2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
3AAAA 2KZ7A 3AA1B 3AA7B 1IZNB 3AA6B 3LK3B 5ADXL 3AAEA 3AAAB 2KXPA 2KZ7B 5ADXK 3AAEB 5AFUL 2KXPB 3AA6A 3LK2A 3LK42 3AA0A 5AFUK 3LK2B 4AKRA 3LK41 3AA1A 3AA7A 3LK3A 1IZNA 3AA0B 4AKRB
chains in the Genus database with same CATH superfamily
3NRYA 1HXTA 3VE1A 3OVUA 2YPVA 5AQNB 3M91A 1VQLP 1OPFA 3USSA 3L75E 2WSEH 3E1IA 1H6S1 3AE2C 3AE5C 3L74G 4X1IE 3ZMSB 2PAJA 2B87B 3D70A 1NOHA 3JTYA 1BCCE 2QJPB 1NTMK 2Q1KA 2JMKA 1PL5A 3RHWA 4C69X 1LTJB 2IAKA 4QHOA 2WPVB 2OYIC 3P7IA 1OW8A 1SQVE 2EHOA 3WI5A 2PG8A 3JCFA 3A8YC 3BCCE 3ZT6A 1FZAA 2IDBA 2IC9A 2K37A 2E9XC 1AVOA 2QJYC 5GTHO 1GFQA 5CBNA 1XTCC 3HKBE 3BQLA 3AEBC 3UU4A 3FXEA 5KKZC 3RGLA 3AE9A 5HEOA 5AQRB 3U1AA 1T2KC 4JEHB 3TLWA 1JM0A 4DMWA 5AW3B 4OYKA 4A97A 4UV8B 2A45H 3EWKA 3IBPA 3ZYMA 1XNRT 3FZFB 1S35A 1VOMA 4ILAA 5LOVE 3FZLB 3RKOA 1FIOA 1ZRTD 3WAJA 5C3JA 3NJTA 4MN4C 2RA1A 2JEEA 4P0AA 3TK1A 2KSJA 2UXDT 1NENA 2W8ZA 3A2AA 3CK6A 4AXPA 4YXDC 2BEQD 1L0NE 2YNKA 3Q3DA 3IFMA 2VKJA 3ONJA 3HW9A 1MIVA 1ZMEC 3VZTX 3DP7A 4JV5T 3UU8A 1J5WA 2D9DA 1E54A 1VQ9P 1BDDA 2CLYB 3PE0A 1RQVA 4XE5B 1CI6B 1T72A 1FZCB 5L3FB 3CPWO 4B86A 4PFPA 1WRDA 4C91A 3H32B 3GP6A 5APSA 2Z6EA 4PFOA 1MIWA 3SFDC 3J9X1 2GM4A 1AJYA 1E7PA 1HR0T 1URQB 2WT7B 3LBXA 1X79A 3KINB 4DV5T 2B89A 2K88A 3K1SA 4OYJA 3WUVA 2VL8A 5AQMB 3DWOX 1EQ7A 3D6YA 2V8SV 4KHPT 4BA9A 4UVCB 3N4XA 1VQKP 3IAOA 1EZ3A 4AKRB 2HG5D 1RQUA 3PJAJ 2VURA 3EABA 2QA4P 1R8IA 3ZCIA 2ZXEB 3PORA 2XU6A 5FXZA 1FC2C 5D5DA 3IR9A 1QJPA 3CVRA 3MACA 2VL0A 4N58A 3Q5XA 1GL2B 2W27A 3I56P 1SVFA 5AQQB 1ZHCA 4TNVA 4IDPA 3O8ZA 4YJ3E 2KC0A 2LT3A 3A0HE 1M1JC 2FYUE 2BKPA 4JI0T 3PGRA 3I1AA 2FKWB 4RO0A 3H1KE 3VKGA 2CE7A 4B3RT 2H3RA 3AAEA 3AAAB 1SQPJ 3IN6A 1GFOA 3SWKA 2VWAA 2W4XA 5IUXA 4AFKA 4NPDA 2H8PD 4Z1MH 4TN7B 1QEXA 3FBZA 2Y6XA 3T1HT 4AKMA 1SQPD 1KILE 1SQBG 1U7JA 3GWHA 3FWLA 2VB6A 3TDKA 3HKCE 2UWJE 4OWFA 4QH5A 4K0KT 1FJKA 4E1SA 5L3GB 2Y9YA 3VTPC 4FZMA 4L5GA 2FGRA 1HH0A 3EHZA 4BAYB 2K24A 1OXZA 2J5UA 4WNKA 5AW5B 3PUWF 5TAOA 4OVNF 4DZOA 2CXDA 4X62T 3VHLA 2MTQA 3V6IA 2BG9B 2V26A 5AQLB 2C0SA 2ZFGA 1Z56A 5FP3A 4DO0A 3RIAA 1EC5A 2F1VA 2M5AB 3H1IJ 3KDPB 3QK6A 1YTZT 1CHUA 2Y8DA 3QC9A 5AW0B 5J0ZA 2AXTO 4WY4A 1NKNA 2YMYA 2WDRA 4C7NB 2N9YB 2QRXA 3H6PA 4U9CA 2FFDA 2C5IT 3AE5A 3EAMA 2BVLA 2R3SA 3H1ID 1KNPA 4LMKA 4R4LA 3HD7B 5CCHD 2W81C 4N75A 4RESB 3RI5A 4JQ0D 2NW8A 4LSHA 5APTA 3CPZA 4PJ0E 4JI3T 2XPKA 2DWKA 5AQVB 1VQ8P 2GA1A 4F6RC 3F89A 2UXBT 1EZVG 3NXSA 2OYIA 2NTYA 3B71A 1SQVK 4KHXA 4EAHA 4AKHA 2D2CB 4XNLA 4C46A 1JO5A 2W80C 3CMLA 4YTNA 1SQXE 3AE4A 4HWDA 2E9XA 4PR7A 1SHZC 3RIFA 1SQQJ 4GKKT 3CWBE 2G3AA 2P7JA 2QEXP 3VE2A 4IDNA 1FDIA 1KZUB 1YHQP 3PUYF 4A56A 2R5DA 2WZ7A 3BASA 3HUSC 4H13B 3L8RA 4ZI2C 1KQGB 3IF8B 1H7CA 3AA0B 7PRNA 3UIAA 1N7LA 3RL0B 5JRCB 3MK7C 4K3AA 1JNMA 1QSDA 5FY1A 4DCKA 4ISTA 4MLKA 1A02F 2A72A 3H1JE 4ZMDA 3RQUA 3AE6A 4Y99C 2W00A 2R89A 2WPRA 1FMVA 2IHR1 1L0NK 1NO4A 1GFNA 2YEVC 4JBZA 4PJ0H 2FXMA 4EGWA 1ZV8A 2RH0A 4B3TT 1PPJD 4L9IA 4D5UA 1L0LE 5APXA 3GLMA 3RYHE 3PUQA 1SFCD 5BMVE 1SLQA 4B6XA 3CC4P 2LOPA 3V2RA 1YJWP 1OWAA 2K3WA 1G1IA 4UIGA 5JR9B 4TWHA 4GF4A 1Q9GA 2HODA 1YQ4A 1VQ7P 1Y47A 3KBUA 2IFNA 2XTRA 2YKPA 4L75A 1LWUB 2D2SA 1SFCC 1HG5A 5AQKB 4TX5A 5AQGB 2FYNC 3N9PA 2NP9A 1S5LO 1L2PA 3PUGA 2QYWA 1X9VA 4AQFC 2JWAA 2QJKC 2NPSC 1W0AA 3O9XA 3P4RA 2KS1B 4XAXB 2ODUA 3AEFC 5LGTB 5ABFB 1PGPA 1IAPA 1FDOA 3V5BA 1GFPA 2Y7SA 2J58A 3RK3E 4LF4T 2LM2A 5CJ0A 3RBXA 1M62A 2MOZA 3TGUE 3LG7A 4ILUA 1LRZA 5DQVA 1KMIZ 3CXHD 3A2SX 1BR2A 4Z3TA 2K48A 1KORA 1SS1A 4K3CA 1YBKA 1KFMA 2N1TB 1BGYJ 1SQPG 4H9RC 3UT5E 3I0QA 3MXZA 4EYYQ 4YHJA 2XNXA 1AJ3A 1N7SD 3QRAA 1SE7A 3AA1A 3P8CD 5TISE 2FYUK 3PHLA 4YSYA 3J7Yq 1BGYD 2KLVA 2YN6A 1PV3A 2KIKA 1T7SA 1GK4A 1IBKT 3FGAD 3TF5A 2QIWA 1KYOD 1N7SC 2BBJA 2M06A 5LHIB 3L37A 2UUBT 4CTDA 4I6MC 3WI3A 1JCCA 1IJDB 2FUPA 2IFMA 3PU8A 3WUUA 1A02J 2XQ4A 3N9NA 2V7QJ 3HE5B 2J4GA 1VQ6P 4L76A 2NW7A 3B5NC 3HI2A 3VOPA 1G90A 5FXVA 4EZ4A 3K3QC 1KFYA 1ZN5A 2LXCB 1S5LX 4KBMB 3OJAA 4UB8O 2KNDA 2JR8A 2QJYB 4I2LC 1RF1B 4G2AA 3H1IG 1YKHB 1UIIA 2V6YB 4PK5A 5JREA 3L09A 1KILA 3T97B 2WQYC 1XDPA 3UU3A 3SFEC 5APVA 4LF6T 4DR2T 4JPZB 2KNCA 3RBHA 3PH0A 3DJBA 2XQ7A 5TISH 3CCSP 5HCJA 1S9KE 4H9SE 3N9MA 5AVVB 3MKDA 3RQWA 3NZQA 4HTEA 1NEKA 5LGUB 4LC1A 3KVBA 2KXPA 3F5HA 2O01H 2Y0EA 5KAFO 1BE3J 2CPSA 4HKZH 4ZI3C 3KZIH 1E5WA 1PRNA 4CI2B 4TLFA 3VMXA 3CQXC 1MM4A 3AB3B 5FL0A 3UFGA 4C4VA 1FDMA 2KWIB 1UX5A 5E79E 3A0BO 1BE3D 2UXXB 2LHFA 4ZZBA 4O2BE 4P09A 2K9JB 1X9BA 3L74J 1T8ZA 3V4WA 4IFDK 2XHEB 2EHOC 3VYIA 2XQ3A 1N32T 3T20A 1GTWA 1NTZE 5HYAA 1VQOP 3LW5J 5L3DB 3H1HJ 4MFRA 2MBGA 5GTHE 2O4VA 4X65T 1PP9E 1PGQA 3SS1A 1S72P 3LK2A 1HCIA 3HUSA 4JLEA 2XE5A 3LK42 3AEGC 5M1BA 1IK7A 3AE9C 4LFBT 1PPJG 5EK2A 3H1HD 2N2NA 2A06D 3MZWB 3BS0A 2P1JA 1YI2P 2YK0A 3OPCA 4IREA 4EYUA 5FNVE 3CX5E 4DV7T 5H6QB 4ILCA 4ZXLA 2J59M 3P4PA 1LTAC 1D1AA 1OVUA 4O4JE 2W6BA 3TLTA 3HE4A 5FYMA 3VRAA 3S4UA 4WBAA 3H3MA 4HFDA 2ZAEB 2RP4A 3IHRA 1L0LK 2WZHA 4KP3C 5GONE 1ZXGA 3KV9A 1P84E 5BU8B 1NWQA 5E79H 3CC7P 1T6AA 4KJMA 3ZMZB 4BXLA 4BRYB 3AA7B 2ERVA 4AIUA 3ONLC 3OYZA 1MMGA 3C50A 4IE5A 2WMMA 3ZN0B 3QOFA 2L9QA 4OGQD 4N74A 3H1LJ 4DBQA 2GUVA 1S2EA 5GTHH 2CEAA 5F5WA 1HX1B 3N2OA 4OK0A 4AQFA 2NPSA 4HWCA 3G3ZA 2IBZI 4H63V 3UUMA 2LLYA 3S9OA 1HGZA 3AE7A 2Z5HA 2VQET 2WU2A 2G0UA 3H1LD 3AEFA 1XDOA 5KX5E 1G2CB 2CK3H 3NSGA 4RJWA 2W6JH 4O9BA 4XBFB 3K3OA 3O6QB 1OMIA 3SRZA 3L71J 1IZNB 3PUAA 3CX5H 1BGYG 4YFSA 1GK6A 3C64A 4LGDE 4DR4T 2E75D 5KLIB 1IFMA 1NTKE 3P4QA 1RE3C 3MGNA 4DJGA 2BCCE 3PTZA 3GF3A 3RRCA 3L71D 2X67A 2E43A 4UF0B 3JSVC 4WVZA 2OA5A 3AXJA 1LTBC 1YS5A 1P84H 1N73B 4H9OC 5J1GA 1H88A 4QH1A 4LFCT 3KXDA 2IIUA 5CJ4A 4FJOA 1NKZB 4J2CA 3CMEP 4X20E 4WZXA 5KJ7C 3PLNA 3Q5DA 3KV6A 4O4HE 4W7YA 3KZIO 1T8BA 3RYCE 3D0TA 3FB2A 1YIJP 5HCMA 1LGHB 4O4LE 4L0RA 4HH2A 2IZ0A 1ZHYA 2OTJP 3BQKA 2W63A 3B5NA 3HTKB 5JDMA 1CZQA 3N9QA 1QJ9A 4GDOA 5E0OA 5FY7A 5TJHA 4IDQA 5IYUA 3B57A 1XMOT 5LHGB 4UV9B 1YJ9P 1M7LA 1IFJA 1D7MA 4X1KE 5FY0A 4JBWF 2XE3A 2ZYAA 3QNUA 1D1BA 2WQYA 1U4QA 4WY4D 2LXBA 1KEYA 2C0XA 2VVSA 1H0TB 3IA3A 1Q90D 1BE3G 4GYSA 2DWGA 3U78A 4DV0T 2KK7A 3VY9X 2OTKE 2WU5A 2YDRA 3NRXA 5L2LA 2R32A 2AXTE 2C0WA 3F2EA 3CMAP 3Q2YA 4WY4C 2BS4A 4RKUJ 5KLVJ 1K04A 1EXJA 1M57D 2FFDC 2PFVA 2Y0HA 1T1LA 2CPTA 1JTHB 3DZMA 3VY8X 3DA3A 2E9XD 1T98A 4C00A 4L73A 2KI7B 5KLVD 3H1HG 2A06G 4I50E 4JFBA 3D71A 2A2FX 5E79O 3ZC0A 4H9PC 4GK0E 2V4HA 3P50A 4GCQA 1VQPP 1LKXA 1JNZA 1D1CA 1T2KD 1NTZK 4CN4A 4ERRA 3DA4A 2JJLA 2CWOA 2HPCA 3AE4C 1KFNA 3GMAA 3AEDC 1BSHA 4OH8B 1W09A 1SFCB 3AEGA 4DR7T 2NOXA 2I59A 2FYNB 4B61A 4JI7T 4W80A 2WSCH 2E76C 2QJKB 2JQYA 4ZS2A 1T3JA 1JMBA 2R88A 2BS3A 1FZBA 2X9HA 1EZVD 2IX7C 2OGUA 4RL9A 4X1YE 5KDMC 4XFJA 1HXUA 4IOIH 3JC6C 4Y28J 2WCAA 2HH7A 3CCEP 2WJRA 5CMZA 1Q86Q 2AXTH 2JKVA 5CFBA 5DQWA 1J1EC 3HWBA 5LG3A 4PD4E 1LT1A 2W6AA 2H43A 3ZMUB 4GCSA 1GW4A 1WYCA 2KZJA 2ZYGA 4ZI7E 1L0NJ 2XJ7A 2QGSA 4A5XA 1RF0A 4BJNA 3AE6C 2V7KA 2J1DG 1IJ6A 1HNZT 3H1LG 4O8SA 2CMRA 4IE0A 3AA6A 3ANWA 1L0ND 3ZT7A 2XAGB 1PFIA 5JDHA 3FXDB 4Z91A 1L0VA 1DX7A 3KV5A 4AUWA 2HN2A 3CCQP 4RJXA 2N9DA 4CZZB 1KD1Q 1Y01A 3D6ZA 4CPGA 4AYCA 1YQ4C 3E22E 2AEMA 1N7SB 1J1JA 3AE8A 3L71G 3P7KA 4FESA 5AVZB 1S5LE 2BKOA 4GIWA 3VN0A 2RPAA 4K0UA 3C51A 4EXTA 3B13A 2WDVA 3KYQA 1V9DA 3O1HA 1HF8A 5APQA 2ODVA 2X0YA 3PUXF 2Q5UA 2FBWC 5LBMA 4JI1T 4L74A 8PRNA 1NTKK 1RE3A 2XV5A 2ZT9C 3ZKRA 4PD4H 5AVXB 1HTJF 4AYNA 3Q5WA 1P4TA 1LTSC 1KTMA 2LFUA 1OEDE 2FJBA 2Z4EA 2X68A 3HOEA 2KOGA 3TNUA 4O3WA 1J1DC 2FJAA 3AA0A 1N8RQ 2KLQA 1HF9A 1LNQA 3QRCA 2MHLA 3SWFA 3JAFA 5GV0A 4FOZA 1UK5A 5G26A 1IK9A 1AVYA 3SY9A 4XNKA 3RC3A 5LMNT 3CLQA 5KJ7A 5A1LA 2AEFA 1QLBA 2CM0A 3N2KE 1QL2A 3PGUA 3RIUA 1GD2E 2Q9QA 1HNXT 2UUAT 4HWIB 1XTGB 1GU4A 1CSBA 1FU1A 3BRYA 1S5LH 2L5GB 1THQA 1M56D 3FZMB 2D0UA 4DVDA 3K19A 3N9OA 3G6EP 2P2UA 2H89A 5AVWB 1D0YA 1E2AA 1JEKA 4EIWA 2GK9A 1JNRA 5LCYA 4JF7A 1KC8Q 1KILD 3CCUP 1LT9A 2QTKA 2DI4A 1SQPE 1WMKA 2VQFT 3P32A 4UB8E 2VK9A 3CL3D 4DV4T 2JPFA 2JQ9A 4HWHA 4F8HA 3UAQA 1ZOYC 2WWVA 5L3CB 2XM1A 4LSEA 2YIUB 4JEUB 3FZHB 1MMNA 3FXEB 1W2BO 2D0TA 1KILC 3AE3C 4HFBA 5AQSB 5KLVG 5FMNA 2JP3A 1VQMP 3R6NA 5LJMA 2WDQA 5JDLA 2A45I 1HVVA 3EVYA 2WTYA 1BCCG 3I5CA 4DNDA 1JY3N 4RLBA 3UFEA 2POHA 2MAWA 1Z8UA 3TLVA 3N5LA 3PGSA 5KAFE 1ZHXA 2JRKA 2CRBA 1DIPA 1O3XA 1DEBA 2WWUA 3ZPOA 2I1JA 2B9BA 1BR0A 4FRTA 4QMAA 1R5LA 5PRNA 4QXHB 3A0BE 4AKLA 1ZP0A 2X51A 3VR9A 3QB5K 3H1IE 3EFFK 4IL6O 4D64A 3RGUA 1KQSO 5CA1E 5KXJA 2YXQB 1SQXJ 1U57A 2YKOA 4YPCA 2O01N 4F4BA 4ZI2D 2L3LA 2KSRA 2FJEA 1YTZI 3CWBJ 2E42A 2CXFA 2R6GF 3AEDA 4UB8H 4HYTB 4U7YA 2XZEA 2OLTA 4YTPC 3ZC1A 2P58A 5ABHA 1SQXD 1FZEA 2CBJA 3H3AA 2IC6A 1LJ2A 4U3FJ 4NIQA 4YSZA 4PNIA 1QVGO 4YJ2E 3CWBD 1W5CE 4AKIA 3LBXB 4MHCA 3C9IA 1X79B 3QB5A 1JOCA 4OGQB 1VF5D 1L0NG 2BEZF 3JC22 2LOSA 2WBLA 4UB6O 4NPFX 4TWDA 4U3FD 3I0OA 3LK3B 1KB9D 2V6YA 2QE7H 3V5SA 1SQQE 5FXXA 1HTLC 2KZ7B 3PF1A 2LM9A 3O1JA 1K73Q 4PD4I 2JMHA 3Q9DA 5KAFH 1DU2A 3KV4A 1QL1A 3L73J 4H44D 1VF5C 1ZW0A 2NWBA 5FVLA 3CI9A 3UU2A 1L0LJ 2LKMA 2F1CX 4IL4A 4ZKPA 3MJXA 4XZCA 2E75B 3A0BH 3L73D 4JYAT 1N36T 3VU7H 5LMUT 4H44C 2IYOA 2NPSD 3C5OA 1L0LD 2HPLA 2CHNA 4NXMT 2AXDS 1FOSF 3AAEB 2VASA 5AW9B 4IDOA 3EQ2A 2V7MA 2OYHA 4IL6X 2J62A 5HEGA 3TYYA 4EV6A 2Y48B 4FSPA 1LTJC 2DL1A 2IBZD 1YD8G 1AV1A 3AE7C 1T16A 3ABVA 4QQ1A 1WR0A 2FBWA 3OW2O 4ZEYA 1N34T 3MUDC 3O4XE 4IE4A 1G8XA 5LBQB 2KB7P 2JDIH 3MHVA 2Z5IA 2WS3A 3PTRB 3SYBA 4LFAT 3AEAC 4IFMA 1HJ0A 4WWIA 3EUHA 2FYUG 2KYVA 3DWNA 3P4WA 3RK3D 2W61A 2WAUA 3HKDE 3QUJA 2WZIA 2GUSA 3CCRP 4GOUA 1MMAA 3UUXB 4GHBA 3B5MA 2YO3A 3EFGA 3C4WA 1YQ3C 1K8AQ 2OQQA 1DD4A 1RHZB 4KUMB 3CXHE 3FZKB 2XQ8A 3WMM0 4RLCA 2X66A 1XMQT 3RK3C 2AEJA 2O01J 4N78D 1OW6A 3CD6P 3NBXX 4RJTA 3WU2O 4WY4B 1OEDA 4QXCB 4O3ZA 2LSKA 3B5ND 3TKLB 5HXCA 4E7SA 3ITKA 4EYYR 3KZIE 4HN9A 2F1TA 2CWYA 1NVOA 3L72E 3KQGA 2XSAA 1S4XA 2CPBA 3Q5SA 2VVNA 5DABA 3T8OA 5LXTE 3VZUX 3JAEA 2ZLDA 3RYIE 1LVKA 1KYOE 2V6XA 4CI1B 3V2QA 2O3JA 2OYIB 1FZCC 1NWMX 3I55P 4KX6A 4GKJT 1VQ5P 1SQPK 1HNWT 4UVAB 4EIJA 2M67A 1L4AA 3ZSSA 2N9BA 5EFWB 2E9XB 1LP1A 4K35A 5HWXA 1ZOYA 3CQGB 1E1HB 2E74D 2ES0A 3AECA 5KKZB 3CX7B 3S4RA 2XQ9A 3MIWA 3AE3A 3JADA 2CCQA 3ETVA 3CX8B 2ZMAA 1EDLA 1KQLA 3VKHA 4X5TA 4CQIA 2VKDA 4B3ST 3RLFF 2D5UA 4EB6E 4ZI3D 3Q5PA 3NFQA 3CXHH 4X66T 2E8IA 3RK2D 3OAKA 5GTIE 2E74C 2IYPA 2LRKA 1OZHA 1J1EB 3AE1C 3ZYLA 4FQEA 4IE7A 1I6ZA 3NZPA 1FE6A 1JUNA 1KV4A 3LIEA 1SQXG 3GHGA 3R4YA 3CCLP 3GN5B 2EHOD 1ZLLA 3M0DA 2ACXA 3POQA 5H2FE 3RK2C 2L91A 3CWBG 4I7ZC 2KWHA 1LTTC 1NTMJ 2W0GA 2HR3A 3RL0g 3C4XA 1KYOH 3CCMP 2PORA 2WSSH 1WYBA 3KVAA 1JY2N 4U3FG 1USEA 1IFDA 4LMLA 1NTMD 3GMIA 4TV9E 4EEDA 4AZLA 1OVRA 4LF8T 3KDSE 4CXXA 4YTPA 1X8YA 4C7RA 3OKQA 1BE3E 3SZVA 2JJ9A 5BVZA 3HTKA 5L4EA 2NW9A 1NU1E 2BG9E 1Y8AA 5AW6B 5LG4A 4CI3B 2NTXA 1ZHTA 2V7QH 5JVDE 4U7IA 1VCTA 2BDEA 3ZN1B 3L73G 3EDVA 1ZHZA 3EDUA 3A3YB 3RBZA 2IZ1A 5CB4E 2LE8A 3L74E 2VRSA 5GTIH 3T1YT 3POUA 4I1LA 1L0LG 1OVVA 1SQQK 5AQHB 4O3XB 3CWZB 4DMVA 1Q9FA 2PGDA 3UUBA 2JWDA 4D65A 3VMAA 2V7IA 3PV0F 1H89A 1M7KA 2UXNB 2WVRA 4AQYT 4YSXA 3HKEE 2WMNA 5AVQB 2XAQB 5H2FH 3AEEA 1RF0C 3U1CA 1AFOA 2IBZG 4EEBA 3T24A 2F4VT 3UPGA 2R5BA 2W2UA 3GW6A 3AA1B 2HPJA 4FZNA 2E5TA 1QX8A 1M1JB 4U33A 1Q7YQ 2KP8A 3HD7C 2B87A 5G3AA 5JQGE 1UCUA 3LDQB 2MJZA 3A7MA 5HEHA 1GDTA 1QJ8A 5BR8T 1ZEEA 3AE8C 1LTJA 2P67A 4HB1A 4JCHA 3NWIA 4U2ZA 2N2LA 2DCFA 3JCUE 2WJQA 2PBIA 3MUDA 1MZ9A 3L3PA 3H25A 5HWYA 5HEUA 1R8EA 5B66O 2QVAA 1MNEA 1I94T 1MMDA 3I9WA 3M9BA 3LW5H 2BCCJ 3AEAA 1MKMA 3H1LE 1BT9A 4UELA 3OJAB 2CHOA 2ITAA 4YXWH 2K9YA 2V5CA 3E0ZA 1D0ZA 4M1PA 5BU5A 5KJ7D 1VQ4P 2BCCD 1KILB 3A5TA 1YQ3A 5KMGP 3KFWX 2Q9QD 3RL0C 2KNCB 3PDYA 2M3BA 3L71E 4NPEA 1QVFO 1GU5A 5L47A 1FJGT 2IWVA 2WSEJ 1MFTA 4KRAA 4DV1T 5EK3A 2BASA 3EI0A 5APYA 2W62A 1YXRA 5ADXK 1QLED 3RIUC 2KXPB 1PHOA 2Q9QC 3P4SA 3AAIA 5DJTB 1BR4A 2N2MA 4D6TJ 2G8YA 2ZM6T 2QG4A 2ZVOB 3L70J 3FXDA 3MTUE 3C98B 4JYCA 2YMKA 2LHNA 2NZ2A 1CI6A 3JCUH 4C4VB 1FZCA 2H89C 2M8RA 5JR9C 5L3BB 1JMMA 2Q9IA 3H32A 4O4XA 4D6TD 3LFMA 4BWNA 1U7MA 3CC2P 5M4YA 1LTGC 2XAFB 3FBLA 3L70D 4PJNA 2FXPA 1LWUC 2YO2A 4HJGH 5AVUB 3FYXA 4X64T 1LT9C 4HGAA 1URQA 2WT7A 2WSSV 3LSVA 5FVNA 3O1IA 1FAVA 3V8UA 2XG6A 2WSCJ 2BS2A 3N9LA 2K0LA 2OARA 4TT3H 4WYVA 3HUSB 3TLSA 4AKRA 3T0SA 1H8AA 2WWWA 1WR6A 3RPUA 4DV6T 2BVMA 4PJJA 2CXLA 2Y9ZA 2WY2A 5C39A 4O4UA 5GTIO 3VZWX 4P0BA 3AE1A 3V2PA 3L75J 2K3RA 5CA0E 1KQFB 1NTMG 1FBMA 4KHZF 2IWWA 4JI8T 1W2EA 2W83C 3W15B 1SQBE 2WSFH 1GL2A 4Y99B 1QGKB 2N1TC 2SPCA 5HAXA 1VF5B 3HE4B 2AXCA 1BCCJ 1YYCA 3L75D 1IBLT 2X0HA 5H2FO 3Q5EA 1UUSA 2N1GA 2JQKA 4AYID 1YITP 2M3EA 1SQVJ 3W68A 1RE4C 1NAYA 3P8MC 1HS7A 1VDFA 5K5GB 4IL6E 3L39A 3AAAA 3WAKA 1BCCD 1ZP0C 1BDCA 3BCCJ 4H44B 3K5BA 4JUYA 2E76D 1J2JB 2LHRA 3VMYA 5ABEA 3VP8A 3PRNA 4LF5T 4I43B 2IPPA 4FSOA 5KLVE 1SQVD 4FMSA 3JC6D 1NU1K 3A5XA 3BCCD 5JDGA 2W90A 4DR1T 2NPSB 3LIDA 4H9NC 4LMJA 1GMJA 2R44A 1BR1A 2M6BA 3RF1A 1RY3A 2X0LB 2QA7A 4UB6E 4ISSA 4IHJE 3B8EB 5CCGA 4GIFA 4FZLA 2YNYA 1RF1C 3CX5I 4DUYT 3MZKB 2OYOA 3WI4A 1EDJA 1EZVE 2BG9A 2FGQX 4ASKA 3TLUA 2RN0A 3GF7A 4PD4D 5APUA 1HGVA 5AFUK 2QSIA 2M5AA 2UUCT 4BJMA 1ZRTE 2ZM2A 5HXHA 3AXJB 2IDOB 1SA0E 1WLXA 4JI4T 3UU6A 4C7NA 1P84I 4ZKUA 4IL6H 2O1JA 1W9RA 1T3UA 2C9NY 2QM7A 3RK3B 1FS0E 3HD7A 4N6JA 3FWNA 2ACZA 1Y64B 2KT9A 3POXA 5AFUL 1WRGA 3KVDD 1NAFA 1N86A 3ZEFB 4CXWA 5DL5A 5AVTB 2RKLA 5HEJA 4NXNT 2A3DA 2OYHC 1NTKG 2ZT9D 3BRTB 3RKGA 2BCCG 4AISA 2KDYA 3JCUO 1JY3P 3OA7A 3B5NB 3BRVB 5JDQA 4UB6H 4GCPA 1Q81Q 3ABVC 1SP4A 4EOZB 3NMDA 3NKZA 4I4TE 3N2GE 1ZKEA 1Q82Q 2Q3EA 2HN1A 4GT1A 1FEWA 2BZBA 2WB5A 3GG2A 2JIWA 5AQUB 4PV1D 3SYSA 5LB7B 4QXBB 3IF4A 4ANJA 1G73A 5ETWA 1AA0A 2P10A 2DLRA 5AW2B 2PJQA 4GK5E 1OW7A 3PQSA 1IFNA 3LK3A 3ZLIA 1SUMB 5JRCA 5LA6E 1DEEG 5EZYE 2KZ7A 5JDFA 2FYUJ 1WFDA 3X1DA 4PV1C 2R8AA 4D6TG 2ZVNB 3H1KJ 2E74B 2XDJA 3L70G 2H7OA 4YLHA 4GOEA 1VQNP 1W0BA 2E2AA 3L35A 3WU2E 2YU1A 4EI2A 4WBNE 5AW1B 2SPZA 2YINA 2QM8A 3L36A 1OEDC 4UXNB 4PK6A 2FYUD 1YJNP 2MPKA 3H1KD 4U72A 5B5EE 2XMXA 3RK2B 4I7ZB 1ZR4A 5AW8B 1L4AD 1PIXA 5JR9A 2W67A 3ZYKA 4YTMA 1JY2O 3MD0A 3CQCB 4GYRA 2XTLA 1LWUA 3G4SP 1VCSA 3SWHA 4ASWA 3CCJP 1JCDA 2A45G 1HWTC 2EHOB 5L8RJ 2XQYA 5AVRB 3HL6A 1L4AC 1IO4A 2HPCB 3CKDA 2KS1A 2C5JA 1BXWA 2LSIA 4O49A 3DTOA 2XE1A 3L75G 2BBHA 4HE8A 2I8DA 3HOLA 4ADZA 4TNWA 5ABFA 1D0XA 2K1AA 3AECC 4HKAA 5FKYA 3PURA 3G7GA 3M3ZB 4G76A 2K9AA 3Q2MA 4KMCA 3PUSA 3C1LA 3OBVE 3AVRA 2XQAA 5KLIC 4A7PA 2YOEA 4E7ZA 3SZDA 3V5UA 1HJBA 3WU2H 1SQBK 2JQQA 1SQVG 3PUVF 3VRBA 2N1TA 1K05A 4TUYE 1MUUA 5AQPB 1JB0J 3BCCG 3MP7B 4AYMC 2IUBA 3TZGA 5B5EH 3GHGC 4GOFA 2BKNA 4EDFA 4ZHQE 1N73C 3M0DC 5LJNA 1YKEB 1RE4A 4JI5T 1CUNA 1NHLA 3PJSK 2PP6A 5AQTB 4ILBA 3A0HH 5IHYA 3UU5A 2CA5A 3AA6B 3ANWB 5FXWA 3AE2A 5L4HA 4U7JA 2FXOA 5KLVK 5APWA 4AKGA 4B3MT 3QWOC 2XASB 4Z8XA 3SOLA 5ABGA 1HX8A 4O2AE 3HE5A 3PP5A 3PUZF 4IT4A 1FZGA 4EZHA 2LKHA 1KN7A 3N7NA 1IBMT 3WUTA 4UVBB 1U5PA 1ZR2A 2DHRA 2PRNA 4H0LD 4PJMA 5CCHC 4HFVA 1OX3A 2WM9A 1NYHA 1X22A 2LJLA 1DD3A 2P9BA 5G38A 1RF1A 4LSFA 4U2YA 3SWYA 4N59A 4KI0F 3AEBA 3H1JJ 2XAHB 1ZHWA 3T97A 1KF6A 4AUIA 5JH7E 1VRBA 3OTOT 2M07A 1FJPA 2KMFA 4H0LC 1EZVI 5CHXA 3S1KA 2V7LA 1SQQD 4U3FE 5G39A 1KB9E 3ZMVB 1DH3A 3TNUB 3H1JD 2WITA 2X9XA 2YU2A 1MV8A 3G71P 3AEEC 1N33T 2PTFA 2B76A 1QUUA 3BK9A 1E79H 1KNZA 1GW3A 4WBOA 4CN1A 5LHHB 1HUCA 3GN5A 4YXDA 3O0EA 3M9QA 1PPJE 5KTBA 2R4OA 3ZCJA 4OX9T 4DBRA 2C9LY 3FX0A 3L73E 4U31A 2B88A 2Q9QB 3F31A 2Y0LA 1OFCX 4I0UA 2QJPC 2WPQA 2MYSA 2K9JA 2OMFA 2Y0KA 2JQHA 3E7KA 5KAIE 3CIRA 2H88C 4FI5A 2LRLA 1XNQT 1MIYA 5B66E 5C8YE 3L4FA 5AVSB 1IC2A 3TGUJ 4NUVA 4DR5T 3SFDA 3U3IA 2AE9A 1LT9B 2IBZE 1AQ5A 4WB4A 2K5BB 4AQGA 3H1KG 5LGNB 2XKMA 2HLOA 3TGUD 2R4NA 3ZSTA 1B7TA 3II6A 1KB9H 3ETUA 4LSIA 2OV9A 2WMOA 1Z0PA 2XAJB 2XQ6A 2PFXA 2W66A 1JY2P 2YXRB 4P1NA 1XZYA 1Q2NA 2A9UA 2XSBA 1NJIQ 1M90Q 2X9WA 3PU3A 4IGUA 3A7OA 5AW4B 2Q7CA 2XE2A 4K3BA 4UR9A 4I55E 2ODJA 4U3CA 2ZM0A 2IMLA 5L3EB 2WPSA 3L72J 3P8CE 2FFDB 3C8VA 4HFIA 4DUZT 1R5SA 1EDKA 3K3NA 5B5EO 1WCRA 2V1DB 2LR2A 4N78E 1BGYE 2H7VC 4G63A 4PAGA 2FJDA 4BRYA 1ORMA 4N3YB 3AA7A 3PJAA 3SSUA 4QX8B 5KAIH 1M1JA 4YHHT 1URQD 1S3JA 2CLYC 3L72D 1BH3A 3A0HO 2LEHA 3UUNA 2Y0DA 2R4PA 2J1NA 1NGMB 4AQRD 5B66H 4H63H 4IFFA 3H37A 4PK4A 1USDA 3RYFE 5DL6A 5FL1A 4G75A 3KPEA 2HHHT 1URQC 2X9YA 3F57A 2DNXA 3FHNA 3NTNA 4MBQA 1G2CA 3ZDMA 1N2DC 2ZLYA 2E76B 3O6QA 4JI6T 4NUUA 2YKQA 5F3JA 4IDZA 3VR8A 2NRGA 2ZYDA 3LJCA 5CJ5A 4Q25A 1IZNA 4FRXA 1GL2D 1J5ET 3G9RA 1Y9BA 5FVKA 1NH4A 3M9HA 1CW5A 4DT0A 2H7HA 4PJLA 4UF0A 2UXCT 2JMMA 1S9KD 5EK4A 4AI6A 4OHFA 4YY3T 3HRNA 4H9QC 1GL2C 1N73A 1LTIC 1PGJA 2E5LT 2E5VA 1MFZA 1FOSE 3K8PC 2B1EA 4M3LA 3W67A 2C5KT 2ZFCA 5JTGA 3BRZA 4JYBA 4ZS3A 3HR0A 4HEAA 1HXXA 5DL8A 4KR8A 5DL7A 2MKVA 1NTZJ 1UURA 3ESLA 4IE6A 4FUVA 2R4LA 4ZOLE 4DV3T 1KNRA 2K4TA 5JDPA 4JI2T 1PP9J 2HYNA 2HODB 5LP6E 1NU1J 1UGOA 4PJ0O 4OFZA 1NTZD 1SQQG 5J2TE 1MNDA 5CCGD 2OYHB 1HG2A 1KK7A 4Z90A 2E5YA 4DIDB 3H1JG 1NTME 5CCHA 1PP9D 2FY8A 4DOJA 1NU1D 4HFCA 3KHUA 1SQXK 2O1KA 1IFPA 1VL2A 4O4IE 4WW0A 1UIXA 4TZ4C 4TV8E 4AYDC 3IEEA 2KLUA 4IL9A 2KUBA 3NVOA 2LSJA 5CCGC 3PRJA 2ZT9B 4U74A 3H1HE 2A06E 3L74D 2YKSA 2NR4A 3V4QA 2YIUC 4A98A 3CX5D 1H0TA 3U59A 2BG9C 4E1TA 1BSNA 3B4SA 2X9KA 1AQTA 4LLHA 1J1DB 2RMZA 3HD7D 3ZT5A 1KB9I 4QKNA 2XTQA 1RH5B 4W7ZA 1GQEA 4HWFA 1K9MQ 3ZJ1A 5C2TA 2XQ5A 4PV1B 2Y0CA 3E1RA 4GODA 5HXRA 5JDNA 4GKGA 3BQIA 2XNDH 1P84D 2XUEA 5AQIB 2D2CD 3VMZA 2HFED 3KBTA 1OEDB 1JTHA 1XWMA 2L8KA 3HA4A 4BUMX 5T5FA 3VP9A 3M0AA 2XZRA 2IW5B 3UQ4A 1EXIA 4PUXA 2R3CA 3UQ7A 4DR3T 1MM5A 3TGUG 1FMWA 3OYXA 2UU9T 2H88A 5KAIO 5H6RB 5EE2A 2D2CC 5CGMA 1S1CX 4H13D 4LF9T 4HFHA 2OTLP 2GE4A 1S94A 4PW8A 5F8PA 2YDSA 4R4MA 4KR4A 2LSYA 3ONXA 5AQOB 3Q1MA 1SFCA 2KSEA 1NTKJ 1FZFA 5LNKA 1US7B 2CBIA 5IYZE 2XY8B 2I0MA 3UULA 3RL0D 3V2NA 4CN6A 1GFMA 1X0TA 1L4AB 2MNHA 5HXSA 2VKOA 1LP1B 1YW0A 4H13C 2I6HA 4V1Av 5DJUB 4AYEC 1M1KQ 3AVSA 3ZMTB 1NTKD 4OGQC 2WP9A 3EMNX 6PRNA 5DJQC 4ASVA 1PGOA 1UX4A 1IFIA 2KZIA 3L72G 4NPPA 2LKGA 1JY3O 2I1KA 5LYJE 2VKHA 4HFEA 4QH4A 5IWAT 3CXHI 3CX6B 3BVHA 4DV2T 1LVFA 4FT6A 2WSFJ 1HBWA 3C4ZA 4QWNB 4DR6T 2ZXXA 2M0BA 3RX6A 2M6IA 4MALA 5AVYB 3BATA 2FYZA 2V5DA 4ZNCA 2JO1A 3GHGB 2LSGA 1HFAA 1PZQA 2E75C 4UEMA 3LK41 3UTKA 4XA4A 5TISO 3I9YA 3QH9A 4LF7T 2Y2XA 1KYOI 5AW7B 5ADXL 1WT6A 3R84B 1N7SA 1M8OB 3TSIA 4EOTA 2XM2A 1OSMA 4QX7B 3RRWA 3M65A 4ZZCA 2J4UP 1GZLA 2WVPA 4IIJE 4COFA 1G1JA 4D6TE 2ZJSE 3LK2B 1MPFA 3Q5RA 3L70E 1TU3F 5CBOA 3SY7A 2V7JA 3RH3A 1IJ5A 2PRRA 2N1TD 2ZM8A 3E08A 1ZV4X 5J2UE 4O3YA 2Q6QA 3MA9A 3G06A 3M06A 1EDIA 3RC8A 1SQBJ 2X27X 4C90A 3SFEA 2DW3A 2J47A 4YT0A 5HXEA 1VPCA 4CXYA 4H0LB 3R2PA 5AQFB 1NTZG 3CCVP 2KINB 4KT0J 1SQBD 2Q3IA 3ZJ2A 5AQJB 4TWFA 3GA8A 2YDQA 1PP9G 1OIPA 1NU1G 3PQUA
chains in the Genus database with same CATH topology
2YK0A 4EYUA 3ZYKA 3NRYA 1HXTA 3O4XE 4IE4A 3VE1A 5FNVE 2YPVA 1G8XA 3CQCB 4GYRA 2XTLA 5LBQB 1OPFA 5H6QB 3SWHA 2EHOB 1D1AA 1H6S1 4O4JE 3SYBA 3PTRB 2XQYA 3HL6A 5FYMA 3EUHA 3S4UA 4X1IE 3CKDA 3ZMSB 2C5JA 1BXWA 2W61A 2LSIA 2WAUA 3HKDE 3JTYA 2RP4A 4O49A 3DTOA 2XE1A 4HE8A 3IHRA 3HOLA 3QUJA 4ADZA 1D0XA 4GOUA 4KP3C 2JMKA 4C69X 5GONE 4HKAA 1MMAA 3KV9A 3PURA 3UUXB 3G7GA 4GHBA 2IAKA 4QHOA 4G76A 3C4WA 2K9AA 3P7IA 3ZMZB 2EHOA 4KUMB 3WI5A 2PG8A 3Q2MA 4KMCA 3AA7B 3PUSA 2ERVA 4RLCA 2X66A 3OYZA 1MMGA 3C50A 3OBVE 3AVRA 4IE5A 4N78D 3ZN0B 2IC9A 2L9QA 3NBXX 4E7ZA 3SZDA 2E9XC 3V5UA 4QXCB 4O3ZA 4DBQA 2LSKA 1GFQA 2JQQA 3TKLB 3HKBE 3BQLA 5HXCA 4E7SA 2CEAA 4TUYE 4EYYR 4AQFA 3N2OA 4OK0A 4HN9A 2F1TA 2CWYA 4AYMC 4H63V 3UUMA 4JEHB 4DMWA 3TZGA 4OYKA 2G0UA 4ZHQE 4UV8B 5KX5E 5LJNA 1YKEB 5DABA 3NSGA 1CUNA 4RJWA 3T8OA 5LXTE 3VZUX 3IBPA 3ZYMA 4XBFB 3RYIE 1LVKA 3K3OA 4CI1B 2ZLDA 1S35A 1VOMA 5LOVE 5IHYA 3SRZA 3RKOA 1FIOA 1NWMX 1IZNB 2CA5A 3AA6B 3ANWB 3PUAA 5FXWA 4YFSA 3WAJA 3C64A 4UVAB 2M67A 2RA1A 4AKGA 4P0AA 2E9XB 5HWXA 2XASB 4Z8XA 3SOLA 3CQGB 4AXPA 1E1HB 3RRCA 1HX8A 4O2AE 2X67A 2ES0A 2YNKA 3CX7B 4UF0B 2VKJA 2OA5A 4EZHA 2CCQA 3ETVA 3HW9A 3CX8B 2ZMAA 1MIVA 3VKHA 1YS5A 4CQIA 2VKDA 1U5PA 4UVBB 3VZTX 2DHRA 2PRNA 4H9OC 3DP7A 2D5UA 5J1GA 4EB6E 4ZI3D 1E54A 4PJMA 2CLYB 4HFVA 3PE0A 2WM9A 2E8IA 2LJLA 4FJOA 2P9BA 4J2CA 5L3FB 4X20E 4LSFA 4PFPA 1WRDA 4C91A 4N59A 3ZYLA 4IE7A 3KV6A 3NZPA 4O4HE 2Z6EA 3GP6A 2XAHB 4PFOA 1ZHWA 1MIWA 4AUIA 5JH7E 1VRBA 3RYCE 3D0TA 3FB2A 2M07A 3J9X1 2KMFA 3GN5B 2EHOD 3LBXA 4O4LE 2V7LA 4L0RA 1X79A 2ACXA 3POQA 3KINB 1ZHYA 4OYJA 3ZMVB 2VL8A 3BQKA 2W63A 2KWHA 2X9XA 5JDMA 2YU2A 4BA9A 3N9QA 4UVCB 2W0GA 3C4XA 1EZ3A 4AKRB 5FY7A 5E0OA 1QJ9A 2PORA 5IYUA 1QUUA 3B57A 3BK9A 1WYBA 5LHGB 1KNZA 3KVAA 3ZCIA 4WBOA 4UV9B 3PORA 5LHHB 5FXZA 4TV9E 3GMIA 4AZLA 3GN5A 3KDSE 4CXXA 4X1KE 5FY0A 1QJPA 2XE3A 3O0EA 5D5DA 3OKQA 1D1BA 3ZCJA 3CVRA 4DBRA 3SZVA 2JJ9A 1U4QA 2NW9A 2Q9QB 3F31A 3MACA 2Y0LA 3Q5XA 4N58A 5LG4A 4CI3B 2NTXA 1ZHTA 2MYSA 1ZHCA 2OMFA 5JVDE 2Y0KA 4YJ3E 2BDEA 2KC0A 4GYSA 3ZN1B 3EDVA 4FI5A 2DWGA 3U78A 3EDUA 1ZHZA 3VY9X 2LT3A 1MIYA 2LE8A 5CB4E 3NRXA 5L2LA 3POUA 3I1AA 3VKGA 3F2EA 2CE7A 5C8YE 2H3RA 3AAEA 4O3XB 3AAAB 3CWZB 4NUVA 4DMVA 1Q9FA 4D65A 1GFOA 2V7IA 2VWAA 3U3IA 4AFKA 2UXNB 4TN7B 2K5BB 2PFVA 2Y6XA 3FBZA 3HKEE 2Y0HA 4AQGA 2WMNA 4AKMA 5LGNB 2XAQB 3VY8X 1B7TA 2E9XD 1T98A 3ETUA 3DA3A 4LSIA 2WMOA 4I50E 4JFBA 1Z0PA 2XAJB 2A2FX 3T24A 3ZC0A 4Z3TA 3GWHA 2VB6A 4H9PC 4GK0E 3UPGA 4GCQA 3AA1B 1LKXA 3HKCE 2HPJA 1D1CA 4FZNA 4ERRA 3DA4A 2X9WA 3PU3A 5L3GB 4FZMA 4IGUA 4E1SA 4L5GA 2FGRA 2CWOA 4BAYB 2K24A 1OXZA 2XE2A 4WNKA 4I55E 2ODJA 2ZM0A 5JQGE 1UCUA 5TAOA 5L3EB 2NOXA 2I59A 2CXDA 1QJ8A 3VHLA 1ZEEA 2MTQA 4B61A 3K3NA 2V26A 2V1DB 4ZS2A 2C0SA 2ZFGA 4G63A 2H7VC 5FP3A 4PAGA 4JCHA 4DO0A 1ORMA 2N2LA 2DCFA 2X9HA 3AA7A 4RL9A 4QX8B 2PBIA 4X1YE 5KDMC 2F1VA 1HXUA 2CLYC 3QK6A 2Y8DA 3L3PA 3QC9A 5HWYA 3JC6C 1BH3A 2LEHA 3UUNA 2HH7A 2J1NA 4U9CA 4H63H 1MNEA 5DQWA 3H37A 3HWBA 4PK4A 1MMDA 3I9WA 2C5IT 3RYFE 5DL6A 2BVLA 1BT9A 3ZMUB 4UELA 4GCSA 1WYCA 4G75A 4ZI7E 2W81C 4M1PA 3E0ZA 1D0ZA 2QGSA 4BJNA 2NW8A 2X9YA 3CPZA 2DNXA 3F57A 3FHNA 4MBQA 2V7KA 4LSHA 2DWKA 1IJ6A 2J1DG 4F6RC 2ZLYA 4NUUA 5F3JA 4IDZA 2NTYA 5KMGP 4O8SA 2CMRA 3LJCA 4IE0A 4EAHA 1IZNA 3ANWA 3AA6A 3KFWX 2Q9QD 4AKHA 2XAGB 4FRXA 5JDHA 3FXDB 4XNLA 3PDYA 3KV5A 2W80C 3CMLA 2E9XA 1SHZC 4RJXA 2N9DA 4CZZB 4KRAA 5EK3A 2W62A 5ADXK 3E22E 4PJLA 4UF0A 2KXPB 3VE2A 1PHOA 2JMMA 5EK4A 4AI6A 2Q9QC 4OHFA 4FESA 3AAIA 4A56A 4H9QC 1BR4A 4GIWA 2N2MA 4ZI2C 4K0UA 3C98B 3C51A 4EXTA 3B13A 2LHNA 3K8PC 2B1EA 1V9DA 3O1HA 1HF8A 1H7CA 2C5KT 2ODVA 3AA0B 3IF8B 5JR9C 7PRNA 5L3BB 4ZS3A 3HR0A 4HEAA 5LBMA 1HXXA 3LFMA 4KR8A 4O4XA 5M4YA 5DL8A 5DL7A 5JRCB 3MK7C 1QSDA 5FY1A 2XAFB 3FBLA 4ISTA 8PRNA 4MLKA 3ESLA 4PJNA 4IE6A 4FUVA 2A72A 4ZOLE 1HTJF 3FYXA 4AYNA 3Q5WA 2K4TA 5JDPA 4HGAA 1P4TA 2WSSV 5FVNA 2W00A 3O1IA 2LFUA 1FMVA 5LP6E 3V8UA 2X68A 2XG6A 3HOEA 1GFNA 3N9LA 4OFZA 2YEVC 4O3WA 2K0LA 5J2TE 3AA0A 1MNDA 1HG2A 1KK7A 2KLQA 4L9IA 4AKRA 3T0SA 4D5UA 3QRCA 3RYHE 1WR6A 3PUQA 2MHLA 5BMVE 3RPUA 4B6XA 4FOZA 5GV0A 2BVMA 2LOPA 4PJJA 2CXLA 5G26A 3SY9A 1OWAA 4XNKA 3RC3A 4UIGA 4WW0A 4O4IE 5JR9B 4GF4A 4O4UA 5A1LA 3VZWX 4P0BA 4TZ4C 4TV8E 3N2KE 2CM0A 3IEEA 1Q9GA 4AYDC 5CA0E 3KBUA 2XTRA 2LSJA 4U74A 2Q9QA 3W15B 2D2SA 1HG5A 4TX5A 2SPCA 3N9PA 2NP9A 5HAXA 3PUGA 4AQFC 1THQA 4E1TA 3O9XA 2D0UA 4DVDA 3K19A 3N9OA 4XAXB 2N1GA 1D0YA 2ODUA 5LGTB 4EIWA 4AYID 4QKNA 1IAPA 1HS7A 2GK9A 2XTQA 5LCYA 3AAAA 3WAKA 1GFPA 3ZJ1A 2Y7SA 5JDNA 4JUYA 5HXRA 2LHRA 3BQIA 2QTKA 2DI4A 3PRNA 3LG7A 2MOZA 4I43B 2XUEA 4ILUA 4FSOA 2VK9A 1LRZA 5DQVA 4FMSA 3A2SX 1BR2A 2JPFA 3JC6D 3KBTA 2K48A 2L8KA 3HA4A 3UAQA 4BUMX 3A5XA 5JDGA 2IW5B 5L3CB 5T5FA 4LSEA 4PUXA 4JEUB 1MMNA 3FXEB 2D0TA 4H9RC 3UT5E 1MM5A 1FMWA 3I0QA 3MXZA 3OYXA 4YHJA 1AJ3A 4H9NC 5FMNA 3QRAA 3AA1A 3R6NA 5LJMA 1BR1A 5H6RB 5EE2A 3P8CD 5JDLA 2X0LB 2QA7A 3EVYA 4ISSA 4DNDA 2GE4A 3J7Yq 1S94A 4IHJE 4RLBA 4PW8A 5F8PA 4KR4A 2LSYA 3ONXA 3UFEA 4FZLA 5LNKA 3MZKB 1US7B 5IYZE 3N5LA 3UULA 3WI4A 2M06A 1GFMA 1ZHXA 5LHIB 2MNHA 2FGQX 2JRKA 5HXSA 2VKOA 4ASKA 1YW0A 3WI3A 4AYEC 1O3XA 4V1Av 2WWUA 3PU8A 3ZPOA 3N9NA 1BR0A 4FRTA 3AVSA 5AFUK 3ZMTB 5PRNA 4BJMA 3EMNX 2ZM2A 4QXHB 2NW7A 5DJQC 5HXHA 4AKLA 3HI2A 6PRNA 1SA0E 2X51A 1WLXA 1G90A 1UX4A 5FXVA 4EZ4A 3K3QC 4D64A 5CA1E 5LYJE 2VKHA 4KBMB 4F4BA 4ZI2D 2L3LA 3OJAA 3CX6B 2CXFA 2KNDA 1LVFA 4FT6A 1Y64B 4G2AA 2KT9A 3C4ZA 4QWNB 3POXA 1YKHB 5AFUL 4PK5A 3KVDD 3ZC1A 1NAFA 5JREA 3ZEFB 4CXWA 5DL5A 3RX6A 3L09A 4MALA 3H3AA 2IC6A 2A3DA 4PNIA 4YJ2E 4AKIA 2LSGA 1HFAA 3LBXB 4MHCA 4UEMA 2KDYA 3LK41 3UTKA 3RBHA 3DJBA 2WBLA 2LOSA 3I9YA 5JDQA 4GCPA 4H9SE 2Y2XA 3I0OA 3N9MA 4EOZB 3LK3B 3MKDA 5ADXL 3NZQA 4HTEA 5LGUB 3KVBA 4I4TE 3R84B 2KXPA 3V5SA 3N2GE 5FXXA 2KZ7B 1ZKEA 2LM9A 3O1JA 1OSMA 4QX7B 3RRWA 2JMHA 3Q9DA 3M65A 1FEWA 2BZBA 3KV4A 4ZI3C 2J4UP 3SYSA 1PRNA 4QXBB 4CI2B 4IIJE 3CQXC 4ANJA 1G73A 2NWBA 5ETWA 1MM4A 3AB3B 3UU2A 3LK2B 2DLRA 2KWIB 1MPFA 1UX5A 2PJQA 4GK5E 3SY7A 3PQSA 3MJXA 4XZCA 3LK3A 3ZLIA 2V7JA 2UXXB 1IJ5A 3RH3A 5JRCA 4O2BE 4P09A 5LA6E 3VU7H 2LHFA 5EZYE 2ZM8A 3E08A 5JDFA 1ZV4X 2XHEB 2KZ7A 5J2UE 3C5OA 2EHOC 2HPLA 3T20A 4O3YA 3MA9A 5HYAA 2H7OA 4YLHA 2YU1A 5L3DB 4MFRA 4WBNE 3RC8A 2MBGA 2YINA 3AAEB 2VASA 2O4VA 2X27X 3SS1A 4C90A 3LK2A 2V7MA 1HCIA 4UXNB 4JLEA 4PK6A 2XE5A 5HXEA 3LK42 4CXYA 4U72A 2XMXA 2KINB 2Y48B 4FSPA 5EK2A 2N2NA 3ZJ2A 1YD8G 5JR9A 3GA8A 4QQ1A 3PQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAA A;  2KZ7 A;  3AA1 B;  3AA7 B;  1IZN B;  3AA6 B;  3LK3 B;  5ADX L;  3AAE A;  3AAA B;  2KXP A;  2KZ7 B;  5ADX K;  3AAE B;  5AFU L;  2KXP B;  3AA6 A;  3LK2 A;  3LK4 2;  3AA0 A;  5AFU K;  3LK2 B;  4AKR A;  3LK4 1;  3AA1 A;  3AA7 A;  3LK3 A;  1IZN A;  3AA0 B;  4AKR B; 
#chains in the Genus database with same CATH topology
 3NRY A;  1HXT A;  3VE1 A;  3OVU A;  2YPV A;  5AQN B;  3M91 A;  1VQL P;  1OPF A;  3USS A;  3L75 E;  2WSE H;  3E1I A;  1H6S 1;  3AE2 C;  3AE5 C;  3L74 G;  4X1I E;  3ZMS B;  2PAJ A;  2B87 B;  3D70 A;  1NOH A;  3JTY A;  1BCC E;  2QJP B;  1NTM K;  2Q1K A;  2JMK A;  1PL5 A;  3RHW A;  4C69 X;  1LTJ B;  2IAK A;  4QHO A;  2WPV B;  2OYI C;  3P7I A;  1OW8 A;  1SQV E;  2EHO A;  3WI5 A;  2PG8 A;  3JCF A;  3A8Y C;  3BCC E;  3ZT6 A;  1FZA A;  2IDB A;  2IC9 A;  2K37 A;  2E9X C;  1AVO A;  2QJY C;  5GTH O;  1GFQ A;  5CBN A;  1XTC C;  3HKB E;  3BQL A;  3AEB C;  3UU4 A;  3FXE A;  5KKZ C;  3RGL A;  3AE9 A;  5HEO A;  5AQR B;  3U1A A;  1T2K C;  4JEH B;  3TLW A;  1JM0 A;  4DMW A;  5AW3 B;  4OYK A;  4A97 A;  4UV8 B;  2A45 H;  3EWK A;  3IBP A;  3ZYM A;  1XNR T;  3FZF B;  1S35 A;  1VOM A;  4ILA A;  5LOV E;  3FZL B;  3RKO A;  1FIO A;  1ZRT D;  3WAJ A;  5C3J A;  3NJT A;  4MN4 C;  2RA1 A;  2JEE A;  4P0A A;  3TK1 A;  2KSJ A;  2UXD T;  1NEN A;  2W8Z A;  3A2A A;  3CK6 A;  4AXP A;  4YXD C;  2BEQ D;  1L0N E;  2YNK A;  3Q3D A;  3IFM A;  2VKJ A;  3ONJ A;  3HW9 A;  1MIV A;  1ZME C;  3VZT X;  3DP7 A;  4JV5 T;  3UU8 A;  1J5W A;  2D9D A;  1E54 A;  1VQ9 P;  1BDD A;  2CLY B;  3PE0 A;  1RQV A;  4XE5 B;  1CI6 B;  1T72 A;  1FZC B;  5L3F B;  3CPW O;  4B86 A;  4PFP A;  1WRD A;  4C91 A;  3H32 B;  3GP6 A;  5APS A;  2Z6E A;  4PFO A;  1MIW A;  3SFD C;  3J9X 1;  2GM4 A;  1AJY A;  1E7P A;  1HR0 T;  1URQ B;  2WT7 B;  3LBX A;  1X79 A;  3KIN B;  4DV5 T;  2B89 A;  2K88 A;  3K1S A;  4OYJ A;  3WUV A;  2VL8 A;  5AQM B;  3DWO X;  1EQ7 A;  3D6Y A;  2V8S V;  4KHP T;  4BA9 A;  4UVC B;  3N4X A;  1VQK P;  3IAO A;  1EZ3 A;  4AKR B;  2HG5 D;  1RQU A;  3PJA J;  2VUR A;  3EAB A;  2QA4 P;  1R8I A;  3ZCI A;  2ZXE B;  3POR A;  2XU6 A;  5FXZ A;  1FC2 C;  5D5D A;  3IR9 A;  1QJP A;  3CVR A;  3MAC A;  2VL0 A;  4N58 A;  3Q5X A;  1GL2 B;  2W27 A;  3I56 P;  1SVF A;  5AQQ B;  1ZHC A;  4TNV A;  4IDP A;  3O8Z A;  4YJ3 E;  2KC0 A;  2LT3 A;  3A0H E;  1M1J C;  2FYU E;  2BKP A;  4JI0 T;  3PGR A;  3I1A A;  2FKW B;  4RO0 A;  3H1K E;  3VKG A;  2CE7 A;  4B3R T;  2H3R A;  3AAE A;  3AAA B;  1SQP J;  3IN6 A;  1GFO A;  3SWK A;  2VWA A;  2W4X A;  5IUX A;  4AFK A;  4NPD A;  2H8P D;  4Z1M H;  4TN7 B;  1QEX A;  3FBZ A;  2Y6X A;  3T1H T;  4AKM A;  1SQP D;  1KIL E;  1SQB G;  1U7J A;  3GWH A;  3FWL A;  2VB6 A;  3TDK A;  3HKC E;  2UWJ E;  4OWF A;  4QH5 A;  4K0K T;  1FJK A;  4E1S A;  5L3G B;  2Y9Y A;  3VTP C;  4FZM A;  4L5G A;  2FGR A;  1HH0 A;  3EHZ A;  4BAY B;  2K24 A;  1OXZ A;  2J5U A;  4WNK A;  5AW5 B;  3PUW F;  5TAO A;  4OVN F;  4DZO A;  2CXD A;  4X62 T;  3VHL A;  2MTQ A;  3V6I A;  2BG9 B;  2V26 A;  5AQL B;  2C0S A;  2ZFG A;  1Z56 A;  5FP3 A;  4DO0 A;  3RIA A;  1EC5 A;  2F1V A;  2M5A B;  3H1I J;  3KDP B;  3QK6 A;  1YTZ T;  1CHU A;  2Y8D A;  3QC9 A;  5AW0 B;  5J0Z A;  2AXT O;  4WY4 A;  1NKN A;  2YMY A;  2WDR A;  4C7N B;  2N9Y B;  2QRX A;  3H6P A;  4U9C A;  2FFD A;  2C5I T;  3AE5 A;  3EAM A;  2BVL A;  2R3S A;  3H1I D;  1KNP A;  4LMK A;  4R4L A;  3HD7 B;  5CCH D;  2W81 C;  4N75 A;  4RES B;  3RI5 A;  4JQ0 D;  2NW8 A;  4LSH A;  5APT A;  3CPZ A;  4PJ0 E;  4JI3 T;  2XPK A;  2DWK A;  5AQV B;  1VQ8 P;  2GA1 A;  4F6R C;  3F89 A;  2UXB T;  1EZV G;  3NXS A;  2OYI A;  2NTY A;  3B71 A;  1SQV K;  4KHX A;  4EAH A;  4AKH A;  2D2C B;  4XNL A;  4C46 A;  1JO5 A;  2W80 C;  3CML A;  4YTN A;  1SQX E;  3AE4 A;  4HWD A;  2E9X A;  4PR7 A;  1SHZ C;  3RIF A;  1SQQ J;  4GKK T;  3CWB E;  2G3A A;  2P7J A;  2QEX P;  3VE2 A;  4IDN A;  1FDI A;  1KZU B;  1YHQ P;  3PUY F;  4A56 A;  2R5D A;  2WZ7 A;  3BAS A;  3HUS C;  4H13 B;  3L8R A;  4ZI2 C;  1KQG B;  3IF8 B;  1H7C A;  3AA0 B;  7PRN A;  3UIA A;  1N7L A;  3RL0 B;  5JRC B;  3MK7 C;  4K3A A;  1JNM A;  1QSD A;  5FY1 A;  4DCK A;  4IST A;  4MLK A;  1A02 F;  2A72 A;  3H1J E;  4ZMD A;  3RQU A;  3AE6 A;  4Y99 C;  2W00 A;  2R89 A;  2WPR A;  1FMV A;  2IHR 1;  1L0N K;  1NO4 A;  1GFN A;  2YEV C;  4JBZ A;  4PJ0 H;  2FXM A;  4EGW A;  1ZV8 A;  2RH0 A;  4B3T T;  1PPJ D;  4L9I A;  4D5U A;  1L0L E;  5APX A;  3GLM A;  3RYH E;  3PUQ A;  1SFC D;  5BMV E;  1SLQ A;  4B6X A;  3CC4 P;  2LOP A;  3V2R A;  1YJW P;  1OWA A;  2K3W A;  1G1I A;  4UIG A;  5JR9 B;  4TWH A;  4GF4 A;  1Q9G A;  2HOD A;  1YQ4 A;  1VQ7 P;  1Y47 A;  3KBU A;  2IFN A;  2XTR A;  2YKP A;  4L75 A;  1LWU B;  2D2S A;  1SFC C;  1HG5 A;  5AQK B;  4TX5 A;  5AQG B;  2FYN C;  3N9P A;  2NP9 A;  1S5L O;  1L2P A;  3PUG A;  2QYW A;  1X9V A;  4AQF C;  2JWA A;  2QJK C;  2NPS C;  1W0A A;  3O9X A;  3P4R A;  2KS1 B;  4XAX B;  2ODU A;  3AEF C;  5LGT B;  5ABF B;  1PGP A;  1IAP A;  1FDO A;  3V5B A;  1GFP A;  2Y7S A;  2J58 A;  3RK3 E;  4LF4 T;  2LM2 A;  5CJ0 A;  3RBX A;  1M62 A;  2MOZ A;  3TGU E;  3LG7 A;  4ILU A;  1LRZ A;  5DQV A;  1KMI Z;  3CXH D;  3A2S X;  1BR2 A;  4Z3T A;  2K48 A;  1KOR A;  1SS1 A;  4K3C A;  1YBK A;  1KFM A;  2N1T B;  1BGY J;  1SQP G;  4H9R C;  3UT5 E;  3I0Q A;  3MXZ A;  4EYY Q;  4YHJ A;  2XNX A;  1AJ3 A;  1N7S D;  3QRA A;  1SE7 A;  3AA1 A;  3P8C D;  5TIS E;  2FYU K;  3PHL A;  4YSY A;  3J7Y q;  1BGY D;  2KLV A;  2YN6 A;  1PV3 A;  2KIK A;  1T7S A;  1GK4 A;  1IBK T;  3FGA D;  3TF5 A;  2QIW A;  1KYO D;  1N7S C;  2BBJ A;  2M06 A;  5LHI B;  3L37 A;  2UUB T;  4CTD A;  4I6M C;  3WI3 A;  1JCC A;  1IJD B;  2FUP A;  2IFM A;  3PU8 A;  3WUU A;  1A02 J;  2XQ4 A;  3N9N A;  2V7Q J;  3HE5 B;  2J4G A;  1VQ6 P;  4L76 A;  2NW7 A;  3B5N C;  3HI2 A;  3VOP A;  1G90 A;  5FXV A;  4EZ4 A;  3K3Q C;  1KFY A;  1ZN5 A;  2LXC B;  1S5L X;  4KBM B;  3OJA A;  4UB8 O;  2KND A;  2JR8 A;  2QJY B;  4I2L C;  1RF1 B;  4G2A A;  3H1I G;  1YKH B;  1UII A;  2V6Y B;  4PK5 A;  5JRE A;  3L09 A;  1KIL A;  3T97 B;  2WQY C;  1XDP A;  3UU3 A;  3SFE C;  5APV A;  4LF6 T;  4DR2 T;  4JPZ B;  2KNC A;  3RBH A;  3PH0 A;  3DJB A;  2XQ7 A;  5TIS H;  3CCS P;  5HCJ A;  1S9K E;  4H9S E;  3N9M A;  5AVV B;  3MKD A;  3RQW A;  3NZQ A;  4HTE A;  1NEK A;  5LGU B;  4LC1 A;  3KVB A;  2KXP A;  3F5H A;  2O01 H;  2Y0E A;  5KAF O;  1BE3 J;  2CPS A;  4HKZ H;  4ZI3 C;  3KZI H;  1E5W A;  1PRN A;  4CI2 B;  4TLF A;  3VMX A;  3CQX C;  1MM4 A;  3AB3 B;  5FL0 A;  3UFG A;  4C4V A;  1FDM A;  2KWI B;  1UX5 A;  5E79 E;  3A0B O;  1BE3 D;  2UXX B;  2LHF A;  4ZZB A;  4O2B E;  4P09 A;  2K9J B;  1X9B A;  3L74 J;  1T8Z A;  3V4W A;  4IFD K;  2XHE B;  2EHO C;  3VYI A;  2XQ3 A;  1N32 T;  3T20 A;  1GTW A;  1NTZ E;  5HYA A;  1VQO P;  3LW5 J;  5L3D B;  3H1H J;  4MFR A;  2MBG A;  5GTH E;  2O4V A;  4X65 T;  1PP9 E;  1PGQ A;  3SS1 A;  1S72 P;  3LK2 A;  1HCI A;  3HUS A;  4JLE A;  2XE5 A;  3LK4 2;  3AEG C;  5M1B A;  1IK7 A;  3AE9 C;  4LFB T;  1PPJ G;  5EK2 A;  3H1H D;  2N2N A;  2A06 D;  3MZW B;  3BS0 A;  2P1J A;  1YI2 P;  2YK0 A;  3OPC A;  4IRE A;  4EYU A;  5FNV E;  3CX5 E;  4DV7 T;  5H6Q B;  4ILC A;  4ZXL A;  2J59 M;  3P4P A;  1LTA C;  1D1A A;  1OVU A;  4O4J E;  2W6B A;  3TLT A;  3HE4 A;  5FYM A;  3VRA A;  3S4U A;  4WBA A;  3H3M A;  4HFD A;  2ZAE B;  2RP4 A;  3IHR A;  1L0L K;  2WZH A;  4KP3 C;  5GON E;  1ZXG A;  3KV9 A;  1P84 E;  5BU8 B;  1NWQ A;  5E79 H;  3CC7 P;  1T6A A;  4KJM A;  3ZMZ B;  4BXL A;  4BRY B;  3AA7 B;  2ERV A;  4AIU A;  3ONL C;  3OYZ A;  1MMG A;  3C50 A;  4IE5 A;  2WMM A;  3ZN0 B;  3QOF A;  2L9Q A;  4OGQ D;  4N74 A;  3H1L J;  4DBQ A;  2GUV A;  1S2E A;  5GTH H;  2CEA A;  5F5W A;  1HX1 B;  3N2O A;  4OK0 A;  4AQF A;  2NPS A;  4HWC A;  3G3Z A;  2IBZ I;  4H63 V;  3UUM A;  2LLY A;  3S9O A;  1HGZ A;  3AE7 A;  2Z5H A;  2VQE T;  2WU2 A;  2G0U A;  3H1L D;  3AEF A;  1XDO A;  5KX5 E;  1G2C B;  2CK3 H;  3NSG A;  4RJW A;  2W6J H;  4O9B A;  4XBF B;  3K3O A;  3O6Q B;  1OMI A;  3SRZ A;  3L71 J;  1IZN B;  3PUA A;  3CX5 H;  1BGY G;  4YFS A;  1GK6 A;  3C64 A;  4LGD E;  4DR4 T;  2E75 D;  5KLI B;  1IFM A;  1NTK E;  3P4Q A;  1RE3 C;  3MGN A;  4DJG A;  2BCC E;  3PTZ A;  3GF3 A;  3RRC A;  3L71 D;  2X67 A;  2E43 A;  4UF0 B;  3JSV C;  4WVZ A;  2OA5 A;  3AXJ A;  1LTB C;  1YS5 A;  1P84 H;  1N73 B;  4H9O C;  5J1G A;  1H88 A;  4QH1 A;  4LFC T;  3KXD A;  2IIU A;  5CJ4 A;  4FJO A;  1NKZ B;  4J2C A;  3CME P;  4X20 E;  4WZX A;  5KJ7 C;  3PLN A;  3Q5D A;  3KV6 A;  4O4H E;  4W7Y A;  3KZI O;  1T8B A;  3RYC E;  3D0T A;  3FB2 A;  1YIJ P;  5HCM A;  1LGH B;  4O4L E;  4L0R A;  4HH2 A;  2IZ0 A;  1ZHY A;  2OTJ P;  3BQK A;  2W63 A;  3B5N A;  3HTK B;  5JDM A;  1CZQ A;  3N9Q A;  1QJ9 A;  4GDO A;  5E0O A;  5FY7 A;  5TJH A;  4IDQ A;  5IYU A;  3B57 A;  1XMO T;  5LHG B;  4UV9 B;  1YJ9 P;  1M7L A;  1IFJ A;  1D7M A;  4X1K E;  5FY0 A;  4JBW F;  2XE3 A;  2ZYA A;  3QNU A;  1D1B A;  2WQY A;  1U4Q A;  4WY4 D;  2LXB A;  1KEY A;  2C0X A;  2VVS A;  1H0T B;  3IA3 A;  1Q90 D;  1BE3 G;  4GYS A;  2DWG A;  3U78 A;  4DV0 T;  2KK7 A;  3VY9 X;  2OTK E;  2WU5 A;  2YDR A;  3NRX A;  5L2L A;  2R32 A;  2AXT E;  2C0W A;  3F2E A;  3CMA P;  3Q2Y A;  4WY4 C;  2BS4 A;  4RKU J;  5KLV J;  1K04 A;  1EXJ A;  1M57 D;  2FFD C;  2PFV A;  2Y0H A;  1T1L A;  2CPT A;  1JTH B;  3DZM A;  3VY8 X;  3DA3 A;  2E9X D;  1T98 A;  4C00 A;  4L73 A;  2KI7 B;  5KLV D;  3H1H G;  2A06 G;  4I50 E;  4JFB A;  3D71 A;  2A2F X;  5E79 O;  3ZC0 A;  4H9P C;  4GK0 E;  2V4H A;  3P50 A;  4GCQ A;  1VQP P;  1LKX A;  1JNZ A;  1D1C A;  1T2K D;  1NTZ K;  4CN4 A;  4ERR A;  3DA4 A;  2JJL A;  2CWO A;  2HPC A;  3AE4 C;  1KFN A;  3GMA A;  3AED C;  1BSH A;  4OH8 B;  1W09 A;  1SFC B;  3AEG A;  4DR7 T;  2NOX A;  2I59 A;  2FYN B;  4B61 A;  4JI7 T;  4W80 A;  2WSC H;  2E76 C;  2QJK B;  2JQY A;  4ZS2 A;  1T3J A;  1JMB A;  2R88 A;  2BS3 A;  1FZB A;  2X9H A;  1EZV D;  2IX7 C;  2OGU A;  4RL9 A;  4X1Y E;  5KDM C;  4XFJ A;  1HXU A;  4IOI H;  3JC6 C;  4Y28 J;  2WCA A;  2HH7 A;  3CCE P;  2WJR A;  5CMZ A;  1Q86 Q;  2AXT H;  2JKV A;  5CFB A;  5DQW A;  1J1E C;  3HWB A;  5LG3 A;  4PD4 E;  1LT1 A;  2W6A A;  2H43 A;  3ZMU B;  4GCS A;  1GW4 A;  1WYC A;  2KZJ A;  2ZYG A;  4ZI7 E;  1L0N J;  2XJ7 A;  2QGS A;  4A5X A;  1RF0 A;  4BJN A;  3AE6 C;  2V7K A;  2J1D G;  1IJ6 A;  1HNZ T;  3H1L G;  4O8S A;  2CMR A;  4IE0 A;  3AA6 A;  3ANW A;  1L0N D;  3ZT7 A;  2XAG B;  1PFI A;  5JDH A;  3FXD B;  4Z91 A;  1L0V A;  1DX7 A;  3KV5 A;  4AUW A;  2HN2 A;  3CCQ P;  4RJX A;  2N9D A;  4CZZ B;  1KD1 Q;  1Y01 A;  3D6Z A;  4CPG A;  4AYC A;  1YQ4 C;  3E22 E;  2AEM A;  1N7S B;  1J1J A;  3AE8 A;  3L71 G;  3P7K A;  4FES A;  5AVZ B;  1S5L E;  2BKO A;  4GIW A;  3VN0 A;  2RPA A;  4K0U A;  3C51 A;  4EXT A;  3B13 A;  2WDV A;  3KYQ A;  1V9D A;  3O1H A;  1HF8 A;  5APQ A;  2ODV A;  2X0Y A;  3PUX F;  2Q5U A;  2FBW C;  5LBM A;  4JI1 T;  4L74 A;  8PRN A;  1NTK K;  1RE3 A;  2XV5 A;  2ZT9 C;  3ZKR A;  4PD4 H;  5AVX B;  1HTJ F;  4AYN A;  3Q5W A;  1P4T A;  1LTS C;  1KTM A;  2LFU A;  1OED E;  2FJB A;  2Z4E A;  2X68 A;  3HOE A;  2KOG A;  3TNU A;  4O3W A;  1J1D C;  2FJA A;  3AA0 A;  1N8R Q;  2KLQ A;  1HF9 A;  1LNQ A;  3QRC A;  2MHL A;  3SWF A;  3JAF A;  5GV0 A;  4FOZ A;  1UK5 A;  5G26 A;  1IK9 A;  1AVY A;  3SY9 A;  4XNK A;  3RC3 A;  5LMN T;  3CLQ A;  5KJ7 A;  5A1L A;  2AEF A;  1QLB A;  2CM0 A;  3N2K E;  1QL2 A;  3PGU A;  3RIU A;  1GD2 E;  2Q9Q A;  1HNX T;  2UUA T;  4HWI B;  1XTG B;  1GU4 A;  1CSB A;  1FU1 A;  3BRY A;  1S5L H;  2L5G B;  1THQ A;  1M56 D;  3FZM B;  2D0U A;  4DVD A;  3K19 A;  3N9O A;  3G6E P;  2P2U A;  2H89 A;  5AVW B;  1D0Y A;  1E2A A;  1JEK A;  4EIW A;  2GK9 A;  1JNR A;  5LCY A;  4JF7 A;  1KC8 Q;  1KIL D;  3CCU P;  1LT9 A;  2QTK A;  2DI4 A;  1SQP E;  1WMK A;  2VQF T;  3P32 A;  4UB8 E;  2VK9 A;  3CL3 D;  4DV4 T;  2JPF A;  2JQ9 A;  4HWH A;  4F8H A;  3UAQ A;  1ZOY C;  2WWV A;  5L3C B;  2XM1 A;  4LSE A;  2YIU B;  4JEU B;  3FZH B;  1MMN A;  3FXE B;  1W2B O;  2D0T A;  1KIL C;  3AE3 C;  4HFB A;  5AQS B;  5KLV G;  5FMN A;  2JP3 A;  1VQM P;  3R6N A;  5LJM A;  2WDQ A;  5JDL A;  2A45 I;  1HVV A;  3EVY A;  2WTY A;  1BCC G;  3I5C A;  4DND A;  1JY3 N;  4RLB A;  3UFE A;  2POH A;  2MAW A;  1Z8U A;  3TLV A;  3N5L A;  3PGS A;  5KAF E;  1ZHX A;  2JRK A;  2CRB A;  1DIP A;  1O3X A;  1DEB A;  2WWU A;  3ZPO A;  2I1J A;  2B9B A;  1BR0 A;  4FRT A;  4QMA A;  1R5L A;  5PRN A;  4QXH B;  3A0B E;  4AKL A;  1ZP0 A;  2X51 A;  3VR9 A;  3QB5 K;  3H1I E;  3EFF K;  4IL6 O;  4D64 A;  3RGU A;  1KQS O;  5CA1 E;  5KXJ A;  2YXQ B;  1SQX J;  1U57 A;  2YKO A;  4YPC A;  2O01 N;  4F4B A;  4ZI2 D;  2L3L A;  2KSR A;  2FJE A;  1YTZ I;  3CWB J;  2E42 A;  2CXF A;  2R6G F;  3AED A;  4UB8 H;  4HYT B;  4U7Y A;  2XZE A;  2OLT A;  4YTP C;  3ZC1 A;  2P58 A;  5ABH A;  1SQX D;  1FZE A;  2CBJ A;  3H3A A;  2IC6 A;  1LJ2 A;  4U3F J;  4NIQ A;  4YSZ A;  4PNI A;  1QVG O;  4YJ2 E;  3CWB D;  1W5C E;  4AKI A;  3LBX B;  4MHC A;  3C9I A;  1X79 B;  3QB5 A;  1JOC A;  4OGQ B;  1VF5 D;  1L0N G;  2BEZ F;  3JC2 2;  2LOS A;  2WBL A;  4UB6 O;  4NPF X;  4TWD A;  4U3F D;  3I0O A;  3LK3 B;  1KB9 D;  2V6Y A;  2QE7 H;  3V5S A;  1SQQ E;  5FXX A;  1HTL C;  2KZ7 B;  3PF1 A;  2LM9 A;  3O1J A;  1K73 Q;  4PD4 I;  2JMH A;  3Q9D A;  5KAF H;  1DU2 A;  3KV4 A;  1QL1 A;  3L73 J;  4H44 D;  1VF5 C;  1ZW0 A;  2NWB A;  5FVL A;  3CI9 A;  3UU2 A;  1L0L J;  2LKM A;  2F1C X;  4IL4 A;  4ZKP A;  3MJX A;  4XZC A;  2E75 B;  3A0B H;  3L73 D;  4JYA T;  1N36 T;  3VU7 H;  5LMU T;  4H44 C;  2IYO A;  2NPS D;  3C5O A;  1L0L D;  2HPL A;  2CHN A;  4NXM T;  2AXD S;  1FOS F;  3AAE B;  2VAS A;  5AW9 B;  4IDO A;  3EQ2 A;  2V7M A;  2OYH A;  4IL6 X;  2J62 A;  5HEG A;  3TYY A;  4EV6 A;  2Y48 B;  4FSP A;  1LTJ C;  2DL1 A;  2IBZ D;  1YD8 G;  1AV1 A;  3AE7 C;  1T16 A;  3ABV A;  4QQ1 A;  1WR0 A;  2FBW A;  3OW2 O;  4ZEY A;  1N34 T;  3MUD C;  3O4X E;  4IE4 A;  1G8X A;  5LBQ B;  2KB7 P;  2JDI H;  3MHV A;  2Z5I A;  2WS3 A;  3PTR B;  3SYB A;  4LFA T;  3AEA C;  4IFM A;  1HJ0 A;  4WWI A;  3EUH A;  2FYU G;  2KYV A;  3DWN A;  3P4W A;  3RK3 D;  2W61 A;  2WAU A;  3HKD E;  3QUJ A;  2WZI A;  2GUS A;  3CCR P;  4GOU A;  1MMA A;  3UUX B;  4GHB A;  3B5M A;  2YO3 A;  3EFG A;  3C4W A;  1YQ3 C;  1K8A Q;  2OQQ A;  1DD4 A;  1RHZ B;  4KUM B;  3CXH E;  3FZK B;  2XQ8 A;  3WMM 0;  4RLC A;  2X66 A;  1XMQ T;  3RK3 C;  2AEJ A;  2O01 J;  4N78 D;  1OW6 A;  3CD6 P;  3NBX X;  4RJT A;  3WU2 O;  4WY4 B;  1OED A;  4QXC B;  4O3Z A;  2LSK A;  3B5N D;  3TKL B;  5HXC A;  4E7S A;  3ITK A;  4EYY R;  3KZI E;  4HN9 A;  2F1T A;  2CWY A;  1NVO A;  3L72 E;  3KQG A;  2XSA A;  1S4X A;  2CPB A;  3Q5S A;  2VVN A;  5DAB A;  3T8O A;  5LXT E;  3VZU X;  3JAE A;  2ZLD A;  3RYI E;  1LVK A;  1KYO E;  2V6X A;  4CI1 B;  3V2Q A;  2O3J A;  2OYI B;  1FZC C;  1NWM X;  3I55 P;  4KX6 A;  4GKJ T;  1VQ5 P;  1SQP K;  1HNW T;  4UVA B;  4EIJ A;  2M67 A;  1L4A A;  3ZSS A;  2N9B A;  5EFW B;  2E9X B;  1LP1 A;  4K35 A;  5HWX A;  1ZOY A;  3CQG B;  1E1H B;  2E74 D;  2ES0 A;  3AEC A;  5KKZ B;  3CX7 B;  3S4R A;  2XQ9 A;  3MIW A;  3AE3 A;  3JAD A;  2CCQ A;  3ETV A;  3CX8 B;  2ZMA A;  1EDL A;  1KQL A;  3VKH A;  4X5T A;  4CQI A;  2VKD A;  4B3S T;  3RLF F;  2D5U A;  4EB6 E;  4ZI3 D;  3Q5P A;  3NFQ A;  3CXH H;  4X66 T;  2E8I A;  3RK2 D;  3OAK A;  5GTI E;  2E74 C;  2IYP A;  2LRK A;  1OZH A;  1J1E B;  3AE1 C;  3ZYL A;  4FQE A;  4IE7 A;  1I6Z A;  3NZP A;  1FE6 A;  1JUN A;  1KV4 A;  3LIE A;  1SQX G;  3GHG A;  3R4Y A;  3CCL P;  3GN5 B;  2EHO D;  1ZLL A;  3M0D A;  2ACX A;  3POQ A;  5H2F E;  3RK2 C;  2L91 A;  3CWB G;  4I7Z C;  2KWH A;  1LTT C;  1NTM J;  2W0G A;  2HR3 A;  3RL0 g;  3C4X A;  1KYO H;  3CCM P;  2POR A;  2WSS H;  1WYB A;  3KVA A;  1JY2 N;  4U3F G;  1USE A;  1IFD A;  4LML A;  1NTM D;  3GMI A;  4TV9 E;  4EED A;  4AZL A;  1OVR A;  4LF8 T;  3KDS E;  4CXX A;  4YTP A;  1X8Y A;  4C7R A;  3OKQ A;  1BE3 E;  3SZV A;  2JJ9 A;  5BVZ A;  3HTK A;  5L4E A;  2NW9 A;  1NU1 E;  2BG9 E;  1Y8A A;  5AW6 B;  5LG4 A;  4CI3 B;  2NTX A;  1ZHT A;  2V7Q H;  5JVD E;  4U7I A;  1VCT A;  2BDE A;  3ZN1 B;  3L73 G;  3EDV A;  1ZHZ A;  3EDU A;  3A3Y B;  3RBZ A;  2IZ1 A;  5CB4 E;  2LE8 A;  3L74 E;  2VRS A;  5GTI H;  3T1Y T;  3POU A;  4I1L A;  1L0L G;  1OVV A;  1SQQ K;  5AQH B;  4O3X B;  3CWZ B;  4DMV A;  1Q9F A;  2PGD A;  3UUB A;  2JWD A;  4D65 A;  3VMA A;  2V7I A;  3PV0 F;  1H89 A;  1M7K A;  2UXN B;  2WVR A;  4AQY T;  4YSX A;  3HKE E;  2WMN A;  5AVQ B;  2XAQ B;  5H2F H;  3AEE A;  1RF0 C;  3U1C A;  1AFO A;  2IBZ G;  4EEB A;  3T24 A;  2F4V T;  3UPG A;  2R5B A;  2W2U A;  3GW6 A;  3AA1 B;  2HPJ A;  4FZN A;  2E5T A;  1QX8 A;  1M1J B;  4U33 A;  1Q7Y Q;  2KP8 A;  3HD7 C;  2B87 A;  5G3A A;  5JQG E;  1UCU A;  3LDQ B;  2MJZ A;  3A7M A;  5HEH A;  1GDT A;  1QJ8 A;  5BR8 T;  1ZEE A;  3AE8 C;  1LTJ A;  2P67 A;  4HB1 A;  4JCH A;  3NWI A;  4U2Z A;  2N2L A;  2DCF A;  3JCU E;  2WJQ A;  2PBI A;  3MUD A;  1MZ9 A;  3L3P A;  3H25 A;  5HWY A;  5HEU A;  1R8E A;  5B66 O;  2QVA A;  1MNE A;  1I94 T;  1MMD A;  3I9W A;  3M9B A;  3LW5 H;  2BCC J;  3AEA A;  1MKM A;  3H1L E;  1BT9 A;  4UEL A;  3OJA B;  2CHO A;  2ITA A;  4YXW H;  2K9Y A;  2V5C A;  3E0Z A;  1D0Z A;  4M1P A;  5BU5 A;  5KJ7 D;  1VQ4 P;  2BCC D;  1KIL B;  3A5T A;  1YQ3 A;  5KMG P;  3KFW X;  2Q9Q D;  3RL0 C;  2KNC B;  3PDY A;  2M3B A;  3L71 E;  4NPE A;  1QVF O;  1GU5 A;  5L47 A;  1FJG T;  2IWV A;  2WSE J;  1MFT A;  4KRA A;  4DV1 T;  5EK3 A;  2BAS A;  3EI0 A;  5APY A;  2W62 A;  1YXR A;  5ADX K;  1QLE D;  3RIU C;  2KXP B;  1PHO A;  2Q9Q C;  3P4S A;  3AAI A;  5DJT B;  1BR4 A;  2N2M A;  4D6T J;  2G8Y A;  2ZM6 T;  2QG4 A;  2ZVO B;  3L70 J;  3FXD A;  3MTU E;  3C98 B;  4JYC A;  2YMK A;  2LHN A;  2NZ2 A;  1CI6 A;  3JCU H;  4C4V B;  1FZC A;  2H89 C;  2M8R A;  5JR9 C;  5L3B B;  1JMM A;  2Q9I A;  3H32 A;  4O4X A;  4D6T D;  3LFM A;  4BWN A;  1U7M A;  3CC2 P;  5M4Y A;  1LTG C;  2XAF B;  3FBL A;  3L70 D;  4PJN A;  2FXP A;  1LWU C;  2YO2 A;  4HJG H;  5AVU B;  3FYX A;  4X64 T;  1LT9 C;  4HGA A;  1URQ A;  2WT7 A;  2WSS V;  3LSV A;  5FVN A;  3O1I A;  1FAV A;  3V8U A;  2XG6 A;  2WSC J;  2BS2 A;  3N9L A;  2K0L A;  2OAR A;  4TT3 H;  4WYV A;  3HUS B;  3TLS A;  4AKR A;  3T0S A;  1H8A A;  2WWW A;  1WR6 A;  3RPU A;  4DV6 T;  2BVM A;  4PJJ A;  2CXL A;  2Y9Z A;  2WY2 A;  5C39 A;  4O4U A;  5GTI O;  3VZW X;  4P0B A;  3AE1 A;  3V2P A;  3L75 J;  2K3R A;  5CA0 E;  1KQF B;  1NTM G;  1FBM A;  4KHZ F;  2IWW A;  4JI8 T;  1W2E A;  2W83 C;  3W15 B;  1SQB E;  2WSF H;  1GL2 A;  4Y99 B;  1QGK B;  2N1T C;  2SPC A;  5HAX A;  1VF5 B;  3HE4 B;  2AXC A;  1BCC J;  1YYC A;  3L75 D;  1IBL T;  2X0H A;  5H2F O;  3Q5E A;  1UUS A;  2N1G A;  2JQK A;  4AYI D;  1YIT P;  2M3E A;  1SQV J;  3W68 A;  1RE4 C;  1NAY A;  3P8M C;  1HS7 A;  1VDF A;  5K5G B;  4IL6 E;  3L39 A;  3AAA A;  3WAK A;  1BCC D;  1ZP0 C;  1BDC A;  3BCC J;  4H44 B;  3K5B A;  4JUY A;  2E76 D;  1J2J B;  2LHR A;  3VMY A;  5ABE A;  3VP8 A;  3PRN A;  4LF5 T;  4I43 B;  2IPP A;  4FSO A;  5KLV E;  1SQV D;  4FMS A;  3JC6 D;  1NU1 K;  3A5X A;  3BCC D;  5JDG A;  2W90 A;  4DR1 T;  2NPS B;  3LID A;  4H9N C;  4LMJ A;  1GMJ A;  2R44 A;  1BR1 A;  2M6B A;  3RF1 A;  1RY3 A;  2X0L B;  2QA7 A;  4UB6 E;  4ISS A;  4IHJ E;  3B8E B;  5CCG A;  4GIF A;  4FZL A;  2YNY A;  1RF1 C;  3CX5 I;  4DUY T;  3MZK B;  2OYO A;  3WI4 A;  1EDJ A;  1EZV E;  2BG9 A;  2FGQ X;  4ASK A;  3TLU A;  2RN0 A;  3GF7 A;  4PD4 D;  5APU A;  1HGV A;  5AFU K;  2QSI A;  2M5A A;  2UUC T;  4BJM A;  1ZRT E;  2ZM2 A;  5HXH A;  3AXJ B;  2IDO B;  1SA0 E;  1WLX A;  4JI4 T;  3UU6 A;  4C7N A;  1P84 I;  4ZKU A;  4IL6 H;  2O1J A;  1W9R A;  1T3U A;  2C9N Y;  2QM7 A;  3RK3 B;  1FS0 E;  3HD7 A;  4N6J A;  3FWN A;  2ACZ A;  1Y64 B;  2KT9 A;  3POX A;  5AFU L;  1WRG A;  3KVD D;  1NAF A;  1N86 A;  3ZEF B;  4CXW A;  5DL5 A;  5AVT B;  2RKL A;  5HEJ A;  4NXN T;  2A3D A;  2OYH C;  1NTK G;  2ZT9 D;  3BRT B;  3RKG A;  2BCC G;  4AIS A;  2KDY A;  3JCU O;  1JY3 P;  3OA7 A;  3B5N B;  3BRV B;  5JDQ A;  4UB6 H;  4GCP A;  1Q81 Q;  3ABV C;  1SP4 A;  4EOZ B;  3NMD A;  3NKZ A;  4I4T E;  3N2G E;  1ZKE A;  1Q82 Q;  2Q3E A;  2HN1 A;  4GT1 A;  1FEW A;  2BZB A;  2WB5 A;  3GG2 A;  2JIW A;  5AQU B;  4PV1 D;  3SYS A;  5LB7 B;  4QXB B;  3IF4 A;  4ANJ A;  1G73 A;  5ETW A;  1AA0 A;  2P10 A;  2DLR A;  5AW2 B;  2PJQ A;  4GK5 E;  1OW7 A;  3PQS A;  1IFN A;  3LK3 A;  3ZLI A;  1SUM B;  5JRC A;  5LA6 E;  1DEE G;  5EZY E;  2KZ7 A;  5JDF A;  2FYU J;  1WFD A;  3X1D A;  4PV1 C;  2R8A A;  4D6T G;  2ZVN B;  3H1K J;  2E74 B;  2XDJ A;  3L70 G;  2H7O A;  4YLH A;  4GOE A;  1VQN P;  1W0B A;  2E2A A;  3L35 A;  3WU2 E;  2YU1 A;  4EI2 A;  4WBN E;  5AW1 B;  2SPZ A;  2YIN A;  2QM8 A;  3L36 A;  1OED C;  4UXN B;  4PK6 A;  2FYU D;  1YJN P;  2MPK A;  3H1K D;  4U72 A;  5B5E E;  2XMX A;  3RK2 B;  4I7Z B;  1ZR4 A;  5AW8 B;  1L4A D;  1PIX A;  5JR9 A;  2W67 A;  3ZYK A;  4YTM A;  1JY2 O;  3MD0 A;  3CQC B;  4GYR A;  2XTL A;  1LWU A;  3G4S P;  1VCS A;  3SWH A;  4ASW A;  3CCJ P;  1JCD A;  2A45 G;  1HWT C;  2EHO B;  5L8R J;  2XQY A;  5AVR B;  3HL6 A;  1L4A C;  1IO4 A;  2HPC B;  3CKD A;  2KS1 A;  2C5J A;  1BXW A;  2LSI A;  4O49 A;  3DTO A;  2XE1 A;  3L75 G;  2BBH A;  4HE8 A;  2I8D A;  3HOL A;  4ADZ A;  4TNW A;  5ABF A;  1D0X A;  2K1A A;  3AEC C;  4HKA A;  5FKY A;  3PUR A;  3G7G A;  3M3Z B;  4G76 A;  2K9A A;  3Q2M A;  4KMC A;  3PUS A;  3C1L A;  3OBV E;  3AVR A;  2XQA A;  5KLI C;  4A7P A;  2YOE A;  4E7Z A;  3SZD A;  3V5U A;  1HJB A;  3WU2 H;  1SQB K;  2JQQ A;  1SQV G;  3PUV F;  3VRB A;  2N1T A;  1K05 A;  4TUY E;  1MUU A;  5AQP B;  1JB0 J;  3BCC G;  3MP7 B;  4AYM C;  2IUB A;  3TZG A;  5B5E H;  3GHG C;  4GOF A;  2BKN A;  4EDF A;  4ZHQ E;  1N73 C;  3M0D C;  5LJN A;  1YKE B;  1RE4 A;  4JI5 T;  1CUN A;  1NHL A;  3PJS K;  2PP6 A;  5AQT B;  4ILB A;  3A0H H;  5IHY A;  3UU5 A;  2CA5 A;  3AA6 B;  3ANW B;  5FXW A;  3AE2 A;  5L4H A;  4U7J A;  2FXO A;  5KLV K;  5APW A;  4AKG A;  4B3M T;  3QWO C;  2XAS B;  4Z8X A;  3SOL A;  5ABG A;  1HX8 A;  4O2A E;  3HE5 A;  3PP5 A;  3PUZ F;  4IT4 A;  1FZG A;  4EZH A;  2LKH A;  1KN7 A;  3N7N A;  1IBM T;  3WUT A;  4UVB B;  1U5P A;  1ZR2 A;  2DHR A;  2PRN A;  4H0L D;  4PJM A;  5CCH C;  4HFV A;  1OX3 A;  2WM9 A;  1NYH A;  1X22 A;  2LJL A;  1DD3 A;  2P9B A;  5G38 A;  1RF1 A;  4LSF A;  4U2Y A;  3SWY A;  4N59 A;  4KI0 F;  3AEB A;  3H1J J;  2XAH B;  1ZHW A;  3T97 A;  1KF6 A;  4AUI A;  5JH7 E;  1VRB A;  3OTO T;  2M07 A;  1FJP A;  2KMF A;  4H0L C;  1EZV I;  5CHX A;  3S1K A;  2V7L A;  1SQQ D;  4U3F E;  5G39 A;  1KB9 E;  3ZMV B;  1DH3 A;  3TNU B;  3H1J D;  2WIT A;  2X9X A;  2YU2 A;  1MV8 A;  3G71 P;  3AEE C;  1N33 T;  2PTF A;  2B76 A;  1QUU A;  3BK9 A;  1E79 H;  1KNZ A;  1GW3 A;  4WBO A;  4CN1 A;  5LHH B;  1HUC A;  3GN5 A;  4YXD A;  3O0E A;  3M9Q A;  1PPJ E;  5KTB A;  2R4O A;  3ZCJ A;  4OX9 T;  4DBR A;  2C9L Y;  3FX0 A;  3L73 E;  4U31 A;  2B88 A;  2Q9Q B;  3F31 A;  2Y0L A;  1OFC X;  4I0U A;  2QJP C;  2WPQ A;  2MYS A;  2K9J A;  2OMF A;  2Y0K A;  2JQH A;  3E7K A;  5KAI E;  3CIR A;  2H88 C;  4FI5 A;  2LRL A;  1XNQ T;  1MIY A;  5B66 E;  5C8Y E;  3L4F A;  5AVS B;  1IC2 A;  3TGU J;  4NUV A;  4DR5 T;  3SFD A;  3U3I A;  2AE9 A;  1LT9 B;  2IBZ E;  1AQ5 A;  4WB4 A;  2K5B B;  4AQG A;  3H1K G;  5LGN B;  2XKM A;  2HLO A;  3TGU D;  2R4N A;  3ZST A;  1B7T A;  3II6 A;  1KB9 H;  3ETU A;  4LSI A;  2OV9 A;  2WMO A;  1Z0P A;  2XAJ B;  2XQ6 A;  2PFX A;  2W66 A;  1JY2 P;  2YXR B;  4P1N A;  1XZY A;  1Q2N A;  2A9U A;  2XSB A;  1NJI Q;  1M90 Q;  2X9W A;  3PU3 A;  4IGU A;  3A7O A;  5AW4 B;  2Q7C A;  2XE2 A;  4K3B A;  4UR9 A;  4I55 E;  2ODJ A;  4U3C A;  2ZM0 A;  2IML A;  5L3E B;  2WPS A;  3L72 J;  3P8C E;  2FFD B;  3C8V A;  4HFI A;  4DUZ T;  1R5S A;  1EDK A;  3K3N A;  5B5E O;  1WCR A;  2V1D B;  2LR2 A;  4N78 E;  1BGY E;  2H7V C;  4G63 A;  4PAG A;  2FJD A;  4BRY A;  1ORM A;  4N3Y B;  3AA7 A;  3PJA A;  3SSU A;  4QX8 B;  5KAI H;  1M1J A;  4YHH T;  1URQ D;  1S3J A;  2CLY C;  3L72 D;  1BH3 A;  3A0H O;  2LEH A;  3UUN A;  2Y0D A;  2R4P A;  2J1N A;  1NGM B;  4AQR D;  5B66 H;  4H63 H;  4IFF A;  3H37 A;  4PK4 A;  1USD A;  3RYF E;  5DL6 A;  5FL1 A;  4G75 A;  3KPE A;  2HHH T;  1URQ C;  2X9Y A;  3F57 A;  2DNX A;  3FHN A;  3NTN A;  4MBQ A;  1G2C A;  3ZDM A;  1N2D C;  2ZLY A;  2E76 B;  3O6Q A;  4JI6 T;  4NUU A;  2YKQ A;  5F3J A;  4IDZ A;  3VR8 A;  2NRG A;  2ZYD A;  3LJC A;  5CJ5 A;  4Q25 A;  1IZN A;  4FRX A;  1GL2 D;  1J5E T;  3G9R A;  1Y9B A;  5FVK A;  1NH4 A;  3M9H A;  1CW5 A;  4DT0 A;  2H7H A;  4PJL A;  4UF0 A;  2UXC T;  2JMM A;  1S9K D;  5EK4 A;  4AI6 A;  4OHF A;  4YY3 T;  3HRN A;  4H9Q C;  1GL2 C;  1N73 A;  1LTI C;  1PGJ A;  2E5L T;  2E5V A;  1MFZ A;  1FOS E;  3K8P C;  2B1E A;  4M3L A;  3W67 A;  2C5K T;  2ZFC A;  5JTG A;  3BRZ A;  4JYB A;  4ZS3 A;  3HR0 A;  4HEA A;  1HXX A;  5DL8 A;  4KR8 A;  5DL7 A;  2MKV A;  1NTZ J;  1UUR A;  3ESL A;  4IE6 A;  4FUV A;  2R4L A;  4ZOL E;  4DV3 T;  1KNR A;  2K4T A;  5JDP A;  4JI2 T;  1PP9 J;  2HYN A;  2HOD B;  5LP6 E;  1NU1 J;  1UGO A;  4PJ0 O;  4OFZ A;  1NTZ D;  1SQQ G;  5J2T E;  1MND A;  5CCG D;  2OYH B;  1HG2 A;  1KK7 A;  4Z90 A;  2E5Y A;  4DID B;  3H1J G;  1NTM E;  5CCH A;  1PP9 D;  2FY8 A;  4DOJ A;  1NU1 D;  4HFC A;  3KHU A;  1SQX K;  2O1K A;  1IFP A;  1VL2 A;  4O4I E;  4WW0 A;  1UIX A;  4TZ4 C;  4TV8 E;  4AYD C;  3IEE A;  2KLU A;  4IL9 A;  2KUB A;  3NVO A;  2LSJ A;  5CCG C;  3PRJ A;  2ZT9 B;  4U74 A;  3H1H E;  2A06 E;  3L74 D;  2YKS A;  2NR4 A;  3V4Q A;  2YIU C;  4A98 A;  3CX5 D;  1H0T A;  3U59 A;  2BG9 C;  4E1T A;  1BSN A;  3B4S A;  2X9K A;  1AQT A;  4LLH A;  1J1D B;  2RMZ A;  3HD7 D;  3ZT5 A;  1KB9 I;  4QKN A;  2XTQ A;  1RH5 B;  4W7Z A;  1GQE A;  4HWF A;  1K9M Q;  3ZJ1 A;  5C2T A;  2XQ5 A;  4PV1 B;  2Y0C A;  3E1R A;  4GOD A;  5HXR A;  5JDN A;  4GKG A;  3BQI A;  2XND H;  1P84 D;  2XUE A;  5AQI B;  2D2C D;  3VMZ A;  2HFE D;  3KBT A;  1OED B;  1JTH A;  1XWM A;  2L8K A;  3HA4 A;  4BUM X;  5T5F A;  3VP9 A;  3M0A A;  2XZR A;  2IW5 B;  3UQ4 A;  1EXI A;  4PUX A;  2R3C A;  3UQ7 A;  4DR3 T;  1MM5 A;  3TGU G;  1FMW A;  3OYX A;  2UU9 T;  2H88 A;  5KAI O;  5H6R B;  5EE2 A;  2D2C C;  5CGM A;  1S1C X;  4H13 D;  4LF9 T;  4HFH A;  2OTL P;  2GE4 A;  1S94 A;  4PW8 A;  5F8P A;  2YDS A;  4R4M A;  4KR4 A;  2LSY A;  3ONX A;  5AQO B;  3Q1M A;  1SFC A;  2KSE A;  1NTK J;  1FZF A;  5LNK A;  1US7 B;  2CBI A;  5IYZ E;  2XY8 B;  2I0M A;  3UUL A;  3RL0 D;  3V2N A;  4CN6 A;  1GFM A;  1X0T A;  1L4A B;  2MNH A;  5HXS A;  2VKO A;  1LP1 B;  1YW0 A;  4H13 C;  2I6H A;  4V1A v;  5DJU B;  4AYE C;  1M1K Q;  3AVS A;  3ZMT B;  1NTK D;  4OGQ C;  2WP9 A;  3EMN X;  6PRN A;  5DJQ C;  4ASV A;  1PGO A;  1UX4 A;  1IFI A;  2KZI A;  3L72 G;  4NPP A;  2LKG A;  1JY3 O;  2I1K A;  5LYJ E;  2VKH A;  4HFE A;  4QH4 A;  5IWA T;  3CXH I;  3CX6 B;  3BVH A;  4DV2 T;  1LVF A;  4FT6 A;  2WSF J;  1HBW A;  3C4Z A;  4QWN B;  4DR6 T;  2ZXX A;  2M0B A;  3RX6 A;  2M6I A;  4MAL A;  5AVY B;  3BAT A;  2FYZ A;  2V5D A;  4ZNC A;  2JO1 A;  3GHG B;  2LSG A;  1HFA A;  1PZQ A;  2E75 C;  4UEM A;  3LK4 1;  3UTK A;  4XA4 A;  5TIS O;  3I9Y A;  3QH9 A;  4LF7 T;  2Y2X A;  1KYO I;  5AW7 B;  5ADX L;  1WT6 A;  3R84 B;  1N7S A;  1M8O B;  3TSI A;  4EOT A;  2XM2 A;  1OSM A;  4QX7 B;  3RRW A;  3M65 A;  4ZZC A;  2J4U P;  1GZL A;  2WVP A;  4IIJ E;  4COF A;  1G1J A;  4D6T E;  2ZJS E;  3LK2 B;  1MPF A;  3Q5R A;  3L70 E;  1TU3 F;  5CBO A;  3SY7 A;  2V7J A;  3RH3 A;  1IJ5 A;  2PRR A;  2N1T D;  2ZM8 A;  3E08 A;  1ZV4 X;  5J2U E;  4O3Y A;  2Q6Q A;  3MA9 A;  3G06 A;  3M06 A;  1EDI A;  3RC8 A;  1SQB J;  2X27 X;  4C90 A;  3SFE A;  2DW3 A;  2J47 A;  4YT0 A;  5HXE A;  1VPC A;  4CXY A;  4H0L B;  3R2P A;  5AQF B;  1NTZ G;  3CCV P;  2KIN B;  4KT0 J;  1SQB D;  2Q3I A;  3ZJ2 A;  5AQJ B;  4TWF A;  3GA8 A;  2YDQ A;  1PP9 G;  1OIP A;  1NU1 G;  3PQU A; 
#chains in the Genus database with same CATH homology
 2YK0 A;  4EYU A;  3ZYK A;  3NRY A;  1HXT A;  3O4X E;  4IE4 A;  3VE1 A;  5FNV E;  2YPV A;  1G8X A;  3CQC B;  4GYR A;  2XTL A;  5LBQ B;  1OPF A;  5H6Q B;  3SWH A;  2EHO B;  1D1A A;  1H6S 1;  4O4J E;  3SYB A;  3PTR B;  2XQY A;  3HL6 A;  5FYM A;  3EUH A;  3S4U A;  4X1I E;  3CKD A;  3ZMS B;  2C5J A;  1BXW A;  2W61 A;  2LSI A;  2WAU A;  3HKD E;  3JTY A;  2RP4 A;  4O49 A;  3DTO A;  2XE1 A;  4HE8 A;  3IHR A;  3HOL A;  3QUJ A;  4ADZ A;  1D0X A;  4GOU A;  4KP3 C;  2JMK A;  4C69 X;  5GON E;  4HKA A;  1MMA A;  3KV9 A;  3PUR A;  3UUX B;  3G7G A;  4GHB A;  2IAK A;  4QHO A;  4G76 A;  3C4W A;  2K9A A;  3P7I A;  3ZMZ B;  2EHO A;  4KUM B;  3WI5 A;  2PG8 A;  3Q2M A;  4KMC A;  3AA7 B;  3PUS A;  2ERV A;  4RLC A;  2X66 A;  3OYZ A;  1MMG A;  3C50 A;  3OBV E;  3AVR A;  4IE5 A;  4N78 D;  3ZN0 B;  2IC9 A;  2L9Q A;  3NBX X;  4E7Z A;  3SZD A;  2E9X C;  3V5U A;  4QXC B;  4O3Z A;  4DBQ A;  2LSK A;  1GFQ A;  2JQQ A;  3TKL B;  3HKB E;  3BQL A;  5HXC A;  4E7S A;  2CEA A;  4TUY E;  4EYY R;  4AQF A;  3N2O A;  4OK0 A;  4HN9 A;  2F1T A;  2CWY A;  4AYM C;  4H63 V;  3UUM A;  4JEH B;  4DMW A;  3TZG A;  4OYK A;  2G0U A;  4ZHQ E;  4UV8 B;  5KX5 E;  5LJN A;  1YKE B;  5DAB A;  3NSG A;  1CUN A;  4RJW A;  3T8O A;  5LXT E;  3VZU X;  3IBP A;  3ZYM A;  4XBF B;  3RYI E;  1LVK A;  3K3O A;  4CI1 B;  2ZLD A;  1S35 A;  1VOM A;  5LOV E;  5IHY A;  3SRZ A;  3RKO A;  1FIO A;  1NWM X;  1IZN B;  2CA5 A;  3AA6 B;  3ANW B;  3PUA A;  5FXW A;  4YFS A;  3WAJ A;  3C64 A;  4UVA B;  2M67 A;  2RA1 A;  4AKG A;  4P0A A;  2E9X B;  5HWX A;  2XAS B;  4Z8X A;  3SOL A;  3CQG B;  4AXP A;  1E1H B;  3RRC A;  1HX8 A;  4O2A E;  2X67 A;  2ES0 A;  2YNK A;  3CX7 B;  4UF0 B;  2VKJ A;  2OA5 A;  4EZH A;  2CCQ A;  3ETV A;  3HW9 A;  3CX8 B;  2ZMA A;  1MIV A;  3VKH A;  1YS5 A;  4CQI A;  2VKD A;  1U5P A;  4UVB B;  3VZT X;  2DHR A;  2PRN A;  4H9O C;  3DP7 A;  2D5U A;  5J1G A;  4EB6 E;  4ZI3 D;  1E54 A;  4PJM A;  2CLY B;  4HFV A;  3PE0 A;  2WM9 A;  2E8I A;  2LJL A;  4FJO A;  2P9B A;  4J2C A;  5L3F B;  4X20 E;  4LSF A;  4PFP A;  1WRD A;  4C91 A;  4N59 A;  3ZYL A;  4IE7 A;  3KV6 A;  3NZP A;  4O4H E;  2Z6E A;  3GP6 A;  2XAH B;  4PFO A;  1ZHW A;  1MIW A;  4AUI A;  5JH7 E;  1VRB A;  3RYC E;  3D0T A;  3FB2 A;  2M07 A;  3J9X 1;  2KMF A;  3GN5 B;  2EHO D;  3LBX A;  4O4L E;  2V7L A;  4L0R A;  1X79 A;  2ACX A;  3POQ A;  3KIN B;  1ZHY A;  4OYJ A;  3ZMV B;  2VL8 A;  3BQK A;  2W63 A;  2KWH A;  2X9X A;  5JDM A;  2YU2 A;  4BA9 A;  3N9Q A;  4UVC B;  2W0G A;  3C4X A;  1EZ3 A;  4AKR B;  5FY7 A;  5E0O A;  1QJ9 A;  2POR A;  5IYU A;  1QUU A;  3B57 A;  3BK9 A;  1WYB A;  5LHG B;  1KNZ A;  3KVA A;  3ZCI A;  4WBO A;  4UV9 B;  3POR A;  5LHH B;  5FXZ A;  4TV9 E;  3GMI A;  4AZL A;  3GN5 A;  3KDS E;  4CXX A;  4X1K E;  5FY0 A;  1QJP A;  2XE3 A;  3O0E A;  5D5D A;  3OKQ A;  1D1B A;  3ZCJ A;  3CVR A;  4DBR A;  3SZV A;  2JJ9 A;  1U4Q A;  2NW9 A;  2Q9Q B;  3F31 A;  3MAC A;  2Y0L A;  3Q5X A;  4N58 A;  5LG4 A;  4CI3 B;  2NTX A;  1ZHT A;  2MYS A;  1ZHC A;  2OMF A;  5JVD E;  2Y0K A;  4YJ3 E;  2BDE A;  2KC0 A;  4GYS A;  3ZN1 B;  3EDV A;  4FI5 A;  2DWG A;  3U78 A;  3EDU A;  1ZHZ A;  3VY9 X;  2LT3 A;  1MIY A;  2LE8 A;  5CB4 E;  3NRX A;  5L2L A;  3POU A;  3I1A A;  3VKG A;  3F2E A;  2CE7 A;  5C8Y E;  2H3R A;  3AAE A;  4O3X B;  3AAA B;  3CWZ B;  4NUV A;  4DMV A;  1Q9F A;  4D65 A;  1GFO A;  2V7I A;  2VWA A;  3U3I A;  4AFK A;  2UXN B;  4TN7 B;  2K5B B;  2PFV A;  2Y6X A;  3FBZ A;  3HKE E;  2Y0H A;  4AQG A;  2WMN A;  4AKM A;  5LGN B;  2XAQ B;  3VY8 X;  1B7T A;  2E9X D;  1T98 A;  3ETU A;  3DA3 A;  4LSI A;  2WMO A;  4I50 E;  4JFB A;  1Z0P A;  2XAJ B;  2A2F X;  3T24 A;  3ZC0 A;  4Z3T A;  3GWH A;  2VB6 A;  4H9P C;  4GK0 E;  3UPG A;  4GCQ A;  3AA1 B;  1LKX A;  3HKC E;  2HPJ A;  1D1C A;  4FZN A;  4ERR A;  3DA4 A;  2X9W A;  3PU3 A;  5L3G B;  4FZM A;  4IGU A;  4E1S A;  4L5G A;  2FGR A;  2CWO A;  4BAY B;  2K24 A;  1OXZ A;  2XE2 A;  4WNK A;  4I55 E;  2ODJ A;  2ZM0 A;  5JQG E;  1UCU A;  5TAO A;  5L3E B;  2NOX A;  2I59 A;  2CXD A;  1QJ8 A;  3VHL A;  1ZEE A;  2MTQ A;  4B61 A;  3K3N A;  2V26 A;  2V1D B;  4ZS2 A;  2C0S A;  2ZFG A;  4G63 A;  2H7V C;  5FP3 A;  4PAG A;  4JCH A;  4DO0 A;  1ORM A;  2N2L A;  2DCF A;  2X9H A;  3AA7 A;  4RL9 A;  4QX8 B;  2PBI A;  4X1Y E;  5KDM C;  2F1V A;  1HXU A;  2CLY C;  3QK6 A;  2Y8D A;  3L3P A;  3QC9 A;  5HWY A;  3JC6 C;  1BH3 A;  2LEH A;  3UUN A;  2HH7 A;  2J1N A;  4U9C A;  4H63 H;  1MNE A;  5DQW A;  3H37 A;  3HWB A;  4PK4 A;  1MMD A;  3I9W A;  2C5I T;  3RYF E;  5DL6 A;  2BVL A;  1BT9 A;  3ZMU B;  4UEL A;  4GCS A;  1WYC A;  4G75 A;  4ZI7 E;  2W81 C;  4M1P A;  3E0Z A;  1D0Z A;  2QGS A;  4BJN A;  2NW8 A;  2X9Y A;  3CPZ A;  2DNX A;  3F57 A;  3FHN A;  4MBQ A;  2V7K A;  4LSH A;  2DWK A;  1IJ6 A;  2J1D G;  4F6R C;  2ZLY A;  4NUU A;  5F3J A;  4IDZ A;  2NTY A;  5KMG P;  4O8S A;  2CMR A;  3LJC A;  4IE0 A;  4EAH A;  1IZN A;  3ANW A;  3AA6 A;  3KFW X;  2Q9Q D;  4AKH A;  2XAG B;  4FRX A;  5JDH A;  3FXD B;  4XNL A;  3PDY A;  3KV5 A;  2W80 C;  3CML A;  2E9X A;  1SHZ C;  4RJX A;  2N9D A;  4CZZ B;  4KRA A;  5EK3 A;  2W62 A;  5ADX K;  3E22 E;  4PJL A;  4UF0 A;  2KXP B;  3VE2 A;  1PHO A;  2JMM A;  5EK4 A;  4AI6 A;  2Q9Q C;  4OHF A;  4FES A;  3AAI A;  4A56 A;  4H9Q C;  1BR4 A;  4GIW A;  2N2M A;  4ZI2 C;  4K0U A;  3C98 B;  3C51 A;  4EXT A;  3B13 A;  2LHN A;  3K8P C;  2B1E A;  1V9D A;  3O1H A;  1HF8 A;  1H7C A;  2C5K T;  2ODV A;  3AA0 B;  3IF8 B;  5JR9 C;  7PRN A;  5L3B B;  4ZS3 A;  3HR0 A;  4HEA A;  5LBM A;  1HXX A;  3LFM A;  4KR8 A;  4O4X A;  5M4Y A;  5DL8 A;  5DL7 A;  5JRC B;  3MK7 C;  1QSD A;  5FY1 A;  2XAF B;  3FBL A;  4IST A;  8PRN A;  4MLK A;  3ESL A;  4PJN A;  4IE6 A;  4FUV A;  2A72 A;  4ZOL E;  1HTJ F;  3FYX A;  4AYN A;  3Q5W A;  2K4T A;  5JDP A;  4HGA A;  1P4T A;  2WSS V;  5FVN A;  2W00 A;  3O1I A;  2LFU A;  1FMV A;  5LP6 E;  3V8U A;  2X68 A;  2XG6 A;  3HOE A;  1GFN A;  3N9L A;  4OFZ A;  2YEV C;  4O3W A;  2K0L A;  5J2T E;  3AA0 A;  1MND A;  1HG2 A;  1KK7 A;  2KLQ A;  4L9I A;  4AKR A;  3T0S A;  4D5U A;  3QRC A;  3RYH E;  1WR6 A;  3PUQ A;  2MHL A;  5BMV E;  3RPU A;  4B6X A;  4FOZ A;  5GV0 A;  2BVM A;  2LOP A;  4PJJ A;  2CXL A;  5G26 A;  3SY9 A;  1OWA A;  4XNK A;  3RC3 A;  4UIG A;  4WW0 A;  4O4I E;  5JR9 B;  4GF4 A;  4O4U A;  5A1L A;  3VZW X;  4P0B A;  4TZ4 C;  4TV8 E;  3N2K E;  2CM0 A;  3IEE A;  1Q9G A;  4AYD C;  5CA0 E;  3KBU A;  2XTR A;  2LSJ A;  4U74 A;  2Q9Q A;  3W15 B;  2D2S A;  1HG5 A;  4TX5 A;  2SPC A;  3N9P A;  2NP9 A;  5HAX A;  3PUG A;  4AQF C;  1THQ A;  4E1T A;  3O9X A;  2D0U A;  4DVD A;  3K19 A;  3N9O A;  4XAX B;  2N1G A;  1D0Y A;  2ODU A;  5LGT B;  4EIW A;  4AYI D;  4QKN A;  1IAP A;  1HS7 A;  2GK9 A;  2XTQ A;  5LCY A;  3AAA A;  3WAK A;  1GFP A;  3ZJ1 A;  2Y7S A;  5JDN A;  4JUY A;  5HXR A;  2LHR A;  3BQI A;  2QTK A;  2DI4 A;  3PRN A;  3LG7 A;  2MOZ A;  4I43 B;  2XUE A;  4ILU A;  4FSO A;  2VK9 A;  1LRZ A;  5DQV A;  4FMS A;  3A2S X;  1BR2 A;  2JPF A;  3JC6 D;  3KBT A;  2K48 A;  2L8K A;  3HA4 A;  3UAQ A;  4BUM X;  3A5X A;  5JDG A;  2IW5 B;  5L3C B;  5T5F A;  4LSE A;  4PUX A;  4JEU B;  1MMN A;  3FXE B;  2D0T A;  4H9R C;  3UT5 E;  1MM5 A;  1FMW A;  3I0Q A;  3MXZ A;  3OYX A;  4YHJ A;  1AJ3 A;  4H9N C;  5FMN A;  3QRA A;  3AA1 A;  3R6N A;  5LJM A;  1BR1 A;  5H6R B;  5EE2 A;  3P8C D;  5JDL A;  2X0L B;  2QA7 A;  3EVY A;  4ISS A;  4DND A;  2GE4 A;  3J7Y q;  1S94 A;  4IHJ E;  4RLB A;  4PW8 A;  5F8P A;  4KR4 A;  2LSY A;  3ONX A;  3UFE A;  4FZL A;  5LNK A;  3MZK B;  1US7 B;  5IYZ E;  3N5L A;  3UUL A;  3WI4 A;  2M06 A;  1GFM A;  1ZHX A;  5LHI B;  2MNH A;  2FGQ X;  2JRK A;  5HXS A;  2VKO A;  4ASK A;  1YW0 A;  3WI3 A;  4AYE C;  1O3X A;  4V1A v;  2WWU A;  3PU8 A;  3ZPO A;  3N9N A;  1BR0 A;  4FRT A;  3AVS A;  5AFU K;  3ZMT B;  5PRN A;  4BJM A;  3EMN X;  2ZM2 A;  4QXH B;  2NW7 A;  5DJQ C;  5HXH A;  4AKL A;  3HI2 A;  6PRN A;  1SA0 E;  2X51 A;  1WLX A;  1G90 A;  1UX4 A;  5FXV A;  4EZ4 A;  3K3Q C;  4D64 A;  5CA1 E;  5LYJ E;  2VKH A;  4KBM B;  4F4B A;  4ZI2 D;  2L3L A;  3OJA A;  3CX6 B;  2CXF A;  2KND A;  1LVF A;  4FT6 A;  1Y64 B;  4G2A A;  2KT9 A;  3C4Z A;  4QWN B;  3POX A;  1YKH B;  5AFU L;  4PK5 A;  3KVD D;  3ZC1 A;  1NAF A;  5JRE A;  3ZEF B;  4CXW A;  5DL5 A;  3RX6 A;  3L09 A;  4MAL A;  3H3A A;  2IC6 A;  2A3D A;  4PNI A;  4YJ2 E;  4AKI A;  2LSG A;  1HFA A;  3LBX B;  4MHC A;  4UEM A;  2KDY A;  3LK4 1;  3UTK A;  3RBH A;  3DJB A;  2WBL A;  2LOS A;  3I9Y A;  5JDQ A;  4GCP A;  4H9S E;  2Y2X A;  3I0O A;  3N9M A;  4EOZ B;  3LK3 B;  3MKD A;  5ADX L;  3NZQ A;  4HTE A;  5LGU B;  3KVB A;  4I4T E;  3R84 B;  2KXP A;  3V5S A;  3N2G E;  5FXX A;  2KZ7 B;  1ZKE A;  2LM9 A;  3O1J A;  1OSM A;  4QX7 B;  3RRW A;  2JMH A;  3Q9D A;  3M65 A;  1FEW A;  2BZB A;  3KV4 A;  4ZI3 C;  2J4U P;  3SYS A;  1PRN A;  4QXB B;  4CI2 B;  4IIJ E;  3CQX C;  4ANJ A;  1G73 A;  2NWB A;  5ETW A;  1MM4 A;  3AB3 B;  3UU2 A;  3LK2 B;  2DLR A;  2KWI B;  1MPF A;  1UX5 A;  2PJQ A;  4GK5 E;  3SY7 A;  3PQS A;  3MJX A;  4XZC A;  3LK3 A;  3ZLI A;  2V7J A;  2UXX B;  1IJ5 A;  3RH3 A;  5JRC A;  4O2B E;  4P09 A;  5LA6 E;  3VU7 H;  2LHF A;  5EZY E;  2ZM8 A;  3E08 A;  5JDF A;  1ZV4 X;  2XHE B;  2KZ7 A;  5J2U E;  3C5O A;  2EHO C;  2HPL A;  3T20 A;  4O3Y A;  3MA9 A;  5HYA A;  2H7O A;  4YLH A;  2YU1 A;  5L3D B;  4MFR A;  4WBN E;  3RC8 A;  2MBG A;  2YIN A;  3AAE B;  2VAS A;  2O4V A;  2X27 X;  3SS1 A;  4C90 A;  3LK2 A;  2V7M A;  1HCI A;  4UXN B;  4JLE A;  4PK6 A;  2XE5 A;  5HXE A;  3LK4 2;  4CXY A;  4U72 A;  2XMX A;  2KIN B;  2Y48 B;  4FSP A;  5EK2 A;  2N2N A;  3ZJ2 A;  1YD8 G;  5JR9 A;  3GA8 A;  4QQ1 A;  3PQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...