1E54A

Anion-selective porin from comamonas acidovorans
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
332
structure length
332
Chain Sequence
ESSVTLFGIVDTNVAYVNKDAAGDSRYGLGTSGASTSRLGLRGTEDLGGGLKAGFWLEGEIFGDDGNASGFNFKRRSTVSLSGNFGEVRLGRDLVPTSQKLTSYDLFSATGIGPFMGFRNWAAGQGADDNGIRANNLISYYTPNFGGFNAGFGYAFDEKQTIGTADSVGRYIGGYVAYDNGPLSASLGLAQQKTAVGGLATDRDEITLGASYNFGVAKLSGLLQQTKFKRDIGGDIKTNSYMLGASAPVGGVGEVKLQYALYDQKAIDSKAHQITLGYVHNLSKRTALYGNLAFLKNKDASTLGLQAKGVYAGGVQAGESQTGVQVGIRHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Outer membrane protein
molecule keywords OUTER MEMBRANE PORIN PROTEIN 32
publication title Crystal Structure of Omp32, the Anion-Selective Porin from Comamonas Acidovorans, in Complex with a Periplasmic Peptideat 2.1 A Resolution
pubmed doi rcsb
total genus 95
structure length 332
sequence length 332
ec nomenclature
pdb deposition date 2000-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 1e54A00
4GCPA 3UU2A 2XE3A 4FRXA 1HXXA 3A2SX 4GCSA 1GFNA 1BH3A 4JFBA 4KRAA 4LSFA 3HWBA 2FGRA 1GFQA 2QTKA 3SYSA 2PORA 3VY8X 1HXTA 1BT9A 3SZDA 1MPFA 3WI4A 2XE2A 2J4UP 2XG6A 3T0SA 3VZUX 8PRNA 7PRNA 1OSMA 3PORA 2Y2XA 1E54A 1GFMA 1PHOA 5DL5A 3POXA 1H6S1 2Y0HA 1OPFA 4LSHA 2Y0KA 4C69X 6PRNA 4FT6A 3HW9A 4LSEA 4FOZA 2Y0LA 3VZTX 3NSGA 4RJWA 2ZFGA 4AUIA 4D65A 2PRNA 4RJXA 5PRNA 3EMNX 3POQA 2OMFA 4FSPA 2J1NA 2XE5A 5JDPA 3JTYA 4D5UA 3SY7A 3SZVA 5DL6A 3UPGA 3T20A 4D64A 2O4VA 3K19A 1GFPA 2FGQX 4KR4A 3VZWX 3O0EA 5DL8A 5FVNA 3VY9X 4FSOA 4FMSA 3FYXA 3WI5A 2K4TA 4BUMX 4FRTA 2XE1A 4LSIA 3SY9A 4KR8A 1PRNA 1HXUA 4GCQA 1GFOA 3T24A 2ZLDA 3POUA 3PRNA 3SYBA 5DL7A 2ODJA
chains in the Genus database with same CATH superfamily
3JCUO 4RLCA 4GCPA 3UU2A 5ADXK 2X27X 4N58A 4U9CA 2XE3A 4FRXA 3NJTA 1HXXA 4B61A 4AYDC 4E1TA 3A2SX 4GCSA 2F1TA 3AA1A 1GFNA 2LHFA 1BH3A 4JFBA 4PR7A 3QRAA 1P4TA 4C4VA 3PQUA 2KC0A 2W81C 4KRAA 2R4OA 3PF1A 3HWBA 2FGRA 2R4PA 4LSFA 1GFQA 2XMXA 4FUVA 5B5EO 3BRZA 2QTKA 1T1LA 3LK3A 4F4BA 3SYSA 4AYNA 3AAAB 4CTDA 5B66O 2YPVA 2PORA 4GF4A 4GHBA 4QQ1A 2XTQA 3AA7A 4O4XA 3VY8X 1YS5A 1HXTA 4Z3TA 3LK2B 1ZHTA 1BT9A 3AA7B 3PGUA 1ZHXA 4FZLA 3SZDA 4FZNA 1MPFA 4UB8O 3AAEA 4K3CA 3UAQA 3WI4A 2R88A 2X9KA 2XE2A 2J4UP 1BXWA 3KZIO 2XG6A 1S5LO 3PGRA 3T0SA 3VZUX 5AFUK 8PRNA 1IZNA 5H2FO 1Q9FA 2WVPA 7PRNA 1OSMA 3PORA 4XNKA 5GTHO 3AA1B 2Y2XA 4FQEA 4AKMA 1E54A 1GFMA 2IWVA 4JCHA 1PHOA 4AKRA 2KZ7A 5DL5A 4C4VB 4UB6O 5G39A 2ERVA 3C5OA 4PUXA 3POXA 2WJRA 1QJ8A 1H6S1 2XTRA 3A0HO 2Y0HA 5GTIO 3TZGA 4E1SA 5G26A 1OPFA 3PQSA 2Y0KA 3LK3B 2GE4A 3AA6A 4LSHA 3DA4A 5KAIO 3RBHA 3WU2O 4FT6A 3G7GA 4C69X 3HW9A 6PRNA 4LSEA 4FOZA 1ZHWA 2R4NA 3AA6B 2Y0LA 3VZTX 3KVDD 2JQYA 3NSGA 3GP6A 3PGSA 3LK41 2ZFGA 4RJWA 4AUIA 2KXPA 2MNHA 4AYID 5ADXL 1MM5A 4O3YA 4FESA 4D65A 2PRNA 4RJXA 3AA0A 1ZHYA 3BS0A 4O3WA 5E79O 5PRNA 4G75A 4O3ZA 5T5FA 4C00A 4AZLA 2W80C 3AAEB 4G76A 3V8UA 4XNLA 3EMNX 1MM4A 3POQA 2M06A 2OMFA 4FSPA 3VE1A 2M07A 2J1NA 2XE5A 3QRCA 4AYMC 5JDPA 1IZNB 2JMMA 3JTYA 4O49A 5D5DA 2LFUA 4K3BA 4D5UA 4AYEC 2N2LA 2Y7SA 2N2MA 2R8AA 4AKRB 3SY7A 2KZ7B 1QJPA 2K0LA 4RLBA 5DL6A 3SZVA 3UPGA 3T20A 4D64A 2O4VA 3K19A 1GFPA 3HOEA 2FGQX 4KR4A 4O4UA 1Q9GA 1THQA 4RL9A 5G3AA 3VZWX 5TISO 3O0EA 5DL8A 5FVNA 2F1CX 3DZMA 3A0BO 3DA3A 3DWNA 3VY9X 4N75A 2IWWA 2WJQA 4FMSA 2KXPB 4FSOA 3LK42 3FYXA 3WI5A 1ZHZA 5AFUL 3AA0B 2K4TA 5KAFO 1T16A 2R4LA 4PJ0O 5G38A 3BRYA 4BUMX 4FRTA 2MHLA 3DWOX 2XE1A 4O3XB 1ORMA 2R89A 2KDYA 3AAAA 4LSIA 3SY9A 4FZMA 4N59A 4IL6O 4KR8A 3VE2A 5EE2A 1PRNA 1QJ9A 4AFKA 4N74A 1HXUA 3LK2A 1G90A 2YNKA 4GCQA 5GV0A 5IYUA 1GFOA 3HOLA 2AXTO 2F1VA 3T24A 2ZLDA 3POUA 3PRNA 3SYBA 5DL7A 2ODJA
chains in the Genus database with same CATH topology
4RLCA 4GCPA 3UU2A 5ADXK 2X27X 4N58A 4U9CA 2XE3A 4FRXA 1HXXA 4B61A 4AYDC 4E1TA 3A2SX 4GCSA 2F1TA 3AA1A 1GFNA 2LHFA 1BH3A 4JFBA 3QRAA 1P4TA 3PQUA 2KC0A 2W81C 4KRAA 4LSFA 3HWBA 2FGRA 1GFQA 2XMXA 4FUVA 2QTKA 3LK3A 4F4BA 3SYSA 4AYNA 3AAAB 2YPVA 2PORA 4GF4A 4GHBA 4QQ1A 2XTQA 3AA7A 4O4XA 3VY8X 1YS5A 1HXTA 4Z3TA 3LK2B 1ZHTA 1BT9A 3AA7B 4FZLA 1ZHXA 3SZDA 4FZNA 1MPFA 3AAEA 3WI4A 3UAQA 2XE2A 2J4UP 1BXWA 2XG6A 3T0SA 3VZUX 5AFUK 8PRNA 1IZNA 1Q9FA 7PRNA 1OSMA 3PORA 4XNKA 3AA1B 2Y2XA 4AKMA 1E54A 1GFMA 4JCHA 4AKRA 1PHOA 2KZ7A 5DL5A 2ERVA 3C5OA 4PUXA 3POXA 1QJ8A 1H6S1 2XTRA 2Y0HA 3TZGA 4E1SA 5G26A 1OPFA 3PQSA 2Y0KA 3LK3B 2GE4A 3AA6A 4LSHA 3DA4A 3RBHA 4C69X 6PRNA 4FT6A 3G7GA 3HW9A 4LSEA 4FOZA 1ZHWA 3AA6B 2Y0LA 3VZTX 3KVDD 3NSGA 3GP6A 4RJWA 3LK41 2ZFGA 4AUIA 4AYID 2KXPA 2MNHA 5ADXL 1MM5A 4O3YA 4FESA 4D65A 2PRNA 4RJXA 3AA0A 1ZHYA 4O3WA 5PRNA 5T5FA 4G75A 4O3ZA 4AZLA 2W80C 3AAEB 4G76A 3V8UA 4XNLA 3EMNX 1MM4A 3POQA 2M06A 2OMFA 4FSPA 3VE1A 2M07A 2J1NA 2XE5A 3QRCA 4AYMC 5JDPA 1IZNB 2JMMA 3JTYA 4O49A 5D5DA 2LFUA 4D5UA 4AYEC 2N2LA 2Y7SA 2N2MA 4AKRB 3SY7A 2KZ7B 1QJPA 2K0LA 4RLBA 5DL6A 3SZVA 3UPGA 3T20A 4D64A 2O4VA 3K19A 1GFPA 3HOEA 2FGQX 4KR4A 4O4UA 1Q9GA 1THQA 4RL9A 3VZWX 3O0EA 5DL8A 5FVNA 3DA3A 3VY9X 4FSOA 4FMSA 2KXPB 3LK42 3FYXA 3WI5A 1ZHZA 5AFUL 3AA0B 2K4TA 4BUMX 4FRTA 2MHLA 2XE1A 4O3XB 1ORMA 2KDYA 3AAAA 4LSIA 3SY9A 4FZMA 4N59A 3VE2A 4KR8A 5EE2A 1PRNA 1QJ9A 4AFKA 1HXUA 3LK2A 1G90A 2YNKA 4GCQA 5GV0A 5IYUA 1GFOA 3HOLA 2F1VA 3T24A 2ZLDA 3POUA 3PRNA 3SYBA 5DL7A 2ODJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCP A;  3UU2 A;  2XE3 A;  4FRX A;  1HXX A;  3A2S X;  4GCS A;  1GFN A;  1BH3 A;  4JFB A;  4KRA A;  4LSF A;  3HWB A;  2FGR A;  1GFQ A;  2QTK A;  3SYS A;  2POR A;  3VY8 X;  1HXT A;  1BT9 A;  3SZD A;  1MPF A;  3WI4 A;  2XE2 A;  2J4U P;  2XG6 A;  3T0S A;  3VZU X;  8PRN A;  7PRN A;  1OSM A;  3POR A;  2Y2X A;  1E54 A;  1GFM A;  1PHO A;  5DL5 A;  3POX A;  1H6S 1;  2Y0H A;  1OPF A;  4LSH A;  2Y0K A;  4C69 X;  6PRN A;  4FT6 A;  3HW9 A;  4LSE A;  4FOZ A;  2Y0L A;  3VZT X;  3NSG A;  4RJW A;  2ZFG A;  4AUI A;  4D65 A;  2PRN A;  4RJX A;  5PRN A;  3EMN X;  3POQ A;  2OMF A;  4FSP A;  2J1N A;  2XE5 A;  5JDP A;  3JTY A;  4D5U A;  3SY7 A;  3SZV A;  5DL6 A;  3UPG A;  3T20 A;  4D64 A;  2O4V A;  3K19 A;  1GFP A;  2FGQ X;  4KR4 A;  3VZW X;  3O0E A;  5DL8 A;  5FVN A;  3VY9 X;  4FSO A;  4FMS A;  3FYX A;  3WI5 A;  2K4T A;  4BUM X;  4FRT A;  2XE1 A;  4LSI A;  3SY9 A;  4KR8 A;  1PRN A;  1HXU A;  4GCQ A;  1GFO A;  3T24 A;  2ZLD A;  3POU A;  3PRN A;  3SYB A;  5DL7 A;  2ODJ A; 
#chains in the Genus database with same CATH topology
 3JCU O;  4RLC A;  4GCP A;  3UU2 A;  5ADX K;  2X27 X;  4N58 A;  4U9C A;  2XE3 A;  4FRX A;  3NJT A;  1HXX A;  4B61 A;  4AYD C;  4E1T A;  3A2S X;  4GCS A;  2F1T A;  3AA1 A;  1GFN A;  2LHF A;  1BH3 A;  4JFB A;  4PR7 A;  3QRA A;  1P4T A;  4C4V A;  3PQU A;  2KC0 A;  2W81 C;  4KRA A;  2R4O A;  3PF1 A;  3HWB A;  2FGR A;  2R4P A;  4LSF A;  1GFQ A;  2XMX A;  4FUV A;  5B5E O;  3BRZ A;  2QTK A;  1T1L A;  3LK3 A;  4F4B A;  3SYS A;  4AYN A;  3AAA B;  4CTD A;  5B66 O;  2YPV A;  2POR A;  4GF4 A;  4GHB A;  4QQ1 A;  2XTQ A;  3AA7 A;  4O4X A;  3VY8 X;  1YS5 A;  1HXT A;  4Z3T A;  3LK2 B;  1ZHT A;  1BT9 A;  3AA7 B;  3PGU A;  1ZHX A;  4FZL A;  3SZD A;  4FZN A;  1MPF A;  4UB8 O;  3AAE A;  4K3C A;  3UAQ A;  3WI4 A;  2R88 A;  2X9K A;  2XE2 A;  2J4U P;  1BXW A;  3KZI O;  2XG6 A;  1S5L O;  3PGR A;  3T0S A;  3VZU X;  5AFU K;  8PRN A;  1IZN A;  5H2F O;  1Q9F A;  2WVP A;  7PRN A;  1OSM A;  3POR A;  4XNK A;  5GTH O;  3AA1 B;  2Y2X A;  4FQE A;  4AKM A;  1E54 A;  1GFM A;  2IWV A;  4JCH A;  1PHO A;  4AKR A;  2KZ7 A;  5DL5 A;  4C4V B;  4UB6 O;  5G39 A;  2ERV A;  3C5O A;  4PUX A;  3POX A;  2WJR A;  1QJ8 A;  1H6S 1;  2XTR A;  3A0H O;  2Y0H A;  5GTI O;  3TZG A;  4E1S A;  5G26 A;  1OPF A;  3PQS A;  2Y0K A;  3LK3 B;  2GE4 A;  3AA6 A;  4LSH A;  3DA4 A;  5KAI O;  3RBH A;  3WU2 O;  4FT6 A;  3G7G A;  4C69 X;  3HW9 A;  6PRN A;  4LSE A;  4FOZ A;  1ZHW A;  2R4N A;  3AA6 B;  2Y0L A;  3VZT X;  3KVD D;  2JQY A;  3NSG A;  3GP6 A;  3PGS A;  3LK4 1;  2ZFG A;  4RJW A;  4AUI A;  2KXP A;  2MNH A;  4AYI D;  5ADX L;  1MM5 A;  4O3Y A;  4FES A;  4D65 A;  2PRN A;  4RJX A;  3AA0 A;  1ZHY A;  3BS0 A;  4O3W A;  5E79 O;  5PRN A;  4G75 A;  4O3Z A;  5T5F A;  4C00 A;  4AZL A;  2W80 C;  3AAE B;  4G76 A;  3V8U A;  4XNL A;  3EMN X;  1MM4 A;  3POQ A;  2M06 A;  2OMF A;  4FSP A;  3VE1 A;  2M07 A;  2J1N A;  2XE5 A;  3QRC A;  4AYM C;  5JDP A;  1IZN B;  2JMM A;  3JTY A;  4O49 A;  5D5D A;  2LFU A;  4K3B A;  4D5U A;  4AYE C;  2N2L A;  2Y7S A;  2N2M A;  2R8A A;  4AKR B;  3SY7 A;  2KZ7 B;  1QJP A;  2K0L A;  4RLB A;  5DL6 A;  3SZV A;  3UPG A;  3T20 A;  4D64 A;  2O4V A;  3K19 A;  1GFP A;  3HOE A;  2FGQ X;  4KR4 A;  4O4U A;  1Q9G A;  1THQ A;  4RL9 A;  5G3A A;  3VZW X;  5TIS O;  3O0E A;  5DL8 A;  5FVN A;  2F1C X;  3DZM A;  3A0B O;  3DA3 A;  3DWN A;  3VY9 X;  4N75 A;  2IWW A;  2WJQ A;  4FMS A;  2KXP B;  4FSO A;  3LK4 2;  3FYX A;  3WI5 A;  1ZHZ A;  5AFU L;  3AA0 B;  2K4T A;  5KAF O;  1T16 A;  2R4L A;  4PJ0 O;  5G38 A;  3BRY A;  4BUM X;  4FRT A;  2MHL A;  3DWO X;  2XE1 A;  4O3X B;  1ORM A;  2R89 A;  2KDY A;  3AAA A;  4LSI A;  3SY9 A;  4FZM A;  4N59 A;  4IL6 O;  4KR8 A;  3VE2 A;  5EE2 A;  1PRN A;  1QJ9 A;  4AFK A;  4N74 A;  1HXU A;  3LK2 A;  1G90 A;  2YNK A;  4GCQ A;  5GV0 A;  5IYU A;  1GFO A;  3HOL A;  2AXT O;  2F1V A;  3T24 A;  2ZLD A;  3POU A;  3PRN A;  3SYB A;  5DL7 A;  2ODJ A; 
#chains in the Genus database with same CATH homology
 4RLC A;  4GCP A;  3UU2 A;  5ADX K;  2X27 X;  4N58 A;  4U9C A;  2XE3 A;  4FRX A;  1HXX A;  4B61 A;  4AYD C;  4E1T A;  3A2S X;  4GCS A;  2F1T A;  3AA1 A;  1GFN A;  2LHF A;  1BH3 A;  4JFB A;  3QRA A;  1P4T A;  3PQU A;  2KC0 A;  2W81 C;  4KRA A;  4LSF A;  3HWB A;  2FGR A;  1GFQ A;  2XMX A;  4FUV A;  2QTK A;  3LK3 A;  4F4B A;  3SYS A;  4AYN A;  3AAA B;  2YPV A;  2POR A;  4GF4 A;  4GHB A;  4QQ1 A;  2XTQ A;  3AA7 A;  4O4X A;  3VY8 X;  1YS5 A;  1HXT A;  4Z3T A;  3LK2 B;  1ZHT A;  1BT9 A;  3AA7 B;  4FZL A;  1ZHX A;  3SZD A;  4FZN A;  1MPF A;  3AAE A;  3WI4 A;  3UAQ A;  2XE2 A;  2J4U P;  1BXW A;  2XG6 A;  3T0S A;  3VZU X;  5AFU K;  8PRN A;  1IZN A;  1Q9F A;  7PRN A;  1OSM A;  3POR A;  4XNK A;  3AA1 B;  2Y2X A;  4AKM A;  1E54 A;  1GFM A;  4JCH A;  4AKR A;  1PHO A;  2KZ7 A;  5DL5 A;  2ERV A;  3C5O A;  4PUX A;  3POX A;  1QJ8 A;  1H6S 1;  2XTR A;  2Y0H A;  3TZG A;  4E1S A;  5G26 A;  1OPF A;  3PQS A;  2Y0K A;  3LK3 B;  2GE4 A;  3AA6 A;  4LSH A;  3DA4 A;  3RBH A;  4C69 X;  6PRN A;  4FT6 A;  3G7G A;  3HW9 A;  4LSE A;  4FOZ A;  1ZHW A;  3AA6 B;  2Y0L A;  3VZT X;  3KVD D;  3NSG A;  3GP6 A;  4RJW A;  3LK4 1;  2ZFG A;  4AUI A;  4AYI D;  2KXP A;  2MNH A;  5ADX L;  1MM5 A;  4O3Y A;  4FES A;  4D65 A;  2PRN A;  4RJX A;  3AA0 A;  1ZHY A;  4O3W A;  5PRN A;  5T5F A;  4G75 A;  4O3Z A;  4AZL A;  2W80 C;  3AAE B;  4G76 A;  3V8U A;  4XNL A;  3EMN X;  1MM4 A;  3POQ A;  2M06 A;  2OMF A;  4FSP A;  3VE1 A;  2M07 A;  2J1N A;  2XE5 A;  3QRC A;  4AYM C;  5JDP A;  1IZN B;  2JMM A;  3JTY A;  4O49 A;  5D5D A;  2LFU A;  4D5U A;  4AYE C;  2N2L A;  2Y7S A;  2N2M A;  4AKR B;  3SY7 A;  2KZ7 B;  1QJP A;  2K0L A;  4RLB A;  5DL6 A;  3SZV A;  3UPG A;  3T20 A;  4D64 A;  2O4V A;  3K19 A;  1GFP A;  3HOE A;  2FGQ X;  4KR4 A;  4O4U A;  1Q9G A;  1THQ A;  4RL9 A;  3VZW X;  3O0E A;  5DL8 A;  5FVN A;  3DA3 A;  3VY9 X;  4FSO A;  4FMS A;  2KXP B;  3LK4 2;  3FYX A;  3WI5 A;  1ZHZ A;  5AFU L;  3AA0 B;  2K4T A;  4BUM X;  4FRT A;  2MHL A;  2XE1 A;  4O3X B;  1ORM A;  2KDY A;  3AAA A;  4LSI A;  3SY9 A;  4FZM A;  4N59 A;  3VE2 A;  4KR8 A;  5EE2 A;  1PRN A;  1QJ9 A;  4AFK A;  1HXU A;  3LK2 A;  1G90 A;  2YNK A;  4GCQ A;  5GV0 A;  5IYU A;  1GFO A;  3HOL A;  2F1V A;  3T24 A;  2ZLD A;  3POU A;  3PRN A;  3SYB A;  5DL7 A;  2ODJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...