2KXPB

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
total genus 54
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1120 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Capz alpha-1 subunit 2kxpB03
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kxpB01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kxpB02
3AA7A 4AKRA 5ADXL 2KXPB 3AA6A 5AFUL 3LK3A 1IZNA 3AAEA 3AAAB 3LK42 3AA0B 3LK2B 3AA1B 2KZ7B 3AA7B 5AFUK 3LK41 5ADXK 2KXPA 4AKRB 3AA6B 3AAAA 3LK3B 3AAEB 1IZNB 3AA0A 3LK2A 3AA1A 2KZ7A
chains in the Genus database with same CATH superfamily
1IFJA 1J1EB 1YQ4A 2X0LB 4YFSA 2ZAEB 2K0LA 3SFDA 1BH3A 1XMQT 1GD2E 2N2MA 1UIXA 3HTKA 4U3FD 4PUXA 2CXFA 4M3LA 1ZHTA 3RIAA 3HOLA 2H88A 3SFDC 2P67A 2VVNA 2ES0A 1KZUB 1L0NK 2XE2A 2YMYA 2UWJE 8PRNA 1HBWA 3U1AA 1SUMB 2H88C 4CXXA 5DQVA 1HVVA 2Y0EA 3B5NB 2LJLA 5JDLA 5KDMC 2WWUA 1RQUA 3QC9A 2YDSA 3LW5H 1X79A 1SQVJ 1OXZA 4RJWA 2LSYA 3ETVA 1YJWP 1A02J 3RYHE 2Z4EA 3O6QB 3ONXA 1BCCJ 3ZT6A 2O01N 4JLEA 4RL9A 2JQHA 4ZKUA 2FYNC 1X8YA 2V26A 2HR3A 1EZVI 2A06D 3JTYA 3H32A 1YJNP 4IT4A 1SQXK 4U31A 5L3DB 2FYUD 3MA9A 3P4RA 4JF7A 4PK6A 1IK7A 3NRYA 2KZ7A 3CWBG 5AQUB 4CN4A 2ZM6T 4AKRA 3ZC0A 2NW7A 4P09A 2K3WA 1GZLA 3H3AA 4TX5A 2LKHA 2HODB 1HFAA 1LTSC 1HTJF 4GYSA 4IE0A 4ZS2A 2I8DA 4HWFA 3ZT5A 1T3UA 5HEGA 5KJ7A 3HKBE 5LYJE 3NZQA 5LMNT 2RP4A 4ZI3C 5AVYB 4N58A 4O4XA 2BVMA 3ZJ2A 1BXWA 4D6TE 2Y0HA 1LP1A 1VQPP 2ZT9C 3LIEA 1HX1B 3AECA 3PUVF 4NUVA 5KJ7C 2W90A 4UB8E 5C3JA 2WSCJ 1WFDA 1Z8UA 4PJNA 3CL3D 2CCQA 1PP9D 3L73E 5AVZB 3RBZA 4PJ0O 1IK9A 2CBIA 3FBLA 3ONJA 2JMMA 2B1EA 4HGAA 1N34T 1T2KC 2X66A 2X0HA 5AQJB 2J4GA 3O0EA 2H7VC 3LK42 2MHLA 2XQ7A 5HXRA 4OH8B 2FYUJ 2XTLA 4DV0T 2QJPB 1HH0A 3MIWA 4TZ4C 5HEHA 1PPJD 4JI1T 1YI2P 1YBKA 5JH7E 4HFHA 3HI2A 1SQQK 4PW8A 4OGQD 4CN1A 4I55E 1MIYA 1OW8A 4WY4B 4AUWA 1L0LG 3L71G 4P0AA 2JKVA 1H0TA 2Q1KA 3DJBA 4QX7B 2WSFH 2XZRA 1Q82Q 3EFGA 1OVVA 5J1GA 2JQYA 1KNRA 3GMAA 1YTZI 1V9DA 3B4SA 3DWNA 5C2TA 4IDNA 3BRYA 3KVDD 4PNIA 3VE1A 3VRBA 1HGVA 1NU1K 1DEEG 4ILUA 1B7TA 1LKXA 4OGQB 4PJLA 4EAHA 3PQSA 4EYYQ 2FUPA 3Q9DA 2R89A 2B9BA 3VZTX 3AE6A 2CEAA 3U59A 3C50A 3Q5RA 5AQIB 4G2AA 4HTEA 5JDQA 4H9PC 3AE6C 4Q25A 3FB2A 1YKHB 1NTZG 2W66A 2PAJA 4XZCA 5DJUB 4HWCA 1SQBG 4UF0A 2CM0A 2QG4A 3CCEP 4GIWA 4H63H 3RK3E 3SSUA 2BG9A 1ZHXA 2HG5D 1G73A 1BE3E 1JY2N 2B89A 1NTKG 4QKNA 5T5FA 1ZHZA 4ASKA 4PD4I 2IBZE 1M56D 2L3LA 3SYSA 1HCIA 2BG9C 1YJ9P 2YEVC 2OGUA 2O01H 5B5EH 3C1LA 2KSRA 2KLQA 4N75A 2R3SA 5AQTB 3CX7B 3SFEA 5KLVJ 2F1VA 2Y48B 2O1KA 4YTPA 5C8YE 1RY3A 5B66H 3PDYA 2JMHA 4EB6E 5AVRB 3CC7P 3T1HT 4B3TT 1KILA 3SFEC 3HL6A 4IDPA 3HE5A 3AE2C 3G3ZA 3OYXA 2P1JA 1E5WA 2Y0CA 2BCCG 4YTPC 3AAEB 3RIUA 1EDJA 2XNDH 2DW3A 2ACZA 3AA1A 1NKZB 5C39A 1KILC 1IBMT 3RH3A 3RIUC 4QXHB 3EFFK 4A97A 5PRNA 2VL0A 3HRNA 1FZFA 2K88A 1NWQA 4AKLA 2Y0KA 2KS1B 1BGYD 1LJ2A 2YN6A 3VMYA 4H44C 3PU8A 2XQYA 2MAWA 2KNCB 1Z0PA 5CJ5A 3RBHA 1N2DC 3WAJA 3FWNA 2UXXB 2X51A 4AI6A 3O1JA 2K9AA 4HH2A 1HGZA 5L3EB 1S5LH 3EWKA 5E79H 5EK3A 1AJ3A 3VU7H 1EZ3A 4YPCA 1EQ7A 5LJNA 2ZVOB 3C8VA 1FJPA 5KLIC 2XAFB 3LDQB 2QM8A 2KYVA 4OX9T 3JC6D 2YMKA 1J1DC 1R8EA 2JO1A 3ZMTB 2CLYC 4YTMA 4MN4C 4TV9E 2XNXA 5ETWA 3A0HO 4O4JE 4ZOLE 3VE2A 4LF7T 3PURA 3CWBE 3L70D 3SZDA 3TF5A 5CCGD 4DIDB 1FU1A 5DJTB 1L0NE 1MMAA 4LMJA 5H6RB 1KFYA 1BGYJ 2YU2A 3ZMVB 4IE5A 3P7IA 2NP9A 2VK9A 1ZRTE 4GCSA 2WMNA 3UUNA 2KMFA 4ASWA 4WBOA 4PK4A 2WPQA 1VL2A 2E74B 1EXIA 3UTKA 4A98A 3M3ZB 3TLSA 3BCCG 1KC8Q 4AQFA 3X1DA 3FXDA 3RPUA 4FZLA 1HXUA 5EK2A 3JADA 4XAXB 3PUAA 5HXHA 4QHOA 3PRJA 5LG3A 3M06A 3E1RA 3LK3B 5FY7A 3CMLA 4DR5T 4AQFC 1MFZA 4A5XA 1OW7A 5GV0A 2BEQD 2V7MA 5LA6E 3FXEB 4O2BE 1OFCX 4DV2T 2XM1A 1UK5A 4JI6T 2LXBA 5FL1A 2FJEA 3GN5B 2QJYC 2H43A 1PZQA 3IF8B 3L70J 3RRWA 3ZMUB 3RGUA 4G75A 4KJMA 1EZVD 2XSAA 1VCTA 3KHUA 3L71E 4OK0A 3QUJA 3L72J 1SQVG 2CK3H 2NOXA 1WMKA 4HFEA 2UXDT 3MGNA 2V5DA 2WZIA 3UU5A 2V6YA 3R84B 4I7ZC 4F8HA 2JWAA 4H9SE 3V2NA 3G9RA 5J2UE 1KQFB 5KAFH 1H7CA 2WSSV 3RHWA 2Q9QB 3KINB 5FXWA 5CB4E 2WJQA 4YT0A 5IHYA 1X79B 4U3FG 4WBAA 3O6QA 4ZI3D 4GYRA 2HPJA 3ANWB 2VURA 4KBMB 2ZT9D 5KJ7D 3GG2A 3PGSA 5EE2A 3ITKA 3ZMSB 4ZXLA 2WZ7A 4HKZH 3H1LD 2C9NY 1YW0A 3AAAB 3RL0B 3TLUA 1T2KD 1M7KA 3RI5A 2XASB 4IDZA 3L36A 2PGDA 3UULA 2PP6A 1DEBA 4AKRB 1ZKEA 1X9BA 3ETUA 4K0UA 2HODA 1NTKE 1G2CB 2QRXA 3OKQA 2F1TA 1OW6A 1NGMB 1W0BA 1S5LE 1NU1E 4D5UA 3RYIE 5AW7B 2ZVNB 3NFQA 2A06G 2XQ5A 2FXOA 1K73Q 1BR1A 4L0RA 2FYUG 5DL6A 1L4AB 3A3YB 2E5LT 4MHCA 3CXHE 4UB6H 2J1DG 5LXTE 2C5IT 3HE4A 2B76A 3VTPC 1KMIZ 4LF8T 2C5JA 3PUXF 3EUHA 1TU3F 2WSFJ 2JQQA 2FY8A 4NXMT 4QWNB 4TWFA 1QJPA 1SQXD 4IOIH 2IZ1A 3M65A 4K35A 4U7YA 2JEEA 4EOTA 1VCSA 1JTHB 3KVAA 2V7QJ 3JAFA 4YTNA 1M90Q 4JEUB 4FRTA 1S5LX 4CI2B 6PRNA 3EI0A 4PV1D 2LE8A 4WY4A 3L75E 1PP9G 2VVSA 5APTA 3ZYMA 2LRLA 1MZ9A 2JP3A 4H9QC 3N7NA 1MUUA 1FZGA 4IHJE 1GFQA 1XTGB 5KLVK 1HR0T 4NPEA 4WB4A 4WY4C 4GT1A 2XJ7A 3TGUE 3BRVB 4W7YA 2Q7CA 1NTME 4YJ2E 1AFOA 2W0GA 3PRNA 3DTOA 4PD4D 1RE3A 1PPJG 2KINB 5FMNA 1HXXA 2QTKA 2WP9A 4F6RC 1JY2P 1L0LJ 4IFDK 2LM2A 5AVQB 1IJDB 4KX6A 3JC22 3C64A 2ZFCA 1BR4A 2YDRA 1HNXT 3H3MA 1CI6B 3WMM0 1RE3C 4PV1B 1N7SB 3P4PA 2Y9ZA 4PJJA 2L5GB 3GA8A 4ZHQE 3D70A 3Q5PA 4OGQC 5AW4B 4L5GA 1SQQD 1JNRA 1W2EA 1QUUA 3C9IA 4RO0A 1YS5A 2E43A 4TV8E 4GCPA 1J1JA 1XWMA 1KYOH 1PV3A 1UIIA 3PUGA 3IEEA 1KFMA 5BVZA 4EYYR 1KILD 4UF0B 5BMVE 3T24A 3WUTA 2AEJA 4I1LA 2BG9B 3QRCA 4AKMA 4FZMA 3CQXC 5L3GB 5AW0B 3QH9A 2A45G 1IO4A 4HEAA 4H44D 3Q5DA 1NTZJ 5AVWB 3V2QA 1GU5A 2JQ9A 4ISSA 4CPGA 2ZM0A 1SQPD 1USDA 3HWBA 1DX7A 1SQBJ 5JDFA 5JQGE 1RHZB 5L8RJ 3G06A 1ORMA 1XNQT 1X0TA 1LTJB 2W62A 2R5DA 2E75B 3KDPB 1NTKJ 2OYOA 4GKGA 4JI3T 5H2FO 2BKNA 3MTUE 2LKGA 3L74D 2YXRB 3RX6A 3AAEA 3KQGA 4YHHT 1LT9B 2XQ3A 4ANJA 3S4RA 3ZKRA 3VY9X 1SVFA 2PFXA 1Y64B 3HKCE 1LRZA 3CCQP 2BKOA 4O4UA 3B71A 1T16A 4AQRD 4ZKPA 3ZCJA 1HWTC 1SQVE 1QSDA 3FZLB 2UUAT 3T1YT 3U3IA 2KS1A 5AW5B 3K8PC 1M1JB 2XE1A 5LP6E 3H1JD 4JI7T 4C7RA 1Y8AA 2KNCA 2BCCJ 2RPAA 3R4YA 4JYAT 4CI3B 2WDVA 4U2ZA 4HWIB 3A0BH 3QB5K 2MBGA 5J2TE 3NSGA 3WI5A 3VR8A 4LF6T 1SQPJ 1IJ6A 3BRZA 1FOSF 1KORA 5KAIH 3T8OA 3H1ID 3J7Yq 1JY3N 2HN1A 4BAYB 1BGYG 3N9LA 1DH3A 1LTTC 3N2KE 4WBNE 3HKEE 4V1Av 3IFMA 1KB9D 4M1PA 4ADZA 3R6NA 2W6JH 1BR2A 5AQHB 5L3BB 4L73A 2A9UA 2M5AA 2YDQA 4H9RC 4BRYB 5K5GB 2IW5B 3UU4A 2OTLP 4YJ3E 4FJOA 1GK6A 2F1CX 5AW1B 4DR2T 3NMDA 4JI0T 3SY9A 3O9XA 4BA9A 2YKOA 1WR6A 5HEOA 3UIAA 3D6YA 2DI4A 1UX4A 2JIWA 1G8XA 3EHZA 5AQRB 4C91A 2FYUE 1FBMA 4O8SA 1UX5A 1G1JA 3FXDB 3WAKA 5TISO 2E74C 1MPFA 3L70G 4HB1A 3VMAA 1XDOA 3JC6C 3H1IJ 2D0UA 2K5BB 4EZ4A 3ZDMA 1BSNA 3KFWX 1D1CA 1R5LA 2XDJA 2KI7B 2MPKA 3AEEA 4X1IE 3FXEA 1XDPA 4GK0E 2QJYB 1RF0A 2WTYA 3BCCJ 2XV5A 3KXDA 3AEEC 3EQ2A 4QMAA 3RL0g 3GN5A 5HWXA 2KC0A 2JWDA 2H3RA 3QWOC 2V7JA 1QL1A 1RF0C 2Y2XA 3ABVA 4WVZA 2QSIA 2A72A 1KYOE 2LEHA 1RF1B 3EVYA 5BU5A 5LOVE 3TKLB 4B3ST 3OTOT 2E8IA 3ABVC 3DA4A 2M3EA 1YQ4C 4B3MT 4I7ZB 1IFNA 5AQFB 3C98B 2LSKA 4TN7B 3SRZA 3ZEFB 4FSPA 2JDIH 2OYHB 2IDBA 3M0DA 3F57A 1ZLLA 2IBZI 4HKAA 4QX8B 2V6YB 1P84H 2E2AA 4C46A 4P0BA 1GFNA 2KWHA 1PPJE 1WRDA 1SFCA 2HHHT 1EXJA 3V6IA 3M0DC 2Q9QA 3UQ7A 5HCMA 4X64T 5G38A 2W67A 3KV5A 1EZVG 1ZHWA 1Q2NA 3IAOA 5AQMB 5ABFB 4X62T 2FXMA 1OEDB 2YOEA 1LT1A 1SFCC 1KQGB 4TWDA 2Q9QC 3ANWA 4KMCA 3JCUE 4Y99B 5CBNA 1KN7A 2NPSB 3FBZA 1FMVA 4UVAB 1MM5A 5AFUK 4DZOA 4O3YA 3P4WA 4ZMDA 4U72A 3WI4A 3AAAA 4IE4A 5AQGB 4LSHA 3OJAB 1VQLP 4BWNA 3PJAA 4U3FJ 4CI1B 3I0QA 5KLVE 1QL2A 2IUBA 3A2SX 3CD6P 1DU2A 4UV8B 3RL0C 5AQVB 1NKNA 2CPSA 2IZ0A 2V5CA 5DL7A 5IYUA 2Q6QA 1G2CA 2BDEA 2CPTA 3A0BE 4HFIA 5L3FB 3VZWX 1YD8G 3KV4A 1L0LK 5FVNA 4AKGA 2GUSA 4DUZT 3CC2P 5CFBA 5KAIE 1MFTA 4W80A 1GDTA 3H1LG 1L4AA 1NYHA 4WY4D 2N9YB 3CX6B 3CX5D 5CCHA 4DV1T 1UURA 3HE4B 1AV1A 1L4AC 4WWIA 4JPZB 3AECC 2WAUA 3TLWA 2Y0DA 4X5TA 5DL8A 3FX0A 3M91A 3KZIH 5CCHC 4Z90A 1L0VA 1S5LO 1JTHA 3OPCA 4ZI7E 3AVSA 2UU9T 4P1NA 3PP5A 1GTWA 2IC9A 2V7IA 1G90A 1ZV8A 4O3WA 3EABA 2NRGA 2ZLDA 4ZNCA 4LC1A 5HXEA 1SQXG 1VQ7P 5G39A 4KHXA 1URQB 3CCRP 1JM0A 4GHBA 4YSZA 3I0OA 1FC2C 2LSGA 1NTKK 2VKDA 3CIRA 1UUSA 2HFED 2N1TB 5JVDE 3V8UA 5D5DA 4LFBT 2V7QH 3M9HA 4X66T 4YSYA 1PP9J 1BGYE 5GTHE 3A7OA 2VB6A 1CI6A 1ZR2A 1WCRA 1N7SA 2AXTH 3USSA 1ZV4X 1MIVA 3UPGA 3RBXA 1QLED 3VP9A 3C4ZA 4DBQA 5APWA 2E5VA 4PV1C 1N7SC 4LFCT 2WMMA 5LBQB 1LTGC 3F89A 4AUIA 4JBZA 3DP7A 5CJ0A 4IE7A 3HA4A 2XTQA 3GW6A 3EDUA 2BVLA 1WR0A 3LBXB 3HUSB 1VQKP 3F2EA 1VPCA 4XBFB 1LNQA 4XNLA 2IHR1 3NWIA 4AQYT 3ESLA 2BZBA 2LM9A 1P84E 2XPKA 2DWKA 2Y8DA 4DV7T 4RJXA 2KZJA 5APVA 2I59A 2W6AA 2VRSA 2WSEJ 3Q3DA 3D0TA 3L70E 1SQQG 2CWYA 2C0WA 1JO5A 3PGUA 5ABGA 3TK1A 3T0SA 1KNPA 4U7IA 2XY8B 1XNRT 3L72E 1T8BA 2QE7H 1LTJA 1NTMK 2VASA 3G7GA 2E76B 3OW2O 2Q5UA 2RA1A 4JCHA 1QLBA 1LT9A 2UXCT 4PFOA 1GK4A 1LTJC 2E75C 4O4HE 4IDOA 1JNZA 3HD7D 2X0YA 3RYFE 1QVGO 1OVUA 3AAIA 2Y7SA 1LT9C 1R5SA 1KV4A 2QA7A 2IC6A 3K1SA 1SQPG 2CPBA 3LJCA 1IZNA 5JREA 1M1JA 4EI2A 4G63A 4DJGA 2HLOA 2ZM2A 3AXJB 5CJ4A 2NZ2A 2WCAA 3CCMP 3LK41 4A56A 2O4VA 2FJAA 5GTIO 3L74G 1M1JC 2OV9A 3VP8A 4X20E 2KWIB 3A5TA 1EC5A 4EV6A 5AQPB 3I56P 3BQKA 4LFAT 2YO2A 2UUCT 4MLKA 3B57A 1THQA 2KDYA 4C69X 2KOGA 3POXA 3CXHI 2XQ8A 2D5UA 2BS2A 3HD7B 2LXCB 1GFPA 1G1IA 1PGQA 2SPCA 3PH0A 1EDKA 2XHEB 3RKGA 3KPEA 2E74D 4EEDA 3S1KA 2JJ9A 3H1JG 3KYQA 2R3CA 3KZIE 4PJ0H 2Z6EA 5AQLB 3FZFB 1MMGA 3WUUA 4UELA 2NWBA 1L2PA 2WQYA 1NO4A 3MUDA 2HPCB 1S72P 3AE4A 2M5AB 1CZQA 1NJIQ 2WQYC 4BRYA 2N1GA 2LFUA 3PORA 5M1BA 1Q7YQ 3H1IG 1X22A 5L4EA 3AE4C 2R5BA 1M62A 1VQ9P 1EDLA 3NZPA 3O8ZA 2W6BA 3P8CD 1SQVK 1N73B 4CXWA 5LHIB 3UU3A 1FAVA 3TSIA 1UGOA 3KBTA 2CE7A 4U7JA 4KI0F 3V5UA 3ZMZB 2M6IA 1D0ZA 1SE7A 2WJRA 3TZGA 2WVPA 2AXTE 3IHRA 2WPRA 5AVSB 2EHOD 4O2AE 1E7PA 1FEWA 4TT3H 3OA7A 3KV9A 3PTRB 4YY3T 5CBOA 3CWZB 3E08A 3VR9A 4DUYT 1FDMA 1SFCD 2Q9QD 3RK3B 3AE8A 1HG5A 2RN0A 5CA0E 1S4XA 1RF1A 2R8AA 4YXWH 1OSMA 1VQ4P 1L0LE 4H13D 4D64A 3AE8C 2J47A 5DJQC 2P7JA 2P9BA 3N5LA 3Q5SA 2W8ZA 4WYVA 2JMKA 1RF1C 3HKDE 2OYHA 2EHOB 2MOZA 3VKGA 3WI3A 3C5OA 4KR4A 4DV5T 2CHNA 2O3JA 1U57A 4OFZA 3LIDA 5B5EE 3CQGB 3RL0D 1KB9H 4O4LE 4WNKA 4FESA 4KT0J 4N78D 4HWHA 2OYHC 2L9QA 4JYCA 5KTBA 1LVFA 1SFCB 3AA7B 5L4HA 2AXCA 3CKDA 3V2PA 4UR9A 3DWOX 5ABFA 1M8OB 3MKDA 5B66E 3IR9A 1OEDA 1T7SA 2A2FX 3VKHA 2YPVA 2OTJP 2XAJB 4NPPA 2FYUK 3H1HD 3RC3A 1WYCA 2G3AA 2IIUA 2NPSA 4H13B 4E1TA 2LOPA 3OBVE 1OEDC 1KNZA 2WWWA 1AJYA 1ZHCA 2YNKA 1U5PA 3S9OA 4Y99C 4BJMA 2NPSC 3A7MA 2Q3EA 2OQQA 1L4AD 3OJAA 1FMWA 1NTZE 5J0ZA 1W09A 1SQBE 5CCHD 5APSA 3E22E 1FZCA 2GA1A 3CCLP 1L0ND 1VQNP 3KV6A 2MJZA 3JCUO 4AYEC 3CPWO 1S2EA 2X68A 4LF5T 2XKMA 2NTXA 1OIPA 1VDFA 4DR6T 1JB0J 2DLRA 3PJAJ 4HFVA 5E79E 5LBMA 3ZN0B 2IFNA 2A3DA 2J62A 1K04A 3BASA 3RLFF 1M7LA 1U7MA 1JCCA 3PLNA 1QJ9A 4H9OC 3P32A 2XQ4A 1YYCA 3CMAP 4KP3C 1IFPA 3H1HJ 3VMZA 1VQ8P 4FSOA 3IF4A 1KILE 3I55P 2R88A 4X1KE 4MBQA 2W4XA 2K1AA 2QYWA 3WUVA 3ZSSA 1YITP 3ZJ1A 2BCCE 3T20A 5APXA 4E7ZA 1NWMX 4OWFA 1JUNA 1BSHA 2E9XB 1E54A 2BEZF 1KEYA 2D2CB 2J59M 1QX8A 4EYUA 3W68A 3H1LJ 1GU4A 1OZHA 2WBLA 1SQPE 2G8YA 5KAIO 4XFJA 1LTBC 4CQIA 4LSFA 2W63A 1S9KD 1HUCA 2YNYA 2L8KA 7PRNA 1FDOA 2R4OA 1PRNA 4NUUA 4UB8O 1N7SD 1YHQP 1HNZT 2J4UP 1AQ5A 1P4TA 3FHNA 4O4IE 2XTRA 5JDPA 2MTQA 4YHJA 4KR8A 1URQA 3VOPA 3PV0F 3VMXA 3ZLIA 3AEBA 1DD4A 1KQSO 2P58A 2N1TA 2XE3A 1K9MQ 1BT9A 1URQC 3SY7A 4C4VB 1HJBA 1OPFA 3UUBA 1I94T 4LLHA 2WZHA 2N1TC 4CN6A 4LMKA 3VY8X 1Q9GA 1SQXJ 2KIKA 4BJNA 2PRNA 3W15B 3F31A 2FFDA 4A7PA 1H89A 4DV6T 4U9CA 2ODVA 2XQAA 1SP4A 4HE8A 4I0UA 4GKKT 1KYOI 2XM2A 1USEA 4E1SA 3M9QA 2I6HA 2FFDC 1RQVA 3H1IE 4C00A 3LBXA 2M6BA 3HUSA 2WM9A 3V4QA 4Z8XA 3F5HA 2E75D 1T3JA 2YIUB 5FYMA 4O3ZA 3CX5H 4JBWF 5GTHO 4CZZB 1T6AA 1Q90D 2PJQA 4LMLA 2BS3A 3BCCE 3HUSC 3A8YC 4K3CA 1KB9E 3AA0B 3IBPA 3VRAA 5KAFE 1MMNA 1X9VA 5H6QB 4MFRA 5AW2B 2K48A 5KKZC 1NU1D 5HWYA 4JV5T 5ABHA 4GIFA 4EOZB 2D9DA 4AQGA 1Y01A 5AVVB 1W2BO 3MJXA 2IWWA 1CUNA 2MNHA 4GCQA 2W81C 4I43B 5KX5E 2O1JA 2VQFT 3CXHD 2JR8A 2DCFA 1QGKB 3RQWA 3NXSA 4IE6A 1BR0A 2M3BA 1LTAC 1SQQJ 1IC2A 4R4MA 2N2NA 4Z91A 2E76C 4G76A 2M07A 1D1BA 3CCJP 2WSEH 1ZW0A 2FBWA 3NVOA 3B13A 4LF4T 3PQUA 2KZIA 3OYZA 4GK5E 4UXNB 3KDSE 4D6TG 1IZNB 4ZEYA 3AXJA 5LG4A 1MNDA 3QNUA 2FBWC 3L75D 3UUXB 2R6GF 1OWAA 1JMBA 2C5KT 2X27X 5EZYE 2B88A 1PGPA 4N6JA 1D1AA 3C4XA 2A45H 4FUVA 4DR1T 3TGUD 2WS3A 4UB6E 4FZNA 4U3FE 1VF5B 3HD7A 1FS0E 2JJLA 4IL6H 2B87B 2W61A 3RIFA 2C0SA 4DV3T 4AKIA 4NXNT 3G6EP 5FVLA 4QH1A 1Z56A 2K9JB 4JQ0D 3HD7C 4EXTA 2FKWB 3L74J 4X65T 3GMIA 1IBKT 1FZAA 3W67A 3NTNA 2WU5A 2HPCA 1Q81Q 3AE5A 4ASVA 2OYIB 5LHHB 4O49A 3GHGB 4L75A 3NRXA 3SOLA 2J58A 1HF8A 3AE5C 1KK7A 3DA3A 3H1JJ 3P4QA 2XSBA 2R32A 1NAFA 1N73A 3K3NA 3SWHA 3KZIO 5A1LA 1J5ET 3H1KD 1I6ZA 2A06E 1Q86Q 2IDOB 5DL5A 2LKMA 2IYOA 1N73C 1FZEA 1GFOA 1IFDA 3OAKA 4AXPA 1OVRA 2KSJA 2WDQA 2X9YA 3D71A 4U3CA 4D65A 2VQET 5IUXA 4N59A 1Y9BA 3I9YA 2YK0A 4U2YA 5FXXA 5BU8B 2FYZA 1UCUA 3ZC1A 4IL4A 4EIJA 3N9MA 3QB5A 4JYBA 4XNKA 4HFBA 3N2OA 4PJMA 1E79H 2W80C 1D0YA 4H9NC 4DOJA 3U78A 3H6PA 2HH7A 3CX5E 3RC8A 4XE5B 1GL2B 1PP9E 3RK3C 1A02F 3OVUA 3C51A 1OMIA 4IL9A 3NJTA 2NPSD 3ZPOA 4RJTA 2AXTO 4TNWA 1Y47A 1KTMA 4AISA 1P84I 2WITA 2EHOA 3H1KJ 2IPPA 3RK2D 4HJGH 2K24A 3O4XE 1PGOA 5DABA 2IAKA 4YSXA 3MACA 4AKHA 1BCCD 2X9KA 4TUYE 5APUA 3FWLA 2EHOC 2I0MA 3FZMB 3AA7A 3K19A 3I5CA 3P7KA 1AVYA 1JNMA 4GF4A 4AZLA 4QH4A 3KVBA 5M4YA 1J5WA 3CX8B 3MP7B 4XA4A 1DIPA 4BUMX 3WU2H 5G26A 3ONLC 3SWFA 5F3JA 3L09A 4KUMB 5H2FH 3N9QA 3RK2B 5DQWA 2VKHA 4WW0A 3UAQA 4H13C 5B5EO 4LGDE 3BQLA 1GW4A 4LSIA 1LWUB 1YXRA 2K4TA 1SA0E 2ZLYA 3LFMA 1ZOYA 3H25A 5B66O 5AW3B 1EDIA 1HX8A 3L4FA 1FZCB 3H1HG 3PU3A 1ZOYC 1U7JA 1KQLA 2ERVA 3I9WA 2LHRA 1VRBA 2IYPA 2V7KA 3AB3B 2XU6A 1H6S1 4C7NB 3TNUA 5FNVE 4IL6E 4DR7T 2LHNA 1OX3A 1KFNA 3HW9A 1H88A 1HS7A 3LG7A 4PAGA 4FRXA 5E0OA 5G3AA 1Q9FA 4GOUA 3CVRA 3RYCE 2FGRA 1L0NG 3UFEA 2KB7P 1WT6A 1URQD 1VQ6P 2E9XA 2JRKA 2KT9A 1NAYA 1FJGT 5LHGB 2SPZA 2N1TD 2K3RA 5E79O 2LHFA 2E9XC 5FVKA 4KRAA 2D2CC 2V1DB 4IIJE 2NW8A 3CLQA 5AQOB 1KYOD 5JDGA 2XMXA 2OA5A 4IL6X 4TNVA 2HPLA 5APQA 5ABEA 2KLUA 1NTZK 4DNDA 4X1YE 3L39A 3QRAA 3AEGA 2XQ6A 3UT5E 3GF3A 4ISTA 2AXDS 4B61A 1SQBK 3J9X1 2PORA 5FL0A 1W9RA 3AEGC 1ZR4A 3POUA 2XZEA 3AEDA 5TISH 4C4VA 5TJHA 3L3PA 4ZZCA 3ZT7A 1CSBA 3FGAD 3POQA 4YLHA 1FJKA 3U1CA 4R4LA 2BASA 2K37A 3AEDC 3EDVA 1N86A 1O3XA 3E7KA 4AYDC 3M9BA 2W83C 3K3QC 2AEMA 5CHXA 2WT7B 1VQOP 4B6XA 2FFDB 1NH4A 2KK7A 4JFBA 2WVRA 3AE3A 4UV9B 3SS1A 4DBRA 1S1CX 4HYTB 2GE4A 3CCUP 2YKSA 2E76D 2OMFA 3AE3C 5KLVD 2M67A 1SQPK 3P50A 3K3OA 4DCKA 2MYSA 3AA0A 5KKZB 2YIUC 3MXZA 4UEMA 2ZYAA 1JY2O 3P8MC 3WU2E 3NBXX 4D6TD 3AVRA 3LK2B 3M0AA 2LT3A 1VQ5P 2XQ9A 2CRBA 5FXVA 1IFMA 3P8CE 3PHLA 5H2FE 3L73D 4EDFA 2H7HA 4RLCA 3GWHA 3N4XA 3E1IA 4BXLA 3CC4P 4GOEA 2WDRA 5KAFO 3CQCB 5JR9B 1R8IA 4AIUA 3PF1A 1JY3P 4KHPT 1NU1G 1SS1A 2LR2A 4I2LC 2N9BA 4Y28J 3N9PA 2OARA 1N7LA 2H7OA 3UU6A 4PD4H 3TLTA 1K05A 3AE2A 1JMMA 2E5TA 2VWAA 5ADXK 3P4SA 3BS0A 2LRKA 2V6XA 1MMDA 3Q1MA 1EZVE 1HTLC 5EK4A 1D0XA 3QOFA 4D6TJ 2B87A 1VQMP 2BS4A 4O3XB 4EEBA 3BQIA 2QJKB 1YQ3A 1S94A 2ODUA 2M8RA 3L73J 2K9JA 1VF5C 3Q2YA 5HEUA 4ZI2C 5FP3A 2V7LA 5LGNB 2QGSA 3L75G 5AQQB 2QA4P 4F4BA 3PE0A 1T98A 3ZYKA 1E1HB 3UUMA 5JTGA 2IWVA 1YQ3C 3KBUA 3AA6B 3PTZA 4N78E 4ZS3A 2CXDA 3A2AA 3TLVA 2OYIA 3RF1A 4H63V 3GHGA 3TGUG 5CMZA 4UB6O 1NTMG 2RH0A 3N9OA 3V2RA 5LGTB 2Y9YA 1VOMA 3H1HE 3MUDC 2AE9A 3UFGA 2AEFA 5AFUL 2OYIC 4RLBA 1QVFO 5AVTB 2VKJA 3VN0A 4TLFA 3CXHH 3GHGC 3MHVA 4GDOA 2WSSH 2NR4A 2VKOA 3T97B 5AVUB 4J2CA 4MALA 5JRCB 3RK3D 1H8AA 3JAEA 1P84D 2IX7C 2MKVA 4FQEA 1BE3D 3H1LE 1LTIC 5TISE 2Q3IA 2DHRA 2UXBT 1GFMA 4GKJT 2IBZD 5HCJA 5CGMA 1PHOA 1K8AQ 2KLVA 3CI9A 2F4VT 1N8RQ 3PGRA 3L35A 5AW8B 3N9NA 4JI2T 2ZM8A 2PRRA 4GODA 2CWOA 1IJ5A 2KXPB 2LSIA 3FZHB 2WB5A 3L72D 4E7SA 1NVOA 2HN2A 1XMOT 3VZUX 1HG2A 3H1KG 4EGWA 5LJMA 2FGQX 3B8EB 1US7B 3VYIA 2X67A 4LF9T 4H0LC 1PFIA 2YKQA 2VL8A 4ZZBA 1GL2A 2X9WA 4K3BA 1RH5B 5EFWB 1MIWA 4KHZF 2LLYA 4FT6A 1KB9I 1GL2C 1SQXE 4HFDA 1SHZC 5FY1A 5JDNA 1BDDA 1BE3J 2W27A 5FXZA 2H89A 3AEAA 2YU1A 3R2PA 1S9KE 3LW5J 1T1LA 4PFPA 2Z5HA 1WYBA 2V4HA 2H89C 4AYCA 4DT0A 3AEAC 1J1EC 4WZXA 3HTKB 1HJ0A 1PGJA 5KXJA 1JOCA 2HYNA 1RE4A 4IREA 3VHLA 3PUZF 2RKLA 1S35A 2GM4A 3UQ4A 1BCCG 4L74A 4FOZA 3B5NA 1RE4C 1LWUA 2ACXA 3BATA 4PD4E 4AFKA 4U74A 4YXDA 3V5SA 3MD0A 2ZYGA 1GQEA 4ERRA 4COFA 3FZKB 3RK2C 1D7MA 3BRTB 2J1NA 3CWBD 2BG9E 3B5NC 5HXSA 3SWKA 1LWUC 2FYNB 5AW6B 3SZVA 2CA5A 2PFVA 2CBJA 4YXDC 2E9XD 4ILAA 2ZFGA 2D2CD 3S4UA 1FIOA 1ZRTD 3Q5EA 5FY0A 5AVXB 4IDQA 4OVNF 1FE6A 4FI5A 1FZCC 2WPSA 1SQQE 4B3RT 2ZXEB 2GUVA 4C7NA 5GTIH 1N32T 1IFIA 3Q5WA 3RKOA 4GOFA 2M0BA 3H32B 3TNUB 2V8SV 1LVKA 4DV4T 1E2AA 5LNKA 2BBJA 2FJBA 2KZ7B 1GMJA 4PJ0E 4HWDA 3ZCIA 1J2JB 2CXLA 1MNEA 2BBHA 4PR7A 3A0BO 4QXCB 5AQKB 3ZYLA 3GP6A 2ZT9B 4Z1MH 3PJSK 1CW5A 1XTCC 4IFMA 3A0HH 5GONE 4IL6O 5JDMA 1CHUA 3CWBJ 4I4TE 4PK5A 4NPDA 3L37A 2R44A 1LP1B 1WLXA 2KUBA 1L0NJ 5JDHA 4DVDA 3PUWF 2FXPA 1M57D 1T8ZA 1L0LD 2KP8A 3L71D 2DL1A 4HFCA 2OLTA 1ZP0A 2X9XA 4U33A 3L74E 2ZYDA 1NENA 2BKPA 1XZYA 3LSVA 4RESB 2Y0LA 4DO0A 1ZP0C 4FMSA 1HXTA 2N9DA 3SWYA 4QQ1A 1DD3A 3CCSP 5ADXL 2UXNB 2I1KA 1HF9A 5HXCA 1S3JA 3UU8A 3V5BA 4L76A 3AEBC 2JPFA 2ZXXA 4QXBB 2QJPC 3H1JE 5L3CB 4HN9A 1YTZT 2WSCH 5HAXA 5TAOA 1ZN5A 5F8PA 3RGLA 3RRCA 2NTYA 5L47A 2M06A 1H0TB 2P2UA 4L9IA 2WT7A 2E42A 2NW9A 4W7ZA 4ILCA 4K3AA 2KNDA 3B5MA 2XAGB 3CX5I 3O1IA 4C90A 2YKPA 2Q9IA 2ODJA 2P10A 1NTZD 1FOSE 4DR3T 2W2UA 3QK6A 5BR8T 4AYMC 2G0UA 3L71J 2D2SA 4UVBB 1SQBD 3ZSTA 3UU2A 1PIXA 1JCDA 1KD1Q 1NTKD 4O9BA 1HNWT 1QJ8A 4JEHB 2C0XA 2O01J 5AQNB 1JEKA 2I1JA 3PUQA 1QEXA 2KSEA 3G4SP 5AQSB 5AW9B 2WY2A 4DMVA 1ZHYA 1FZBA 3PUSA 3A5XA 2H8PD 5F5WA 1LGHB 1ZXGA 5IYZE 1AQTA 4OHFA 1W5CE 3LK2A 3D6ZA 2LSJA 3H37A 2QVAA 3L8RA 5KLVG 1MKMA 3H1KE 3CPZA 3FYXA 1IAPA 4N74A 2JQKA 4RKUJ 2RMZA 1T72A 4CXYA 2R4PA 5JR9A 2BCCD 2R4LA 4CTDA 4AYID 1AVOA 1VF5D 2PBIA 4ZI2D 3RQUA 2XUEA 4UIGA 4AYNA 2W00A 3G71P 1NHLA 5JR9C 2Z5IA 2IFMA 4I6MC 3C4WA 3N2GE 5KMGP 5FKYA 3WU2O 2YO3A 1YIJP 2XAHB 1IBLT 1WRGA 3IN6A 4JI8T 2XE5A 2X9HA 1NOHA 2J5UA 2XG6A 2LOSA 5L2LA 3I1AA 1BDCA 3ZN1B 3DZMA 2A45I 3L73G 2QIWA 5GTIE 1KILB 3JCUH 1U4QA 3HE5B 1N36T 1NU1J 3AE9A 1OEDE 3AA1B 5HEJA 2WU2A 1NTMD 3JCFA 4H44B 3E0ZA 3AE9C 1MV8A 2K9YA 2XAQB 3O1HA 2Y6XA 2FJDA 2ZMAA 5LCYA 1BCCE 2DNXA 3K5BA 1JY3O 4LSEA 2QJKC 3AA6A 4K0KT 3EMNX 4NPFX 3A0HE 2C9LY 4I50E 4IFFA 2CMRA 3HOEA 2PTFA 1N33T 5KLIB 3MZWB 2GK9A 1W0AA 3BVHA 1SLQA 3Q5XA 1J1DB 5HYAA 2N2LA 3CCVP 3TYYA 3MK7C 4H0LD 3L75J 2CLYB 4JI4T 3MZKB 2IMLA 4UB8H 3T97A 4UVCB 5JRCA 4ILBA 4N3YB 1KF6A 1YKEB 5LB7B 5CA1E 4Z3TA 3BCCD 3Q2MA 4DR4T 2OTKE 2R4NA 2WPVB 3TGUJ 1GW3A 1ZMEC 1NTMJ 1GL2D 1AA0A 5IWAT 2ZJSE 2QM7A 1PL5A 3JSVC 3AE7A 3GF7A 3AEFA 4EIWA 4QH5A 2KXPA 1M1KQ 3CMEP 3BK9A 4OYKA 2POHA 4JI5T 3SYBA 2WMOA 2PG8A 4H0LB 3V4WA 3AE7C 3AEFC 1NEKA 2D0TA 3II6A 3GLMA 1MM4A 2YINA 3AE1A 3EAMA 4EZHA 2QEXP 1BE3G 5LMUT 2E5YA 2DWGA 1ZEEA 2IBZG 3LK3A 1FDIA 2ITAA 4JUYA 2UUBT 3TDKA 4IGUA 3AE1C 4DMWA 3NKZA 5CCGA 2L91A 2YXQB 1SQVD 5LGUB 3CK6A 3PUYF 4TWHA 5GTHH 4NIQA 3L72G 3HR0A 5CCGC 3B5ND 5APYA 2WWVA 2CHOA 4OYJA 4B86A 3IA3A
chains in the Genus database with same CATH topology
2JMKA 4UEMA 2X0LB 3HKDE 2MOZA 2EHOB 4YFSA 3VKGA 3WI3A 2K0LA 3C5OA 4KR4A 3PUGA 1BH3A 3IEEA 4EYYR 2N2MA 4UF0B 5BMVE 4OFZA 3T24A 3CQGB 4PUXA 2CXFA 4O4LE 4WNKA 1ZHTA 3QRCA 4FESA 3HOLA 4N78D 3NBXX 2L9QA 3AVRA 3LK2B 3CQXC 4FZMA 4AKMA 1LVFA 5L3GB 2LT3A 3AA7B 3CKDA 2ES0A 5FXVA 3MKDA 4HEAA 2A2FX 3VKHA 2XE2A 2YPVA 2XAJB 4ISSA 4RLCA 8PRNA 3GWHA 3RC3A 4CXXA 1WYCA 2ZM0A 5DQVA 3HWBA 2LJLA 5JDLA 5JDFA 5KDMC 3CQCB 5JR9B 2WWUA 5JQGE 4E1TA 2LOPA 3OBVE 1KNZA 1ZHCA 3QC9A 1ORMA 2YNKA 1X79A 4RJWA 1OXZA 1U5PA 2LSYA 2W62A 3ETVA 3N9PA 4BJMA 2H7OA 3RYHE 3RX6A 3AAEA 3ONXA 3OJAA 1FMWA 4ANJA 4JLEA 4RL9A 3VY9X 2VWAA 1Y64B 3HKCE 1LRZA 2V26A 5ADXK 3E22E 4O4UA 3ZCJA 3JTYA 3KV6A 1QSDA 1MMDA 5L3DB 3MA9A 4AYEC 3U3IA 2X68A 3K8PC 2XE1A 4PK6A 2NTXA 3NRYA 5LP6E 2KZ7A 5EK4A 2DLRA 3WI5A 4AKRA 1D0XA 4HFVA 3ZC0A 2NW7A 5LBMA 3ZN0B 2A3DA 4P09A 4CI3B 4O3XB 3H3AA 4TX5A 2MBGA 5J2TE 1HFAA 3BQIA 1HTJF 2ODUA 1S94A 4GYSA 4H9OC 4IE0A 4ZS2A 1QJ9A 3NSGA 4KP3C 4ZI2C 5FP3A 1IJ6A 2V7LA 5LGNB 4FSOA 2QGSA 3HKBE 5LYJE 3NZQA 4F4BA 3PE0A 1T98A 4MBQA 1E1HB 4X1KE 3UUMA 2RP4A 4ZI3C 3KBUA 3ZYKA 4N58A 2BVMA 3AA6B 4ZS3A 3T8OA 3ZJ2A 4O4XA 2CXDA 3ZJ1A 3J7Yq 1BXWA 2Y0HA 3T20A 4E7ZA 1NWMX 2E9XB 4BAYB 4NUVA 1E54A 4H63V 3N9LA 4EYUA 4PJNA 2CCQA 3N2KE 4WBNE 3HKEE 3N9OA 5LGTB 1VOMA 2WBLA 3FBLA 2JMMA 4V1Av 4M1PA 2B1EA 4HGAA 5AFUL 4RLBA 4CQIA 4ADZA 3R6NA 2W63A 2VKJA 1BR2A 2X66A 4LSFA 2L8KA 7PRNA 5L3BB 2H7VC 3LK42 4NUUA 1PRNA 2VKOA 2MHLA 4J2CA 3O0EA 5HXRA 4MALA 2J4UP 5JRCB 1P4TA 2XTLA 3FHNA 4O4IE 2XTRA 5JDPA 4H9RC 4TZ4C 2IW5B 4YJ3E 4FJOA 2DHRA 2MTQA 4YHJA 5JH7E 4PW8A 3HI2A 1GFMA 4KR8A 3ZLIA 4I55E 1PHOA 3SY9A 1MIYA 3O9XA 4BA9A 1WR6A 2DI4A 4P0AA 1UX4A 3N9NA 1G8XA 2ZM8A 4C91A 1BT9A 2CWOA 2XE3A 3SY7A 1IJ5A 3DJBA 4QX7B 4O8SA 2KXPB 1UX5A 3FXDB 3WAKA 2LSIA 5J1GA 1OPFA 4E7SA 1MPFA 3JC6C 1V9DA 2D0UA 1HG2A 2K5BB 4EZ4A 3VY8X 3VZUX 1Q9GA 5LJMA 3KFWX 1D1CA 1US7B 2FGQX 2X67A 4PNIA 3KVDD 4BJNA 4X1IE 2PRNA 3VE1A 3W15B 3F31A 4GK0E 4U9CA 2ODVA 2VL8A 4HE8A 4ILUA 1B7TA 2X9WA 1LKXA 5HWXA 4PJLA 3GN5A 2KC0A 4EAHA 3PQSA 4E1SA 2H3RA 3Q9DA 2V7JA 1MIWA 2Y2XA 3LBXA 4FT6A 3VZTX 2WM9A 2CEAA 4Z8XA 1SHZC 2A72A 5FYMA 4O3ZA 2LEHA 5FY1A 5JDNA 4CZZB 3C50A 2PJQA 3EVYA 5FXZA 5LOVE 3TKLB 4G2AA 2E8IA 4HTEA 5JDQA 4H9PC 3DA4A 3AA0B 3IBPA 2YU1A 1YKHB 3FB2A 1MMNA 3C98B 2LSKA 4TN7B 5H6QB 3SRZA 3ZEFB 4MFRA 4XZCA 4FSPA 4PFPA 2K48A 1WYBA 2CM0A 3F57A 4UF0A 5HWYA 4GIWA 4H63H 4HKAA 4QX8B 1ZHXA 4EOZB 1G73A 4P0BA 2KWHA 4AQGA 1GFNA 3MJXA 1WRDA 4QKNA 1CUNA 2MNHA 5T5FA 3VHLA 1ZHZA 4ASKA 2Q9QA 4GCQA 2W81C 1S35A 4I43B 5KX5E 2L3LA 3SYSA 1HCIA 3KV5A 1ZHWA 2YEVC 2DCFA 4FOZA 2KLQA 4IE6A 3CX7B 2ACXA 1BR0A 2Q9QC 3ANWA 4KMCA 4AFKA 4U74A 2F1VA 3V5SA 2N2NA 4ERRA 3FBZA 2Y48B 4G76A 2M07A 5C8YE 1FMVA 4UVAB 3PDYA 1MM5A 1D1BA 2JMHA 4EB6E 2J1NA 5AFUK 5HXSA 4O3YA 3B13A 3HL6A 4U72A 2CA5A 2PFVA 3PQUA 3SZVA 2E9XD 2ZFGA 3OYZA 3AAAA 4GK5E 3OYXA 4IE4A 4LSHA 3AAEB 4UXNB 3KDSE 3S4UA 1IZNB 1FIOA 5FY0A 3AA1A 4CI1B 5LG4A 1MNDA 4FI5A 3I0QA 3UUXB 3A2SX 4UV8B 3RH3A 3Q5WA 4QXHB 1OWAA 5DL7A 2C5KT 3RKOA 2X27X 5EZYE 5PRNA 5IYUA 2BDEA 3VZWX 1LVKA 1D1AA 4AKLA 5L3FB 2Y0KA 3C4XA 1YD8G 4FUVA 3KV4A 5FVNA 5LNKA 4AKGA 2KZ7B 3PU8A 4FZNA 2XQYA 1Z0PA 3ZCIA 3RBHA 3WAJA 2W61A 2CXLA 2UXXB 2C0SA 2X51A 4AI6A 1MNEA 2K9AA 3O1JA 4AKIA 5L3EB 4QXCB 3ZYLA 4EXTA 3GP6A 3CX6B 5EK3A 3GMIA 1AJ3A 3VU7H 1EZ3A 5LJNA 5GONE 5JDMA 2XAFB 4I4TE 4PK5A 2WAUA 1WLXA 5DL8A 5LHHB 5JDHA 3JC6D 4DVDA 4O49A 3ZMTB 3NRXA 2CLYC 2X9XA 4ZI7E 3AVSA 1HF8A 3SOLA 1KK7A 4TV9E 5ETWA 3DA3A 2IC9A 4O4JE 4ZOLE 3VE2A 1NAFA 2V7IA 3PURA 1G90A 3SZDA 3K3NA 3SWHA 4DO0A 5A1LA 2Y0LA 4O3WA 4FMSA 1HXTA 2ZLDA 1MMAA 2N9DA 3ZMVB 5H6RB 4QQ1A 2YU2A 5DL5A 4IE5A 3P7IA 5ADXL 2UXNB 2NP9A 2VK9A 5HXCA 5HXEA 4GCSA 2WMNA 2JPFA 3UUNA 2KMFA 4AXPA 1GFOA 4QXBB 4GHBA 4WBOA 4PK4A 4HN9A 5L3CB 2X9YA 3I0OA 4D65A 5HAXA 5TAOA 3RRCA 2LSGA 2VKDA 5F8PA 5JVDE 3UTKA 4N59A 2NTYA 3V8UA 5D5DA 4AQFA 2M06A 3RPUA 4FZLA 3I9YA 2YK0A 4L9IA 5FXXA 5EK2A 1HXUA 1UCUA 4XAXB 2NW9A 3PUAA 3ZC1A 5HXHA 4QHOA 2VB6A 3LK3B 2KNDA 3N9MA 5FY7A 3CMLA 2XAGB 4AQFC 4XNKA 1ZV4X 1MIVA 3N2OA 3O1IA 3UPGA 4C90A 4PJMA 5GV0A 2W80C 2ODJA 2V7MA 3C4ZA 3QK6A 4AYMC 2G0UA 1D0YA 5LA6E 4DBQA 3FXEB 2D2SA 4H9NC 4O2BE 4UVBB 3U78A 2HH7A 5LBQB 3RC8A 3UU2A 4AUIA 3C51A 3DP7A 3GN5B 3ZPOA 4IE7A 3HA4A 3IF8B 3RRWA 3ZMUB 1QJ8A 3EDUA 2BVLA 4JEHB 2XTQA 2EHOA 2K24A 3LBXB 3O4XE 5DABA 3F2EA 4G75A 2IAKA 3PUQA 3MACA 4XBFB 4XNLA 4AKHA 4DMVA 1ZHYA 4TUYE 3ESLA 3PUSA 2BZBA 2LM9A 3A5XA 4OK0A 3QUJA 2Y8DA 2DWKA 5IYZE 4RJXA 2EHOC 2NOXA 4OHFA 3LK2A 2LSJA 2I59A 3K19A 3AA7A 3H37A 4GF4A 3D0TA 4AZLA 3KVBA 3R84B 2CWYA 5M4YA 3CX8B 3CPZA 3FYXA 1IAPA 4H9SE 5J2UE 4CXYA 4BUMX 5G26A 5JR9A 1H7CA 2WSSV 3T0SA 4AYID 2Q9QB 3KINB 3L09A 2PBIA 5FXWA 5CB4E 4ZI2D 4KUMB 5F3JA 2XUEA 5IHYA 2VASA 3N9QA 4UIGA 3G7GA 4AYNA 5DQWA 2VKHA 4WW0A 3UAQA 2RA1A 2W00A 5JR9C 4C69X 4JCHA 3BQLA 4ZI3D 4LSIA 4GYRA 3C4WA 2HPJA 3N2GE 3ANWB 4PFOA 5KMGP 2K4TA 1SA0E 2XAHB 2ZLYA 4KBMB 3LFMA 4O4HE 2XE5A 2X9HA 3RYFE 2XG6A 2LOSA 5L2LA 3AAIA 2Y7SA 3I1AA 3ZN1B 5EE2A 1HX8A 2QA7A 2IC6A 3LJCA 3PU3A 3ZMSB 1U4QA 1IZNA 1YW0A 3AAAB 5JREA 4G63A 2XASB 4IDZA 2ERVA 3I9WA 2LHRA 2ZM2A 1VRBA 3AA1B 3UULA 2V7KA 3AB3B 3LK41 4AKRB 1H6S1 1ZKEA 4A56A 2O4VA 3ETUA 4K0UA 3E0ZA 5FNVE 2LHNA 4X20E 2KWIB 2XAQB 3HW9A 3O1HA 2Y6XA 3BQKA 3OKQA 1HS7A 1THQA 3LG7A 3B57A 4MLKA 2F1TA 2ZMAA 4PAGA 5LCYA 2KDYA 2DNXA 5E0OA 1Q9FA 3RYIE 4FRXA 4GOUA 3POXA 4D5UA 4LSEA 3CVRA 3RYCE 2FGRA 2D5UA 3AA6A 3UFEA 1GFPA 3EMNX 1BR1A 4L0RA 2SPCA 4I50E 2E9XA 5DL6A 2JRKA 2CMRA 2XHEB 2KT9A 3HOEA 4MHCA 5LHGB 2GK9A 2J1DG 2JJ9A 2Z6EA 3Q5XA 2C5IT 5LXTE 1MMGA 4UELA 2LHFA 2E9XC 2C5JA 2NWBA 3EUHA 5HYAA 2JQQA 2N2LA 4KRAA 2V1DB 3MK7C 4QWNB 2CLYB 1QJPA 3MZKB 3M65A 2NW8A 4IIJE 4UVCB 5JDGA 5JRCA 2OA5A 2XMXA 2HPLA 3KVAA 1YKEB 5CA1E 4Z3TA 2LFUA 2N1GA 3Q2MA 4DNDA 4X1YE 3PORA 4JEUB 3QRAA 3UT5E 4FRTA 4ISTA 4B61A 4CI2B 3J9X1 6PRNA 2PORA 2LE8A 3WI4A 3NZPA 3P8CD 4CXWA 3ZYMA 4H9QC 3POUA 4EIWA 5LHIB 2KXPA 3KBTA 4IHJE 1GFQA 3BK9A 3L3PA 2CE7A 4OYKA 3V5UA 3SYBA 3POQA 2WMOA 4YLHA 2PG8A 3ZMZB 1D0ZA 2D0TA 4YJ2E 1MM4A 2W0GA 3TZGA 3IHRA 2YINA 4EZHA 2EHOD 3DTOA 3EDVA 3PRNA 1O3XA 2KINB 4O2AE 5FMNA 1HXXA 3K3QC 2QTKA 4AYDC 4F6RC 1FEWA 2DWGA 1ZEEA 4B6XA 3LK3A 3PTRB 3KV9A 4JUYA 3C64A 1BR4A 3CWZB 3E08A 4IGUA 4DMWA 4JFBA 4UV9B 3SS1A 4DBRA 4PJJA 5LGUB 2GE4A 2Q9QD 3GA8A 4ZHQE 1HG5A 5CA0E 4L5GA 3HR0A 2OMFA 2M67A 1OSMA 1QUUA 3K3OA 1YS5A 4D64A 2MYSA 4TV8E 5DJQC 3AA0A 4OYJA 2P9BA 3N5LA 4GCPA 3MXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 A;  4AKR A;  5ADX L;  2KXP B;  3AA6 A;  5AFU L;  3LK3 A;  1IZN A;  3AAE A;  3AAA B;  3LK4 2;  3AA0 B;  3LK2 B;  3AA1 B;  2KZ7 B;  3AA7 B;  5AFU K;  3LK4 1;  5ADX K;  2KXP A;  4AKR B;  3AA6 B;  3AAA A;  3LK3 B;  3AAE B;  1IZN B;  3AA0 A;  3LK2 A;  3AA1 A;  2KZ7 A; 
#chains in the Genus database with same CATH topology
 1IFJ A;  1J1E B;  1YQ4 A;  2X0L B;  4YFS A;  2ZAE B;  2K0L A;  3SFD A;  1BH3 A;  1XMQ T;  1GD2 E;  2N2M A;  1UIX A;  3HTK A;  4U3F D;  4PUX A;  2CXF A;  4M3L A;  1ZHT A;  3RIA A;  3HOL A;  2H88 A;  3SFD C;  2P67 A;  2VVN A;  2ES0 A;  1KZU B;  1L0N K;  2XE2 A;  2YMY A;  2UWJ E;  8PRN A;  1HBW A;  3U1A A;  1SUM B;  2H88 C;  4CXX A;  5DQV A;  1HVV A;  2Y0E A;  3B5N B;  2LJL A;  5JDL A;  5KDM C;  2WWU A;  1RQU A;  3QC9 A;  2YDS A;  3LW5 H;  1X79 A;  1SQV J;  1OXZ A;  4RJW A;  2LSY A;  3ETV A;  1YJW P;  1A02 J;  3RYH E;  2Z4E A;  3O6Q B;  3ONX A;  1BCC J;  3ZT6 A;  2O01 N;  4JLE A;  4RL9 A;  2JQH A;  4ZKU A;  2FYN C;  1X8Y A;  2V26 A;  2HR3 A;  1EZV I;  2A06 D;  3JTY A;  3H32 A;  1YJN P;  4IT4 A;  1SQX K;  4U31 A;  5L3D B;  2FYU D;  3MA9 A;  3P4R A;  4JF7 A;  4PK6 A;  1IK7 A;  3NRY A;  2KZ7 A;  3CWB G;  5AQU B;  4CN4 A;  2ZM6 T;  4AKR A;  3ZC0 A;  2NW7 A;  4P09 A;  2K3W A;  1GZL A;  3H3A A;  4TX5 A;  2LKH A;  2HOD B;  1HFA A;  1LTS C;  1HTJ F;  4GYS A;  4IE0 A;  4ZS2 A;  2I8D A;  4HWF A;  3ZT5 A;  1T3U A;  5HEG A;  5KJ7 A;  3HKB E;  5LYJ E;  3NZQ A;  5LMN T;  2RP4 A;  4ZI3 C;  5AVY B;  4N58 A;  4O4X A;  2BVM A;  3ZJ2 A;  1BXW A;  4D6T E;  2Y0H A;  1LP1 A;  1VQP P;  2ZT9 C;  3LIE A;  1HX1 B;  3AEC A;  3PUV F;  4NUV A;  5KJ7 C;  2W90 A;  4UB8 E;  5C3J A;  2WSC J;  1WFD A;  1Z8U A;  4PJN A;  3CL3 D;  2CCQ A;  1PP9 D;  3L73 E;  5AVZ B;  3RBZ A;  4PJ0 O;  1IK9 A;  2CBI A;  3FBL A;  3ONJ A;  2JMM A;  2B1E A;  4HGA A;  1N34 T;  1T2K C;  2X66 A;  2X0H A;  5AQJ B;  2J4G A;  3O0E A;  2H7V C;  3LK4 2;  2MHL A;  2XQ7 A;  5HXR A;  4OH8 B;  2FYU J;  2XTL A;  4DV0 T;  2QJP B;  1HH0 A;  3MIW A;  4TZ4 C;  5HEH A;  1PPJ D;  4JI1 T;  1YI2 P;  1YBK A;  5JH7 E;  4HFH A;  3HI2 A;  1SQQ K;  4PW8 A;  4OGQ D;  4CN1 A;  4I55 E;  1MIY A;  1OW8 A;  4WY4 B;  4AUW A;  1L0L G;  3L71 G;  4P0A A;  2JKV A;  1H0T A;  2Q1K A;  3DJB A;  4QX7 B;  2WSF H;  2XZR A;  1Q82 Q;  3EFG A;  1OVV A;  5J1G A;  2JQY A;  1KNR A;  3GMA A;  1YTZ I;  1V9D A;  3B4S A;  3DWN A;  5C2T A;  4IDN A;  3BRY A;  3KVD D;  4PNI A;  3VE1 A;  3VRB A;  1HGV A;  1NU1 K;  1DEE G;  4ILU A;  1B7T A;  1LKX A;  4OGQ B;  4PJL A;  4EAH A;  3PQS A;  4EYY Q;  2FUP A;  3Q9D A;  2R89 A;  2B9B A;  3VZT X;  3AE6 A;  2CEA A;  3U59 A;  3C50 A;  3Q5R A;  5AQI B;  4G2A A;  4HTE A;  5JDQ A;  4H9P C;  3AE6 C;  4Q25 A;  3FB2 A;  1YKH B;  1NTZ G;  2W66 A;  2PAJ A;  4XZC A;  5DJU B;  4HWC A;  1SQB G;  4UF0 A;  2CM0 A;  2QG4 A;  3CCE P;  4GIW A;  4H63 H;  3RK3 E;  3SSU A;  2BG9 A;  1ZHX A;  2HG5 D;  1G73 A;  1BE3 E;  1JY2 N;  2B89 A;  1NTK G;  4QKN A;  5T5F A;  1ZHZ A;  4ASK A;  4PD4 I;  2IBZ E;  1M56 D;  2L3L A;  3SYS A;  1HCI A;  2BG9 C;  1YJ9 P;  2YEV C;  2OGU A;  2O01 H;  5B5E H;  3C1L A;  2KSR A;  2KLQ A;  4N75 A;  2R3S A;  5AQT B;  3CX7 B;  3SFE A;  5KLV J;  2F1V A;  2Y48 B;  2O1K A;  4YTP A;  5C8Y E;  1RY3 A;  5B66 H;  3PDY A;  2JMH A;  4EB6 E;  5AVR B;  3CC7 P;  3T1H T;  4B3T T;  1KIL A;  3SFE C;  3HL6 A;  4IDP A;  3HE5 A;  3AE2 C;  3G3Z A;  3OYX A;  2P1J A;  1E5W A;  2Y0C A;  2BCC G;  4YTP C;  3AAE B;  3RIU A;  1EDJ A;  2XND H;  2DW3 A;  2ACZ A;  3AA1 A;  1NKZ B;  5C39 A;  1KIL C;  1IBM T;  3RH3 A;  3RIU C;  4QXH B;  3EFF K;  4A97 A;  5PRN A;  2VL0 A;  3HRN A;  1FZF A;  2K88 A;  1NWQ A;  4AKL A;  2Y0K A;  2KS1 B;  1BGY D;  1LJ2 A;  2YN6 A;  3VMY A;  4H44 C;  3PU8 A;  2XQY A;  2MAW A;  2KNC B;  1Z0P A;  5CJ5 A;  3RBH A;  1N2D C;  3WAJ A;  3FWN A;  2UXX B;  2X51 A;  4AI6 A;  3O1J A;  2K9A A;  4HH2 A;  1HGZ A;  5L3E B;  1S5L H;  3EWK A;  5E79 H;  5EK3 A;  1AJ3 A;  3VU7 H;  1EZ3 A;  4YPC A;  1EQ7 A;  5LJN A;  2ZVO B;  3C8V A;  1FJP A;  5KLI C;  2XAF B;  3LDQ B;  2QM8 A;  2KYV A;  4OX9 T;  3JC6 D;  2YMK A;  1J1D C;  1R8E A;  2JO1 A;  3ZMT B;  2CLY C;  4YTM A;  4MN4 C;  4TV9 E;  2XNX A;  5ETW A;  3A0H O;  4O4J E;  4ZOL E;  3VE2 A;  4LF7 T;  3PUR A;  3CWB E;  3L70 D;  3SZD A;  3TF5 A;  5CCG D;  4DID B;  1FU1 A;  5DJT B;  1L0N E;  1MMA A;  4LMJ A;  5H6R B;  1KFY A;  1BGY J;  2YU2 A;  3ZMV B;  4IE5 A;  3P7I A;  2NP9 A;  2VK9 A;  1ZRT E;  4GCS A;  2WMN A;  3UUN A;  2KMF A;  4ASW A;  4WBO A;  4PK4 A;  2WPQ A;  1VL2 A;  2E74 B;  1EXI A;  3UTK A;  4A98 A;  3M3Z B;  3TLS A;  3BCC G;  1KC8 Q;  4AQF A;  3X1D A;  3FXD A;  3RPU A;  4FZL A;  1HXU A;  5EK2 A;  3JAD A;  4XAX B;  3PUA A;  5HXH A;  4QHO A;  3PRJ A;  5LG3 A;  3M06 A;  3E1R A;  3LK3 B;  5FY7 A;  3CML A;  4DR5 T;  4AQF C;  1MFZ A;  4A5X A;  1OW7 A;  5GV0 A;  2BEQ D;  2V7M A;  5LA6 E;  3FXE B;  4O2B E;  1OFC X;  4DV2 T;  2XM1 A;  1UK5 A;  4JI6 T;  2LXB A;  5FL1 A;  2FJE A;  3GN5 B;  2QJY C;  2H43 A;  1PZQ A;  3IF8 B;  3L70 J;  3RRW A;  3ZMU B;  3RGU A;  4G75 A;  4KJM A;  1EZV D;  2XSA A;  1VCT A;  3KHU A;  3L71 E;  4OK0 A;  3QUJ A;  3L72 J;  1SQV G;  2CK3 H;  2NOX A;  1WMK A;  4HFE A;  2UXD T;  3MGN A;  2V5D A;  2WZI A;  3UU5 A;  2V6Y A;  3R84 B;  4I7Z C;  4F8H A;  2JWA A;  4H9S E;  3V2N A;  3G9R A;  5J2U E;  1KQF B;  5KAF H;  1H7C A;  2WSS V;  3RHW A;  2Q9Q B;  3KIN B;  5FXW A;  5CB4 E;  2WJQ A;  4YT0 A;  5IHY A;  1X79 B;  4U3F G;  4WBA A;  3O6Q A;  4ZI3 D;  4GYR A;  2HPJ A;  3ANW B;  2VUR A;  4KBM B;  2ZT9 D;  5KJ7 D;  3GG2 A;  3PGS A;  5EE2 A;  3ITK A;  3ZMS B;  4ZXL A;  2WZ7 A;  4HKZ H;  3H1L D;  2C9N Y;  1YW0 A;  3AAA B;  3RL0 B;  3TLU A;  1T2K D;  1M7K A;  3RI5 A;  2XAS B;  4IDZ A;  3L36 A;  2PGD A;  3UUL A;  2PP6 A;  1DEB A;  4AKR B;  1ZKE A;  1X9B A;  3ETU A;  4K0U A;  2HOD A;  1NTK E;  1G2C B;  2QRX A;  3OKQ A;  2F1T A;  1OW6 A;  1NGM B;  1W0B A;  1S5L E;  1NU1 E;  4D5U A;  3RYI E;  5AW7 B;  2ZVN B;  3NFQ A;  2A06 G;  2XQ5 A;  2FXO A;  1K73 Q;  1BR1 A;  4L0R A;  2FYU G;  5DL6 A;  1L4A B;  3A3Y B;  2E5L T;  4MHC A;  3CXH E;  4UB6 H;  2J1D G;  5LXT E;  2C5I T;  3HE4 A;  2B76 A;  3VTP C;  1KMI Z;  4LF8 T;  2C5J A;  3PUX F;  3EUH A;  1TU3 F;  2WSF J;  2JQQ A;  2FY8 A;  4NXM T;  4QWN B;  4TWF A;  1QJP A;  1SQX D;  4IOI H;  2IZ1 A;  3M65 A;  4K35 A;  4U7Y A;  2JEE A;  4EOT A;  1VCS A;  1JTH B;  3KVA A;  2V7Q J;  3JAF A;  4YTN A;  1M90 Q;  4JEU B;  4FRT A;  1S5L X;  4CI2 B;  6PRN A;  3EI0 A;  4PV1 D;  2LE8 A;  4WY4 A;  3L75 E;  1PP9 G;  2VVS A;  5APT A;  3ZYM A;  2LRL A;  1MZ9 A;  2JP3 A;  4H9Q C;  3N7N A;  1MUU A;  1FZG A;  4IHJ E;  1GFQ A;  1XTG B;  5KLV K;  1HR0 T;  4NPE A;  4WB4 A;  4WY4 C;  4GT1 A;  2XJ7 A;  3TGU E;  3BRV B;  4W7Y A;  2Q7C A;  1NTM E;  4YJ2 E;  1AFO A;  2W0G A;  3PRN A;  3DTO A;  4PD4 D;  1RE3 A;  1PPJ G;  2KIN B;  5FMN A;  1HXX A;  2QTK A;  2WP9 A;  4F6R C;  1JY2 P;  1L0L J;  4IFD K;  2LM2 A;  5AVQ B;  1IJD B;  4KX6 A;  3JC2 2;  3C64 A;  2ZFC A;  1BR4 A;  2YDR A;  1HNX T;  3H3M A;  1CI6 B;  3WMM 0;  1RE3 C;  4PV1 B;  1N7S B;  3P4P A;  2Y9Z A;  4PJJ A;  2L5G B;  3GA8 A;  4ZHQ E;  3D70 A;  3Q5P A;  4OGQ C;  5AW4 B;  4L5G A;  1SQQ D;  1JNR A;  1W2E A;  1QUU A;  3C9I A;  4RO0 A;  1YS5 A;  2E43 A;  4TV8 E;  4GCP A;  1J1J A;  1XWM A;  1KYO H;  1PV3 A;  1UII A;  3PUG A;  3IEE A;  1KFM A;  5BVZ A;  4EYY R;  1KIL D;  4UF0 B;  5BMV E;  3T24 A;  3WUT A;  2AEJ A;  4I1L A;  2BG9 B;  3QRC A;  4AKM A;  4FZM A;  3CQX C;  5L3G B;  5AW0 B;  3QH9 A;  2A45 G;  1IO4 A;  4HEA A;  4H44 D;  3Q5D A;  1NTZ J;  5AVW B;  3V2Q A;  1GU5 A;  2JQ9 A;  4ISS A;  4CPG A;  2ZM0 A;  1SQP D;  1USD A;  3HWB A;  1DX7 A;  1SQB J;  5JDF A;  5JQG E;  1RHZ B;  5L8R J;  3G06 A;  1ORM A;  1XNQ T;  1X0T A;  1LTJ B;  2W62 A;  2R5D A;  2E75 B;  3KDP B;  1NTK J;  2OYO A;  4GKG A;  4JI3 T;  5H2F O;  2BKN A;  3MTU E;  2LKG A;  3L74 D;  2YXR B;  3RX6 A;  3AAE A;  3KQG A;  4YHH T;  1LT9 B;  2XQ3 A;  4ANJ A;  3S4R A;  3ZKR A;  3VY9 X;  1SVF A;  2PFX A;  1Y64 B;  3HKC E;  1LRZ A;  3CCQ P;  2BKO A;  4O4U A;  3B71 A;  1T16 A;  4AQR D;  4ZKP A;  3ZCJ A;  1HWT C;  1SQV E;  1QSD A;  3FZL B;  2UUA T;  3T1Y T;  3U3I A;  2KS1 A;  5AW5 B;  3K8P C;  1M1J B;  2XE1 A;  5LP6 E;  3H1J D;  4JI7 T;  4C7R A;  1Y8A A;  2KNC A;  2BCC J;  2RPA A;  3R4Y A;  4JYA T;  4CI3 B;  2WDV A;  4U2Z A;  4HWI B;  3A0B H;  3QB5 K;  2MBG A;  5J2T E;  3NSG A;  3WI5 A;  3VR8 A;  4LF6 T;  1SQP J;  1IJ6 A;  3BRZ A;  1FOS F;  1KOR A;  5KAI H;  3T8O A;  3H1I D;  3J7Y q;  1JY3 N;  2HN1 A;  4BAY B;  1BGY G;  3N9L A;  1DH3 A;  1LTT C;  3N2K E;  4WBN E;  3HKE E;  4V1A v;  3IFM A;  1KB9 D;  4M1P A;  4ADZ A;  3R6N A;  2W6J H;  1BR2 A;  5AQH B;  5L3B B;  4L73 A;  2A9U A;  2M5A A;  2YDQ A;  4H9R C;  4BRY B;  5K5G B;  2IW5 B;  3UU4 A;  2OTL P;  4YJ3 E;  4FJO A;  1GK6 A;  2F1C X;  5AW1 B;  4DR2 T;  3NMD A;  4JI0 T;  3SY9 A;  3O9X A;  4BA9 A;  2YKO A;  1WR6 A;  5HEO A;  3UIA A;  3D6Y A;  2DI4 A;  1UX4 A;  2JIW A;  1G8X A;  3EHZ A;  5AQR B;  4C91 A;  2FYU E;  1FBM A;  4O8S A;  1UX5 A;  1G1J A;  3FXD B;  3WAK A;  5TIS O;  2E74 C;  1MPF A;  3L70 G;  4HB1 A;  3VMA A;  1XDO A;  3JC6 C;  3H1I J;  2D0U A;  2K5B B;  4EZ4 A;  3ZDM A;  1BSN A;  3KFW X;  1D1C A;  1R5L A;  2XDJ A;  2KI7 B;  2MPK A;  3AEE A;  4X1I E;  3FXE A;  1XDP A;  4GK0 E;  2QJY B;  1RF0 A;  2WTY A;  3BCC J;  2XV5 A;  3KXD A;  3AEE C;  3EQ2 A;  4QMA A;  3RL0 g;  3GN5 A;  5HWX A;  2KC0 A;  2JWD A;  2H3R A;  3QWO C;  2V7J A;  1QL1 A;  1RF0 C;  2Y2X A;  3ABV A;  4WVZ A;  2QSI A;  2A72 A;  1KYO E;  2LEH A;  1RF1 B;  3EVY A;  5BU5 A;  5LOV E;  3TKL B;  4B3S T;  3OTO T;  2E8I A;  3ABV C;  3DA4 A;  2M3E A;  1YQ4 C;  4B3M T;  4I7Z B;  1IFN A;  5AQF B;  3C98 B;  2LSK A;  4TN7 B;  3SRZ A;  3ZEF B;  4FSP A;  2JDI H;  2OYH B;  2IDB A;  3M0D A;  3F57 A;  1ZLL A;  2IBZ I;  4HKA A;  4QX8 B;  2V6Y B;  1P84 H;  2E2A A;  4C46 A;  4P0B A;  1GFN A;  2KWH A;  1PPJ E;  1WRD A;  1SFC A;  2HHH T;  1EXJ A;  3V6I A;  3M0D C;  2Q9Q A;  3UQ7 A;  5HCM A;  4X64 T;  5G38 A;  2W67 A;  3KV5 A;  1EZV G;  1ZHW A;  1Q2N A;  3IAO A;  5AQM B;  5ABF B;  4X62 T;  2FXM A;  1OED B;  2YOE A;  1LT1 A;  1SFC C;  1KQG B;  4TWD A;  2Q9Q C;  3ANW A;  4KMC A;  3JCU E;  4Y99 B;  5CBN A;  1KN7 A;  2NPS B;  3FBZ A;  1FMV A;  4UVA B;  1MM5 A;  5AFU K;  4DZO A;  4O3Y A;  3P4W A;  4ZMD A;  4U72 A;  3WI4 A;  3AAA A;  4IE4 A;  5AQG B;  4LSH A;  3OJA B;  1VQL P;  4BWN A;  3PJA A;  4U3F J;  4CI1 B;  3I0Q A;  5KLV E;  1QL2 A;  2IUB A;  3A2S X;  3CD6 P;  1DU2 A;  4UV8 B;  3RL0 C;  5AQV B;  1NKN A;  2CPS A;  2IZ0 A;  2V5C A;  5DL7 A;  5IYU A;  2Q6Q A;  1G2C A;  2BDE A;  2CPT A;  3A0B E;  4HFI A;  5L3F B;  3VZW X;  1YD8 G;  3KV4 A;  1L0L K;  5FVN A;  4AKG A;  2GUS A;  4DUZ T;  3CC2 P;  5CFB A;  5KAI E;  1MFT A;  4W80 A;  1GDT A;  3H1L G;  1L4A A;  1NYH A;  4WY4 D;  2N9Y B;  3CX6 B;  3CX5 D;  5CCH A;  4DV1 T;  1UUR A;  3HE4 B;  1AV1 A;  1L4A C;  4WWI A;  4JPZ B;  3AEC C;  2WAU A;  3TLW A;  2Y0D A;  4X5T A;  5DL8 A;  3FX0 A;  3M91 A;  3KZI H;  5CCH C;  4Z90 A;  1L0V A;  1S5L O;  1JTH A;  3OPC A;  4ZI7 E;  3AVS A;  2UU9 T;  4P1N A;  3PP5 A;  1GTW A;  2IC9 A;  2V7I A;  1G90 A;  1ZV8 A;  4O3W A;  3EAB A;  2NRG A;  2ZLD A;  4ZNC A;  4LC1 A;  5HXE A;  1SQX G;  1VQ7 P;  5G39 A;  4KHX A;  1URQ B;  3CCR P;  1JM0 A;  4GHB A;  4YSZ A;  3I0O A;  1FC2 C;  2LSG A;  1NTK K;  2VKD A;  3CIR A;  1UUS A;  2HFE D;  2N1T B;  5JVD E;  3V8U A;  5D5D A;  4LFB T;  2V7Q H;  3M9H A;  4X66 T;  4YSY A;  1PP9 J;  1BGY E;  5GTH E;  3A7O A;  2VB6 A;  1CI6 A;  1ZR2 A;  1WCR A;  1N7S A;  2AXT H;  3USS A;  1ZV4 X;  1MIV A;  3UPG A;  3RBX A;  1QLE D;  3VP9 A;  3C4Z A;  4DBQ A;  5APW A;  2E5V A;  4PV1 C;  1N7S C;  4LFC T;  2WMM A;  5LBQ B;  1LTG C;  3F89 A;  4AUI A;  4JBZ A;  3DP7 A;  5CJ0 A;  4IE7 A;  3HA4 A;  2XTQ A;  3GW6 A;  3EDU A;  2BVL A;  1WR0 A;  3LBX B;  3HUS B;  1VQK P;  3F2E A;  1VPC A;  4XBF B;  1LNQ A;  4XNL A;  2IHR 1;  3NWI A;  4AQY T;  3ESL A;  2BZB A;  2LM9 A;  1P84 E;  2XPK A;  2DWK A;  2Y8D A;  4DV7 T;  4RJX A;  2KZJ A;  5APV A;  2I59 A;  2W6A A;  2VRS A;  2WSE J;  3Q3D A;  3D0T A;  3L70 E;  1SQQ G;  2CWY A;  2C0W A;  1JO5 A;  3PGU A;  5ABG A;  3TK1 A;  3T0S A;  1KNP A;  4U7I A;  2XY8 B;  1XNR T;  3L72 E;  1T8B A;  2QE7 H;  1LTJ A;  1NTM K;  2VAS A;  3G7G A;  2E76 B;  3OW2 O;  2Q5U A;  2RA1 A;  4JCH A;  1QLB A;  1LT9 A;  2UXC T;  4PFO A;  1GK4 A;  1LTJ C;  2E75 C;  4O4H E;  4IDO A;  1JNZ A;  3HD7 D;  2X0Y A;  3RYF E;  1QVG O;  1OVU A;  3AAI A;  2Y7S A;  1LT9 C;  1R5S A;  1KV4 A;  2QA7 A;  2IC6 A;  3K1S A;  1SQP G;  2CPB A;  3LJC A;  1IZN A;  5JRE A;  1M1J A;  4EI2 A;  4G63 A;  4DJG A;  2HLO A;  2ZM2 A;  3AXJ B;  5CJ4 A;  2NZ2 A;  2WCA A;  3CCM P;  3LK4 1;  4A56 A;  2O4V A;  2FJA A;  5GTI O;  3L74 G;  1M1J C;  2OV9 A;  3VP8 A;  4X20 E;  2KWI B;  3A5T A;  1EC5 A;  4EV6 A;  5AQP B;  3I56 P;  3BQK A;  4LFA T;  2YO2 A;  2UUC T;  4MLK A;  3B57 A;  1THQ A;  2KDY A;  4C69 X;  2KOG A;  3POX A;  3CXH I;  2XQ8 A;  2D5U A;  2BS2 A;  3HD7 B;  2LXC B;  1GFP A;  1G1I A;  1PGQ A;  2SPC A;  3PH0 A;  1EDK A;  2XHE B;  3RKG A;  3KPE A;  2E74 D;  4EED A;  3S1K A;  2JJ9 A;  3H1J G;  3KYQ A;  2R3C A;  3KZI E;  4PJ0 H;  2Z6E A;  5AQL B;  3FZF B;  1MMG A;  3WUU A;  4UEL A;  2NWB A;  1L2P A;  2WQY A;  1NO4 A;  3MUD A;  2HPC B;  1S72 P;  3AE4 A;  2M5A B;  1CZQ A;  1NJI Q;  2WQY C;  4BRY A;  2N1G A;  2LFU A;  3POR A;  5M1B A;  1Q7Y Q;  3H1I G;  1X22 A;  5L4E A;  3AE4 C;  2R5B A;  1M62 A;  1VQ9 P;  1EDL A;  3NZP A;  3O8Z A;  2W6B A;  3P8C D;  1SQV K;  1N73 B;  4CXW A;  5LHI B;  3UU3 A;  1FAV A;  3TSI A;  1UGO A;  3KBT A;  2CE7 A;  4U7J A;  4KI0 F;  3V5U A;  3ZMZ B;  2M6I A;  1D0Z A;  1SE7 A;  2WJR A;  3TZG A;  2WVP A;  2AXT E;  3IHR A;  2WPR A;  5AVS B;  2EHO D;  4O2A E;  1E7P A;  1FEW A;  4TT3 H;  3OA7 A;  3KV9 A;  3PTR B;  4YY3 T;  5CBO A;  3CWZ B;  3E08 A;  3VR9 A;  4DUY T;  1FDM A;  1SFC D;  2Q9Q D;  3RK3 B;  3AE8 A;  1HG5 A;  2RN0 A;  5CA0 E;  1S4X A;  1RF1 A;  2R8A A;  4YXW H;  1OSM A;  1VQ4 P;  1L0L E;  4H13 D;  4D64 A;  3AE8 C;  2J47 A;  5DJQ C;  2P7J A;  2P9B A;  3N5L A;  3Q5S A;  2W8Z A;  4WYV A;  2JMK A;  1RF1 C;  3HKD E;  2OYH A;  2EHO B;  2MOZ A;  3VKG A;  3WI3 A;  3C5O A;  4KR4 A;  4DV5 T;  2CHN A;  2O3J A;  1U57 A;  4OFZ A;  3LID A;  5B5E E;  3CQG B;  3RL0 D;  1KB9 H;  4O4L E;  4WNK A;  4FES A;  4KT0 J;  4N78 D;  4HWH A;  2OYH C;  2L9Q A;  4JYC A;  5KTB A;  1LVF A;  1SFC B;  3AA7 B;  5L4H A;  2AXC A;  3CKD A;  3V2P A;  4UR9 A;  3DWO X;  5ABF A;  1M8O B;  3MKD A;  5B66 E;  3IR9 A;  1OED A;  1T7S A;  2A2F X;  3VKH A;  2YPV A;  2OTJ P;  2XAJ B;  4NPP A;  2FYU K;  3H1H D;  3RC3 A;  1WYC A;  2G3A A;  2IIU A;  2NPS A;  4H13 B;  4E1T A;  2LOP A;  3OBV E;  1OED C;  1KNZ A;  2WWW A;  1AJY A;  1ZHC A;  2YNK A;  1U5P A;  3S9O A;  4Y99 C;  4BJM A;  2NPS C;  3A7M A;  2Q3E A;  2OQQ A;  1L4A D;  3OJA A;  1FMW A;  1NTZ E;  5J0Z A;  1W09 A;  1SQB E;  5CCH D;  5APS A;  3E22 E;  1FZC A;  2GA1 A;  3CCL P;  1L0N D;  1VQN P;  3KV6 A;  2MJZ A;  3JCU O;  4AYE C;  3CPW O;  1S2E A;  2X68 A;  4LF5 T;  2XKM A;  2NTX A;  1OIP A;  1VDF A;  4DR6 T;  1JB0 J;  2DLR A;  3PJA J;  4HFV A;  5E79 E;  5LBM A;  3ZN0 B;  2IFN A;  2A3D A;  2J62 A;  1K04 A;  3BAS A;  3RLF F;  1M7L A;  1U7M A;  1JCC A;  3PLN A;  1QJ9 A;  4H9O C;  3P32 A;  2XQ4 A;  1YYC A;  3CMA P;  4KP3 C;  1IFP A;  3H1H J;  3VMZ A;  1VQ8 P;  4FSO A;  3IF4 A;  1KIL E;  3I55 P;  2R88 A;  4X1K E;  4MBQ A;  2W4X A;  2K1A A;  2QYW A;  3WUV A;  3ZSS A;  1YIT P;  3ZJ1 A;  2BCC E;  3T20 A;  5APX A;  4E7Z A;  1NWM X;  4OWF A;  1JUN A;  1BSH A;  2E9X B;  1E54 A;  2BEZ F;  1KEY A;  2D2C B;  2J59 M;  1QX8 A;  4EYU A;  3W68 A;  3H1L J;  1GU4 A;  1OZH A;  2WBL A;  1SQP E;  2G8Y A;  5KAI O;  4XFJ A;  1LTB C;  4CQI A;  4LSF A;  2W63 A;  1S9K D;  1HUC A;  2YNY A;  2L8K A;  7PRN A;  1FDO A;  2R4O A;  1PRN A;  4NUU A;  4UB8 O;  1N7S D;  1YHQ P;  1HNZ T;  2J4U P;  1AQ5 A;  1P4T A;  3FHN A;  4O4I E;  2XTR A;  5JDP A;  2MTQ A;  4YHJ A;  4KR8 A;  1URQ A;  3VOP A;  3PV0 F;  3VMX A;  3ZLI A;  3AEB A;  1DD4 A;  1KQS O;  2P58 A;  2N1T A;  2XE3 A;  1K9M Q;  1BT9 A;  1URQ C;  3SY7 A;  4C4V B;  1HJB A;  1OPF A;  3UUB A;  1I94 T;  4LLH A;  2WZH A;  2N1T C;  4CN6 A;  4LMK A;  3VY8 X;  1Q9G A;  1SQX J;  2KIK A;  4BJN A;  2PRN A;  3W15 B;  3F31 A;  2FFD A;  4A7P A;  1H89 A;  4DV6 T;  4U9C A;  2ODV A;  2XQA A;  1SP4 A;  4HE8 A;  4I0U A;  4GKK T;  1KYO I;  2XM2 A;  1USE A;  4E1S A;  3M9Q A;  2I6H A;  2FFD C;  1RQV A;  3H1I E;  4C00 A;  3LBX A;  2M6B A;  3HUS A;  2WM9 A;  3V4Q A;  4Z8X A;  3F5H A;  2E75 D;  1T3J A;  2YIU B;  5FYM A;  4O3Z A;  3CX5 H;  4JBW F;  5GTH O;  4CZZ B;  1T6A A;  1Q90 D;  2PJQ A;  4LML A;  2BS3 A;  3BCC E;  3HUS C;  3A8Y C;  4K3C A;  1KB9 E;  3AA0 B;  3IBP A;  3VRA A;  5KAF E;  1MMN A;  1X9V A;  5H6Q B;  4MFR A;  5AW2 B;  2K48 A;  5KKZ C;  1NU1 D;  5HWY A;  4JV5 T;  5ABH A;  4GIF A;  4EOZ B;  2D9D A;  4AQG A;  1Y01 A;  5AVV B;  1W2B O;  3MJX A;  2IWW A;  1CUN A;  2MNH A;  4GCQ A;  2W81 C;  4I43 B;  5KX5 E;  2O1J A;  2VQF T;  3CXH D;  2JR8 A;  2DCF A;  1QGK B;  3RQW A;  3NXS A;  4IE6 A;  1BR0 A;  2M3B A;  1LTA C;  1SQQ J;  1IC2 A;  4R4M A;  2N2N A;  4Z91 A;  2E76 C;  4G76 A;  2M07 A;  1D1B A;  3CCJ P;  2WSE H;  1ZW0 A;  2FBW A;  3NVO A;  3B13 A;  4LF4 T;  3PQU A;  2KZI A;  3OYZ A;  4GK5 E;  4UXN B;  3KDS E;  4D6T G;  1IZN B;  4ZEY A;  3AXJ A;  5LG4 A;  1MND A;  3QNU A;  2FBW C;  3L75 D;  3UUX B;  2R6G F;  1OWA A;  1JMB A;  2C5K T;  2X27 X;  5EZY E;  2B88 A;  1PGP A;  4N6J A;  1D1A A;  3C4X A;  2A45 H;  4FUV A;  4DR1 T;  3TGU D;  2WS3 A;  4UB6 E;  4FZN A;  4U3F E;  1VF5 B;  3HD7 A;  1FS0 E;  2JJL A;  4IL6 H;  2B87 B;  2W61 A;  3RIF A;  2C0S A;  4DV3 T;  4AKI A;  4NXN T;  3G6E P;  5FVL A;  4QH1 A;  1Z56 A;  2K9J B;  4JQ0 D;  3HD7 C;  4EXT A;  2FKW B;  3L74 J;  4X65 T;  3GMI A;  1IBK T;  1FZA A;  3W67 A;  3NTN A;  2WU5 A;  2HPC A;  1Q81 Q;  3AE5 A;  4ASV A;  2OYI B;  5LHH B;  4O49 A;  3GHG B;  4L75 A;  3NRX A;  3SOL A;  2J58 A;  1HF8 A;  3AE5 C;  1KK7 A;  3DA3 A;  3H1J J;  3P4Q A;  2XSB A;  2R32 A;  1NAF A;  1N73 A;  3K3N A;  3SWH A;  3KZI O;  5A1L A;  1J5E T;  3H1K D;  1I6Z A;  2A06 E;  1Q86 Q;  2IDO B;  5DL5 A;  2LKM A;  2IYO A;  1N73 C;  1FZE A;  1GFO A;  1IFD A;  3OAK A;  4AXP A;  1OVR A;  2KSJ A;  2WDQ A;  2X9Y A;  3D71 A;  4U3C A;  4D65 A;  2VQE T;  5IUX A;  4N59 A;  1Y9B A;  3I9Y A;  2YK0 A;  4U2Y A;  5FXX A;  5BU8 B;  2FYZ A;  1UCU A;  3ZC1 A;  4IL4 A;  4EIJ A;  3N9M A;  3QB5 A;  4JYB A;  4XNK A;  4HFB A;  3N2O A;  4PJM A;  1E79 H;  2W80 C;  1D0Y A;  4H9N C;  4DOJ A;  3U78 A;  3H6P A;  2HH7 A;  3CX5 E;  3RC8 A;  4XE5 B;  1GL2 B;  1PP9 E;  3RK3 C;  1A02 F;  3OVU A;  3C51 A;  1OMI A;  4IL9 A;  3NJT A;  2NPS D;  3ZPO A;  4RJT A;  2AXT O;  4TNW A;  1Y47 A;  1KTM A;  4AIS A;  1P84 I;  2WIT A;  2EHO A;  3H1K J;  2IPP A;  3RK2 D;  4HJG H;  2K24 A;  3O4X E;  1PGO A;  5DAB A;  2IAK A;  4YSX A;  3MAC A;  4AKH A;  1BCC D;  2X9K A;  4TUY E;  5APU A;  3FWL A;  2EHO C;  2I0M A;  3FZM B;  3AA7 A;  3K19 A;  3I5C A;  3P7K A;  1AVY A;  1JNM A;  4GF4 A;  4AZL A;  4QH4 A;  3KVB A;  5M4Y A;  1J5W A;  3CX8 B;  3MP7 B;  4XA4 A;  1DIP A;  4BUM X;  3WU2 H;  5G26 A;  3ONL C;  3SWF A;  5F3J A;  3L09 A;  4KUM B;  5H2F H;  3N9Q A;  3RK2 B;  5DQW A;  2VKH A;  4WW0 A;  3UAQ A;  4H13 C;  5B5E O;  4LGD E;  3BQL A;  1GW4 A;  4LSI A;  1LWU B;  1YXR A;  2K4T A;  1SA0 E;  2ZLY A;  3LFM A;  1ZOY A;  3H25 A;  5B66 O;  5AW3 B;  1EDI A;  1HX8 A;  3L4F A;  1FZC B;  3H1H G;  3PU3 A;  1ZOY C;  1U7J A;  1KQL A;  2ERV A;  3I9W A;  2LHR A;  1VRB A;  2IYP A;  2V7K A;  3AB3 B;  2XU6 A;  1H6S 1;  4C7N B;  3TNU A;  5FNV E;  4IL6 E;  4DR7 T;  2LHN A;  1OX3 A;  1KFN A;  3HW9 A;  1H88 A;  1HS7 A;  3LG7 A;  4PAG A;  4FRX A;  5E0O A;  5G3A A;  1Q9F A;  4GOU A;  3CVR A;  3RYC E;  2FGR A;  1L0N G;  3UFE A;  2KB7 P;  1WT6 A;  1URQ D;  1VQ6 P;  2E9X A;  2JRK A;  2KT9 A;  1NAY A;  1FJG T;  5LHG B;  2SPZ A;  2N1T D;  2K3R A;  5E79 O;  2LHF A;  2E9X C;  5FVK A;  4KRA A;  2D2C C;  2V1D B;  4IIJ E;  2NW8 A;  3CLQ A;  5AQO B;  1KYO D;  5JDG A;  2XMX A;  2OA5 A;  4IL6 X;  4TNV A;  2HPL A;  5APQ A;  5ABE A;  2KLU A;  1NTZ K;  4DND A;  4X1Y E;  3L39 A;  3QRA A;  3AEG A;  2XQ6 A;  3UT5 E;  3GF3 A;  4IST A;  2AXD S;  4B61 A;  1SQB K;  3J9X 1;  2POR A;  5FL0 A;  1W9R A;  3AEG C;  1ZR4 A;  3POU A;  2XZE A;  3AED A;  5TIS H;  4C4V A;  5TJH A;  3L3P A;  4ZZC A;  3ZT7 A;  1CSB A;  3FGA D;  3POQ A;  4YLH A;  1FJK A;  3U1C A;  4R4L A;  2BAS A;  2K37 A;  3AED C;  3EDV A;  1N86 A;  1O3X A;  3E7K A;  4AYD C;  3M9B A;  2W83 C;  3K3Q C;  2AEM A;  5CHX A;  2WT7 B;  1VQO P;  4B6X A;  2FFD B;  1NH4 A;  2KK7 A;  4JFB A;  2WVR A;  3AE3 A;  4UV9 B;  3SS1 A;  4DBR A;  1S1C X;  4HYT B;  2GE4 A;  3CCU P;  2YKS A;  2E76 D;  2OMF A;  3AE3 C;  5KLV D;  2M67 A;  1SQP K;  3P50 A;  3K3O A;  4DCK A;  2MYS A;  3AA0 A;  5KKZ B;  2YIU C;  3MXZ A;  4UEM A;  2ZYA A;  1JY2 O;  3P8M C;  3WU2 E;  3NBX X;  4D6T D;  3AVR A;  3LK2 B;  3M0A A;  2LT3 A;  1VQ5 P;  2XQ9 A;  2CRB A;  5FXV A;  1IFM A;  3P8C E;  3PHL A;  5H2F E;  3L73 D;  4EDF A;  2H7H A;  4RLC A;  3GWH A;  3N4X A;  3E1I A;  4BXL A;  3CC4 P;  4GOE A;  2WDR A;  5KAF O;  3CQC B;  5JR9 B;  1R8I A;  4AIU A;  3PF1 A;  1JY3 P;  4KHP T;  1NU1 G;  1SS1 A;  2LR2 A;  4I2L C;  2N9B A;  4Y28 J;  3N9P A;  2OAR A;  1N7L A;  2H7O A;  3UU6 A;  4PD4 H;  3TLT A;  1K05 A;  3AE2 A;  1JMM A;  2E5T A;  2VWA A;  5ADX K;  3P4S A;  3BS0 A;  2LRK A;  2V6X A;  1MMD A;  3Q1M A;  1EZV E;  1HTL C;  5EK4 A;  1D0X A;  3QOF A;  4D6T J;  2B87 A;  1VQM P;  2BS4 A;  4O3X B;  4EEB A;  3BQI A;  2QJK B;  1YQ3 A;  1S94 A;  2ODU A;  2M8R A;  3L73 J;  2K9J A;  1VF5 C;  3Q2Y A;  5HEU A;  4ZI2 C;  5FP3 A;  2V7L A;  5LGN B;  2QGS A;  3L75 G;  5AQQ B;  2QA4 P;  4F4B A;  3PE0 A;  1T98 A;  3ZYK A;  1E1H B;  3UUM A;  5JTG A;  2IWV A;  1YQ3 C;  3KBU A;  3AA6 B;  3PTZ A;  4N78 E;  4ZS3 A;  2CXD A;  3A2A A;  3TLV A;  2OYI A;  3RF1 A;  4H63 V;  3GHG A;  3TGU G;  5CMZ A;  4UB6 O;  1NTM G;  2RH0 A;  3N9O A;  3V2R A;  5LGT B;  2Y9Y A;  1VOM A;  3H1H E;  3MUD C;  2AE9 A;  3UFG A;  2AEF A;  5AFU L;  2OYI C;  4RLB A;  1QVF O;  5AVT B;  2VKJ A;  3VN0 A;  4TLF A;  3CXH H;  3GHG C;  3MHV A;  4GDO A;  2WSS H;  2NR4 A;  2VKO A;  3T97 B;  5AVU B;  4J2C A;  4MAL A;  5JRC B;  3RK3 D;  1H8A A;  3JAE A;  1P84 D;  2IX7 C;  2MKV A;  4FQE A;  1BE3 D;  3H1L E;  1LTI C;  5TIS E;  2Q3I A;  2DHR A;  2UXB T;  1GFM A;  4GKJ T;  2IBZ D;  5HCJ A;  5CGM A;  1PHO A;  1K8A Q;  2KLV A;  3CI9 A;  2F4V T;  1N8R Q;  3PGR A;  3L35 A;  5AW8 B;  3N9N A;  4JI2 T;  2ZM8 A;  2PRR A;  4GOD A;  2CWO A;  1IJ5 A;  2KXP B;  2LSI A;  3FZH B;  2WB5 A;  3L72 D;  4E7S A;  1NVO A;  2HN2 A;  1XMO T;  3VZU X;  1HG2 A;  3H1K G;  4EGW A;  5LJM A;  2FGQ X;  3B8E B;  1US7 B;  3VYI A;  2X67 A;  4LF9 T;  4H0L C;  1PFI A;  2YKQ A;  2VL8 A;  4ZZB A;  1GL2 A;  2X9W A;  4K3B A;  1RH5 B;  5EFW B;  1MIW A;  4KHZ F;  2LLY A;  4FT6 A;  1KB9 I;  1GL2 C;  1SQX E;  4HFD A;  1SHZ C;  5FY1 A;  5JDN A;  1BDD A;  1BE3 J;  2W27 A;  5FXZ A;  2H89 A;  3AEA A;  2YU1 A;  3R2P A;  1S9K E;  3LW5 J;  1T1L A;  4PFP A;  2Z5H A;  1WYB A;  2V4H A;  2H89 C;  4AYC A;  4DT0 A;  3AEA C;  1J1E C;  4WZX A;  3HTK B;  1HJ0 A;  1PGJ A;  5KXJ A;  1JOC A;  2HYN A;  1RE4 A;  4IRE A;  3VHL A;  3PUZ F;  2RKL A;  1S35 A;  2GM4 A;  3UQ4 A;  1BCC G;  4L74 A;  4FOZ A;  3B5N A;  1RE4 C;  1LWU A;  2ACX A;  3BAT A;  4PD4 E;  4AFK A;  4U74 A;  4YXD A;  3V5S A;  3MD0 A;  2ZYG A;  1GQE A;  4ERR A;  4COF A;  3FZK B;  3RK2 C;  1D7M A;  3BRT B;  2J1N A;  3CWB D;  2BG9 E;  3B5N C;  5HXS A;  3SWK A;  1LWU C;  2FYN B;  5AW6 B;  3SZV A;  2CA5 A;  2PFV A;  2CBJ A;  4YXD C;  2E9X D;  4ILA A;  2ZFG A;  2D2C D;  3S4U A;  1FIO A;  1ZRT D;  3Q5E A;  5FY0 A;  5AVX B;  4IDQ A;  4OVN F;  1FE6 A;  4FI5 A;  1FZC C;  2WPS A;  1SQQ E;  4B3R T;  2ZXE B;  2GUV A;  4C7N A;  5GTI H;  1N32 T;  1IFI A;  3Q5W A;  3RKO A;  4GOF A;  2M0B A;  3H32 B;  3TNU B;  2V8S V;  1LVK A;  4DV4 T;  1E2A A;  5LNK A;  2BBJ A;  2FJB A;  2KZ7 B;  1GMJ A;  4PJ0 E;  4HWD A;  3ZCI A;  1J2J B;  2CXL A;  1MNE A;  2BBH A;  4PR7 A;  3A0B O;  4QXC B;  5AQK B;  3ZYL A;  3GP6 A;  2ZT9 B;  4Z1M H;  3PJS K;  1CW5 A;  1XTC C;  4IFM A;  3A0H H;  5GON E;  4IL6 O;  5JDM A;  1CHU A;  3CWB J;  4I4T E;  4PK5 A;  4NPD A;  3L37 A;  2R44 A;  1LP1 B;  1WLX A;  2KUB A;  1L0N J;  5JDH A;  4DVD A;  3PUW F;  2FXP A;  1M57 D;  1T8Z A;  1L0L D;  2KP8 A;  3L71 D;  2DL1 A;  4HFC A;  2OLT A;  1ZP0 A;  2X9X A;  4U33 A;  3L74 E;  2ZYD A;  1NEN A;  2BKP A;  1XZY A;  3LSV A;  4RES B;  2Y0L A;  4DO0 A;  1ZP0 C;  4FMS A;  1HXT A;  2N9D A;  3SWY A;  4QQ1 A;  1DD3 A;  3CCS P;  5ADX L;  2UXN B;  2I1K A;  1HF9 A;  5HXC A;  1S3J A;  3UU8 A;  3V5B A;  4L76 A;  3AEB C;  2JPF A;  2ZXX A;  4QXB B;  2QJP C;  3H1J E;  5L3C B;  4HN9 A;  1YTZ T;  2WSC H;  5HAX A;  5TAO A;  1ZN5 A;  5F8P A;  3RGL A;  3RRC A;  2NTY A;  5L47 A;  2M06 A;  1H0T B;  2P2U A;  4L9I A;  2WT7 A;  2E42 A;  2NW9 A;  4W7Z A;  4ILC A;  4K3A A;  2KND A;  3B5M A;  2XAG B;  3CX5 I;  3O1I A;  4C90 A;  2YKP A;  2Q9I A;  2ODJ A;  2P10 A;  1NTZ D;  1FOS E;  4DR3 T;  2W2U A;  3QK6 A;  5BR8 T;  4AYM C;  2G0U A;  3L71 J;  2D2S A;  4UVB B;  1SQB D;  3ZST A;  3UU2 A;  1PIX A;  1JCD A;  1KD1 Q;  1NTK D;  4O9B A;  1HNW T;  1QJ8 A;  4JEH B;  2C0X A;  2O01 J;  5AQN B;  1JEK A;  2I1J A;  3PUQ A;  1QEX A;  2KSE A;  3G4S P;  5AQS B;  5AW9 B;  2WY2 A;  4DMV A;  1ZHY A;  1FZB A;  3PUS A;  3A5X A;  2H8P D;  5F5W A;  1LGH B;  1ZXG A;  5IYZ E;  1AQT A;  4OHF A;  1W5C E;  3LK2 A;  3D6Z A;  2LSJ A;  3H37 A;  2QVA A;  3L8R A;  5KLV G;  1MKM A;  3H1K E;  3CPZ A;  3FYX A;  1IAP A;  4N74 A;  2JQK A;  4RKU J;  2RMZ A;  1T72 A;  4CXY A;  2R4P A;  5JR9 A;  2BCC D;  2R4L A;  4CTD A;  4AYI D;  1AVO A;  1VF5 D;  2PBI A;  4ZI2 D;  3RQU A;  2XUE A;  4UIG A;  4AYN A;  2W00 A;  3G71 P;  1NHL A;  5JR9 C;  2Z5I A;  2IFM A;  4I6M C;  3C4W A;  3N2G E;  5KMG P;  5FKY A;  3WU2 O;  2YO3 A;  1YIJ P;  2XAH B;  1IBL T;  1WRG A;  3IN6 A;  4JI8 T;  2XE5 A;  2X9H A;  1NOH A;  2J5U A;  2XG6 A;  2LOS A;  5L2L A;  3I1A A;  1BDC A;  3ZN1 B;  3DZM A;  2A45 I;  3L73 G;  2QIW A;  5GTI E;  1KIL B;  3JCU H;  1U4Q A;  3HE5 B;  1N36 T;  1NU1 J;  3AE9 A;  1OED E;  3AA1 B;  5HEJ A;  2WU2 A;  1NTM D;  3JCF A;  4H44 B;  3E0Z A;  3AE9 C;  1MV8 A;  2K9Y A;  2XAQ B;  3O1H A;  2Y6X A;  2FJD A;  2ZMA A;  5LCY A;  1BCC E;  2DNX A;  3K5B A;  1JY3 O;  4LSE A;  2QJK C;  3AA6 A;  4K0K T;  3EMN X;  4NPF X;  3A0H E;  2C9L Y;  4I50 E;  4IFF A;  2CMR A;  3HOE A;  2PTF A;  1N33 T;  5KLI B;  3MZW B;  2GK9 A;  1W0A A;  3BVH A;  1SLQ A;  3Q5X A;  1J1D B;  5HYA A;  2N2L A;  3CCV P;  3TYY A;  3MK7 C;  4H0L D;  3L75 J;  2CLY B;  4JI4 T;  3MZK B;  2IML A;  4UB8 H;  3T97 A;  4UVC B;  5JRC A;  4ILB A;  4N3Y B;  1KF6 A;  1YKE B;  5LB7 B;  5CA1 E;  4Z3T A;  3BCC D;  3Q2M A;  4DR4 T;  2OTK E;  2R4N A;  2WPV B;  3TGU J;  1GW3 A;  1ZME C;  1NTM J;  1GL2 D;  1AA0 A;  5IWA T;  2ZJS E;  2QM7 A;  1PL5 A;  3JSV C;  3AE7 A;  3GF7 A;  3AEF A;  4EIW A;  4QH5 A;  2KXP A;  1M1K Q;  3CME P;  3BK9 A;  4OYK A;  2POH A;  4JI5 T;  3SYB A;  2WMO A;  2PG8 A;  4H0L B;  3V4W A;  3AE7 C;  3AEF C;  1NEK A;  2D0T A;  3II6 A;  3GLM A;  1MM4 A;  2YIN A;  3AE1 A;  3EAM A;  4EZH A;  2QEX P;  1BE3 G;  5LMU T;  2E5Y A;  2DWG A;  1ZEE A;  2IBZ G;  3LK3 A;  1FDI A;  2ITA A;  4JUY A;  2UUB T;  3TDK A;  4IGU A;  3AE1 C;  4DMW A;  3NKZ A;  5CCG A;  2L91 A;  2YXQ B;  1SQV D;  5LGU B;  3CK6 A;  3PUY F;  4TWH A;  5GTH H;  4NIQ A;  3L72 G;  3HR0 A;  5CCG C;  3B5N D;  5APY A;  2WWV A;  2CHO A;  4OYJ A;  4B86 A;  3IA3 A; 
#chains in the Genus database with same CATH homology
 2JMK A;  4UEM A;  2X0L B;  3HKD E;  2MOZ A;  2EHO B;  4YFS A;  3VKG A;  3WI3 A;  2K0L A;  3C5O A;  4KR4 A;  3PUG A;  1BH3 A;  3IEE A;  4EYY R;  2N2M A;  4UF0 B;  5BMV E;  4OFZ A;  3T24 A;  3CQG B;  4PUX A;  2CXF A;  4O4L E;  4WNK A;  1ZHT A;  3QRC A;  4FES A;  3HOL A;  4N78 D;  3NBX X;  2L9Q A;  3AVR A;  3LK2 B;  3CQX C;  4FZM A;  4AKM A;  1LVF A;  5L3G B;  2LT3 A;  3AA7 B;  3CKD A;  2ES0 A;  5FXV A;  3MKD A;  4HEA A;  2A2F X;  3VKH A;  2XE2 A;  2YPV A;  2XAJ B;  4ISS A;  4RLC A;  8PRN A;  3GWH A;  3RC3 A;  4CXX A;  1WYC A;  2ZM0 A;  5DQV A;  3HWB A;  2LJL A;  5JDL A;  5JDF A;  5KDM C;  3CQC B;  5JR9 B;  2WWU A;  5JQG E;  4E1T A;  2LOP A;  3OBV E;  1KNZ A;  1ZHC A;  3QC9 A;  1ORM A;  2YNK A;  1X79 A;  4RJW A;  1OXZ A;  1U5P A;  2LSY A;  2W62 A;  3ETV A;  3N9P A;  4BJM A;  2H7O A;  3RYH E;  3RX6 A;  3AAE A;  3ONX A;  3OJA A;  1FMW A;  4ANJ A;  4JLE A;  4RL9 A;  3VY9 X;  2VWA A;  1Y64 B;  3HKC E;  1LRZ A;  2V26 A;  5ADX K;  3E22 E;  4O4U A;  3ZCJ A;  3JTY A;  3KV6 A;  1QSD A;  1MMD A;  5L3D B;  3MA9 A;  4AYE C;  3U3I A;  2X68 A;  3K8P C;  2XE1 A;  4PK6 A;  2NTX A;  3NRY A;  5LP6 E;  2KZ7 A;  5EK4 A;  2DLR A;  3WI5 A;  4AKR A;  1D0X A;  4HFV A;  3ZC0 A;  2NW7 A;  5LBM A;  3ZN0 B;  2A3D A;  4P09 A;  4CI3 B;  4O3X B;  3H3A A;  4TX5 A;  2MBG A;  5J2T E;  1HFA A;  3BQI A;  1HTJ F;  2ODU A;  1S94 A;  4GYS A;  4H9O C;  4IE0 A;  4ZS2 A;  1QJ9 A;  3NSG A;  4KP3 C;  4ZI2 C;  5FP3 A;  1IJ6 A;  2V7L A;  5LGN B;  4FSO A;  2QGS A;  3HKB E;  5LYJ E;  3NZQ A;  4F4B A;  3PE0 A;  1T98 A;  4MBQ A;  1E1H B;  4X1K E;  3UUM A;  2RP4 A;  4ZI3 C;  3KBU A;  3ZYK A;  4N58 A;  2BVM A;  3AA6 B;  4ZS3 A;  3T8O A;  3ZJ2 A;  4O4X A;  2CXD A;  3ZJ1 A;  3J7Y q;  1BXW A;  2Y0H A;  3T20 A;  4E7Z A;  1NWM X;  2E9X B;  4BAY B;  4NUV A;  1E54 A;  4H63 V;  3N9L A;  4EYU A;  4PJN A;  2CCQ A;  3N2K E;  4WBN E;  3HKE E;  3N9O A;  5LGT B;  1VOM A;  2WBL A;  3FBL A;  2JMM A;  4V1A v;  4M1P A;  2B1E A;  4HGA A;  5AFU L;  4RLB A;  4CQI A;  4ADZ A;  3R6N A;  2W63 A;  2VKJ A;  1BR2 A;  2X66 A;  4LSF A;  2L8K A;  7PRN A;  5L3B B;  2H7V C;  3LK4 2;  4NUU A;  1PRN A;  2VKO A;  2MHL A;  4J2C A;  3O0E A;  5HXR A;  4MAL A;  2J4U P;  5JRC B;  1P4T A;  2XTL A;  3FHN A;  4O4I E;  2XTR A;  5JDP A;  4H9R C;  4TZ4 C;  2IW5 B;  4YJ3 E;  4FJO A;  2DHR A;  2MTQ A;  4YHJ A;  5JH7 E;  4PW8 A;  3HI2 A;  1GFM A;  4KR8 A;  3ZLI A;  4I55 E;  1PHO A;  3SY9 A;  1MIY A;  3O9X A;  4BA9 A;  1WR6 A;  2DI4 A;  4P0A A;  1UX4 A;  3N9N A;  1G8X A;  2ZM8 A;  4C91 A;  1BT9 A;  2CWO A;  2XE3 A;  3SY7 A;  1IJ5 A;  3DJB A;  4QX7 B;  4O8S A;  2KXP B;  1UX5 A;  3FXD B;  3WAK A;  2LSI A;  5J1G A;  1OPF A;  4E7S A;  1MPF A;  3JC6 C;  1V9D A;  2D0U A;  1HG2 A;  2K5B B;  4EZ4 A;  3VY8 X;  3VZU X;  1Q9G A;  5LJM A;  3KFW X;  1D1C A;  1US7 B;  2FGQ X;  2X67 A;  4PNI A;  3KVD D;  4BJN A;  4X1I E;  2PRN A;  3VE1 A;  3W15 B;  3F31 A;  4GK0 E;  4U9C A;  2ODV A;  2VL8 A;  4HE8 A;  4ILU A;  1B7T A;  2X9W A;  1LKX A;  5HWX A;  4PJL A;  3GN5 A;  2KC0 A;  4EAH A;  3PQS A;  4E1S A;  2H3R A;  3Q9D A;  2V7J A;  1MIW A;  2Y2X A;  3LBX A;  4FT6 A;  3VZT X;  2WM9 A;  2CEA A;  4Z8X A;  1SHZ C;  2A72 A;  5FYM A;  4O3Z A;  2LEH A;  5FY1 A;  5JDN A;  4CZZ B;  3C50 A;  2PJQ A;  3EVY A;  5FXZ A;  5LOV E;  3TKL B;  4G2A A;  2E8I A;  4HTE A;  5JDQ A;  4H9P C;  3DA4 A;  3AA0 B;  3IBP A;  2YU1 A;  1YKH B;  3FB2 A;  1MMN A;  3C98 B;  2LSK A;  4TN7 B;  5H6Q B;  3SRZ A;  3ZEF B;  4MFR A;  4XZC A;  4FSP A;  4PFP A;  2K48 A;  1WYB A;  2CM0 A;  3F57 A;  4UF0 A;  5HWY A;  4GIW A;  4H63 H;  4HKA A;  4QX8 B;  1ZHX A;  4EOZ B;  1G73 A;  4P0B A;  2KWH A;  4AQG A;  1GFN A;  3MJX A;  1WRD A;  4QKN A;  1CUN A;  2MNH A;  5T5F A;  3VHL A;  1ZHZ A;  4ASK A;  2Q9Q A;  4GCQ A;  2W81 C;  1S35 A;  4I43 B;  5KX5 E;  2L3L A;  3SYS A;  1HCI A;  3KV5 A;  1ZHW A;  2YEV C;  2DCF A;  4FOZ A;  2KLQ A;  4IE6 A;  3CX7 B;  2ACX A;  1BR0 A;  2Q9Q C;  3ANW A;  4KMC A;  4AFK A;  4U74 A;  2F1V A;  3V5S A;  2N2N A;  4ERR A;  3FBZ A;  2Y48 B;  4G76 A;  2M07 A;  5C8Y E;  1FMV A;  4UVA B;  3PDY A;  1MM5 A;  1D1B A;  2JMH A;  4EB6 E;  2J1N A;  5AFU K;  5HXS A;  4O3Y A;  3B13 A;  3HL6 A;  4U72 A;  2CA5 A;  2PFV A;  3PQU A;  3SZV A;  2E9X D;  2ZFG A;  3OYZ A;  3AAA A;  4GK5 E;  3OYX A;  4IE4 A;  4LSH A;  3AAE B;  4UXN B;  3KDS E;  3S4U A;  1IZN B;  1FIO A;  5FY0 A;  3AA1 A;  4CI1 B;  5LG4 A;  1MND A;  4FI5 A;  3I0Q A;  3UUX B;  3A2S X;  4UV8 B;  3RH3 A;  3Q5W A;  4QXH B;  1OWA A;  5DL7 A;  2C5K T;  3RKO A;  2X27 X;  5EZY E;  5PRN A;  5IYU A;  2BDE A;  3VZW X;  1LVK A;  1D1A A;  4AKL A;  5L3F B;  2Y0K A;  3C4X A;  1YD8 G;  4FUV A;  3KV4 A;  5FVN A;  5LNK A;  4AKG A;  2KZ7 B;  3PU8 A;  4FZN A;  2XQY A;  1Z0P A;  3ZCI A;  3RBH A;  3WAJ A;  2W61 A;  2CXL A;  2UXX B;  2C0S A;  2X51 A;  4AI6 A;  1MNE A;  2K9A A;  3O1J A;  4AKI A;  5L3E B;  4QXC B;  3ZYL A;  4EXT A;  3GP6 A;  3CX6 B;  5EK3 A;  3GMI A;  1AJ3 A;  3VU7 H;  1EZ3 A;  5LJN A;  5GON E;  5JDM A;  2XAF B;  4I4T E;  4PK5 A;  2WAU A;  1WLX A;  5DL8 A;  5LHH B;  5JDH A;  3JC6 D;  4DVD A;  4O49 A;  3ZMT B;  3NRX A;  2CLY C;  2X9X A;  4ZI7 E;  3AVS A;  1HF8 A;  3SOL A;  1KK7 A;  4TV9 E;  5ETW A;  3DA3 A;  2IC9 A;  4O4J E;  4ZOL E;  3VE2 A;  1NAF A;  2V7I A;  3PUR A;  1G90 A;  3SZD A;  3K3N A;  3SWH A;  4DO0 A;  5A1L A;  2Y0L A;  4O3W A;  4FMS A;  1HXT A;  2ZLD A;  1MMA A;  2N9D A;  3ZMV B;  5H6R B;  4QQ1 A;  2YU2 A;  5DL5 A;  4IE5 A;  3P7I A;  5ADX L;  2UXN B;  2NP9 A;  2VK9 A;  5HXC A;  5HXE A;  4GCS A;  2WMN A;  2JPF A;  3UUN A;  2KMF A;  4AXP A;  1GFO A;  4QXB B;  4GHB A;  4WBO A;  4PK4 A;  4HN9 A;  5L3C B;  2X9Y A;  3I0O A;  4D65 A;  5HAX A;  5TAO A;  3RRC A;  2LSG A;  2VKD A;  5F8P A;  5JVD E;  3UTK A;  4N59 A;  2NTY A;  3V8U A;  5D5D A;  4AQF A;  2M06 A;  3RPU A;  4FZL A;  3I9Y A;  2YK0 A;  4L9I A;  5FXX A;  5EK2 A;  1HXU A;  1UCU A;  4XAX B;  2NW9 A;  3PUA A;  3ZC1 A;  5HXH A;  4QHO A;  2VB6 A;  3LK3 B;  2KND A;  3N9M A;  5FY7 A;  3CML A;  2XAG B;  4AQF C;  4XNK A;  1ZV4 X;  1MIV A;  3N2O A;  3O1I A;  3UPG A;  4C90 A;  4PJM A;  5GV0 A;  2W80 C;  2ODJ A;  2V7M A;  3C4Z A;  3QK6 A;  4AYM C;  2G0U A;  1D0Y A;  5LA6 E;  4DBQ A;  3FXE B;  2D2S A;  4H9N C;  4O2B E;  4UVB B;  3U78 A;  2HH7 A;  5LBQ B;  3RC8 A;  3UU2 A;  4AUI A;  3C51 A;  3DP7 A;  3GN5 B;  3ZPO A;  4IE7 A;  3HA4 A;  3IF8 B;  3RRW A;  3ZMU B;  1QJ8 A;  3EDU A;  2BVL A;  4JEH B;  2XTQ A;  2EHO A;  2K24 A;  3LBX B;  3O4X E;  5DAB A;  3F2E A;  4G75 A;  2IAK A;  3PUQ A;  3MAC A;  4XBF B;  4XNL A;  4AKH A;  4DMV A;  1ZHY A;  4TUY E;  3ESL A;  3PUS A;  2BZB A;  2LM9 A;  3A5X A;  4OK0 A;  3QUJ A;  2Y8D A;  2DWK A;  5IYZ E;  4RJX A;  2EHO C;  2NOX A;  4OHF A;  3LK2 A;  2LSJ A;  2I59 A;  3K19 A;  3AA7 A;  3H37 A;  4GF4 A;  3D0T A;  4AZL A;  3KVB A;  3R84 B;  2CWY A;  5M4Y A;  3CX8 B;  3CPZ A;  3FYX A;  1IAP A;  4H9S E;  5J2U E;  4CXY A;  4BUM X;  5G26 A;  5JR9 A;  1H7C A;  2WSS V;  3T0S A;  4AYI D;  2Q9Q B;  3KIN B;  3L09 A;  2PBI A;  5FXW A;  5CB4 E;  4ZI2 D;  4KUM B;  5F3J A;  2XUE A;  5IHY A;  2VAS A;  3N9Q A;  4UIG A;  3G7G A;  4AYN A;  5DQW A;  2VKH A;  4WW0 A;  3UAQ A;  2RA1 A;  2W00 A;  5JR9 C;  4C69 X;  4JCH A;  3BQL A;  4ZI3 D;  4LSI A;  4GYR A;  3C4W A;  2HPJ A;  3N2G E;  3ANW B;  4PFO A;  5KMG P;  2K4T A;  1SA0 E;  2XAH B;  2ZLY A;  4KBM B;  3LFM A;  4O4H E;  2XE5 A;  2X9H A;  3RYF E;  2XG6 A;  2LOS A;  5L2L A;  3AAI A;  2Y7S A;  3I1A A;  3ZN1 B;  5EE2 A;  1HX8 A;  2QA7 A;  2IC6 A;  3LJC A;  3PU3 A;  3ZMS B;  1U4Q A;  1IZN A;  1YW0 A;  3AAA B;  5JRE A;  4G63 A;  2XAS B;  4IDZ A;  2ERV A;  3I9W A;  2LHR A;  2ZM2 A;  1VRB A;  3AA1 B;  3UUL A;  2V7K A;  3AB3 B;  3LK4 1;  4AKR B;  1H6S 1;  1ZKE A;  4A56 A;  2O4V A;  3ETU A;  4K0U A;  3E0Z A;  5FNV E;  2LHN A;  4X20 E;  2KWI B;  2XAQ B;  3HW9 A;  3O1H A;  2Y6X A;  3BQK A;  3OKQ A;  1HS7 A;  1THQ A;  3LG7 A;  3B57 A;  4MLK A;  2F1T A;  2ZMA A;  4PAG A;  5LCY A;  2KDY A;  2DNX A;  5E0O A;  1Q9F A;  3RYI E;  4FRX A;  4GOU A;  3POX A;  4D5U A;  4LSE A;  3CVR A;  3RYC E;  2FGR A;  2D5U A;  3AA6 A;  3UFE A;  1GFP A;  3EMN X;  1BR1 A;  4L0R A;  2SPC A;  4I50 E;  2E9X A;  5DL6 A;  2JRK A;  2CMR A;  2XHE B;  2KT9 A;  3HOE A;  4MHC A;  5LHG B;  2GK9 A;  2J1D G;  2JJ9 A;  2Z6E A;  3Q5X A;  2C5I T;  5LXT E;  1MMG A;  4UEL A;  2LHF A;  2E9X C;  2C5J A;  2NWB A;  3EUH A;  5HYA A;  2JQQ A;  2N2L A;  4KRA A;  2V1D B;  3MK7 C;  4QWN B;  2CLY B;  1QJP A;  3MZK B;  3M65 A;  2NW8 A;  4IIJ E;  4UVC B;  5JDG A;  5JRC A;  2OA5 A;  2XMX A;  2HPL A;  3KVA A;  1YKE B;  5CA1 E;  4Z3T A;  2LFU A;  2N1G A;  3Q2M A;  4DND A;  4X1Y E;  3POR A;  4JEU B;  3QRA A;  3UT5 E;  4FRT A;  4IST A;  4B61 A;  4CI2 B;  3J9X 1;  6PRN A;  2POR A;  2LE8 A;  3WI4 A;  3NZP A;  3P8C D;  4CXW A;  3ZYM A;  4H9Q C;  3POU A;  4EIW A;  5LHI B;  2KXP A;  3KBT A;  4IHJ E;  1GFQ A;  3BK9 A;  3L3P A;  2CE7 A;  4OYK A;  3V5U A;  3SYB A;  3POQ A;  2WMO A;  4YLH A;  2PG8 A;  3ZMZ B;  1D0Z A;  2D0T A;  4YJ2 E;  1MM4 A;  2W0G A;  3TZG A;  3IHR A;  2YIN A;  4EZH A;  2EHO D;  3DTO A;  3EDV A;  3PRN A;  1O3X A;  2KIN B;  4O2A E;  5FMN A;  1HXX A;  3K3Q C;  2QTK A;  4AYD C;  4F6R C;  1FEW A;  2DWG A;  1ZEE A;  4B6X A;  3LK3 A;  3PTR B;  3KV9 A;  4JUY A;  3C64 A;  1BR4 A;  3CWZ B;  3E08 A;  4IGU A;  4DMW A;  4JFB A;  4UV9 B;  3SS1 A;  4DBR A;  4PJJ A;  5LGU B;  2GE4 A;  2Q9Q D;  3GA8 A;  4ZHQ E;  1HG5 A;  5CA0 E;  4L5G A;  3HR0 A;  2OMF A;  2M67 A;  1OSM A;  1QUU A;  3K3O A;  1YS5 A;  4D64 A;  2MYS A;  4TV8 E;  5DJQ C;  3AA0 A;  4OYJ A;  2P9B A;  3N5L A;  4GCP A;  3MXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...