2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
5AFUL 3LK41 3AA6B 3LK2B 3AA6A 3LK2A 3AAAA 3AA1B 2KZ7B 3AA0B 5ADXL 2KZ7A 3AA1A 1IZNB 3AA0A 3LK3B 3LK3A 5AFUK 2KXPB 2KXPA 3AA7B 3AA7A 5ADXK 4AKRB 3LK42 4AKRA 3AAEB 3AAEA 3AAAB 1IZNA
chains in the Genus database with same CATH superfamily
2HPJA 4GDOA 4UIGA 2B87A 1RF0C 4RKUJ 3C4ZA 3ONJA 3SY7A 4G63A 4B61A 4X1YE 3UQ4A 5H6QB 2IBZE 4IT4A 5CMZA 2XNDH 1PGQA 2A45G 2ZT9D 2LR2A 4DZOA 1IO4A 5F5WA 2KT9A 2DNXA 1N8RQ 1IBMT 5AW9B 4DMWA 2M3BA 3BCCD 2CPSA 2E74D 3CCSP 2J4GA 3F31A 4L76A 4AYCA 2Y7SA 3SS1A 2RMZA 4LFAT 2KYVA 2C0WA 3KFWX 3BRVB 1OMIA 2FKWB 4UEMA 1FZAA 4ASVA 3O6QB 3N9LA 1M56D 4C7NA 1I94T 1LTJC 1YJWP 1YS5A 1KB9I 2ITAA 4U3FD 5AW5B 1Q90D 5FKYA 2P7JA 2WCAA 2LKHA 3JCUE 1UCUA 2YDRA 1R5LA 4H63V 1M57D 2FGRA 1GL2A 4LLHA 1NYHA 2KI7B 5EK2A 1YYCA 1W9RA 3O1HA 2IBZI 2L5GB 3KV4A 1SQQK 3CWBJ 1HXXA 5ADXL 1S5LE 1O3XA 3L71J 1CW5A 3B5MA 1NAFA 2YMYA 4TX5A 3QOFA 3Q1MA 5TAOA 1ZOYC 3VN0A 2M5AB 4I55E 4U2ZA 5LXTE 4JYAT 5GTHE 1IBLT 3LDQB 3QRCA 5LA6E 2OQQA 4IDNA 1S35A 2V8SV 2F1TA 1AJYA 3C64A 3GF3A 2JQQA 2M6IA 1RE4C 4XBFB 1LGHB 3KBUA 4PJMA 3CWZB 2PG8A 1N7SB 3WI3A 3A3YB 4KHZF 2WQYC 1HF9A 4I2LC 3Q2YA 1VQNP 1OEDC 4Z1MH 4DNDA 3CCMP 2IBZD 2J5UA 3USSA 1NTKD 4MBQA 4YJ2E 2E42A 5GTIE 2WJRA 4AI6A 3G3ZA 3L70J 2E9XA 3N9QA 5KAFH 2CM0A 3CWBG 1R8IA 4GIWA 3CCRP 3CCUP 1J2JB 2CHOA 2D5UA 3L71G 2C5IT 4A56A 1IFNA 2C0XA 2HPCB 2KOGA 2LKMA 5ABEA 3IF8B 3BVHA 4BUMX 5AQFB 3ZPOA 4NIQA 3AEFA 4O4HE 1FDMA 1YITP 4BRYB 3X1DA 2W2UA 4WW0A 3P8CE 5KJ7C 1FJKA 1YJ9P 1DD3A 1NTMK 4HJGH 1PP9J 3SFDC 1YTZI 2MTQA 1LWUC 1NVOA 4AKIA 3AE7C 1SHZC 3L74J 2QGSA 1T6AA 1MMGA 1EZVG 1BE3J 5KXJA 1IC2A 3L8RA 3AEGA 3PJAA 4GHBA 3L70G 1OZHA 2V7JA 2CMRA 1E7PA 4FRXA 1N2DC 1WYCA 1N7SD 3L75J 4HH2A 1KQSO 2NPSA 2DI4A 4DV0T 2K4TA 2WPQA 3GG2A 3AAEB 3CQCB 3UUMA 4GT1A 2FYNC 4CI3B 5KKZC 1MM4A 3CX8B 1HGZA 5HEOA 1H7CA 4W80A 4HE8A 4H9PC 5CCHA 3AVRA 4KRAA 4AKGA 3TNUA 4PK4A 4HTEA 4ISTA 2KMFA 4JEUB 2W62A 4QWNB 1PP9G 3QUJA 1VQMP 3BQLA 2X0HA 3ZYMA 2ZFGA 2PFVA 1YW0A 3L74G 4IE0A 3ETVA 1BE3G 2LRKA 3WU2E 4ZI3D 1PZQA 1WYBA 2N9BA 1FOSE 2PP6A 4QH1A 3ABVA 3LK42 3ZT5A 1LT1A 5JDMA 2BCCJ 1HF8A 1S5LO 2YIUC 2W0GA 4KJMA 4PK5A 1G8XA 2Y2XA 3AE4A 4OGQC 2O01H 3NRYA 2JJLA 5KX5E 3L75G 1FEWA 4ZKUA 3B71A 1BGYD 1FBMA 4JPZB 1NWMX 1LKXA 2IWWA 4EGWA 3CMEP 2FFDC 4LF9T 2E5TA 5GTHO 3ZEFB 4DJGA 3OBVE 3MA9A 2LJLA 1SQPE 2YU1A 2CLYB 2V7KA 4I7ZB 1KC8Q 2HPLA 1FDIA 5HXRA 5AVQB 4AQRD 3UULA 2LOPA 4C91A 4FUVA 3P8CD 3KBTA 4UV9B 1SQQD 4JF7A 1T98A 4PJNA 2D2CB 2WPSA 1XNRT 1HH0A 1VDFA 2YU2A 2NZ2A 4ZI7E 3D6ZA 1GK6A 2P2UA 4YT0A 3SYBA 2WSFJ 2LHRA 5JDQA 1HJBA 3OYZA 4O49A 2BCCG 3QB5K 3K3OA 4G76A 5L3DB 3DWNA 1W09A 4UF0A 2G3AA 2UXCT 3L36A 1KILA 1S9KE 4C4VB 1ZRTD 1N33T 3C9IA 2Z4EA 2M0BA 5LNKA 1PHOA 4ADZA 2DW3A 2DL1A 3V4WA 2IZ0A 2UXDT 4YTNA 4OYKA 3AE5C 1KORA 4HFEA 4PJLA 4TWFA 5HEJA 2JMMA 4GOEA 1E79H 2WT7A 3PUXF 2WVPA 2EHOA 1M7LA 2AXTH 2JIWA 3LK2A 2IYOA 1J1DB 4EDFA 2H43A 2V7QH 3JC6C 4HEAA 2WTYA 4HYTB 3K3QC 5FVNA 2P9BA 2BS3A 3R6NA 3WUUA 5LG4A 4YJ3E 4UV8B 3MZWB 1CZQA 3D6YA 2KXPA 3CCQP 3RYCE 4IDPA 5APSA 3MK7C 3CCEP 4JI6T 4JBWF 3WAKA 1IAPA 1UIIA 4O3ZA 4O4LE 2D2CD 2B88A 2CRBA 1NTMD 2JRKA 1GW3A 4DUZT 3OJAB 4B86A 3GHGA 3H1HD 4U33A 3SWYA 7PRNA 2Q9QB 3BASA 2E76C 1BCCJ 2OYHC 4IE5A 2W61A 3LK3A 2KLQA 4LMKA 2I0MA 2X51A 3WMM0 3RL0g 4JUYA 2NP9A 3UUNA 1S3JA 2YK0A 1HTLC 1FZFA 4L74A 3MUDC 2K24A 4DT0A 2LEHA 1J1EC 2E8IA 5TJHA 3LK41 2OTJP 2H7OA 4BA9A 5H2FH 4OH8B 2Q9IA 3WI4A 1N86A 2A45I 2HODA 3HKCE 3OVUA 3DA4A 3KDSE 1DU2A 1HG5A 2A2FX 1MIVA 2OMFA 1GD2E 5KAFO 4YSXA 1ORMA 2O01N 4CN6A 4CTDA 5JQGE 3M06A 3PE0A 1OPFA 3QC9A 1SQVJ 1CHUA 1S9KD 1MPFA 4D6TJ 3S1KA 1NKZB 1LTJB 2PRRA 1BCCG 5LGUB 1NOHA 1Q9GA 3OKQA 1T2KD 4TV8E 4FI5A 4DMVA 2NRGA 2XY8B 2K9AA 3U78A 3UU5A 1MKMA 3RF1A 4H9OC 2A72A 2ZMAA 4U2YA 2D0UA 4JV5T 2V26A 4KI0F 4HWIB 5ABGA 3PRNA 3QB5A 2K9JA 4LMLA 4IFMA 2ZXEB 4K3AA 2Q9QD 3CWBE 5FVLA 2ZM2A 4LSFA 5EE2A 2BVLA 2VASA 4CI2B 2LHFA 3HL6A 3IA3A 2W4XA 4CXXA 5L8RJ 3L71E 2V5CA 3HW9A 1PGJA 3BRTB 3HTKA 3D0TA 1J1JA 3UQ7A 5HCJA 1KNPA 2IHR1 1MFZA 4NPPA 5FYMA 3KQGA 1VQOP 2JJ9A 3B5NA 3M0DA 4DO0A 3ONXA 1MV8A 3N7NA 2DLRA 2FGQX 2Z6EA 3HOLA 5DABA 1SQVG 2E75C 4D6TG 2PRNA 3HA4A 4QXHB 3S9OA 2BVMA 5E79H 4JI5T 1ZR4A 4B3MT 4JFBA 1M1JB 3HD7A 1RF1A 5G3AA 2YO2A 1R5SA 1DEEG 1EQ7A 1JUNA 3GA8A 4CZZB 5JDLA 2QEXP 4EEBA 4XNLA 3PQSA 5FXWA 1EZVE 2O3JA 3TLSA 3O1IA 2L8KA 3FBLA 3M0AA 3ZDMA 5HXHA 3L70E 2IAKA 3PUAA 2JP3A 2FXMA 2MNHA 2KSRA 3H1LJ 5JRCA 3CI9A 3MXZA 2I1KA 5C39A 2H89C 1X79A 1NAYA 3NKZA 2N1TD 3RBZA 1RH5B 3T20A 2FXOA 5KLIC 4I4TE 2BZBA 3NJTA 4NXNT 4UXNB 2MJZA 1XDPA 4AKRA 3ZT6A 3T97B 2H8PD 2YNKA 3PJAJ 2JMKA 1PP9E 4EZHA 2FY8A 4MALA 3MTUE 1LVKA 2ZLDA 2WSFH 2VL8A 1LWUB 2PJQA 1LJ2A 3L72D 2VK9A 4ZI3C 3L74E 2R3CA 3B8EB 4TUYE 1BE3E 3MZKB 1QL2A 2ES0A 3E1IA 1P84H 2BG9E 1SFCC 2QA7A 2WPRA 1T3JA 2N2MA 2XQ8A 2XNXA 5LBMA 1P4TA 3AEEC 5LGNB 1EZVI 3ANWB 3H1LG 2XDJA 1G2CA 1GFMA 2D0TA 4ZEYA 1LNQA 3GF7A 1GK4A 4R4LA 3CWBD 2WSSH 3L75E 1CI6A 1KQFB 4HFBA 1ZHTA 1YIJP 3H25A 2XE3A 4WY4A 1HNWT 1IZNB 3L71D 4LSHA 3PH0A 2N1GA 2JO1A 1EC5A 3CX5I 1HR0T 3A0HE 2FYNB 5KKZB 4DVDA 2E5VA 1LTSC 4JCHA 1KFMA 2M3EA 2WS3A 2V1DB 1URQA 1KFNA 2CPBA 2XQ9A 2Q5UA 3G6EP 1FOSF 5GV0A 3HKDE 4QH4A 2G8YA 2CPTA 3L73E 3FBZA 2KWHA 3NSGA 3AEAC 3MD0A 2AXTO 3K8PC 2ODVA 1NGMB 3BK9A 3D71A 4YSZA 2JQHA 3LSVA 2BCCE 2LFUA 4HFHA 3HUSC 2YIUB 1NENA 4L9IA 3K5BA 3IR9A 4JLEA 5HXSA 1XDOA 3TF5A 2K37A 4OGQB 3WUVA 2BS2A 4AQFC 3ZC1A 2XE5A 2WJQA 4OVNF 2X0LB 1ZHZA 5AFUK 2P1JA 3I1AA 3CX5D 2KS1B 3RX6A 2X0YA 2WU5A 4FMSA 1G1JA 4NPFX 3H37A 2FFDB 4F6RC 2QIWA 1SQXJ 2YEVC 1PIXA 2UWJE 1FZCA 3QRAA 1IK7A 3L35A 3V2PA 3MIWA 1H0TB 1LTBC 1VQ4P 4N59A 3F57A 3Q5RA 3QNUA 1RE3C 4EAHA 4C46A 2JR8A 4RJXA 2YKSA 1KTMA 5B5EH 3LG7A 1FJPA 3I0QA 4TN7B 2AE9A 1EXJA 3L74D 3NBXX 3OYXA 5JR9A 2R5BA 3Q5XA 1SVFA 4KHXA 1W0AA 1Y64B 1WR0A 1MIWA 2VB6A 2WZHA 2D2CC 4DUYT 3VTPC 3G4SP 1JY3P 2X68A 3SFEA 1M8OB 2O4VA 2A3DA 5C2TA 3SY9A 1S1CX 3CL3D 5H2FO 3WI5A 2OTLP 4ZMDA 4DR3T 3RGUA 1BDDA 3GMAA 5FL0A 2NR4A 4AXPA 3AE6A 4MLKA 3RH3A 1ZP0C 1SQXG 3ZMSB 3PUZF 3O9XA 2WM9A 1WR6A 2HG5D 4ZZBA 1BR4A 4UVAB 2Y0KA 4OGQD 2B89A 4IFDK 1NWQA 5AQPB 1TU3F 2RP4A 4DV6T 1U57A 5LMNT 1LT9A 4EYYR 2Y0EA 2WSEJ 3RQWA 3PQUA 2RH0A 5AQOB 2JKVA 2V5DA 3KDPB 2W8ZA 2JEEA 1EXIA 1D1AA 4YTMA 3TLWA 3AA6A 4UVCB 3ZYLA 3HE4A 2BCCD 1D0XA 1XWMA 2MYSA 2WZIA 3VE1A 5G26A 1OW8A 3HRNA 3M9BA 2KK7A 2V4HA 4FZMA 3DZMA 1IFDA 2LSJA 4H63H 3A0HO 2BBJA 2MPKA 1BCCE 4MN4C 3PU8A 2E76B 1KK7A 2V6XA 1KN7A 3AE2C 2HN1A 3KPEA 4YHJA 1WFDA 1W2BO 5LHHB 3RK2C 1B7TA 3AAAB 4N75A 1QEXA 3UU4A 3PU3A 5E79O 2Q9QC 2QYWA 1USEA 2O01J 1J1EB 1S4XA 3OW2O 2UUAT 2E5LT 2FYZA 3UUXB 3PGRA 3Q9DA 4K0UA 1MMNA 5B66H 2IUBA 2PORA 4Z90A 3AEBC 3HE5B 5B5EE 1T7SA 2B76A 3TKLB 3JC6D 2VVNA 5JVDE 2QA4P 2UXXB 5LMUT 3B4SA 3E7KA 1SQVE 5APUA 4D6TE 2Q3EA 2XM2A 3GW6A 1KF6A 4JYBA 3LJCA 1SQBJ 1KYOD 2V7MA 4HFCA 2FUPA 3RPUA 2LRLA 2A06E 4CXWA 3R4YA 2C9LY 2KZIA 5CBNA 4C7NB 4FSOA 3I5CA 3UTKA 1EDIA 1FZEA 4QX8B 3N2KE 5CCGC 2ZXXA 4I50E 4DR4T 1YKEB 4XA4A 2E76D 3AE8A 3CQGB 3PUQA 1S94A 2CXDA 2N1TC 1EZ3A 1YXRA 2XE1A 4D64A 3I9WA 3P4SA 4IOIH 2JWAA 1RQVA 2V7QJ 1I6ZA 3O6QA 1OFCX 2E75B 4OHFA 4K3BA 1HX8A 2KUBA 4YTPC 4DIDB 4D5UA 1SQBG 2LM9A 2JQKA 1MUUA 2VRSA 2OV9A 2R4PA 3II6A 2QVAA 2I8DA 3KV6A 2PAJA 4CXYA 2M8RA 1FIOA 4EV6A 4YXDA 1K04A 1KB9D 4G2AA 1BR0A 2HN2A 4IHJE 4G75A 2IMLA 4KUMB 2KZJA 1M1JC 3V4QA 2K9YA 2N2LA 4X20E 3I9YA 1YQ4A 3H1LE 4QHOA 4E7SA 5HAXA 2YXQB 5KDMC 2POHA 4BAYB 2IDOB 3BRZA 3UU3A 3SYSA 5C3JA 4L73A 1M90Q 3TYYA 1JM0A 5HWXA 4AKLA 4PFOA 5KLIB 2M5AA 5B66E 2QM8A 4WB4A 3PGSA 1GFOA 3ESLA 5AQMB 1LP1B 5AVSB 1HNXT 1N36T 2XQYA 1QLED 1WMKA 2AEMA 3VE2A 2OYIC 1U7MA 4COFA 4ZHQE 3PHLA 4V1Av 4HFIA 1VF5C 1N7SA 2O1JA 1YJNP 1IFMA 2JMHA 3K3NA 4LFBT 4AYMC 2Y6XA 3C4XA 5JTGA 3KVDD 3IEEA 3AECC 4DR2T 2UUCT 1SFCB 3CXHH 3FZFB 3VKHA 4JI4T 1SQXK 2E75D 5BR8T 3SSUA 5CJ4A 3VOPA 1XZYA 2YKPA 2IWVA 4XAXB 4B6XA 3Q5WA 2UUBT 4YPCA 2QJKB 5B5EO 2ZM8A 4O2AE 3TLVA 2HPCA 2KNDA 4X1IE 4P0AA 5C8YE 3CIRA 3FZKB 1SQPK 3G06A 3RYIE 2W6AA 4BRYA 2X9KA 2K3WA 3IN6A 3U59A 3PURA 1BSNA 2D9DA 2XQ3A 2YKQA 1EDLA 2V7LA 2W66A 2WSEH 5APWA 1JMBA 4X5TA 3AE3A 1W5CE 2FBWC 3H1IJ 5AW6B 3C8VA 3N2OA 3AXJB 2ZLYA 2XPKA 1NU1J 2OYOA 5EFWB 4KR4A 1UGOA 2VVSA 1THQA 1AQTA 2VKDA 1QUUA 2BG9C 5TISH 3AEDA 3FXEB 4EYUA 3C5OA 4O4XA 1A02J 1VQPP 3KZIH 4PV1D 1N73C 3HUSB 1JCDA 2H88C 3VU7H 4F4BA 5JDNA 3L73J 2AXCA 3EMNX 2CBJA 5APXA 3H1LD 2W6BA 3AE1C 2GK9A 4B3RT 3DTOA 2RA1A 4HWHA 3KV9A 5IYZE 3AAEA 1SFCD 2FXPA 4LF8T 1SQXE 3TLUA 3ZKRA 4JI8T 1G90A 2YOEA 1L0NJ 4RO0A 5AQQB 2XTQA 3T8OA 2J1DG 4O2BE 4IL6H 3A0BH 4ILAA 1W0BA 4GIFA 5KAFE 4AUIA 1OXZA 3H1IG 2JDIH 1OVUA 3RL0B 3GN5B 4AKMA 1NU1G 3RK3E 1KILE 1IJ6A 4GCSA 2WSCJ 3AB3B 2WDQA 1QJ8A 3RYFE 3EI0A 5G38A 2MBGA 2KSEA 4GOFA 1ZKEA 2BKNA 2C5JA 2DWGA 3CX6B 1HNZT 5GONE 4DBRA 3CXHE 3AE9C 3L73G 4UB6H 5AFUL 1AA0A 4XE5B 4TLFA 5B66O 5CCHD 5JDGA 1GDTA 2WBLA 5KTBA 3ZJ1A 3ETUA 3MACA 1L0NG 2W83C 3W67A 2LLYA 4AZLA 1YQ3C 4DR6T 4FT6A 2IYPA 1YHQP 2XSBA 4PJJA 3NTNA 3RIUC 3G9RA 3TDKA 3OTOT 4GODA 1NO4A 3VY8X 2DHRA 1DD4A 4PAGA 4DV3T 5J2TE 2F1VA 3DWOX 4HB1A 5M4YA 5CFBA 1GMJA 2YNYA 3JC22 3OAKA 1PL5A 5KLVJ 2KINB 3FZMB 5D5DA 4N58A 1ZHWA 5CJ5A 2B9BA 1Q2NA 3RL0D 4O4JE 5TISE 2KXPB 4ASWA 1T8BA 3KZIE 1LTIC 3L37A 4J2CA 4NPDA 1VQKP 3UT5E 1BH3A 4AYEC 4IDQA 4Z8XA 2P10A 4IE7A 4PNIA 4PD4H 4FESA 4AFKA 1GQEA 1Q82Q 3F89A 1L4AC 3OPCA 5DL7A 4Z3TA 4DV5T 3ITKA 4D65A 1SQXD 1IFPA 3I56P 3EAMA 2XTRA 3RK2B 2X9HA 2H7HA 1VQ9P 1IK9A 3PUVF 1L0LJ 4B3TT 3A0BE 3E0ZA 4DV4T 1VOMA 4K35A 2W81C 4A97A 3AA7B 5LCYA 4GCPA 5KAIH 4IFFA 4I1LA 1SQPD 2ERVA 4DV1T 5KLVG 2V6YB 2KSJA 1JB0J 4TZ4C 4CN1A 2ACZA 4N3YB 3A2SX 1NH4A 2KNCB 2MHLA 3PUGA 3OJAA 2HODB 3R84B 3RRWA 4N78E 4LGDE 3UU8A 5JREA 3PJSK 3UAQA 4UB6E 5ETWA 1RF0A 5AVYB 1SQBE 2W90A 2MAWA 3L39A 3M65A 3ZJ2A 3H32B 3K1SA 4HWDA 2OARA 2J4UP 3V6IA 4RESB 1S5LX 2IC9A 1L0LG 5AQUB 3G7GA 3VYIA 2XQ6A 4JI0T 3VMAA 4I6MC 3RHWA 4JI3T 5FNVE 3EQ2A 5LGTB 2Q3IA 2N1TB 4ZI2D 1Y9BA 4H13C 2R88A 3RK2D 2AXTE 3Q2MA 3RBXA 1FMVA 3QK6A 4BJMA 2W80C 2XE2A 3QWOC 1JTHB 1EDJA 3FXDB 3C98B 5ADXK 2CWOA 1E1HB 3HTKB 5AW2B 1OWAA 3TGUJ 2QG4A 4E7ZA 3SWFA 5APVA 4QXCB 1GU5A 2IFNA 1GL2C 4CN4A 4WWIA 1LTJA 3T0SA 3WUTA 1CUNA 2YPVA 2JQ9A 1D1CA 2VKJA 5L3BB 4TV9E 5APYA 1QGKB 3T24A 8PRNA 4DOJA 1D0ZA 3HD7B 3N9MA 3N5LA 2WVRA 2VURA 1MFTA 5LP6E 1FE6A 2YO3A 3UIAA 3NZQA 3CVRA 5J1GA 4AQGA 4BWNA 5J2UE 2GE4A 2A06G 3Q5PA 2XQ4A 4OWFA 1VCTA 2QE7H 2Y0CA 3RC3A 5TISO 4ISSA 2I6HA 4RLCA 3KZIO 5KAIE 1ZOYA 4KT0J 1US7B 3IHRA 4KMCA 4ILUA 1GFNA 5CCGD 2X66A 3VP9A 5AQSB 4YHHT 1AVOA 3TGUG 4TNWA 1PGOA 2XAQB 2E43A 3M9HA 1HX1B 1UIXA 3ZN1B 2Z5HA 2NW8A 3O4XE 3RRCA 2OYIB 2WSCH 2R32A 5H2FE 1MZ9A 2E9XC 1RE4A 3BS0A 2XQAA 2O1KA 2LSYA 1VF5B 1E2AA 6PRNA 1N32T 3P4PA 4XFJA 3L09A 2ZFCA 3UUBA 4AKRB 5AW4B 2WQYA 5CB4E 1RY3A 1OEDA 4IL6O 3A0BO 4PV1C 4EIWA 2A9UA 4X62T 1BR2A 5ABFB 4O4UA 3AEFC 4RJTA 4WNKA 4U7JA 4FZLA 3POXA 4O8SA 4GOUA 2NTYA 3RQUA 3CPWO 4ZXLA 1ZV8A 4OK0A 3VHLA 4I43B 2BASA 2XHEB 2Y9YA 2AXDS 1NEKA 2K48A 1QVFO 2M07A 3Q5SA 1BGYJ 1G2CB 5HEHA 3HD7D 4RJWA 1K9MQ 2QJKC 4UB6O 1K73Q 5LJNA 5KJ7A 5JDPA 5AVTB 3T97A 1VQ5P 3AEGC 2XAGB 1Z0PA 3H1IE 3LIDA 3EDVA 3SFDA 1LWUA 1JNMA 4UB8H 4NUVA 1NU1E 3N9OA 1HXTA 3KINB 1ZN5A 3AE7A 4PW8A 1SQQJ 3ZCJA 2N9DA 3CD6P 2XJ7A 1JY3N 2NPSC 3E1RA 2KZ7B 2BG9B 2G0UA 3NRXA 1KNZA 4DR5T 2GA1A 5HXEA 1N34T 1N73B 3CC7P 5AVUB 3ANWA 1HXUA 4PJ0H 5CCHC 1Z8UA 5E79E 5DL5A 1VF5D 3EABA 1VQ7P 4DBQA 2Y9ZA 1IZNA 4B3ST 1EZVD 2GUSA 2HYNA 3PTZA 4NXMT 2H7VC 1BGYG 3UPGA 3H1JJ 4H9SE 3DJBA 5DQWA 1L0NE 2Q6QA 2NW9A 3H1KJ 3JAFA 3L70D 1FJGT 3U3IA 3GMIA 5FY1A 2J62A 2I1JA 3AA0B 3PF1A 4WZXA 3P7KA 4L0RA 2GUVA 3D70A 3ABVC 3T1YT 1S2EA 4GYRA 2WU2A 1KQGB 1VL2A 2Z5IA 1L0VA 4Y99C 2KWIB 1FZCB 1SQQG 3AE4C 2BKOA 3H6PA 4K3CA 3RBHA 2WP9A 2RN0A 1FS0E 2ACXA 1RHZB 5APQA 1PFIA 1SA0E 4GF4A 3RL0C 2WITA 1PP9D 2VQFT 1JY2N 3F5HA 5KAIO 3AA1B 3SWKA 3Q5EA 3KV5A 2DCFA 2KS1A 1L0LK 4F8HA 1BE3D 3BQKA 4ZKPA 4IE6A 2FFDA 4H9QC 3B57A 3HOEA 2VKOA 3H1JG 2R8AA 1P84E 3H1HJ 3H1KG 3UFEA 4LC1A 5DJTB 5BU8B 1H0TA 1GW4A 4ILBA 5DJUB 5BVZA 5AQVB 5LG3A 3L75D 4FJOA 3VR8A 1XMQT 2P67A 3RK3C 1KILC 4ZNCA 1QJ9A 1Q86Q 2XASB 1GTWA 5BU5A 4UB8E 5IYUA 2VQET 5EK4A 2Y0HA 5KLVE 2L9QA 3HKBE 1PGPA 3VMZA 1AVYA 4GYSA 4WVZA 1LVFA 4QH5A 3LBXA 4U7IA 5ABHA 4UVBB 3V8UA 4U74A 1FZBA 5FL1A 1MNEA 2EHOC 3ZC0A 3VZTX 1H89A 1SQVK 1JCCA 5CJ0A 5FY7A 5EZYE 2YDSA 1VPCA 3L73D 1KNRA 4PJ0E 5G39A 1NTMG 3IFMA 3RGLA 3AE5A 4AYNA 2SPZA 3EVYA 1YBKA 5AQTB 2W6JH 3H1HG 4ZOLE 2WDVA 1L4AB 2YKOA 4LSEA 1MMDA 4YFSA 3K19A 3M91A 1L0ND 3FWLA 5L3FB 1UUSA 3QH9A 1UX5A 3PV0F 3JCUH 2PGDA 1P84I 3PP5A 5L47A 1L0LE 3UFGA 1MIYA 2BS4A 5FMNA 4ZI2C 3GHGC 3BQIA 3A7OA 2C5KT 4H44B 4MHCA 4EB6E 2RKLA 4GKKT 2B87B 2CBIA 4HKZH 4P0BA 1Z56A 2QJPC 4AUWA 2L3LA 3U1AA 5HEGA 1UK5A 4HWFA 3JAEA 3CCVP 3ZN0B 5FXVA 2ODUA 3GP6A 1FAVA 3SWHA 4QXBB 2OYHA 4X1KE 4OFZA 2E5YA 2WDRA 1VCSA 3ZMTB 2YXRB 2BBHA 3FGAD 4FZNA 1OSMA 2V7IA 1P84D 1HCIA 3AAAA 1ZHXA 3O0EA 2R4LA 1ZXGA 3FZLB 3PORA 3MUDA 4L5GA 2PFXA 4CPGA 3MKDA 4HWCA 1BSHA 1NTKE 3P32A 2KC0A 5GTIH 5HEUA 2XV5A 5AQKB 2CEAA 3IF4A 3HE5A 1L4AD 1IJ5A 4H13B 4H9NC 5KLVD 1V9DA 2BKPA 5L2LA 1NTZJ 3TGUE 4AIUA 5JDHA 1KEYA 3JTYA 1J5ET 2K0LA 2Y8DA 2K88A 3P8MC 2W67A 4E1TA 1GL2B 1GU4A 1VQ8P 2LSKA 3KHUA 1OIPA 4H44D 4GKJT 2AEFA 1ZR2A 2CCQA 3CMLA 3VKGA 2BEQD 3CLQA 4R4MA 3BRYA 3CPZA 4MFRA 4H0LC 3V2QA 4ANJA 1UURA 4IL4A 3L72J 4TT3H 1PRNA 4P09A 5AVWB 4EOTA 1KD1Q 2CWYA 1EDKA 3GWHA 2M6BA 1AV1A 4UB8O 4M1PA 2XM1A 3B5NC 3M0DC 3NMDA 4FRTA 3ZMVB 2HR3A 1L0LD 1BCCD 2LHNA 1XMOT 1QSDA 5AVZB 1JNRA 2IFMA 2PBIA 2WWWA 3HD7C 1RF1C 2ZVNB 3L3PA 4A5XA 3G71P 5BMVE 2YDQA 5IWAT 2N9YB 4PJ0O 2J59M 1NTZG 3VRAA 3S4UA 4L75A 4LF5T 3EFGA 1QX8A 4H9RC 2K5BB 3JADA 2E9XB 1H8AA 4H13D 3AAIA 4KX6A 3LW5J 1IJDB 2NTXA 3L72G 1UX4A 5AW1B 3CMAP 5CA1E 3T1HT 4PV1B 3WU2H 5M1BA 1SQVD 1YKHB 4D6TD 3VP8A 1GL2D 3DP7A 4PFPA 1VQ6P 2XAFB 2VKHA 5LB7B 4GK0E 3RYHE 4AKHA 1WLXA 2H89A 2A06D 2UXNB 3W68A 4C7RA 2FJAA 3Q5DA 1FZGA 4DV7T 5HYAA 3NZPA 5AQLB 1YI2P 4E1SA 3ZLIA 1BGYE 2HLOA 5LHIB 3WAJA 2R89A 3DA3A 1LP1A 2LT3A 3POQA 2QRXA 3VMYA 4I0UA 4U7YA 3UU2A 4AYID 1AFOA 3TGUD 2FJBA 1OW7A 4XZCA 1A02F 1N7LA 1SQQE 5AW3B 2XSAA 4LMJA 3RLFF 1PV3A 2NPSB 1SFCA 3AVSA 4WY4C 3O8ZA 4EI2A 3V5BA 3ZCIA 2QTKA 3AEEA 1AQ5A 1FU1A 2WB5A 4TNVA 3LFMA 2KP8A 2E9XD 5AQGB 2XG6A 2RPAA 3TNUB 4JBZA 5LOVE 2F1CX 4GCQA 3KVAA 1URQC 1KQLA 3I55P 3H3MA 1ZRTE 2P58A 1JO5A 1T16A 3I0OA 2LE8A 3H1JE 2X9YA 3IBPA 3ZT7A 3H1KE 3NXSA 4KHPT 4CQIA 3NVOA 1YTZT 3RI5A 2ZM6T 3RC8A 2HFED 1ZHCA 4IDOA 4A7PA 4CI1B 4Y28J 2QSIA 4LF4T 4HN9A 1M1KQ 3AXJA 3MHVA 4IE4A 5LBQB 4GK5E 1KZUB 2A45H 4Y99B 4P1NA 2R5DA 5L3CB 3AEAA 2NWBA 1WRGA 3SZVA 3V2NA 1X0TA 2X9WA 4JI1T 3FXEA 3JCUO 1IFIA 1RQUA 2XAHB 1HG2A 2ZVOB 5FXZA 2OLTA 4O9BA 3HUSA 2FYUJ 1FZCC 4IL9A 2LXCB 4QMAA 4AQFA 3A2AA 4AYDC 1K05A 3J9X1 4ASKA 5PRNA 1NTME 3O1JA 4JQ0D 2NPSD 5H6RB 3ONLC 3H1HE 5AQHB 4K0KT 3P7IA 4HKAA 3CKDA 3TSIA 3ZYKA 2IW5B 3C4WA 2ZAEB 4TWDA 5FY0A 5JR9C 3V2RA 1HTJF 1RE3A 3GN5A 2HH7A 4AISA 3VZUX 3SFEC 3RIFA 3PRJA 5LJMA 4UF0B 3NFQA 3RK3B 1KILB 3EDUA 5HWYA 3VR9A 3A8YC 4NUUA 4LFCT 1W2EA 2YMKA 3Q3DA 4DR7T 1GFQA 3EFFK 3B13A 3AE6C 4KBMB 2CXLA 2FYUG 2WT7B 3CX7B 3GLMA 1PPJG 2EHOB 2L91A 2XZEA 3ZSTA 5GTIO 3CCJP 3LK2B 2XUEA 1ZLLA 3A5TA 4LF6T 3N9NA 1M7KA 1SQBK 1MM5A 1SUMB 1HGVA 5AVVB 1ZW0A 4X66T 1LT9C 2QJYC 1ZP0A 2CHNA 2MOZA 4U72A 2ZYDA 4C4VA 1Q7YQ 2WZ7A 3ZMZB 3H1JD 3PUYF 2R6GF 3BCCJ 2LOSA 3H1KD 4EOZB 2JPFA 2AEJA 1HWTC 2R4OA 3CXHI 2GM4A 1NTZK 2XAJB 3ZMUB 2JQYA 5K5GB 4AQYT 2ZT9C 2IPPA 2LXBA 1BXWA 4U3FJ 3GHGB 3POUA 3N4XA 1OVVA 3U1CA 1ZHYA 1MMAA 2WMOA 1LRZA 3LK3B 1HUCA 2QJPB 1ZEEA 4IL6E 1JOCA 2NOXA 1IFJA 3HR0A 3C1LA 1KILD 2E74C 3RK3D 2X9XA 4H44C 1Y8AA 2FJEA 3HI2A 3LW5H 2ZM0A 3PTRB 4EZ4A 3KXDA 3AE2A 3A5XA 5FXXA 3SOLA 3VY9X 2WMNA 3BCCG 4DCKA 2YINA 1QJPA 5CBOA 2EHOD 1U7JA 4O3YA 5L3EB 2WAUA 1LTGC 3CXHD 1H6S1 4EYYQ 2IX7C 3HKEE 2KB7P 2Q9QA 1DX7A 1J5WA 2D2SA 4C00A 4O4IE 4JI2T 2F4VT 3AA7A 4U3FG 3V5SA 1XTCC 2V6YA 3AEBA 3CX5H 2I59A 1R8EA 3WU2O 3M9QA 3TK1A 3VRBA 1SLQA 2X27X 2KNCA 4BXLA 2NW7A 3RKOA 2W63A 1NTKJ 1NTZE 2PTFA 4N74A 2IIUA 1LTTC 2W00A 2WPVB 3E08A 1G73A 1XTGB 2K9JB 4ZZCA 1NHLA 4X65T 3FHNA 3IAOA 3AE8C 3H32A 2J47A 3V5UA 4H0LB 3L72E 3M3ZB 4IDZA 1Q9FA 4IIJE 4HFDA 3ZSSA 4FSPA 2UU9T 4YY3T 1U5PA 5JH7E 1ZV4X 4WBOA 5CCGA 5AW8B 4U9CA 1K8AQ 3PGUA 3B5NB 3PUSA 1D7MA 4ZS2A 2VL0A 2N1TA 1LTAC 4PD4E 1RF1B 1X9VA 2Y48B 2HHHT 3OA7A 1JTHA 3FXDA 2IBZG 1NTKG 1X9BA 2R44A 1OEDE 3MP7B 2N2NA 3A0HH 4YXDC 3UU6A 3P50A 1HBWA 3A7MA 5AQIB 4YTPA 2Y0DA 1SP4A 1NU1K 4DR1T 1YQ4C 2XTLA 2IC6A 1D0YA 5JRCB 1ZMEC 3MGNA 4M3LA 1QL1A 2CA5A 1OW6A 1X79B 5AW0B 1H88A 3KVBA 5AQJB 4YXWH 1M1JA 4N78D 2ZYAA 5KMGP 1SQBD 1OEDB 1QLBA 4TWHA 1KMIZ 1USDA 1BDCA 3J7Yq 4UR9A 3JSVC 4H0LD 1JEKA 5HXCA 2LKGA 5L4HA 3R2PA 1L0NK 1N7SC 5DJQC 2XQ5A 4PUXA 2W27A 3CX5E 1M62A 4JYCA 3NWIA 2IZ1A 4A98A 5JDFA 4PD4I 3B5ND 3EUHA 4Q25A 2SPCA 3P4RA 4C69X 1SE7A 5J0ZA 1NTZD 2OYIA 2FYUK 2XZRA 2OGUA 3P4WA 1Y01A 1T3UA 4LSIA 2ZJSE 3FWNA 4O3WA 2WY2A 3PUWF 2C9NY 3FX0A 4QKNA 3AECA 1X8YA 1CI6B 3BATA 4YLHA 3C51A 5ABFA 4WY4B 4JI7T 1G1IA 4IGUA 1SS1A 1S72P 3SZDA 5APTA 2CXFA 3KYQA 4GKGA 4WBAA 2WMMA 1YD8G 4O3XB 2JWDA 5IHYA 4U3CA 1URQB 1Y47A 3AE3C 1KYOH 3FZHB 4PD4D 5L4EA 1MNDA 1HJ0A 2R3SA 5FVKA 2BEZF 5AW7B 1WT6A 3F2EA 3RKGA 1WCRA 4WYVA 4HGAA 4EIJA 2XQ7A 2CE7A 3AEDC 4C90A 5F3JA 1KFYA 1E5WA 2FBWA 1NKNA 1D1BA 5IUXA 1QVGO 3P4QA 4NPEA 3TLTA 1WRDA 4IREA 2LM2A 2J1NA 4BJNA 4HFVA 2YN6A 1JMMA 3S4RA 5KLVK 2KZ7A 2BDEA 2BG9A 1T8ZA 1BR1A 3CC2P 2CK3H 1N73A 4PK6A 2FYUE 1OVRA 1T72A 1KV4A 5HCMA 2H88A 1PPJE 2ZYGA 5DQVA 1XNQT 5KJ7D 3AE1A 2LSGA 5AVXB 2XKMA 2B1EA 3CQXC 3N9PA 2WWUA 5A1LA 1AJ3A 4WY4D 2WWVA 4Z91A 1IBKT 2X67A 2IDBA 3L4FA 1OX3A 2KDYA 2KLUA 3AA0A 5JR9B 1KB9H 1HFAA 2E2AA 2OTKE 2Q7CA 1E54A 1NTMJ 4FQEA 1URQD 1CSBA 2XMXA 4UELA 2ODJA 1U4QA 1VRBA 5E0OA 3MJXA 1L2PA 1NJIQ 1T1LA 3CC4P 2R4NA 3CCLP 4RL9A 4KP3C 4EXTA 2CLYC 1SQPJ 4I7ZC 1GZLA 5CGMA 3H1ID 3AE9A 2WSSV 3EWKA 3JCFA 4QX7B 4W7ZA 3AA1A 1NU1D 1GFPA 1JY3O 3LBXB 3W15B 3C50A 4WBNE 5F8PA 1BT9A 1LT9B 2QJYB 4JEHB 3TZGA 4DV2T 4YSYA 1YQ3A 2MKVA 1KYOE 3FYXA 3BCCE 4IL6X 5T5FA 4OYJA 4EEDA 2M67A 2K3RA 4W7YA 3RIUA 2QM7A 3AA6B 1HS7A 5FP3A 1NTKK 4ILCA 5AVRB 3HE4B 5LHGB 2M06A 2DWKA 3H3AA 4U31A 3FB2A 5DL6A 4XNKA 2ZT9B 4U3FE 2FJDA 3LIEA 3PLNA 2K1AA 2VWAA 2Q1KA 3CK6A 3EHZA 2LSIA 3E22E 1SQPG 2KIKA 4QQ1A 3PDYA 4KR8A 1J1DC 2J58A 2FYUD 3N2GE 2UXBT 5CA0E 2OA5A 2E74B 1HVVA 1PPJD 5AQRB 3VZWX 1FC2C 1S5LH 1FMWA 4OX9T 5AQNB 4ERRA 5LYJE 4FOZA 4PR7A 1VQLP 5EK3A 5CHXA 1L4AA 3SRZA 4RLBA 3HWBA 3RIAA 1JY2O 1JNZA 1FDOA 1T2KC 1JY2P 1DIPA 3VMXA 2H3RA 4X64T 2OYHB 5GTHH 4LF7T 5L3GB 4N6JA 1Q81Q 1KB9E 1X22A 1KYOI 5DL8A 1DEBA 2Y0LA 2XU6A 4ZS3A 1DH3A 2KLVA 2C0SA
chains in the Genus database with same CATH topology
2HPJA 2XG6A 2N1GA 4UIGA 2MHLA 5LOVE 4GCQA 3KVAA 3C4ZA 3PUGA 3OJAA 3SY7A 4DVDA 3R84B 3RRWA 4G63A 4JCHA 4B61A 4X1YE 3I0OA 5H6QB 5JREA 3UAQA 2LE8A 5ETWA 2X9YA 2V1DB 3IBPA 4CQIA 3RC8A 5GV0A 1ZHCA 3HKDE 3M65A 3ZJ2A 4CI1B 3FBZA 4HN9A 2KWHA 3NSGA 2KT9A 2J4UP 2DNXA 3K8PC 2ODVA 4IE4A 5LBQB 3BK9A 2IC9A 4GK5E 3G7GA 2LFUA 5L3CB 2NWBA 5FNVE 3SZVA 4DMWA 2X9WA 5LGTB 4L9IA 4JLEA 5HXSA 3F31A 2XAHB 4ZI2D 1HG2A 4AQFC 3JTYA 5FXZA 2XE5A 3ZC1A 3SS1A 2Y7SA 2X0LB 1ZHZA 5AFUK 3KFWX 3I1AA 3RX6A 4UEMA 3Q2MA 4FMSA 1FMVA 3QK6A 4BJMA 3N9LA 2W80C 3H37A 2XE2A 4AQFA 3FXDB 4F6RC 4AYDC 1YS5A 2YEVC 3C98B 3J9X1 2CWOA 4ASKA 1E1HB 4E7ZA 5PRNA 1OWAA 5ADXK 3O1JA 4QXCB 3QRAA 5H6RB 4N59A 3T0SA 1UCUA 3F57A 3P7IA 1CUNA 4EAHA 4HKAA 3CKDA 4H63V 2YPVA 3ZYKA 2IW5B 2FGRA 1D1CA 2VKJA 3C4WA 5FY0A 5JR9C 4RJXA 5L3BB 5EK2A 3O1HA 1HTJF 4TV9E 3LG7A 3I0QA 3KV4A 3GN5A 4TN7B 2HH7A 3T24A 1HXXA 3VZUX 8PRNA 3NBXX 5ADXL 3OYXA 1D0ZA 1O3XA 5JR9A 5LJMA 4UF0B 3N9MA 3Q5XA 3N5LA 1Y64B 1MIWA 2VB6A 3EDUA 5HWYA 1NAFA 5LP6E 3NZQA 4TX5A 2X68A 3CVRA 5J1GA 4NUUA 4AQGA 2A3DA 5J2UE 2GE4A 2O4VA 3SY9A 1GFQA 3B13A 5TAOA 4I55E 3WI5A 4KBMB 3RC3A 2CXLA 4ISSA 5LXTE 4RLCA 3CX7B 3QRCA 2EHOB 1US7B 5LA6E 3IHRA 1S35A 4KMCA 4ILUA 4AXPA 1GFNA 2F1TA 3LK2B 2XUEA 3C64A 4MLKA 3RH3A 2X66A 3ZMSB 2JQQA 3N9NA 4XBFB 3O9XA 2XAQB 3KBUA 4PJMA 3CWZB 1MM5A 2PG8A 3ZN1B 2WM9A 1WR6A 3WI3A 2NW8A 3O4XE 3RRCA 1BR4A 4UVAB 2MOZA 2E9XC 4U72A 2Y0KA 4DNDA 2LSYA 3ZMZB 2RP4A 6PRNA 4MBQA 2LOSA 3L09A 4YJ2E 4AKRB 4EOZB 4EYYR 5CB4E 3PQUA 4AI6A 2E9XA 3N9QA 2CM0A 2JPFA 4GIWA 4EIWA 1BR2A 4O4UA 4WNKA 2D5UA 4FZLA 2XAJB 2C5IT 3POXA 1D1AA 4O8SA 4A56A 4GOUA 2NTYA 3ZMUB 3AA6A 4UVCB 3ZYLA 1BXWA 3IF8B 4BUMX 3POUA 3ZPOA 1D0XA 2MYSA 4O4HE 3VE1A 5G26A 1ZHYA 1MMAA 2WMOA 4OK0A 1LRZA 4WW0A 3VHLA 3LK3B 4I43B 4FZMA 2XHEB 4H63H 1ZEEA 2LSJA 2K48A 2NOXA 2M07A 3PU8A 1KK7A 3HR0A 4RJWA 2X9XA 2MTQA 5LJNA 5JDPA 4YHJA 4AKIA 1SHZC 3HI2A 2XAGB 5LHHB 2QGSA 1Z0PA 2ZM0A 1B7TA 3AAAB 3PTRB 4EZ4A 1MMGA 3EDVA 3PU3A 4NUVA 3A5XA 3N9OA 5FXXA 2Q9QC 3KINB 3SOLA 1HXTA 3VY9X 4PW8A 2WMNA 2YINA 1QJPA 3ZCJA 2EHOD 2N9DA 4O3YA 5L3EB 2WAUA 1H6S1 4GHBA 3HKEE 3UUXB 3Q9DA 4K0UA 2V7JA 2KZ7B 2D2SA 2Q9QA 1MMNA 2CMRA 2G0UA 3NRXA 1KNZA 2PORA 4O4IE 4FRXA 5HXEA 1WYCA 2DI4A 3ANWA 3AA7A 1HXUA 3TKLB 3JC6D 3V5SA 5JVDE 5DL5A 2K4TA 3AAEB 2I59A 3CQCB 3UUMA 2UXXB 4CI3B 1MM4A 4DBQA 3CX8B 1H7CA 4HE8A 1IZNA 2X27X 4H9PC 4KRAA 3AVRA 4AKGA 4PK4A 2NW7A 4HTEA 2H7VC 2KMFA 2W63A 4ISTA 2W62A 3LJCA 4JEUB 3RKOA 4H9SE 4QWNB 3DJBA 5DQWA 2V7MA 2NW9A 3UPGA 3QUJA 2W00A 3BQLA 3RPUA 3ZYMA 2ZFGA 3E08A 3GMIA 5FY1A 2PFVA 3U3IA 1YW0A 3AA0B 1G73A 4L0RA 4CXWA 4IE0A 3ETVA 4GYRA 4ZI3D 3FHNA 4FSOA 3UTKA 1WYBA 4QX8B 3N2KE 2KWIB 3V5UA 3LK42 3RBHA 4I50E 5JDMA 1HF8A 4IDZA 1Q9FA 1YKEB 4IIJE 4FSPA 2W0GA 2ACXA 1U5PA 4PK5A 1ZV4X 3CQGB 3PUQA 1S94A 4WBOA 2CXDA 1SA0E 1G8XA 4U9CA 2Y2XA 1EZ3A 4GF4A 3NRYA 5KX5E 1FEWA 3PUSA 2XE1A 1NWMX 3I9WA 1LKXA 4ZS2A 4D64A 3ZEFB 3AA1B 3OBVE 3MA9A 2LJLA 3KV5A 2DCFA 2YU1A 2CLYB 2V7KA 2HPLA 3BQKA 2Y48B 4OHFA 5HXRA 4IE6A 1HX8A 4H9QC 3B57A 3UULA 3HOEA 2VKOA 2LOPA 4C91A 4FUVA 3P8CD 2LM9A 3KBTA 4UV9B 4PJNA 1T98A 2N2NA 4D5UA 3UFEA 2YU2A 4ZI7E 3KV6A 4CXYA 1FIOA 4G2AA 2XTLA 2IC6A 3SYBA 1BR0A 1D0YA 4FJOA 4IHJE 2LHRA 5JDQA 5JH7E 5JRCB 4G75A 4KUMB 3OYZA 4O49A 1QJ9A 2N2LA 2CA5A 3I9YA 4X20E 2XASB 3K3OA 4QHOA 4E7SA 5HAXA 5L3DB 3KVBA 4G76A 4UF0A 5IYUA 5KDMC 5EK4A 4BAYB 2Y0HA 3SYSA 2L9QA 3HKBE 4N78D 4GYSA 5KMGP 1LVFA 4AKLA 3LBXA 5HWXA 5LNKA 4UVBB 4PFOA 4U74A 3V8UA 1PHOA 4ADZA 1MNEA 2EHOC 3ZC0A 3VZTX 4OYKA 4PJLA 2JMMA 1GFOA 5FY7A 3J7Yq 5EZYE 3ESLA 5HXCA 2EHOA 2XQYA 5DJQC 3LK2A 4PUXA 4AYNA 3VE2A 3EVYA 4ZHQE 5JDFA 3JC6C 4ZOLE 3EUHA 4V1Av 4HEAA 2SPCA 4LSEA 1MMDA 2JMHA 4C69X 3K3QC 3K3NA 5FVNA 4YFSA 2P9BA 3K19A 2Y6XA 3R6NA 4AYMC 3C4XA 5L3FB 3KVDD 5LG4A 3IEEA 1UX5A 4YJ3E 4UV8B 4LSIA 4O3WA 2KXPA 3RYCE 3VKHA 3MK7C 1MIYA 3WAKA 4QKNA 1IAPA 5FMNA 4YLHA 4ZI2C 4XAXB 4B6XA 3Q5WA 4O3ZA 3C51A 3BQIA 4O4LE 4IGUA 2C5KT 2ZM8A 4MHCA 4O2AE 4EB6E 2JRKA 3SZDA 2KNDA 4X1IE 4P0BA 4P0AA 2CXFA 5C8YE 1YD8G 4O3XB 2L3LA 7PRNA 3RYIE 2Q9QB 4IE5A 5IHYA 2W61A 3LK3A 2KLQA 3PURA 3ZN0B 4LSHA 2X51A 5FXVA 2ODUA 2V7LA 3GP6A 4JUYA 4QXBB 3SWHA 2NP9A 1MNDA 4OFZA 4X1KE 3UUNA 2YK0A 3N2OA 3F2EA 3ZMTB 2ZLYA 4FZNA 2LEHA 2K24A 4HGAA 1OSMA 2CE7A 2E8IA 2V7IA 1HCIA 4C90A 5F3JA 1ZHXA 3AAAA 3O0EA 4KR4A 3LK41 2H7OA 4BA9A 1THQA 2VKDA 1QUUA 3PORA 1D1BA 4L5GA 3WI4A 3FXEB 4EYUA 3HKCE 3C5OA 1WRDA 3MKDA 4O4XA 3DA4A 2J1NA 3KDSE 1HG5A 4BJNA 2KC0A 4HFVA 2A2FX 2KZ7A 1MIVA 2BDEA 3VU7H 2OMFA 5EE2A 4F4BA 2CEAA 5JDNA 3EMNX 1BR1A 1IJ5A 4PK6A 1ORMA 2GK9A 4H9NC 3DTOA 2RA1A 3PE0A 3QC9A 5JQGE 1OPFA 3KV9A 1MPFA 1V9DA 5IYZE 3AAEA 5DQVA 5LGUB 1Q9GA 1G90A 5L2LA 3OKQA 4TV8E 2LSGA 4FI5A 5JDHA 2XTQA 2B1EA 3CQXC 2Y8DA 3N9PA 4DMVA 2K0LA 2K9AA 3T8OA 2J1DG 4O2BE 3U78A 2WWUA 4E1TA 5A1LA 1AJ3A 4H9OC 2LSKA 2A72A 2ZMAA 2X67A 4AUIA 2CCQA 1OXZA 3CMLA 3VKGA 2D0UA 3GN5B 2V26A 2KDYA 4AKMA 1IJ6A 3AA0A 4GCSA 3CPZA 4MFRA 5JR9B 3PRNA 1HFAA 4ANJA 2Q9QD 3AB3B 2ZM2A 1E54A 4P09A 1PRNA 4LSFA 2BVLA 2CWYA 2VASA 3RYFE 4CI2B 1QJ8A 2LHFA 2XMXA 3HL6A 3GWHA 4UELA 4CXXA 2ODJA 1U4QA 2MBGA 3D0TA 4M1PA 3HW9A 1ZKEA 2C5JA 2DWGA 1VRBA 3CX6B 4FRTA 3ZMVB 5E0OA 5GONE 2LHNA 4DBRA 1QSDA 3MJXA 5FYMA 5AFUL 2JJ9A 2PBIA 4DO0A 3ONXA 4RL9A 2DLRA 4KP3C 2Z6EA 4EXTA 2FGQX 2CLYC 5DABA 5JDGA 3HOLA 3L3PA 2WBLA 2PRNA 5BMVE 3HA4A 4QXHB 2WSSV 3ZJ1A 4QX7B 3AA1A 2BVMA 3ETUA 3MACA 1GFPA 4JFBA 3S4UA 4AZLA 3LBXB 3W15B 4FT6A 3C50A 3GA8A 4PJJA 4WBNE 4CZZB 4H9RC 5F8PA 5JDLA 4XNLA 1BT9A 2K5BB 5FXWA 3PQSA 4JEHB 3TZGA 2E9XB 3AAIA 3O1IA 2L8KA 3FBLA 3FYXA 3VY8X 5T5FA 2DHRA 4OYJA 2M67A 5HXHA 2IAKA 2NTXA 3PUAA 4PAGA 1UX4A 2MNHA 5J2TE 3AA6B 5CA1E 1HS7A 2F1VA 5FP3A 5JRCA 5M4YA 3MXZA 1YKHB 2KINB 5LHGB 2M06A 2DWKA 3H3AA 3DP7A 5D5DA 4PFPA 4N58A 1X79A 1ZHWA 3FB2A 5DL6A 3T20A 4XNKA 2XAFB 4O4JE 2VKHA 4I4TE 2KXPB 2BZBA 2VWAA 4GK0E 3RYHE 4AKHA 1WLXA 4J2CA 2UXNB 2LSIA 3E22E 3UT5E 4QQ1A 1BH3A 4UXNB 4AYEC 3PDYA 4AKRA 5HYAA 3NZPA 4E1SA 3ZLIA 2YNKA 5LHIB 4KR8A 3N2GE 3WAJA 4Z8XA 5CA0E 2JMKA 4PNIA 4IE7A 4EZHA 3DA3A 2OA5A 4MALA 4FESA 1LVKA 3VZWX 2LT3A 2ZLDA 2VL8A 3POQA 2PJQA 5DL7A 4AFKA 4Z3TA 2VK9A 1FMWA 4ZI3C 4ERRA 4D65A 5LYJE 2XTRA 4FOZA 4TUYE 3UU2A 4AYID 2X9HA 3MZKB 2ES0A 5EK3A 4XZCA 4RLBA 3SRZA 3HWBA 2QA7A 3LFMA 2N2MA 3E0ZA 2H3RA 5LBMA 1VOMA 1P4TA 5LGNB 2W81C 3AA7B 3ANWB 3AVSA 5LCYA 5L3GB 1GFMA 4GCPA 2D0TA 3ZCIA 2ERVA 2QTKA 5DL8A 2Y0LA 1ZHTA 4ZS3A 4TZ4C 2XE3A 3A2SX 1IZNB 2C0SA 2E9XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU L;  3LK4 1;  3AA6 B;  3LK2 B;  3AA6 A;  3LK2 A;  3AAA A;  3AA1 B;  2KZ7 B;  3AA0 B;  5ADX L;  2KZ7 A;  3AA1 A;  1IZN B;  3AA0 A;  3LK3 B;  3LK3 A;  5AFU K;  2KXP B;  2KXP A;  3AA7 B;  3AA7 A;  5ADX K;  4AKR B;  3LK4 2;  4AKR A;  3AAE B;  3AAE A;  3AAA B;  1IZN A; 
#chains in the Genus database with same CATH topology
 2HPJ A;  4GDO A;  4UIG A;  2B87 A;  1RF0 C;  4RKU J;  3C4Z A;  3ONJ A;  3SY7 A;  4G63 A;  4B61 A;  4X1Y E;  3UQ4 A;  5H6Q B;  2IBZ E;  4IT4 A;  5CMZ A;  2XND H;  1PGQ A;  2A45 G;  2ZT9 D;  2LR2 A;  4DZO A;  1IO4 A;  5F5W A;  2KT9 A;  2DNX A;  1N8R Q;  1IBM T;  5AW9 B;  4DMW A;  2M3B A;  3BCC D;  2CPS A;  2E74 D;  3CCS P;  2J4G A;  3F31 A;  4L76 A;  4AYC A;  2Y7S A;  3SS1 A;  2RMZ A;  4LFA T;  2KYV A;  2C0W A;  3KFW X;  3BRV B;  1OMI A;  2FKW B;  4UEM A;  1FZA A;  4ASV A;  3O6Q B;  3N9L A;  1M56 D;  4C7N A;  1I94 T;  1LTJ C;  1YJW P;  1YS5 A;  1KB9 I;  2ITA A;  4U3F D;  5AW5 B;  1Q90 D;  5FKY A;  2P7J A;  2WCA A;  2LKH A;  3JCU E;  1UCU A;  2YDR A;  1R5L A;  4H63 V;  1M57 D;  2FGR A;  1GL2 A;  4LLH A;  1NYH A;  2KI7 B;  5EK2 A;  1YYC A;  1W9R A;  3O1H A;  2IBZ I;  2L5G B;  3KV4 A;  1SQQ K;  3CWB J;  1HXX A;  5ADX L;  1S5L E;  1O3X A;  3L71 J;  1CW5 A;  3B5M A;  1NAF A;  2YMY A;  4TX5 A;  3QOF A;  3Q1M A;  5TAO A;  1ZOY C;  3VN0 A;  2M5A B;  4I55 E;  4U2Z A;  5LXT E;  4JYA T;  5GTH E;  1IBL T;  3LDQ B;  3QRC A;  5LA6 E;  2OQQ A;  4IDN A;  1S35 A;  2V8S V;  2F1T A;  1AJY A;  3C64 A;  3GF3 A;  2JQQ A;  2M6I A;  1RE4 C;  4XBF B;  1LGH B;  3KBU A;  4PJM A;  3CWZ B;  2PG8 A;  1N7S B;  3WI3 A;  3A3Y B;  4KHZ F;  2WQY C;  1HF9 A;  4I2L C;  3Q2Y A;  1VQN P;  1OED C;  4Z1M H;  4DND A;  3CCM P;  2IBZ D;  2J5U A;  3USS A;  1NTK D;  4MBQ A;  4YJ2 E;  2E42 A;  5GTI E;  2WJR A;  4AI6 A;  3G3Z A;  3L70 J;  2E9X A;  3N9Q A;  5KAF H;  2CM0 A;  3CWB G;  1R8I A;  4GIW A;  3CCR P;  3CCU P;  1J2J B;  2CHO A;  2D5U A;  3L71 G;  2C5I T;  4A56 A;  1IFN A;  2C0X A;  2HPC B;  2KOG A;  2LKM A;  5ABE A;  3IF8 B;  3BVH A;  4BUM X;  5AQF B;  3ZPO A;  4NIQ A;  3AEF A;  4O4H E;  1FDM A;  1YIT P;  4BRY B;  3X1D A;  2W2U A;  4WW0 A;  3P8C E;  5KJ7 C;  1FJK A;  1YJ9 P;  1DD3 A;  1NTM K;  4HJG H;  1PP9 J;  3SFD C;  1YTZ I;  2MTQ A;  1LWU C;  1NVO A;  4AKI A;  3AE7 C;  1SHZ C;  3L74 J;  2QGS A;  1T6A A;  1MMG A;  1EZV G;  1BE3 J;  5KXJ A;  1IC2 A;  3L8R A;  3AEG A;  3PJA A;  4GHB A;  3L70 G;  1OZH A;  2V7J A;  2CMR A;  1E7P A;  4FRX A;  1N2D C;  1WYC A;  1N7S D;  3L75 J;  4HH2 A;  1KQS O;  2NPS A;  2DI4 A;  4DV0 T;  2K4T A;  2WPQ A;  3GG2 A;  3AAE B;  3CQC B;  3UUM A;  4GT1 A;  2FYN C;  4CI3 B;  5KKZ C;  1MM4 A;  3CX8 B;  1HGZ A;  5HEO A;  1H7C A;  4W80 A;  4HE8 A;  4H9P C;  5CCH A;  3AVR A;  4KRA A;  4AKG A;  3TNU A;  4PK4 A;  4HTE A;  4IST A;  2KMF A;  4JEU B;  2W62 A;  4QWN B;  1PP9 G;  3QUJ A;  1VQM P;  3BQL A;  2X0H A;  3ZYM A;  2ZFG A;  2PFV A;  1YW0 A;  3L74 G;  4IE0 A;  3ETV A;  1BE3 G;  2LRK A;  3WU2 E;  4ZI3 D;  1PZQ A;  1WYB A;  2N9B A;  1FOS E;  2PP6 A;  4QH1 A;  3ABV A;  3LK4 2;  3ZT5 A;  1LT1 A;  5JDM A;  2BCC J;  1HF8 A;  1S5L O;  2YIU C;  2W0G A;  4KJM A;  4PK5 A;  1G8X A;  2Y2X A;  3AE4 A;  4OGQ C;  2O01 H;  3NRY A;  2JJL A;  5KX5 E;  3L75 G;  1FEW A;  4ZKU A;  3B71 A;  1BGY D;  1FBM A;  4JPZ B;  1NWM X;  1LKX A;  2IWW A;  4EGW A;  3CME P;  2FFD C;  4LF9 T;  2E5T A;  5GTH O;  3ZEF B;  4DJG A;  3OBV E;  3MA9 A;  2LJL A;  1SQP E;  2YU1 A;  2CLY B;  2V7K A;  4I7Z B;  1KC8 Q;  2HPL A;  1FDI A;  5HXR A;  5AVQ B;  4AQR D;  3UUL A;  2LOP A;  4C91 A;  4FUV A;  3P8C D;  3KBT A;  4UV9 B;  1SQQ D;  4JF7 A;  1T98 A;  4PJN A;  2D2C B;  2WPS A;  1XNR T;  1HH0 A;  1VDF A;  2YU2 A;  2NZ2 A;  4ZI7 E;  3D6Z A;  1GK6 A;  2P2U A;  4YT0 A;  3SYB A;  2WSF J;  2LHR A;  5JDQ A;  1HJB A;  3OYZ A;  4O49 A;  2BCC G;  3QB5 K;  3K3O A;  4G76 A;  5L3D B;  3DWN A;  1W09 A;  4UF0 A;  2G3A A;  2UXC T;  3L36 A;  1KIL A;  1S9K E;  4C4V B;  1ZRT D;  1N33 T;  3C9I A;  2Z4E A;  2M0B A;  5LNK A;  1PHO A;  4ADZ A;  2DW3 A;  2DL1 A;  3V4W A;  2IZ0 A;  2UXD T;  4YTN A;  4OYK A;  3AE5 C;  1KOR A;  4HFE A;  4PJL A;  4TWF A;  5HEJ A;  2JMM A;  4GOE A;  1E79 H;  2WT7 A;  3PUX F;  2WVP A;  2EHO A;  1M7L A;  2AXT H;  2JIW A;  3LK2 A;  2IYO A;  1J1D B;  4EDF A;  2H43 A;  2V7Q H;  3JC6 C;  4HEA A;  2WTY A;  4HYT B;  3K3Q C;  5FVN A;  2P9B A;  2BS3 A;  3R6N A;  3WUU A;  5LG4 A;  4YJ3 E;  4UV8 B;  3MZW B;  1CZQ A;  3D6Y A;  2KXP A;  3CCQ P;  3RYC E;  4IDP A;  5APS A;  3MK7 C;  3CCE P;  4JI6 T;  4JBW F;  3WAK A;  1IAP A;  1UII A;  4O3Z A;  4O4L E;  2D2C D;  2B88 A;  2CRB A;  1NTM D;  2JRK A;  1GW3 A;  4DUZ T;  3OJA B;  4B86 A;  3GHG A;  3H1H D;  4U33 A;  3SWY A;  7PRN A;  2Q9Q B;  3BAS A;  2E76 C;  1BCC J;  2OYH C;  4IE5 A;  2W61 A;  3LK3 A;  2KLQ A;  4LMK A;  2I0M A;  2X51 A;  3WMM 0;  3RL0 g;  4JUY A;  2NP9 A;  3UUN A;  1S3J A;  2YK0 A;  1HTL C;  1FZF A;  4L74 A;  3MUD C;  2K24 A;  4DT0 A;  2LEH A;  1J1E C;  2E8I A;  5TJH A;  3LK4 1;  2OTJ P;  2H7O A;  4BA9 A;  5H2F H;  4OH8 B;  2Q9I A;  3WI4 A;  1N86 A;  2A45 I;  2HOD A;  3HKC E;  3OVU A;  3DA4 A;  3KDS E;  1DU2 A;  1HG5 A;  2A2F X;  1MIV A;  2OMF A;  1GD2 E;  5KAF O;  4YSX A;  1ORM A;  2O01 N;  4CN6 A;  4CTD A;  5JQG E;  3M06 A;  3PE0 A;  1OPF A;  3QC9 A;  1SQV J;  1CHU A;  1S9K D;  1MPF A;  4D6T J;  3S1K A;  1NKZ B;  1LTJ B;  2PRR A;  1BCC G;  5LGU B;  1NOH A;  1Q9G A;  3OKQ A;  1T2K D;  4TV8 E;  4FI5 A;  4DMV A;  2NRG A;  2XY8 B;  2K9A A;  3U78 A;  3UU5 A;  1MKM A;  3RF1 A;  4H9O C;  2A72 A;  2ZMA A;  4U2Y A;  2D0U A;  4JV5 T;  2V26 A;  4KI0 F;  4HWI B;  5ABG A;  3PRN A;  3QB5 A;  2K9J A;  4LML A;  4IFM A;  2ZXE B;  4K3A A;  2Q9Q D;  3CWB E;  5FVL A;  2ZM2 A;  4LSF A;  5EE2 A;  2BVL A;  2VAS A;  4CI2 B;  2LHF A;  3HL6 A;  3IA3 A;  2W4X A;  4CXX A;  5L8R J;  3L71 E;  2V5C A;  3HW9 A;  1PGJ A;  3BRT B;  3HTK A;  3D0T A;  1J1J A;  3UQ7 A;  5HCJ A;  1KNP A;  2IHR 1;  1MFZ A;  4NPP A;  5FYM A;  3KQG A;  1VQO P;  2JJ9 A;  3B5N A;  3M0D A;  4DO0 A;  3ONX A;  1MV8 A;  3N7N A;  2DLR A;  2FGQ X;  2Z6E A;  3HOL A;  5DAB A;  1SQV G;  2E75 C;  4D6T G;  2PRN A;  3HA4 A;  4QXH B;  3S9O A;  2BVM A;  5E79 H;  4JI5 T;  1ZR4 A;  4B3M T;  4JFB A;  1M1J B;  3HD7 A;  1RF1 A;  5G3A A;  2YO2 A;  1R5S A;  1DEE G;  1EQ7 A;  1JUN A;  3GA8 A;  4CZZ B;  5JDL A;  2QEX P;  4EEB A;  4XNL A;  3PQS A;  5FXW A;  1EZV E;  2O3J A;  3TLS A;  3O1I A;  2L8K A;  3FBL A;  3M0A A;  3ZDM A;  5HXH A;  3L70 E;  2IAK A;  3PUA A;  2JP3 A;  2FXM A;  2MNH A;  2KSR A;  3H1L J;  5JRC A;  3CI9 A;  3MXZ A;  2I1K A;  5C39 A;  2H89 C;  1X79 A;  1NAY A;  3NKZ A;  2N1T D;  3RBZ A;  1RH5 B;  3T20 A;  2FXO A;  5KLI C;  4I4T E;  2BZB A;  3NJT A;  4NXN T;  4UXN B;  2MJZ A;  1XDP A;  4AKR A;  3ZT6 A;  3T97 B;  2H8P D;  2YNK A;  3PJA J;  2JMK A;  1PP9 E;  4EZH A;  2FY8 A;  4MAL A;  3MTU E;  1LVK A;  2ZLD A;  2WSF H;  2VL8 A;  1LWU B;  2PJQ A;  1LJ2 A;  3L72 D;  2VK9 A;  4ZI3 C;  3L74 E;  2R3C A;  3B8E B;  4TUY E;  1BE3 E;  3MZK B;  1QL2 A;  2ES0 A;  3E1I A;  1P84 H;  2BG9 E;  1SFC C;  2QA7 A;  2WPR A;  1T3J A;  2N2M A;  2XQ8 A;  2XNX A;  5LBM A;  1P4T A;  3AEE C;  5LGN B;  1EZV I;  3ANW B;  3H1L G;  2XDJ A;  1G2C A;  1GFM A;  2D0T A;  4ZEY A;  1LNQ A;  3GF7 A;  1GK4 A;  4R4L A;  3CWB D;  2WSS H;  3L75 E;  1CI6 A;  1KQF B;  4HFB A;  1ZHT A;  1YIJ P;  3H25 A;  2XE3 A;  4WY4 A;  1HNW T;  1IZN B;  3L71 D;  4LSH A;  3PH0 A;  2N1G A;  2JO1 A;  1EC5 A;  3CX5 I;  1HR0 T;  3A0H E;  2FYN B;  5KKZ B;  4DVD A;  2E5V A;  1LTS C;  4JCH A;  1KFM A;  2M3E A;  2WS3 A;  2V1D B;  1URQ A;  1KFN A;  2CPB A;  2XQ9 A;  2Q5U A;  3G6E P;  1FOS F;  5GV0 A;  3HKD E;  4QH4 A;  2G8Y A;  2CPT A;  3L73 E;  3FBZ A;  2KWH A;  3NSG A;  3AEA C;  3MD0 A;  2AXT O;  3K8P C;  2ODV A;  1NGM B;  3BK9 A;  3D71 A;  4YSZ A;  2JQH A;  3LSV A;  2BCC E;  2LFU A;  4HFH A;  3HUS C;  2YIU B;  1NEN A;  4L9I A;  3K5B A;  3IR9 A;  4JLE A;  5HXS A;  1XDO A;  3TF5 A;  2K37 A;  4OGQ B;  3WUV A;  2BS2 A;  4AQF C;  3ZC1 A;  2XE5 A;  2WJQ A;  4OVN F;  2X0L B;  1ZHZ A;  5AFU K;  2P1J A;  3I1A A;  3CX5 D;  2KS1 B;  3RX6 A;  2X0Y A;  2WU5 A;  4FMS A;  1G1J A;  4NPF X;  3H37 A;  2FFD B;  4F6R C;  2QIW A;  1SQX J;  2YEV C;  1PIX A;  2UWJ E;  1FZC A;  3QRA A;  1IK7 A;  3L35 A;  3V2P A;  3MIW A;  1H0T B;  1LTB C;  1VQ4 P;  4N59 A;  3F57 A;  3Q5R A;  3QNU A;  1RE3 C;  4EAH A;  4C46 A;  2JR8 A;  4RJX A;  2YKS A;  1KTM A;  5B5E H;  3LG7 A;  1FJP A;  3I0Q A;  4TN7 B;  2AE9 A;  1EXJ A;  3L74 D;  3NBX X;  3OYX A;  5JR9 A;  2R5B A;  3Q5X A;  1SVF A;  4KHX A;  1W0A A;  1Y64 B;  1WR0 A;  1MIW A;  2VB6 A;  2WZH A;  2D2C C;  4DUY T;  3VTP C;  3G4S P;  1JY3 P;  2X68 A;  3SFE A;  1M8O B;  2O4V A;  2A3D A;  5C2T A;  3SY9 A;  1S1C X;  3CL3 D;  5H2F O;  3WI5 A;  2OTL P;  4ZMD A;  4DR3 T;  3RGU A;  1BDD A;  3GMA A;  5FL0 A;  2NR4 A;  4AXP A;  3AE6 A;  4MLK A;  3RH3 A;  1ZP0 C;  1SQX G;  3ZMS B;  3PUZ F;  3O9X A;  2WM9 A;  1WR6 A;  2HG5 D;  4ZZB A;  1BR4 A;  4UVA B;  2Y0K A;  4OGQ D;  2B89 A;  4IFD K;  1NWQ A;  5AQP B;  1TU3 F;  2RP4 A;  4DV6 T;  1U57 A;  5LMN T;  1LT9 A;  4EYY R;  2Y0E A;  2WSE J;  3RQW A;  3PQU A;  2RH0 A;  5AQO B;  2JKV A;  2V5D A;  3KDP B;  2W8Z A;  2JEE A;  1EXI A;  1D1A A;  4YTM A;  3TLW A;  3AA6 A;  4UVC B;  3ZYL A;  3HE4 A;  2BCC D;  1D0X A;  1XWM A;  2MYS A;  2WZI A;  3VE1 A;  5G26 A;  1OW8 A;  3HRN A;  3M9B A;  2KK7 A;  2V4H A;  4FZM A;  3DZM A;  1IFD A;  2LSJ A;  4H63 H;  3A0H O;  2BBJ A;  2MPK A;  1BCC E;  4MN4 C;  3PU8 A;  2E76 B;  1KK7 A;  2V6X A;  1KN7 A;  3AE2 C;  2HN1 A;  3KPE A;  4YHJ A;  1WFD A;  1W2B O;  5LHH B;  3RK2 C;  1B7T A;  3AAA B;  4N75 A;  1QEX A;  3UU4 A;  3PU3 A;  5E79 O;  2Q9Q C;  2QYW A;  1USE A;  2O01 J;  1J1E B;  1S4X A;  3OW2 O;  2UUA T;  2E5L T;  2FYZ A;  3UUX B;  3PGR A;  3Q9D A;  4K0U A;  1MMN A;  5B66 H;  2IUB A;  2POR A;  4Z90 A;  3AEB C;  3HE5 B;  5B5E E;  1T7S A;  2B76 A;  3TKL B;  3JC6 D;  2VVN A;  5JVD E;  2QA4 P;  2UXX B;  5LMU T;  3B4S A;  3E7K A;  1SQV E;  5APU A;  4D6T E;  2Q3E A;  2XM2 A;  3GW6 A;  1KF6 A;  4JYB A;  3LJC A;  1SQB J;  1KYO D;  2V7M A;  4HFC A;  2FUP A;  3RPU A;  2LRL A;  2A06 E;  4CXW A;  3R4Y A;  2C9L Y;  2KZI A;  5CBN A;  4C7N B;  4FSO A;  3I5C A;  3UTK A;  1EDI A;  1FZE A;  4QX8 B;  3N2K E;  5CCG C;  2ZXX A;  4I50 E;  4DR4 T;  1YKE B;  4XA4 A;  2E76 D;  3AE8 A;  3CQG B;  3PUQ A;  1S94 A;  2CXD A;  2N1T C;  1EZ3 A;  1YXR A;  2XE1 A;  4D64 A;  3I9W A;  3P4S A;  4IOI H;  2JWA A;  1RQV A;  2V7Q J;  1I6Z A;  3O6Q A;  1OFC X;  2E75 B;  4OHF A;  4K3B A;  1HX8 A;  2KUB A;  4YTP C;  4DID B;  4D5U A;  1SQB G;  2LM9 A;  2JQK A;  1MUU A;  2VRS A;  2OV9 A;  2R4P A;  3II6 A;  2QVA A;  2I8D A;  3KV6 A;  2PAJ A;  4CXY A;  2M8R A;  1FIO A;  4EV6 A;  4YXD A;  1K04 A;  1KB9 D;  4G2A A;  1BR0 A;  2HN2 A;  4IHJ E;  4G75 A;  2IML A;  4KUM B;  2KZJ A;  1M1J C;  3V4Q A;  2K9Y A;  2N2L A;  4X20 E;  3I9Y A;  1YQ4 A;  3H1L E;  4QHO A;  4E7S A;  5HAX A;  2YXQ B;  5KDM C;  2POH A;  4BAY B;  2IDO B;  3BRZ A;  3UU3 A;  3SYS A;  5C3J A;  4L73 A;  1M90 Q;  3TYY A;  1JM0 A;  5HWX A;  4AKL A;  4PFO A;  5KLI B;  2M5A A;  5B66 E;  2QM8 A;  4WB4 A;  3PGS A;  1GFO A;  3ESL A;  5AQM B;  1LP1 B;  5AVS B;  1HNX T;  1N36 T;  2XQY A;  1QLE D;  1WMK A;  2AEM A;  3VE2 A;  2OYI C;  1U7M A;  4COF A;  4ZHQ E;  3PHL A;  4V1A v;  4HFI A;  1VF5 C;  1N7S A;  2O1J A;  1YJN P;  1IFM A;  2JMH A;  3K3N A;  4LFB T;  4AYM C;  2Y6X A;  3C4X A;  5JTG A;  3KVD D;  3IEE A;  3AEC C;  4DR2 T;  2UUC T;  1SFC B;  3CXH H;  3FZF B;  3VKH A;  4JI4 T;  1SQX K;  2E75 D;  5BR8 T;  3SSU A;  5CJ4 A;  3VOP A;  1XZY A;  2YKP A;  2IWV A;  4XAX B;  4B6X A;  3Q5W A;  2UUB T;  4YPC A;  2QJK B;  5B5E O;  2ZM8 A;  4O2A E;  3TLV A;  2HPC A;  2KND A;  4X1I E;  4P0A A;  5C8Y E;  3CIR A;  3FZK B;  1SQP K;  3G06 A;  3RYI E;  2W6A A;  4BRY A;  2X9K A;  2K3W A;  3IN6 A;  3U59 A;  3PUR A;  1BSN A;  2D9D A;  2XQ3 A;  2YKQ A;  1EDL A;  2V7L A;  2W66 A;  2WSE H;  5APW A;  1JMB A;  4X5T A;  3AE3 A;  1W5C E;  2FBW C;  3H1I J;  5AW6 B;  3C8V A;  3N2O A;  3AXJ B;  2ZLY A;  2XPK A;  1NU1 J;  2OYO A;  5EFW B;  4KR4 A;  1UGO A;  2VVS A;  1THQ A;  1AQT A;  2VKD A;  1QUU A;  2BG9 C;  5TIS H;  3AED A;  3FXE B;  4EYU A;  3C5O A;  4O4X A;  1A02 J;  1VQP P;  3KZI H;  4PV1 D;  1N73 C;  3HUS B;  1JCD A;  2H88 C;  3VU7 H;  4F4B A;  5JDN A;  3L73 J;  2AXC A;  3EMN X;  2CBJ A;  5APX A;  3H1L D;  2W6B A;  3AE1 C;  2GK9 A;  4B3R T;  3DTO A;  2RA1 A;  4HWH A;  3KV9 A;  5IYZ E;  3AAE A;  1SFC D;  2FXP A;  4LF8 T;  1SQX E;  3TLU A;  3ZKR A;  4JI8 T;  1G90 A;  2YOE A;  1L0N J;  4RO0 A;  5AQQ B;  2XTQ A;  3T8O A;  2J1D G;  4O2B E;  4IL6 H;  3A0B H;  4ILA A;  1W0B A;  4GIF A;  5KAF E;  4AUI A;  1OXZ A;  3H1I G;  2JDI H;  1OVU A;  3RL0 B;  3GN5 B;  4AKM A;  1NU1 G;  3RK3 E;  1KIL E;  1IJ6 A;  4GCS A;  2WSC J;  3AB3 B;  2WDQ A;  1QJ8 A;  3RYF E;  3EI0 A;  5G38 A;  2MBG A;  2KSE A;  4GOF A;  1ZKE A;  2BKN A;  2C5J A;  2DWG A;  3CX6 B;  1HNZ T;  5GON E;  4DBR A;  3CXH E;  3AE9 C;  3L73 G;  4UB6 H;  5AFU L;  1AA0 A;  4XE5 B;  4TLF A;  5B66 O;  5CCH D;  5JDG A;  1GDT A;  2WBL A;  5KTB A;  3ZJ1 A;  3ETU A;  3MAC A;  1L0N G;  2W83 C;  3W67 A;  2LLY A;  4AZL A;  1YQ3 C;  4DR6 T;  4FT6 A;  2IYP A;  1YHQ P;  2XSB A;  4PJJ A;  3NTN A;  3RIU C;  3G9R A;  3TDK A;  3OTO T;  4GOD A;  1NO4 A;  3VY8 X;  2DHR A;  1DD4 A;  4PAG A;  4DV3 T;  5J2T E;  2F1V A;  3DWO X;  4HB1 A;  5M4Y A;  5CFB A;  1GMJ A;  2YNY A;  3JC2 2;  3OAK A;  1PL5 A;  5KLV J;  2KIN B;  3FZM B;  5D5D A;  4N58 A;  1ZHW A;  5CJ5 A;  2B9B A;  1Q2N A;  3RL0 D;  4O4J E;  5TIS E;  2KXP B;  4ASW A;  1T8B A;  3KZI E;  1LTI C;  3L37 A;  4J2C A;  4NPD A;  1VQK P;  3UT5 E;  1BH3 A;  4AYE C;  4IDQ A;  4Z8X A;  2P10 A;  4IE7 A;  4PNI A;  4PD4 H;  4FES A;  4AFK A;  1GQE A;  1Q82 Q;  3F89 A;  1L4A C;  3OPC A;  5DL7 A;  4Z3T A;  4DV5 T;  3ITK A;  4D65 A;  1SQX D;  1IFP A;  3I56 P;  3EAM A;  2XTR A;  3RK2 B;  2X9H A;  2H7H A;  1VQ9 P;  1IK9 A;  3PUV F;  1L0L J;  4B3T T;  3A0B E;  3E0Z A;  4DV4 T;  1VOM A;  4K35 A;  2W81 C;  4A97 A;  3AA7 B;  5LCY A;  4GCP A;  5KAI H;  4IFF A;  4I1L A;  1SQP D;  2ERV A;  4DV1 T;  5KLV G;  2V6Y B;  2KSJ A;  1JB0 J;  4TZ4 C;  4CN1 A;  2ACZ A;  4N3Y B;  3A2S X;  1NH4 A;  2KNC B;  2MHL A;  3PUG A;  3OJA A;  2HOD B;  3R84 B;  3RRW A;  4N78 E;  4LGD E;  3UU8 A;  5JRE A;  3PJS K;  3UAQ A;  4UB6 E;  5ETW A;  1RF0 A;  5AVY B;  1SQB E;  2W90 A;  2MAW A;  3L39 A;  3M65 A;  3ZJ2 A;  3H32 B;  3K1S A;  4HWD A;  2OAR A;  2J4U P;  3V6I A;  4RES B;  1S5L X;  2IC9 A;  1L0L G;  5AQU B;  3G7G A;  3VYI A;  2XQ6 A;  4JI0 T;  3VMA A;  4I6M C;  3RHW A;  4JI3 T;  5FNV E;  3EQ2 A;  5LGT B;  2Q3I A;  2N1T B;  4ZI2 D;  1Y9B A;  4H13 C;  2R88 A;  3RK2 D;  2AXT E;  3Q2M A;  3RBX A;  1FMV A;  3QK6 A;  4BJM A;  2W80 C;  2XE2 A;  3QWO C;  1JTH B;  1EDJ A;  3FXD B;  3C98 B;  5ADX K;  2CWO A;  1E1H B;  3HTK B;  5AW2 B;  1OWA A;  3TGU J;  2QG4 A;  4E7Z A;  3SWF A;  5APV A;  4QXC B;  1GU5 A;  2IFN A;  1GL2 C;  4CN4 A;  4WWI A;  1LTJ A;  3T0S A;  3WUT A;  1CUN A;  2YPV A;  2JQ9 A;  1D1C A;  2VKJ A;  5L3B B;  4TV9 E;  5APY A;  1QGK B;  3T24 A;  8PRN A;  4DOJ A;  1D0Z A;  3HD7 B;  3N9M A;  3N5L A;  2WVR A;  2VUR A;  1MFT A;  5LP6 E;  1FE6 A;  2YO3 A;  3UIA A;  3NZQ A;  3CVR A;  5J1G A;  4AQG A;  4BWN A;  5J2U E;  2GE4 A;  2A06 G;  3Q5P A;  2XQ4 A;  4OWF A;  1VCT A;  2QE7 H;  2Y0C A;  3RC3 A;  5TIS O;  4ISS A;  2I6H A;  4RLC A;  3KZI O;  5KAI E;  1ZOY A;  4KT0 J;  1US7 B;  3IHR A;  4KMC A;  4ILU A;  1GFN A;  5CCG D;  2X66 A;  3VP9 A;  5AQS B;  4YHH T;  1AVO A;  3TGU G;  4TNW A;  1PGO A;  2XAQ B;  2E43 A;  3M9H A;  1HX1 B;  1UIX A;  3ZN1 B;  2Z5H A;  2NW8 A;  3O4X E;  3RRC A;  2OYI B;  2WSC H;  2R32 A;  5H2F E;  1MZ9 A;  2E9X C;  1RE4 A;  3BS0 A;  2XQA A;  2O1K A;  2LSY A;  1VF5 B;  1E2A A;  6PRN A;  1N32 T;  3P4P A;  4XFJ A;  3L09 A;  2ZFC A;  3UUB A;  4AKR B;  5AW4 B;  2WQY A;  5CB4 E;  1RY3 A;  1OED A;  4IL6 O;  3A0B O;  4PV1 C;  4EIW A;  2A9U A;  4X62 T;  1BR2 A;  5ABF B;  4O4U A;  3AEF C;  4RJT A;  4WNK A;  4U7J A;  4FZL A;  3POX A;  4O8S A;  4GOU A;  2NTY A;  3RQU A;  3CPW O;  4ZXL A;  1ZV8 A;  4OK0 A;  3VHL A;  4I43 B;  2BAS A;  2XHE B;  2Y9Y A;  2AXD S;  1NEK A;  2K48 A;  1QVF O;  2M07 A;  3Q5S A;  1BGY J;  1G2C B;  5HEH A;  3HD7 D;  4RJW A;  1K9M Q;  2QJK C;  4UB6 O;  1K73 Q;  5LJN A;  5KJ7 A;  5JDP A;  5AVT B;  3T97 A;  1VQ5 P;  3AEG C;  2XAG B;  1Z0P A;  3H1I E;  3LID A;  3EDV A;  3SFD A;  1LWU A;  1JNM A;  4UB8 H;  4NUV A;  1NU1 E;  3N9O A;  1HXT A;  3KIN B;  1ZN5 A;  3AE7 A;  4PW8 A;  1SQQ J;  3ZCJ A;  2N9D A;  3CD6 P;  2XJ7 A;  1JY3 N;  2NPS C;  3E1R A;  2KZ7 B;  2BG9 B;  2G0U A;  3NRX A;  1KNZ A;  4DR5 T;  2GA1 A;  5HXE A;  1N34 T;  1N73 B;  3CC7 P;  5AVU B;  3ANW A;  1HXU A;  4PJ0 H;  5CCH C;  1Z8U A;  5E79 E;  5DL5 A;  1VF5 D;  3EAB A;  1VQ7 P;  4DBQ A;  2Y9Z A;  1IZN A;  4B3S T;  1EZV D;  2GUS A;  2HYN A;  3PTZ A;  4NXM T;  2H7V C;  1BGY G;  3UPG A;  3H1J J;  4H9S E;  3DJB A;  5DQW A;  1L0N E;  2Q6Q A;  2NW9 A;  3H1K J;  3JAF A;  3L70 D;  1FJG T;  3U3I A;  3GMI A;  5FY1 A;  2J62 A;  2I1J A;  3AA0 B;  3PF1 A;  4WZX A;  3P7K A;  4L0R A;  2GUV A;  3D70 A;  3ABV C;  3T1Y T;  1S2E A;  4GYR A;  2WU2 A;  1KQG B;  1VL2 A;  2Z5I A;  1L0V A;  4Y99 C;  2KWI B;  1FZC B;  1SQQ G;  3AE4 C;  2BKO A;  3H6P A;  4K3C A;  3RBH A;  2WP9 A;  2RN0 A;  1FS0 E;  2ACX A;  1RHZ B;  5APQ A;  1PFI A;  1SA0 E;  4GF4 A;  3RL0 C;  2WIT A;  1PP9 D;  2VQF T;  1JY2 N;  3F5H A;  5KAI O;  3AA1 B;  3SWK A;  3Q5E A;  3KV5 A;  2DCF A;  2KS1 A;  1L0L K;  4F8H A;  1BE3 D;  3BQK A;  4ZKP A;  4IE6 A;  2FFD A;  4H9Q C;  3B57 A;  3HOE A;  2VKO A;  3H1J G;  2R8A A;  1P84 E;  3H1H J;  3H1K G;  3UFE A;  4LC1 A;  5DJT B;  5BU8 B;  1H0T A;  1GW4 A;  4ILB A;  5DJU B;  5BVZ A;  5AQV B;  5LG3 A;  3L75 D;  4FJO A;  3VR8 A;  1XMQ T;  2P67 A;  3RK3 C;  1KIL C;  4ZNC A;  1QJ9 A;  1Q86 Q;  2XAS B;  1GTW A;  5BU5 A;  4UB8 E;  5IYU A;  2VQE T;  5EK4 A;  2Y0H A;  5KLV E;  2L9Q A;  3HKB E;  1PGP A;  3VMZ A;  1AVY A;  4GYS A;  4WVZ A;  1LVF A;  4QH5 A;  3LBX A;  4U7I A;  5ABH A;  4UVB B;  3V8U A;  4U74 A;  1FZB A;  5FL1 A;  1MNE A;  2EHO C;  3ZC0 A;  3VZT X;  1H89 A;  1SQV K;  1JCC A;  5CJ0 A;  5FY7 A;  5EZY E;  2YDS A;  1VPC A;  3L73 D;  1KNR A;  4PJ0 E;  5G39 A;  1NTM G;  3IFM A;  3RGL A;  3AE5 A;  4AYN A;  2SPZ A;  3EVY A;  1YBK A;  5AQT B;  2W6J H;  3H1H G;  4ZOL E;  2WDV A;  1L4A B;  2YKO A;  4LSE A;  1MMD A;  4YFS A;  3K19 A;  3M91 A;  1L0N D;  3FWL A;  5L3F B;  1UUS A;  3QH9 A;  1UX5 A;  3PV0 F;  3JCU H;  2PGD A;  1P84 I;  3PP5 A;  5L47 A;  1L0L E;  3UFG A;  1MIY A;  2BS4 A;  5FMN A;  4ZI2 C;  3GHG C;  3BQI A;  3A7O A;  2C5K T;  4H44 B;  4MHC A;  4EB6 E;  2RKL A;  4GKK T;  2B87 B;  2CBI A;  4HKZ H;  4P0B A;  1Z56 A;  2QJP C;  4AUW A;  2L3L A;  3U1A A;  5HEG A;  1UK5 A;  4HWF A;  3JAE A;  3CCV P;  3ZN0 B;  5FXV A;  2ODU A;  3GP6 A;  1FAV A;  3SWH A;  4QXB B;  2OYH A;  4X1K E;  4OFZ A;  2E5Y A;  2WDR A;  1VCS A;  3ZMT B;  2YXR B;  2BBH A;  3FGA D;  4FZN A;  1OSM A;  2V7I A;  1P84 D;  1HCI A;  3AAA A;  1ZHX A;  3O0E A;  2R4L A;  1ZXG A;  3FZL B;  3POR A;  3MUD A;  4L5G A;  2PFX A;  4CPG A;  3MKD A;  4HWC A;  1BSH A;  1NTK E;  3P32 A;  2KC0 A;  5GTI H;  5HEU A;  2XV5 A;  5AQK B;  2CEA A;  3IF4 A;  3HE5 A;  1L4A D;  1IJ5 A;  4H13 B;  4H9N C;  5KLV D;  1V9D A;  2BKP A;  5L2L A;  1NTZ J;  3TGU E;  4AIU A;  5JDH A;  1KEY A;  3JTY A;  1J5E T;  2K0L A;  2Y8D A;  2K88 A;  3P8M C;  2W67 A;  4E1T A;  1GL2 B;  1GU4 A;  1VQ8 P;  2LSK A;  3KHU A;  1OIP A;  4H44 D;  4GKJ T;  2AEF A;  1ZR2 A;  2CCQ A;  3CML A;  3VKG A;  2BEQ D;  3CLQ A;  4R4M A;  3BRY A;  3CPZ A;  4MFR A;  4H0L C;  3V2Q A;  4ANJ A;  1UUR A;  4IL4 A;  3L72 J;  4TT3 H;  1PRN A;  4P09 A;  5AVW B;  4EOT A;  1KD1 Q;  2CWY A;  1EDK A;  3GWH A;  2M6B A;  1AV1 A;  4UB8 O;  4M1P A;  2XM1 A;  3B5N C;  3M0D C;  3NMD A;  4FRT A;  3ZMV B;  2HR3 A;  1L0L D;  1BCC D;  2LHN A;  1XMO T;  1QSD A;  5AVZ B;  1JNR A;  2IFM A;  2PBI A;  2WWW A;  3HD7 C;  1RF1 C;  2ZVN B;  3L3P A;  4A5X A;  3G71 P;  5BMV E;  2YDQ A;  5IWA T;  2N9Y B;  4PJ0 O;  2J59 M;  1NTZ G;  3VRA A;  3S4U A;  4L75 A;  4LF5 T;  3EFG A;  1QX8 A;  4H9R C;  2K5B B;  3JAD A;  2E9X B;  1H8A A;  4H13 D;  3AAI A;  4KX6 A;  3LW5 J;  1IJD B;  2NTX A;  3L72 G;  1UX4 A;  5AW1 B;  3CMA P;  5CA1 E;  3T1H T;  4PV1 B;  3WU2 H;  5M1B A;  1SQV D;  1YKH B;  4D6T D;  3VP8 A;  1GL2 D;  3DP7 A;  4PFP A;  1VQ6 P;  2XAF B;  2VKH A;  5LB7 B;  4GK0 E;  3RYH E;  4AKH A;  1WLX A;  2H89 A;  2A06 D;  2UXN B;  3W68 A;  4C7R A;  2FJA A;  3Q5D A;  1FZG A;  4DV7 T;  5HYA A;  3NZP A;  5AQL B;  1YI2 P;  4E1S A;  3ZLI A;  1BGY E;  2HLO A;  5LHI B;  3WAJ A;  2R89 A;  3DA3 A;  1LP1 A;  2LT3 A;  3POQ A;  2QRX A;  3VMY A;  4I0U A;  4U7Y A;  3UU2 A;  4AYI D;  1AFO A;  3TGU D;  2FJB A;  1OW7 A;  4XZC A;  1A02 F;  1N7L A;  1SQQ E;  5AW3 B;  2XSA A;  4LMJ A;  3RLF F;  1PV3 A;  2NPS B;  1SFC A;  3AVS A;  4WY4 C;  3O8Z A;  4EI2 A;  3V5B A;  3ZCI A;  2QTK A;  3AEE A;  1AQ5 A;  1FU1 A;  2WB5 A;  4TNV A;  3LFM A;  2KP8 A;  2E9X D;  5AQG B;  2XG6 A;  2RPA A;  3TNU B;  4JBZ A;  5LOV E;  2F1C X;  4GCQ A;  3KVA A;  1URQ C;  1KQL A;  3I55 P;  3H3M A;  1ZRT E;  2P58 A;  1JO5 A;  1T16 A;  3I0O A;  2LE8 A;  3H1J E;  2X9Y A;  3IBP A;  3ZT7 A;  3H1K E;  3NXS A;  4KHP T;  4CQI A;  3NVO A;  1YTZ T;  3RI5 A;  2ZM6 T;  3RC8 A;  2HFE D;  1ZHC A;  4IDO A;  4A7P A;  4CI1 B;  4Y28 J;  2QSI A;  4LF4 T;  4HN9 A;  1M1K Q;  3AXJ A;  3MHV A;  4IE4 A;  5LBQ B;  4GK5 E;  1KZU B;  2A45 H;  4Y99 B;  4P1N A;  2R5D A;  5L3C B;  3AEA A;  2NWB A;  1WRG A;  3SZV A;  3V2N A;  1X0T A;  2X9W A;  4JI1 T;  3FXE A;  3JCU O;  1IFI A;  1RQU A;  2XAH B;  1HG2 A;  2ZVO B;  5FXZ A;  2OLT A;  4O9B A;  3HUS A;  2FYU J;  1FZC C;  4IL9 A;  2LXC B;  4QMA A;  4AQF A;  3A2A A;  4AYD C;  1K05 A;  3J9X 1;  4ASK A;  5PRN A;  1NTM E;  3O1J A;  4JQ0 D;  2NPS D;  5H6R B;  3ONL C;  3H1H E;  5AQH B;  4K0K T;  3P7I A;  4HKA A;  3CKD A;  3TSI A;  3ZYK A;  2IW5 B;  3C4W A;  2ZAE B;  4TWD A;  5FY0 A;  5JR9 C;  3V2R A;  1HTJ F;  1RE3 A;  3GN5 A;  2HH7 A;  4AIS A;  3VZU X;  3SFE C;  3RIF A;  3PRJ A;  5LJM A;  4UF0 B;  3NFQ A;  3RK3 B;  1KIL B;  3EDU A;  5HWY A;  3VR9 A;  3A8Y C;  4NUU A;  4LFC T;  1W2E A;  2YMK A;  3Q3D A;  4DR7 T;  1GFQ A;  3EFF K;  3B13 A;  3AE6 C;  4KBM B;  2CXL A;  2FYU G;  2WT7 B;  3CX7 B;  3GLM A;  1PPJ G;  2EHO B;  2L91 A;  2XZE A;  3ZST A;  5GTI O;  3CCJ P;  3LK2 B;  2XUE A;  1ZLL A;  3A5T A;  4LF6 T;  3N9N A;  1M7K A;  1SQB K;  1MM5 A;  1SUM B;  1HGV A;  5AVV B;  1ZW0 A;  4X66 T;  1LT9 C;  2QJY C;  1ZP0 A;  2CHN A;  2MOZ A;  4U72 A;  2ZYD A;  4C4V A;  1Q7Y Q;  2WZ7 A;  3ZMZ B;  3H1J D;  3PUY F;  2R6G F;  3BCC J;  2LOS A;  3H1K D;  4EOZ B;  2JPF A;  2AEJ A;  1HWT C;  2R4O A;  3CXH I;  2GM4 A;  1NTZ K;  2XAJ B;  3ZMU B;  2JQY A;  5K5G B;  4AQY T;  2ZT9 C;  2IPP A;  2LXB A;  1BXW A;  4U3F J;  3GHG B;  3POU A;  3N4X A;  1OVV A;  3U1C A;  1ZHY A;  1MMA A;  2WMO A;  1LRZ A;  3LK3 B;  1HUC A;  2QJP B;  1ZEE A;  4IL6 E;  1JOC A;  2NOX A;  1IFJ A;  3HR0 A;  3C1L A;  1KIL D;  2E74 C;  3RK3 D;  2X9X A;  4H44 C;  1Y8A A;  2FJE A;  3HI2 A;  3LW5 H;  2ZM0 A;  3PTR B;  4EZ4 A;  3KXD A;  3AE2 A;  3A5X A;  5FXX A;  3SOL A;  3VY9 X;  2WMN A;  3BCC G;  4DCK A;  2YIN A;  1QJP A;  5CBO A;  2EHO D;  1U7J A;  4O3Y A;  5L3E B;  2WAU A;  1LTG C;  3CXH D;  1H6S 1;  4EYY Q;  2IX7 C;  3HKE E;  2KB7 P;  2Q9Q A;  1DX7 A;  1J5W A;  2D2S A;  4C00 A;  4O4I E;  4JI2 T;  2F4V T;  3AA7 A;  4U3F G;  3V5S A;  1XTC C;  2V6Y A;  3AEB A;  3CX5 H;  2I59 A;  1R8E A;  3WU2 O;  3M9Q A;  3TK1 A;  3VRB A;  1SLQ A;  2X27 X;  2KNC A;  4BXL A;  2NW7 A;  3RKO A;  2W63 A;  1NTK J;  1NTZ E;  2PTF A;  4N74 A;  2IIU A;  1LTT C;  2W00 A;  2WPV B;  3E08 A;  1G73 A;  1XTG B;  2K9J B;  4ZZC A;  1NHL A;  4X65 T;  3FHN A;  3IAO A;  3AE8 C;  3H32 A;  2J47 A;  3V5U A;  4H0L B;  3L72 E;  3M3Z B;  4IDZ A;  1Q9F A;  4IIJ E;  4HFD A;  3ZSS A;  4FSP A;  2UU9 T;  4YY3 T;  1U5P A;  5JH7 E;  1ZV4 X;  4WBO A;  5CCG A;  5AW8 B;  4U9C A;  1K8A Q;  3PGU A;  3B5N B;  3PUS A;  1D7M A;  4ZS2 A;  2VL0 A;  2N1T A;  1LTA C;  4PD4 E;  1RF1 B;  1X9V A;  2Y48 B;  2HHH T;  3OA7 A;  1JTH A;  3FXD A;  2IBZ G;  1NTK G;  1X9B A;  2R44 A;  1OED E;  3MP7 B;  2N2N A;  3A0H H;  4YXD C;  3UU6 A;  3P50 A;  1HBW A;  3A7M A;  5AQI B;  4YTP A;  2Y0D A;  1SP4 A;  1NU1 K;  4DR1 T;  1YQ4 C;  2XTL A;  2IC6 A;  1D0Y A;  5JRC B;  1ZME C;  3MGN A;  4M3L A;  1QL1 A;  2CA5 A;  1OW6 A;  1X79 B;  5AW0 B;  1H88 A;  3KVB A;  5AQJ B;  4YXW H;  1M1J A;  4N78 D;  2ZYA A;  5KMG P;  1SQB D;  1OED B;  1QLB A;  4TWH A;  1KMI Z;  1USD A;  1BDC A;  3J7Y q;  4UR9 A;  3JSV C;  4H0L D;  1JEK A;  5HXC A;  2LKG A;  5L4H A;  3R2P A;  1L0N K;  1N7S C;  5DJQ C;  2XQ5 A;  4PUX A;  2W27 A;  3CX5 E;  1M62 A;  4JYC A;  3NWI A;  2IZ1 A;  4A98 A;  5JDF A;  4PD4 I;  3B5N D;  3EUH A;  4Q25 A;  2SPC A;  3P4R A;  4C69 X;  1SE7 A;  5J0Z A;  1NTZ D;  2OYI A;  2FYU K;  2XZR A;  2OGU A;  3P4W A;  1Y01 A;  1T3U A;  4LSI A;  2ZJS E;  3FWN A;  4O3W A;  2WY2 A;  3PUW F;  2C9N Y;  3FX0 A;  4QKN A;  3AEC A;  1X8Y A;  1CI6 B;  3BAT A;  4YLH A;  3C51 A;  5ABF A;  4WY4 B;  4JI7 T;  1G1I A;  4IGU A;  1SS1 A;  1S72 P;  3SZD A;  5APT A;  2CXF A;  3KYQ A;  4GKG A;  4WBA A;  2WMM A;  1YD8 G;  4O3X B;  2JWD A;  5IHY A;  4U3C A;  1URQ B;  1Y47 A;  3AE3 C;  1KYO H;  3FZH B;  4PD4 D;  5L4E A;  1MND A;  1HJ0 A;  2R3S A;  5FVK A;  2BEZ F;  5AW7 B;  1WT6 A;  3F2E A;  3RKG A;  1WCR A;  4WYV A;  4HGA A;  4EIJ A;  2XQ7 A;  2CE7 A;  3AED C;  4C90 A;  5F3J A;  1KFY A;  1E5W A;  2FBW A;  1NKN A;  1D1B A;  5IUX A;  1QVG O;  3P4Q A;  4NPE A;  3TLT A;  1WRD A;  4IRE A;  2LM2 A;  2J1N A;  4BJN A;  4HFV A;  2YN6 A;  1JMM A;  3S4R A;  5KLV K;  2KZ7 A;  2BDE A;  2BG9 A;  1T8Z A;  1BR1 A;  3CC2 P;  2CK3 H;  1N73 A;  4PK6 A;  2FYU E;  1OVR A;  1T72 A;  1KV4 A;  5HCM A;  2H88 A;  1PPJ E;  2ZYG A;  5DQV A;  1XNQ T;  5KJ7 D;  3AE1 A;  2LSG A;  5AVX B;  2XKM A;  2B1E A;  3CQX C;  3N9P A;  2WWU A;  5A1L A;  1AJ3 A;  4WY4 D;  2WWV A;  4Z91 A;  1IBK T;  2X67 A;  2IDB A;  3L4F A;  1OX3 A;  2KDY A;  2KLU A;  3AA0 A;  5JR9 B;  1KB9 H;  1HFA A;  2E2A A;  2OTK E;  2Q7C A;  1E54 A;  1NTM J;  4FQE A;  1URQ D;  1CSB A;  2XMX A;  4UEL A;  2ODJ A;  1U4Q A;  1VRB A;  5E0O A;  3MJX A;  1L2P A;  1NJI Q;  1T1L A;  3CC4 P;  2R4N A;  3CCL P;  4RL9 A;  4KP3 C;  4EXT A;  2CLY C;  1SQP J;  4I7Z C;  1GZL A;  5CGM A;  3H1I D;  3AE9 A;  2WSS V;  3EWK A;  3JCF A;  4QX7 B;  4W7Z A;  3AA1 A;  1NU1 D;  1GFP A;  1JY3 O;  3LBX B;  3W15 B;  3C50 A;  4WBN E;  5F8P A;  1BT9 A;  1LT9 B;  2QJY B;  4JEH B;  3TZG A;  4DV2 T;  4YSY A;  1YQ3 A;  2MKV A;  1KYO E;  3FYX A;  3BCC E;  4IL6 X;  5T5F A;  4OYJ A;  4EED A;  2M67 A;  2K3R A;  4W7Y A;  3RIU A;  2QM7 A;  3AA6 B;  1HS7 A;  5FP3 A;  1NTK K;  4ILC A;  5AVR B;  3HE4 B;  5LHG B;  2M06 A;  2DWK A;  3H3A A;  4U31 A;  3FB2 A;  5DL6 A;  4XNK A;  2ZT9 B;  4U3F E;  2FJD A;  3LIE A;  3PLN A;  2K1A A;  2VWA A;  2Q1K A;  3CK6 A;  3EHZ A;  2LSI A;  3E22 E;  1SQP G;  2KIK A;  4QQ1 A;  3PDY A;  4KR8 A;  1J1D C;  2J58 A;  2FYU D;  3N2G E;  2UXB T;  5CA0 E;  2OA5 A;  2E74 B;  1HVV A;  1PPJ D;  5AQR B;  3VZW X;  1FC2 C;  1S5L H;  1FMW A;  4OX9 T;  5AQN B;  4ERR A;  5LYJ E;  4FOZ A;  4PR7 A;  1VQL P;  5EK3 A;  5CHX A;  1L4A A;  3SRZ A;  4RLB A;  3HWB A;  3RIA A;  1JY2 O;  1JNZ A;  1FDO A;  1T2K C;  1JY2 P;  1DIP A;  3VMX A;  2H3R A;  4X64 T;  2OYH B;  5GTH H;  4LF7 T;  5L3G B;  4N6J A;  1Q81 Q;  1KB9 E;  1X22 A;  1KYO I;  5DL8 A;  1DEB A;  2Y0L A;  2XU6 A;  4ZS3 A;  1DH3 A;  2KLV A;  2C0S A; 
#chains in the Genus database with same CATH homology
 2HPJ A;  2XG6 A;  2N1G A;  4UIG A;  2MHL A;  5LOV E;  4GCQ A;  3KVA A;  3C4Z A;  3PUG A;  3OJA A;  3SY7 A;  4DVD A;  3R84 B;  3RRW A;  4G63 A;  4JCH A;  4B61 A;  4X1Y E;  3I0O A;  5H6Q B;  5JRE A;  3UAQ A;  2LE8 A;  5ETW A;  2X9Y A;  2V1D B;  3IBP A;  4CQI A;  3RC8 A;  5GV0 A;  1ZHC A;  3HKD E;  3M65 A;  3ZJ2 A;  4CI1 B;  3FBZ A;  4HN9 A;  2KWH A;  3NSG A;  2KT9 A;  2J4U P;  2DNX A;  3K8P C;  2ODV A;  4IE4 A;  5LBQ B;  3BK9 A;  2IC9 A;  4GK5 E;  3G7G A;  2LFU A;  5L3C B;  2NWB A;  5FNV E;  3SZV A;  4DMW A;  2X9W A;  5LGT B;  4L9I A;  4JLE A;  5HXS A;  3F31 A;  2XAH B;  4ZI2 D;  1HG2 A;  4AQF C;  3JTY A;  5FXZ A;  2XE5 A;  3ZC1 A;  3SS1 A;  2Y7S A;  2X0L B;  1ZHZ A;  5AFU K;  3KFW X;  3I1A A;  3RX6 A;  4UEM A;  3Q2M A;  4FMS A;  1FMV A;  3QK6 A;  4BJM A;  3N9L A;  2W80 C;  3H37 A;  2XE2 A;  4AQF A;  3FXD B;  4F6R C;  4AYD C;  1YS5 A;  2YEV C;  3C98 B;  3J9X 1;  2CWO A;  4ASK A;  1E1H B;  4E7Z A;  5PRN A;  1OWA A;  5ADX K;  3O1J A;  4QXC B;  3QRA A;  5H6R B;  4N59 A;  3T0S A;  1UCU A;  3F57 A;  3P7I A;  1CUN A;  4EAH A;  4HKA A;  3CKD A;  4H63 V;  2YPV A;  3ZYK A;  2IW5 B;  2FGR A;  1D1C A;  2VKJ A;  3C4W A;  5FY0 A;  5JR9 C;  4RJX A;  5L3B B;  5EK2 A;  3O1H A;  1HTJ F;  4TV9 E;  3LG7 A;  3I0Q A;  3KV4 A;  3GN5 A;  4TN7 B;  2HH7 A;  3T24 A;  1HXX A;  3VZU X;  8PRN A;  3NBX X;  5ADX L;  3OYX A;  1D0Z A;  1O3X A;  5JR9 A;  5LJM A;  4UF0 B;  3N9M A;  3Q5X A;  3N5L A;  1Y64 B;  1MIW A;  2VB6 A;  3EDU A;  5HWY A;  1NAF A;  5LP6 E;  3NZQ A;  4TX5 A;  2X68 A;  3CVR A;  5J1G A;  4NUU A;  4AQG A;  2A3D A;  5J2U E;  2GE4 A;  2O4V A;  3SY9 A;  1GFQ A;  3B13 A;  5TAO A;  4I55 E;  3WI5 A;  4KBM B;  3RC3 A;  2CXL A;  4ISS A;  5LXT E;  4RLC A;  3CX7 B;  3QRC A;  2EHO B;  1US7 B;  5LA6 E;  3IHR A;  1S35 A;  4KMC A;  4ILU A;  4AXP A;  1GFN A;  2F1T A;  3LK2 B;  2XUE A;  3C64 A;  4MLK A;  3RH3 A;  2X66 A;  3ZMS B;  2JQQ A;  3N9N A;  4XBF B;  3O9X A;  2XAQ B;  3KBU A;  4PJM A;  3CWZ B;  1MM5 A;  2PG8 A;  3ZN1 B;  2WM9 A;  1WR6 A;  3WI3 A;  2NW8 A;  3O4X E;  3RRC A;  1BR4 A;  4UVA B;  2MOZ A;  2E9X C;  4U72 A;  2Y0K A;  4DND A;  2LSY A;  3ZMZ B;  2RP4 A;  6PRN A;  4MBQ A;  2LOS A;  3L09 A;  4YJ2 E;  4AKR B;  4EOZ B;  4EYY R;  5CB4 E;  3PQU A;  4AI6 A;  2E9X A;  3N9Q A;  2CM0 A;  2JPF A;  4GIW A;  4EIW A;  1BR2 A;  4O4U A;  4WNK A;  2D5U A;  4FZL A;  2XAJ B;  2C5I T;  3POX A;  1D1A A;  4O8S A;  4A56 A;  4GOU A;  2NTY A;  3ZMU B;  3AA6 A;  4UVC B;  3ZYL A;  1BXW A;  3IF8 B;  4BUM X;  3POU A;  3ZPO A;  1D0X A;  2MYS A;  4O4H E;  3VE1 A;  5G26 A;  1ZHY A;  1MMA A;  2WMO A;  4OK0 A;  1LRZ A;  4WW0 A;  3VHL A;  3LK3 B;  4I43 B;  4FZM A;  2XHE B;  4H63 H;  1ZEE A;  2LSJ A;  2K48 A;  2NOX A;  2M07 A;  3PU8 A;  1KK7 A;  3HR0 A;  4RJW A;  2X9X A;  2MTQ A;  5LJN A;  5JDP A;  4YHJ A;  4AKI A;  1SHZ C;  3HI2 A;  2XAG B;  5LHH B;  2QGS A;  1Z0P A;  2ZM0 A;  1B7T A;  3AAA B;  3PTR B;  4EZ4 A;  1MMG A;  3EDV A;  3PU3 A;  4NUV A;  3A5X A;  3N9O A;  5FXX A;  2Q9Q C;  3KIN B;  3SOL A;  1HXT A;  3VY9 X;  4PW8 A;  2WMN A;  2YIN A;  1QJP A;  3ZCJ A;  2EHO D;  2N9D A;  4O3Y A;  5L3E B;  2WAU A;  1H6S 1;  4GHB A;  3HKE E;  3UUX B;  3Q9D A;  4K0U A;  2V7J A;  2KZ7 B;  2D2S A;  2Q9Q A;  1MMN A;  2CMR A;  2G0U A;  3NRX A;  1KNZ A;  2POR A;  4O4I E;  4FRX A;  5HXE A;  1WYC A;  2DI4 A;  3ANW A;  3AA7 A;  1HXU A;  3TKL B;  3JC6 D;  3V5S A;  5JVD E;  5DL5 A;  2K4T A;  3AAE B;  2I59 A;  3CQC B;  3UUM A;  2UXX B;  4CI3 B;  1MM4 A;  4DBQ A;  3CX8 B;  1H7C A;  4HE8 A;  1IZN A;  2X27 X;  4H9P C;  4KRA A;  3AVR A;  4AKG A;  4PK4 A;  2NW7 A;  4HTE A;  2H7V C;  2KMF A;  2W63 A;  4IST A;  2W62 A;  3LJC A;  4JEU B;  3RKO A;  4H9S E;  4QWN B;  3DJB A;  5DQW A;  2V7M A;  2NW9 A;  3UPG A;  3QUJ A;  2W00 A;  3BQL A;  3RPU A;  3ZYM A;  2ZFG A;  3E08 A;  3GMI A;  5FY1 A;  2PFV A;  3U3I A;  1YW0 A;  3AA0 B;  1G73 A;  4L0R A;  4CXW A;  4IE0 A;  3ETV A;  4GYR A;  4ZI3 D;  3FHN A;  4FSO A;  3UTK A;  1WYB A;  4QX8 B;  3N2K E;  2KWI B;  3V5U A;  3LK4 2;  3RBH A;  4I50 E;  5JDM A;  1HF8 A;  4IDZ A;  1Q9F A;  1YKE B;  4IIJ E;  4FSP A;  2W0G A;  2ACX A;  1U5P A;  4PK5 A;  1ZV4 X;  3CQG B;  3PUQ A;  1S94 A;  4WBO A;  2CXD A;  1SA0 E;  1G8X A;  4U9C A;  2Y2X A;  1EZ3 A;  4GF4 A;  3NRY A;  5KX5 E;  1FEW A;  3PUS A;  2XE1 A;  1NWM X;  3I9W A;  1LKX A;  4ZS2 A;  4D64 A;  3ZEF B;  3AA1 B;  3OBV E;  3MA9 A;  2LJL A;  3KV5 A;  2DCF A;  2YU1 A;  2CLY B;  2V7K A;  2HPL A;  3BQK A;  2Y48 B;  4OHF A;  5HXR A;  4IE6 A;  1HX8 A;  4H9Q C;  3B57 A;  3UUL A;  3HOE A;  2VKO A;  2LOP A;  4C91 A;  4FUV A;  3P8C D;  2LM9 A;  3KBT A;  4UV9 B;  4PJN A;  1T98 A;  2N2N A;  4D5U A;  3UFE A;  2YU2 A;  4ZI7 E;  3KV6 A;  4CXY A;  1FIO A;  4G2A A;  2XTL A;  2IC6 A;  3SYB A;  1BR0 A;  1D0Y A;  4FJO A;  4IHJ E;  2LHR A;  5JDQ A;  5JH7 E;  5JRC B;  4G75 A;  4KUM B;  3OYZ A;  4O49 A;  1QJ9 A;  2N2L A;  2CA5 A;  3I9Y A;  4X20 E;  2XAS B;  3K3O A;  4QHO A;  4E7S A;  5HAX A;  5L3D B;  3KVB A;  4G76 A;  4UF0 A;  5IYU A;  5KDM C;  5EK4 A;  4BAY B;  2Y0H A;  3SYS A;  2L9Q A;  3HKB E;  4N78 D;  4GYS A;  5KMG P;  1LVF A;  4AKL A;  3LBX A;  5HWX A;  5LNK A;  4UVB B;  4PFO A;  4U74 A;  3V8U A;  1PHO A;  4ADZ A;  1MNE A;  2EHO C;  3ZC0 A;  3VZT X;  4OYK A;  4PJL A;  2JMM A;  1GFO A;  5FY7 A;  3J7Y q;  5EZY E;  3ESL A;  5HXC A;  2EHO A;  2XQY A;  5DJQ C;  3LK2 A;  4PUX A;  4AYN A;  3VE2 A;  3EVY A;  4ZHQ E;  5JDF A;  3JC6 C;  4ZOL E;  3EUH A;  4V1A v;  4HEA A;  2SPC A;  4LSE A;  1MMD A;  2JMH A;  4C69 X;  3K3Q C;  3K3N A;  5FVN A;  4YFS A;  2P9B A;  3K19 A;  2Y6X A;  3R6N A;  4AYM C;  3C4X A;  5L3F B;  3KVD D;  5LG4 A;  3IEE A;  1UX5 A;  4YJ3 E;  4UV8 B;  4LSI A;  4O3W A;  2KXP A;  3RYC E;  3VKH A;  3MK7 C;  1MIY A;  3WAK A;  4QKN A;  1IAP A;  5FMN A;  4YLH A;  4ZI2 C;  4XAX B;  4B6X A;  3Q5W A;  4O3Z A;  3C51 A;  3BQI A;  4O4L E;  4IGU A;  2C5K T;  2ZM8 A;  4MHC A;  4O2A E;  4EB6 E;  2JRK A;  3SZD A;  2KND A;  4X1I E;  4P0B A;  4P0A A;  2CXF A;  5C8Y E;  1YD8 G;  4O3X B;  2L3L A;  7PRN A;  3RYI E;  2Q9Q B;  4IE5 A;  5IHY A;  2W61 A;  3LK3 A;  2KLQ A;  3PUR A;  3ZN0 B;  4LSH A;  2X51 A;  5FXV A;  2ODU A;  2V7L A;  3GP6 A;  4JUY A;  4QXB B;  3SWH A;  2NP9 A;  1MND A;  4OFZ A;  4X1K E;  3UUN A;  2YK0 A;  3N2O A;  3F2E A;  3ZMT B;  2ZLY A;  4FZN A;  2LEH A;  2K24 A;  4HGA A;  1OSM A;  2CE7 A;  2E8I A;  2V7I A;  1HCI A;  4C90 A;  5F3J A;  1ZHX A;  3AAA A;  3O0E A;  4KR4 A;  3LK4 1;  2H7O A;  4BA9 A;  1THQ A;  2VKD A;  1QUU A;  3POR A;  1D1B A;  4L5G A;  3WI4 A;  3FXE B;  4EYU A;  3HKC E;  3C5O A;  1WRD A;  3MKD A;  4O4X A;  3DA4 A;  2J1N A;  3KDS E;  1HG5 A;  4BJN A;  2KC0 A;  4HFV A;  2A2F X;  2KZ7 A;  1MIV A;  2BDE A;  3VU7 H;  2OMF A;  5EE2 A;  4F4B A;  2CEA A;  5JDN A;  3EMN X;  1BR1 A;  1IJ5 A;  4PK6 A;  1ORM A;  2GK9 A;  4H9N C;  3DTO A;  2RA1 A;  3PE0 A;  3QC9 A;  5JQG E;  1OPF A;  3KV9 A;  1MPF A;  1V9D A;  5IYZ E;  3AAE A;  5DQV A;  5LGU B;  1Q9G A;  1G90 A;  5L2L A;  3OKQ A;  4TV8 E;  2LSG A;  4FI5 A;  5JDH A;  2XTQ A;  2B1E A;  3CQX C;  2Y8D A;  3N9P A;  4DMV A;  2K0L A;  2K9A A;  3T8O A;  2J1D G;  4O2B E;  3U78 A;  2WWU A;  4E1T A;  5A1L A;  1AJ3 A;  4H9O C;  2LSK A;  2A72 A;  2ZMA A;  2X67 A;  4AUI A;  2CCQ A;  1OXZ A;  3CML A;  3VKG A;  2D0U A;  3GN5 B;  2V26 A;  2KDY A;  4AKM A;  1IJ6 A;  3AA0 A;  4GCS A;  3CPZ A;  4MFR A;  5JR9 B;  3PRN A;  1HFA A;  4ANJ A;  2Q9Q D;  3AB3 B;  2ZM2 A;  1E54 A;  4P09 A;  1PRN A;  4LSF A;  2BVL A;  2CWY A;  2VAS A;  3RYF E;  4CI2 B;  1QJ8 A;  2LHF A;  2XMX A;  3HL6 A;  3GWH A;  4UEL A;  4CXX A;  2ODJ A;  1U4Q A;  2MBG A;  3D0T A;  4M1P A;  3HW9 A;  1ZKE A;  2C5J A;  2DWG A;  1VRB A;  3CX6 B;  4FRT A;  3ZMV B;  5E0O A;  5GON E;  2LHN A;  4DBR A;  1QSD A;  3MJX A;  5FYM A;  5AFU L;  2JJ9 A;  2PBI A;  4DO0 A;  3ONX A;  4RL9 A;  2DLR A;  4KP3 C;  2Z6E A;  4EXT A;  2FGQ X;  2CLY C;  5DAB A;  5JDG A;  3HOL A;  3L3P A;  2WBL A;  2PRN A;  5BMV E;  3HA4 A;  4QXH B;  2WSS V;  3ZJ1 A;  4QX7 B;  3AA1 A;  2BVM A;  3ETU A;  3MAC A;  1GFP A;  4JFB A;  3S4U A;  4AZL A;  3LBX B;  3W15 B;  4FT6 A;  3C50 A;  3GA8 A;  4PJJ A;  4WBN E;  4CZZ B;  4H9R C;  5F8P A;  5JDL A;  4XNL A;  1BT9 A;  2K5B B;  5FXW A;  3PQS A;  4JEH B;  3TZG A;  2E9X B;  3AAI A;  3O1I A;  2L8K A;  3FBL A;  3FYX A;  3VY8 X;  5T5F A;  2DHR A;  4OYJ A;  2M67 A;  5HXH A;  2IAK A;  2NTX A;  3PUA A;  4PAG A;  1UX4 A;  2MNH A;  5J2T E;  3AA6 B;  5CA1 E;  1HS7 A;  2F1V A;  5FP3 A;  5JRC A;  5M4Y A;  3MXZ A;  1YKH B;  2KIN B;  5LHG B;  2M06 A;  2DWK A;  3H3A A;  3DP7 A;  5D5D A;  4PFP A;  4N58 A;  1X79 A;  1ZHW A;  3FB2 A;  5DL6 A;  3T20 A;  4XNK A;  2XAF B;  4O4J E;  2VKH A;  4I4T E;  2KXP B;  2BZB A;  2VWA A;  4GK0 E;  3RYH E;  4AKH A;  1WLX A;  4J2C A;  2UXN B;  2LSI A;  3E22 E;  3UT5 E;  4QQ1 A;  1BH3 A;  4UXN B;  4AYE C;  3PDY A;  4AKR A;  5HYA A;  3NZP A;  4E1S A;  3ZLI A;  2YNK A;  5LHI B;  4KR8 A;  3N2G E;  3WAJ A;  4Z8X A;  5CA0 E;  2JMK A;  4PNI A;  4IE7 A;  4EZH A;  3DA3 A;  2OA5 A;  4MAL A;  4FES A;  1LVK A;  3VZW X;  2LT3 A;  2ZLD A;  2VL8 A;  3POQ A;  2PJQ A;  5DL7 A;  4AFK A;  4Z3T A;  2VK9 A;  1FMW A;  4ZI3 C;  4ERR A;  4D65 A;  5LYJ E;  2XTR A;  4FOZ A;  4TUY E;  3UU2 A;  4AYI D;  2X9H A;  3MZK B;  2ES0 A;  5EK3 A;  4XZC A;  4RLB A;  3SRZ A;  3HWB A;  2QA7 A;  3LFM A;  2N2M A;  3E0Z A;  2H3R A;  5LBM A;  1VOM A;  1P4T A;  5LGN B;  2W81 C;  3AA7 B;  3ANW B;  3AVS A;  5LCY A;  5L3G B;  1GFM A;  4GCP A;  2D0T A;  3ZCI A;  2ERV A;  2QTK A;  5DL8 A;  2Y0L A;  1ZHT A;  4ZS3 A;  4TZ4 C;  2XE3 A;  3A2S X;  1IZN B;  2C0S A;  2E9X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...