4U9CA

Structure of the lbpb n-lobe from neisseria meningitidis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
286
Chain Sequence
PVNRPAVGAAMRLPRRNIASYKPDKHQAEEHLPLKEKDILFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKEKTSEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGSTDLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVNPNEPKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNSVFGVFAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of lactoferrin-binding protein B from Neisseria meningitidis suggests roles in iron acquisition and neutralization of host defences.
pubmed doi rcsb
source organism Neisseria meningitidis cu385
molecule tags Lactoferrin-binding protein
molecule keywords Lactoferrin-binding protein B
total genus 89
structure length 286
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u9cA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4u9cA02
2Y7SA 4AYNA 5T5FA 3VE1A 2KDYA 4O3YA 4O3WA 4O4XA 4O3XB 2KC0A 4O3ZA 3VE2A 3HOLA 4Z3TA 4AYMC 4AYDC 4AYID 3HOEA 4AYEC 3PQUA 4U9CA 3V8UA 4QQ1A 3PQSA 4O49A 3UAQA 1YS5A 2YPVA 5EE2A 2W81C 3KVDD 4O4UA 2W80C 2LFUA
chains in the Genus database with same CATH superfamily
2R4NA 5F7GA 2Q9SA 4GE1A 2Y3EA 2C1SA 1GXAA 5B27A 5EEEA 1EXSA 2JU8A 4O9SA 1AVEA 5LJHA 3P6GA 1E02A 1T68X 4UU2A 1N0SA 2X56A 5H9AA 1GT1A 5F1EA 3BX8A 1VWJB 2HYSA 4JO6A 4O4XA 3KZIO 4GU8A 1BM5A 4FMSA 4CPEA 2DJGA 1IFCA 3APWA 1JYJA 4BQUA 4RUUA 1O1VA 2FR2A 1ICMA 1SWTA 3FYFA 4MVKA 1SWDA 1SWCA 4EXZA 3RY2A 3FW5A 4U8UN 1CBIA 2BS5A 4OEMA 3DA4A 4OS8A 2J4UP 3WJDA 2Q2MA 3JQOA 3RDSA 1YWCA 4ZR2A 5AJCA 2X55A 4GDZA 2OY8A 3RSWA 3JCUO 2VFCA 2FR3A 1AQBA 2ODJA 4M6SA 4NP1A 5KICA 4C4VB 4GRJA 4HPCA 2Y2XA 2L9CA 1Q9FA 4BX6A 1OBPA 3VG3A 5IO5A 3C78X 1KT6A 1SWHA 3JTYA 5BVQA 2IZGB 1EIOA 5DL6A 3CBSA 1JJUA 1SWBA 2BLGA 2Z4HA 3AAEA 3TZSA 1NP1A 3B2JA 2JMMA 4HPAA 4DNEA 2MO5A 5KHPA 1W5RA 3GAQA 2GTFX 1I4UA 5F58A 3ELXA 1FTPA 2IZHB 4JNJA 3NQKA 4RL9A 4ML7B 4MIRA 2K0LA 5D8JA 4LSHA 2IZIA 4D65A 1QJ9A 4ZHGA 3RDMA 3TGAA 4RLBA 8PRNA 3WJEA 1MM9A 2C4IA 3HOEA 3PGSA 5D48A 2ZAGA 3Q6LA 4A8ZA 4AZQA 4Y0PA 2Y32A 3AA0A 4E1TA 4YGGA 1GFNA 3KZAA 3NSGA 1HXLA 1KQXA 3PDFA 1G85A 3AEHA 1N43A 4PUXA 1A2DA 2YG2A 5G26A 2AF5A 3S5VA 1HMRA 5HTDA 2F1TA 4K3CA 1BRQA 5F6BA 4ZGFA 4BX6B 2W2AA 4OS3A 2CBSA 1TW4A 3AAAA 4TQ2A 2N93A 4FBOA 3RDOA 4BX5A 2F73A 3WYPA 1KL3A 5L3YA 4A1HA 1KT3A 2FKGA 4FGIB 3C76X 1UYNX 5KIDA 3LTWA 1SWRA 1H6S1 2MM3A 2ANSA 3SLOA 4YVBA 2DM5A 4NV7A 1NQMA 1STSB 1ZHTA 1BLRA 3RE6A 1AB0A 4UB6O 4GCQA 2IZKA 5BYPA 1ZHWA 4YFPA 3VG7A 1KGLA 5HCDC 4GJVA 1PRNA 1LELA 4YDBA 5K68A 1QWDA 1WUBA 1STRB 1HMTA 3PF1A 4YCEA 2XG6A 3PGUA 3BS2A 2X8TA 1KZXA 4Y0SA 5BVSA 4IB8A 5B3MO 1NC9A 1T8VA 1SWEA 4O3YA 1SWOA 4C5PA 5CE4A 4AKRB 1D2UA 1SWPA 1Z24A 5D5DA 1R0UA 2HMBA 3VY8X 3KQ0A 4MISA 2QMIA 1AVDA 3G7GA 2Y0KA 3D97A 3KFGA 1GFOA 4FRTA 1ZHZA 2WPUA 3KFHA 4INNA 4L3RA 1STPA 4Y0QA 4MVIA 1DZMA 2R89A 2OVEA 1W4TA 5IYUA 3EC5A 5LJGA 4FQBB 5GTHO 4KIIA 1RBPA 2YMSA 1S7DA 4CDEA 1ZNHA 1QFVA 3AAAB 4AYID 2VDFA 1VWQB 3VG6A 7PRNA 4MEEA 4FZMA 2KW1A 4ZH6A 2OL6O 4OELA 1SA8A 1KOIA 1N7YA 2Y7SA 1JYDA 3NX1A 4GKCA 3H3IA 1SXUA 3FR5A 2BHVA 2LB6A 2AT6X 1SWQA 4CTDA 1SWFA 2CZUA 4IRWA 2FHNX 4KCAA 2ACPX 1EQDA 1MM4A 1B56A 3T24A 3FW4A 1JZUA 4YCHA 2RTAA 3KFIA 1GGLA 4JFBA 2FGRA 3RE5A 4TJZA 2XE1A 4PJ2A 5FENA 5JDPA 1YIVA 2MNHA 2CBRA 3LHNA 3LK3B 2I5VO 3KVNA 1T16A 2RTEB 2XKLA 4EEJA 5FQ8E 2HZRA 4GH7A 3P24A 4A1YA 2BC3A 1SRHA 3T0SA 4G76A 1UREA 2JQYA 3MG5A 4AZNA 1X8PA 3SLJA 2KC0A 5FFHA 3FEPA 4GK9A 1GFQA 2ACOA 1K3BA 4KC8A 2KD2A 3HWEA 4Z2VA 2O62A 5HZ9A 2XTRA 4NV8A 4B55A 3HWBA 3HWDA 2RD7C 2F1CX 4I6SA 5PRNA 4BUMX 2ASNX 1LIFA 1W6FA 3PORA 4NYRA 1N9MA 1OSPO 2RN4A 3NX2A 4DQ3A 3AA7A 1RXJA 4BX7B 4GF4A 2BSZA 2L68A 3FA6A 4LSIA 2OFRX 4LSFA 4NLJA 4TNNA 3DWOX 1SXXA 2FHLA 2HKDA 1LDOA 1MOYA 1OPBA 2Z4IA 3T6LA 1JJXA 4U46A 4CPIA 1SWLA 3RY1A 4ZHCA 1QJ8A 3SZJA 1OPAA 1Y9TA 5B66O 4Z2PA 3PECA 4XMGA 2AL0X 3O2YA 2IZAA 2CM9A 4D6AA 5CHKA 5B5GA 2MHDA 2WEWA 3I17A 3VU1A 4KH8A 2RTPB 3POUA 1SREA 1P6PA 4ORWA 4C69X 5IO7A 3A0HO 1Y0GA 4RLCA 5F6ZA 4DQ4A 1VWLB 4NW4A 2OL8O 1YWDA 3PQSA 5IO6A 5F2BA 3ZW0A 1MVGA 5D45A 3RKGA 3AKMA 1X89A 2G7BA 2I5ZO 5T5FA 1VWNB 3BS0A 2C1QA 1BWYA 3WJGA 4GUZA 2RTJA 3P6CA 2R4OA 1PBYA 3CKFA 2A5CA 2RQ0A 3CWKA 1IZNB 4CPFA 3I0AA 2XE2A 2KTSA 4AW8A 1BRPA 3FELA 1ZHYA 2GTLN 3LK3A 2W2BA 3WZPA 5FAZA 3RDUA 5H9NA 2F09A 2GE4A 5FQ7E 1HBPA 1Y52X 5IRWA 1BT9A 4HFOA 4YBPA 5H2FO 3A0BO 3AAEB 3BRNA 2QO4A 3HPEA 4GGTA 4C4VA 3HTYA 4ALBA 1L6MA 1VYOA 2A3FX 3MX7A 1LDQA 4CV7A 2Q2PA 2XTQA 4AUIA 2X46A 4I9SA 1IKJA 3WJCA 1CBSA 4TLJA 3PEDA 4QGXA 4FOZA 3D9WA 2XE5A 3BRZA 2JN3A 4L1NA 1BBPA 1GKAB 3WI5A 2AT0X 2MJIA 2GH7A 2IZJA 3RDXA 1VWEB 2M06A 2FT9A 1VWIB 5EE2A 3BRYA 2X8SA 1KQWA 1ALBA 3CKGA 4WFUA 2L5PA 2OFBA 1X8OA 1O1UA 5HA0A 3ZWEA 1JV4A 3ZW1A 4AZPA 2A8GA 1SXYA 1YS5A 4D64A 3B2HA 2W80C 3NQ9A 2AT5X 1SRFA 1GX8A 3QRCA 2QOSC 3SYSA 4EQAC 1TOUA 1G7NA 3RWXA 3CQNA 1MPFA 1MX8A 2JW1A 3APUA 3TZGA 2OFAA 1TXLA 4CDFA 3LK42 4ZH9A 1VYFA 4I3BA 3EMNX 3QKGA 3TGCA 5HZ5A 4PSQA 1ORMA 2WR6A 3DZMA 2RTHB 1KXOA 2GC9A 3JS1A 1U18A 3RBYA 5K06A 3LK2A 2G78A 1QY1A 1YP6A 2LBAA 2AXTO 3K3LA 5D4AA 1LF7A 5G39A 5DL7A 1VWMB 4O3WA 4B61A 4KRAA 5HZQA 2N2LA 3EMMA 1Y53X 4QGVA 5H9KA 1SMPI 2Q4NA 2RTOB 2RTQB 4XMHA 3RDQA 3VPJE 1LNMA 3HW9A 4KT5A 3FA7A 1MDCA 4AYNA 3FA9A 1XCAA 4JGLA 1SRGA 5KAFO 1JJJA 2X8FA 1E06A 3NP1A 3B2LA 5H8TA 3F6ZB 1LUQA 1DF8A 5C0NA 2RCQA 1OBQA 1ZNDA 1FE3A 2WQ9A 5ADXL 1HQQA 5LJCA 4N59A 3IA8A 4EFGA 2FGSA 3APXA 3OE3A 1BH3A 4GZVA 4NNSA 1I06A 3ZUIA 1CBQA 2CAMA 3P6EA 3NR3A 4OMWA 1KZWA 1X71A 4YGZA 2X34A 1E54A 1KT5A 3VG5A 3GP6A 2OF9A 1IZNA 1D3SA 3UEWA 5KAIO 4U8UO 1G90A 5L8OA 1YUPA 1ERBA 4ORRA 4LSEA 3DWNA 2W2FA 1GM6A 3ZZVA 1GT3A 2QCBA 4ORSA 3FMZA 4ZJ0A 3T2XA 4NYQA 1Y55X 1VWHB 4A60A 2WVPA 4GNYA 4IB9A 1SRIA 3MVFA 1PMPA 1MEPA 2WJRA 2RTLA 2RA6A 2RTFB 2KZ7B 4U8UM 3KVDD 1VWOB 2RTCB 1I05A 4I3CA 3F8AA 2X45A 1LKEA 4N74A 3SY9A 1FENA 5B2AO 3POQA 5FQ6E 4I9RA 4AYMC 1T1LA 3BLGA 2OYBO 4E1SA 4PJ0O 2X4MA 3UEXA 5G3AA 3QRAA 1G5WA 5EDCA 1RAVA 1ZRYA 2MWHA 2K23A 1I78A 3APVA 1GX3A 2DJFA 1DV9A 2JOZA 3WI4A 3JSQA 3FYXA 5HA1A 4XNKA 3PQUA 2IFBA 1NP4A 2AMMX 5HCEC 1UYOX 5DPQA 4FSPA 1SWNA 4OS0A 1HN2A 4MVEA 1O8VA 5AFUL 2QO6A 4HPBA 2OFMX 2KXPA 4QZUA 4BX7A 2G79A 4R0BA 4CSBA 4FQEA 4NNTA 1HMSA 4GGRA 3B2KA 1T0VA 1HY2A 2A2UA 2A2GA 2RTNB 5AFUK 2XMXA 3B2IA 4YGHA 2R8AA 3VG2A 1FDQA 1S44A 3EBWA 4Y0RA 3EW2A 1VWAB 2R74A 4I60A 4ORUA 4CK4A 3AA6B 4YFRA 1HQPA 1QFTA 2FLJA 1A3YA 4YDAA 3PK2A 5AEOA 2EU7X 2RTRB 2LBVA 3ELZA 4BBOA 2BT9A 2A0AA 2G8CO 3S26A 3VHMA 2MHLA 2K4TA 1FEMA 4QQ1A 4Y5DA 4IB6A 3O22A 1X8QA 5DL5A 4YBUA 5HZ6A 4AZMA 4GD9A 1ZNEA 4FSOA 1PBOA 4YKOA 3VY9X 4OMXA 1DC9A 4IB7A 1BSOA 4AYEC 1EIIA 2WJQA 3U0DA 4GJSA 2ZSCA 4FZLA 1QY2A 4HWMA 1SWKA 3WVMA 4AZRA 2ERVA 1THQA 4YMYA 3P6HA 3VHHA 1U0XA 3RBHA 1SY0A 4HPDA 3VE2A 3WJBA 5GTIO 4ZFXA 3S60A 3KFFA 1BXWA 2AKQA 3SAOA 5LKEA 1RLBE 3UU2A 5JD2A 2POAA 3NADA 5FVNA 2UZ2A 1QQSA 2O4VA 1X8NA 4TKBA 5LJKA 1E00A 5DG4A 2R4PA 4I3DA 2PY1A 4ZCBA 2FGQX 2MF6A 1P4TA 2RCTA 3HK1A 2J1NA 4UU3A 4F4BA 1ERXA 5AQ6A 4Z28A 1Y9LA 4N7CA 4IMOA 2RTIB 3POXA 2LHFA 1QG5A 3DTQA 2AH7X 2KXPB 1OSMA 2OZQA 4KC7A 4Z3TA 3EM0A 3T6FA 4BJ8A 3FIQA 1HXUA 3WU2O 1VPRA 1MK5A 1DZJA 3CMPA 3NJTA 3ZW1B 2X32A 3CBCA 2WSJA 1LCWA 4LKTA 4AYHA 3OBLA 1XKIA 4ID2A 4M7MA 5CSEA 5G38A 1RXKA 4O3ZA 1VWBB 1ML7A 1SRJA 4LZVA 2GJ5A 3T2WA 4BCSA 3BU1A 5LJDA 2NNEA 1LPJA 3NQ3A 3ZUOA 1GT4A 1K24A 1GFMA 2FS6A 3SOTA 1PM1X 3SY7A 1GKAA 4ODDA 3WOVA 4RJXA 2HLVA 5E79O 5CYBA 2RTKA 2QOMA 1EPAA 3AA7B 4ZHFA 3FR4A 4ORYA 2IZFB 4QGWA 5GV0A 4LKPA 1S2PA 4K19A 5B5FA 3HOLA 3F9DA 3AA0B 2OVSA 2M07A 3PP6A 2WUTA 5TISO 3TF6A 2OMFA 4Y59A 3BDRA 3O0EA 2Y3FA 1OEJA 2IZDB 2JU7A 3UEUA 3BX7A 3SZDA 3C77X 4EKVA 3DSZA 2HNXA 4N75A 1SWAA 1GT5A 4ES7A 1CJ5A 4AZOA 1DF3A 4O4UA 4IAWA 1EI5A 1FJ1E 2LA7A 4AZLA 1IJ8A 5EPQA 5HTEA 2FRSA 2OY7A 1SXWA 1N4JA 3D95A 4WHIA 4YKMA 1MM5A 1SLGB 4O49A 1DFVA 2WWPA 2KTDA 3X00A 3FLLA 1KL5A 3FIDA 3OJYC 2R73A 3STNA 1GX9A 3FEKA 1HXZA 4O3XB 1OBUA 1ZHXA 2IZLB 1SWGA 4ZHDA 1SY2A 1LIDA 2R56A 1E2TA 1JQPA 4XMDA 4DCBA 2YNKA 4LZUA 4FESA 4FBVA 2G5LA 4XMFA 1KT7A 3PGRA 4O4OA 4TKJA 1SLFB 2KDYA 4FZNA 3FR2A 5LJEA 4C00A 3WZNA 1JMXA 3G7XA 3T20A 3FDCA 2AT8X 4QYPA 4NLIA 2XE3A 3MM0A 3BY0A 4CDCA 1ACDA 5HWZA 1RSTB 4ORXA 2HZQA 1GFPA 3PH5A 2X9KA 3AUMO 3WYQA 1MUPA 2NNQA 1CBRA 3WZQA 5H9LA 2F1VA 3D4RA 4D5UA 1BEBA 3STMX 4PR7A 5IRUA 1SY1A 1VWPB 4I95A 2PORA 1VWFB 1JIWI 4QYNA 1NDJA 2ALLX 4QNIA 3RZYA 5AJBA 2AVIA 3HWGA 4LQZA 1NGLA 1VWDB 1AELA 1PEEA 2UYWA 4ON1A 3N91A 4GNWA 1QJPA 1B8EA 3PPTA 4GHBA 1BSYA 3GE2A 4GCPA 3ZQ3A 2IZCB 1SLDB 5EDBA 2OVAA 1ZNKA 1JMZA 1CRBA 1ZNLA 2YPVA 3O19A 5L8NA 2IWWA 5LKFA 4COTA 1VWKB 4BGFA 2JU3A 5L8IA 4Z2OA 3T1DA 3K19A 3UPGA 4YH0A 2JMBA 4AFKA 1LIBA 2K62A 1TVQA 4BX5B 5IRAA 5ADXK 3P02A 5HAEA 3E3CA 1EPBA 4FBRA 2RTGB 2W81C 4IMNA 4OKAA 1VWRB 4FUVA 1OPFA 4XNLA 2KZ7A 1ZNGA 1VYGA 4MVLA 2ZFGA 5HZ8A 1EALA 3QQ2A 3NPOA 1SWUA 1LFOA 1IKEA 3V8UA 2CM4A 1SLEB 2RTDB 3EBKA 3WXQA 3AA1A 2GTLM 3L4RA 1JBHA 3PH6A 4CPHB 2BS6A 4Z27A 1N9YA 1G74A 1H91A 3VE1A 4GDAA 4IBAA 3A2SX 1I9HA 4JCHA 3SZVA 1HXTA 4ZGUA 2IWVA 1NQNA 4K3BA 4FRXA 3SZIA 2L67A 3CR6A 4GETA 5B5EO 5EEDA 1RXHA 3AA6A 3PRNA 6PRNA 3VG4A 3SLTA 5K67A 3WZOA 3EW1A 3ZI8A 4JHQA 4ALOA 1BSQA 1KT4A 2FWVA 4AKRA 3HWFA 5HCCC 2F01A 4AKMA 5DL8A 2WEXA 2X27X 1WBIA 1IW2A 4RUNA 3VHIA 2RTMA 1IIUA 1YWBA 3ZW0B 4D6BA 3FENA 2FTBA 2XSTA 3WBGA 4GGZA 2IZBA 5B11O 5B10O 1SWJA 1Q9GA 4G75A 2FKJA 1MX7A 2OVDA 1A18A 1SY3A 3STKA 2QO5A 1B0OA 1VWGB 1PHOA 2ZLDA 2OY5O 3EYCA 3WJFA 1TOWA 1VWCB 4YFQA 5BVTA 4EDEA 2OF8A 2Y0LA 5EZ2A 2GTLO 1EW3A 3ZW2A 4UB8O 2VFBA 4IABA 5JR8A 4AYDC 4CDDA 3LK41 2NNDA 4WBKA 1I04A 2RTBB 3VZTX 3AKNA 1E5PA 4QAEA 1QABE 4N58A 1YWAA 2QTKA 5IXGA 1S5LO 2CZTA 1YP7A 5B29A 2FS7A 2PI3O 3BSZE 4Z6JA 2QM9A 2LKKA 3Q34A 3IFBA 3VZUX 2JGSA 4BOEA 1B4MA 1AVGI 3U9PC 1UZ2X 1X8UA 1KL4A 3SYBA 5D47A 3VGWA 3UAQA 5LJBA 1NBXA 2Y0HA 4IAXA 4XMEA 1ICNA 4TKHA 4XMCA 1DZKA 4U3QA 2KT4B 2OL7A 1IFBA 4WFVA 1DZPA 2ZAIA 4QRLA 4GCSA 1FELA 1LICA 4IL6O 1HBQA 2E4JA 3VZWX 4ZHHA 1LIEA 1KFFA 4N7DA 3D96A 3AA1B 3U03A 3NBXX 1EUOA 3FA8A 2R88A 4FT6A 2WQAE 4RJWA 2OY1O 3CQRA 1U17A 3LV4A 4CPHA 2LFUA 2A5BA 1RSUB 1OEKA 1QY0A 2P8GA 3S5XA 3SZHA 1LCVA 3P6FA 2N2MA 1HXXA 3C5OA 2AT3X 1PTSA 2PRNA 3OD9A 1A57A 5HBSA 4QZTA 4KR4A 1SWSA 2NP1A 4ARHA 2A13A 2M4LA 1OEEA 2LFOA 4BVMA 3UEVA 3DA3A 2IZEB 2Q39A 4O4SA 1LCZA 3P6DA 1BJ7A 3BU9A 3TGBA 3LK2B 4U9CA 4KR8A 1ADLA 3MBTA 2R4LA
chains in the Genus database with same CATH topology
1I05A 5PRNA 4I3CA 5F7GA 4BUMX 1ACDA 2ASNX 2X45A 1LIFA 3F8AA 1LKEA 2Q9SA 5HWZA 3SY9A 1FENA 4GE1A 3POQA 4ORXA 5FQ6E 4I9RA 2HZQA 1GFPA 4AYMC 3PH5A 1GXAA 3PORA 4NYRA 1MUPA 3BLGA 2NNQA 5B27A 5EEEA 1EXSA 2JU8A 1CBRA 4E1SA 4O9SA 5H9LA 2F1VA 3D4RA 2RN4A 4D5UA 3NX2A 3UEXA 4DQ3A 3AA7A 1BEBA 5LJHA 3QRAA 3P6GA 1E02A 1T68X 3STMX 4UU2A 1N0SA 4GF4A 2L68A 1G5WA 3FA6A 5EDCA 4LSIA 1ZRYA 5H9AA 1SY1A 1GT1A 2K23A 2MWHA 3BX8A 2OFRX 4I95A 5F1EA 2PORA 4LSFA 4NLJA 4TNNA 1SXXA 2HYSA 3APVA 4O4XA 1JIWI 4GU8A 1BM5A 4FMSA 4QYNA 1DV9A 2JOZA 2KC0A 1OPBA 2ALLX 4QNIA 3WI4A 3JSQA 3FYXA 2Z4IA 5HA1A 1IFCA 4XNKA 3PQUA 2IFBA 3APWA 3RZYA 5AJBA 1NP4A 2AMMX 5HCEC 5DPQA 1JJXA 1JYJA 4BQUA 3HWGA 4FSPA 4LQZA 1NGLA 4RUUA 1AELA 1O1VA 4OS0A 1HN2A 2FR2A 4MVEA 1PEEA 4ZHCA 1ICMA 1O8VA 5AFUL 2QO6A 1QJ8A 4HPBA 2OFMX 1OPAA 1Y9TA 3FYFA 3N91A 4ON1A 2KXPA 4QZUA 2G79A 4GNWA 4MVKA 1QJPA 1B8EA 3PPTA 4GHBA 3PECA 1BSYA 4R0BA 4XMGA 4CSBA 4EXZA 2AL0X 4NNTA 3GE2A 1HMSA 3O2YA 4GCPA 3ZQ3A 3B2KA 3FW5A 4U8UN 1CBIA 2BS5A 1T0VA 3DA4A 2CM9A 4D6AA 4OS8A 2A2UA 2A2GA 5EDBA 2J4UP 2OVAA 1ZNKA 3WJDA 2Q2MA 3JQOA 1CRBA 5AFUK 2XMXA 3B2IA 4YGHA 1ZNLA 2YPVA 3O19A 2MHDA 3VG2A 2WEWA 3I17A 3VU1A 1FDQA 1YWCA 4ZR2A 1S44A 5AJCA 5L8NA 3EBWA 5LKFA 4KH8A 4COTA 4Y0RA 3POUA 4GDZA 2JU3A 3RSWA 5L8IA 3T1DA 2R74A 4ORUA 1P6PA 3K19A 3UPGA 4CK4A 4YH0A 3AA6B 2JMBA 4AFKA 1LIBA 2FR3A 1AQBA 2K62A 4ORWA 1TVQA 5IO7A 4C69X 2ODJA 4M6SA 4YFRA 1HQPA 4NP1A 4RLCA 1QFTA 2FLJA 5KICA 3P02A 5ADXK 5F6ZA 4DQ4A 1A3YA 4YDAA 5HAEA 3E3CA 4GRJA 4NW4A 4HPCA 1EPBA 1YWDA 3PQSA 4FBRA 5AEOA 2Y2XA 2EU7X 2L9CA 5IO6A 1Q9FA 2W81C 4IMNA 3ZW0A 1OBPA 4FUVA 3VG3A 1MVGA 5D45A 1OPFA 4XNLA 2LBVA 3ELZA 5IO5A 3C78X 1KT6A 3RKGA 3JTYA 2KZ7A 3AKMA 1X89A 1VYGA 1ZNGA 2BT9A 2G7BA 5BVQA 2A0AA 4MVLA 5T5FA 3S26A 2ZFGA 5HZ8A 1EIOA 5DL6A 3CBSA 2BLGA 1EALA 1BWYA 3WJGA 2Z4HA 3AAEA 3NPOA 3P6CA 3TZSA 1NP1A 3B2JA 2JMMA 1LFOA 4HPAA 1IKEA 2MHLA 2MO5A 2K4TA 1FEMA 2RQ0A 3CWKA 4QQ1A 3V8UA 5KHPA 2CM4A 3GAQA 2GTFX 1IZNB 1I4UA 5F58A 3ELXA 4IB6A 1FTPA 3EBKA 3I0AA 3WXQA 3O22A 1X8QA 2XE2A 3AA1A 2GTLM 3L4RA 3NQKA 1JBHA 4RL9A 2KTSA 4ML7B 5DL5A 4MIRA 3PH6A 2K0LA 2BS6A 4AW8A 5D8JA 1BRPA 3FELA 4YBUA 2GTLN 1G74A 1H91A 2W2BA 5HZ6A 3VE1A 4AZMA 1ZHYA 3LK3A 4LSHA 4D65A 1QJ9A 1ZNEA 4ZHGA 5FAZA 3TGAA 4IBAA 4RLBA 8PRNA 4FSOA 1PBOA 4YKOA 5H9NA 3WJEA 4OMXA 3A2SX 3VY9X 1DC9A 2F09A 4IB7A 1BSOA 2GE4A 3HOEA 4AYEC 5FQ7E 1EIIA 3U0DA 1HBPA 1BT9A 5D48A 4JCHA 2ZAGA 3SZVA 4HFOA 1HXTA 4ZGUA 4YBPA 4FZLA 1QY2A 3Q6LA 4HWMA 4A8ZA 4AZQA 3AAEB 3BRNA 2QO4A 3WVMA 4AZRA 2ERVA 4Y0PA 3HTYA 4FRXA 2L67A 4ALBA 1THQA 3AA0A 1L6MA 3CR6A 3MX7A 2A3FX 3P6HA 4GETA 4YMYA 5EEDA 4YGGA 4E1TA 1U0XA 4CV7A 3AA6A 2Q2PA 3RBHA 2XTQA 1SY0A 1GFNA 4AUIA 3PRNA 4HPDA 2X46A 3KZAA 3VE2A 3WJBA 3NSGA 3VG4A 6PRNA 4ZFXA 1KQXA 1G85A 3S60A 3KFFA 1BXWA 2AKQA 4I9SA 1IKJA 3SAOA 5LKEA 4PUXA 1A2DA 3WJCA 1CBSA 2YG2A 5G26A 1RLBE 4TLJA 3ZI8A 3PEDA 3UU2A 3S5VA 1HMRA 2POAA 4ALOA 3NADA 5HTDA 5FVNA 4QGXA 4FOZA 2XE5A 2F1TA 4D64A 1BSQA 1KT4A 2FWVA 1BRQA 1QQSA 2O4VA 1X8NA 4AKRA 4TKBA 5LJKA 5F6BA 4ZGFA 2JN3A 1E00A 2W2AA 4L1NA 3HWFA 1BBPA 4OS3A 5DG4A 2CBSA 4I3DA 2PY1A 1GKAB 1TW4A 4ZCBA 5HCCC 2FGQX 4AKMA 3AAAA 3WI5A 5DL8A 2WEXA 2AT0X 2RCTA 4TQ2A 1P4TA 2N93A 3HK1A 4FBOA 2X27X 2MJIA 2J1NA 4UU3A 4F4BA 1ERXA 5AQ6A 2F73A 1IW2A 4RUNA 1KT3A 4FGIB 4A1HA 1IIUA 2M06A 2FT9A 3C76X 1YWBA 3ZW0B 5EE2A 1Y9LA 5KIDA 4N7CA 4D6BA 2X8SA 1KQWA 3FENA 2FTBA 2XSTA 4IMOA 1H6S1 3WBGA 2MM3A 3POXA 2ANSA 2LHFA 1QG5A 1ALBA 3DTQA 2AH7X 2KXPB 2DM5A 1OSMA 2OZQA 4KC7A 4Z3TA 3EM0A 3FIQA 4WFUA 1HXUA 2L5PA 1Q9GA 1VPRA 1X8OA 4G75A 1O1UA 5HA0A 3ZWEA 1JV4A 3ZW1A 1MX7A 4AZPA 1DZJA 2OVDA 1A18A 1ZHTA 1BLRA 1SXYA 1AB0A 1SY3A 3B2HA 2QO5A 3CMPA 3STKA 1B0OA 5BYPA 1YS5A 1ZHWA 4GCQA 1PHOA 2W80C 4YFPA 3ZW1B 3VG7A 3NQ9A 2AT5X 3CBCA 1GX8A 2WSJA 3QRCA 4LKTA 1KGLA 2QOSC 4AYHA 3SYSA 3OBLA 4EQAC 1TOUA 1XKIA 4ID2A 5HCDC 4M7MA 2ZLDA 1G7NA 3EYCA 3WJFA 3RWXA 4O3ZA 1TOWA 3CQNA 1ML7A 4YFQA 5BVTA 1MPFA 1PRNA 4LZVA 1MX8A 4EDEA 4YDBA 2Y0LA 2JW1A 2GJ5A 5EZ2A 1QWDA 3APUA 3BU1A 3TZGA 1HMTA 2GTLO 5LJDA 1EW3A 4YCEA 3ZW2A 2XG6A 1TXLA 2NNEA 3LK42 1LPJA 4ZH9A 4IABA 3NQ3A 3ZUOA 5JR8A 1VYFA 4AYDC 3BS2A 2X8TA 4I3BA 1KZXA 3QKGA 4Y0SA 5BVSA 3EMNX 3LK41 2NNDA 1GT4A 4WBKA 4IB8A 1I04A 3TGCA 3VZTX 1T8VA 3AKNA 2FS6A 3SOTA 1GFMA 1PM1X 5HZ5A 4PSQA 4O3YA 1ORMA 1GKAA 1E5PA 2WR6A 4ODDA 3SY7A 3WOVA 4QAEA 1KXOA 2GC9A 3JS1A 1QABE 4RJXA 2HLVA 5CE4A 4AKRB 1D2UA 1U18A 3RBYA 5K06A 1Z24A 5CYBA 3LK2A 4N58A 5D5DA 1YWAA 2G78A 1QY1A 1YP6A 1R0UA 2HMBA 3VY8X 3KQ0A 2QTKA 2LBAA 4MISA 2QMIA 1EPAA 3AA7B 3K3LA 4ZHFA 2CZTA 3FR4A 1YP7A 4ORYA 5D4AA 3D97A 2Y0KA 3G7GA 5B29A 4QGWA 3KFGA 2FS7A 5GV0A 1GFOA 1LF7A 4FRTA 5DL7A 4LKPA 1ZHZA 4O3WA 3KFHA 4B61A 1S2PA 4INNA 4KRAA 4K19A 4L3RA 4Y0QA 3BSZE 3HOLA 1DZMA 3F9DA 4MVIA 5HZQA 2OVEA 2N2LA 3EMMA 3AA0B 2QM9A 2LKKA 2OVSA 5IYUA 3IFBA 2M07A 4QGVA 3PP6A 3VZUX 5H9KA 4BOEA 1B4MA 1AVGI 1SMPI 3U9PC 1UZ2X 1X8UA 3SYBA 5LJGA 4FQBB 2Q4NA 2WUTA 5D47A 3UAQA 5LJBA 4KIIA 4XMHA 1RBPA 2YMSA 1S7DA 3VPJE 3TF6A 2Y0HA 2OMFA 4IAXA 1LNMA 4XMEA 3HW9A 4KT5A 1ICNA 3BDRA 3FA7A 1MDCA 3O0EA 4TKHA 1OEJA 2JU7A 4AYNA 1ZNHA 3UEUA 3BX7A 3FA9A 1QFVA 1XCAA 4XMCA 1DZKA 4JGLA 3SZDA 3C77X 4U3QA 3DSZA 3AAAB 2KT4B 1JJJA 4AYID 1IFBA 2HNXA 4WFVA 1DZPA 3VG6A 2X8FA 7PRNA 1E06A 2ZAIA 3NP1A 3B2LA 4FZMA 5H8TA 2KW1A 3F6ZB 4ZH6A 4QRLA 4GCSA 1GT5A 4ES7A 1FELA 1CJ5A 4AZOA 1LICA 1SA8A 2RCQA 5C0NA 1DF3A 4O4UA 1OBQA 1KOIA 1HBQA 1ZNDA 1FE3A 2E4JA 2WQ9A 4IAWA 1JYDA 2Y7SA 3NX1A 1EI5A 2LA7A 4GKCA 4ZHHA 3VZWX 4AZLA 5ADXL 5LJCA 3H3IA 4N59A 1LIEA 1SXUA 3FR5A 3IA8A 4N7DA 3D96A 5EPQA 2BHVA 5HTEA 4EFGA 3AA1B 2LB6A 3U03A 2FRSA 2AT6X 3NBXX 1SXWA 1EUOA 3FA8A 3APXA 4FT6A 3D95A 3OE3A 2WQAE 4WHIA 2CZUA 4RJWA 1BH3A 4GZVA 4NNSA 4YKMA 1I06A 4KCAA 3ZUIA 1MM5A 2ACPX 1CBQA 1EQDA 4O49A 1MM4A 3CQRA 3MBTA 3P6EA 1DFVA 2WWPA 3NR3A 1B56A 3T24A 1U17A 3FW4A 2KTDA 3LV4A 1JZUA 2LFUA 4OMWA 1KZWA 4YCHA 3KFIA 1GGLA 4JFBA 3FLLA 1X71A 2FGRA 4YGZA 4TJZA 1E54A 3OJYC 2XE1A 2R73A 1KT5A 3STNA 3VG5A 1GX9A 3GP6A 3FEKA 1OEKA 4PJ2A 1IZNA 1D3SA 3UEWA 1QY0A 4O3XB 5FENA 5JDPA 1YIVA 4U8UO 1OBUA 1G90A 2MNHA 2P8GA 3S5XA 1ZHXA 2CBRA 3LHNA 3P6FA 3LK3B 5L8OA 1YUPA 4ZHDA 1SY2A 1ERBA 1LIDA 2N2MA 1HXXA 2XKLA 4ORRA 4EEJA 4LSEA 2R56A 2W2FA 1GM6A 3ZZVA 3C5OA 2AT3X 1GT3A 5FQ8E 2PRNA 3OD9A 1A57A 4XMDA 2HZRA 4ORSA 4GH7A 3P24A 4A1YA 3FMZA 5HBSA 2YNKA 4LZUA 4QZTA 4ZJ0A 4FBVA 4FESA 4KR4A 4NYQA 2NP1A 4XMFA 1KT7A 3T0SA 4G76A 4O4OA 4ARHA 4A60A 1UREA 2A13A 4TKJA 2KDYA 2M4LA 4AZNA 4FZNA 1X8PA 1OEEA 3FR2A 5LJEA 5FFHA 2LFOA 3FEPA 4GK9A 4GNYA 4IB9A 3G7XA 4BVMA 3MVFA 3UEVA 1GFQA 2ACOA 3DA3A 4KC8A 2Q39A 2KD2A 1PMPA 3HWEA 4O4SA 3T20A 2AT8X 2O62A 3P6DA 5HZ9A 2XTRA 1BJ7A 3BU9A 3TGBA 3LK2B 4U9CA 2RA6A 4QYPA 2KZ7B 4KR8A 1ADLA 4U8UM 4NLIA 2XE3A 3BY0A 3HWDA 3HWBA 3KVDD 2RD7C 4I6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y7S A;  4AYN A;  5T5F A;  3VE1 A;  2KDY A;  4O3Y A;  4O3W A;  4O4X A;  4O3X B;  2KC0 A;  4O3Z A;  3VE2 A;  3HOL A;  4Z3T A;  4AYM C;  4AYD C;  4AYI D;  3HOE A;  4AYE C;  3PQU A;  4U9C A;  3V8U A;  4QQ1 A;  3PQS A;  4O49 A;  3UAQ A;  1YS5 A;  2YPV A;  5EE2 A;  2W81 C;  3KVD D;  4O4U A;  2W80 C;  2LFU A; 
#chains in the Genus database with same CATH topology
 2R4N A;  5F7G A;  2Q9S A;  4GE1 A;  2Y3E A;  2C1S A;  1GXA A;  5B27 A;  5EEE A;  1EXS A;  2JU8 A;  4O9S A;  1AVE A;  5LJH A;  3P6G A;  1E02 A;  1T68 X;  4UU2 A;  1N0S A;  2X56 A;  5H9A A;  1GT1 A;  5F1E A;  3BX8 A;  1VWJ B;  2HYS A;  4JO6 A;  4O4X A;  3KZI O;  4GU8 A;  1BM5 A;  4FMS A;  4CPE A;  2DJG A;  1IFC A;  3APW A;  1JYJ A;  4BQU A;  4RUU A;  1O1V A;  2FR2 A;  1ICM A;  1SWT A;  3FYF A;  4MVK A;  1SWD A;  1SWC A;  4EXZ A;  3RY2 A;  3FW5 A;  4U8U N;  1CBI A;  2BS5 A;  4OEM A;  3DA4 A;  4OS8 A;  2J4U P;  3WJD A;  2Q2M A;  3JQO A;  3RDS A;  1YWC A;  4ZR2 A;  5AJC A;  2X55 A;  4GDZ A;  2OY8 A;  3RSW A;  3JCU O;  2VFC A;  2FR3 A;  1AQB A;  2ODJ A;  4M6S A;  4NP1 A;  5KIC A;  4C4V B;  4GRJ A;  4HPC A;  2Y2X A;  2L9C A;  1Q9F A;  4BX6 A;  1OBP A;  3VG3 A;  5IO5 A;  3C78 X;  1KT6 A;  1SWH A;  3JTY A;  5BVQ A;  2IZG B;  1EIO A;  5DL6 A;  3CBS A;  1JJU A;  1SWB A;  2BLG A;  2Z4H A;  3AAE A;  3TZS A;  1NP1 A;  3B2J A;  2JMM A;  4HPA A;  4DNE A;  2MO5 A;  5KHP A;  1W5R A;  3GAQ A;  2GTF X;  1I4U A;  5F58 A;  3ELX A;  1FTP A;  2IZH B;  4JNJ A;  3NQK A;  4RL9 A;  4ML7 B;  4MIR A;  2K0L A;  5D8J A;  4LSH A;  2IZI A;  4D65 A;  1QJ9 A;  4ZHG A;  3RDM A;  3TGA A;  4RLB A;  8PRN A;  3WJE A;  1MM9 A;  2C4I A;  3HOE A;  3PGS A;  5D48 A;  2ZAG A;  3Q6L A;  4A8Z A;  4AZQ A;  4Y0P A;  2Y32 A;  3AA0 A;  4E1T A;  4YGG A;  1GFN A;  3KZA A;  3NSG A;  1HXL A;  1KQX A;  3PDF A;  1G85 A;  3AEH A;  1N43 A;  4PUX A;  1A2D A;  2YG2 A;  5G26 A;  2AF5 A;  3S5V A;  1HMR A;  5HTD A;  2F1T A;  4K3C A;  1BRQ A;  5F6B A;  4ZGF A;  4BX6 B;  2W2A A;  4OS3 A;  2CBS A;  1TW4 A;  3AAA A;  4TQ2 A;  2N93 A;  4FBO A;  3RDO A;  4BX5 A;  2F73 A;  3WYP A;  1KL3 A;  5L3Y A;  4A1H A;  1KT3 A;  2FKG A;  4FGI B;  3C76 X;  1UYN X;  5KID A;  3LTW A;  1SWR A;  1H6S 1;  2MM3 A;  2ANS A;  3SLO A;  4YVB A;  2DM5 A;  4NV7 A;  1NQM A;  1STS B;  1ZHT A;  1BLR A;  3RE6 A;  1AB0 A;  4UB6 O;  4GCQ A;  2IZK A;  5BYP A;  1ZHW A;  4YFP A;  3VG7 A;  1KGL A;  5HCD C;  4GJV A;  1PRN A;  1LEL A;  4YDB A;  5K68 A;  1QWD A;  1WUB A;  1STR B;  1HMT A;  3PF1 A;  4YCE A;  2XG6 A;  3PGU A;  3BS2 A;  2X8T A;  1KZX A;  4Y0S A;  5BVS A;  4IB8 A;  5B3M O;  1NC9 A;  1T8V A;  1SWE A;  4O3Y A;  1SWO A;  4C5P A;  5CE4 A;  4AKR B;  1D2U A;  1SWP A;  1Z24 A;  5D5D A;  1R0U A;  2HMB A;  3VY8 X;  3KQ0 A;  4MIS A;  2QMI A;  1AVD A;  3G7G A;  2Y0K A;  3D97 A;  3KFG A;  1GFO A;  4FRT A;  1ZHZ A;  2WPU A;  3KFH A;  4INN A;  4L3R A;  1STP A;  4Y0Q A;  4MVI A;  1DZM A;  2R89 A;  2OVE A;  1W4T A;  5IYU A;  3EC5 A;  5LJG A;  4FQB B;  5GTH O;  4KII A;  1RBP A;  2YMS A;  1S7D A;  4CDE A;  1ZNH A;  1QFV A;  3AAA B;  4AYI D;  2VDF A;  1VWQ B;  3VG6 A;  7PRN A;  4MEE A;  4FZM A;  2KW1 A;  4ZH6 A;  2OL6 O;  4OEL A;  1SA8 A;  1KOI A;  1N7Y A;  2Y7S A;  1JYD A;  3NX1 A;  4GKC A;  3H3I A;  1SXU A;  3FR5 A;  2BHV A;  2LB6 A;  2AT6 X;  1SWQ A;  4CTD A;  1SWF A;  2CZU A;  4IRW A;  2FHN X;  4KCA A;  2ACP X;  1EQD A;  1MM4 A;  1B56 A;  3T24 A;  3FW4 A;  1JZU A;  4YCH A;  2RTA A;  3KFI A;  1GGL A;  4JFB A;  2FGR A;  3RE5 A;  4TJZ A;  2XE1 A;  4PJ2 A;  5FEN A;  5JDP A;  1YIV A;  2MNH A;  2CBR A;  3LHN A;  3LK3 B;  2I5V O;  3KVN A;  1T16 A;  2RTE B;  2XKL A;  4EEJ A;  5FQ8 E;  2HZR A;  4GH7 A;  3P24 A;  4A1Y A;  2BC3 A;  1SRH A;  3T0S A;  4G76 A;  1URE A;  2JQY A;  3MG5 A;  4AZN A;  1X8P A;  3SLJ A;  2KC0 A;  5FFH A;  3FEP A;  4GK9 A;  1GFQ A;  2ACO A;  1K3B A;  4KC8 A;  2KD2 A;  3HWE A;  4Z2V A;  2O62 A;  5HZ9 A;  2XTR A;  4NV8 A;  4B55 A;  3HWB A;  3HWD A;  2RD7 C;  2F1C X;  4I6S A;  5PRN A;  4BUM X;  2ASN X;  1LIF A;  1W6F A;  3POR A;  4NYR A;  1N9M A;  1OSP O;  2RN4 A;  3NX2 A;  4DQ3 A;  3AA7 A;  1RXJ A;  4BX7 B;  4GF4 A;  2BSZ A;  2L68 A;  3FA6 A;  4LSI A;  2OFR X;  4LSF A;  4NLJ A;  4TNN A;  3DWO X;  1SXX A;  2FHL A;  2HKD A;  1LDO A;  1MOY A;  1OPB A;  2Z4I A;  3T6L A;  1JJX A;  4U46 A;  4CPI A;  1SWL A;  3RY1 A;  4ZHC A;  1QJ8 A;  3SZJ A;  1OPA A;  1Y9T A;  5B66 O;  4Z2P A;  3PEC A;  4XMG A;  2AL0 X;  3O2Y A;  2IZA A;  2CM9 A;  4D6A A;  5CHK A;  5B5G A;  2MHD A;  2WEW A;  3I17 A;  3VU1 A;  4KH8 A;  2RTP B;  3POU A;  1SRE A;  1P6P A;  4ORW A;  4C69 X;  5IO7 A;  3A0H O;  1Y0G A;  4RLC A;  5F6Z A;  4DQ4 A;  1VWL B;  4NW4 A;  2OL8 O;  1YWD A;  3PQS A;  5IO6 A;  5F2B A;  3ZW0 A;  1MVG A;  5D45 A;  3RKG A;  3AKM A;  1X89 A;  2G7B A;  2I5Z O;  5T5F A;  1VWN B;  3BS0 A;  2C1Q A;  1BWY A;  3WJG A;  4GUZ A;  2RTJ A;  3P6C A;  2R4O A;  1PBY A;  3CKF A;  2A5C A;  2RQ0 A;  3CWK A;  1IZN B;  4CPF A;  3I0A A;  2XE2 A;  2KTS A;  4AW8 A;  1BRP A;  3FEL A;  1ZHY A;  2GTL N;  3LK3 A;  2W2B A;  3WZP A;  5FAZ A;  3RDU A;  5H9N A;  2F09 A;  2GE4 A;  5FQ7 E;  1HBP A;  1Y52 X;  5IRW A;  1BT9 A;  4HFO A;  4YBP A;  5H2F O;  3A0B O;  3AAE B;  3BRN A;  2QO4 A;  3HPE A;  4GGT A;  4C4V A;  3HTY A;  4ALB A;  1L6M A;  1VYO A;  2A3F X;  3MX7 A;  1LDQ A;  4CV7 A;  2Q2P A;  2XTQ A;  4AUI A;  2X46 A;  4I9S A;  1IKJ A;  3WJC A;  1CBS A;  4TLJ A;  3PED A;  4QGX A;  4FOZ A;  3D9W A;  2XE5 A;  3BRZ A;  2JN3 A;  4L1N A;  1BBP A;  1GKA B;  3WI5 A;  2AT0 X;  2MJI A;  2GH7 A;  2IZJ A;  3RDX A;  1VWE B;  2M06 A;  2FT9 A;  1VWI B;  5EE2 A;  3BRY A;  2X8S A;  1KQW A;  1ALB A;  3CKG A;  4WFU A;  2L5P A;  2OFB A;  1X8O A;  1O1U A;  5HA0 A;  3ZWE A;  1JV4 A;  3ZW1 A;  4AZP A;  2A8G A;  1SXY A;  1YS5 A;  4D64 A;  3B2H A;  2W80 C;  3NQ9 A;  2AT5 X;  1SRF A;  1GX8 A;  3QRC A;  2QOS C;  3SYS A;  4EQA C;  1TOU A;  1G7N A;  3RWX A;  3CQN A;  1MPF A;  1MX8 A;  2JW1 A;  3APU A;  3TZG A;  2OFA A;  1TXL A;  4CDF A;  3LK4 2;  4ZH9 A;  1VYF A;  4I3B A;  3EMN X;  3QKG A;  3TGC A;  5HZ5 A;  4PSQ A;  1ORM A;  2WR6 A;  3DZM A;  2RTH B;  1KXO A;  2GC9 A;  3JS1 A;  1U18 A;  3RBY A;  5K06 A;  3LK2 A;  2G78 A;  1QY1 A;  1YP6 A;  2LBA A;  2AXT O;  3K3L A;  5D4A A;  1LF7 A;  5G39 A;  5DL7 A;  1VWM B;  4O3W A;  4B61 A;  4KRA A;  5HZQ A;  2N2L A;  3EMM A;  1Y53 X;  4QGV A;  5H9K A;  1SMP I;  2Q4N A;  2RTO B;  2RTQ B;  4XMH A;  3RDQ A;  3VPJ E;  1LNM A;  3HW9 A;  4KT5 A;  3FA7 A;  1MDC A;  4AYN A;  3FA9 A;  1XCA A;  4JGL A;  1SRG A;  5KAF O;  1JJJ A;  2X8F A;  1E06 A;  3NP1 A;  3B2L A;  5H8T A;  3F6Z B;  1LUQ A;  1DF8 A;  5C0N A;  2RCQ A;  1OBQ A;  1ZND A;  1FE3 A;  2WQ9 A;  5ADX L;  1HQQ A;  5LJC A;  4N59 A;  3IA8 A;  4EFG A;  2FGS A;  3APX A;  3OE3 A;  1BH3 A;  4GZV A;  4NNS A;  1I06 A;  3ZUI A;  1CBQ A;  2CAM A;  3P6E A;  3NR3 A;  4OMW A;  1KZW A;  1X71 A;  4YGZ A;  2X34 A;  1E54 A;  1KT5 A;  3VG5 A;  3GP6 A;  2OF9 A;  1IZN A;  1D3S A;  3UEW A;  5KAI O;  4U8U O;  1G90 A;  5L8O A;  1YUP A;  1ERB A;  4ORR A;  4LSE A;  3DWN A;  2W2F A;  1GM6 A;  3ZZV A;  1GT3 A;  2QCB A;  4ORS A;  3FMZ A;  4ZJ0 A;  3T2X A;  4NYQ A;  1Y55 X;  1VWH B;  4A60 A;  2WVP A;  4GNY A;  4IB9 A;  1SRI A;  3MVF A;  1PMP A;  1MEP A;  2WJR A;  2RTL A;  2RA6 A;  2RTF B;  2KZ7 B;  4U8U M;  3KVD D;  1VWO B;  2RTC B;  1I05 A;  4I3C A;  3F8A A;  2X45 A;  1LKE A;  4N74 A;  3SY9 A;  1FEN A;  5B2A O;  3POQ A;  5FQ6 E;  4I9R A;  4AYM C;  1T1L A;  3BLG A;  2OYB O;  4E1S A;  4PJ0 O;  2X4M A;  3UEX A;  5G3A A;  3QRA A;  1G5W A;  5EDC A;  1RAV A;  1ZRY A;  2MWH A;  2K23 A;  1I78 A;  3APV A;  1GX3 A;  2DJF A;  1DV9 A;  2JOZ A;  3WI4 A;  3JSQ A;  3FYX A;  5HA1 A;  4XNK A;  3PQU A;  2IFB A;  1NP4 A;  2AMM X;  5HCE C;  1UYO X;  5DPQ A;  4FSP A;  1SWN A;  4OS0 A;  1HN2 A;  4MVE A;  1O8V A;  5AFU L;  2QO6 A;  4HPB A;  2OFM X;  2KXP A;  4QZU A;  4BX7 A;  2G79 A;  4R0B A;  4CSB A;  4FQE A;  4NNT A;  1HMS A;  4GGR A;  3B2K A;  1T0V A;  1HY2 A;  2A2U A;  2A2G A;  2RTN B;  5AFU K;  2XMX A;  3B2I A;  4YGH A;  2R8A A;  3VG2 A;  1FDQ A;  1S44 A;  3EBW A;  4Y0R A;  3EW2 A;  1VWA B;  2R74 A;  4I60 A;  4ORU A;  4CK4 A;  3AA6 B;  4YFR A;  1HQP A;  1QFT A;  2FLJ A;  1A3Y A;  4YDA A;  3PK2 A;  5AEO A;  2EU7 X;  2RTR B;  2LBV A;  3ELZ A;  4BBO A;  2BT9 A;  2A0A A;  2G8C O;  3S26 A;  3VHM A;  2MHL A;  2K4T A;  1FEM A;  4QQ1 A;  4Y5D A;  4IB6 A;  3O22 A;  1X8Q A;  5DL5 A;  4YBU A;  5HZ6 A;  4AZM A;  4GD9 A;  1ZNE A;  4FSO A;  1PBO A;  4YKO A;  3VY9 X;  4OMX A;  1DC9 A;  4IB7 A;  1BSO A;  4AYE C;  1EII A;  2WJQ A;  3U0D A;  4GJS A;  2ZSC A;  4FZL A;  1QY2 A;  4HWM A;  1SWK A;  3WVM A;  4AZR A;  2ERV A;  1THQ A;  4YMY A;  3P6H A;  3VHH A;  1U0X A;  3RBH A;  1SY0 A;  4HPD A;  3VE2 A;  3WJB A;  5GTI O;  4ZFX A;  3S60 A;  3KFF A;  1BXW A;  2AKQ A;  3SAO A;  5LKE A;  1RLB E;  3UU2 A;  5JD2 A;  2POA A;  3NAD A;  5FVN A;  2UZ2 A;  1QQS A;  2O4V A;  1X8N A;  4TKB A;  5LJK A;  1E00 A;  5DG4 A;  2R4P A;  4I3D A;  2PY1 A;  4ZCB A;  2FGQ X;  2MF6 A;  1P4T A;  2RCT A;  3HK1 A;  2J1N A;  4UU3 A;  4F4B A;  1ERX A;  5AQ6 A;  4Z28 A;  1Y9L A;  4N7C A;  4IMO A;  2RTI B;  3POX A;  2LHF A;  1QG5 A;  3DTQ A;  2AH7 X;  2KXP B;  1OSM A;  2OZQ A;  4KC7 A;  4Z3T A;  3EM0 A;  3T6F A;  4BJ8 A;  3FIQ A;  1HXU A;  3WU2 O;  1VPR A;  1MK5 A;  1DZJ A;  3CMP A;  3NJT A;  3ZW1 B;  2X32 A;  3CBC A;  2WSJ A;  1LCW A;  4LKT A;  4AYH A;  3OBL A;  1XKI A;  4ID2 A;  4M7M A;  5CSE A;  5G38 A;  1RXK A;  4O3Z A;  1VWB B;  1ML7 A;  1SRJ A;  4LZV A;  2GJ5 A;  3T2W A;  4BCS A;  3BU1 A;  5LJD A;  2NNE A;  1LPJ A;  3NQ3 A;  3ZUO A;  1GT4 A;  1K24 A;  1GFM A;  2FS6 A;  3SOT A;  1PM1 X;  3SY7 A;  1GKA A;  4ODD A;  3WOV A;  4RJX A;  2HLV A;  5E79 O;  5CYB A;  2RTK A;  2QOM A;  1EPA A;  3AA7 B;  4ZHF A;  3FR4 A;  4ORY A;  2IZF B;  4QGW A;  5GV0 A;  4LKP A;  1S2P A;  4K19 A;  5B5F A;  3HOL A;  3F9D A;  3AA0 B;  2OVS A;  2M07 A;  3PP6 A;  2WUT A;  5TIS O;  3TF6 A;  2OMF A;  4Y59 A;  3BDR A;  3O0E A;  2Y3F A;  1OEJ A;  2IZD B;  2JU7 A;  3UEU A;  3BX7 A;  3SZD A;  3C77 X;  4EKV A;  3DSZ A;  2HNX A;  4N75 A;  1SWA A;  1GT5 A;  4ES7 A;  1CJ5 A;  4AZO A;  1DF3 A;  4O4U A;  4IAW A;  1EI5 A;  1FJ1 E;  2LA7 A;  4AZL A;  1IJ8 A;  5EPQ A;  5HTE A;  2FRS A;  2OY7 A;  1SXW A;  1N4J A;  3D95 A;  4WHI A;  4YKM A;  1MM5 A;  1SLG B;  4O49 A;  1DFV A;  2WWP A;  2KTD A;  3X00 A;  3FLL A;  1KL5 A;  3FID A;  3OJY C;  2R73 A;  3STN A;  1GX9 A;  3FEK A;  1HXZ A;  4O3X B;  1OBU A;  1ZHX A;  2IZL B;  1SWG A;  4ZHD A;  1SY2 A;  1LID A;  2R56 A;  1E2T A;  1JQP A;  4XMD A;  4DCB A;  2YNK A;  4LZU A;  4FES A;  4FBV A;  2G5L A;  4XMF A;  1KT7 A;  3PGR A;  4O4O A;  4TKJ A;  1SLF B;  2KDY A;  4FZN A;  3FR2 A;  5LJE A;  4C00 A;  3WZN A;  1JMX A;  3G7X A;  3T20 A;  3FDC A;  2AT8 X;  4QYP A;  4NLI A;  2XE3 A;  3MM0 A;  3BY0 A;  4CDC A;  1ACD A;  5HWZ A;  1RST B;  4ORX A;  2HZQ A;  1GFP A;  3PH5 A;  2X9K A;  3AUM O;  3WYQ A;  1MUP A;  2NNQ A;  1CBR A;  3WZQ A;  5H9L A;  2F1V A;  3D4R A;  4D5U A;  1BEB A;  3STM X;  4PR7 A;  5IRU A;  1SY1 A;  1VWP B;  4I95 A;  2POR A;  1VWF B;  1JIW I;  4QYN A;  1NDJ A;  2ALL X;  4QNI A;  3RZY A;  5AJB A;  2AVI A;  3HWG A;  4LQZ A;  1NGL A;  1VWD B;  1AEL A;  1PEE A;  2UYW A;  4ON1 A;  3N91 A;  4GNW A;  1QJP A;  1B8E A;  3PPT A;  4GHB A;  1BSY A;  3GE2 A;  4GCP A;  3ZQ3 A;  2IZC B;  1SLD B;  5EDB A;  2OVA A;  1ZNK A;  1JMZ A;  1CRB A;  1ZNL A;  2YPV A;  3O19 A;  5L8N A;  2IWW A;  5LKF A;  4COT A;  1VWK B;  4BGF A;  2JU3 A;  5L8I A;  4Z2O A;  3T1D A;  3K19 A;  3UPG A;  4YH0 A;  2JMB A;  4AFK A;  1LIB A;  2K62 A;  1TVQ A;  4BX5 B;  5IRA A;  5ADX K;  3P02 A;  5HAE A;  3E3C A;  1EPB A;  4FBR A;  2RTG B;  2W81 C;  4IMN A;  4OKA A;  1VWR B;  4FUV A;  1OPF A;  4XNL A;  2KZ7 A;  1ZNG A;  1VYG A;  4MVL A;  2ZFG A;  5HZ8 A;  1EAL A;  3QQ2 A;  3NPO A;  1SWU A;  1LFO A;  1IKE A;  3V8U A;  2CM4 A;  1SLE B;  2RTD B;  3EBK A;  3WXQ A;  3AA1 A;  2GTL M;  3L4R A;  1JBH A;  3PH6 A;  4CPH B;  2BS6 A;  4Z27 A;  1N9Y A;  1G74 A;  1H91 A;  3VE1 A;  4GDA A;  4IBA A;  3A2S X;  1I9H A;  4JCH A;  3SZV A;  1HXT A;  4ZGU A;  2IWV A;  1NQN A;  4K3B A;  4FRX A;  3SZI A;  2L67 A;  3CR6 A;  4GET A;  5B5E O;  5EED A;  1RXH A;  3AA6 A;  3PRN A;  6PRN A;  3VG4 A;  3SLT A;  5K67 A;  3WZO A;  3EW1 A;  3ZI8 A;  4JHQ A;  4ALO A;  1BSQ A;  1KT4 A;  2FWV A;  4AKR A;  3HWF A;  5HCC C;  2F01 A;  4AKM A;  5DL8 A;  2WEX A;  2X27 X;  1WBI A;  1IW2 A;  4RUN A;  3VHI A;  2RTM A;  1IIU A;  1YWB A;  3ZW0 B;  4D6B A;  3FEN A;  2FTB A;  2XST A;  3WBG A;  4GGZ A;  2IZB A;  5B11 O;  5B10 O;  1SWJ A;  1Q9G A;  4G75 A;  2FKJ A;  1MX7 A;  2OVD A;  1A18 A;  1SY3 A;  3STK A;  2QO5 A;  1B0O A;  1VWG B;  1PHO A;  2ZLD A;  2OY5 O;  3EYC A;  3WJF A;  1TOW A;  1VWC B;  4YFQ A;  5BVT A;  4EDE A;  2OF8 A;  2Y0L A;  5EZ2 A;  2GTL O;  1EW3 A;  3ZW2 A;  4UB8 O;  2VFB A;  4IAB A;  5JR8 A;  4AYD C;  4CDD A;  3LK4 1;  2NND A;  4WBK A;  1I04 A;  2RTB B;  3VZT X;  3AKN A;  1E5P A;  4QAE A;  1QAB E;  4N58 A;  1YWA A;  2QTK A;  5IXG A;  1S5L O;  2CZT A;  1YP7 A;  5B29 A;  2FS7 A;  2PI3 O;  3BSZ E;  4Z6J A;  2QM9 A;  2LKK A;  3Q34 A;  3IFB A;  3VZU X;  2JGS A;  4BOE A;  1B4M A;  1AVG I;  3U9P C;  1UZ2 X;  1X8U A;  1KL4 A;  3SYB A;  5D47 A;  3VGW A;  3UAQ A;  5LJB A;  1NBX A;  2Y0H A;  4IAX A;  4XME A;  1ICN A;  4TKH A;  4XMC A;  1DZK A;  4U3Q A;  2KT4 B;  2OL7 A;  1IFB A;  4WFV A;  1DZP A;  2ZAI A;  4QRL A;  4GCS A;  1FEL A;  1LIC A;  4IL6 O;  1HBQ A;  2E4J A;  3VZW X;  4ZHH A;  1LIE A;  1KFF A;  4N7D A;  3D96 A;  3AA1 B;  3U03 A;  3NBX X;  1EUO A;  3FA8 A;  2R88 A;  4FT6 A;  2WQA E;  4RJW A;  2OY1 O;  3CQR A;  1U17 A;  3LV4 A;  4CPH A;  2LFU A;  2A5B A;  1RSU B;  1OEK A;  1QY0 A;  2P8G A;  3S5X A;  3SZH A;  1LCV A;  3P6F A;  2N2M A;  1HXX A;  3C5O A;  2AT3 X;  1PTS A;  2PRN A;  3OD9 A;  1A57 A;  5HBS A;  4QZT A;  4KR4 A;  1SWS A;  2NP1 A;  4ARH A;  2A13 A;  2M4L A;  1OEE A;  2LFO A;  4BVM A;  3UEV A;  3DA3 A;  2IZE B;  2Q39 A;  4O4S A;  1LCZ A;  3P6D A;  1BJ7 A;  3BU9 A;  3TGB A;  3LK2 B;  4U9C A;  4KR8 A;  1ADL A;  3MBT A;  2R4L A; 
#chains in the Genus database with same CATH homology
 1I05 A;  5PRN A;  4I3C A;  5F7G A;  4BUM X;  1ACD A;  2ASN X;  2X45 A;  1LIF A;  3F8A A;  1LKE A;  2Q9S A;  5HWZ A;  3SY9 A;  1FEN A;  4GE1 A;  3POQ A;  4ORX A;  5FQ6 E;  4I9R A;  2HZQ A;  1GFP A;  4AYM C;  3PH5 A;  1GXA A;  3POR A;  4NYR A;  1MUP A;  3BLG A;  2NNQ A;  5B27 A;  5EEE A;  1EXS A;  2JU8 A;  1CBR A;  4E1S A;  4O9S A;  5H9L A;  2F1V A;  3D4R A;  2RN4 A;  4D5U A;  3NX2 A;  3UEX A;  4DQ3 A;  3AA7 A;  1BEB A;  5LJH A;  3QRA A;  3P6G A;  1E02 A;  1T68 X;  3STM X;  4UU2 A;  1N0S A;  4GF4 A;  2L68 A;  1G5W A;  3FA6 A;  5EDC A;  4LSI A;  1ZRY A;  5H9A A;  1SY1 A;  1GT1 A;  2K23 A;  2MWH A;  3BX8 A;  2OFR X;  4I95 A;  5F1E A;  2POR A;  4LSF A;  4NLJ A;  4TNN A;  1SXX A;  2HYS A;  3APV A;  4O4X A;  1JIW I;  4GU8 A;  1BM5 A;  4FMS A;  4QYN A;  1DV9 A;  2JOZ A;  2KC0 A;  1OPB A;  2ALL X;  4QNI A;  3WI4 A;  3JSQ A;  3FYX A;  2Z4I A;  5HA1 A;  1IFC A;  4XNK A;  3PQU A;  2IFB A;  3APW A;  3RZY A;  5AJB A;  1NP4 A;  2AMM X;  5HCE C;  5DPQ A;  1JJX A;  1JYJ A;  4BQU A;  3HWG A;  4FSP A;  4LQZ A;  1NGL A;  4RUU A;  1AEL A;  1O1V A;  4OS0 A;  1HN2 A;  2FR2 A;  4MVE A;  1PEE A;  4ZHC A;  1ICM A;  1O8V A;  5AFU L;  2QO6 A;  1QJ8 A;  4HPB A;  2OFM X;  1OPA A;  1Y9T A;  3FYF A;  3N91 A;  4ON1 A;  2KXP A;  4QZU A;  2G79 A;  4GNW A;  4MVK A;  1QJP A;  1B8E A;  3PPT A;  4GHB A;  3PEC A;  1BSY A;  4R0B A;  4XMG A;  4CSB A;  4EXZ A;  2AL0 X;  4NNT A;  3GE2 A;  1HMS A;  3O2Y A;  4GCP A;  3ZQ3 A;  3B2K A;  3FW5 A;  4U8U N;  1CBI A;  2BS5 A;  1T0V A;  3DA4 A;  2CM9 A;  4D6A A;  4OS8 A;  2A2U A;  2A2G A;  5EDB A;  2J4U P;  2OVA A;  1ZNK A;  3WJD A;  2Q2M A;  3JQO A;  1CRB A;  5AFU K;  2XMX A;  3B2I A;  4YGH A;  1ZNL A;  2YPV A;  3O19 A;  2MHD A;  3VG2 A;  2WEW A;  3I17 A;  3VU1 A;  1FDQ A;  1YWC A;  4ZR2 A;  1S44 A;  5AJC A;  5L8N A;  3EBW A;  5LKF A;  4KH8 A;  4COT A;  4Y0R A;  3POU A;  4GDZ A;  2JU3 A;  3RSW A;  5L8I A;  3T1D A;  2R74 A;  4ORU A;  1P6P A;  3K19 A;  3UPG A;  4CK4 A;  4YH0 A;  3AA6 B;  2JMB A;  4AFK A;  1LIB A;  2FR3 A;  1AQB A;  2K62 A;  4ORW A;  1TVQ A;  5IO7 A;  4C69 X;  2ODJ A;  4M6S A;  4YFR A;  1HQP A;  4NP1 A;  4RLC A;  1QFT A;  2FLJ A;  5KIC A;  3P02 A;  5ADX K;  5F6Z A;  4DQ4 A;  1A3Y A;  4YDA A;  5HAE A;  3E3C A;  4GRJ A;  4NW4 A;  4HPC A;  1EPB A;  1YWD A;  3PQS A;  4FBR A;  5AEO A;  2Y2X A;  2EU7 X;  2L9C A;  5IO6 A;  1Q9F A;  2W81 C;  4IMN A;  3ZW0 A;  1OBP A;  4FUV A;  3VG3 A;  1MVG A;  5D45 A;  1OPF A;  4XNL A;  2LBV A;  3ELZ A;  5IO5 A;  3C78 X;  1KT6 A;  3RKG A;  3JTY A;  2KZ7 A;  3AKM A;  1X89 A;  1VYG A;  1ZNG A;  2BT9 A;  2G7B A;  5BVQ A;  2A0A A;  4MVL A;  5T5F A;  3S26 A;  2ZFG A;  5HZ8 A;  1EIO A;  5DL6 A;  3CBS A;  2BLG A;  1EAL A;  1BWY A;  3WJG A;  2Z4H A;  3AAE A;  3NPO A;  3P6C A;  3TZS A;  1NP1 A;  3B2J A;  2JMM A;  1LFO A;  4HPA A;  1IKE A;  2MHL A;  2MO5 A;  2K4T A;  1FEM A;  2RQ0 A;  3CWK A;  4QQ1 A;  3V8U A;  5KHP A;  2CM4 A;  3GAQ A;  2GTF X;  1IZN B;  1I4U A;  5F58 A;  3ELX A;  4IB6 A;  1FTP A;  3EBK A;  3I0A A;  3WXQ A;  3O22 A;  1X8Q A;  2XE2 A;  3AA1 A;  2GTL M;  3L4R A;  3NQK A;  1JBH A;  4RL9 A;  2KTS A;  4ML7 B;  5DL5 A;  4MIR A;  3PH6 A;  2K0L A;  2BS6 A;  4AW8 A;  5D8J A;  1BRP A;  3FEL A;  4YBU A;  2GTL N;  1G74 A;  1H91 A;  2W2B A;  5HZ6 A;  3VE1 A;  4AZM A;  1ZHY A;  3LK3 A;  4LSH A;  4D65 A;  1QJ9 A;  1ZNE A;  4ZHG A;  5FAZ A;  3TGA A;  4IBA A;  4RLB A;  8PRN A;  4FSO A;  1PBO A;  4YKO A;  5H9N A;  3WJE A;  4OMX A;  3A2S X;  3VY9 X;  1DC9 A;  2F09 A;  4IB7 A;  1BSO A;  2GE4 A;  3HOE A;  4AYE C;  5FQ7 E;  1EII A;  3U0D A;  1HBP A;  1BT9 A;  5D48 A;  4JCH A;  2ZAG A;  3SZV A;  4HFO A;  1HXT A;  4ZGU A;  4YBP A;  4FZL A;  1QY2 A;  3Q6L A;  4HWM A;  4A8Z A;  4AZQ A;  3AAE B;  3BRN A;  2QO4 A;  3WVM A;  4AZR A;  2ERV A;  4Y0P A;  3HTY A;  4FRX A;  2L67 A;  4ALB A;  1THQ A;  3AA0 A;  1L6M A;  3CR6 A;  3MX7 A;  2A3F X;  3P6H A;  4GET A;  4YMY A;  5EED A;  4YGG A;  4E1T A;  1U0X A;  4CV7 A;  3AA6 A;  2Q2P A;  3RBH A;  2XTQ A;  1SY0 A;  1GFN A;  4AUI A;  3PRN A;  4HPD A;  2X46 A;  3KZA A;  3VE2 A;  3WJB A;  3NSG A;  3VG4 A;  6PRN A;  4ZFX A;  1KQX A;  1G85 A;  3S60 A;  3KFF A;  1BXW A;  2AKQ A;  4I9S A;  1IKJ A;  3SAO A;  5LKE A;  4PUX A;  1A2D A;  3WJC A;  1CBS A;  2YG2 A;  5G26 A;  1RLB E;  4TLJ A;  3ZI8 A;  3PED A;  3UU2 A;  3S5V A;  1HMR A;  2POA A;  4ALO A;  3NAD A;  5HTD A;  5FVN A;  4QGX A;  4FOZ A;  2XE5 A;  2F1T A;  4D64 A;  1BSQ A;  1KT4 A;  2FWV A;  1BRQ A;  1QQS A;  2O4V A;  1X8N A;  4AKR A;  4TKB A;  5LJK A;  5F6B A;  4ZGF A;  2JN3 A;  1E00 A;  2W2A A;  4L1N A;  3HWF A;  1BBP A;  4OS3 A;  5DG4 A;  2CBS A;  4I3D A;  2PY1 A;  1GKA B;  1TW4 A;  4ZCB A;  5HCC C;  2FGQ X;  4AKM A;  3AAA A;  3WI5 A;  5DL8 A;  2WEX A;  2AT0 X;  2RCT A;  4TQ2 A;  1P4T A;  2N93 A;  3HK1 A;  4FBO A;  2X27 X;  2MJI A;  2J1N A;  4UU3 A;  4F4B A;  1ERX A;  5AQ6 A;  2F73 A;  1IW2 A;  4RUN A;  1KT3 A;  4FGI B;  4A1H A;  1IIU A;  2M06 A;  2FT9 A;  3C76 X;  1YWB A;  3ZW0 B;  5EE2 A;  1Y9L A;  5KID A;  4N7C A;  4D6B A;  2X8S A;  1KQW A;  3FEN A;  2FTB A;  2XST A;  4IMO A;  1H6S 1;  3WBG A;  2MM3 A;  3POX A;  2ANS A;  2LHF A;  1QG5 A;  1ALB A;  3DTQ A;  2AH7 X;  2KXP B;  2DM5 A;  1OSM A;  2OZQ A;  4KC7 A;  4Z3T A;  3EM0 A;  3FIQ A;  4WFU A;  1HXU A;  2L5P A;  1Q9G A;  1VPR A;  1X8O A;  4G75 A;  1O1U A;  5HA0 A;  3ZWE A;  1JV4 A;  3ZW1 A;  1MX7 A;  4AZP A;  1DZJ A;  2OVD A;  1A18 A;  1ZHT A;  1BLR A;  1SXY A;  1AB0 A;  1SY3 A;  3B2H A;  2QO5 A;  3CMP A;  3STK A;  1B0O A;  5BYP A;  1YS5 A;  1ZHW A;  4GCQ A;  1PHO A;  2W80 C;  4YFP A;  3ZW1 B;  3VG7 A;  3NQ9 A;  2AT5 X;  3CBC A;  1GX8 A;  2WSJ A;  3QRC A;  4LKT A;  1KGL A;  2QOS C;  4AYH A;  3SYS A;  3OBL A;  4EQA C;  1TOU A;  1XKI A;  4ID2 A;  5HCD C;  4M7M A;  2ZLD A;  1G7N A;  3EYC A;  3WJF A;  3RWX A;  4O3Z A;  1TOW A;  3CQN A;  1ML7 A;  4YFQ A;  5BVT A;  1MPF A;  1PRN A;  4LZV A;  1MX8 A;  4EDE A;  4YDB A;  2Y0L A;  2JW1 A;  2GJ5 A;  5EZ2 A;  1QWD A;  3APU A;  3BU1 A;  3TZG A;  1HMT A;  2GTL O;  5LJD A;  1EW3 A;  4YCE A;  3ZW2 A;  2XG6 A;  1TXL A;  2NNE A;  3LK4 2;  1LPJ A;  4ZH9 A;  4IAB A;  3NQ3 A;  3ZUO A;  5JR8 A;  1VYF A;  4AYD C;  3BS2 A;  2X8T A;  4I3B A;  1KZX A;  3QKG A;  4Y0S A;  5BVS A;  3EMN X;  3LK4 1;  2NND A;  1GT4 A;  4WBK A;  4IB8 A;  1I04 A;  3TGC A;  3VZT X;  1T8V A;  3AKN A;  2FS6 A;  3SOT A;  1GFM A;  1PM1 X;  5HZ5 A;  4PSQ A;  4O3Y A;  1ORM A;  1GKA A;  1E5P A;  2WR6 A;  4ODD A;  3SY7 A;  3WOV A;  4QAE A;  1KXO A;  2GC9 A;  3JS1 A;  1QAB E;  4RJX A;  2HLV A;  5CE4 A;  4AKR B;  1D2U A;  1U18 A;  3RBY A;  5K06 A;  1Z24 A;  5CYB A;  3LK2 A;  4N58 A;  5D5D A;  1YWA A;  2G78 A;  1QY1 A;  1YP6 A;  1R0U A;  2HMB A;  3VY8 X;  3KQ0 A;  2QTK A;  2LBA A;  4MIS A;  2QMI A;  1EPA A;  3AA7 B;  3K3L A;  4ZHF A;  2CZT A;  3FR4 A;  1YP7 A;  4ORY A;  5D4A A;  3D97 A;  2Y0K A;  3G7G A;  5B29 A;  4QGW A;  3KFG A;  2FS7 A;  5GV0 A;  1GFO A;  1LF7 A;  4FRT A;  5DL7 A;  4LKP A;  1ZHZ A;  4O3W A;  3KFH A;  4B61 A;  1S2P A;  4INN A;  4KRA A;  4K19 A;  4L3R A;  4Y0Q A;  3BSZ E;  3HOL A;  1DZM A;  3F9D A;  4MVI A;  5HZQ A;  2OVE A;  2N2L A;  3EMM A;  3AA0 B;  2QM9 A;  2LKK A;  2OVS A;  5IYU A;  3IFB A;  2M07 A;  4QGV A;  3PP6 A;  3VZU X;  5H9K A;  4BOE A;  1B4M A;  1AVG I;  1SMP I;  3U9P C;  1UZ2 X;  1X8U A;  3SYB A;  5LJG A;  4FQB B;  2Q4N A;  2WUT A;  5D47 A;  3UAQ A;  5LJB A;  4KII A;  4XMH A;  1RBP A;  2YMS A;  1S7D A;  3VPJ E;  3TF6 A;  2Y0H A;  2OMF A;  4IAX A;  1LNM A;  4XME A;  3HW9 A;  4KT5 A;  1ICN A;  3BDR A;  3FA7 A;  1MDC A;  3O0E A;  4TKH A;  1OEJ A;  2JU7 A;  4AYN A;  1ZNH A;  3UEU A;  3BX7 A;  3FA9 A;  1QFV A;  1XCA A;  4XMC A;  1DZK A;  4JGL A;  3SZD A;  3C77 X;  4U3Q A;  3DSZ A;  3AAA B;  2KT4 B;  1JJJ A;  4AYI D;  1IFB A;  2HNX A;  4WFV A;  1DZP A;  3VG6 A;  2X8F A;  7PRN A;  1E06 A;  2ZAI A;  3NP1 A;  3B2L A;  4FZM A;  5H8T A;  2KW1 A;  3F6Z B;  4ZH6 A;  4QRL A;  4GCS A;  1GT5 A;  4ES7 A;  1FEL A;  1CJ5 A;  4AZO A;  1LIC A;  1SA8 A;  2RCQ A;  5C0N A;  1DF3 A;  4O4U A;  1OBQ A;  1KOI A;  1HBQ A;  1ZND A;  1FE3 A;  2E4J A;  2WQ9 A;  4IAW A;  1JYD A;  2Y7S A;  3NX1 A;  1EI5 A;  2LA7 A;  4GKC A;  4ZHH A;  3VZW X;  4AZL A;  5ADX L;  5LJC A;  3H3I A;  4N59 A;  1LIE A;  1SXU A;  3FR5 A;  3IA8 A;  4N7D A;  3D96 A;  5EPQ A;  2BHV A;  5HTE A;  4EFG A;  3AA1 B;  2LB6 A;  3U03 A;  2FRS A;  2AT6 X;  3NBX X;  1SXW A;  1EUO A;  3FA8 A;  3APX A;  4FT6 A;  3D95 A;  3OE3 A;  2WQA E;  4WHI A;  2CZU A;  4RJW A;  1BH3 A;  4GZV A;  4NNS A;  4YKM A;  1I06 A;  4KCA A;  3ZUI A;  1MM5 A;  2ACP X;  1CBQ A;  1EQD A;  4O49 A;  1MM4 A;  3CQR A;  3MBT A;  3P6E A;  1DFV A;  2WWP A;  3NR3 A;  1B56 A;  3T24 A;  1U17 A;  3FW4 A;  2KTD A;  3LV4 A;  1JZU A;  2LFU A;  4OMW A;  1KZW A;  4YCH A;  3KFI A;  1GGL A;  4JFB A;  3FLL A;  1X71 A;  2FGR A;  4YGZ A;  4TJZ A;  1E54 A;  3OJY C;  2XE1 A;  2R73 A;  1KT5 A;  3STN A;  3VG5 A;  1GX9 A;  3GP6 A;  3FEK A;  1OEK A;  4PJ2 A;  1IZN A;  1D3S A;  3UEW A;  1QY0 A;  4O3X B;  5FEN A;  5JDP A;  1YIV A;  4U8U O;  1OBU A;  1G90 A;  2MNH A;  2P8G A;  3S5X A;  1ZHX A;  2CBR A;  3LHN A;  3P6F A;  3LK3 B;  5L8O A;  1YUP A;  4ZHD A;  1SY2 A;  1ERB A;  1LID A;  2N2M A;  1HXX A;  2XKL A;  4ORR A;  4EEJ A;  4LSE A;  2R56 A;  2W2F A;  1GM6 A;  3ZZV A;  3C5O A;  2AT3 X;  1GT3 A;  5FQ8 E;  2PRN A;  3OD9 A;  1A57 A;  4XMD A;  2HZR A;  4ORS A;  4GH7 A;  3P24 A;  4A1Y A;  3FMZ A;  5HBS A;  2YNK A;  4LZU A;  4QZT A;  4ZJ0 A;  4FBV A;  4FES A;  4KR4 A;  4NYQ A;  2NP1 A;  4XMF A;  1KT7 A;  3T0S A;  4G76 A;  4O4O A;  4ARH A;  4A60 A;  1URE A;  2A13 A;  4TKJ A;  2KDY A;  2M4L A;  4AZN A;  4FZN A;  1X8P A;  1OEE A;  3FR2 A;  5LJE A;  5FFH A;  2LFO A;  3FEP A;  4GK9 A;  4GNY A;  4IB9 A;  3G7X A;  4BVM A;  3MVF A;  3UEV A;  1GFQ A;  2ACO A;  3DA3 A;  4KC8 A;  2Q39 A;  2KD2 A;  1PMP A;  3HWE A;  4O4S A;  3T20 A;  2AT8 X;  2O62 A;  3P6D A;  5HZ9 A;  2XTR A;  1BJ7 A;  3BU9 A;  3TGB A;  3LK2 B;  4U9C A;  2RA6 A;  4QYP A;  2KZ7 B;  4KR8 A;  1ADL A;  4U8U M;  4NLI A;  2XE3 A;  3BY0 A;  3HWD A;  3HWB A;  3KVD D;  2RD7 C;  4I6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...