2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
3AAEA 3LK42 1IZNB 3LK41 1IZNA 3AAAB 3AAAA 5ADXK 5ADXL 3AA7B 3AA7A 3AA1B 3AA1A 2KZ7B 4AKRB 5AFUK 2KZ7A 3AA6B 4AKRA 3AA6A 5AFUL 3LK3B 3LK3A 3AA0B 2KXPB 3AA0A 2KXPA 3LK2B 3AAEB 3LK2A
chains in the Genus database with same CATH superfamily
4MFRA 1KILC 1ZOYA 4FOZA 3VU7H 4O4XA 3MHVA 1IZNA 4K35A 3M0DA 4TN7B 2R5DA 3MZWB 4EIWA 4GIFA 4Z8XA 1KORA 4H63H 3J7Yq 1HXXA 2NOXA 4I1LA 3MK7C 2WSSV 4PD4H 1FZCA 2YKQA 3A5TA 3C50A 3A0BO 3EWKA 1LTGC 2OARA 1LVKA 2YINA 3CK6A 1UUSA 5APVA 1G8XA 5LB7B 2CXDA 1Q9GA 2K9JA 3JSVC 3WU2O 3BK9A 1PL5A 4JQ0D 2R4LA 1Z0PA 3L70E 3MUDA 3E7KA 3ANWB 3A0HH 2LKGA 2WTYA 1L4AD 1NH4A 5EFWB 2O3JA 1IBLT 3UAQA 1R5LA 1YJ9P 1SQVE 4JCHA 4PUXA 1RF1C 4K3BA 1NTKE 3HD7D 3SWYA 4PFOA 2Y0LA 5AW5B 1SQQD 1YW0A 4D6TD 3IHRA 1T2KD 4H9RC 1NYHA 4HWDA 2VVSA 3HR0A 1XNQT 1BGYG 1L0NE 5LBMA 2OYIB 5AQVB 5H2FH 1SQBK 2X66A 1NTZE 3BATA 3V8UA 3RH3A 3VHLA 4GKKT 1L0LK 3BRVB 4OVNF 3MJXA 1KILD 4PFPA 3AE2C 3HE5B 2P1JA 3TZGA 4I0UA 4IDQA 1J1EB 7PRNA 1HF9A 4EYYR 3UFEA 4C4VB 4EGWA 2KC0A 4M3LA 3Q2YA 2IAKA 4RLBA 2W80C 4AQFA 2H3RA 2BG9A 1M8OB 2CXFA 3W15B 1AFOA 4WB4A 3SFEA 4B6XA 4O8SA 1WLXA 1KNZA 3FZFB 2A2FX 1AVYA 2EHOB 2Q9QB 1OEDC 2B88A 4O3YA 3B5MA 3CC7P 1JCDA 4ASWA 2M6IA 4Y99C 1NHLA 2Q1KA 4R4LA 5B66E 3OJAB 3C5OA 4O3XB 4DR4T 2AE9A 5AQLB 4JYBA 5CJ5A 2KNCB 4IDPA 4O4HE 4DV2T 2P7JA 1G2CB 3DWNA 1URQB 2XZRA 4H13C 3KVDD 3AEDA 2X0HA 2V5CA 3ITKA 3AXJB 3AAAB 1JY3P 5CCHC 5AQFB 1GTWA 1QEXA 3H1HG 3HWBA 2IYPA 3Q5PA 5AQPB 3CPZA 3B4SA 2C0XA 3AA6B 1KF6A 1NU1K 2QG4A 5KLVD 3RI5A 4BUMX 5AW3B 4U72A 4PJJA 4ZNCA 3V5BA 3HD7A 1XTGB 4LF6T 1G90A 2N9DA 1URQD 4HJGH 4XFJA 2R8AA 3OBVE 5DJQC 4EB6E 3I5CA 1KB9H 2XAGB 2UUCT 1U7JA 1AA0A 1IFPA 3L72D 3Q5RA 4UB8O 2PBIA 3L70G 3PGSA 4A98A 1HJ0A 2NW7A 3JTYA 2B89A 3OAKA 2CEAA 5GTIE 5HEUA 2Y9ZA 2HN1A 2RPAA 5LCYA 2FXMA 3VMAA 3Q5SA 5LXTE 4PV1C 3T1YT 1SQVG 2WQYA 1KC8Q 4B61A 2DI4A 1KILA 2Q3IA 5LGTB 1QVGO 2OA5A 1R8IA 2M06A 1NTKG 1M1KQ 3MTUE 2JDIH 4NXMT 2K3RA 3EDVA 4LFCT 1ZR2A 3PTRB 3O1IA 2R88A 3RK3B 1YYCA 1BSHA 3N5LA 4ZXLA 3EAMA 1L0NG 5KAIO 2OYIA 2OTLP 1SE7A 3T8OA 2FFDC 3G9RA 3VE1A 3AE6C 4H13D 1BT9A 4XAXB 5FL0A 5CCHD 5B5EE 4D64A 1JO5A 2RA1A 1N2DC 3M3ZB 2N1TC 1NTMK 1PPJE 2BS3A 5ABFB 2D0UA 2V5DA 5HXCA 5BVZA 2I8DA 2R4NA 4AYMC 3QUJA 5JDMA 2LHNA 2XNXA 3OA7A 5L3CB 4FJOA 2BBJA 1U7MA 4PD4I 1PZQA 2CMRA 5BR8T 1PRNA 1FEWA 2WP9A 2X9XA 2R4OA 1YKHB 2WZIA 4XA4A 1PIXA 3PV0F 2KP8A 2LXCB 2QM8A 4EEBA 3H1IJ 4OH8B 3A0BH 3GN5A 2MBGA 2EHOA 2Q9QA 4AUWA 1UX5A 3K1SA 2PFVA 4YT0A 2J59M 3J9X1 1HXUA 1VL2A 4PV1D 2MAWA 3WU2H 3BQKA 1J1JA 5AVSB 1P84E 2WSCH 3OJAA 3O8ZA 2W6BA 1K04A 2FXOA 3Q5XA 2YKPA 3RYHE 1JB0J 4H0LC 4H44C 3NKZA 3ZT7A 1IK9A 3B5NC 1G2CA 3N9MA 3H1JJ 2J1NA 1EC5A 1URQA 3V4QA 2UXBT 1YBKA 4YTMA 1D1CA 1ZHWA 5AQJB 1GK4A 4I55E 3AXJA 4DIDB 3HUSC 3N4XA 1T6AA 2J5UA 3ZMVB 5HXRA 4H9NC 4RO0A 3UQ4A 2W8ZA 5CJ0A 3WUTA 2V7KA 4BRYB 1LP1A 1BGYD 1R8EA 2IIUA 3PUSA 1G1IA 2Z5IA 4P09A 1YJWP 2FUPA 4N59A 1LVFA 4L74A 2Z6EA 5ETWA 5L3BB 2N1TD 5EK3A 2JR8A 2E5VA 3NWIA 3BRTB 3CX5D 3AE5C 3D70A 1QVFO 2P2UA 4V1Av 3RK2B 4NPFX 3PGRA 1MMGA 3RPUA 3PUGA 4KUMB 2M5AB 2CWOA 1JCCA 5LMNT 2QJYB 4DV0T 1GDTA 2WDRA 3G06A 2HLOA 4IT4A 4HN9A 4PJNA 1IBMT 5CCHA 2ODJA 3WI5A 1YJNP 1BSNA 2J62A 1ZHXA 1GQEA 4JI5T 2XM1A 2DWKA 1LT9B 2K9YA 2KDYA 2HODA 2IBZI 3RK2D 2WAUA 1PV3A 1ZW0A 3HTKA 4YJ2E 1QLED 2WSSH 1HG2A 3UFGA 4DMVA 5CBOA 2M67A 4H0LD 4H44D 5APSA 3C51A 4OYJA 2GK9A 4A5XA 1KFMA 1YQ4C 3B5ND 3KYQA 2XE5A 4KR4A 1XDPA 1SQPJ 3SSUA 5DJTB 4L5GA 1IAPA 3N2GE 4U2ZA 2W81C 5TISE 4GCQA 2CHNA 4IL6X 3CC2P 1USDA 5ABFA 3AA0B 2LSYA 2XJ7A 5KAFH 3HA4A 2YXRB 4DO0A 5KLVJ 3AEEA 1U5PA 3NRXA 5HEGA 3U3IA 4WBNE 3TDKA 3CX6B 3EDUA 1MNDA 3EI0A 5IUXA 1VF5C 2Z4EA 2WDQA 5L47A 3AEGA 3O9XA 1KB9I 1BR2A 1N7SC 2E43A 2ZM0A 3QRCA 3H1IE 3O6QB 1RE4A 2E76C 5AFUK 5IYUA 3RGUA 2I0MA 3JCUE 1J2JB 1LTJC 3L70D 5C39A 1WRDA 3FX0A 1ZP0A 2O1KA 3AE6A 2N2NA 4UB8H 1Q2NA 3OW2O 3R6NA 4EXTA 3L39A 5M1BA 2NTYA 1UGOA 1M1JC 1SQVD 4K3CA 1SP4A 3H1JE 1NTKD 4QH4A 2VQFT 4F6RC 1HNWT 5AQKB 1GK6A 4EV6A 4QMAA 3T0SA 1JY3O 5FY1A 2RH0A 2WSEJ 2W83C 5H6RB 3ZN0B 1KNPA 2H88A 2CXLA 1L0ND 1E54A 2N9YB 3AE8C 1NTZD 2A45H 2LR2A 2IPPA 4HFVA 2M6BA 2K24A 5B66O 3USSA 1DU2A 2WSFH 8PRNA 2J4UP 1GFNA 2KT9A 3R2PA 1Y8AA 4B3MT 2FY8A 2K0LA 2NWBA 4N74A 2J58A 2ES0A 4C00A 1WFDA 1CHUA 4ZS2A 2YIUB 3TLSA 3KZIE 4X1IE 5JDQA 1VF5D 3B5NA 3AEFC 2NW9A 3BRYA 1JUNA 4X62T 4DJGA 2QJPB 1SLQA 3NJTA 4GKJT 2W6JH 1N7SD 1LWUC 2VKDA 2E76D 3HUSA 2JRKA 2E9XC 4LF7T 4LLHA 2WU5A 4QQ1A 2BVLA 3P7KA 3PTZA 3VN0A 3RGLA 1UIIA 4W80A 4TV9E 2R3SA 5IHYA 1PFIA 3KV5A 2GUSA 1JNRA 1Q86Q 4AXPA 2D5UA 2YKSA 2VKHA 2PAJA 1XDOA 4RJWA 4MLKA 2CA5A 4DV1T 1S9KE 4G76A 1SQPE 1K8AQ 4DR5T 4Z90A 3PHLA 4EZHA 4O9BA 5A1LA 4O3ZA 4JEUB 2X9WA 3RYFE 1P4TA 4ZKPA 1T72A 4X65T 4JI8T 4NPDA 2Y0HA 4ADZA 1GFPA 3AECC 3AA0A 1YITP 3PP5A 4AISA 3KDPB 5FXZA 3N7NA 4ERRA 5KLVE 4AQGA 4DR7T 4N6JA 4AI6A 3IA3A 5DQWA 2XQ5A 3PUAA 3DWOX 1X9VA 5APWA 3MZKB 3L8RA 5DL6A 2HPCB 2D2CB 4ZZCA 3H1IG 3I55P 3O6QA 2CBJA 3MD0A 3MP7B 1IC2A 2JQHA 4NUUA 5LGUB 3RL0C 3V2NA 3LK3B 1N7LA 4WVZA 1YQ4A 1X22A 4IIJE 2XG6A 1FC2C 1HGVA 4QX8B 5EE2A 4N58A 1VQKP 3IFMA 2E9XD 1OEDE 5CA1E 2B87B 1YXRA 1PGQA 3CCLP 3A7OA 5DABA 3H1JG 4GK5E 3UUBA 5LYJE 2FJBA 2BBHA 4O49A 4PJLA 3M9HA 2R3CA 3HOLA 4PK6A 2XQ7A 1L0LJ 3M9QA 2N1GA 1FAVA 1FMVA 3CWBE 3TK1A 1QSDA 1UX4A 5TAOA 3V5SA 2Y9YA 1N32T 2VQET 2YMYA 1XTCC 1KNRA 2CBIA 2K4TA 3W67A 1IZNB 5T5FA 2DL1A 4WZXA 2UUAT 3WAJA 1ZEEA 3IF4A 3NXSA 1PPJD 4PK5A 1Y01A 1QUUA 2IWVA 1N8RQ 5L8RJ 3ONXA 2L3LA 4H9PC 2QRXA 4UVAB 3N9PA 5G39A 1FZCB 2JQYA 3RHWA 5FY7A 3UUXB 4L73A 4LFAT 2K9JB 3HW9A 3JAEA 4DV4T 1NKZB 3RL0D 3CMAP 2PJQA 5AQGB 2XASB 1DX7A 1Q82Q 1WMKA 3C4WA 4HWHA 2K88A 4HFCA 3TKLB 1T7SA 2O01H 1AQTA 3HKBE 3AE8A 2I1JA 3BASA 2YMKA 2IFMA 2KWHA 3MACA 3OYZA 3RQWA 1P84D 2MJZA 4O2AE 5J2TE 3BCCE 2VKJA 1SQPG 3D0TA 3HI2A 4EAHA 3PUQA 5JDHA 4Q25A 3CWZB 3PDYA 3EABA 2V6YA 2H43A 4O4IE 2AXTO 4U9CA 2Y8DA 1OVUA 2E74C 2O01N 5E79O 5KLVG 1VQLP 2H7OA 5FNVE 3LK41 2V7QJ 2KMFA 5AW6B 4I7ZC 5JDGA 2A45I 1SUMB 2E75B 1HVVA 1N73C 2HPCA 2H7HA 1WR6A 4L9IA 2OYHC 2K48A 2MTQA 2X51A 5AQOB 4DR2T 5L3FB 4LSHA 1BR4A 5EK2A 5TISO 2B76A 3LK3A 1E79H 4UB6E 1LT1A 3L71J 1FE6A 1PGJA 4EDFA 1Q7YQ 1MIWA 2KZIA 2XE3A 4YTPC 3T97A 3SFDA 3EQ2A 3V4WA 3LK42 2X9KA 2Y0EA 1LNQA 1U4QA 2XSBA 1JY3N 1BXWA 4TWHA 1MMNA 4DZOA 3SRZA 2JEEA 4Y28J 2X9HA 3R84B 3CMLA 2BASA 5LJNA 4PW8A 1JTHB 3NBXX 4JV5T 2W66A 1LTIC 3CX5I 1I6ZA 3P4WA 2NTXA 4DUYT 3JCUO 4U7YA 1L0LE 4XNKA 4DCKA 3EFFK 1OXZA 4RL9A 1NTMJ 2O1JA 4JEHB 1EQ7A 3UPGA 2XU6A 2ZXEB 4IFMA 2DNXA 4EYUA 2QM7A 1YQ3A 4HWFA 3LIDA 5KKZB 1VCTA 2BCCJ 2E74D 1NOHA 1FZGA 3RRWA 5KLIC 1N33T 1L4AB 2ODUA 2XHEB 5FXWA 4LF8T 4LF9T 3CX8B 4CI2B 1UCUA 2IUBA 2R5BA 4PNIA 2IYOA 4TZ4C 3RYIE 3N2OA 5HCMA 4LSEA 5AFUL 3Q2MA 4LSIA 5FVNA 3HD7B 2Y0DA 3U59A 1MIYA 2JQKA 5AQSB 4AYID 2DW3A 2P10A 2ZLYA 4B3RT 1PHOA 3Q9DA 4TLFA 4JI0T 4IL6O 1S4XA 5AQNB 2BKPA 3VZUX 3OVUA 4D5UA 3H1ID 3PE0A 5GTHE 5AQIB 3VZWX 2FBWA 2V26A 3O4XE 3ZCIA 1N36T 2CLYC 2UXXB 1YTZT 3KBUA 1FMWA 3QRAA 2FGQX 4IE7A 1KILB 1VQ6P 5HXHA 2K37A 3H1LJ 1SQXK 3AEAC 1WR0A 4ILAA 4ISTA 1EXIA 5HEHA 2RKLA 3AAIA 2JP3A 2WPQA 3UU4A 4ISSA 4ZKUA 3H1JD 2Q3EA 2XQ3A 3LK2A 3AE7C 1RQVA 2JPFA 4FMSA 4EZ4A 1EDJA 2KINB 4U2YA 3VP8A 2BKOA 1IFJA 2Y7SA 4X1YE 4GKGA 3MKDA 3PQUA 3RBHA 4AKGA 5GONE 2PRNA 1KYOE 1S3JA 1NJIQ 2BEQD 2WJQA 4IOIH 1MIVA 4KJMA 1GL2C 3PLNA 3KVAA 3FXDA 3F2EA 5LHIB 2XAFB 1RF1B 1VQ7P 1LRZA 2VKOA 3L71E 2YDSA 3RKGA 4DR3T 5FMNA 2XPKA 4YJ3E 5LGNB 2IZ1A 3E22E 5CHXA 3CI9A 1LKXA 4DV6T 2IWWA 5DL5A 2M3EA 2I6HA 3GN5B 4LMLA 2HHHT 2UWJE 2F1VA 1ZHTA 4CN4A 5JDFA 1FZEA 4C46A 3PURA 3CCMP 4HYTB 1JTHA 2VL8A 3N9NA 5CFBA 3KINB 2BKNA 1JNMA 1RE3C 4MN4C 3A5XA 1BR0A 1FOSE 1L0LG 1RF0A 1KFYA 2VB6A 1SFCC 2R32A 3Q5EA 1N73A 3GG2A 3CQCB 2E5TA 3F89A 2K9AA 4AIUA 4PJ0O 1S9KD 1SQPD 5J1GA 3H3MA 1NTME 3HRNA 2Y48B 5LG3A 1QLBA 1OX3A 5CCGC 2XTQA 4W7ZA 3E0ZA 1NO4A 1ZHZA 2W6AA 2BCCE 5AVWB 1YD8G 2PRRA 1ZV4X 4YTPA 1L4AA 1LP1B 3M91A 3JC22 4C69X 3L74J 2AXTH 1ZMEC 2AXCA 1S2EA 2OQQA 4IL9A 2RP4A 4DMWA 4AUIA 2NPSC 1EDLA 3S4UA 5E79H 1OEDB 5F3JA 4HFBA 1GL2D 4N75A 2LHRA 4JPZB 4Y99B 3KFWX 2KZJA 1GFOA 3M06A 2PP6A 4QHOA 1W0AA 2ZT9C 3GA8A 1VDFA 1EXJA 4H13B 4EYYQ 5TISH 1HCIA 1H6S1 1CSBA 1VQNP 3AE3C 5AW9B 5HYAA 1NAYA 3H1LE 2W00A 2QJKC 3N9OA 1IJ6A 3RKOA 2C0SA 2HODB 3B8EB 5M4YA 3HTKB 3WUVA 5LP6E 3N9QA 4HH2A 1GU5A 3FZMB 3H3AA 4KBMB 3P50A 1NTZG 1SFCD 3RF1A 1H7CA 5FVKA 1W5CE 5AQMB 1S1CX 2IDOB 2KIKA 3CWBD 5HEJA 4PD4E 3JCUH 2SPZA 5CCGD 4TWDA 5C2TA 1BE3J 1SS1A 3WMM0 1QGKB 3ZJ2A 3T24A 4H9QC 2LSJA 2FYNC 3UUNA 3RYCE 3IF8B 1FJGT 4CTDA 1S94A 3U78A 4PV1B 4YPCA 2ZM8A 4HWIB 3QWOC 2H89C 1GU4A 2W2UA 4NPEA 1RF1A 2NPSD 3L71G 4KT0J 3SWHA 2KOGA 2ACXA 2XZEA 3CCUP 2KSJA 3PUWF 2W62A 1FZFA 3VR9A 4X66T 4MBQA 1GFQA 4CZZB 2ZT9D 3K3OA 4K0KT 4FZMA 1LJ2A 2KLVA 2WITA 1EDKA 4IL6H 2K1AA 1IFDA 3DTOA 3AE2A 3AEBC 4YHHT 4UB6O 5H2FE 2N1TB 5C3JA 2ERVA 2WBLA 2Q6QA 4UXNB 3BCCD 4IGUA 3QOFA 3H1KJ 1NTMG 1X9BA 2BCCG 2V7LA 2C5KT 3GHGC 1Z8UA 2RMZA 4AYDC 1QX8A 3K5BA 1CZQA 3L74E 2QIWA 3V2PA 3BQIA 5IWAT 4B86A 1MKMA 1X79B 1OEDA 1FDIA 3E1IA 3P4QA 3JC6C 3CL3D 1GMJA 2LM2A 3L73J 4UF0B 1P84I 2D9DA 4BAYB 3AE9C 1IJ5A 4OYKA 4J2CA 4G2AA 4OGQC 3F31A 4H0LB 4H44B 4AKHA 3SZDA 1SFCA 3B5NB 1H89A 3HOEA 3CX7B 2JQ9A 2YEVC 4IFDK 5BU5A 2CPTA 2LRKA 1PGOA 3PRNA 3SY9A 3EMNX 4WY4C 1MMDA 2JIWA 3HUSB 3H1LG 3PH0A 2UUBT 2A06D 5CCGA 3P7IA 3I0OA 2WU2A 5G26A 2M3BA 2G0UA 1J1DC 1WYBA 2XY8B 3UTKA 3VP9A 4C7RA 2ZFCA 4U74A 2YO3A 1SA0E 4IDNA 4IDOA 2BEZF 4HFIA 5CBNA 2YOEA 2WM9A 1XWMA 2VK9A 4ANJA 5GTHO 4PAGA 4X1KE 3FBZA 1GW4A 2DHRA 1L0LD 2NRGA 1WCRA 1W2EA 4YHJA 3ZMTB 3ZDMA 2L91A 3C9IA 2IC9A 1PPJG 4P1NA 1BE3E 1Y9BA 3U1CA 2AEFA 4PJ0H 5BU8B 5EZYE 2N2MA 4LSFA 3PJSK 3T20A 1KB9E 2XQ4A 1KEYA 5L3EB 4ZS3A 2XNDH 2CHOA 3AE3A 1CI6A 4IL4A 1EZ3A 1YIJP 3JCFA 4FESA 5JR9C 3JC6D 5APXA 5G3AA 3FWLA 3N9LA 4KI0F 2DLRA 1VPCA 3X1DA 1A02F 1VRBA 1YS5A 4OGQD 2DWGA 3SYBA 2K5BB 3SZVA 5HXSA 4PR7A 3ZC0A 4O4JE 1KQSO 3FYXA 3SWFA 2FFDA 5L3GB 2KWIB 4TNVA 4CI3B 5CMZA 3M0AA 3RX6A 2N1TA 2LOPA 1LTBC 3MA9A 5AVRB 1VOMA 1KZUB 3TYYA 3D6ZA 1M7KA 4K3AA 5LA6E 4IE4A 3H1KE 4XZCA 3GMIA 2H89A 5LG4A 2WB5A 2L9QA 5FXXA 4HE8A 3ONLC 4JI2T 4GDOA 4O2BE 1VF5B 1RH5B 2HFED 3CWBJ 4U3CA 3CCSP 3FHNA 3PUZF 3L74G 2CM0A 5KAIH 2FYUK 1N7SB 2N9BA 1FDMA 1NU1D 2PFXA 2KLUA 2E76B 4WNKA 4ZI3C 2UXDT 2LKHA 3FZHB 1X79A 3MIWA 1KYOD 1LTJB 2LXBA 4YXDC 4UF0A 3L73E 3POQA 3G6EP 1E7PA 4Z91A 4PJMA 3CXHE 1M1JB 1QJ9A 2KSEA 4AQRD 2ZMAA 2JJLA 3CMEP 2HG5D 3ABVC 3ONJA 4DV5T 3L71D 3VMZA 2YDQA 3ZPOA 1VQ8P 2LSGA 5AW0B 1OSMA 4AZLA 3QH9A 2BDEA 3Q3DA 3L4FA 3NFQA 2W0GA 3LW5H 1Q90D 5CGMA 1S35A 3GHGA 3BVHA 2LLYA 5AQRB 3SYSA 4CXXA 4ZI2C 3K3NA 4U31A 2OYOA 3CX5H 1G73A 5AW2B 2XAQB 3BCCJ 4WW0A 3NSGA 1OW8A 2QA7A 3AE5A 4EOTA 3PU3A 4OHFA 5GTIO 4YFSA 2N2LA 1Y64B 3L35A 4GT1A 3C4XA 4KHPT 3AE9A 3SOLA 3G4SP 4UB6H 2V6YB 3AE4C 3MGNA 1HNXT 3WI3A 4G75A 1BE3G 2WSFJ 3KV9A 1NTMD 2C5JA 1DIPA 3VKGA 3RBXA 1THQA 4XNLA 2BCCD 4ZZBA 1T98A 1LWUB 3I1AA 4UVBB 1D0XA 2ZXXA 1OIPA 5FL1A 2E9XB 3RIFA 1I94T 4DT0A 3CCRP 2YDRA 1SQQK 2F4VT 1HXTA 4YXWH 1YI2P 2LFUA 5B5EO 1JMBA 4GHBA 1MM4A 3K3QC 5L3DB 1HX1B 4JI7T 1LTAC 2FJEA 4AQYT 3T97B 1M90Q 3UQ7A 3G71P 1SQXJ 5LBQB 1VQMP 3FB2A 1S5LX 1SHZC 4U7IA 2MKVA 2WMOA 3RIAA 4E7SA 1HFAA 3KBTA 3RC3A 4Z1MH 3ZYMA 5FXVA 4C7NB 4LFBT 3H1LD 1AQ5A 2WMMA 4ZI2D 2A9UA 3H1KG 4TNWA 3ETUA 2POHA 1SQBJ 1FDOA 1QJ8A 2KI7B 3B13A 5AVUB 3M0DC 2MOZA 1HS7A 2XTRA 2H7VC 5KAFE 3H6PA 3CC4P 2XQ9A 2VASA 2FKWB 1KQGB 2KUBA 3V6IA 1HBWA 1HX8A 2V7IA 1XMOT 1N7SA 4QH1A 4OK0A 3U1AA 3RL0B 2W63A 5GTHH 4W7YA 4ILCA 1LTJA 4PD4D 3TLUA 3OKQA 2D0TA 3P4RA 3SWKA 3L73G 4I43B 4HEAA 4GCPA 4KX6A 3MUDC 1HTJF 4CN6A 1M1JA 1JNZA 2CWYA 4F8HA 4UB8E 2XAHB 1BDDA 5JTGA 3VKHA 4FSPA 4L76A 3WUUA 4GYRA 1YKEB 1FZAA 2XQ8A 4OFZA 4UEMA 1S5LE 5ADXL 2YN6A 3ZMZB 3TLVA 4EOZB 4HFHA 5KLVK 3B57A 5HWYA 2AEMA 1VQ9P 5AQHB 4QKNA 1ZRTE 3P4SA 4AKRA 3PJAJ 1B7TA 2Z5HA 5AVQB 3DA4A 5PRNA 4U3FD 2WPSA 2E75C 3LK2B 4JI4T 3QK6A 3AEFA 3ABVA 2NR4A 1EZVE 1NU1J 4FZLA 5H6QB 3MXZA 4U33A 3KVBA 2R89A 1LWUA 4KHXA 5CA0E 5APUA 5FKYA 2E9XA 2V7JA 2BG9C 3ESLA 5L2LA 3L74D 3UIAA 2NZ2A 4JYCA 4QXHB 2IDBA 4X5TA 3SFEC 5G38A 4UV9B 1HH0A 5LOVE 2F1TA 5KJ7C 2P67A 5B66H 2V8SV 1NENA 5AQQB 5E0OA 1NWMX 3FXDB 2CRBA 2OLTA 3RIUC 3GWHA 1USEA 1OW6A 5AVXB 1BDCA 1L2PA 1UURA 4O4LE 5AVTB 1JY2P 2O01J 4M1PA 4B3TT 5JH7E 2IBZD 1E2AA 3TLWA 1SQXE 3A3YB 1DEEG 3ETVA 3FZLB 2A06E 2YXQB 4PK4A 4I6MC 4YTNA 1UIXA 1KTMA 4C7NA 1U57A 3AECA 2LEHA 3OTOT 5C8YE 2E74B 3UULA 1OWAA 3P8MC 3VRBA 2IHR1 1KD1Q 1IJDB 4I7ZB 1SQBE 2ZYAA 2WS3A 1FU1A 4JUYA 3VY9X 2Q5UA 3L3PA 2VWAA 4YLHA 5TJHA 3CVRA 1PP9J 3CWBG 1N73B 3G3ZA 4AYEC 2OYHB 4K0UA 1Y47A 2XDJA 3IEEA 5HWXA 3P32A 1W09A 4TX5A 3E1RA 2E42A 3ZT6A 1ORMA 4NIQA 1NWQA 5GTIH 3KQGA 1MM5A 3PF1A 4Z3TA 3F57A 2WJRA 1BE3D 1IK7A 2JO1A 3ZEFB 1XMQT 1PGPA 3AA1A 1QL2A 1KB9D 3C98B 1TU3F 4COFA 1HF8A 5FY0A 5KJ7D 3C64A 2WQYC 1H0TB 3NZPA 3PORA 3IR9A 4E7ZA 2NW8A 2QTKA 4ASKA 3H1HE 2I59A 1LTSC 3FBLA 2HYNA 5FP3A 5B5EH 1T3JA 4DBRA 2OYIC 4ZOLE 4UVCB 3BCCG 3KZIO 4KR8A 3Q5DA 4GOEA 4ILBA 2PGDA 1GFMA 3UU5A 5JREA 2ZVOB 3M65A 2WVPA 1X8YA 2WZHA 2A45G 1NKNA 5KLIB 5AW4B 1H88A 2LRLA 5JRCA 4CI1B 4I4TE 3H1KD 1J1EC 3DJBA 1MUUA 1EZVG 3DZMA 1NU1E 1E1HB 3V2RA 4WBAA 3FXEB 3Q1MA 4QH5A 2WT7B 1XNRT 2C0WA 5IYZE 1NEKA 1OW7A 2ZAEB 2JQQA 4IFFA 1P84H 2CLYB 2EHOC 2Q9QC 3C4ZA 4YSXA 3L73D 2UXCT 1M56D 2QGSA 5L4EA 3RBZA 1JMMA 3C8VA 3CXHD 5KMGP 1SQXG 3TGUJ 3JAFA 3I9YA 2A06G 2QA4P 3VMXA 3LDQB 2VL0A 3I56P 1D0YA 3RLFF 1CW5A 2KLQA 4H9SE 2X67A 3QC9A 1URQC 4GYSA 3GF3A 3G7GA 2KZ7A 2V6XA 1BR1A 1G1JA 2FYZA 3S4RA 3EHZA 5HCJA 1SQBG 3L36A 4U7JA 4A97A 1OFCX 4C91A 1KYOI 3F5HA 1ZHYA 5AVYB 2ZYDA 2DCFA 2OTJP 2KYVA 2KSRA 2P9BA 1PP9E 4U3FJ 5KJ7A 2OYHA 1GL2B 2JMKA 2ZYGA 1KFNA 2P58A 1V9DA 3RIUA 4JI6T 5JDLA 3OYXA 3ZMUB 4CN1A 5APQA 1FJPA 5L4HA 3I9WA 1LTTC 2M0BA 3PUXF 1Q9FA 3ZN1B 1SQVK 1NVOA 3PGUA 2QE7H 2K3WA 3NVOA 2E2AA 1NTKK 4IREA 1H0TA 4X64T 5KAFO 2C5IT 2EHOD 2FXPA 3LIEA 2Q9QD 5LNKA 5AW8B 3S9OA 5F5WA 2LOSA 4KRAA 1L0NK 4I2LC 1IBKT 4L75A 1SFCB 3PRJA 3RK3C 2NP9A 3LSVA 1NTZK 1ZKEA 4AKIA 4DOJA 4HFDA 2UU9T 2Y0KA 4FI5A 1K73Q 3D71A 3PUYF 4GK0E 5KX5E 2FJAA 3EUHA 3CD6P 1BCCJ 3L09A 3CCQP 3A2SX 4QWNB 4JLEA 2XMXA 1KQFB 6PRNA 3CCVP 3P8CE 5APYA 4L0RA 2ZFGA 3ANWA 5LJMA 4TUYE 2LJLA 3L75J 2I1KA 2XQYA 3ZT5A 2JMHA 3HKEE 2NPSB 4DUZT 1KN7A 2FYUJ 3AEEC 3AA7B 1NU1G 3BQLA 3FXEA 3K8PC 3II6A 4KHZF 1S5LO 4GODA 1FBMA 2IW5B 1HGZA 2WT7A 4O3WA 3IN6A 3AEGC 2ZT9B 3KXDA 2R6GF 5JVDE 2KXPB 3POXA 3R4YA 4H9OC 1RE4C 4TV8E 2L5GB 4WYVA 5APTA 1AVOA 5AQTB 1HR0T 1ZP0C 4WWIA 1CI6B 3AEAA 3A0HE 2PTFA 2X9YA 2X68A 4CXWA 4BXLA 2QJKB 1L0VA 1ZLLA 1JY2O 3HE4B 3HE5A 3TGUE 4FT6A 3GF7A 3AE7A 1K9MQ 4RKUJ 2SPCA 3RK3D 2FFDB 4C4VA 4YY3T 2VURA 2Q9IA 3ZJ1A 4XBFB 5AW7B 4E1SA 4ZMDA 4GOUA 2H88C 4DR1T 1IFIA 1PP9G 2WWWA 5ABEA 2FYNB 1ZRTD 3ZYLA 5ADXK 4U3FE 1W9RA 1GL2A 3LFMA 2HR3A 2KNDA 3KZIH 3CXHH 3P4PA 3TNUB 4E1TA 2D2SA 2ITAA 4P0AA 2LSIA 4HB1A 4KP3C 3RK2C 2OTKE 4P0BA 4BWNA 2HN2A 4X20E 4RLCA 1EZVD 2QJYC 1XZYA 3SS1A 4YSYA 3PUVF 1SQQJ 2V4HA 2KNCA 4D6TJ 2QSIA 4IE0A 4AKMA 1FIOA 1LGHB 3C1LA 3VMYA 2IFNA 3SY7A 4N78E 2JWDA 3AAAA 5DQVA 3PU8A 1Q81Q 3IBPA 2ZVNB 3VE2A 1RE3A 1LT9C 4NUVA 2IBZE 2WZ7A 4EIJA 2C9LY 5JQGE 1KMIZ 3LJCA 3AA6A 2CPBA 2WSCJ 1UK5A 2R4PA 4OX9T 1BH3A 2Y0CA 1K05A 2B9BA 1SQXD 3A8YC 2W67A 1BCCE 3S1KA 4UIGA 2BZBA 3GHGB 1CUNA 3DA3A 2WPVB 1VQOP 2W4XA 2KS1B 4JBZA 3PQSA 2LT3A 3LBXB 2LKMA 1Z56A 2G3AA 3L75E 1H8AA 5J2UE 1D1BA 2NPSA 2YKOA 1SQBD 1D0ZA 4HKZH 4LMJA 3AA7A 5F8PA 1WYCA 1T16A 2FYUE 1YTZI 5DJUB 3D6YA 1FJKA 4TT3H 1VCSA 1OMIA 4RJTA 2AXTE 1W0BA 5KDMC 3UU2A 2JKVA 4OGQB 3I0QA 4IHJE 1R5SA 1N34T 5E79E 4MHCA 2KXPA 5DL8A 3VZTX 2BG9E 3CPWO 1SVFA 1GZLA 1MFZA 3JADA 5LHHB 4WY4B 1MNEA 3QB5A 1ZV8A 2X0YA 4IDZA 2C9NY 3V5UA 3HE4A 2JJ9A 3TGUG 1JOCA 1J1DB 2CE7A 1RY3A 3CQGB 3CCJP 1IFMA 4EI2A 4NPPA 1GD2E 3KDSE 3FZKB 2WSEH 3H32B 2CK3H 3BS0A 2VRSA 3GP6A 1T8BA 3NTNA 3H1HD 3RRCA 1D7MA 4DBQA 1DH3A 3AAEB 2FGRA 4WY4D 1W2BO 5D5DA 1T1LA 1QL1A 4JI1T 3L72J 1M7LA 3AVRA 3UU6A 4U3FG 1M57D 2V7MA 4NXNT 3HKCE 1IO4A 4RESB 2WCAA 4AYCA 4ILUA 1T8ZA 3TNUA 1J5WA 2CCQA 3E08A 2XE2A 1WT6A 1HNZT 5JR9B 1VQPP 1DEBA 3CLQA 3FGAD 2IC6A 2YIUC 2QEXP 4H63V 2O4VA 1E5WA 2WWVA 1SQQE 2KK7A 4ASVA 4D6TE 2W61A 2WWUA 2MHLA 2QJPC 3VTPC 3AE1C 1S5LH 2IZ0A 4I50E 2YPVA 2YU1A 2WVRA 3VY8X 2A3DA 2WPRA 1DD4A 1ZN5A 3UU3A 3A0BE 1JM0A 4ZEYA 3AEBA 3GLMA 4TWFA 3AB3B 1OVRA 2IBZG 4BRYA 1X0TA 3POUA 4LF4T 1KILE 3KV6A 4C90A 1J5ET 4JYAT 1FS0E 3WU2E 4JBWF 4GF4A 4IL6E 2ZM2A 4FQEA 4HFEA 5J0ZA 3IAOA 1FOSF 1BCCG 2A72A 5K5GB 2E5YA 2KB7P 3HL6A 5AW1B 2QVAA 2M07A 4FZNA 2M5AA 3VRAA 2KS1A 3LBXA 3VOPA 4IE6A 3DP7A 2G8YA 3L75G 3CQXC 3UUMA 2H8PD 2W27A 5HEOA 1MV8A 2ODVA 2FYUG 5AVVB 3L37A 4AKRB 1ZR4A 4KMCA 1DD3A 1PP9D 2FJDA 5AQUB 3CXHI 5AVZB 1LT9A 1JY2N 2D2CC 2OGUA 4GOFA 3TLTA 3H37A 3A7MA 3ZMSB 2LE8A 4WY4A 4DNDA 4ZI3D 2Q7CA 2GUVA 3KPEA 2IX7C 3SFDC 2XAJB 5FVLA 1HJBA 1HWTC 4HTEA 2ACZA 3ZC1A 3BRZA 4BA9A 5CJ4A 4UV8B 2BVMA 2GM4A 3LG7A 1BGYJ 3PJAA 2XE1A 2L8KA 3H32A 3LW5J 4DVDA 1MZ9A 2GA1A 2V1DB 2XQAA 1MFTA 4OWFA 2QYWA 3O1JA 4QXBB 3AAEA 4CXYA 3KHUA 5FYMA 3W68A 2YNKA 1ZHCA 3WI4A 2YNYA 4JFBA 3L72E 3A0HO 2WDVA 1MMAA 4XE5B 2R44A 3K19A 4GCSA 2Y6XA 1QJPA 4QXCB 1ZOYC 3P8CD 1YQ3C 5GV0A 2IMLA 1AJYA 2CPSA 2LHFA 2MYSA 2JMMA 1JEKA 5JR9A 4PJ0E 4JI3T 4HKAA 4LF5T 4D65A 2LSKA 3ZLIA 1FZCC 4JF7A 3ZCJA 1SQQG 5EK4A 4D6TG 1OVVA 4N3YB 2XTLA 2OMFA 5ABGA 2D2CD 5H2FO 1HTLC 2AEJA 4AFKA 3ZSSA 3A2AA 3NZQA 3ZSTA 2XQ6A 3RC8A 2XUEA 2XSAA 3AA1B 4UELA 3UT5E 5KTBA 2J47A 1D1AA 2ZLDA 3VYIA 2FBWC 2GE4A 4WBOA 5CB4E 4O4UA 1SQPK 2UXNB 4A56A 5BMVE 4DV7T 2WMNA 2W90A 2XKMA 2XM2A 5LMUT 2XV5A 2RN0A 3TGUD 3RK3E 3H1HJ 1O3XA 5HXEA 5HAXA 2YU2A 1NGMB 2MPKA 3RQUA 3ZKRA 2J1DG 2V7QH 4F4BA 4BJNA 1EDIA 3UU8A 1KYOH 3M9BA 2LM9A 4R4MA 1HG5A 3FWNA 5KXJA 2E8IA 2YO2A 2HPJA 3AE1A 3KV4A 1N86A 3AVSA 4LGDE 2X0LB 4YXDA 4MALA 3HKDE 1RHZB 3L70J 5KAIE 4FRTA 2Y2XA 4FUVA 4G63A 2PORA 5JRCB 4DV3T 2PG8A 1SQVJ 1A02J 4QX7B 4AQFC 2JWAA 1NTKJ 2HPLA 3ZYKA 4YSZA 1GW3A 2X27X 4IE5A 1M62A 4B3ST 3QNUA 4EEDA 3CCEP 4A7PA 3CKDA 4FRXA 1L0NJ 1VQ4P 4ZHQE 4LMKA 4CPGA 1BGYE 4N78D 1NTZJ 2VVNA 3N2KE 4GIWA 3H25A 1OZHA 3NMDA 2M8RA 2E5LT 4HGAA 3NRYA 1MPFA 3CX5E 3GMAA 4LC1A 1US7B 3AE4A 1RF0C 5JDPA 3L72G 5DL7A 1AV1A 4ZI7E 3O1HA 1EZVI 2KZ7B 3AEDC 2B1EA 1BCCD 4AYNA 4CQIA 2ZM6T 2HH7A 1KK7A 2J4GA 3GW6A 2F1CX 5KKZC 1VQ5P 4RJXA 2YK0A 5LHGB 2BG9B 2BS4A 2AXDS 5JDNA 3B71A 1T3UA 1IFNA 1L4AC 3L75D 2ZJSE 3VR8A 3O0EA 4UR9A 1KQLA 4DR6T 2FYUD 5ABHA 1OPFA 4HWCA 2B87A 3EVYA 3RL0g 2WY2A 2E75D 4BJMA 3HD7C 4AKLA 1S72P 1FZBA 2OV9A 3OPCA 1RQUA 1T2KC 3TF5A 3V2QA 2MNHA 2BS2A 3WAKA 3T1HT 1ZXGA 3CIRA 3QB5K 1WRGA 1NAFA 4FSOA 1HUCA 1KV4A 3TSIA 3Q5WA 1YHQP 1AJ3A 3EFGA
chains in the Genus database with same CATH topology
4L0RA 4MFRA 2ZFGA 2E9XD 5L3EB 4ZS3A 3ANWA 5LJMA 4FOZA 4TUYE 2LJLA 3VU7H 5CA1E 4O4XA 2XQYA 1IZNA 1EZ3A 2JMHA 5DABA 3HKEE 4FESA 4GK5E 5JR9C 3JC6D 4TN7B 5LYJE 3AA7B 3N9LA 4EIWA 3BQLA 3K8PC 4PJLA 4Z8XA 4O49A 2DLRA 4H63H 3J7Yq 1VRBA 1YS5A 4PK6A 3HOLA 1HXXA 2NOXA 3MK7C 2IW5B 2WSSV 2DWGA 3SYBA 4O3WA 2K5BB 3C50A 5HXSA 3SZVA 3ZC0A 1LVKA 2YINA 4O4JE 3FYXA 1G8XA 2N1GA 5L3GB 5JVDE 2KXPB 1FMVA 2CXDA 2KWIB 1Q9GA 3POXA 1QSDA 4H9OC 3BK9A 1UX4A 5TAOA 3V5SA 1Z0PA 4TV8E 4CI3B 3RX6A 3ANWB 2K4TA 1IZNB 5T5FA 2LOPA 3MA9A 2X9YA 1VOMA 2X68A 4CXWA 3WAJA 1ZEEA 3UAQA 4PK5A 5LA6E 1QUUA 4IE4A 4FT6A 4XZCA 3ONXA 2L3LA 3GMIA 4H9PC 4UVAB 4JCHA 3N9PA 4PUXA 5LG4A 2L9QA 5FXXA 4HE8A 4PFOA 2Y0LA 4O2BE 2SPCA 5FY7A 1YW0A 3UUXB 3IHRA 3FHNA 4H9RC 2CM0A 3HW9A 3ZJ1A 4XBFB 2PJQA 3HR0A 2XASB 4WNKA 4ZI3C 5LBMA 4E1SA 4GOUA 3C4WA 2X66A 1X79A 3V8UA 3TKLB 3RH3A 3VHLA 3ZYLA 5ADXK 3HKBE 4UF0A 3MJXA 4PFPA 3LFMA 3POQA 2KWHA 3OYZA 2KNDA 3MACA 4PJMA 4O2AE 4E1TA 5J2TE 2D2SA 1QJ9A 4P0AA 2ZMAA 2LSIA 2VKJA 3D0TA 3HI2A 4KP3C 4EAHA 3TZGA 3PUQA 5JDHA 4P0BA 7PRNA 4EYYR 3CWZB 3PDYA 3UFEA 4X20E 2KC0A 4RLCA 2IAKA 3ZPOA 2LSGA 4RLBA 1OSMA 4AQFA 3SS1A 2W80C 4O4IE 4AZLA 2BDEA 2H3RA 4U9CA 2Y8DA 2W0GA 2CXFA 3W15B 4IE0A 4AKMA 1FIOA 1S35A 4B6XA 2H7OA 5FNVE 3LK41 3SY7A 4O8SA 2KMFA 4CXXA 3SYSA 1WLXA 3K3NA 5DQVA 4ZI2C 5JDGA 1KNZA 3AAAA 3PU8A 1G73A 3IBPA 3VE2A 2A2FX 2XAQB 4WW0A 3NSGA 2EHOB 2Q9QB 4NUVA 2QA7A 4O3YA 3PU3A 4OHFA 4L9IA 4YFSA 1WR6A 2N2LA 5JQGE 2K48A 1Y64B 3LJCA 3AA6A 2MTQA 2X51A 3C4XA 3C5OA 3SOLA 5L3FB 4LSHA 1BR4A 5EK2A 4O3XB 1BH3A 3LK3A 3WI3A 4G75A 3KV9A 4O4HE 2C5JA 1MIWA 2XE3A 4UIGA 2BZBA 1CUNA 3VKGA 3LK42 3KVDD 1THQA 3DA3A 4XNLA 1U4QA 1T98A 1BXWA 3AAAB 3PQSA 1MMNA 2LT3A 1D0XA 3I1AA 3LBXB 4UVBB 2E9XB 3SRZA 5J2UE 1D1BA 3HWBA 1D0ZA 2X9HA 3R84B 3AA7A 3CMLA 5F8PA 1WYCA 5LJNA 4PW8A 3CPZA 3NBXX 1HXTA 3AA6B 5KDMC 2LFUA 4BUMX 4U72A 4PJJA 3UU2A 4GHBA 1MM4A 3I0QA 2NTXA 4IHJE 1G90A 2N9DA 4XNKA 3K3QC 5L3DB 3OBVE 4MHCA 5DJQC 4EB6E 2KXPA 1OXZA 2XAGB 5DL8A 4RL9A 3VZTX 5LBQB 3FB2A 2PBIA 4JEHB 1SHZC 3UPGA 2NW7A 2DNXA 2WMOA 5LHHB 3JTYA 4E7SA 4EYUA 1HFAA 1MNEA 2CEAA 3KBTA 3RC3A 3ZYMA 4IDZA 5FXVA 5LCYA 3RRWA 3V5UA 5LXTE 2ODUA 2XHEB 2JJ9A 5FXWA 4ZI2D 3CX8B 4CI2B 4B61A 1UCUA 2CE7A 2DI4A 3ETUA 5LGTB 3CQGB 2OA5A 4PNIA 2M06A 4TZ4C 3RYIE 1QJ8A 3N2OA 4LSEA 5AFUL 3KDSE 3Q2MA 3B13A 4LSIA 5FVNA 1MIYA 2MOZA 3EDVA 1HS7A 2XTRA 4AYID 2H7VC 3PTRB 3GP6A 2VASA 2ZLYA 3O1IA 3RRCA 1HX8A 2V7IA 3AAEB 4DBQA 3N5LA 1PHOA 2FGRA 3Q9DA 4OK0A 3T8OA 3VZUX 5D5DA 4D5UA 2W63A 3PE0A 3VE1A 3AVRA 3VZWX 3OKQA 2D0TA 1BT9A 2V26A 4XAXB 3O4XE 3ZCIA 2V7MA 2CLYC 2UXXB 3HKCE 4HEAA 4I43B 3KBUA 1FMWA 3QRAA 4GCPA 2FGQX 4IE7A 1HTJF 4ILUA 5HXHA 4D64A 2RA1A 2CCQA 2CWYA 3E08A 4ISTA 2XE2A 2D0UA 5HXCA 3AAIA 5JR9B 4AYMC 4ISSA 3QUJA 2IC6A 2LHNA 5JDMA 4H63V 2XAHB 2O4VA 5L3CB 4FJOA 3VKHA 3LK2A 4FSPA 2JPFA 4FMSA 2CMRA 2W61A 4EZ4A 2WWUA 4GYRA 1PRNA 2MHLA 2KINB 1FEWA 1YKEB 2X9XA 4OFZA 1YKHB 4I50E 4UEMA 2YPVA 2YU1A 3VY8X 2Y7SA 2A3DA 5ADXL 3ZMZB 4X1YE 4EOZB 3MKDA 3PQUA 3RBHA 4AKGA 3B57A 3GN5A 5GONE 5HWYA 2PRNA 2MBGA 2EHOA 2Q9QA 4QKNA 1UX5A 3AB3B 3POUA 2PFVA 4AKRA 3J9X1 1MIVA 3KV6A 1HXUA 4C90A 3BQKA 1B7TA 3KVAA 3OJAA 4GF4A 3Q5XA 2ZM2A 3F2EA 3RYHE 3DA4A 5PRNA 5LHIB 2XAFB 3LK2B 1LRZA 2VKOA 2A72A 3N9MA 3QK6A 5FMNA 2J1NA 3HL6A 4YJ3E 5LGNB 2M07A 4FZLA 1ZHWA 1D1CA 3MXZA 3E22E 5H6QB 1LKXA 3KVBA 4I55E 4FZNA 3SY9A 5CA0E 3LBXA 5DL5A 3ZMVB 4IE6A 5HXRA 3DP7A 2E9XA 2V7JA 3CQXC 3ESLA 3GN5B 4H9NC 3UUMA 5L2LA 2F1VA 1ZHTA 4QXHB 5JDFA 2V7KA 4UV9B 2ODVA 5LOVE 3PURA 4AKRB 2F1TA 3PUSA 2VL8A 3N9NA 4KMCA 3KINB 4P09A 4N59A 1LVFA 2Z6EA 1NWMX 5E0OA 3FXDB 5ETWA 5L3BB 3A5XA 5EK3A 3GWHA 1BR0A 2VB6A 4O4LE 3CQCB 4V1Av 2K9AA 4M1PA 5JH7E 3H37A 1MMGA 3RPUA 5J1GA 3ETVA 3PUGA 4KUMB 2CWOA 3ZMSB 2LE8A 2Y48B 4DNDA 4ZI3D 2XTQA 3E0ZA 1ZHZA 4PK4A 2XAJB 1YD8G 1ZV4X 2LEHA 5C8YE 3UULA 1OWAA 4HTEA 3ZC1A 4C69X 4HN9A 4BA9A 4UV8B 2BVMA 2RP4A 3LG7A 4PJNA 4DMWA 3WI5A 2ODJA 3VY9X 2XE1A 4JUYA 1ZHXA 4AUIA 2L8KA 3L3PA 2DWKA 2VWAA 3S4UA 4YLHA 4DVDA 2KDYA 2V1DB 3CVRA 2WAUA 5F3JA 3O1JA 4QXBB 2LHRA 4AYEC 4K0UA 4YJ2E 4CXYA 3AAEA 1HG2A 3IEEA 3KFWX 4DMVA 5HWXA 4TX5A 5FYMA 1GFOA 1ORMA 2YNKA 2M67A 4OYJA 3C51A 1ZHCA 2GK9A 4KR4A 4QHOA 2XE5A 3WI4A 3GA8A 1MM5A 4JFBA 4Z3TA 3F57A 1MMAA 4L5GA 1IAPA 3N2GE 2W81C 3K19A 4GCSA 2Y6XA 3ZEFB 1QJPA 4QXCB 3AA1A 1HCIA 1H6S1 3P8CD 3C98B 5HYAA 4GCQA 5GV0A 2W00A 2LHFA 2MYSA 3N9OA 2JMMA 3AA0B 2LSYA 1IJ6A 3RKOA 1HF8A 2C0SA 3HA4A 5FY0A 5JR9A 4HKAA 3C64A 1U5PA 3NRXA 4DO0A 4D65A 2LSKA 3NZPA 3U3IA 4WBNE 5LP6E 5M4YA 3ZLIA 3CX6B 3EDUA 3N9QA 4E7ZA 3PORA 2NW8A 3ZCJA 2QTKA 3H3AA 5EK4A 4KBMB 4ASKA 2XTLA 1MNDA 2OMFA 1H7CA 2I59A 4AFKA 3O9XA 3NZQA 3FBLA 1BR2A 3RC8A 2ZM0A 3QRCA 5FP3A 2XUEA 4DBRA 3AA1B 4UELA 4ZOLE 3UT5E 5AFUK 5IYUA 4UVCB 1D1AA 2ZLDA 4KR8A 3ZJ2A 3T24A 4H9QC 1WRDA 2LSJA 1GFMA 5JREA 2GE4A 3UUNA 3M65A 4WBOA 3IF8B 5CB4E 2N2NA 3RYCE 4O4UA 1S94A 3R6NA 3U78A 2UXNB 4EXTA 4A56A 5BMVE 2ZM8A 2WMNA 2NTYA 5JRCA 4CI1B 4I4TE 1O3XA 3DJBA 3SWHA 5HXEA 5HAXA 2ACXA 2YU2A 2W62A 1E1HB 2J1DG 3FXEB 4F4BA 4BJNA 4F6RC 3T0SA 4MBQA 2LM9A 1HG5A 5FY1A 5IYZE 4CZZB 1GFQA 5H6RB 3ZN0B 2E8IA 3K3OA 2CXLA 4FZMA 2HPJA 2JQQA 3KV4A 1E54A 3AVSA 2X0LB 4MALA 4HFVA 3HKDE 2K24A 3DTOA 2CLYB 4FRTA 2Y2XA 2EHOC 4FUVA 2Q9QC 3C4ZA 4G63A 2PORA 2QGSA 5JRCB 8PRNA 2J4UP 1GFNA 2KT9A 2WBLA 2ERVA 4UXNB 5KMGP 2K0LA 2NWBA 2PG8A 4IGUA 4QX7B 3I9YA 2ES0A 4AQFC 1D0YA 4ZS2A 2HPLA 4X1IE 2KLQA 4H9SE 2X67A 3ZYKA 3QC9A 5JDQA 2NW9A 2V7LA 2C5KT 4GYSA 2X27X 2KZ7A 3G7GA 4IE5A 4AYDC 1BR1A 2VKDA 4FRXA 3CKDA 2JRKA 2E9XC 4ZHQE 4C91A 4QQ1A 4N78D 1ZHYA 2BVLA 3BQIA 4GIWA 3N2KE 2DCFA 4TV9E 2P9BA 3JC6C 5IHYA 3KV5A 4UF0B 4BAYB 4OYKA 1IJ5A 2JMKA 4J2CA 4HGAA 3NRYA 4G2AA 1V9DA 2D5UA 2VKHA 4AXPA 1MPFA 4RJWA 1US7B 3F31A 4MLKA 5JDPA 5JDLA 3OYXA 2CA5A 4AKHA 5DL7A 4ZI7E 3SZDA 4G76A 3HOEA 3O1HA 3CX7B 2YEVC 3ZMUB 2KZ7B 4AYNA 2B1EA 4EZHA 4CQIA 5A1LA 4JEUB 3PRNA 4O3ZA 2X9WA 2HH7A 3I9WA 3RYFE 1P4TA 3EMNX 1KK7A 1MMDA 1Q9FA 3ZN1B 2Y0HA 4RJXA 4ADZA 1GFPA 2YK0A 5LHGB 3P7IA 3I0OA 3AA0A 5JDNA 5G26A 2G0UA 5FXZA 3O0EA 4ERRA 1WYBA 4AQGA 4AI6A 3UTKA 1OPFA 2C5IT 4U74A 2EHOD 3EVYA 1SA0E 2Q9QD 5LNKA 5DQWA 3PUAA 4BJMA 2WM9A 2LOSA 2VK9A 3MZKB 4AKLA 4ANJA 4KRAA 5DL6A 4PAGA 4X1KE 3FBZA 2NP9A 2DHRA 2MNHA 1ZKEA 4AKIA 3WAKA 4NUUA 4YHJA 3ZMTB 5LGUB 2Y0KA 4FI5A 4GK0E 5KX5E 3LK3B 3EUHA 2IC9A 3L09A 1NAFA 3A2SX 4FSOA 4QWNB 4IIJE 4JLEA 5EZYE 2N2MA 4QX8B 3Q5WA 1AJ3A 2XG6A 2XMXA 4LSFA 4N58A 5EE2A 6PRNA 3T20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAE A;  3LK4 2;  1IZN B;  3LK4 1;  1IZN A;  3AAA B;  3AAA A;  5ADX K;  5ADX L;  3AA7 B;  3AA7 A;  3AA1 B;  3AA1 A;  2KZ7 B;  4AKR B;  5AFU K;  2KZ7 A;  3AA6 B;  4AKR A;  3AA6 A;  5AFU L;  3LK3 B;  3LK3 A;  3AA0 B;  2KXP B;  3AA0 A;  2KXP A;  3LK2 B;  3AAE B;  3LK2 A; 
#chains in the Genus database with same CATH topology
 4MFR A;  1KIL C;  1ZOY A;  4FOZ A;  3VU7 H;  4O4X A;  3MHV A;  1IZN A;  4K35 A;  3M0D A;  4TN7 B;  2R5D A;  3MZW B;  4EIW A;  4GIF A;  4Z8X A;  1KOR A;  4H63 H;  3J7Y q;  1HXX A;  2NOX A;  4I1L A;  3MK7 C;  2WSS V;  4PD4 H;  1FZC A;  2YKQ A;  3A5T A;  3C50 A;  3A0B O;  3EWK A;  1LTG C;  2OAR A;  1LVK A;  2YIN A;  3CK6 A;  1UUS A;  5APV A;  1G8X A;  5LB7 B;  2CXD A;  1Q9G A;  2K9J A;  3JSV C;  3WU2 O;  3BK9 A;  1PL5 A;  4JQ0 D;  2R4L A;  1Z0P A;  3L70 E;  3MUD A;  3E7K A;  3ANW B;  3A0H H;  2LKG A;  2WTY A;  1L4A D;  1NH4 A;  5EFW B;  2O3J A;  1IBL T;  3UAQ A;  1R5L A;  1YJ9 P;  1SQV E;  4JCH A;  4PUX A;  1RF1 C;  4K3B A;  1NTK E;  3HD7 D;  3SWY A;  4PFO A;  2Y0L A;  5AW5 B;  1SQQ D;  1YW0 A;  4D6T D;  3IHR A;  1T2K D;  4H9R C;  1NYH A;  4HWD A;  2VVS A;  3HR0 A;  1XNQ T;  1BGY G;  1L0N E;  5LBM A;  2OYI B;  5AQV B;  5H2F H;  1SQB K;  2X66 A;  1NTZ E;  3BAT A;  3V8U A;  3RH3 A;  3VHL A;  4GKK T;  1L0L K;  3BRV B;  4OVN F;  3MJX A;  1KIL D;  4PFP A;  3AE2 C;  3HE5 B;  2P1J A;  3TZG A;  4I0U A;  4IDQ A;  1J1E B;  7PRN A;  1HF9 A;  4EYY R;  3UFE A;  4C4V B;  4EGW A;  2KC0 A;  4M3L A;  3Q2Y A;  2IAK A;  4RLB A;  2W80 C;  4AQF A;  2H3R A;  2BG9 A;  1M8O B;  2CXF A;  3W15 B;  1AFO A;  4WB4 A;  3SFE A;  4B6X A;  4O8S A;  1WLX A;  1KNZ A;  3FZF B;  2A2F X;  1AVY A;  2EHO B;  2Q9Q B;  1OED C;  2B88 A;  4O3Y A;  3B5M A;  3CC7 P;  1JCD A;  4ASW A;  2M6I A;  4Y99 C;  1NHL A;  2Q1K A;  4R4L A;  5B66 E;  3OJA B;  3C5O A;  4O3X B;  4DR4 T;  2AE9 A;  5AQL B;  4JYB A;  5CJ5 A;  2KNC B;  4IDP A;  4O4H E;  4DV2 T;  2P7J A;  1G2C B;  3DWN A;  1URQ B;  2XZR A;  4H13 C;  3KVD D;  3AED A;  2X0H A;  2V5C A;  3ITK A;  3AXJ B;  3AAA B;  1JY3 P;  5CCH C;  5AQF B;  1GTW A;  1QEX A;  3H1H G;  3HWB A;  2IYP A;  3Q5P A;  5AQP B;  3CPZ A;  3B4S A;  2C0X A;  3AA6 B;  1KF6 A;  1NU1 K;  2QG4 A;  5KLV D;  3RI5 A;  4BUM X;  5AW3 B;  4U72 A;  4PJJ A;  4ZNC A;  3V5B A;  3HD7 A;  1XTG B;  4LF6 T;  1G90 A;  2N9D A;  1URQ D;  4HJG H;  4XFJ A;  2R8A A;  3OBV E;  5DJQ C;  4EB6 E;  3I5C A;  1KB9 H;  2XAG B;  2UUC T;  1U7J A;  1AA0 A;  1IFP A;  3L72 D;  3Q5R A;  4UB8 O;  2PBI A;  3L70 G;  3PGS A;  4A98 A;  1HJ0 A;  2NW7 A;  3JTY A;  2B89 A;  3OAK A;  2CEA A;  5GTI E;  5HEU A;  2Y9Z A;  2HN1 A;  2RPA A;  5LCY A;  2FXM A;  3VMA A;  3Q5S A;  5LXT E;  4PV1 C;  3T1Y T;  1SQV G;  2WQY A;  1KC8 Q;  4B61 A;  2DI4 A;  1KIL A;  2Q3I A;  5LGT B;  1QVG O;  2OA5 A;  1R8I A;  2M06 A;  1NTK G;  1M1K Q;  3MTU E;  2JDI H;  4NXM T;  2K3R A;  3EDV A;  4LFC T;  1ZR2 A;  3PTR B;  3O1I A;  2R88 A;  3RK3 B;  1YYC A;  1BSH A;  3N5L A;  4ZXL A;  3EAM A;  1L0N G;  5KAI O;  2OYI A;  2OTL P;  1SE7 A;  3T8O A;  2FFD C;  3G9R A;  3VE1 A;  3AE6 C;  4H13 D;  1BT9 A;  4XAX B;  5FL0 A;  5CCH D;  5B5E E;  4D64 A;  1JO5 A;  2RA1 A;  1N2D C;  3M3Z B;  2N1T C;  1NTM K;  1PPJ E;  2BS3 A;  5ABF B;  2D0U A;  2V5D A;  5HXC A;  5BVZ A;  2I8D A;  2R4N A;  4AYM C;  3QUJ A;  5JDM A;  2LHN A;  2XNX A;  3OA7 A;  5L3C B;  4FJO A;  2BBJ A;  1U7M A;  4PD4 I;  1PZQ A;  2CMR A;  5BR8 T;  1PRN A;  1FEW A;  2WP9 A;  2X9X A;  2R4O A;  1YKH B;  2WZI A;  4XA4 A;  1PIX A;  3PV0 F;  2KP8 A;  2LXC B;  2QM8 A;  4EEB A;  3H1I J;  4OH8 B;  3A0B H;  3GN5 A;  2MBG A;  2EHO A;  2Q9Q A;  4AUW A;  1UX5 A;  3K1S A;  2PFV A;  4YT0 A;  2J59 M;  3J9X 1;  1HXU A;  1VL2 A;  4PV1 D;  2MAW A;  3WU2 H;  3BQK A;  1J1J A;  5AVS B;  1P84 E;  2WSC H;  3OJA A;  3O8Z A;  2W6B A;  1K04 A;  2FXO A;  3Q5X A;  2YKP A;  3RYH E;  1JB0 J;  4H0L C;  4H44 C;  3NKZ A;  3ZT7 A;  1IK9 A;  3B5N C;  1G2C A;  3N9M A;  3H1J J;  2J1N A;  1EC5 A;  1URQ A;  3V4Q A;  2UXB T;  1YBK A;  4YTM A;  1D1C A;  1ZHW A;  5AQJ B;  1GK4 A;  4I55 E;  3AXJ A;  4DID B;  3HUS C;  3N4X A;  1T6A A;  2J5U A;  3ZMV B;  5HXR A;  4H9N C;  4RO0 A;  3UQ4 A;  2W8Z A;  5CJ0 A;  3WUT A;  2V7K A;  4BRY B;  1LP1 A;  1BGY D;  1R8E A;  2IIU A;  3PUS A;  1G1I A;  2Z5I A;  4P09 A;  1YJW P;  2FUP A;  4N59 A;  1LVF A;  4L74 A;  2Z6E A;  5ETW A;  5L3B B;  2N1T D;  5EK3 A;  2JR8 A;  2E5V A;  3NWI A;  3BRT B;  3CX5 D;  3AE5 C;  3D70 A;  1QVF O;  2P2U A;  4V1A v;  3RK2 B;  4NPF X;  3PGR A;  1MMG A;  3RPU A;  3PUG A;  4KUM B;  2M5A B;  2CWO A;  1JCC A;  5LMN T;  2QJY B;  4DV0 T;  1GDT A;  2WDR A;  3G06 A;  2HLO A;  4IT4 A;  4HN9 A;  4PJN A;  1IBM T;  5CCH A;  2ODJ A;  3WI5 A;  1YJN P;  1BSN A;  2J62 A;  1ZHX A;  1GQE A;  4JI5 T;  2XM1 A;  2DWK A;  1LT9 B;  2K9Y A;  2KDY A;  2HOD A;  2IBZ I;  3RK2 D;  2WAU A;  1PV3 A;  1ZW0 A;  3HTK A;  4YJ2 E;  1QLE D;  2WSS H;  1HG2 A;  3UFG A;  4DMV A;  5CBO A;  2M67 A;  4H0L D;  4H44 D;  5APS A;  3C51 A;  4OYJ A;  2GK9 A;  4A5X A;  1KFM A;  1YQ4 C;  3B5N D;  3KYQ A;  2XE5 A;  4KR4 A;  1XDP A;  1SQP J;  3SSU A;  5DJT B;  4L5G A;  1IAP A;  3N2G E;  4U2Z A;  2W81 C;  5TIS E;  4GCQ A;  2CHN A;  4IL6 X;  3CC2 P;  1USD A;  5ABF A;  3AA0 B;  2LSY A;  2XJ7 A;  5KAF H;  3HA4 A;  2YXR B;  4DO0 A;  5KLV J;  3AEE A;  1U5P A;  3NRX A;  5HEG A;  3U3I A;  4WBN E;  3TDK A;  3CX6 B;  3EDU A;  1MND A;  3EI0 A;  5IUX A;  1VF5 C;  2Z4E A;  2WDQ A;  5L47 A;  3AEG A;  3O9X A;  1KB9 I;  1BR2 A;  1N7S C;  2E43 A;  2ZM0 A;  3QRC A;  3H1I E;  3O6Q B;  1RE4 A;  2E76 C;  5AFU K;  5IYU A;  3RGU A;  2I0M A;  3JCU E;  1J2J B;  1LTJ C;  3L70 D;  5C39 A;  1WRD A;  3FX0 A;  1ZP0 A;  2O1K A;  3AE6 A;  2N2N A;  4UB8 H;  1Q2N A;  3OW2 O;  3R6N A;  4EXT A;  3L39 A;  5M1B A;  2NTY A;  1UGO A;  1M1J C;  1SQV D;  4K3C A;  1SP4 A;  3H1J E;  1NTK D;  4QH4 A;  2VQF T;  4F6R C;  1HNW T;  5AQK B;  1GK6 A;  4EV6 A;  4QMA A;  3T0S A;  1JY3 O;  5FY1 A;  2RH0 A;  2WSE J;  2W83 C;  5H6R B;  3ZN0 B;  1KNP A;  2H88 A;  2CXL A;  1L0N D;  1E54 A;  2N9Y B;  3AE8 C;  1NTZ D;  2A45 H;  2LR2 A;  2IPP A;  4HFV A;  2M6B A;  2K24 A;  5B66 O;  3USS A;  1DU2 A;  2WSF H;  8PRN A;  2J4U P;  1GFN A;  2KT9 A;  3R2P A;  1Y8A A;  4B3M T;  2FY8 A;  2K0L A;  2NWB A;  4N74 A;  2J58 A;  2ES0 A;  4C00 A;  1WFD A;  1CHU A;  4ZS2 A;  2YIU B;  3TLS A;  3KZI E;  4X1I E;  5JDQ A;  1VF5 D;  3B5N A;  3AEF C;  2NW9 A;  3BRY A;  1JUN A;  4X62 T;  4DJG A;  2QJP B;  1SLQ A;  3NJT A;  4GKJ T;  2W6J H;  1N7S D;  1LWU C;  2VKD A;  2E76 D;  3HUS A;  2JRK A;  2E9X C;  4LF7 T;  4LLH A;  2WU5 A;  4QQ1 A;  2BVL A;  3P7K A;  3PTZ A;  3VN0 A;  3RGL A;  1UII A;  4W80 A;  4TV9 E;  2R3S A;  5IHY A;  1PFI A;  3KV5 A;  2GUS A;  1JNR A;  1Q86 Q;  4AXP A;  2D5U A;  2YKS A;  2VKH A;  2PAJ A;  1XDO A;  4RJW A;  4MLK A;  2CA5 A;  4DV1 T;  1S9K E;  4G76 A;  1SQP E;  1K8A Q;  4DR5 T;  4Z90 A;  3PHL A;  4EZH A;  4O9B A;  5A1L A;  4O3Z A;  4JEU B;  2X9W A;  3RYF E;  1P4T A;  4ZKP A;  1T72 A;  4X65 T;  4JI8 T;  4NPD A;  2Y0H A;  4ADZ A;  1GFP A;  3AEC C;  3AA0 A;  1YIT P;  3PP5 A;  4AIS A;  3KDP B;  5FXZ A;  3N7N A;  4ERR A;  5KLV E;  4AQG A;  4DR7 T;  4N6J A;  4AI6 A;  3IA3 A;  5DQW A;  2XQ5 A;  3PUA A;  3DWO X;  1X9V A;  5APW A;  3MZK B;  3L8R A;  5DL6 A;  2HPC B;  2D2C B;  4ZZC A;  3H1I G;  3I55 P;  3O6Q A;  2CBJ A;  3MD0 A;  3MP7 B;  1IC2 A;  2JQH A;  4NUU A;  5LGU B;  3RL0 C;  3V2N A;  3LK3 B;  1N7L A;  4WVZ A;  1YQ4 A;  1X22 A;  4IIJ E;  2XG6 A;  1FC2 C;  1HGV A;  4QX8 B;  5EE2 A;  4N58 A;  1VQK P;  3IFM A;  2E9X D;  1OED E;  5CA1 E;  2B87 B;  1YXR A;  1PGQ A;  3CCL P;  3A7O A;  5DAB A;  3H1J G;  4GK5 E;  3UUB A;  5LYJ E;  2FJB A;  2BBH A;  4O49 A;  4PJL A;  3M9H A;  2R3C A;  3HOL A;  4PK6 A;  2XQ7 A;  1L0L J;  3M9Q A;  2N1G A;  1FAV A;  1FMV A;  3CWB E;  3TK1 A;  1QSD A;  1UX4 A;  5TAO A;  3V5S A;  2Y9Y A;  1N32 T;  2VQE T;  2YMY A;  1XTC C;  1KNR A;  2CBI A;  2K4T A;  3W67 A;  1IZN B;  5T5F A;  2DL1 A;  4WZX A;  2UUA T;  3WAJ A;  1ZEE A;  3IF4 A;  3NXS A;  1PPJ D;  4PK5 A;  1Y01 A;  1QUU A;  2IWV A;  1N8R Q;  5L8R J;  3ONX A;  2L3L A;  4H9P C;  2QRX A;  4UVA B;  3N9P A;  5G39 A;  1FZC B;  2JQY A;  3RHW A;  5FY7 A;  3UUX B;  4L73 A;  4LFA T;  2K9J B;  3HW9 A;  3JAE A;  4DV4 T;  1NKZ B;  3RL0 D;  3CMA P;  2PJQ A;  5AQG B;  2XAS B;  1DX7 A;  1Q82 Q;  1WMK A;  3C4W A;  4HWH A;  2K88 A;  4HFC A;  3TKL B;  1T7S A;  2O01 H;  1AQT A;  3HKB E;  3AE8 A;  2I1J A;  3BAS A;  2YMK A;  2IFM A;  2KWH A;  3MAC A;  3OYZ A;  3RQW A;  1P84 D;  2MJZ A;  4O2A E;  5J2T E;  3BCC E;  2VKJ A;  1SQP G;  3D0T A;  3HI2 A;  4EAH A;  3PUQ A;  5JDH A;  4Q25 A;  3CWZ B;  3PDY A;  3EAB A;  2V6Y A;  2H43 A;  4O4I E;  2AXT O;  4U9C A;  2Y8D A;  1OVU A;  2E74 C;  2O01 N;  5E79 O;  5KLV G;  1VQL P;  2H7O A;  5FNV E;  3LK4 1;  2V7Q J;  2KMF A;  5AW6 B;  4I7Z C;  5JDG A;  2A45 I;  1SUM B;  2E75 B;  1HVV A;  1N73 C;  2HPC A;  2H7H A;  1WR6 A;  4L9I A;  2OYH C;  2K48 A;  2MTQ A;  2X51 A;  5AQO B;  4DR2 T;  5L3F B;  4LSH A;  1BR4 A;  5EK2 A;  5TIS O;  2B76 A;  3LK3 A;  1E79 H;  4UB6 E;  1LT1 A;  3L71 J;  1FE6 A;  1PGJ A;  4EDF A;  1Q7Y Q;  1MIW A;  2KZI A;  2XE3 A;  4YTP C;  3T97 A;  3SFD A;  3EQ2 A;  3V4W A;  3LK4 2;  2X9K A;  2Y0E A;  1LNQ A;  1U4Q A;  2XSB A;  1JY3 N;  1BXW A;  4TWH A;  1MMN A;  4DZO A;  3SRZ A;  2JEE A;  4Y28 J;  2X9H A;  3R84 B;  3CML A;  2BAS A;  5LJN A;  4PW8 A;  1JTH B;  3NBX X;  4JV5 T;  2W66 A;  1LTI C;  3CX5 I;  1I6Z A;  3P4W A;  2NTX A;  4DUY T;  3JCU O;  4U7Y A;  1L0L E;  4XNK A;  4DCK A;  3EFF K;  1OXZ A;  4RL9 A;  1NTM J;  2O1J A;  4JEH B;  1EQ7 A;  3UPG A;  2XU6 A;  2ZXE B;  4IFM A;  2DNX A;  4EYU A;  2QM7 A;  1YQ3 A;  4HWF A;  3LID A;  5KKZ B;  1VCT A;  2BCC J;  2E74 D;  1NOH A;  1FZG A;  3RRW A;  5KLI C;  1N33 T;  1L4A B;  2ODU A;  2XHE B;  5FXW A;  4LF8 T;  4LF9 T;  3CX8 B;  4CI2 B;  1UCU A;  2IUB A;  2R5B A;  4PNI A;  2IYO A;  4TZ4 C;  3RYI E;  3N2O A;  5HCM A;  4LSE A;  5AFU L;  3Q2M A;  4LSI A;  5FVN A;  3HD7 B;  2Y0D A;  3U59 A;  1MIY A;  2JQK A;  5AQS B;  4AYI D;  2DW3 A;  2P10 A;  2ZLY A;  4B3R T;  1PHO A;  3Q9D A;  4TLF A;  4JI0 T;  4IL6 O;  1S4X A;  5AQN B;  2BKP A;  3VZU X;  3OVU A;  4D5U A;  3H1I D;  3PE0 A;  5GTH E;  5AQI B;  3VZW X;  2FBW A;  2V26 A;  3O4X E;  3ZCI A;  1N36 T;  2CLY C;  2UXX B;  1YTZ T;  3KBU A;  1FMW A;  3QRA A;  2FGQ X;  4IE7 A;  1KIL B;  1VQ6 P;  5HXH A;  2K37 A;  3H1L J;  1SQX K;  3AEA C;  1WR0 A;  4ILA A;  4IST A;  1EXI A;  5HEH A;  2RKL A;  3AAI A;  2JP3 A;  2WPQ A;  3UU4 A;  4ISS A;  4ZKU A;  3H1J D;  2Q3E A;  2XQ3 A;  3LK2 A;  3AE7 C;  1RQV A;  2JPF A;  4FMS A;  4EZ4 A;  1EDJ A;  2KIN B;  4U2Y A;  3VP8 A;  2BKO A;  1IFJ A;  2Y7S A;  4X1Y E;  4GKG A;  3MKD A;  3PQU A;  3RBH A;  4AKG A;  5GON E;  2PRN A;  1KYO E;  1S3J A;  1NJI Q;  2BEQ D;  2WJQ A;  4IOI H;  1MIV A;  4KJM A;  1GL2 C;  3PLN A;  3KVA A;  3FXD A;  3F2E A;  5LHI B;  2XAF B;  1RF1 B;  1VQ7 P;  1LRZ A;  2VKO A;  3L71 E;  2YDS A;  3RKG A;  4DR3 T;  5FMN A;  2XPK A;  4YJ3 E;  5LGN B;  2IZ1 A;  3E22 E;  5CHX A;  3CI9 A;  1LKX A;  4DV6 T;  2IWW A;  5DL5 A;  2M3E A;  2I6H A;  3GN5 B;  4LML A;  2HHH T;  2UWJ E;  2F1V A;  1ZHT A;  4CN4 A;  5JDF A;  1FZE A;  4C46 A;  3PUR A;  3CCM P;  4HYT B;  1JTH A;  2VL8 A;  3N9N A;  5CFB A;  3KIN B;  2BKN A;  1JNM A;  1RE3 C;  4MN4 C;  3A5X A;  1BR0 A;  1FOS E;  1L0L G;  1RF0 A;  1KFY A;  2VB6 A;  1SFC C;  2R32 A;  3Q5E A;  1N73 A;  3GG2 A;  3CQC B;  2E5T A;  3F89 A;  2K9A A;  4AIU A;  4PJ0 O;  1S9K D;  1SQP D;  5J1G A;  3H3M A;  1NTM E;  3HRN A;  2Y48 B;  5LG3 A;  1QLB A;  1OX3 A;  5CCG C;  2XTQ A;  4W7Z A;  3E0Z A;  1NO4 A;  1ZHZ A;  2W6A A;  2BCC E;  5AVW B;  1YD8 G;  2PRR A;  1ZV4 X;  4YTP A;  1L4A A;  1LP1 B;  3M91 A;  3JC2 2;  4C69 X;  3L74 J;  2AXT H;  1ZME C;  2AXC A;  1S2E A;  2OQQ A;  4IL9 A;  2RP4 A;  4DMW A;  4AUI A;  2NPS C;  1EDL A;  3S4U A;  5E79 H;  1OED B;  5F3J A;  4HFB A;  1GL2 D;  4N75 A;  2LHR A;  4JPZ B;  4Y99 B;  3KFW X;  2KZJ A;  1GFO A;  3M06 A;  2PP6 A;  4QHO A;  1W0A A;  2ZT9 C;  3GA8 A;  1VDF A;  1EXJ A;  4H13 B;  4EYY Q;  5TIS H;  1HCI A;  1H6S 1;  1CSB A;  1VQN P;  3AE3 C;  5AW9 B;  5HYA A;  1NAY A;  3H1L E;  2W00 A;  2QJK C;  3N9O A;  1IJ6 A;  3RKO A;  2C0S A;  2HOD B;  3B8E B;  5M4Y A;  3HTK B;  3WUV A;  5LP6 E;  3N9Q A;  4HH2 A;  1GU5 A;  3FZM B;  3H3A A;  4KBM B;  3P50 A;  1NTZ G;  1SFC D;  3RF1 A;  1H7C A;  5FVK A;  1W5C E;  5AQM B;  1S1C X;  2IDO B;  2KIK A;  3CWB D;  5HEJ A;  4PD4 E;  3JCU H;  2SPZ A;  5CCG D;  4TWD A;  5C2T A;  1BE3 J;  1SS1 A;  3WMM 0;  1QGK B;  3ZJ2 A;  3T24 A;  4H9Q C;  2LSJ A;  2FYN C;  3UUN A;  3RYC E;  3IF8 B;  1FJG T;  4CTD A;  1S94 A;  3U78 A;  4PV1 B;  4YPC A;  2ZM8 A;  4HWI B;  3QWO C;  2H89 C;  1GU4 A;  2W2U A;  4NPE A;  1RF1 A;  2NPS D;  3L71 G;  4KT0 J;  3SWH A;  2KOG A;  2ACX A;  2XZE A;  3CCU P;  2KSJ A;  3PUW F;  2W62 A;  1FZF A;  3VR9 A;  4X66 T;  4MBQ A;  1GFQ A;  4CZZ B;  2ZT9 D;  3K3O A;  4K0K T;  4FZM A;  1LJ2 A;  2KLV A;  2WIT A;  1EDK A;  4IL6 H;  2K1A A;  1IFD A;  3DTO A;  3AE2 A;  3AEB C;  4YHH T;  4UB6 O;  5H2F E;  2N1T B;  5C3J A;  2ERV A;  2WBL A;  2Q6Q A;  4UXN B;  3BCC D;  4IGU A;  3QOF A;  3H1K J;  1NTM G;  1X9B A;  2BCC G;  2V7L A;  2C5K T;  3GHG C;  1Z8U A;  2RMZ A;  4AYD C;  1QX8 A;  3K5B A;  1CZQ A;  3L74 E;  2QIW A;  3V2P A;  3BQI A;  5IWA T;  4B86 A;  1MKM A;  1X79 B;  1OED A;  1FDI A;  3E1I A;  3P4Q A;  3JC6 C;  3CL3 D;  1GMJ A;  2LM2 A;  3L73 J;  4UF0 B;  1P84 I;  2D9D A;  4BAY B;  3AE9 C;  1IJ5 A;  4OYK A;  4J2C A;  4G2A A;  4OGQ C;  3F31 A;  4H0L B;  4H44 B;  4AKH A;  3SZD A;  1SFC A;  3B5N B;  1H89 A;  3HOE A;  3CX7 B;  2JQ9 A;  2YEV C;  4IFD K;  5BU5 A;  2CPT A;  2LRK A;  1PGO A;  3PRN A;  3SY9 A;  3EMN X;  4WY4 C;  1MMD A;  2JIW A;  3HUS B;  3H1L G;  3PH0 A;  2UUB T;  2A06 D;  5CCG A;  3P7I A;  3I0O A;  2WU2 A;  5G26 A;  2M3B A;  2G0U A;  1J1D C;  1WYB A;  2XY8 B;  3UTK A;  3VP9 A;  4C7R A;  2ZFC A;  4U74 A;  2YO3 A;  1SA0 E;  4IDN A;  4IDO A;  2BEZ F;  4HFI A;  5CBN A;  2YOE A;  2WM9 A;  1XWM A;  2VK9 A;  4ANJ A;  5GTH O;  4PAG A;  4X1K E;  3FBZ A;  1GW4 A;  2DHR A;  1L0L D;  2NRG A;  1WCR A;  1W2E A;  4YHJ A;  3ZMT B;  3ZDM A;  2L91 A;  3C9I A;  2IC9 A;  1PPJ G;  4P1N A;  1BE3 E;  1Y9B A;  3U1C A;  2AEF A;  4PJ0 H;  5BU8 B;  5EZY E;  2N2M A;  4LSF A;  3PJS K;  3T20 A;  1KB9 E;  2XQ4 A;  1KEY A;  5L3E B;  4ZS3 A;  2XND H;  2CHO A;  3AE3 A;  1CI6 A;  4IL4 A;  1EZ3 A;  1YIJ P;  3JCF A;  4FES A;  5JR9 C;  3JC6 D;  5APX A;  5G3A A;  3FWL A;  3N9L A;  4KI0 F;  2DLR A;  1VPC A;  3X1D A;  1A02 F;  1VRB A;  1YS5 A;  4OGQ D;  2DWG A;  3SYB A;  2K5B B;  3SZV A;  5HXS A;  4PR7 A;  3ZC0 A;  4O4J E;  1KQS O;  3FYX A;  3SWF A;  2FFD A;  5L3G B;  2KWI B;  4TNV A;  4CI3 B;  5CMZ A;  3M0A A;  3RX6 A;  2N1T A;  2LOP A;  1LTB C;  3MA9 A;  5AVR B;  1VOM A;  1KZU B;  3TYY A;  3D6Z A;  1M7K A;  4K3A A;  5LA6 E;  4IE4 A;  3H1K E;  4XZC A;  3GMI A;  2H89 A;  5LG4 A;  2WB5 A;  2L9Q A;  5FXX A;  4HE8 A;  3ONL C;  4JI2 T;  4GDO A;  4O2B E;  1VF5 B;  1RH5 B;  2HFE D;  3CWB J;  4U3C A;  3CCS P;  3FHN A;  3PUZ F;  3L74 G;  2CM0 A;  5KAI H;  2FYU K;  1N7S B;  2N9B A;  1FDM A;  1NU1 D;  2PFX A;  2KLU A;  2E76 B;  4WNK A;  4ZI3 C;  2UXD T;  2LKH A;  3FZH B;  1X79 A;  3MIW A;  1KYO D;  1LTJ B;  2LXB A;  4YXD C;  4UF0 A;  3L73 E;  3POQ A;  3G6E P;  1E7P A;  4Z91 A;  4PJM A;  3CXH E;  1M1J B;  1QJ9 A;  2KSE A;  4AQR D;  2ZMA A;  2JJL A;  3CME P;  2HG5 D;  3ABV C;  3ONJ A;  4DV5 T;  3L71 D;  3VMZ A;  2YDQ A;  3ZPO A;  1VQ8 P;  2LSG A;  5AW0 B;  1OSM A;  4AZL A;  3QH9 A;  2BDE A;  3Q3D A;  3L4F A;  3NFQ A;  2W0G A;  3LW5 H;  1Q90 D;  5CGM A;  1S35 A;  3GHG A;  3BVH A;  2LLY A;  5AQR B;  3SYS A;  4CXX A;  4ZI2 C;  3K3N A;  4U31 A;  2OYO A;  3CX5 H;  1G73 A;  5AW2 B;  2XAQ B;  3BCC J;  4WW0 A;  3NSG A;  1OW8 A;  2QA7 A;  3AE5 A;  4EOT A;  3PU3 A;  4OHF A;  5GTI O;  4YFS A;  2N2L A;  1Y64 B;  3L35 A;  4GT1 A;  3C4X A;  4KHP T;  3AE9 A;  3SOL A;  3G4S P;  4UB6 H;  2V6Y B;  3AE4 C;  3MGN A;  1HNX T;  3WI3 A;  4G75 A;  1BE3 G;  2WSF J;  3KV9 A;  1NTM D;  2C5J A;  1DIP A;  3VKG A;  3RBX A;  1THQ A;  4XNL A;  2BCC D;  4ZZB A;  1T98 A;  1LWU B;  3I1A A;  4UVB B;  1D0X A;  2ZXX A;  1OIP A;  5FL1 A;  2E9X B;  3RIF A;  1I94 T;  4DT0 A;  3CCR P;  2YDR A;  1SQQ K;  2F4V T;  1HXT A;  4YXW H;  1YI2 P;  2LFU A;  5B5E O;  1JMB A;  4GHB A;  1MM4 A;  3K3Q C;  5L3D B;  1HX1 B;  4JI7 T;  1LTA C;  2FJE A;  4AQY T;  3T97 B;  1M90 Q;  3UQ7 A;  3G71 P;  1SQX J;  5LBQ B;  1VQM P;  3FB2 A;  1S5L X;  1SHZ C;  4U7I A;  2MKV A;  2WMO A;  3RIA A;  4E7S A;  1HFA A;  3KBT A;  3RC3 A;  4Z1M H;  3ZYM A;  5FXV A;  4C7N B;  4LFB T;  3H1L D;  1AQ5 A;  2WMM A;  4ZI2 D;  2A9U A;  3H1K G;  4TNW A;  3ETU A;  2POH A;  1SQB J;  1FDO A;  1QJ8 A;  2KI7 B;  3B13 A;  5AVU B;  3M0D C;  2MOZ A;  1HS7 A;  2XTR A;  2H7V C;  5KAF E;  3H6P A;  3CC4 P;  2XQ9 A;  2VAS A;  2FKW B;  1KQG B;  2KUB A;  3V6I A;  1HBW A;  1HX8 A;  2V7I A;  1XMO T;  1N7S A;  4QH1 A;  4OK0 A;  3U1A A;  3RL0 B;  2W63 A;  5GTH H;  4W7Y A;  4ILC A;  1LTJ A;  4PD4 D;  3TLU A;  3OKQ A;  2D0T A;  3P4R A;  3SWK A;  3L73 G;  4I43 B;  4HEA A;  4GCP A;  4KX6 A;  3MUD C;  1HTJ F;  4CN6 A;  1M1J A;  1JNZ A;  2CWY A;  4F8H A;  4UB8 E;  2XAH B;  1BDD A;  5JTG A;  3VKH A;  4FSP A;  4L76 A;  3WUU A;  4GYR A;  1YKE B;  1FZA A;  2XQ8 A;  4OFZ A;  4UEM A;  1S5L E;  5ADX L;  2YN6 A;  3ZMZ B;  3TLV A;  4EOZ B;  4HFH A;  5KLV K;  3B57 A;  5HWY A;  2AEM A;  1VQ9 P;  5AQH B;  4QKN A;  1ZRT E;  3P4S A;  4AKR A;  3PJA J;  1B7T A;  2Z5H A;  5AVQ B;  3DA4 A;  5PRN A;  4U3F D;  2WPS A;  2E75 C;  3LK2 B;  4JI4 T;  3QK6 A;  3AEF A;  3ABV A;  2NR4 A;  1EZV E;  1NU1 J;  4FZL A;  5H6Q B;  3MXZ A;  4U33 A;  3KVB A;  2R89 A;  1LWU A;  4KHX A;  5CA0 E;  5APU A;  5FKY A;  2E9X A;  2V7J A;  2BG9 C;  3ESL A;  5L2L A;  3L74 D;  3UIA A;  2NZ2 A;  4JYC A;  4QXH B;  2IDB A;  4X5T A;  3SFE C;  5G38 A;  4UV9 B;  1HH0 A;  5LOV E;  2F1T A;  5KJ7 C;  2P67 A;  5B66 H;  2V8S V;  1NEN A;  5AQQ B;  5E0O A;  1NWM X;  3FXD B;  2CRB A;  2OLT A;  3RIU C;  3GWH A;  1USE A;  1OW6 A;  5AVX B;  1BDC A;  1L2P A;  1UUR A;  4O4L E;  5AVT B;  1JY2 P;  2O01 J;  4M1P A;  4B3T T;  5JH7 E;  2IBZ D;  1E2A A;  3TLW A;  1SQX E;  3A3Y B;  1DEE G;  3ETV A;  3FZL B;  2A06 E;  2YXQ B;  4PK4 A;  4I6M C;  4YTN A;  1UIX A;  1KTM A;  4C7N A;  1U57 A;  3AEC A;  2LEH A;  3OTO T;  5C8Y E;  2E74 B;  3UUL A;  1OWA A;  3P8M C;  3VRB A;  2IHR 1;  1KD1 Q;  1IJD B;  4I7Z B;  1SQB E;  2ZYA A;  2WS3 A;  1FU1 A;  4JUY A;  3VY9 X;  2Q5U A;  3L3P A;  2VWA A;  4YLH A;  5TJH A;  3CVR A;  1PP9 J;  3CWB G;  1N73 B;  3G3Z A;  4AYE C;  2OYH B;  4K0U A;  1Y47 A;  2XDJ A;  3IEE A;  5HWX A;  3P32 A;  1W09 A;  4TX5 A;  3E1R A;  2E42 A;  3ZT6 A;  1ORM A;  4NIQ A;  1NWQ A;  5GTI H;  3KQG A;  1MM5 A;  3PF1 A;  4Z3T A;  3F57 A;  2WJR A;  1BE3 D;  1IK7 A;  2JO1 A;  3ZEF B;  1XMQ T;  1PGP A;  3AA1 A;  1QL2 A;  1KB9 D;  3C98 B;  1TU3 F;  4COF A;  1HF8 A;  5FY0 A;  5KJ7 D;  3C64 A;  2WQY C;  1H0T B;  3NZP A;  3POR A;  3IR9 A;  4E7Z A;  2NW8 A;  2QTK A;  4ASK A;  3H1H E;  2I59 A;  1LTS C;  3FBL A;  2HYN A;  5FP3 A;  5B5E H;  1T3J A;  4DBR A;  2OYI C;  4ZOL E;  4UVC B;  3BCC G;  3KZI O;  4KR8 A;  3Q5D A;  4GOE A;  4ILB A;  2PGD A;  1GFM A;  3UU5 A;  5JRE A;  2ZVO B;  3M65 A;  2WVP A;  1X8Y A;  2WZH A;  2A45 G;  1NKN A;  5KLI B;  5AW4 B;  1H88 A;  2LRL A;  5JRC A;  4CI1 B;  4I4T E;  3H1K D;  1J1E C;  3DJB A;  1MUU A;  1EZV G;  3DZM A;  1NU1 E;  1E1H B;  3V2R A;  4WBA A;  3FXE B;  3Q1M A;  4QH5 A;  2WT7 B;  1XNR T;  2C0W A;  5IYZ E;  1NEK A;  1OW7 A;  2ZAE B;  2JQQ A;  4IFF A;  1P84 H;  2CLY B;  2EHO C;  2Q9Q C;  3C4Z A;  4YSX A;  3L73 D;  2UXC T;  1M56 D;  2QGS A;  5L4E A;  3RBZ A;  1JMM A;  3C8V A;  3CXH D;  5KMG P;  1SQX G;  3TGU J;  3JAF A;  3I9Y A;  2A06 G;  2QA4 P;  3VMX A;  3LDQ B;  2VL0 A;  3I56 P;  1D0Y A;  3RLF F;  1CW5 A;  2KLQ A;  4H9S E;  2X67 A;  3QC9 A;  1URQ C;  4GYS A;  3GF3 A;  3G7G A;  2KZ7 A;  2V6X A;  1BR1 A;  1G1J A;  2FYZ A;  3S4R A;  3EHZ A;  5HCJ A;  1SQB G;  3L36 A;  4U7J A;  4A97 A;  1OFC X;  4C91 A;  1KYO I;  3F5H A;  1ZHY A;  5AVY B;  2ZYD A;  2DCF A;  2OTJ P;  2KYV A;  2KSR A;  2P9B A;  1PP9 E;  4U3F J;  5KJ7 A;  2OYH A;  1GL2 B;  2JMK A;  2ZYG A;  1KFN A;  2P58 A;  1V9D A;  3RIU A;  4JI6 T;  5JDL A;  3OYX A;  3ZMU B;  4CN1 A;  5APQ A;  1FJP A;  5L4H A;  3I9W A;  1LTT C;  2M0B A;  3PUX F;  1Q9F A;  3ZN1 B;  1SQV K;  1NVO A;  3PGU A;  2QE7 H;  2K3W A;  3NVO A;  2E2A A;  1NTK K;  4IRE A;  1H0T A;  4X64 T;  5KAF O;  2C5I T;  2EHO D;  2FXP A;  3LIE A;  2Q9Q D;  5LNK A;  5AW8 B;  3S9O A;  5F5W A;  2LOS A;  4KRA A;  1L0N K;  4I2L C;  1IBK T;  4L75 A;  1SFC B;  3PRJ A;  3RK3 C;  2NP9 A;  3LSV A;  1NTZ K;  1ZKE A;  4AKI A;  4DOJ A;  4HFD A;  2UU9 T;  2Y0K A;  4FI5 A;  1K73 Q;  3D71 A;  3PUY F;  4GK0 E;  5KX5 E;  2FJA A;  3EUH A;  3CD6 P;  1BCC J;  3L09 A;  3CCQ P;  3A2S X;  4QWN B;  4JLE A;  2XMX A;  1KQF B;  6PRN A;  3CCV P;  3P8C E;  5APY A;  4L0R A;  2ZFG A;  3ANW A;  5LJM A;  4TUY E;  2LJL A;  3L75 J;  2I1K A;  2XQY A;  3ZT5 A;  2JMH A;  3HKE E;  2NPS B;  4DUZ T;  1KN7 A;  2FYU J;  3AEE C;  3AA7 B;  1NU1 G;  3BQL A;  3FXE A;  3K8P C;  3II6 A;  4KHZ F;  1S5L O;  4GOD A;  1FBM A;  2IW5 B;  1HGZ A;  2WT7 A;  4O3W A;  3IN6 A;  3AEG C;  2ZT9 B;  3KXD A;  2R6G F;  5JVD E;  2KXP B;  3POX A;  3R4Y A;  4H9O C;  1RE4 C;  4TV8 E;  2L5G B;  4WYV A;  5APT A;  1AVO A;  5AQT B;  1HR0 T;  1ZP0 C;  4WWI A;  1CI6 B;  3AEA A;  3A0H E;  2PTF A;  2X9Y A;  2X68 A;  4CXW A;  4BXL A;  2QJK B;  1L0V A;  1ZLL A;  1JY2 O;  3HE4 B;  3HE5 A;  3TGU E;  4FT6 A;  3GF7 A;  3AE7 A;  1K9M Q;  4RKU J;  2SPC A;  3RK3 D;  2FFD B;  4C4V A;  4YY3 T;  2VUR A;  2Q9I A;  3ZJ1 A;  4XBF B;  5AW7 B;  4E1S A;  4ZMD A;  4GOU A;  2H88 C;  4DR1 T;  1IFI A;  1PP9 G;  2WWW A;  5ABE A;  2FYN B;  1ZRT D;  3ZYL A;  5ADX K;  4U3F E;  1W9R A;  1GL2 A;  3LFM A;  2HR3 A;  2KND A;  3KZI H;  3CXH H;  3P4P A;  3TNU B;  4E1T A;  2D2S A;  2ITA A;  4P0A A;  2LSI A;  4HB1 A;  4KP3 C;  3RK2 C;  2OTK E;  4P0B A;  4BWN A;  2HN2 A;  4X20 E;  4RLC A;  1EZV D;  2QJY C;  1XZY A;  3SS1 A;  4YSY A;  3PUV F;  1SQQ J;  2V4H A;  2KNC A;  4D6T J;  2QSI A;  4IE0 A;  4AKM A;  1FIO A;  1LGH B;  3C1L A;  3VMY A;  2IFN A;  3SY7 A;  4N78 E;  2JWD A;  3AAA A;  5DQV A;  3PU8 A;  1Q81 Q;  3IBP A;  2ZVN B;  3VE2 A;  1RE3 A;  1LT9 C;  4NUV A;  2IBZ E;  2WZ7 A;  4EIJ A;  2C9L Y;  5JQG E;  1KMI Z;  3LJC A;  3AA6 A;  2CPB A;  2WSC J;  1UK5 A;  2R4P A;  4OX9 T;  1BH3 A;  2Y0C A;  1K05 A;  2B9B A;  1SQX D;  3A8Y C;  2W67 A;  1BCC E;  3S1K A;  4UIG A;  2BZB A;  3GHG B;  1CUN A;  3DA3 A;  2WPV B;  1VQO P;  2W4X A;  2KS1 B;  4JBZ A;  3PQS A;  2LT3 A;  3LBX B;  2LKM A;  1Z56 A;  2G3A A;  3L75 E;  1H8A A;  5J2U E;  1D1B A;  2NPS A;  2YKO A;  1SQB D;  1D0Z A;  4HKZ H;  4LMJ A;  3AA7 A;  5F8P A;  1WYC A;  1T16 A;  2FYU E;  1YTZ I;  5DJU B;  3D6Y A;  1FJK A;  4TT3 H;  1VCS A;  1OMI A;  4RJT A;  2AXT E;  1W0B A;  5KDM C;  3UU2 A;  2JKV A;  4OGQ B;  3I0Q A;  4IHJ E;  1R5S A;  1N34 T;  5E79 E;  4MHC A;  2KXP A;  5DL8 A;  3VZT X;  2BG9 E;  3CPW O;  1SVF A;  1GZL A;  1MFZ A;  3JAD A;  5LHH B;  4WY4 B;  1MNE A;  3QB5 A;  1ZV8 A;  2X0Y A;  4IDZ A;  2C9N Y;  3V5U A;  3HE4 A;  2JJ9 A;  3TGU G;  1JOC A;  1J1D B;  2CE7 A;  1RY3 A;  3CQG B;  3CCJ P;  1IFM A;  4EI2 A;  4NPP A;  1GD2 E;  3KDS E;  3FZK B;  2WSE H;  3H32 B;  2CK3 H;  3BS0 A;  2VRS A;  3GP6 A;  1T8B A;  3NTN A;  3H1H D;  3RRC A;  1D7M A;  4DBQ A;  1DH3 A;  3AAE B;  2FGR A;  4WY4 D;  1W2B O;  5D5D A;  1T1L A;  1QL1 A;  4JI1 T;  3L72 J;  1M7L A;  3AVR A;  3UU6 A;  4U3F G;  1M57 D;  2V7M A;  4NXN T;  3HKC E;  1IO4 A;  4RES B;  2WCA A;  4AYC A;  4ILU A;  1T8Z A;  3TNU A;  1J5W A;  2CCQ A;  3E08 A;  2XE2 A;  1WT6 A;  1HNZ T;  5JR9 B;  1VQP P;  1DEB A;  3CLQ A;  3FGA D;  2IC6 A;  2YIU C;  2QEX P;  4H63 V;  2O4V A;  1E5W A;  2WWV A;  1SQQ E;  2KK7 A;  4ASV A;  4D6T E;  2W61 A;  2WWU A;  2MHL A;  2QJP C;  3VTP C;  3AE1 C;  1S5L H;  2IZ0 A;  4I50 E;  2YPV A;  2YU1 A;  2WVR A;  3VY8 X;  2A3D A;  2WPR A;  1DD4 A;  1ZN5 A;  3UU3 A;  3A0B E;  1JM0 A;  4ZEY A;  3AEB A;  3GLM A;  4TWF A;  3AB3 B;  1OVR A;  2IBZ G;  4BRY A;  1X0T A;  3POU A;  4LF4 T;  1KIL E;  3KV6 A;  4C90 A;  1J5E T;  4JYA T;  1FS0 E;  3WU2 E;  4JBW F;  4GF4 A;  4IL6 E;  2ZM2 A;  4FQE A;  4HFE A;  5J0Z A;  3IAO A;  1FOS F;  1BCC G;  2A72 A;  5K5G B;  2E5Y A;  2KB7 P;  3HL6 A;  5AW1 B;  2QVA A;  2M07 A;  4FZN A;  2M5A A;  3VRA A;  2KS1 A;  3LBX A;  3VOP A;  4IE6 A;  3DP7 A;  2G8Y A;  3L75 G;  3CQX C;  3UUM A;  2H8P D;  2W27 A;  5HEO A;  1MV8 A;  2ODV A;  2FYU G;  5AVV B;  3L37 A;  4AKR B;  1ZR4 A;  4KMC A;  1DD3 A;  1PP9 D;  2FJD A;  5AQU B;  3CXH I;  5AVZ B;  1LT9 A;  1JY2 N;  2D2C C;  2OGU A;  4GOF A;  3TLT A;  3H37 A;  3A7M A;  3ZMS B;  2LE8 A;  4WY4 A;  4DND A;  4ZI3 D;  2Q7C A;  2GUV A;  3KPE A;  2IX7 C;  3SFD C;  2XAJ B;  5FVL A;  1HJB A;  1HWT C;  4HTE A;  2ACZ A;  3ZC1 A;  3BRZ A;  4BA9 A;  5CJ4 A;  4UV8 B;  2BVM A;  2GM4 A;  3LG7 A;  1BGY J;  3PJA A;  2XE1 A;  2L8K A;  3H32 A;  3LW5 J;  4DVD A;  1MZ9 A;  2GA1 A;  2V1D B;  2XQA A;  1MFT A;  4OWF A;  2QYW A;  3O1J A;  4QXB B;  3AAE A;  4CXY A;  3KHU A;  5FYM A;  3W68 A;  2YNK A;  1ZHC A;  3WI4 A;  2YNY A;  4JFB A;  3L72 E;  3A0H O;  2WDV A;  1MMA A;  4XE5 B;  2R44 A;  3K19 A;  4GCS A;  2Y6X A;  1QJP A;  4QXC B;  1ZOY C;  3P8C D;  1YQ3 C;  5GV0 A;  2IML A;  1AJY A;  2CPS A;  2LHF A;  2MYS A;  2JMM A;  1JEK A;  5JR9 A;  4PJ0 E;  4JI3 T;  4HKA A;  4LF5 T;  4D65 A;  2LSK A;  3ZLI A;  1FZC C;  4JF7 A;  3ZCJ A;  1SQQ G;  5EK4 A;  4D6T G;  1OVV A;  4N3Y B;  2XTL A;  2OMF A;  5ABG A;  2D2C D;  5H2F O;  1HTL C;  2AEJ A;  4AFK A;  3ZSS A;  3A2A A;  3NZQ A;  3ZST A;  2XQ6 A;  3RC8 A;  2XUE A;  2XSA A;  3AA1 B;  4UEL A;  3UT5 E;  5KTB A;  2J47 A;  1D1A A;  2ZLD A;  3VYI A;  2FBW C;  2GE4 A;  4WBO A;  5CB4 E;  4O4U A;  1SQP K;  2UXN B;  4A56 A;  5BMV E;  4DV7 T;  2WMN A;  2W90 A;  2XKM A;  2XM2 A;  5LMU T;  2XV5 A;  2RN0 A;  3TGU D;  3RK3 E;  3H1H J;  1O3X A;  5HXE A;  5HAX A;  2YU2 A;  1NGM B;  2MPK A;  3RQU A;  3ZKR A;  2J1D G;  2V7Q H;  4F4B A;  4BJN A;  1EDI A;  3UU8 A;  1KYO H;  3M9B A;  2LM9 A;  4R4M A;  1HG5 A;  3FWN A;  5KXJ A;  2E8I A;  2YO2 A;  2HPJ A;  3AE1 A;  3KV4 A;  1N86 A;  3AVS A;  4LGD E;  2X0L B;  4YXD A;  4MAL A;  3HKD E;  1RHZ B;  3L70 J;  5KAI E;  4FRT A;  2Y2X A;  4FUV A;  4G63 A;  2POR A;  5JRC B;  4DV3 T;  2PG8 A;  1SQV J;  1A02 J;  4QX7 B;  4AQF C;  2JWA A;  1NTK J;  2HPL A;  3ZYK A;  4YSZ A;  1GW3 A;  2X27 X;  4IE5 A;  1M62 A;  4B3S T;  3QNU A;  4EED A;  3CCE P;  4A7P A;  3CKD A;  4FRX A;  1L0N J;  1VQ4 P;  4ZHQ E;  4LMK A;  4CPG A;  1BGY E;  4N78 D;  1NTZ J;  2VVN A;  3N2K E;  4GIW A;  3H25 A;  1OZH A;  3NMD A;  2M8R A;  2E5L T;  4HGA A;  3NRY A;  1MPF A;  3CX5 E;  3GMA A;  4LC1 A;  1US7 B;  3AE4 A;  1RF0 C;  5JDP A;  3L72 G;  5DL7 A;  1AV1 A;  4ZI7 E;  3O1H A;  1EZV I;  2KZ7 B;  3AED C;  2B1E A;  1BCC D;  4AYN A;  4CQI A;  2ZM6 T;  2HH7 A;  1KK7 A;  2J4G A;  3GW6 A;  2F1C X;  5KKZ C;  1VQ5 P;  4RJX A;  2YK0 A;  5LHG B;  2BG9 B;  2BS4 A;  2AXD S;  5JDN A;  3B71 A;  1T3U A;  1IFN A;  1L4A C;  3L75 D;  2ZJS E;  3VR8 A;  3O0E A;  4UR9 A;  1KQL A;  4DR6 T;  2FYU D;  5ABH A;  1OPF A;  4HWC A;  2B87 A;  3EVY A;  3RL0 g;  2WY2 A;  2E75 D;  4BJM A;  3HD7 C;  4AKL A;  1S72 P;  1FZB A;  2OV9 A;  3OPC A;  1RQU A;  1T2K C;  3TF5 A;  3V2Q A;  2MNH A;  2BS2 A;  3WAK A;  3T1H T;  1ZXG A;  3CIR A;  3QB5 K;  1WRG A;  1NAF A;  4FSO A;  1HUC A;  1KV4 A;  3TSI A;  3Q5W A;  1YHQ P;  1AJ3 A;  3EFG A; 
#chains in the Genus database with same CATH homology
 4L0R A;  4MFR A;  2ZFG A;  2E9X D;  5L3E B;  4ZS3 A;  3ANW A;  5LJM A;  4FOZ A;  4TUY E;  2LJL A;  3VU7 H;  5CA1 E;  4O4X A;  2XQY A;  1IZN A;  1EZ3 A;  2JMH A;  5DAB A;  3HKE E;  4FES A;  4GK5 E;  5JR9 C;  3JC6 D;  4TN7 B;  5LYJ E;  3AA7 B;  3N9L A;  4EIW A;  3BQL A;  3K8P C;  4PJL A;  4Z8X A;  4O49 A;  2DLR A;  4H63 H;  3J7Y q;  1VRB A;  1YS5 A;  4PK6 A;  3HOL A;  1HXX A;  2NOX A;  3MK7 C;  2IW5 B;  2WSS V;  2DWG A;  3SYB A;  4O3W A;  2K5B B;  3C50 A;  5HXS A;  3SZV A;  3ZC0 A;  1LVK A;  2YIN A;  4O4J E;  3FYX A;  1G8X A;  2N1G A;  5L3G B;  5JVD E;  2KXP B;  1FMV A;  2CXD A;  2KWI B;  1Q9G A;  3POX A;  1QSD A;  4H9O C;  3BK9 A;  1UX4 A;  5TAO A;  3V5S A;  1Z0P A;  4TV8 E;  4CI3 B;  3RX6 A;  3ANW B;  2K4T A;  1IZN B;  5T5F A;  2LOP A;  3MA9 A;  2X9Y A;  1VOM A;  2X68 A;  4CXW A;  3WAJ A;  1ZEE A;  3UAQ A;  4PK5 A;  5LA6 E;  1QUU A;  4IE4 A;  4FT6 A;  4XZC A;  3ONX A;  2L3L A;  3GMI A;  4H9P C;  4UVA B;  4JCH A;  3N9P A;  4PUX A;  5LG4 A;  2L9Q A;  5FXX A;  4HE8 A;  4PFO A;  2Y0L A;  4O2B E;  2SPC A;  5FY7 A;  1YW0 A;  3UUX B;  3IHR A;  3FHN A;  4H9R C;  2CM0 A;  3HW9 A;  3ZJ1 A;  4XBF B;  2PJQ A;  3HR0 A;  2XAS B;  4WNK A;  4ZI3 C;  5LBM A;  4E1S A;  4GOU A;  3C4W A;  2X66 A;  1X79 A;  3V8U A;  3TKL B;  3RH3 A;  3VHL A;  3ZYL A;  5ADX K;  3HKB E;  4UF0 A;  3MJX A;  4PFP A;  3LFM A;  3POQ A;  2KWH A;  3OYZ A;  2KND A;  3MAC A;  4PJM A;  4O2A E;  4E1T A;  5J2T E;  2D2S A;  1QJ9 A;  4P0A A;  2ZMA A;  2LSI A;  2VKJ A;  3D0T A;  3HI2 A;  4KP3 C;  4EAH A;  3TZG A;  3PUQ A;  5JDH A;  4P0B A;  7PRN A;  4EYY R;  3CWZ B;  3PDY A;  3UFE A;  4X20 E;  2KC0 A;  4RLC A;  2IAK A;  3ZPO A;  2LSG A;  4RLB A;  1OSM A;  4AQF A;  3SS1 A;  2W80 C;  4O4I E;  4AZL A;  2BDE A;  2H3R A;  4U9C A;  2Y8D A;  2W0G A;  2CXF A;  3W15 B;  4IE0 A;  4AKM A;  1FIO A;  1S35 A;  4B6X A;  2H7O A;  5FNV E;  3LK4 1;  3SY7 A;  4O8S A;  2KMF A;  4CXX A;  3SYS A;  1WLX A;  3K3N A;  5DQV A;  4ZI2 C;  5JDG A;  1KNZ A;  3AAA A;  3PU8 A;  1G73 A;  3IBP A;  3VE2 A;  2A2F X;  2XAQ B;  4WW0 A;  3NSG A;  2EHO B;  2Q9Q B;  4NUV A;  2QA7 A;  4O3Y A;  3PU3 A;  4OHF A;  4L9I A;  4YFS A;  1WR6 A;  2N2L A;  5JQG E;  2K48 A;  1Y64 B;  3LJC A;  3AA6 A;  2MTQ A;  2X51 A;  3C4X A;  3C5O A;  3SOL A;  5L3F B;  4LSH A;  1BR4 A;  5EK2 A;  4O3X B;  1BH3 A;  3LK3 A;  3WI3 A;  4G75 A;  3KV9 A;  4O4H E;  2C5J A;  1MIW A;  2XE3 A;  4UIG A;  2BZB A;  1CUN A;  3VKG A;  3LK4 2;  3KVD D;  1THQ A;  3DA3 A;  4XNL A;  1U4Q A;  1T98 A;  1BXW A;  3AAA B;  3PQS A;  1MMN A;  2LT3 A;  1D0X A;  3I1A A;  3LBX B;  4UVB B;  2E9X B;  3SRZ A;  5J2U E;  1D1B A;  3HWB A;  1D0Z A;  2X9H A;  3R84 B;  3AA7 A;  3CML A;  5F8P A;  1WYC A;  5LJN A;  4PW8 A;  3CPZ A;  3NBX X;  1HXT A;  3AA6 B;  5KDM C;  2LFU A;  4BUM X;  4U72 A;  4PJJ A;  3UU2 A;  4GHB A;  1MM4 A;  3I0Q A;  2NTX A;  4IHJ E;  1G90 A;  2N9D A;  4XNK A;  3K3Q C;  5L3D B;  3OBV E;  4MHC A;  5DJQ C;  4EB6 E;  2KXP A;  1OXZ A;  2XAG B;  5DL8 A;  4RL9 A;  3VZT X;  5LBQ B;  3FB2 A;  2PBI A;  4JEH B;  1SHZ C;  3UPG A;  2NW7 A;  2DNX A;  2WMO A;  5LHH B;  3JTY A;  4E7S A;  4EYU A;  1HFA A;  1MNE A;  2CEA A;  3KBT A;  3RC3 A;  3ZYM A;  4IDZ A;  5FXV A;  5LCY A;  3RRW A;  3V5U A;  5LXT E;  2ODU A;  2XHE B;  2JJ9 A;  5FXW A;  4ZI2 D;  3CX8 B;  4CI2 B;  4B61 A;  1UCU A;  2CE7 A;  2DI4 A;  3ETU A;  5LGT B;  3CQG B;  2OA5 A;  4PNI A;  2M06 A;  4TZ4 C;  3RYI E;  1QJ8 A;  3N2O A;  4LSE A;  5AFU L;  3KDS E;  3Q2M A;  3B13 A;  4LSI A;  5FVN A;  1MIY A;  2MOZ A;  3EDV A;  1HS7 A;  2XTR A;  4AYI D;  2H7V C;  3PTR B;  3GP6 A;  2VAS A;  2ZLY A;  3O1I A;  3RRC A;  1HX8 A;  2V7I A;  3AAE B;  4DBQ A;  3N5L A;  1PHO A;  2FGR A;  3Q9D A;  4OK0 A;  3T8O A;  3VZU X;  5D5D A;  4D5U A;  2W63 A;  3PE0 A;  3VE1 A;  3AVR A;  3VZW X;  3OKQ A;  2D0T A;  1BT9 A;  2V26 A;  4XAX B;  3O4X E;  3ZCI A;  2V7M A;  2CLY C;  2UXX B;  3HKC E;  4HEA A;  4I43 B;  3KBU A;  1FMW A;  3QRA A;  4GCP A;  2FGQ X;  4IE7 A;  1HTJ F;  4ILU A;  5HXH A;  4D64 A;  2RA1 A;  2CCQ A;  2CWY A;  3E08 A;  4IST A;  2XE2 A;  2D0U A;  5HXC A;  3AAI A;  5JR9 B;  4AYM C;  4ISS A;  3QUJ A;  2IC6 A;  2LHN A;  5JDM A;  4H63 V;  2XAH B;  2O4V A;  5L3C B;  4FJO A;  3VKH A;  3LK2 A;  4FSP A;  2JPF A;  4FMS A;  2CMR A;  2W61 A;  4EZ4 A;  2WWU A;  4GYR A;  1PRN A;  2MHL A;  2KIN B;  1FEW A;  1YKE B;  2X9X A;  4OFZ A;  1YKH B;  4I50 E;  4UEM A;  2YPV A;  2YU1 A;  3VY8 X;  2Y7S A;  2A3D A;  5ADX L;  3ZMZ B;  4X1Y E;  4EOZ B;  3MKD A;  3PQU A;  3RBH A;  4AKG A;  3B57 A;  3GN5 A;  5GON E;  5HWY A;  2PRN A;  2MBG A;  2EHO A;  2Q9Q A;  4QKN A;  1UX5 A;  3AB3 B;  3POU A;  2PFV A;  4AKR A;  3J9X 1;  1MIV A;  3KV6 A;  1HXU A;  4C90 A;  3BQK A;  1B7T A;  3KVA A;  3OJA A;  4GF4 A;  3Q5X A;  2ZM2 A;  3F2E A;  3RYH E;  3DA4 A;  5PRN A;  5LHI B;  2XAF B;  3LK2 B;  1LRZ A;  2VKO A;  2A72 A;  3N9M A;  3QK6 A;  5FMN A;  2J1N A;  3HL6 A;  4YJ3 E;  5LGN B;  2M07 A;  4FZL A;  1ZHW A;  1D1C A;  3MXZ A;  3E22 E;  5H6Q B;  1LKX A;  3KVB A;  4I55 E;  4FZN A;  3SY9 A;  5CA0 E;  3LBX A;  5DL5 A;  3ZMV B;  4IE6 A;  5HXR A;  3DP7 A;  2E9X A;  2V7J A;  3CQX C;  3ESL A;  3GN5 B;  4H9N C;  3UUM A;  5L2L A;  2F1V A;  1ZHT A;  4QXH B;  5JDF A;  2V7K A;  4UV9 B;  2ODV A;  5LOV E;  3PUR A;  4AKR B;  2F1T A;  3PUS A;  2VL8 A;  3N9N A;  4KMC A;  3KIN B;  4P09 A;  4N59 A;  1LVF A;  2Z6E A;  1NWM X;  5E0O A;  3FXD B;  5ETW A;  5L3B B;  3A5X A;  5EK3 A;  3GWH A;  1BR0 A;  2VB6 A;  4O4L E;  3CQC B;  4V1A v;  2K9A A;  4M1P A;  5JH7 E;  3H37 A;  1MMG A;  3RPU A;  5J1G A;  3ETV A;  3PUG A;  4KUM B;  2CWO A;  3ZMS B;  2LE8 A;  2Y48 B;  4DND A;  4ZI3 D;  2XTQ A;  3E0Z A;  1ZHZ A;  4PK4 A;  2XAJ B;  1YD8 G;  1ZV4 X;  2LEH A;  5C8Y E;  3UUL A;  1OWA A;  4HTE A;  3ZC1 A;  4C69 X;  4HN9 A;  4BA9 A;  4UV8 B;  2BVM A;  2RP4 A;  3LG7 A;  4PJN A;  4DMW A;  3WI5 A;  2ODJ A;  3VY9 X;  2XE1 A;  4JUY A;  1ZHX A;  4AUI A;  2L8K A;  3L3P A;  2DWK A;  2VWA A;  3S4U A;  4YLH A;  4DVD A;  2KDY A;  2V1D B;  3CVR A;  2WAU A;  5F3J A;  3O1J A;  4QXB B;  2LHR A;  4AYE C;  4K0U A;  4YJ2 E;  4CXY A;  3AAE A;  1HG2 A;  3IEE A;  3KFW X;  4DMV A;  5HWX A;  4TX5 A;  5FYM A;  1GFO A;  1ORM A;  2YNK A;  2M67 A;  4OYJ A;  3C51 A;  1ZHC A;  2GK9 A;  4KR4 A;  4QHO A;  2XE5 A;  3WI4 A;  3GA8 A;  1MM5 A;  4JFB A;  4Z3T A;  3F57 A;  1MMA A;  4L5G A;  1IAP A;  3N2G E;  2W81 C;  3K19 A;  4GCS A;  2Y6X A;  3ZEF B;  1QJP A;  4QXC B;  3AA1 A;  1HCI A;  1H6S 1;  3P8C D;  3C98 B;  5HYA A;  4GCQ A;  5GV0 A;  2W00 A;  2LHF A;  2MYS A;  3N9O A;  2JMM A;  3AA0 B;  2LSY A;  1IJ6 A;  3RKO A;  1HF8 A;  2C0S A;  3HA4 A;  5FY0 A;  5JR9 A;  4HKA A;  3C64 A;  1U5P A;  3NRX A;  4DO0 A;  4D65 A;  2LSK A;  3NZP A;  3U3I A;  4WBN E;  5LP6 E;  5M4Y A;  3ZLI A;  3CX6 B;  3EDU A;  3N9Q A;  4E7Z A;  3POR A;  2NW8 A;  3ZCJ A;  2QTK A;  3H3A A;  5EK4 A;  4KBM B;  4ASK A;  2XTL A;  1MND A;  2OMF A;  1H7C A;  2I59 A;  4AFK A;  3O9X A;  3NZQ A;  3FBL A;  1BR2 A;  3RC8 A;  2ZM0 A;  3QRC A;  5FP3 A;  2XUE A;  4DBR A;  3AA1 B;  4UEL A;  4ZOL E;  3UT5 E;  5AFU K;  5IYU A;  4UVC B;  1D1A A;  2ZLD A;  4KR8 A;  3ZJ2 A;  3T24 A;  4H9Q C;  1WRD A;  2LSJ A;  1GFM A;  5JRE A;  2GE4 A;  3UUN A;  3M65 A;  4WBO A;  3IF8 B;  5CB4 E;  2N2N A;  3RYC E;  4O4U A;  1S94 A;  3R6N A;  3U78 A;  2UXN B;  4EXT A;  4A56 A;  5BMV E;  2ZM8 A;  2WMN A;  2NTY A;  5JRC A;  4CI1 B;  4I4T E;  1O3X A;  3DJB A;  3SWH A;  5HXE A;  5HAX A;  2ACX A;  2YU2 A;  2W62 A;  1E1H B;  2J1D G;  3FXE B;  4F4B A;  4BJN A;  4F6R C;  3T0S A;  4MBQ A;  2LM9 A;  1HG5 A;  5FY1 A;  5IYZ E;  4CZZ B;  1GFQ A;  5H6R B;  3ZN0 B;  2E8I A;  3K3O A;  2CXL A;  4FZM A;  2HPJ A;  2JQQ A;  3KV4 A;  1E54 A;  3AVS A;  2X0L B;  4MAL A;  4HFV A;  3HKD E;  2K24 A;  3DTO A;  2CLY B;  4FRT A;  2Y2X A;  2EHO C;  4FUV A;  2Q9Q C;  3C4Z A;  4G63 A;  2POR A;  2QGS A;  5JRC B;  8PRN A;  2J4U P;  1GFN A;  2KT9 A;  2WBL A;  2ERV A;  4UXN B;  5KMG P;  2K0L A;  2NWB A;  2PG8 A;  4IGU A;  4QX7 B;  3I9Y A;  2ES0 A;  4AQF C;  1D0Y A;  4ZS2 A;  2HPL A;  4X1I E;  2KLQ A;  4H9S E;  2X67 A;  3ZYK A;  3QC9 A;  5JDQ A;  2NW9 A;  2V7L A;  2C5K T;  4GYS A;  2X27 X;  2KZ7 A;  3G7G A;  4IE5 A;  4AYD C;  1BR1 A;  2VKD A;  4FRX A;  3CKD A;  2JRK A;  2E9X C;  4ZHQ E;  4C91 A;  4QQ1 A;  4N78 D;  1ZHY A;  2BVL A;  3BQI A;  4GIW A;  3N2K E;  2DCF A;  4TV9 E;  2P9B A;  3JC6 C;  5IHY A;  3KV5 A;  4UF0 B;  4BAY B;  4OYK A;  1IJ5 A;  2JMK A;  4J2C A;  4HGA A;  3NRY A;  4G2A A;  1V9D A;  2D5U A;  2VKH A;  4AXP A;  1MPF A;  4RJW A;  1US7 B;  3F31 A;  4MLK A;  5JDP A;  5JDL A;  3OYX A;  2CA5 A;  4AKH A;  5DL7 A;  4ZI7 E;  3SZD A;  4G76 A;  3HOE A;  3O1H A;  3CX7 B;  2YEV C;  3ZMU B;  2KZ7 B;  4AYN A;  2B1E A;  4EZH A;  4CQI A;  5A1L A;  4JEU B;  3PRN A;  4O3Z A;  2X9W A;  2HH7 A;  3I9W A;  3RYF E;  1P4T A;  3EMN X;  1KK7 A;  1MMD A;  1Q9F A;  3ZN1 B;  2Y0H A;  4RJX A;  4ADZ A;  1GFP A;  2YK0 A;  5LHG B;  3P7I A;  3I0O A;  3AA0 A;  5JDN A;  5G26 A;  2G0U A;  5FXZ A;  3O0E A;  4ERR A;  1WYB A;  4AQG A;  4AI6 A;  3UTK A;  1OPF A;  2C5I T;  4U74 A;  2EHO D;  3EVY A;  1SA0 E;  2Q9Q D;  5LNK A;  5DQW A;  3PUA A;  4BJM A;  2WM9 A;  2LOS A;  2VK9 A;  3MZK B;  4AKL A;  4ANJ A;  4KRA A;  5DL6 A;  4PAG A;  4X1K E;  3FBZ A;  2NP9 A;  2DHR A;  2MNH A;  1ZKE A;  4AKI A;  3WAK A;  4NUU A;  4YHJ A;  3ZMT B;  5LGU B;  2Y0K A;  4FI5 A;  4GK0 E;  5KX5 E;  3LK3 B;  3EUH A;  2IC9 A;  3L09 A;  1NAF A;  3A2S X;  4FSO A;  4QWN B;  4IIJ E;  4JLE A;  5EZY E;  2N2M A;  4QX8 B;  3Q5W A;  1AJ3 A;  2XG6 A;  2XMX A;  4LSF A;  4N58 A;  5EE2 A;  6PRN A;  3T20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...