2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
3LK2B 3AAEB 3AA0A 3AA6B 3AA1A 3AA1B 2KXPA 3AA7B 5AFUL 2KZ7B 3LK3B 2KZ7A 4AKRA 1IZNB 3LK42 3AAAA 3LK2A 3AAEA 3AA0B 3AA6A 2KXPB 3LK3A 3AA7A 5ADXL 3LK41 4AKRB 1IZNA 5AFUK 5ADXK 3AAAB
chains in the Genus database with same CATH superfamily
1ZMEC 1DEEG 1SQBK 5APUA 2JR8A 3AAEB 4IHJE 5AVXB 1FC2C 4KR8A 2KB7P 5HWYA 3R84B 4XA4A 2XQ7A 2OYOA 4C4VB 3GF3A 3C8VA 3P8MC 4IDOA 4UVAB 1NTMJ 1XTGB 3RK3B 4BJNA 3HW9A 2IZ1A 1X79B 2XDJA 2X9XA 1SP4A 2LEHA 1LT9C 3RK2C 3POQA 1HCIA 2BG9A 2KDYA 2D2CD 2IYPA 4IE6A 4NPDA 4LSIA 3OYZA 1KN7A 1VQ4P 3SZVA 4X64T 1ZHWA 1U57A 4G76A 2E9XC 2N9DA 4IREA 5AQPB 3RK3C 3MUDA 3EABA 2K9JA 2H89A 3FXDA 2OYIB 1BDDA 3GMAA 3PURA 2WQYA 3TNUA 5KAIO 2VASA 4JUYA 4LLHA 2HN1A 1PZQA 3CXHE 4BA9A 5KJ7D 3HI2A 3H32B 5L4HA 2B88A 3VZWX 4AKMA 3E7KA 3PQUA 1FS0E 2P7JA 4U2YA 1J5WA 4A98A 3QWOC 2JIWA 4AIUA 3T1YT 2HPCA 2O4VA 5LMNT 4EGWA 2UUAT 3MACA 1NOHA 4IE4A 4O4JE 1S2EA 1RF1B 1LRZA 1MM5A 5LCYA 1BDCA 2O3JA 2Q3IA 3L37A 3KVBA 3AA1B 4GK5E 1HNXT 4K0UA 3U1AA 3QRCA 4HGAA 2J4UP 1J1EB 1SHZC 2IZ0A 1NHLA 3AVRA 4AYDC 4AYMC 3G6EP 1JTHA 2FYNB 3B71A 1IFJA 4DR6T 4EEDA 1N7SB 3W67A 1T98A 4ASKA 2ZLDA 3UPGA 4IFDK 1EZVI 2CXLA 3LIDA 3A0BH 3ANWA 2NPSD 3CX7B 4OX9T 1ZLLA 4UV8B 5LGNB 2FYNC 3CQXC 4ZI7E 3EUHA 2YINA 1MMDA 1SQQK 2XZEA 3RYCE 3VY9X 3CXHD 1G2CB 4HEAA 1TU3F 2WSFH 2YXQB 3PUGA 5FVKA 2Y0HA 2Z5IA 1NWQA 2QA7A 2YMKA 3TF5A 3FZLB 2B1EA 5AQRB 2N2NA 5JDQA 4N78D 1FIOA 1OVRA 1A02J 2W83C 3SYBA 1Y8AA 3O8ZA 3L8RA 1VQ7P 1SQVD 3TLUA 4U3FG 4WB4A 3AE5A 2FJEA 3LW5H 3N9LA 5FXZA 2YKQA 4ASVA 2N9BA 5J2TE 1WYCA 2PJQA 4JQ0D 1M8OB 3V5UA 3GLMA 4U31A 2LKGA 3EFFK 1XWMA 2QSIA 2AXTH 4KR4A 4ZKUA 4MLKA 1D1AA 3UT5E 2JMHA 2CK3H 1BR1A 2KS1A 3A0BE 1W09A 3KHUA 1FJKA 3U59A 3T8OA 2PRNA 1L0LD 1S4XA 3ZN0B 2J58A 5TAOA 2GUSA 3N9QA 1KILD 5DL7A 4UB8H 3RK2B 3T20A 4X1KE 5CGMA 4O3YA 4PR7A 1OFCX 3S9OA 4KHXA 2SPZA 4O49A 3ITKA 1SQBJ 3TGUD 2NW8A 2RPAA 2WBLA 3BK9A 1IJDB 2ZVOB 3H1IE 3O1IA 1EDIA 2H43A 5HXEA 2QJKB 1NYHA 2JP3A 5IWAT 5LA6E 3WUUA 1BR4A 3ETUA 1LTJA 1SQPK 4B3TT 1OX3A 3CX8B 4X5TA 1S5LX 1SFCC 4WBNE 1T3JA 4ZKPA 3O1JA 3AEDC 2X9WA 3P4WA 2V7QH 5LHGB 2X0HA 3H1KJ 4QWNB 2R4LA 3E22E 2X67A 2WZ7A 2OYHC 4H63V 2CPTA 1W2BO 3HE5B 3A5XA 3VR8A 4BUMX 4RJWA 1QL2A 1MNEA 2KSJA 3MJXA 5DL6A 3PGRA 2LM9A 4X1YE 1IJ6A 4PAGA 4YTPA 1BR0A 1NKZB 3BRVB 1EXIA 3TSIA 3PUZF 4DVDA 1EDKA 2FJAA 1PPJE 3ZT5A 1XNQT 3N7NA 1M1JC 2LR2A 3F2EA 4LMLA 4DR4T 1J5ET 1YJWP 4B86A 3QOFA 3C9IA 2QJPC 3LIEA 3V2QA 4RESB 4G2AA 3HE4A 1NTZE 1URQB 2Q9QC 5LGUB 3KFWX 4QH5A 1ZN5A 3LBXB 3FB2A 2WSSH 2R4PA 3UQ7A 2L9QA 4TZ4C 1VQNP 2BG9C 1YQ3A 5AVRB 2B76A 4A5XA 5TISE 4DJGA 3P7IA 2FGRA 4C46A 3PH0A 1NWMX 3C4WA 1PP9J 1OEDB 1Q90D 5CCHD 1KFYA 3AA6B 4HWIB 4O4LE 4O8SA 3ZMSB 3TLVA 2P2UA 4MHCA 5KDMC 3R4YA 4H13B 2FJBA 2JWDA 3NZPA 4ZZBA 4IOIH 4HFDA 5KMGP 2DLRA 5FMNA 2WVPA 3FZFB 2KXPB 2ZM8A 4JF7A 3M0DC 2K5BB 3ZC1A 3PTZA 2N1TC 4K3AA 2ZXXA 1MPFA 3BQLA 1FZCC 4O3WA 4EYUA 4FMSA 3WUVA 3KVDD 4JPZB 2XJ7A 1R8EA 1NTME 3J9X1 3K3QC 5AVUB 4KX6A 3AXJB 4KT0J 2KZ7B 1L0LE 1YW0A 1U5PA 2MTQA 5JR9B 4U74A 1MFTA 1BCCJ 3A0HE 3ZPOA 2VQET 4I6MC 5L8RJ 1U7JA 2IX7C 2CPSA 3CPWO 2FFDB 2X9YA 2IBZE 5HXHA 4AUWA 4LFAT 3JCUH 1NTZD 1KORA 2Y0CA 1D0XA 4JYAT 2Y7SA 1HJ0A 3ZMZB 4WBAA 4UELA 1SVFA 2VURA 5ADXK 2R3SA 5DJTB 4D5UA 2ES0A 3L35A 3PUAA 1DX7A 1ORMA 3L74D 3AE7C 3V8UA 1KFMA 1EC5A 2K3WA 1S9KD 2OV9A 4IL6E 3CQCB 5LBQB 4DR5T 3N2KE 2OTJP 3H32A 2Q5UA 5CBNA 3PE0A 5HWXA 2X66A 1VQ6P 5K5GB 4PD4H 4DV2T 2V8SV 4AUIA 3FXEA 1WMKA 5IYZE 2ZYAA 1QVGO 1HG5A 2XUEA 3CPZA 1ZP0C 4P0BA 2D2SA 4GIFA 1GU4A 2ODVA 3OKQA 2Y0LA 4YSZA 1FBMA 2WDQA 1RF0A 2XAHB 3EVYA 2WSEJ 2G3AA 2XQAA 2P9BA 3TK1A 2Q9QD 2N1TB 2YO2A 2MYSA 2W00A 2P1JA 2A45I 3AEFC 3QC9A 1IFPA 1VCSA 3GMIA 2W4XA 3L70E 1Z56A 2RKLA 3RL0C 2XAJB 2JQKA 3TLTA 2I0MA 2WDRA 4A56A 1YTZI 2K4TA 2M07A 3NVOA 1MM4A 2WPVB 3MGNA 3VN0A 1I94T 3CX6B 2WJQA 3CWBD 4IDNA 4ZMDA 4JI3T 3MUDC 3SFEA 3V5SA 2PTFA 3PUVF 4TV9E 4F8HA 4AQYT 1QJ8A 4PK5A 4H9QC 5DJQC 4ZXLA 3HOLA 2E75B 3SZDA 2BBHA 2Y6XA 3ZJ2A 5PRNA 2R8AA 3I55P 5AW3B 1URQC 2Q9QB 4XBFB 3H1HG 4B3MT 1YKHB 5H6RB 2WMOA 3ZLIA 2NPSB 4IFFA 1G90A 5C3JA 1FMVA 1PFIA 2FYUE 1OEDE 5LJNA 1GU5A 3RIUA 2LSKA 3X1DA 2LKMA 3RBXA 4RLBA 4YFSA 3VE2A 1T8ZA 1ZXGA 4QX7B 5CMZA 2KYVA 5JDFA 2ZT9C 2CEAA 1ZRTD 3P50A 2WCAA 2IAKA 3CIRA 1FOSE 1J1DB 4AKIA 2IYOA 3EDVA 2FKWB 2IWVA 3F89A 3ZSTA 2BKNA 4RLCA 2XQ6A 2P58A 2YIUB 2UUCT 2B87A 2XQ8A 4AKLA 5BU5A 3ONXA 1Q9FA 3GHGB 5GONE 5JDGA 1AVOA 3IN6A 2UXDT 2VVNA 2JMMA 2H3RA 5LP6E 3FGAD 2MJZA 1N8RQ 1RHZB 1AV1A 2E76B 1U7MA 5GTIH 3MZKB 3OPCA 1FDOA 3ANWB 3L72G 2W27A 1BT9A 3RIFA 3ZYMA 1PV3A 3KV9A 2OYIC 2OA5A 2POHA 5H6QB 3RGUA 1EQ7A 1Q86Q 1W0AA 3K19A 5L3EB 1DH3A 2CLYB 5CA0E 1YQ4A 1LTJB 4PV1B 5FXXA 4U7YA 1M90Q 1OVVA 3M91A 2C9LY 4FSPA 1GL2D 2R4OA 4GCPA 3MP7B 1HTJF 3ZMVB 2K3RA 5LHIB 4ZI2D 1MIYA 3EMNX 1LT9B 3CI9A 3P4RA 3E1RA 4W80A 3Q5SA 2MKVA 3NWIA 2CLYC 2BS4A 3AE6C 2Y0KA 1L4AD 3KBUA 2LSIA 4QXCB 1D7MA 2EHOB 2CPBA 3NRYA 3AB3B 2ACZA 3VTPC 3UUBA 3SFDA 1SQXD 3G9RA 3EQ2A 5AQLB 3UFGA 4EXTA 2W2UA 3FZKB 3NKZA 3OAKA 2WAUA 2R4NA 1SQQG 1UGOA 3A8YC 3PV0F 3ONJA 4WY4B 4NXNT 4FRXA 4X66T 5AVVB 2KNCB 1H0TA 2PBIA 2RA1A 4QXHB 3H1HJ 1BGYJ 2QA4P 3UU5A 3CVRA 3Q2MA 4E7ZA 3A0HO 5LYJE 1P84H 3VMAA 2QEXP 3AE1C 1IO4A 1SQBG 1OW8A 2HR3A 4IDQA 5JR9A 3N9PA 2BVLA 3AAAB 3VMYA 3UULA 1JUNA 3H1ID 2Y9ZA 4WNKA 2XTRA 1T6AA 3PHLA 4OGQD 2LRLA 2M6BA 4Z8XA 1SS1A 3B5NB 3JC22 3HA4A 3ZN1B 4WW0A 1GL2C 1NAYA 4KI0F 5CB4E 1KNPA 4A7PA 4UB6O 3L73G 3CX5I 4DOJA 3ZT7A 3IEEA 4OWFA 5AW0B 3NFQA 1E2AA 2F4VT 5ETWA 1RF1C 1MMAA 2XQ9A 1SQQJ 3GF7A 1OMIA 3AE8A 4AYEC 1U4QA 2Y0DA 3LK3B 1ZP0A 3V5BA 1EZ3A 5KKZC 2M8RA 4EI2A 2K48A 5LGTB 3HKEE 2F1VA 3UUXB 2NR4A 3V2NA 4EYYR 4YHHT 4AKHA 1L4AB 2HN2A 4N6JA 1LWUB 4ILCA 4DR3T 3H1LD 1HX1B 3L39A 2GA1A 4C7NA 2YPVA 2XG6A 4I2LC 3HD7B 3CX5E 3VP9A 1URQA 2CM0A 3UU6A 5LBMA 1VDFA 1FJPA 1FZEA 4FQEA 2E2AA 5AQSB 2JKVA 1T16A 3CC7P 4KUMB 2O1JA 1L0NJ 3OBVE 4OGQC 1GK4A 1KYOD 4DR1T 1M7LA 5BR8T 1P4TA 1KMIZ 2NPSA 2HPLA 3PU8A 4PD4E 1SQXK 3CXHI 3VMZA 5LG4A 3U78A 3SY7A 1OSMA 2GM4A 4KMCA 2XTLA 1GFQA 1JY3P 1KC8Q 4JCHA 3IBPA 4PFPA 4IIJE 3WAJA 5L3CB 2WSEH 5EFWB 2PGDA 2KXPA 1FZCA 2XHEB 1KYOH 4M1PA 5KLVK 3TGUE 5LHHB 1SFCD 3M0DA 2OTKE 1HXTA 3RKOA 1SQBE 3GWHA 3AE2A 2A9UA 2N2LA 3U1CA 4GDOA 1ZHYA 3P4PA 5JDNA 1ZHZA 4YJ2E 4BRYB 2M3EA 2K9AA 2VK9A 2V26A 5JR9C 2QRXA 3GHGA 2Z6EA 1N73A 3TZGA 3AE1A 1NTZG 3L70J 1HS7A 1N32T 2J1DG 2B87B 2XAGB 5CJ4A 4NUUA 1S5LE 1X9VA 1VQ5P 3AEEA 3DTOA 3AE3A 2DHRA 3HL6A 3S4UA 3H1KE 4COFA 1USEA 4O4IE 1MZ9A 4FJOA 4GCSA 5G3AA 1YD8G 4OFZA 3Q2YA 2Q9QA 2WB5A 4BAYB 3HD7C 1NU1E 3B13A 1QJ9A 1W0BA 1SQVE 3GG2A 5ADXL 1KILA 4FSOA 3LK41 2RMZA 3BCCG 1KEYA 1BGYG 4MFRA 2UXNB 3AEBA 3PDYA 3DA4A 1PGOA 1R5LA 3NMDA 2YO3A 2YEVC 1PGJA 4ILBA 2G0UA 1JB0J 3AE9C 1VQLP 4EOTA 4WYVA 4H9SE 4U3FJ 1QEXA 5HXSA 3ZCJA 1SQXJ 4DV4T 3L72D 2N1TA 4DMVA 4D6TD 3FWLA 4UB8E 1LT1A 5CA1E 3PUYF 3N9OA 3UUNA 4MALA 3MIWA 3L09A 4ILUA 1M1JB 1LKXA 3RIAA 2A45H 3AA7B 4FUVA 5CJ0A 5APSA 1FOSF 4GYSA 2BKPA 1KB9D 3M9HA 2C0SA 1IZNB 2OTLP 2V5CA 4GKKT 4G75A 4LF5T 5FVLA 3AAEA 4ZNCA 5AW4B 1ZHTA 4DV0T 3ZSSA 1W2EA 4C91A 5JH7E 1LGHB 3PRJA 3Q5RA 4JEHB 2ERVA 2OYHB 1PP9E 2KWHA 3HD7D 2L91A 4RO0A 5JDMA 2IFNA 3AVSA 3A0BO 1NTKK 5KXJA 1BE3J 4PW8A 4C7RA 4CPGA 1D1BA 5IUXA 4O3ZA 1KQSO 4HB1A 4D6TJ 5KLVD 1GFNA 2K0LA 2KK7A 3P7KA 1ZV4X 4U3FD 3H1HD 3HUSC 4Z91A 4PD4D 4ASWA 3FBLA 2FUPA 3HTKB 2KWIB 2WM9A 2M6IA 5JTGA 2PFVA 4AQFA 5FL0A 1GFMA 3VZTX 2A06D 3G06A 3CD6P 4N78E 4LMKA 3KBTA 3K3OA 4PK6A 3RIUC 3QRAA 5H2FE 3AE9A 3L70G 1JO5A 2BCCG 2M0BA 3HKCE 2X9KA 1AFOA 5DQVA 3CC4P 1HF8A 4ZHQE 2IPPA 3IF8B 4JYCA 4OGQB 2J59M 2IIUA 2W66A 3GN5B 3CCVP 1N7SD 1WCRA 4HH2A 3L74E 3AEBC 4B61A 1FDMA 4I7ZC 3TDKA 3SY9A 3L75G 3E1IA 5APYA 1LWUA 4H13D 3L75J 4GCQA 3L70D 1T7SA 1KILC 2MOZA 3A2SX 1ZR2A 3H1LJ 1Y47A 4QH1A 4AI6A 2OQQA 3PQSA 2KIKA 3HD7A 3N4XA 4JI7T 1HFAA 2QE7H 4MN4C 4FZMA 1ZV8A 3GP6A 2W6BA 2K9YA 4P09A 2CXDA 1XDOA 3WUTA 5E79H 1X79A 2C0WA 5AQGB 2MNHA 3ZT6A 1JMBA 3CWBJ 4GOEA 1MFZA 3OW2O 3CCEP 3RQWA 2ZM0A 3MD0A 3Q9DA 2GK9A 2YKOA 4DBQA 3O0EA 3TKLB 2CWYA 1FZFA 4DBRA 4U72A 2I8DA 4KJMA 3NBXX 3HKBE 5FNVE 1I6ZA 1HXXA 1OIPA 3B57A 1UIIA 3AA0A 2YMYA 2HFED 3HRNA 2UUBT 3GW6A 2H88C 4LF9T 2DW3A 4TNVA 1NU1J 3D6YA 4J2CA 3WAKA 2C5JA 1JEKA 2JJLA 3CL3D 1L0ND 2ZT9B 5CCHA 2ZT9D 1R5SA 4O4UA 3B4SA 5L2LA 2YKSA 3PTRB 4B3ST 2IHR1 2ZYDA 2PAJA 1K05A 2XTQA 1HWTC 4PV1D 1J1EC 3VMXA 5BU8B 2IBZI 2V1DB 1JY3O 3Q5PA 3LJCA 2X9HA 4CN1A 2K24A 5LXTE 2BS2A 2LXCB 2E5TA 1UX5A 4HFEA 4JEUB 2I6HA 4MBQA 3H37A 4LSFA 1Q2NA 1NU1K 1WT6A 3WU2E 3ZMUB 2NZ2A 4W7ZA 2XASB 4HKZH 2YDRA 5GTIO 3WU2O 2K9JB 3HWBA 3I1AA 2E74B 2FXMA 3AEGA 5HXRA 4OYKA 5ABHA 4ZS2A 2KC0A 5CCHC 1NTMG 1EXJA 3OJAA 4CN6A 4ZI3D 5IYUA 3LW5J 1HUCA 2YDQA 5JVDE 4UB8O 4AQFC 4AFKA 1QSDA 3KZIO 1Y64B 2E9XB 3VY8X 3KQGA 1BCCG 3A3YB 1T1LA 5AW7B 1OW6A 2FYZA 4PUXA 2BZBA 2ZAEB 2M67A 4GKJT 2KLVA 1FDIA 1YJ9P 2WPSA 2CA5A 4F6RC 3WI4A 3CCQP 1YQ3C 2HODA 3VE1A 4Q25A 1Y01A 2A3DA 2PRRA 2E75D 2OARA 1UUSA 4YTMA 5AFUL 1ZW0A 1MUUA 1AJ3A 4HFVA 1BGYD 1OVUA 1USDA 2X0LB 3H1LG 4O4XA 1T2KC 1GK6A 1IFIA 2BASA 4H44D 3CCMP 5A1LA 1M1JA 5E0OA 2R6GF 1H88A 3DWOX 1GTWA 1T8BA 2JWAA 2YU2A 1SA0E 3ESLA 4H0LB 1WR6A 3JAFA 4PJ0H 1SLQA 3JC6D 2FFDC 4AYNA 1ZRTE 3HE4B 2FGQX 2AXTE 1IFDA 1ZHCA 1AA0A 2YNYA 2KZ7A 4HFHA 1SQPG 4LGDE 5JDPA 2OYHA 1J1DC 2LHRA 3BASA 3ONLC 2YK0A 5KTBA 3B5ND 1IBKT 2UXXB 4FT6A 1KZUB 2FYUK 1OEDA 3CXHH 4U33A 1KV4A 1E7PA 3JCUO 4CXXA 3PGUA 3AEDA 5B66H 5B5EH 3SWKA 3CCSP 3HUSA 4UB6E 4Z1MH 5DL8A 2WPRA 4E1TA 2LXBA 5B66O 3AE6A 4GOUA 1VF5D 1KYOI 1RE4A 4K0KT 1QGKB 3L71G 2W63A 4I4TE 5CJ5A 5JREA 3QK6A 1X8YA 2QIWA 2WZIA 2UWJE 1K9MQ 4U9CA 5FYMA 1GZLA 3CWBG 5KJ7A 1JMMA 2WMNA 2W81C 3BVHA 2E75C 3LK42 2QJYC 2MHLA 4GODA 4N75A 3LK2A 5FY1A 2FYUG 4IL9A 4CQIA 4DIDB 1M56D 2KINB 2XAQB 3QUJA 4UIGA 3DWNA 2Y9YA 1S72P 4ERRA 2NTXA 1W9RA 3V2PA 1MIVA 4PJ0O 2V5DA 1PP9D 3FBZA 4D6TE 4DV1T 5FKYA 1FMWA 3RH3A 2I1KA 4ZZCA 3CMLA 4FZLA 1ZEEA 4HYTB 1QJPA 2P10A 1V9DA 1YXRA 1Q7YQ 5LOVE 1XZYA 4EB6E 3BCCD 5B5EE 2C0XA 1PP9G 3V6IA 1GQEA 3KDSE 2WDVA 1ZHXA 5LG3A 2IFMA 5HYAA 1A02F 4TN7B 1HX8A 5CCGC 1OPFA 1VQ8P 4CZZB 2V7JA 3P8CD 2Y48B 3H3AA 1THQA 3DJBA 4GIWA 5BMVE 4GF4A 3UAQA 3L74J 3T0SA 1VF5C 5C8YE 4H0LC 2A2FX 3PP5A 1SFCB 4L74A 5AQNB 4NIQA 3O6QB 4CI1B 5AW9B 5TJHA 1S94A 2I1JA 3WI3A 1GW4A 4TLFA 4GOFA 1CI6A 2WITA 1NTKG 2BCCE 1KD1Q 2WU5A 1X22A 3MZWB 1BR2A 4DO0A 1AJYA 3N5LA 5HEGA 5E79O 1AQTA 2CCQA 2JRKA 5DQWA 2ODUA 3VHLA 4EZ4A 4JFBA 2G8YA 4JI4T 1VF5B 4NUVA 4UXNB 3IFMA 5D5DA 4OVNF 3L75E 4GK0E 3BRYA 1L0NE 1UIXA 1KF6A 3T97B 4ISSA 2KMFA 2V6YB 5HEJA 2Q6QA 3AA6A 3AE2C 2O01J 4H9PC 1OXZA 3AECC 4HWFA 2ZXEB 3H6PA 5GV0A 2LOPA 3A0HH 3IA3A 2UXCT 5DABA 3CWBE 4JLEA 3S1KA 4K3BA 1CSBA 4B6XA 3H1JE 4IDPA 3VR9A 3F31A 5ABEA 4EEBA 4GYRA 4QQ1A 3VRAA 1M62A 1QUUA 1BH3A 2JQYA 2KOGA 5FXWA 4LF7T 1RF0C 3Q5DA 5AQQB 4N59A 3C1LA 1SQXG 2H89C 2X51A 1N33T 3FXEB 3BRZA 5KKZB 4UR9A 2BBJA 2AXTO 4PNIA 2JPFA 1SQVJ 2JJ9A 5AQFB 1GFPA 4R4LA 3V4QA 2BG9B 4WVZA 4UVCB 4KHPT 2FXPA 4DMWA 4JBZA 1NTZJ 1M57D 1PGPA 5AW8B 2LOSA 2LRKA 2H7OA 2V7LA 4N58A 4ZS3A 4H63H 4EDFA 4HWDA 4JYBA 2AE9A 2F1TA 5LMUT 3HOEA 3Q5EA 4TT3H 1LTIC 4IL4A 3J7Yq 2KNDA 4H9OC 1P84D 1MIWA 3KV4A 4DUZT 2A06E 3OJAB 2VKOA 3H1JD 1D0YA 2V6XA 1NVOA 1L0NK 2XSBA 1LJ2A 4G63A 4TWFA 2VKDA 3H1KD 1OW7A 4C4VA 4WWIA 1EZVD 3MXZA 2NW9A 4YY3T 4K35A 3PUXF 4YTNA 4YXDC 4ILAA 2YU1A 4U3FE 5AW6B 1FU1A 3TYYA 1H0TB 1MV8A 2K37A 3KV5A 1LP1A 4YT0A 3ZCIA 4H44C 1HBWA 1FZGA 3E08A 4WY4D 1S5LH 5TISO 1L0NG 2O01H 1VOMA 2DWKA 2EHOA 2IBZG 4DV6T 2MPKA 4RJTA 3OVUA 2AXCA 2W80C 2RH0A 2OYIA 3M06A 1NGMB 3O1HA 3P4QA 5GTIE 1Z0PA 2XZRA 3ABVA 5KLIB 2NWBA 4IFMA 4OHFA 5AQOB 4BJMA 3PJSK 3VU7H 1PGQA 2B9BA 1L0LJ 8PRNA 3RX6A 3CCRP 2PFXA 1G1IA 4DNDA 4HFCA 3AE4C 2HPCB 1KB9I 4WY4A 1MNDA 3M65A 4DV3T 6PRNA 4FESA 1QLED 3M9BA 3R2PA 2N2MA 3L3PA 3RYHE 2ZM2A 3QNUA 2FBWC 5ABFB 4D65A 2VQFT 1HVVA 3L72E 2N1TD 3A5TA 2CE7A 4TUYE 5L3FB 3VKHA 2XE1A 4PJLA 1X0TA 2W90A 2E8IA 4AYCA 1JNZA 3LG7A 3R6NA 3E0ZA 4O2BE 4UV9B 1G73A 3II6A 1NENA 5C39A 3D6ZA 4AXPA 3O9XA 1VQKP 2WMMA 4I50E 4GKGA 1S3JA 2WTYA 2LLYA 1Q81Q 3QB5A 2KZIA 3RQUA 2O1KA 4YTPC 1NO4A 2M3BA 4UF0B 1L0LK 5B66E 1ZKEA 2KUBA 4HFBA 3PF1A 2E76C 4WZXA 4XE5B 2GE4A 2XMXA 5F3JA 2L5GB 4UB6H 1SQPE 1IJ5A 2DWGA 1GW3A 4JV5T 4PJJA 5GTHH 3RRWA 4AQGA 1Q9GA 4BWNA 2MAWA 5APXA 4IE0A 4EZHA 1PHOA 2A72A 1SQVG 3CK6A 3CWZB 1YQ4C 2VRSA 2HHHT 2KLQA 5FY7A 1SFCA 3U3IA 2IWWA 3L73J 4PJNA 2XNDH 1FE6A 3K1SA 2WWUA 3D71A 3CCJP 3LFMA 4QKNA 2R5BA 5APTA 5HXCA 1DU2A 5B5EO 5APQA 5J0ZA 2VVSA 2ZM6T 4V1Av 2D0UA 1H89A 2XSAA 2XQ4A 5EK4A 1HTLC 5CBOA 2KI7B 2WZHA 1N86A 5AVWB 1Y9BA 5CCGD 4TNWA 1JY2P 2E5VA 1KQFB 1WFDA 4CI2B 4U7IA 2JQ9A 4O4HE 3K5BA 4C7NB 4U3CA 4LF8T 3I0OA 2XQYA 4AKRA 1JCDA 1S1CX 3ZEFB 2E43A 2CWOA 3ZDMA 3AEFA 3T97A 1RH5B 3BATA 3M9QA 5AQIB 4E7SA 1S35A 4LMJA 3WU2H 3QB5K 1NTZK 5EE2A 1R8IA 4JI2T 3RBHA 5AVYB 3F5HA 2KS1B 2Q3EA 4XZCA 3MA9A 3Q1MA 4RL9A 1NAFA 1VQ9P 2XPKA 4D64A 3NXSA 1BCCE 4JI0T 1PPJD 3UTKA 1GFOA 1OZHA 2WT7B 1SE7A 5TISH 1KYOE 1QVFO 3AEAC 4OK0A 1D0ZA 3EWKA 2XNXA 1P84E 3B5NA 3PU3A 2R88A 3UU8A 3CKDA 4TV8E 3BQIA 4OH8B 4NPEA 2DI4A 4X62T 3AEGC 5APWA 3PUWF 2XQ5A 4EYYQ 3RK2D 4UVBB 1XMOT 1XTCC 1LTTC 1KILB 1URQD 2H7HA 4OYJA 3H1IG 3GA8A 3IR9A 1HGVA 1JNMA 4IT4A 5EK2A 2F1CX 3CX5H 4I7ZB 4IL6X 5KLVE 2BVMA 2E9XD 1FZAA 2J47A 4Y28J 3AA1A 1WR0A 1LTGC 3BCCJ 5HEOA 2V7KA 3I5CA 5GTHE 3V2RA 2IBZD 4AYID 1JM0A 1JTHB 1NTKE 5AQMB 1E54A 2D9DA 5KAFO 4HN9A 1RE3C 2DNXA 4QXBB 1T2KD 3N9NA 5FL1A 4F4BA 1KTMA 5AQUB 5F5WA 2H88A 1FJGT 2ZMAA 4IL6O 3H25A 5L3BB 1IC2A 5CFBA 1HG2A 4H44B 1YKEB 2R89A 2BKOA 3MK7C 1JCCA 1PPJG 2E42A 2LM2A 2W0GA 4HFIA 5AW1B 5CHXA 1UX4A 1UK5A 4HE8A 3G3ZA 1LVFA 2J5UA 1NTMK 2EHOD 3LK3A 3H1JJ 3M0AA 2W61A 5EK3A 2OMFA 4XNLA 3CQGB 5AQVB 3L75D 2NOXA 4IE5A 1O3XA 4IE7A 2YKPA 4CXWA 3C64A 1Z8UA 4ZEYA 2FFDA 1YIJP 2Z4EA 4YJ3E 2K1AA 4XAXB 3Q5WA 5IHYA 4NXMT 3ZYKA 1WLXA 5FXVA 1OWAA 1T72A 2VL0A 3EHZA 4D6TG 3L71D 1HXUA 4TWDA 3HTKA 1M1KQ 1NTMD 4H9RC 4DCKA 1LWUC 2OGUA 5JRCA 3AA7A 2UXBT 1L4AC 2WU2A 4BRYA 1KK7A 2KLUA 4HKAA 3C5OA 3HE5A 1VQPP 2D0TA 3POUA 2HH7A 1E79H 1KQLA 2FY8A 3H3MA 2UU9T 4U2ZA 3L73E 4KBMB 4EV6A 3POXA 3AXJA 3M3ZB 2O01N 2V7IA 5JDHA 2QYWA 1EDJA 2C5KT 3UU3A 2OLTA 5ABFA 1IAPA 1IK9A 4UF0A 2VKJA 1FZBA 3VOPA 4LSHA 1VQOP 3I9YA 3SOLA 4M3LA 4DZOA 3SS1A 2KSRA 4O9BA 5G39A 3G4SP 4YPCA 3TLWA 4O2AE 4QHOA 4WBOA 3LBXA 5HEUA 2M5AA 4QH4A 2NRGA 1IBMT 4HJGH 2JO1A 2BEQD 5L3GB 3NJTA 1RE3A 2MBGA 1YYCA 4N3YB 1EZVE 2JQQA 4LFBT 4NPFX 3PUSA 1KILE 2ACXA 1KNRA 4TWHA 4H0LD 2XM2A 5JDLA 3IHRA 4R4MA 5HAXA 4YSXA 4AISA 3L72J 5HCMA 2C9NY 4LF6T 1BXWA 1S5LO 4DR7T 1L0VA 1IK7A 5ABGA 4FOZA 2BEZF 1H7CA 2XV5A 2XE3A 2WY2A 4I55E 1DD3A 2KP8A 5FY0A 3JCFA 2WWVA 2WJRA 2HYNA 2LKHA 1AVYA 1GMJA 2IUBA 1XMQT 5AVSB 1VRBA 1LTBC 2L8KA 4EOZB 5KAFH 3RYFE 5J1GA 2QM8A 3H1JG 3N9MA 4AKRB 4JI6T 2D2CC 1MKMA 2FYUD 3AEAA 3H1KG 3H1LE 2I59A 3DA3A 2CRBA 2CMRA 1UURA 1IBLT 1NJIQ 1LTJC 5F8PA 4UEMA 3JTYA 3D0TA 3OYXA 1WRDA 1JY2N 2WT7A 5DJUB 4W7YA 1ZR4A 2BCCJ 3NSGA 4O3XB 5AVZB 4LSEA 2JEEA 3SWYA 1XDPA 2LSGA 3PUQA 3H1HE 2AEJA 3EFGA 3USSA 3VYIA 3AEEC 2CBJA 3RF1A 1B7TA 5G26A 1G8XA 3K8PC 2BDEA 2E74C 2IC9A 1NU1G 5FP3A 2RN0A 1YS5A 4K3CA 1N73C 2LSJA 2GUVA 2Z5HA 3GHGC 2AXDS 3JSVC 1N7LA 1DIPA 3P32A 2A06G 1YHQP 2CHNA 2R32A 4PK4A 4KHZF 1SQPD 1WYBA 2YIUC 1SQQE 5AVTB 2J1NA 3BS0A 3C98B 2QM7A 3NZQA 2V4HA 1MMGA 4JI8T 2ZFGA 4P0AA 2XE2A 2YDSA 1GL2B 2XKMA 3B5NC 4PFOA 5C2TA 3AE5C 2IW5B 4I0UA 1YITP 3I56P 2W62A 1Q82Q 4YXWH 3N2OA 2WVRA 4LC1A 3RHWA 1D1CA 4C90A 3CCUP 2NPSC 3UFEA 4AZLA 2BS3A 5H2FO 3HKDE 1N36T 1PL5A 4EAHA 5APVA 5L4EA 2PP6A 2W6AA 3KINB 5KAFE 2Y8DA 3KZIH 4PD4I 3RPUA 3DP7A 2FBWA 5KAIE 1WRGA 4XFJA 4E1SA 4A97A 3VKGA 5GTHO 1LTAC 3CX5D 3RYIE 4WY4C 3K3NA 3HR0A 4EIJA 1YI2P 4DUYT 1NKNA 2R44A 3O4XE 1LT9A 1NTKJ 1QX8A 1SQQD 3KDPB 3AAAA 2R5DA 2ODJA 4IDZA 3SWHA 3IF4A 1NH4A 4IGUA 5M4YA 2QVAA 5KLVJ 2IDBA 3VRBA 1KFNA 3PRNA 3FXDB 1FAVA 4X65T 5KLVG 4EIWA 2XE5A 3L74G 1HF9A 4FI5A 2WS3A 2EHOC 3ZMTB 3AE8C 3W68A 2QG4A 5AW2B 1SQVK 4HWCA 1G1JA 2W67A 1P84I 3WI5A 3H1IJ 4C69X 4N74A 4PV1C 1FEWA 3JADA 2KZJA 1K04A 3G7GA 2D2CB 3RI5A 3TGUG 2Q1KA 1XNRT 1YTZT 1EDLA 5KLIC 4XNKA 3OTOT 4CXYA 2LHFA 5JQGE 1K73Q 4L9IA 2WQYC 3IAOA 1L4AA 5LB7B 2ZYGA 2YOEA 5DL5A 1NTKD 1N7SA 2M06A 1IFNA 1VL2A 2H8PD 4NPPA 2E5YA 4P1NA 3KVAA 1GD2E 1VPCA 3HUSB 2E9XA 3OA7A 2Q7CA 1HGZA 3MKDA 5L47A 2E76D 2V7MA 2M5AB 1J2JB 4FRTA 3AE4A 3AE3C 5G38A 5JRCB 2ITAA 2JQHA 4HTEA 1JOCA 3ZC0A 3JCUE 4RKUJ 3RRCA 4RJXA 4LF4T 3L71J 1VCTA 4HWHA 4QX8B 1BCCD 2WSCH 2BG9E 3KV6A 1SQXE 3TNUB 4C00A 1H8AA 3UU4A 1PRNA 1BGYE 1NU1D 2QGSA 2W8ZA 4DT0A 2N9YB 1HNZT 2C5IT 2H7VC 2NW7A 1QL1A 2HPJA 3RBZA 2J4GA 3FYXA 2SPCA 1W5CE 4X1IE 4TX5A 1J1JA 1CI6B 1SQPJ 2AEMA 2XU6A 4H13C 3JAEA 2ZLYA 1CW5A 1YBKA 4YXDA 3L4FA 2FJDA 3NRXA 2WSCJ 1N34T 2NP9A 5KX5E 2ZVNB 4L76A 3EDUA 4DV7T 1ZOYC 3SSUA 1N73B 5LNKA 5BVZA 2HODB 4DV5T 3UUMA 3P4SA 2V6YA 1N2DC 3CC2P 2V7QJ 1YJNP 3B8EB 3C50A 3DZMA 2DCFA 2PG8A 2BCCD 5M1BA 5AW5B 1UCUA 3RL0B 2P67A 1L2PA 2QJPB 3LSVA 3CMAP 4I1LA 2HLOA 3O6QA 4YHJA 2A45G 4Y99B 2XY8B 3B5MA 5AQKB 2XAFB 1BSNA 3SRZA 1BE3E 3EAMA 4GT1A 2KNCA 4QMAA 3PLNA 1KNZA 2HG5D 4B3RT 4ZI2C 2WSSV 1DD4A 1E1HB 3S4RA 2L3LA 2IMLA 4L0RA 1RQVA 2LT3A 3EI0A 5HCJA 3A7MA 3WMM0 4ANJA 2YXRB 1HR0T 2VB6A 3SWFA 7PRNA 3VP8A 1RF1A 2VKHA 3ZJ1A 1HNWT 2IDOB 2X27X 1CZQA 5AVQB 1T3UA 2ZFCA 4AQRD 2YNKA 4YSYA 2E74D 2B89A 3SYSA 3RK3E 5AQJB 3W15B 1JY3N 1LTSC 4PJ0E 5T5FA 1GL2A 3AECA 3CCLP 2XM1A 1BE3D 3ETVA 2Y2XA 1IZNA 3CLQA 3RKGA 4LFCT 5KAIH 3LK2B 2R3CA 4AKGA 4JI1T 1LNQA 1CUNA 2W6JH 2ZJSE 3BCCE 1BSHA 1GDTA 1SQBD 3SFEC 3TGUJ 4IL6H 3CMEP 1G2CA 4ZI3C 2Y0EA 2PORA 2QTKA 4JBWF 4ISTA 3N2GE 3T1HT 2JMKA 3RGLA 3V4WA 2CXFA 2RP4A 4L73A 4L75A 3D70A 1FZCB 1RQUA 2X68A 4KP3C 3C51A 4H9NC 3VZUX 3PJAA 3MHVA 3KYQA 2YN6A 4Y99C 1JNRA 3NTNA 3RL0D 2VL8A 2FYUJ 3L73D 1QLBA 1RE4C 1X9BA 3T24A 4PJMA 2FXOA 4ADZA 4ZOLE 3Q5XA 3A7OA 3I9WA 4JI5T 4BXLA 3L36A 3UQ4A 4KRAA 3RLFF 1JY2O 3SFDC 3FX0A 3RK3D 3ZYLA 1H6S1 1US7B 3QH9A 2X0YA 3PGSA 3UU2A 3KPEA 2CHOA 2VWAA 1KB9H 1K8AQ 3FZHB 1OEDC 2WPQA 1KQGB 3ZKRA 3P8CE 4DR2T 5CCGA 3RC8A 3L71E 4FZNA 1PIXA 3TLSA 4YLHA 2QJYB 3PJAJ 3FZMB 4U7JA 3GN5A 5HEHA 5FVNA 3A2AA 4Z90A 4CI3B 2D5UA 1EZVG 1HJBA 3KZIE 3PORA 1AQ5A 1CHUA 3AE7A 1BE3G 3MTUE 2LSYA 1LP1B 5AQHB 3C4XA 3Q3DA 2J62A 1M7KA 2IC6A 2LE8A 3ABVC 5H2FH 1SUMB 2LHNA 2E5LT 1IFMA 3RL0g 2KT9A 3FHNA 5EZYE 1N7SC 4L5GA 2JDIH 2DL1A 5AQTB 4GHBA 3UIAA 1DEBA 1ZOYA 2NTYA 1MMNA 2Q9IA 2WSFJ 1E5WA 5AFUK 2CBIA 2LJLA 3RC3A 2WP9A 5KJ7C 3BRTB 1NEKA 3I0QA 4CN4A 1KB9E 3F57A 4CTDA 3LDQB 1LVKA 2LFUA 2WWWA 4X20E 5LJMA 3FWNA 3BQKA 2N1GA 1L0LG 3G71P 3AAIA 3AA0B 3JC6C 1RY3A 1HH0A 5E79E 4I43B 5J2UE 1S9KE 5L3DB 3KXDA 4Z3TA 2AEFA 3C4ZA 2KSEA 2QJKC 2XQ3A 1VQMP 2K88A
chains in the Genus database with same CATH topology
4QHOA 4EXTA 4WBOA 4KR8A 4E1TA 4IHJE 3AAEB 3LBXA 4GOUA 5HWYA 2WAUA 3R84B 2W63A 4I4TE 5JREA 3QK6A 4UVAB 4BJNA 3HW9A 4U9CA 5FYMA 5L3GB 2W81C 4FRXA 2WMNA 2X9XA 2MBGA 3LK42 2LEHA 2MHLA 2JQQA 2PBIA 3POQA 2RA1A 4QXHB 1HCIA 3LK2A 2KDYA 5FY1A 4CQIA 2XAQB 2KINB 3CVRA 3PUSA 4IE6A 3Q2MA 2ACXA 3QUJA 4E7ZA 4LSIA 4UIGA 3OYZA 5LYJE 3SZVA 4ERRA 2NTXA 1ZHWA 1MIVA 5JDLA 3IHRA 4G76A 2E9XC 2N9DA 5HAXA 3FBZA 5JR9A 3N9PA 1BXWA 2BVLA 3AAAB 3UULA 4FOZA 1H7CA 2XE3A 1FMWA 4I55E 3RH3A 3CMLA 4WNKA 2XTRA 5FY0A 1ZEEA 4FZLA 3PURA 1QJPA 4Z8XA 1V9DA 2VASA 3HA4A 4JUYA 3ZN1B 5LOVE 4WW0A 4BA9A 4EB6E 3HI2A 3VZWX 4AKMA 2L8KA 1VRBA 5CB4E 3KDSE 3PQUA 4EOZB 3RYFE 5J1GA 3N9MA 1ZHXA 3IEEA 5HYAA 4AKRB 4TN7B 1HX8A 2O4VA 2I59A 3MACA 3DA3A 4IE4A 1OPFA 4O4JE 4CZZB 1LRZA 2V7JA 2CMRA 5ETWA 1MMAA 3P8CD 2Y48B 5LCYA 1MM5A 3H3AA 3KVBA 3AA1B 1THQA 3DJBA 4AYEC 1U4QA 4GK5E 4GIWA 3LK3B 4K0UA 5BMVE 4GF4A 1EZ3A 3UAQA 3T0SA 2K48A 5C8YE 5F8PA 4UEMA 4HGAA 5LGTB 3QRCA 2J4UP 1SHZC 3HKEE 2F1VA 3JTYA 3UUXB 3AVRA 3D0TA 4AYDC 2A2FX 4EYYR 3OYXA 4AYMC 4AKHA 1WRDA 4CI1B 1T98A 4ASKA 2ZLDA 3UPGA 1S94A 3WI3A 3NSGA 4O3XB 4LSEA 2YPVA 2LSGA 2XG6A 2CXLA 3ANWA 3CX7B 3PUQA 1BR2A 4DO0A 3N5LA 2CM0A 4UV8B 5LGNB 5LBMA 1B7TA 2CCQA 2JRKA 3EUHA 2YINA 1G8XA 3CQXC 3K8PC 5DQWA 4ZI7E 5G26A 1MMDA 2BDEA 2IC9A 2ODUA 5FP3A 3RYCE 3VHLA 4EZ4A 4JFBA 3VY9X 4NUVA 4UXNB 1YS5A 5D5DA 2LSJA 4GK0E 4KUMB 4HEAA 3OBVE 2Y0HA 3PUGA 4ISSA 2KMFA 4PK4A 2QA7A 1WYBA 3AA6A 2B1EA 1P4TA 2HPLA 2N2NA 3PU8A 4H9PC 5JDQA 2J1NA 1OXZA 3U78A 4N78D 5LG4A 1OSMA 3SY7A 1FIOA 3C98B 5GV0A 4KMCA 2XTLA 3SYBA 3NZQA 1GFQA 1MMGA 2LOPA 4JCHA 3IBPA 2ZFGA 4PFPA 4P0AA 4IIJE 5DABA 2XE2A 3WAJA 4JLEA 3N9LA 5L3CB 5FXZA 4B6XA 5J2TE 2KXPA 3F31A 1WYCA 2PJQA 2XHEB 4M1PA 4GYRA 4PFOA 2IW5B 3V5UA 1QUUA 1BH3A 5LHHB 4QQ1A 5FXWA 2W62A 3N2OA 4N59A 1HXTA 1D1CA 4MLKA 3RKOA 4C90A 4KR4A 1D1AA 3UT5E 2JMHA 3GWHA 2N2LA 2X51A 3UFEA 4AZLA 1BR1A 3FXEB 1ZHYA 5JDNA 3HKDE 1ZHZA 4EAHA 4YJ2E 3T8OA 2K9AA 2VK9A 2PRNA 2V26A 4PNIA 2JPFA 2JJ9A 3KINB 5JR9C 3ZN0B 1GFPA 2Y8DA 2Z6EA 3RPUA 5TAOA 3TZGA 3DP7A 3N9QA 5DL7A 4UVCB 4E1SA 3T20A 4X1KE 4DMWA 3VKGA 1HS7A 2J1DG 2XAGB 2LOSA 3RYIE 4NUUA 2H7OA 4O3YA 2V7LA 3K3NA 3HR0A 4N58A 3DTOA 3O4XE 2DHRA 4O49A 3HL6A 2NW8A 3S4UA 4ZS3A 2WBLA 3BK9A 4H63H 4O4IE 3AAAA 4FJOA 2ODJA 4GCSA 2F1TA 3HOEA 4IDZA 1YD8G 4OFZA 2Q9QA 3O1IA 3SWHA 4IGUA 4BAYB 5M4YA 5HXEA 3PRNA 3B13A 3FXDB 5LA6E 1QJ9A 3J7Yq 5ADXL 4EIWA 4FSOA 3LK41 2XE5A 2KNDA 1BR4A 3ETUA 1MIWA 3KV4A 4FI5A 4H9OC 2VKOA 2EHOC 4MFRA 2UXNB 1D0YA 3ZMTB 3CX8B 3PDYA 4G63A 4WBNE 3DA4A 3O1JA 2VKDA 2X9WA 5LHGB 2YEVC 3MXZA 2NW9A 4QWNB 3E22E 2X67A 3WI5A 2G0UA 2YU1A 4H63V 4C69X 4H9SE 5HXSA 1FEWA 3A5XA 3ZCJA 4BUMX 3KV5A 3G7GA 4RJWA 3ZCIA 1MNEA 4DMVA 3MJXA 5DL6A 2LM9A 4X1YE 4XNKA 1IJ6A 4PAGA 1BR0A 5CA1E 3UUNA 3N9OA 3E08A 4CXYA 2LHFA 5JQGE 4L9IA 4DVDA 4MALA 5DL5A 1VOMA 2DWKA 2EHOA 3L09A 4ILUA 1LKXA 2M06A 3F2EA 3AA7B 2W80C 4FUVA 3KVAA 4GYSA 3O1HA 2C0SA 1IZNB 1Z0PA 2E9XA 4G2AA 2NWBA 4OHFA 2Q9QC 5LGUB 4G75A 3KFWX 3MKDA 4BJMA 3LBXB 2V7MA 3VU7H 3AAEA 3FB2A 1ZHTA 8PRNA 2L9QA 3RX6A 4TZ4C 4FRTA 5JH7E 4C91A 5JRCB 4DNDA 4JEHB 2ERVA 1MNDA 6PRNA 3M65A 3P7IA 2KWHA 4HTEA 2FGRA 3ZC0A 4FESA 5JDMA 1NWMX 3C4WA 3AVSA 3RRCA 2N2MA 4RJXA 3L3PA 4PW8A 2ZM2A 3RYHE 4O3ZA 1D1BA 4D65A 2CE7A 3VKHA 1GFNA 4TUYE 2K0LA 5L3FB 4O4LE 3AA6B 4PJLA 2XE1A 4QX8B 4O8SA 2E8IA 3LG7A 3R6NA 3ZMSB 3KV6A 3E0ZA 4O2BE 4UV9B 4MHCA 5KDMC 1ZV4X 1G73A 1PRNA 3NZPA 3O9XA 4AXPA 2QGSA 3FBLA 2KWIB 2WM9A 4I50E 5KMGP 2C5IT 2DLRA 2H7VC 2PFVA 5FMNA 4AQFA 2NW7A 2HPJA 4UF0B 2KXPB 2ZM8A 1GFMA 3FYXA 2SPCA 4X1IE 2K5BB 4TX5A 1ZKEA 3ZC1A 3VZTX 3KBTA 1MPFA 2GE4A 3BQLA 3K3OA 5F3JA 2XMXA 4PK6A 4O3WA 3QRAA 4EYUA 4FMSA 2ZLYA 1IJ5A 2DWGA 3KVDD 4PJJA 3HKCE 3RRWA 4AQGA 1Q9GA 3J9X1 3NRXA 5DQVA 3K3QC 1HF8A 2NP9A 4IE0A 4ZHQE 4EZHA 2KZ7B 3IF8B 5KX5E 2A72A 3CWZB 1PHOA 1YW0A 1U5PA 3GN5B 2MTQA 3EDUA 2KLQA 4U74A 5FY7A 5JR9B 3ZPOA 4B61A 3U3IA 5LNKA 4PJNA 3SY9A 3UUMA 2WWUA 2X9YA 5HXHA 3C50A 4GCQA 4QKNA 2DCFA 3LFMA 1D0XA 2MOZA 2PG8A 3A2SX 5HXCA 2Y7SA 4AI6A 1UCUA 3PQSA 3ZMZB 4V1Av 2D0UA 4UELA 5ADXK 5EK4A 4D5UA 2ES0A 1HFAA 4FZMA 4YHJA 3PUAA 3GP6A 4P09A 1ORMA 2CXDA 4CI2B 2XAFB 3V8UA 4O4HE 4AKRA 3I0OA 2XQYA 3SRZA 1X79A 5LBQB 3CQCB 3ZEFB 2MNHA 2CWOA 3N2KE 4E7SA 5HWXA 1KNZA 1S35A 3PE0A 2X66A 2ZM0A 5EE2A 4ZI2C 2WSSV 3Q9DA 1E1HB 2GK9A 2L3LA 3RBHA 4L0RA 4AUIA 2LT3A 4XZCA 3MA9A 4DBQA 3TKLB 5IYZE 2CWYA 2XUEA 1HG5A 1NAFA 3CPZA 4ANJA 3O0EA 4RL9A 4DBRA 4P0BA 4U72A 2D2SA 2ODVA 3NBXX 3OKQA 2Y0LA 2VB6A 3HKBE 5FNVE 1HXXA 4D64A 7PRNA 3B57A 3ZJ1A 2VKHA 3UTKA 3AA0A 1GFOA 2XAHB 3EVYA 2P9BA 2X27X 2Q9QD 4OK0A 1D0ZA 2MYSA 2W00A 4J2CA 3WAKA 3PU3A 2C5JA 2YNKA 3QC9A 3CKDA 4TV8E 3SYSA 3BQIA 3GMIA 3W15B 4O4UA 5L2LA 2DI4A 5T5FA 3PTRB 2XAJB 2XTQA 4UVBB 3ETVA 4A56A 2K4TA 2M07A 4OYJA 2Y2XA 3GA8A 1IZNA 1MM4A 5EK2A 2V1DB 3CX6B 3LK2B 4AKGA 1CUNA 2BVMA 2X9HA 2K24A 3LJCA 5LXTE 2E9XD 3V5SA 3AA1A 1UX5A 4TV9E 4JEUB 4MBQA 1QJ8A 3H37A 4PK5A 4LSFA 2V7KA 4H9QC 4ZI3C 5DJQC 3ZMUB 2PORA 2QTKA 3WI4A 3HOLA 2XASB 3SZDA 4ISTA 2Y6XA 3ZJ2A 5PRNA 4AYID 3N2GE 2Q9QB 2JMKA 2CXFA 2RP4A 4XBFB 3HWBA 3I1AA 1YKHB 5H6RB 2WMOA 4HN9A 3ZLIA 1E54A 2DNXA 2X68A 4QXBB 5HXRA 4KP3C 3N9NA 4OYKA 1G90A 3C51A 4H9NC 3VZUX 1FMVA 4ZS2A 2KC0A 5LJNA 4F4BA 2LSKA 3OJAA 2VL8A 3T24A 4PJMA 4RLBA 4YFSA 4ZI3D 3VE2A 5IYUA 4ADZA 4QX7B 4ZOLE 3Q5XA 5JVDE 2ZMAA 5JDFA 3I9WA 5L3BB 2CEAA 4KRAA 4AQFC 4AFKA 1QSDA 1HG2A 2IAKA 3ZYLA 1H6S1 1US7B 1YKEB 3MK7C 3UU2A 4AKIA 1Y64B 2W0GA 2E9XB 2VWAA 3EDVA 3VY8X 4PUXA 4RLCA 1UX4A 2BZBA 4HE8A 2M67A 3RC8A 1LVFA 2EHOD 3LK3A 4FZNA 4AKLA 2W61A 5EK3A 4YLHA 2OMFA 4XNLA 2CA5A 3CQGB 3GN5A 3ONXA 4F6RC 2NOXA 4IE5A 4CI3B 1Q9FA 5FVNA 1O3XA 2D5UA 5GONE 4IE7A 5JDGA 4CXWA 3PORA 3C64A 3VE1A 2JMMA 2A3DA 2H3RA 2LSYA 5LP6E 4YJ3E 4XAXB 5AFUL 3C4XA 3Q5WA 5IHYA 4HFVA 3MZKB 1AJ3A 2X0LB 3ZYKA 1WLXA 5FXVA 1OWAA 3ANWB 2IC6A 1BT9A 4O4XA 2LE8A 3ZYMA 2LHNA 1HXUA 3KV9A 2OA5A 4H9RC 5H6QB 2KT9A 3FHNA 5E0OA 5EZYE 5A1LA 4L5GA 4GHBA 5JRCA 3AA7A 2YU2A 1SA0E 3ESLA 2NTYA 5L3EB 3K19A 1KK7A 1MMNA 1WR6A 2CLYB 5CA0E 3JC6D 4AYNA 5AFUK 4HKAA 3C5OA 5FXXA 2FGQX 2D0TA 3POUA 2HH7A 2LJLA 4FSPA 3RC3A 1ZHCA 4KBMB 4GCPA 3POXA 2KZ7A 1HTJF 3I0QA 3F57A 3ZMVB 4ZI2D 1MIYA 5LHIB 3EMNX 2V7IA 5JDPA 5JDHA 1LVKA 2LFUA 4X20E 2C5KT 2LHRA 5LJMA 2CLYC 2YK0A 2Y0KA 3KBUA 3BQKA 2LSIA 2N1GA 2UXXB 4FT6A 4QXCB 2EHOB 3AAIA 3AA0B 1IAPA 3JC6C 4UF0A 2VKJA 4CXXA 4LSHA 3NRYA 4I43B 5J2UE 3AB3B 5L3DB 3I9YA 3SOLA 4Z3TA 3SS1A 3C4ZA 5DL8A 4O2AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 B;  3AAE B;  3AA0 A;  3AA6 B;  3AA1 A;  3AA1 B;  2KXP A;  3AA7 B;  5AFU L;  2KZ7 B;  3LK3 B;  2KZ7 A;  4AKR A;  1IZN B;  3LK4 2;  3AAA A;  3LK2 A;  3AAE A;  3AA0 B;  3AA6 A;  2KXP B;  3LK3 A;  3AA7 A;  5ADX L;  3LK4 1;  4AKR B;  1IZN A;  5AFU K;  5ADX K;  3AAA B; 
#chains in the Genus database with same CATH topology
 1ZME C;  1DEE G;  1SQB K;  5APU A;  2JR8 A;  3AAE B;  4IHJ E;  5AVX B;  1FC2 C;  4KR8 A;  2KB7 P;  5HWY A;  3R84 B;  4XA4 A;  2XQ7 A;  2OYO A;  4C4V B;  3GF3 A;  3C8V A;  3P8M C;  4IDO A;  4UVA B;  1NTM J;  1XTG B;  3RK3 B;  4BJN A;  3HW9 A;  2IZ1 A;  1X79 B;  2XDJ A;  2X9X A;  1SP4 A;  2LEH A;  1LT9 C;  3RK2 C;  3POQ A;  1HCI A;  2BG9 A;  2KDY A;  2D2C D;  2IYP A;  4IE6 A;  4NPD A;  4LSI A;  3OYZ A;  1KN7 A;  1VQ4 P;  3SZV A;  4X64 T;  1ZHW A;  1U57 A;  4G76 A;  2E9X C;  2N9D A;  4IRE A;  5AQP B;  3RK3 C;  3MUD A;  3EAB A;  2K9J A;  2H89 A;  3FXD A;  2OYI B;  1BDD A;  3GMA A;  3PUR A;  2WQY A;  3TNU A;  5KAI O;  2VAS A;  4JUY A;  4LLH A;  2HN1 A;  1PZQ A;  3CXH E;  4BA9 A;  5KJ7 D;  3HI2 A;  3H32 B;  5L4H A;  2B88 A;  3VZW X;  4AKM A;  3E7K A;  3PQU A;  1FS0 E;  2P7J A;  4U2Y A;  1J5W A;  4A98 A;  3QWO C;  2JIW A;  4AIU A;  3T1Y T;  2HPC A;  2O4V A;  5LMN T;  4EGW A;  2UUA T;  3MAC A;  1NOH A;  4IE4 A;  4O4J E;  1S2E A;  1RF1 B;  1LRZ A;  1MM5 A;  5LCY A;  1BDC A;  2O3J A;  2Q3I A;  3L37 A;  3KVB A;  3AA1 B;  4GK5 E;  1HNX T;  4K0U A;  3U1A A;  3QRC A;  4HGA A;  2J4U P;  1J1E B;  1SHZ C;  2IZ0 A;  1NHL A;  3AVR A;  4AYD C;  4AYM C;  3G6E P;  1JTH A;  2FYN B;  3B71 A;  1IFJ A;  4DR6 T;  4EED A;  1N7S B;  3W67 A;  1T98 A;  4ASK A;  2ZLD A;  3UPG A;  4IFD K;  1EZV I;  2CXL A;  3LID A;  3A0B H;  3ANW A;  2NPS D;  3CX7 B;  4OX9 T;  1ZLL A;  4UV8 B;  5LGN B;  2FYN C;  3CQX C;  4ZI7 E;  3EUH A;  2YIN A;  1MMD A;  1SQQ K;  2XZE A;  3RYC E;  3VY9 X;  3CXH D;  1G2C B;  4HEA A;  1TU3 F;  2WSF H;  2YXQ B;  3PUG A;  5FVK A;  2Y0H A;  2Z5I A;  1NWQ A;  2QA7 A;  2YMK A;  3TF5 A;  3FZL B;  2B1E A;  5AQR B;  2N2N A;  5JDQ A;  4N78 D;  1FIO A;  1OVR A;  1A02 J;  2W83 C;  3SYB A;  1Y8A A;  3O8Z A;  3L8R A;  1VQ7 P;  1SQV D;  3TLU A;  4U3F G;  4WB4 A;  3AE5 A;  2FJE A;  3LW5 H;  3N9L A;  5FXZ A;  2YKQ A;  4ASV A;  2N9B A;  5J2T E;  1WYC A;  2PJQ A;  4JQ0 D;  1M8O B;  3V5U A;  3GLM A;  4U31 A;  2LKG A;  3EFF K;  1XWM A;  2QSI A;  2AXT H;  4KR4 A;  4ZKU A;  4MLK A;  1D1A A;  3UT5 E;  2JMH A;  2CK3 H;  1BR1 A;  2KS1 A;  3A0B E;  1W09 A;  3KHU A;  1FJK A;  3U59 A;  3T8O A;  2PRN A;  1L0L D;  1S4X A;  3ZN0 B;  2J58 A;  5TAO A;  2GUS A;  3N9Q A;  1KIL D;  5DL7 A;  4UB8 H;  3RK2 B;  3T20 A;  4X1K E;  5CGM A;  4O3Y A;  4PR7 A;  1OFC X;  3S9O A;  4KHX A;  2SPZ A;  4O49 A;  3ITK A;  1SQB J;  3TGU D;  2NW8 A;  2RPA A;  2WBL A;  3BK9 A;  1IJD B;  2ZVO B;  3H1I E;  3O1I A;  1EDI A;  2H43 A;  5HXE A;  2QJK B;  1NYH A;  2JP3 A;  5IWA T;  5LA6 E;  3WUU A;  1BR4 A;  3ETU A;  1LTJ A;  1SQP K;  4B3T T;  1OX3 A;  3CX8 B;  4X5T A;  1S5L X;  1SFC C;  4WBN E;  1T3J A;  4ZKP A;  3O1J A;  3AED C;  2X9W A;  3P4W A;  2V7Q H;  5LHG B;  2X0H A;  3H1K J;  4QWN B;  2R4L A;  3E22 E;  2X67 A;  2WZ7 A;  2OYH C;  4H63 V;  2CPT A;  1W2B O;  3HE5 B;  3A5X A;  3VR8 A;  4BUM X;  4RJW A;  1QL2 A;  1MNE A;  2KSJ A;  3MJX A;  5DL6 A;  3PGR A;  2LM9 A;  4X1Y E;  1IJ6 A;  4PAG A;  4YTP A;  1BR0 A;  1NKZ B;  3BRV B;  1EXI A;  3TSI A;  3PUZ F;  4DVD A;  1EDK A;  2FJA A;  1PPJ E;  3ZT5 A;  1XNQ T;  3N7N A;  1M1J C;  2LR2 A;  3F2E A;  4LML A;  4DR4 T;  1J5E T;  1YJW P;  4B86 A;  3QOF A;  3C9I A;  2QJP C;  3LIE A;  3V2Q A;  4RES B;  4G2A A;  3HE4 A;  1NTZ E;  1URQ B;  2Q9Q C;  5LGU B;  3KFW X;  4QH5 A;  1ZN5 A;  3LBX B;  3FB2 A;  2WSS H;  2R4P A;  3UQ7 A;  2L9Q A;  4TZ4 C;  1VQN P;  2BG9 C;  1YQ3 A;  5AVR B;  2B76 A;  4A5X A;  5TIS E;  4DJG A;  3P7I A;  2FGR A;  4C46 A;  3PH0 A;  1NWM X;  3C4W A;  1PP9 J;  1OED B;  1Q90 D;  5CCH D;  1KFY A;  3AA6 B;  4HWI B;  4O4L E;  4O8S A;  3ZMS B;  3TLV A;  2P2U A;  4MHC A;  5KDM C;  3R4Y A;  4H13 B;  2FJB A;  2JWD A;  3NZP A;  4ZZB A;  4IOI H;  4HFD A;  5KMG P;  2DLR A;  5FMN A;  2WVP A;  3FZF B;  2KXP B;  2ZM8 A;  4JF7 A;  3M0D C;  2K5B B;  3ZC1 A;  3PTZ A;  2N1T C;  4K3A A;  2ZXX A;  1MPF A;  3BQL A;  1FZC C;  4O3W A;  4EYU A;  4FMS A;  3WUV A;  3KVD D;  4JPZ B;  2XJ7 A;  1R8E A;  1NTM E;  3J9X 1;  3K3Q C;  5AVU B;  4KX6 A;  3AXJ B;  4KT0 J;  2KZ7 B;  1L0L E;  1YW0 A;  1U5P A;  2MTQ A;  5JR9 B;  4U74 A;  1MFT A;  1BCC J;  3A0H E;  3ZPO A;  2VQE T;  4I6M C;  5L8R J;  1U7J A;  2IX7 C;  2CPS A;  3CPW O;  2FFD B;  2X9Y A;  2IBZ E;  5HXH A;  4AUW A;  4LFA T;  3JCU H;  1NTZ D;  1KOR A;  2Y0C A;  1D0X A;  4JYA T;  2Y7S A;  1HJ0 A;  3ZMZ B;  4WBA A;  4UEL A;  1SVF A;  2VUR A;  5ADX K;  2R3S A;  5DJT B;  4D5U A;  2ES0 A;  3L35 A;  3PUA A;  1DX7 A;  1ORM A;  3L74 D;  3AE7 C;  3V8U A;  1KFM A;  1EC5 A;  2K3W A;  1S9K D;  2OV9 A;  4IL6 E;  3CQC B;  5LBQ B;  4DR5 T;  3N2K E;  2OTJ P;  3H32 A;  2Q5U A;  5CBN A;  3PE0 A;  5HWX A;  2X66 A;  1VQ6 P;  5K5G B;  4PD4 H;  4DV2 T;  2V8S V;  4AUI A;  3FXE A;  1WMK A;  5IYZ E;  2ZYA A;  1QVG O;  1HG5 A;  2XUE A;  3CPZ A;  1ZP0 C;  4P0B A;  2D2S A;  4GIF A;  1GU4 A;  2ODV A;  3OKQ A;  2Y0L A;  4YSZ A;  1FBM A;  2WDQ A;  1RF0 A;  2XAH B;  3EVY A;  2WSE J;  2G3A A;  2XQA A;  2P9B A;  3TK1 A;  2Q9Q D;  2N1T B;  2YO2 A;  2MYS A;  2W00 A;  2P1J A;  2A45 I;  3AEF C;  3QC9 A;  1IFP A;  1VCS A;  3GMI A;  2W4X A;  3L70 E;  1Z56 A;  2RKL A;  3RL0 C;  2XAJ B;  2JQK A;  3TLT A;  2I0M A;  2WDR A;  4A56 A;  1YTZ I;  2K4T A;  2M07 A;  3NVO A;  1MM4 A;  2WPV B;  3MGN A;  3VN0 A;  1I94 T;  3CX6 B;  2WJQ A;  3CWB D;  4IDN A;  4ZMD A;  4JI3 T;  3MUD C;  3SFE A;  3V5S A;  2PTF A;  3PUV F;  4TV9 E;  4F8H A;  4AQY T;  1QJ8 A;  4PK5 A;  4H9Q C;  5DJQ C;  4ZXL A;  3HOL A;  2E75 B;  3SZD A;  2BBH A;  2Y6X A;  3ZJ2 A;  5PRN A;  2R8A A;  3I55 P;  5AW3 B;  1URQ C;  2Q9Q B;  4XBF B;  3H1H G;  4B3M T;  1YKH B;  5H6R B;  2WMO A;  3ZLI A;  2NPS B;  4IFF A;  1G90 A;  5C3J A;  1FMV A;  1PFI A;  2FYU E;  1OED E;  5LJN A;  1GU5 A;  3RIU A;  2LSK A;  3X1D A;  2LKM A;  3RBX A;  4RLB A;  4YFS A;  3VE2 A;  1T8Z A;  1ZXG A;  4QX7 B;  5CMZ A;  2KYV A;  5JDF A;  2ZT9 C;  2CEA A;  1ZRT D;  3P50 A;  2WCA A;  2IAK A;  3CIR A;  1FOS E;  1J1D B;  4AKI A;  2IYO A;  3EDV A;  2FKW B;  2IWV A;  3F89 A;  3ZST A;  2BKN A;  4RLC A;  2XQ6 A;  2P58 A;  2YIU B;  2UUC T;  2B87 A;  2XQ8 A;  4AKL A;  5BU5 A;  3ONX A;  1Q9F A;  3GHG B;  5GON E;  5JDG A;  1AVO A;  3IN6 A;  2UXD T;  2VVN A;  2JMM A;  2H3R A;  5LP6 E;  3FGA D;  2MJZ A;  1N8R Q;  1RHZ B;  1AV1 A;  2E76 B;  1U7M A;  5GTI H;  3MZK B;  3OPC A;  1FDO A;  3ANW B;  3L72 G;  2W27 A;  1BT9 A;  3RIF A;  3ZYM A;  1PV3 A;  3KV9 A;  2OYI C;  2OA5 A;  2POH A;  5H6Q B;  3RGU A;  1EQ7 A;  1Q86 Q;  1W0A A;  3K19 A;  5L3E B;  1DH3 A;  2CLY B;  5CA0 E;  1YQ4 A;  1LTJ B;  4PV1 B;  5FXX A;  4U7Y A;  1M90 Q;  1OVV A;  3M91 A;  2C9L Y;  4FSP A;  1GL2 D;  2R4O A;  4GCP A;  3MP7 B;  1HTJ F;  3ZMV B;  2K3R A;  5LHI B;  4ZI2 D;  1MIY A;  3EMN X;  1LT9 B;  3CI9 A;  3P4R A;  3E1R A;  4W80 A;  3Q5S A;  2MKV A;  3NWI A;  2CLY C;  2BS4 A;  3AE6 C;  2Y0K A;  1L4A D;  3KBU A;  2LSI A;  4QXC B;  1D7M A;  2EHO B;  2CPB A;  3NRY A;  3AB3 B;  2ACZ A;  3VTP C;  3UUB A;  3SFD A;  1SQX D;  3G9R A;  3EQ2 A;  5AQL B;  3UFG A;  4EXT A;  2W2U A;  3FZK B;  3NKZ A;  3OAK A;  2WAU A;  2R4N A;  1SQQ G;  1UGO A;  3A8Y C;  3PV0 F;  3ONJ A;  4WY4 B;  4NXN T;  4FRX A;  4X66 T;  5AVV B;  2KNC B;  1H0T A;  2PBI A;  2RA1 A;  4QXH B;  3H1H J;  1BGY J;  2QA4 P;  3UU5 A;  3CVR A;  3Q2M A;  4E7Z A;  3A0H O;  5LYJ E;  1P84 H;  3VMA A;  2QEX P;  3AE1 C;  1IO4 A;  1SQB G;  1OW8 A;  2HR3 A;  4IDQ A;  5JR9 A;  3N9P A;  2BVL A;  3AAA B;  3VMY A;  3UUL A;  1JUN A;  3H1I D;  2Y9Z A;  4WNK A;  2XTR A;  1T6A A;  3PHL A;  4OGQ D;  2LRL A;  2M6B A;  4Z8X A;  1SS1 A;  3B5N B;  3JC2 2;  3HA4 A;  3ZN1 B;  4WW0 A;  1GL2 C;  1NAY A;  4KI0 F;  5CB4 E;  1KNP A;  4A7P A;  4UB6 O;  3L73 G;  3CX5 I;  4DOJ A;  3ZT7 A;  3IEE A;  4OWF A;  5AW0 B;  3NFQ A;  1E2A A;  2F4V T;  5ETW A;  1RF1 C;  1MMA A;  2XQ9 A;  1SQQ J;  3GF7 A;  1OMI A;  3AE8 A;  4AYE C;  1U4Q A;  2Y0D A;  3LK3 B;  1ZP0 A;  3V5B A;  1EZ3 A;  5KKZ C;  2M8R A;  4EI2 A;  2K48 A;  5LGT B;  3HKE E;  2F1V A;  3UUX B;  2NR4 A;  3V2N A;  4EYY R;  4YHH T;  4AKH A;  1L4A B;  2HN2 A;  4N6J A;  1LWU B;  4ILC A;  4DR3 T;  3H1L D;  1HX1 B;  3L39 A;  2GA1 A;  4C7N A;  2YPV A;  2XG6 A;  4I2L C;  3HD7 B;  3CX5 E;  3VP9 A;  1URQ A;  2CM0 A;  3UU6 A;  5LBM A;  1VDF A;  1FJP A;  1FZE A;  4FQE A;  2E2A A;  5AQS B;  2JKV A;  1T16 A;  3CC7 P;  4KUM B;  2O1J A;  1L0N J;  3OBV E;  4OGQ C;  1GK4 A;  1KYO D;  4DR1 T;  1M7L A;  5BR8 T;  1P4T A;  1KMI Z;  2NPS A;  2HPL A;  3PU8 A;  4PD4 E;  1SQX K;  3CXH I;  3VMZ A;  5LG4 A;  3U78 A;  3SY7 A;  1OSM A;  2GM4 A;  4KMC A;  2XTL A;  1GFQ A;  1JY3 P;  1KC8 Q;  4JCH A;  3IBP A;  4PFP A;  4IIJ E;  3WAJ A;  5L3C B;  2WSE H;  5EFW B;  2PGD A;  2KXP A;  1FZC A;  2XHE B;  1KYO H;  4M1P A;  5KLV K;  3TGU E;  5LHH B;  1SFC D;  3M0D A;  2OTK E;  1HXT A;  3RKO A;  1SQB E;  3GWH A;  3AE2 A;  2A9U A;  2N2L A;  3U1C A;  4GDO A;  1ZHY A;  3P4P A;  5JDN A;  1ZHZ A;  4YJ2 E;  4BRY B;  2M3E A;  2K9A A;  2VK9 A;  2V26 A;  5JR9 C;  2QRX A;  3GHG A;  2Z6E A;  1N73 A;  3TZG A;  3AE1 A;  1NTZ G;  3L70 J;  1HS7 A;  1N32 T;  2J1D G;  2B87 B;  2XAG B;  5CJ4 A;  4NUU A;  1S5L E;  1X9V A;  1VQ5 P;  3AEE A;  3DTO A;  3AE3 A;  2DHR A;  3HL6 A;  3S4U A;  3H1K E;  4COF A;  1USE A;  4O4I E;  1MZ9 A;  4FJO A;  4GCS A;  5G3A A;  1YD8 G;  4OFZ A;  3Q2Y A;  2Q9Q A;  2WB5 A;  4BAY B;  3HD7 C;  1NU1 E;  3B13 A;  1QJ9 A;  1W0B A;  1SQV E;  3GG2 A;  5ADX L;  1KIL A;  4FSO A;  3LK4 1;  2RMZ A;  3BCC G;  1KEY A;  1BGY G;  4MFR A;  2UXN B;  3AEB A;  3PDY A;  3DA4 A;  1PGO A;  1R5L A;  3NMD A;  2YO3 A;  2YEV C;  1PGJ A;  4ILB A;  2G0U A;  1JB0 J;  3AE9 C;  1VQL P;  4EOT A;  4WYV A;  4H9S E;  4U3F J;  1QEX A;  5HXS A;  3ZCJ A;  1SQX J;  4DV4 T;  3L72 D;  2N1T A;  4DMV A;  4D6T D;  3FWL A;  4UB8 E;  1LT1 A;  5CA1 E;  3PUY F;  3N9O A;  3UUN A;  4MAL A;  3MIW A;  3L09 A;  4ILU A;  1M1J B;  1LKX A;  3RIA A;  2A45 H;  3AA7 B;  4FUV A;  5CJ0 A;  5APS A;  1FOS F;  4GYS A;  2BKP A;  1KB9 D;  3M9H A;  2C0S A;  1IZN B;  2OTL P;  2V5C A;  4GKK T;  4G75 A;  4LF5 T;  5FVL A;  3AAE A;  4ZNC A;  5AW4 B;  1ZHT A;  4DV0 T;  3ZSS A;  1W2E A;  4C91 A;  5JH7 E;  1LGH B;  3PRJ A;  3Q5R A;  4JEH B;  2ERV A;  2OYH B;  1PP9 E;  2KWH A;  3HD7 D;  2L91 A;  4RO0 A;  5JDM A;  2IFN A;  3AVS A;  3A0B O;  1NTK K;  5KXJ A;  1BE3 J;  4PW8 A;  4C7R A;  4CPG A;  1D1B A;  5IUX A;  4O3Z A;  1KQS O;  4HB1 A;  4D6T J;  5KLV D;  1GFN A;  2K0L A;  2KK7 A;  3P7K A;  1ZV4 X;  4U3F D;  3H1H D;  3HUS C;  4Z91 A;  4PD4 D;  4ASW A;  3FBL A;  2FUP A;  3HTK B;  2KWI B;  2WM9 A;  2M6I A;  5JTG A;  2PFV A;  4AQF A;  5FL0 A;  1GFM A;  3VZT X;  2A06 D;  3G06 A;  3CD6 P;  4N78 E;  4LMK A;  3KBT A;  3K3O A;  4PK6 A;  3RIU C;  3QRA A;  5H2F E;  3AE9 A;  3L70 G;  1JO5 A;  2BCC G;  2M0B A;  3HKC E;  2X9K A;  1AFO A;  5DQV A;  3CC4 P;  1HF8 A;  4ZHQ E;  2IPP A;  3IF8 B;  4JYC A;  4OGQ B;  2J59 M;  2IIU A;  2W66 A;  3GN5 B;  3CCV P;  1N7S D;  1WCR A;  4HH2 A;  3L74 E;  3AEB C;  4B61 A;  1FDM A;  4I7Z C;  3TDK A;  3SY9 A;  3L75 G;  3E1I A;  5APY A;  1LWU A;  4H13 D;  3L75 J;  4GCQ A;  3L70 D;  1T7S A;  1KIL C;  2MOZ A;  3A2S X;  1ZR2 A;  3H1L J;  1Y47 A;  4QH1 A;  4AI6 A;  2OQQ A;  3PQS A;  2KIK A;  3HD7 A;  3N4X A;  4JI7 T;  1HFA A;  2QE7 H;  4MN4 C;  4FZM A;  1ZV8 A;  3GP6 A;  2W6B A;  2K9Y A;  4P09 A;  2CXD A;  1XDO A;  3WUT A;  5E79 H;  1X79 A;  2C0W A;  5AQG B;  2MNH A;  3ZT6 A;  1JMB A;  3CWB J;  4GOE A;  1MFZ A;  3OW2 O;  3CCE P;  3RQW A;  2ZM0 A;  3MD0 A;  3Q9D A;  2GK9 A;  2YKO A;  4DBQ A;  3O0E A;  3TKL B;  2CWY A;  1FZF A;  4DBR A;  4U72 A;  2I8D A;  4KJM A;  3NBX X;  3HKB E;  5FNV E;  1I6Z A;  1HXX A;  1OIP A;  3B57 A;  1UII A;  3AA0 A;  2YMY A;  2HFE D;  3HRN A;  2UUB T;  3GW6 A;  2H88 C;  4LF9 T;  2DW3 A;  4TNV A;  1NU1 J;  3D6Y A;  4J2C A;  3WAK A;  2C5J A;  1JEK A;  2JJL A;  3CL3 D;  1L0N D;  2ZT9 B;  5CCH A;  2ZT9 D;  1R5S A;  4O4U A;  3B4S A;  5L2L A;  2YKS A;  3PTR B;  4B3S T;  2IHR 1;  2ZYD A;  2PAJ A;  1K05 A;  2XTQ A;  1HWT C;  4PV1 D;  1J1E C;  3VMX A;  5BU8 B;  2IBZ I;  2V1D B;  1JY3 O;  3Q5P A;  3LJC A;  2X9H A;  4CN1 A;  2K24 A;  5LXT E;  2BS2 A;  2LXC B;  2E5T A;  1UX5 A;  4HFE A;  4JEU B;  2I6H A;  4MBQ A;  3H37 A;  4LSF A;  1Q2N A;  1NU1 K;  1WT6 A;  3WU2 E;  3ZMU B;  2NZ2 A;  4W7Z A;  2XAS B;  4HKZ H;  2YDR A;  5GTI O;  3WU2 O;  2K9J B;  3HWB A;  3I1A A;  2E74 B;  2FXM A;  3AEG A;  5HXR A;  4OYK A;  5ABH A;  4ZS2 A;  2KC0 A;  5CCH C;  1NTM G;  1EXJ A;  3OJA A;  4CN6 A;  4ZI3 D;  5IYU A;  3LW5 J;  1HUC A;  2YDQ A;  5JVD E;  4UB8 O;  4AQF C;  4AFK A;  1QSD A;  3KZI O;  1Y64 B;  2E9X B;  3VY8 X;  3KQG A;  1BCC G;  3A3Y B;  1T1L A;  5AW7 B;  1OW6 A;  2FYZ A;  4PUX A;  2BZB A;  2ZAE B;  2M67 A;  4GKJ T;  2KLV A;  1FDI A;  1YJ9 P;  2WPS A;  2CA5 A;  4F6R C;  3WI4 A;  3CCQ P;  1YQ3 C;  2HOD A;  3VE1 A;  4Q25 A;  1Y01 A;  2A3D A;  2PRR A;  2E75 D;  2OAR A;  1UUS A;  4YTM A;  5AFU L;  1ZW0 A;  1MUU A;  1AJ3 A;  4HFV A;  1BGY D;  1OVU A;  1USD A;  2X0L B;  3H1L G;  4O4X A;  1T2K C;  1GK6 A;  1IFI A;  2BAS A;  4H44 D;  3CCM P;  5A1L A;  1M1J A;  5E0O A;  2R6G F;  1H88 A;  3DWO X;  1GTW A;  1T8B A;  2JWA A;  2YU2 A;  1SA0 E;  3ESL A;  4H0L B;  1WR6 A;  3JAF A;  4PJ0 H;  1SLQ A;  3JC6 D;  2FFD C;  4AYN A;  1ZRT E;  3HE4 B;  2FGQ X;  2AXT E;  1IFD A;  1ZHC A;  1AA0 A;  2YNY A;  2KZ7 A;  4HFH A;  1SQP G;  4LGD E;  5JDP A;  2OYH A;  1J1D C;  2LHR A;  3BAS A;  3ONL C;  2YK0 A;  5KTB A;  3B5N D;  1IBK T;  2UXX B;  4FT6 A;  1KZU B;  2FYU K;  1OED A;  3CXH H;  4U33 A;  1KV4 A;  1E7P A;  3JCU O;  4CXX A;  3PGU A;  3AED A;  5B66 H;  5B5E H;  3SWK A;  3CCS P;  3HUS A;  4UB6 E;  4Z1M H;  5DL8 A;  2WPR A;  4E1T A;  2LXB A;  5B66 O;  3AE6 A;  4GOU A;  1VF5 D;  1KYO I;  1RE4 A;  4K0K T;  1QGK B;  3L71 G;  2W63 A;  4I4T E;  5CJ5 A;  5JRE A;  3QK6 A;  1X8Y A;  2QIW A;  2WZI A;  2UWJ E;  1K9M Q;  4U9C A;  5FYM A;  1GZL A;  3CWB G;  5KJ7 A;  1JMM A;  2WMN A;  2W81 C;  3BVH A;  2E75 C;  3LK4 2;  2QJY C;  2MHL A;  4GOD A;  4N75 A;  3LK2 A;  5FY1 A;  2FYU G;  4IL9 A;  4CQI A;  4DID B;  1M56 D;  2KIN B;  2XAQ B;  3QUJ A;  4UIG A;  3DWN A;  2Y9Y A;  1S72 P;  4ERR A;  2NTX A;  1W9R A;  3V2P A;  1MIV A;  4PJ0 O;  2V5D A;  1PP9 D;  3FBZ A;  4D6T E;  4DV1 T;  5FKY A;  1FMW A;  3RH3 A;  2I1K A;  4ZZC A;  3CML A;  4FZL A;  1ZEE A;  4HYT B;  1QJP A;  2P10 A;  1V9D A;  1YXR A;  1Q7Y Q;  5LOV E;  1XZY A;  4EB6 E;  3BCC D;  5B5E E;  2C0X A;  1PP9 G;  3V6I A;  1GQE A;  3KDS E;  2WDV A;  1ZHX A;  5LG3 A;  2IFM A;  5HYA A;  1A02 F;  4TN7 B;  1HX8 A;  5CCG C;  1OPF A;  1VQ8 P;  4CZZ B;  2V7J A;  3P8C D;  2Y48 B;  3H3A A;  1THQ A;  3DJB A;  4GIW A;  5BMV E;  4GF4 A;  3UAQ A;  3L74 J;  3T0S A;  1VF5 C;  5C8Y E;  4H0L C;  2A2F X;  3PP5 A;  1SFC B;  4L74 A;  5AQN B;  4NIQ A;  3O6Q B;  4CI1 B;  5AW9 B;  5TJH A;  1S94 A;  2I1J A;  3WI3 A;  1GW4 A;  4TLF A;  4GOF A;  1CI6 A;  2WIT A;  1NTK G;  2BCC E;  1KD1 Q;  2WU5 A;  1X22 A;  3MZW B;  1BR2 A;  4DO0 A;  1AJY A;  3N5L A;  5HEG A;  5E79 O;  1AQT A;  2CCQ A;  2JRK A;  5DQW A;  2ODU A;  3VHL A;  4EZ4 A;  4JFB A;  2G8Y A;  4JI4 T;  1VF5 B;  4NUV A;  4UXN B;  3IFM A;  5D5D A;  4OVN F;  3L75 E;  4GK0 E;  3BRY A;  1L0N E;  1UIX A;  1KF6 A;  3T97 B;  4ISS A;  2KMF A;  2V6Y B;  5HEJ A;  2Q6Q A;  3AA6 A;  3AE2 C;  2O01 J;  4H9P C;  1OXZ A;  3AEC C;  4HWF A;  2ZXE B;  3H6P A;  5GV0 A;  2LOP A;  3A0H H;  3IA3 A;  2UXC T;  5DAB A;  3CWB E;  4JLE A;  3S1K A;  4K3B A;  1CSB A;  4B6X A;  3H1J E;  4IDP A;  3VR9 A;  3F31 A;  5ABE A;  4EEB A;  4GYR A;  4QQ1 A;  3VRA A;  1M62 A;  1QUU A;  1BH3 A;  2JQY A;  2KOG A;  5FXW A;  4LF7 T;  1RF0 C;  3Q5D A;  5AQQ B;  4N59 A;  3C1L A;  1SQX G;  2H89 C;  2X51 A;  1N33 T;  3FXE B;  3BRZ A;  5KKZ B;  4UR9 A;  2BBJ A;  2AXT O;  4PNI A;  2JPF A;  1SQV J;  2JJ9 A;  5AQF B;  1GFP A;  4R4L A;  3V4Q A;  2BG9 B;  4WVZ A;  4UVC B;  4KHP T;  2FXP A;  4DMW A;  4JBZ A;  1NTZ J;  1M57 D;  1PGP A;  5AW8 B;  2LOS A;  2LRK A;  2H7O A;  2V7L A;  4N58 A;  4ZS3 A;  4H63 H;  4EDF A;  4HWD A;  4JYB A;  2AE9 A;  2F1T A;  5LMU T;  3HOE A;  3Q5E A;  4TT3 H;  1LTI C;  4IL4 A;  3J7Y q;  2KND A;  4H9O C;  1P84 D;  1MIW A;  3KV4 A;  4DUZ T;  2A06 E;  3OJA B;  2VKO A;  3H1J D;  1D0Y A;  2V6X A;  1NVO A;  1L0N K;  2XSB A;  1LJ2 A;  4G63 A;  4TWF A;  2VKD A;  3H1K D;  1OW7 A;  4C4V A;  4WWI A;  1EZV D;  3MXZ A;  2NW9 A;  4YY3 T;  4K35 A;  3PUX F;  4YTN A;  4YXD C;  4ILA A;  2YU1 A;  4U3F E;  5AW6 B;  1FU1 A;  3TYY A;  1H0T B;  1MV8 A;  2K37 A;  3KV5 A;  1LP1 A;  4YT0 A;  3ZCI A;  4H44 C;  1HBW A;  1FZG A;  3E08 A;  4WY4 D;  1S5L H;  5TIS O;  1L0N G;  2O01 H;  1VOM A;  2DWK A;  2EHO A;  2IBZ G;  4DV6 T;  2MPK A;  4RJT A;  3OVU A;  2AXC A;  2W80 C;  2RH0 A;  2OYI A;  3M06 A;  1NGM B;  3O1H A;  3P4Q A;  5GTI E;  1Z0P A;  2XZR A;  3ABV A;  5KLI B;  2NWB A;  4IFM A;  4OHF A;  5AQO B;  4BJM A;  3PJS K;  3VU7 H;  1PGQ A;  2B9B A;  1L0L J;  8PRN A;  3RX6 A;  3CCR P;  2PFX A;  1G1I A;  4DND A;  4HFC A;  3AE4 C;  2HPC B;  1KB9 I;  4WY4 A;  1MND A;  3M65 A;  4DV3 T;  6PRN A;  4FES A;  1QLE D;  3M9B A;  3R2P A;  2N2M A;  3L3P A;  3RYH E;  2ZM2 A;  3QNU A;  2FBW C;  5ABF B;  4D65 A;  2VQF T;  1HVV A;  3L72 E;  2N1T D;  3A5T A;  2CE7 A;  4TUY E;  5L3F B;  3VKH A;  2XE1 A;  4PJL A;  1X0T A;  2W90 A;  2E8I A;  4AYC A;  1JNZ A;  3LG7 A;  3R6N A;  3E0Z A;  4O2B E;  4UV9 B;  1G73 A;  3II6 A;  1NEN A;  5C39 A;  3D6Z A;  4AXP A;  3O9X A;  1VQK P;  2WMM A;  4I50 E;  4GKG A;  1S3J A;  2WTY A;  2LLY A;  1Q81 Q;  3QB5 A;  2KZI A;  3RQU A;  2O1K A;  4YTP C;  1NO4 A;  2M3B A;  4UF0 B;  1L0L K;  5B66 E;  1ZKE A;  2KUB A;  4HFB A;  3PF1 A;  2E76 C;  4WZX A;  4XE5 B;  2GE4 A;  2XMX A;  5F3J A;  2L5G B;  4UB6 H;  1SQP E;  1IJ5 A;  2DWG A;  1GW3 A;  4JV5 T;  4PJJ A;  5GTH H;  3RRW A;  4AQG A;  1Q9G A;  4BWN A;  2MAW A;  5APX A;  4IE0 A;  4EZH A;  1PHO A;  2A72 A;  1SQV G;  3CK6 A;  3CWZ B;  1YQ4 C;  2VRS A;  2HHH T;  2KLQ A;  5FY7 A;  1SFC A;  3U3I A;  2IWW A;  3L73 J;  4PJN A;  2XND H;  1FE6 A;  3K1S A;  2WWU A;  3D71 A;  3CCJ P;  3LFM A;  4QKN A;  2R5B A;  5APT A;  5HXC A;  1DU2 A;  5B5E O;  5APQ A;  5J0Z A;  2VVS A;  2ZM6 T;  4V1A v;  2D0U A;  1H89 A;  2XSA A;  2XQ4 A;  5EK4 A;  1HTL C;  5CBO A;  2KI7 B;  2WZH A;  1N86 A;  5AVW B;  1Y9B A;  5CCG D;  4TNW A;  1JY2 P;  2E5V A;  1KQF B;  1WFD A;  4CI2 B;  4U7I A;  2JQ9 A;  4O4H E;  3K5B A;  4C7N B;  4U3C A;  4LF8 T;  3I0O A;  2XQY A;  4AKR A;  1JCD A;  1S1C X;  3ZEF B;  2E43 A;  2CWO A;  3ZDM A;  3AEF A;  3T97 A;  1RH5 B;  3BAT A;  3M9Q A;  5AQI B;  4E7S A;  1S35 A;  4LMJ A;  3WU2 H;  3QB5 K;  1NTZ K;  5EE2 A;  1R8I A;  4JI2 T;  3RBH A;  5AVY B;  3F5H A;  2KS1 B;  2Q3E A;  4XZC A;  3MA9 A;  3Q1M A;  4RL9 A;  1NAF A;  1VQ9 P;  2XPK A;  4D64 A;  3NXS A;  1BCC E;  4JI0 T;  1PPJ D;  3UTK A;  1GFO A;  1OZH A;  2WT7 B;  1SE7 A;  5TIS H;  1KYO E;  1QVF O;  3AEA C;  4OK0 A;  1D0Z A;  3EWK A;  2XNX A;  1P84 E;  3B5N A;  3PU3 A;  2R88 A;  3UU8 A;  3CKD A;  4TV8 E;  3BQI A;  4OH8 B;  4NPE A;  2DI4 A;  4X62 T;  3AEG C;  5APW A;  3PUW F;  2XQ5 A;  4EYY Q;  3RK2 D;  4UVB B;  1XMO T;  1XTC C;  1LTT C;  1KIL B;  1URQ D;  2H7H A;  4OYJ A;  3H1I G;  3GA8 A;  3IR9 A;  1HGV A;  1JNM A;  4IT4 A;  5EK2 A;  2F1C X;  3CX5 H;  4I7Z B;  4IL6 X;  5KLV E;  2BVM A;  2E9X D;  1FZA A;  2J47 A;  4Y28 J;  3AA1 A;  1WR0 A;  1LTG C;  3BCC J;  5HEO A;  2V7K A;  3I5C A;  5GTH E;  3V2R A;  2IBZ D;  4AYI D;  1JM0 A;  1JTH B;  1NTK E;  5AQM B;  1E54 A;  2D9D A;  5KAF O;  4HN9 A;  1RE3 C;  2DNX A;  4QXB B;  1T2K D;  3N9N A;  5FL1 A;  4F4B A;  1KTM A;  5AQU B;  5F5W A;  2H88 A;  1FJG T;  2ZMA A;  4IL6 O;  3H25 A;  5L3B B;  1IC2 A;  5CFB A;  1HG2 A;  4H44 B;  1YKE B;  2R89 A;  2BKO A;  3MK7 C;  1JCC A;  1PPJ G;  2E42 A;  2LM2 A;  2W0G A;  4HFI A;  5AW1 B;  5CHX A;  1UX4 A;  1UK5 A;  4HE8 A;  3G3Z A;  1LVF A;  2J5U A;  1NTM K;  2EHO D;  3LK3 A;  3H1J J;  3M0A A;  2W61 A;  5EK3 A;  2OMF A;  4XNL A;  3CQG B;  5AQV B;  3L75 D;  2NOX A;  4IE5 A;  1O3X A;  4IE7 A;  2YKP A;  4CXW A;  3C64 A;  1Z8U A;  4ZEY A;  2FFD A;  1YIJ P;  2Z4E A;  4YJ3 E;  2K1A A;  4XAX B;  3Q5W A;  5IHY A;  4NXM T;  3ZYK A;  1WLX A;  5FXV A;  1OWA A;  1T72 A;  2VL0 A;  3EHZ A;  4D6T G;  3L71 D;  1HXU A;  4TWD A;  3HTK A;  1M1K Q;  1NTM D;  4H9R C;  4DCK A;  1LWU C;  2OGU A;  5JRC A;  3AA7 A;  2UXB T;  1L4A C;  2WU2 A;  4BRY A;  1KK7 A;  2KLU A;  4HKA A;  3C5O A;  3HE5 A;  1VQP P;  2D0T A;  3POU A;  2HH7 A;  1E79 H;  1KQL A;  2FY8 A;  3H3M A;  2UU9 T;  4U2Z A;  3L73 E;  4KBM B;  4EV6 A;  3POX A;  3AXJ A;  3M3Z B;  2O01 N;  2V7I A;  5JDH A;  2QYW A;  1EDJ A;  2C5K T;  3UU3 A;  2OLT A;  5ABF A;  1IAP A;  1IK9 A;  4UF0 A;  2VKJ A;  1FZB A;  3VOP A;  4LSH A;  1VQO P;  3I9Y A;  3SOL A;  4M3L A;  4DZO A;  3SS1 A;  2KSR A;  4O9B A;  5G39 A;  3G4S P;  4YPC A;  3TLW A;  4O2A E;  4QHO A;  4WBO A;  3LBX A;  5HEU A;  2M5A A;  4QH4 A;  2NRG A;  1IBM T;  4HJG H;  2JO1 A;  2BEQ D;  5L3G B;  3NJT A;  1RE3 A;  2MBG A;  1YYC A;  4N3Y B;  1EZV E;  2JQQ A;  4LFB T;  4NPF X;  3PUS A;  1KIL E;  2ACX A;  1KNR A;  4TWH A;  4H0L D;  2XM2 A;  5JDL A;  3IHR A;  4R4M A;  5HAX A;  4YSX A;  4AIS A;  3L72 J;  5HCM A;  2C9N Y;  4LF6 T;  1BXW A;  1S5L O;  4DR7 T;  1L0V A;  1IK7 A;  5ABG A;  4FOZ A;  2BEZ F;  1H7C A;  2XV5 A;  2XE3 A;  2WY2 A;  4I55 E;  1DD3 A;  2KP8 A;  5FY0 A;  3JCF A;  2WWV A;  2WJR A;  2HYN A;  2LKH A;  1AVY A;  1GMJ A;  2IUB A;  1XMQ T;  5AVS B;  1VRB A;  1LTB C;  2L8K A;  4EOZ B;  5KAF H;  3RYF E;  5J1G A;  2QM8 A;  3H1J G;  3N9M A;  4AKR B;  4JI6 T;  2D2C C;  1MKM A;  2FYU D;  3AEA A;  3H1K G;  3H1L E;  2I59 A;  3DA3 A;  2CRB A;  2CMR A;  1UUR A;  1IBL T;  1NJI Q;  1LTJ C;  5F8P A;  4UEM A;  3JTY A;  3D0T A;  3OYX A;  1WRD A;  1JY2 N;  2WT7 A;  5DJU B;  4W7Y A;  1ZR4 A;  2BCC J;  3NSG A;  4O3X B;  5AVZ B;  4LSE A;  2JEE A;  3SWY A;  1XDP A;  2LSG A;  3PUQ A;  3H1H E;  2AEJ A;  3EFG A;  3USS A;  3VYI A;  3AEE C;  2CBJ A;  3RF1 A;  1B7T A;  5G26 A;  1G8X A;  3K8P C;  2BDE A;  2E74 C;  2IC9 A;  1NU1 G;  5FP3 A;  2RN0 A;  1YS5 A;  4K3C A;  1N73 C;  2LSJ A;  2GUV A;  2Z5H A;  3GHG C;  2AXD S;  3JSV C;  1N7L A;  1DIP A;  3P32 A;  2A06 G;  1YHQ P;  2CHN A;  2R32 A;  4PK4 A;  4KHZ F;  1SQP D;  1WYB A;  2YIU C;  1SQQ E;  5AVT B;  2J1N A;  3BS0 A;  3C98 B;  2QM7 A;  3NZQ A;  2V4H A;  1MMG A;  4JI8 T;  2ZFG A;  4P0A A;  2XE2 A;  2YDS A;  1GL2 B;  2XKM A;  3B5N C;  4PFO A;  5C2T A;  3AE5 C;  2IW5 B;  4I0U A;  1YIT P;  3I56 P;  2W62 A;  1Q82 Q;  4YXW H;  3N2O A;  2WVR A;  4LC1 A;  3RHW A;  1D1C A;  4C90 A;  3CCU P;  2NPS C;  3UFE A;  4AZL A;  2BS3 A;  5H2F O;  3HKD E;  1N36 T;  1PL5 A;  4EAH A;  5APV A;  5L4E A;  2PP6 A;  2W6A A;  3KIN B;  5KAF E;  2Y8D A;  3KZI H;  4PD4 I;  3RPU A;  3DP7 A;  2FBW A;  5KAI E;  1WRG A;  4XFJ A;  4E1S A;  4A97 A;  3VKG A;  5GTH O;  1LTA C;  3CX5 D;  3RYI E;  4WY4 C;  3K3N A;  3HR0 A;  4EIJ A;  1YI2 P;  4DUY T;  1NKN A;  2R44 A;  3O4X E;  1LT9 A;  1NTK J;  1QX8 A;  1SQQ D;  3KDP B;  3AAA A;  2R5D A;  2ODJ A;  4IDZ A;  3SWH A;  3IF4 A;  1NH4 A;  4IGU A;  5M4Y A;  2QVA A;  5KLV J;  2IDB A;  3VRB A;  1KFN A;  3PRN A;  3FXD B;  1FAV A;  4X65 T;  5KLV G;  4EIW A;  2XE5 A;  3L74 G;  1HF9 A;  4FI5 A;  2WS3 A;  2EHO C;  3ZMT B;  3AE8 C;  3W68 A;  2QG4 A;  5AW2 B;  1SQV K;  4HWC A;  1G1J A;  2W67 A;  1P84 I;  3WI5 A;  3H1I J;  4C69 X;  4N74 A;  4PV1 C;  1FEW A;  3JAD A;  2KZJ A;  1K04 A;  3G7G A;  2D2C B;  3RI5 A;  3TGU G;  2Q1K A;  1XNR T;  1YTZ T;  1EDL A;  5KLI C;  4XNK A;  3OTO T;  4CXY A;  2LHF A;  5JQG E;  1K73 Q;  4L9I A;  2WQY C;  3IAO A;  1L4A A;  5LB7 B;  2ZYG A;  2YOE A;  5DL5 A;  1NTK D;  1N7S A;  2M06 A;  1IFN A;  1VL2 A;  2H8P D;  4NPP A;  2E5Y A;  4P1N A;  3KVA A;  1GD2 E;  1VPC A;  3HUS B;  2E9X A;  3OA7 A;  2Q7C A;  1HGZ A;  3MKD A;  5L47 A;  2E76 D;  2V7M A;  2M5A B;  1J2J B;  4FRT A;  3AE4 A;  3AE3 C;  5G38 A;  5JRC B;  2ITA A;  2JQH A;  4HTE A;  1JOC A;  3ZC0 A;  3JCU E;  4RKU J;  3RRC A;  4RJX A;  4LF4 T;  3L71 J;  1VCT A;  4HWH A;  4QX8 B;  1BCC D;  2WSC H;  2BG9 E;  3KV6 A;  1SQX E;  3TNU B;  4C00 A;  1H8A A;  3UU4 A;  1PRN A;  1BGY E;  1NU1 D;  2QGS A;  2W8Z A;  4DT0 A;  2N9Y B;  1HNZ T;  2C5I T;  2H7V C;  2NW7 A;  1QL1 A;  2HPJ A;  3RBZ A;  2J4G A;  3FYX A;  2SPC A;  1W5C E;  4X1I E;  4TX5 A;  1J1J A;  1CI6 B;  1SQP J;  2AEM A;  2XU6 A;  4H13 C;  3JAE A;  2ZLY A;  1CW5 A;  1YBK A;  4YXD A;  3L4F A;  2FJD A;  3NRX A;  2WSC J;  1N34 T;  2NP9 A;  5KX5 E;  2ZVN B;  4L76 A;  3EDU A;  4DV7 T;  1ZOY C;  3SSU A;  1N73 B;  5LNK A;  5BVZ A;  2HOD B;  4DV5 T;  3UUM A;  3P4S A;  2V6Y A;  1N2D C;  3CC2 P;  2V7Q J;  1YJN P;  3B8E B;  3C50 A;  3DZM A;  2DCF A;  2PG8 A;  2BCC D;  5M1B A;  5AW5 B;  1UCU A;  3RL0 B;  2P67 A;  1L2P A;  2QJP B;  3LSV A;  3CMA P;  4I1L A;  2HLO A;  3O6Q A;  4YHJ A;  2A45 G;  4Y99 B;  2XY8 B;  3B5M A;  5AQK B;  2XAF B;  1BSN A;  3SRZ A;  1BE3 E;  3EAM A;  4GT1 A;  2KNC A;  4QMA A;  3PLN A;  1KNZ A;  2HG5 D;  4B3R T;  4ZI2 C;  2WSS V;  1DD4 A;  1E1H B;  3S4R A;  2L3L A;  2IML A;  4L0R A;  1RQV A;  2LT3 A;  3EI0 A;  5HCJ A;  3A7M A;  3WMM 0;  4ANJ A;  2YXR B;  1HR0 T;  2VB6 A;  3SWF A;  7PRN A;  3VP8 A;  1RF1 A;  2VKH A;  3ZJ1 A;  1HNW T;  2IDO B;  2X27 X;  1CZQ A;  5AVQ B;  1T3U A;  2ZFC A;  4AQR D;  2YNK A;  4YSY A;  2E74 D;  2B89 A;  3SYS A;  3RK3 E;  5AQJ B;  3W15 B;  1JY3 N;  1LTS C;  4PJ0 E;  5T5F A;  1GL2 A;  3AEC A;  3CCL P;  2XM1 A;  1BE3 D;  3ETV A;  2Y2X A;  1IZN A;  3CLQ A;  3RKG A;  4LFC T;  5KAI H;  3LK2 B;  2R3C A;  4AKG A;  4JI1 T;  1LNQ A;  1CUN A;  2W6J H;  2ZJS E;  3BCC E;  1BSH A;  1GDT A;  1SQB D;  3SFE C;  3TGU J;  4IL6 H;  3CME P;  1G2C A;  4ZI3 C;  2Y0E A;  2POR A;  2QTK A;  4JBW F;  4IST A;  3N2G E;  3T1H T;  2JMK A;  3RGL A;  3V4W A;  2CXF A;  2RP4 A;  4L73 A;  4L75 A;  3D70 A;  1FZC B;  1RQU A;  2X68 A;  4KP3 C;  3C51 A;  4H9N C;  3VZU X;  3PJA A;  3MHV A;  3KYQ A;  2YN6 A;  4Y99 C;  1JNR A;  3NTN A;  3RL0 D;  2VL8 A;  2FYU J;  3L73 D;  1QLB A;  1RE4 C;  1X9B A;  3T24 A;  4PJM A;  2FXO A;  4ADZ A;  4ZOL E;  3Q5X A;  3A7O A;  3I9W A;  4JI5 T;  4BXL A;  3L36 A;  3UQ4 A;  4KRA A;  3RLF F;  1JY2 O;  3SFD C;  3FX0 A;  3RK3 D;  3ZYL A;  1H6S 1;  1US7 B;  3QH9 A;  2X0Y A;  3PGS A;  3UU2 A;  3KPE A;  2CHO A;  2VWA A;  1KB9 H;  1K8A Q;  3FZH B;  1OED C;  2WPQ A;  1KQG B;  3ZKR A;  3P8C E;  4DR2 T;  5CCG A;  3RC8 A;  3L71 E;  4FZN A;  1PIX A;  3TLS A;  4YLH A;  2QJY B;  3PJA J;  3FZM B;  4U7J A;  3GN5 A;  5HEH A;  5FVN A;  3A2A A;  4Z90 A;  4CI3 B;  2D5U A;  1EZV G;  1HJB A;  3KZI E;  3POR A;  1AQ5 A;  1CHU A;  3AE7 A;  1BE3 G;  3MTU E;  2LSY A;  1LP1 B;  5AQH B;  3C4X A;  3Q3D A;  2J62 A;  1M7K A;  2IC6 A;  2LE8 A;  3ABV C;  5H2F H;  1SUM B;  2LHN A;  2E5L T;  1IFM A;  3RL0 g;  2KT9 A;  3FHN A;  5EZY E;  1N7S C;  4L5G A;  2JDI H;  2DL1 A;  5AQT B;  4GHB A;  3UIA A;  1DEB A;  1ZOY A;  2NTY A;  1MMN A;  2Q9I A;  2WSF J;  1E5W A;  5AFU K;  2CBI A;  2LJL A;  3RC3 A;  2WP9 A;  5KJ7 C;  3BRT B;  1NEK A;  3I0Q A;  4CN4 A;  1KB9 E;  3F57 A;  4CTD A;  3LDQ B;  1LVK A;  2LFU A;  2WWW A;  4X20 E;  5LJM A;  3FWN A;  3BQK A;  2N1G A;  1L0L G;  3G71 P;  3AAI A;  3AA0 B;  3JC6 C;  1RY3 A;  1HH0 A;  5E79 E;  4I43 B;  5J2U E;  1S9K E;  5L3D B;  3KXD A;  4Z3T A;  2AEF A;  3C4Z A;  2KSE A;  2QJK C;  2XQ3 A;  1VQM P;  2K88 A; 
#chains in the Genus database with same CATH homology
 4QHO A;  4EXT A;  4WBO A;  4KR8 A;  4E1T A;  4IHJ E;  3AAE B;  3LBX A;  4GOU A;  5HWY A;  2WAU A;  3R84 B;  2W63 A;  4I4T E;  5JRE A;  3QK6 A;  4UVA B;  4BJN A;  3HW9 A;  4U9C A;  5FYM A;  5L3G B;  2W81 C;  4FRX A;  2WMN A;  2X9X A;  2MBG A;  3LK4 2;  2LEH A;  2MHL A;  2JQQ A;  2PBI A;  3POQ A;  2RA1 A;  4QXH B;  1HCI A;  3LK2 A;  2KDY A;  5FY1 A;  4CQI A;  2XAQ B;  2KIN B;  3CVR A;  3PUS A;  4IE6 A;  3Q2M A;  2ACX A;  3QUJ A;  4E7Z A;  4LSI A;  4UIG A;  3OYZ A;  5LYJ E;  3SZV A;  4ERR A;  2NTX A;  1ZHW A;  1MIV A;  5JDL A;  3IHR A;  4G76 A;  2E9X C;  2N9D A;  5HAX A;  3FBZ A;  5JR9 A;  3N9P A;  1BXW A;  2BVL A;  3AAA B;  3UUL A;  4FOZ A;  1H7C A;  2XE3 A;  1FMW A;  4I55 E;  3RH3 A;  3CML A;  4WNK A;  2XTR A;  5FY0 A;  1ZEE A;  4FZL A;  3PUR A;  1QJP A;  4Z8X A;  1V9D A;  2VAS A;  3HA4 A;  4JUY A;  3ZN1 B;  5LOV E;  4WW0 A;  4BA9 A;  4EB6 E;  3HI2 A;  3VZW X;  4AKM A;  2L8K A;  1VRB A;  5CB4 E;  3KDS E;  3PQU A;  4EOZ B;  3RYF E;  5J1G A;  3N9M A;  1ZHX A;  3IEE A;  5HYA A;  4AKR B;  4TN7 B;  1HX8 A;  2O4V A;  2I59 A;  3MAC A;  3DA3 A;  4IE4 A;  1OPF A;  4O4J E;  4CZZ B;  1LRZ A;  2V7J A;  2CMR A;  5ETW A;  1MMA A;  3P8C D;  2Y48 B;  5LCY A;  1MM5 A;  3H3A A;  3KVB A;  3AA1 B;  1THQ A;  3DJB A;  4AYE C;  1U4Q A;  4GK5 E;  4GIW A;  3LK3 B;  4K0U A;  5BMV E;  4GF4 A;  1EZ3 A;  3UAQ A;  3T0S A;  2K48 A;  5C8Y E;  5F8P A;  4UEM A;  4HGA A;  5LGT B;  3QRC A;  2J4U P;  1SHZ C;  3HKE E;  2F1V A;  3JTY A;  3UUX B;  3AVR A;  3D0T A;  4AYD C;  2A2F X;  4EYY R;  3OYX A;  4AYM C;  4AKH A;  1WRD A;  4CI1 B;  1T98 A;  4ASK A;  2ZLD A;  3UPG A;  1S94 A;  3WI3 A;  3NSG A;  4O3X B;  4LSE A;  2YPV A;  2LSG A;  2XG6 A;  2CXL A;  3ANW A;  3CX7 B;  3PUQ A;  1BR2 A;  4DO0 A;  3N5L A;  2CM0 A;  4UV8 B;  5LGN B;  5LBM A;  1B7T A;  2CCQ A;  2JRK A;  3EUH A;  2YIN A;  1G8X A;  3CQX C;  3K8P C;  5DQW A;  4ZI7 E;  5G26 A;  1MMD A;  2BDE A;  2IC9 A;  2ODU A;  5FP3 A;  3RYC E;  3VHL A;  4EZ4 A;  4JFB A;  3VY9 X;  4NUV A;  4UXN B;  1YS5 A;  5D5D A;  2LSJ A;  4GK0 E;  4KUM B;  4HEA A;  3OBV E;  2Y0H A;  3PUG A;  4ISS A;  2KMF A;  4PK4 A;  2QA7 A;  1WYB A;  3AA6 A;  2B1E A;  1P4T A;  2HPL A;  2N2N A;  3PU8 A;  4H9P C;  5JDQ A;  2J1N A;  1OXZ A;  3U78 A;  4N78 D;  5LG4 A;  1OSM A;  3SY7 A;  1FIO A;  3C98 B;  5GV0 A;  4KMC A;  2XTL A;  3SYB A;  3NZQ A;  1GFQ A;  1MMG A;  2LOP A;  4JCH A;  3IBP A;  2ZFG A;  4PFP A;  4P0A A;  4IIJ E;  5DAB A;  2XE2 A;  3WAJ A;  4JLE A;  3N9L A;  5L3C B;  5FXZ A;  4B6X A;  5J2T E;  2KXP A;  3F31 A;  1WYC A;  2PJQ A;  2XHE B;  4M1P A;  4GYR A;  4PFO A;  2IW5 B;  3V5U A;  1QUU A;  1BH3 A;  5LHH B;  4QQ1 A;  5FXW A;  2W62 A;  3N2O A;  4N59 A;  1HXT A;  1D1C A;  4MLK A;  3RKO A;  4C90 A;  4KR4 A;  1D1A A;  3UT5 E;  2JMH A;  3GWH A;  2N2L A;  2X51 A;  3UFE A;  4AZL A;  1BR1 A;  3FXE B;  1ZHY A;  5JDN A;  3HKD E;  1ZHZ A;  4EAH A;  4YJ2 E;  3T8O A;  2K9A A;  2VK9 A;  2PRN A;  2V26 A;  4PNI A;  2JPF A;  2JJ9 A;  3KIN B;  5JR9 C;  3ZN0 B;  1GFP A;  2Y8D A;  2Z6E A;  3RPU A;  5TAO A;  3TZG A;  3DP7 A;  3N9Q A;  5DL7 A;  4UVC B;  4E1S A;  3T20 A;  4X1K E;  4DMW A;  3VKG A;  1HS7 A;  2J1D G;  2XAG B;  2LOS A;  3RYI E;  4NUU A;  2H7O A;  4O3Y A;  2V7L A;  3K3N A;  3HR0 A;  4N58 A;  3DTO A;  3O4X E;  2DHR A;  4O49 A;  3HL6 A;  2NW8 A;  3S4U A;  4ZS3 A;  2WBL A;  3BK9 A;  4H63 H;  4O4I E;  3AAA A;  4FJO A;  2ODJ A;  4GCS A;  2F1T A;  3HOE A;  4IDZ A;  1YD8 G;  4OFZ A;  2Q9Q A;  3O1I A;  3SWH A;  4IGU A;  4BAY B;  5M4Y A;  5HXE A;  3PRN A;  3B13 A;  3FXD B;  5LA6 E;  1QJ9 A;  3J7Y q;  5ADX L;  4EIW A;  4FSO A;  3LK4 1;  2XE5 A;  2KND A;  1BR4 A;  3ETU A;  1MIW A;  3KV4 A;  4FI5 A;  4H9O C;  2VKO A;  2EHO C;  4MFR A;  2UXN B;  1D0Y A;  3ZMT B;  3CX8 B;  3PDY A;  4G63 A;  4WBN E;  3DA4 A;  3O1J A;  2VKD A;  2X9W A;  5LHG B;  2YEV C;  3MXZ A;  2NW9 A;  4QWN B;  3E22 E;  2X67 A;  3WI5 A;  2G0U A;  2YU1 A;  4H63 V;  4C69 X;  4H9S E;  5HXS A;  1FEW A;  3A5X A;  3ZCJ A;  4BUM X;  3KV5 A;  3G7G A;  4RJW A;  3ZCI A;  1MNE A;  4DMV A;  3MJX A;  5DL6 A;  2LM9 A;  4X1Y E;  4XNK A;  1IJ6 A;  4PAG A;  1BR0 A;  5CA1 E;  3UUN A;  3N9O A;  3E08 A;  4CXY A;  2LHF A;  5JQG E;  4L9I A;  4DVD A;  4MAL A;  5DL5 A;  1VOM A;  2DWK A;  2EHO A;  3L09 A;  4ILU A;  1LKX A;  2M06 A;  3F2E A;  3AA7 B;  2W80 C;  4FUV A;  3KVA A;  4GYS A;  3O1H A;  2C0S A;  1IZN B;  1Z0P A;  2E9X A;  4G2A A;  2NWB A;  4OHF A;  2Q9Q C;  5LGU B;  4G75 A;  3KFW X;  3MKD A;  4BJM A;  3LBX B;  2V7M A;  3VU7 H;  3AAE A;  3FB2 A;  1ZHT A;  8PRN A;  2L9Q A;  3RX6 A;  4TZ4 C;  4FRT A;  5JH7 E;  4C91 A;  5JRC B;  4DND A;  4JEH B;  2ERV A;  1MND A;  6PRN A;  3M65 A;  3P7I A;  2KWH A;  4HTE A;  2FGR A;  3ZC0 A;  4FES A;  5JDM A;  1NWM X;  3C4W A;  3AVS A;  3RRC A;  2N2M A;  4RJX A;  3L3P A;  4PW8 A;  2ZM2 A;  3RYH E;  4O3Z A;  1D1B A;  4D65 A;  2CE7 A;  3VKH A;  1GFN A;  4TUY E;  2K0L A;  5L3F B;  4O4L E;  3AA6 B;  4PJL A;  2XE1 A;  4QX8 B;  4O8S A;  2E8I A;  3LG7 A;  3R6N A;  3ZMS B;  3KV6 A;  3E0Z A;  4O2B E;  4UV9 B;  4MHC A;  5KDM C;  1ZV4 X;  1G73 A;  1PRN A;  3NZP A;  3O9X A;  4AXP A;  2QGS A;  3FBL A;  2KWI B;  2WM9 A;  4I50 E;  5KMG P;  2C5I T;  2DLR A;  2H7V C;  2PFV A;  5FMN A;  4AQF A;  2NW7 A;  2HPJ A;  4UF0 B;  2KXP B;  2ZM8 A;  1GFM A;  3FYX A;  2SPC A;  4X1I E;  2K5B B;  4TX5 A;  1ZKE A;  3ZC1 A;  3VZT X;  3KBT A;  1MPF A;  2GE4 A;  3BQL A;  3K3O A;  5F3J A;  2XMX A;  4PK6 A;  4O3W A;  3QRA A;  4EYU A;  4FMS A;  2ZLY A;  1IJ5 A;  2DWG A;  3KVD D;  4PJJ A;  3HKC E;  3RRW A;  4AQG A;  1Q9G A;  3J9X 1;  3NRX A;  5DQV A;  3K3Q C;  1HF8 A;  2NP9 A;  4IE0 A;  4ZHQ E;  4EZH A;  2KZ7 B;  3IF8 B;  5KX5 E;  2A72 A;  3CWZ B;  1PHO A;  1YW0 A;  1U5P A;  3GN5 B;  2MTQ A;  3EDU A;  2KLQ A;  4U74 A;  5FY7 A;  5JR9 B;  3ZPO A;  4B61 A;  3U3I A;  5LNK A;  4PJN A;  3SY9 A;  3UUM A;  2WWU A;  2X9Y A;  5HXH A;  3C50 A;  4GCQ A;  4QKN A;  2DCF A;  3LFM A;  1D0X A;  2MOZ A;  2PG8 A;  3A2S X;  5HXC A;  2Y7S A;  4AI6 A;  1UCU A;  3PQS A;  3ZMZ B;  4V1A v;  2D0U A;  4UEL A;  5ADX K;  5EK4 A;  4D5U A;  2ES0 A;  1HFA A;  4FZM A;  4YHJ A;  3PUA A;  3GP6 A;  4P09 A;  1ORM A;  2CXD A;  4CI2 B;  2XAF B;  3V8U A;  4O4H E;  4AKR A;  3I0O A;  2XQY A;  3SRZ A;  1X79 A;  5LBQ B;  3CQC B;  3ZEF B;  2MNH A;  2CWO A;  3N2K E;  4E7S A;  5HWX A;  1KNZ A;  1S35 A;  3PE0 A;  2X66 A;  2ZM0 A;  5EE2 A;  4ZI2 C;  2WSS V;  3Q9D A;  1E1H B;  2GK9 A;  2L3L A;  3RBH A;  4L0R A;  4AUI A;  2LT3 A;  4XZC A;  3MA9 A;  4DBQ A;  3TKL B;  5IYZ E;  2CWY A;  2XUE A;  1HG5 A;  1NAF A;  3CPZ A;  4ANJ A;  3O0E A;  4RL9 A;  4DBR A;  4P0B A;  4U72 A;  2D2S A;  2ODV A;  3NBX X;  3OKQ A;  2Y0L A;  2VB6 A;  3HKB E;  5FNV E;  1HXX A;  4D64 A;  7PRN A;  3B57 A;  3ZJ1 A;  2VKH A;  3UTK A;  3AA0 A;  1GFO A;  2XAH B;  3EVY A;  2P9B A;  2X27 X;  2Q9Q D;  4OK0 A;  1D0Z A;  2MYS A;  2W00 A;  4J2C A;  3WAK A;  3PU3 A;  2C5J A;  2YNK A;  3QC9 A;  3CKD A;  4TV8 E;  3SYS A;  3BQI A;  3GMI A;  3W15 B;  4O4U A;  5L2L A;  2DI4 A;  5T5F A;  3PTR B;  2XAJ B;  2XTQ A;  4UVB B;  3ETV A;  4A56 A;  2K4T A;  2M07 A;  4OYJ A;  2Y2X A;  3GA8 A;  1IZN A;  1MM4 A;  5EK2 A;  2V1D B;  3CX6 B;  3LK2 B;  4AKG A;  1CUN A;  2BVM A;  2X9H A;  2K24 A;  3LJC A;  5LXT E;  2E9X D;  3V5S A;  3AA1 A;  1UX5 A;  4TV9 E;  4JEU B;  4MBQ A;  1QJ8 A;  3H37 A;  4PK5 A;  4LSF A;  2V7K A;  4H9Q C;  4ZI3 C;  5DJQ C;  3ZMU B;  2POR A;  2QTK A;  3WI4 A;  3HOL A;  2XAS B;  3SZD A;  4IST A;  2Y6X A;  3ZJ2 A;  5PRN A;  4AYI D;  3N2G E;  2Q9Q B;  2JMK A;  2CXF A;  2RP4 A;  4XBF B;  3HWB A;  3I1A A;  1YKH B;  5H6R B;  2WMO A;  4HN9 A;  3ZLI A;  1E54 A;  2DNX A;  2X68 A;  4QXB B;  5HXR A;  4KP3 C;  3N9N A;  4OYK A;  1G90 A;  3C51 A;  4H9N C;  3VZU X;  1FMV A;  4ZS2 A;  2KC0 A;  5LJN A;  4F4B A;  2LSK A;  3OJA A;  2VL8 A;  3T24 A;  4PJM A;  4RLB A;  4YFS A;  4ZI3 D;  3VE2 A;  5IYU A;  4ADZ A;  4QX7 B;  4ZOL E;  3Q5X A;  5JVD E;  2ZMA A;  5JDF A;  3I9W A;  5L3B B;  2CEA A;  4KRA A;  4AQF C;  4AFK A;  1QSD A;  1HG2 A;  2IAK A;  3ZYL A;  1H6S 1;  1US7 B;  1YKE B;  3MK7 C;  3UU2 A;  4AKI A;  1Y64 B;  2W0G A;  2E9X B;  2VWA A;  3EDV A;  3VY8 X;  4PUX A;  4RLC A;  1UX4 A;  2BZB A;  4HE8 A;  2M67 A;  3RC8 A;  1LVF A;  2EHO D;  3LK3 A;  4FZN A;  4AKL A;  2W61 A;  5EK3 A;  4YLH A;  2OMF A;  4XNL A;  2CA5 A;  3CQG B;  3GN5 A;  3ONX A;  4F6R C;  2NOX A;  4IE5 A;  4CI3 B;  1Q9F A;  5FVN A;  1O3X A;  2D5U A;  5GON E;  4IE7 A;  5JDG A;  4CXW A;  3POR A;  3C64 A;  3VE1 A;  2JMM A;  2A3D A;  2H3R A;  2LSY A;  5LP6 E;  4YJ3 E;  4XAX B;  5AFU L;  3C4X A;  3Q5W A;  5IHY A;  4HFV A;  3MZK B;  1AJ3 A;  2X0L B;  3ZYK A;  1WLX A;  5FXV A;  1OWA A;  3ANW B;  2IC6 A;  1BT9 A;  4O4X A;  2LE8 A;  3ZYM A;  2LHN A;  1HXU A;  3KV9 A;  2OA5 A;  4H9R C;  5H6Q B;  2KT9 A;  3FHN A;  5E0O A;  5EZY E;  5A1L A;  4L5G A;  4GHB A;  5JRC A;  3AA7 A;  2YU2 A;  1SA0 E;  3ESL A;  2NTY A;  5L3E B;  3K19 A;  1KK7 A;  1MMN A;  1WR6 A;  2CLY B;  5CA0 E;  3JC6 D;  4AYN A;  5AFU K;  4HKA A;  3C5O A;  5FXX A;  2FGQ X;  2D0T A;  3POU A;  2HH7 A;  2LJL A;  4FSP A;  3RC3 A;  1ZHC A;  4KBM B;  4GCP A;  3POX A;  2KZ7 A;  1HTJ F;  3I0Q A;  3F57 A;  3ZMV B;  4ZI2 D;  1MIY A;  5LHI B;  3EMN X;  2V7I A;  5JDP A;  5JDH A;  1LVK A;  2LFU A;  4X20 E;  2C5K T;  2LHR A;  5LJM A;  2CLY C;  2YK0 A;  2Y0K A;  3KBU A;  3BQK A;  2LSI A;  2N1G A;  2UXX B;  4FT6 A;  4QXC B;  2EHO B;  3AAI A;  3AA0 B;  1IAP A;  3JC6 C;  4UF0 A;  2VKJ A;  4CXX A;  4LSH A;  3NRY A;  4I43 B;  5J2U E;  3AB3 B;  5L3D B;  3I9Y A;  3SOL A;  4Z3T A;  3SS1 A;  3C4Z A;  5DL8 A;  4O2A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...