  2CM0 A;  3HA4 A;  4GHB A;  2YEV C;  4X1I E;  2LSJ A;  1WYC A;  3ETV A;  4YJ3 E;  4XNK A;  5LCY A;  5JDL A;  3AA7 B;  4L0R A;  4P0A A;  4ZI7 E;  1QJ8 A;  4UV9 B;  5LNK A;  1H6S 1;  5DQV A;  2YIN A;  3I0Q A;  1MPF A;  4UVC B;  5JRE A;  1GFN A;  3FYX A;  4PJL A;  1MM4 A;  4WBN E;  3C50 A;  4AKM A;  3LBX B;  3AAA B;  5HXH A;  3T20 A;  1PRN A;  4LSH A;  2NTX A;  2OA5 A;  3ZMS B;  3RH3 A;  2C5K T;  3PUQ A;  5JDN A;  3SYS A;  1IZN B;  2LE8 A;  3KIN B;  2K9A A;  3BQI A;  2NW7 A;  4HEA A;  3RRW A;  5F8P A;  3NSG A;  1YW0 A;  3GN5 A;  3O1J A;  4AQG A;  2CWO A;  2M07 A;  1MMG A;  3F2E A;  4YJ2 E;  2MYS A;  3AA1 B;  2Y48 B;  2KZ7 B;  3VE2 A;  3NZP A;  3AVS A;  4FZL A;  2LSY A;  3U78 A;  2W63 A;  3SRZ A;  3CX8 B;  3IBP A;  5FY7 A;  3FBZ A;  4QKN A;  3CPZ A;  4HFV A;  3K3O A;  2RA1 A;  2BVM A;  1D0X A;  1SHZ C;  2J1D G;  3FHN A;  2Z6E A;  1E1H B;  2YK0 A;  4JEU B;  4UF0 B;  4ZI2 D;  5BMV E;  3RRC A;  2V7K A;  4GCP A;  2IAK A;  4AQF A;  2MNH A;  1ZV4 X;  2XAG B;  1QSD A;  5FXZ A;  3LG7 A;  4JLE A;  3SWH A;  5M4Y A;  2XAF B;  3KV5 A;  5J1G A;  4YHJ A;  1WRD A;  5LHH B;  5LXT E;  1MNE A;  3NRY A;  2XMX A;  2NOX A;  3BQL A;  2VWA A;  3K8P C;  3ZEF B;  2CXL A;  2VKD A;  5T5F A;  3VY8 X;  4O4J E;  3GP6 A;  2ODU A;  3J9X 1;  4O4U A;  2W80 C;  4AYE C;  4C90 A;  2NP9 A;  1PHO A;  2DNX A;  2V7I A;  5CB4 E;  2DCF A;  4XNL A;  4GOU A;  2BZB A;  4IGU A;  1HS7 A;  3UU2 A;  4B61 A;  3VU7 H;  1QJP A;  1D1B A;  2D5U A;  1OSM A;  5AFU K;  1ZHZ A;  4PJJ A;  3SY7 A;  4B6X A;  2O4V A;  2RP4 A;  3AA7 A;  2KND A;  3E08 A;  4I4T E;  3AB3 B;  5LP6 E;  3L3P A;  4UXN B;  4O3Z A;  4CI2 B;  4AKR A;  3LFM A;  2XE1 A;  3UUL A;  3PDY A;  2KXP B;  4FMS A;  2CE7 A;  3N9L A;  2JPF A;  4V1A v;  3KBU A;  5KX5 E;  2CA5 A;  3KDS E;  4G76 A;  4WNK A;  3ZYK A;  5DL7 A;  3ZLI A;  2X67 A;  3TZG A;  3LK2 B;  4EYU A;  2CLY B;  4QHO A;  4G75 A;  4O8S A;  3O1I A;  4E1T A;  5DJQ C;  3C4X A;  2IC9 A;  3VZT X;  4F6R C;  3KVA A;  4O4H E;  1EZ3 A;  3C64 A;  1HFA A;  2LHF A;  4UVA B;  2VKO A;  3UFE A;  2ZLY A;  3AAI A;  2VL8 A;  2XAQ B;  3AAE B;  4PJN A;  4WBO A;  5LG4 A;  1AJ3 A;  1YD8 G;  1MMN A;  3IF8 B;  2E8I A;  2XAH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...