4U9CA

Structure of the lbpb n-lobe from neisseria meningitidis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
286
Chain Sequence
b'PVNRPAVGAAMRLPRRNIASYKPDKHQAEEHLPLKEKDILFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKEKTSEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGSTDLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVNPNEPKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNSVFGVFAGKQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactoferrin-binding protein B
publication title The structure of lactoferrin-binding protein B from Neisseria meningitidis suggests roles in iron acquisition and neutralization of host defences.
pubmed doi rcsb
source organism Neisseria meningitidis cu385
molecule tags Lactoferrin-binding protein
total genus 89
structure length 286
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u9cA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4u9cA02
4O3ZA 3HOLA 5EE2A 4U9CA 4AYDC 3UAQA 4AYID 4O4XA 4QQ1A 2KDYA 3V8UA 2KC0A 4Z3TA 3VE2A 4AYEC 2Y7SA 4O3YA 4O3XB 2YPVA 2W80C 4O4UA 3VE1A 2W81C 5T5FA 4O49A 2LFUA 4O3WA 4AYNA 3HOEA 3PQSA 1YS5A 4AYMC 3PQUA 3KVDD
chains in the Genus database with same CATH superfamily
2OF9A 2PY1A 1UREA 3ELZA 4YFRA 2OFMX 1VWAB 4I3BA 4BX7B 1SWRA 2NNQA 2W2BA 3E3CA 1SWDA 1LPJA 4YDBA 1P6PA 3FR4A 5IXGA 3VZTX 3CKGA 1EIIA 1SRIA 1A57A 1GX8A 5B5FA 4CK4A 1VWGB 5AQ6A 4Z2VA 1OEJA 3POQA 3O0EA 3AKNA 1SA8A 4Y5DA 4NV7A 1VWPB 3A0BO 2MM3A 1KL3A 1SRGA 3I0AA 4QGVA 3VG7A 2G78A 1MX7A 1QY1A 2RTNB 4QQ1A 3MG5A 3SY7A 4O3YA 4Y0RA 1DFVA 1MVGA 2GTLM 4YGHA 3OBLA 3S26A 3S60A 1IW2A 1XKIA 1W4TA 3APVA 2Y32A 2HLVA 4RUNA 3TZSA 2NNDA 1I4UA 4EEJA 4ALBA 2GTFX 4U8UO 2RTRB 2X8TA 3EBWA 1G85A 4FOZA 1MM9A 5PRNA 4I3DA 5H8TA 1ZNKA 1BRPA 3VG5A 4IMNA 1LNMA 2HMBA 1EUOA 4M7MA 1CRBA 5K68A 1SWHA 1Q9GA 2A2UA 2ASNX 3DZMA 4AZLA 3F6ZB 2RTCB 3OE3A 4ZJ0A 2XTQA 1MPFA 3QQ2A 2OVDA 3EC5A 3ZQ3A 5B10O 2X46A 4NNTA 4ORYA 3D9WA 2FGQX 4BVMA 3EW1A 1CBIA 4ZGFA 1RSUB 3PK2A 4AYMC 5G38A 5IRUA 4LSIA 3CBCA 2OVEA 3D97A 2O4VA 1AVDA 4Z2OA 4OS0A 4IRWA 2LKKA 3JTYA 2WJQA 3CWKA 3AAAB 1Y55X 2BS6A 2XTRA 2G7BA 4XMCA 1FENA 3WYQA 1YUPA 2I5VO 2FKJA 4KIIA 3RSWA 2QMIA 2A13A 4TKBA 5EE2A 3FA7A 3GP6A 5D4AA 2C4IA 1SXYA 4O4XA 2X34A 5IRAA 1LKEA 1SLGB 4ORWA 4GGZA 4AW8A 3PF1A 2CBRA 3NP1A 4WHIA 1LIEA 3BRNA 5HA1A 3ZW1A 3EYCA 1JZUA 4D5UA 1I05A 2WR6A 4ALOA 2YG2A 5H9LA 1Z24A 2N2MA 5HCCC 4TKJA 3U03A 1H6S1 4K3CA 1SXWA 4C5PA 2FHNX 5K67A 5LJBA 3KQ0A 1LIFA 3TGCA 4YCEA 4K19A 1G5WA 3AA7A 5F7GA 5CSEA 1G7NA 2G79A 2L68A 2ZFGA 1NQNA 5IO5A 4YGGA 4MVLA 4YFQA 1STPA 3PGUA 2Y3FA 3JS1A 2AXTO 1VWOB 3B2JA 2XE2A 2AL0X 2YPVA 1KL4A 3RKGA 4COTA 4EKVA 3SYBA 1JJUA 1A18A 2K0LA 1AVEA 4GF4A 2RQ0A 2IZKA 4Y0SA 4Z28A 4Z2PA 4BCSA 2A5BA 3FEKA 2FGSA 4GE1A 1NP1A 2KD2A 2MJIA 5F6BA 4GNWA 2RA6A 4FZNA 5H9NA 1LCVA 1O1UA 5G3AA 3RBHA 3BLGA 1LCWA 1HBPA 3WVMA 3PGRA 1BWYA 3NADA 4GHBA 3OJYC 3T6LA 2KDYA 2R4PA 4D65A 3N91A 2MHDA 5FFHA 5AEOA 1ICNA 5D45A 5JD2A 4BX7A 1N7YA 3PQUA 3CR6A 1KZXA 3U9PC 5DL8A 4NLJA 2HYSA 1X8QA 4Y0PA 3GE2A 1THQA 2PI3O 2GTLN 3UAQA 3FW5A 2J1NA 2IZEB 3P6CA 2ODJA 3PH6A 1EPBA 4FBVA 1NGLA 1SWEA 4NLIA 2FRSA 4U3QA 3VY9X 1PBYA 3LV4A 4QNIA 1S5LO 2R88A 1EALA 4GD9A 4MIRA 1GGLA 2KXPB 2E4JA 3L4RA 1X8PA 3B2HA 1YP7A 1FTPA 5HWZA 1BEBA 1MUPA 2IZIA 2BC3A 1KQXA 2K62A 1QQSA 1T0VA 4BJ8A 4AKMA 3PDFA 2IWWA 1NDJA 4CV7A 4LSEA 2L5PA 3T1DA 4ZH9A 5L3YA 3P6DA 4UU3A 1KT3A 2XMXA 2MO5A 4GDZA 4IAXA 2BS5A 1DC9A 1E02A 1WBIA 1OSPO 1VWBB 2OY8A 1IKJA 3B2LA 1ZHZA 2JW1A 1K24A 1LUQA 1RBPA 4F4BA 5LKEA 1LIDA 1N9MA 1ZHXA 3A0HO 2MWHA 1D2UA 3CMPA 1OEKA 1SRFA 1GKAB 1OPBA 2IZAA 3STMX 5L8NA 1I78A 1AVGI 3HTYA 5IRWA 4AUIA 2QCBA 4YCHA 5F6ZA 1LICA 1E2TA 4I9SA 3WZQA 3QRAA 5B66O 4BGFA 3ZW0B 5B11O 1X89A 3FENA 1OBUA 2XE1A 5LJEA 2QOSC 2CAMA 1OBQA 2AT6X 2OFAA 3AAAA 2HZRA 5KIDA 4IABA 1G90A 5BVTA 3SY9A 3WJFA 1GX9A 5KICA 4E1SA 3P6EA 1SXUA 3NJTA 3I17A 2X9KA 2JGSA 1LF7A 4FUVA 1OPFA 2RTGB 3LTWA 1ZHWA 3D95A 4Z3TA 1FJ1E 1QFVA 2F01A 5G39A 2FKGA 2ZSCA 4AYHA 3CKFA 5B2AO 2Q2PA 1IKEA 5EZ2A 1HMTA 3PH5A 4L1NA 1NC9A 1ZNDA 1FELA 3FELA 2WQAE 2X8SA 2R73A 4ORUA 5LJHA 5KAFO 4CPFA 4K3BA 1GFMA 1KL5A 1IFCA 4NYRA 2RTHB 4JNJA 1SWKA 4QGXA 3STNA 2JU8A 1JJXA 4MVKA 1DZPA 2AKQA 2Y7SA 4XMDA 1X71A 1E54A 5B3MO 2OFBA 4JGLA 4OS3A 5JR8A 3B2KA 3SZDA 1VYOA 3FW4A 4CTDA 2A2GA 4QZTA 4EDEA 1SY3A 2DJGA 1KT5A 5E79O 3MX7A 3SZHA 3OD9A 4A8ZA 1SXXA 1VYGA 4INNA 2ZAIA 1NQMA 4N7CA 4TJZA 2JMBA 5GV0A 4QYPA 2FGRA 1IFBA 3KZAA 2W2AA 5D47A 4KCAA 3C77X 1DZJA 2VDFA 4IB9A 5EEEA 2A0AA 5AFUK 5FAZA 3P02A 3BU9A 1HQPA 3FYXA 3HK1A 1VWFB 1ADLA 1SRJA 1DF8A 3JCUO 3CQRA 4KR4A 3JSQA 2J4UP 1EXSA 1LIBA 4KC8A 1OSMA 1G74A 3B2IA 1RXKA 4O4UA 4LSHA 3VHMA 3WBGA 3NQKA 2BT9A 4JO6A 4GUZA 3HOLA 3C5OA 1ALBA 3BRYA 4ID2A 4EFGA 4CPIA 1IIUA 3AUMO 2Q4NA 3DA3A 3PRNA 4UB6O 3RE5A 4ARHA 2LFUA 5LKFA 2R56A 4CPEA 3QRCA 3T6FA 1SWGA 4Z27A 2OL8O 3KFGA 2HKDA 5LJCA 2BHVA 3WJGA 1SRHA 2FT9A 4BX5B 4D6BA 3LK41 2N93A 4GDAA 4C69X 1ZHTA 2NP1A 3UU2A 1SWPA 3PQSA 5DL6A 2OFRX 5HZQA 3POXA 4LZUA 4IAWA 1SLEB 3K3LA 2R8AA 3PECA 2FS6A 1ICMA 1GKAA 1O8VA 4B55A 3BRZA 4MISA 1TXLA 3WJDA 4ZHFA 1E00A 3POUA 4OEMA 4GCQA 7PRNA 3TF6A 5L8OA 1GT4A 4RJXA 3KVDD 2EU7X 1L6MA 4GJVA 3PEDA 2IZHB 2X45A 5AJCA 2X32A 5IO7A 3ZW0A 1JMZA 3LK3B 3T2XA 2MF6A 4AYEC 3VY8X 1HXZA 1KFFA 1BSYA 5AJBA 2F1TA 2C1SA 4WBKA 4LKPA 1LDQA 2AH7X 3HWGA 1GT3A 4QZUA 2XG6A 4YBPA 4L3RA 2FR3A 4FBOA 1YWBA 3WXQA 1E06A 1HXTA 3FA8A 1YWCA 3WJEA 3AA0B 4AZNA 1SWNA 3KFIA 4ZR2A 3FIQA 1VYFA 2WSJA 5HTDA 1O1VA 5D5DA 1BSQA 2FTBA 3BSZE 4HWMA 2AF5A 1FDQA 4XMFA 1EW3A 4JCHA 1N4JA 3HOEA 3UEUA 1AB0A 4MVEA 3D4RA 1EPAA 2VFBA 1MM5A 4FSPA 3RY1A 3SLOA 4FQEA 5F58A 1DF3A 4YKMA 3DA4A 1OEEA 4TNNA 1SWUA 4TQ2A 3RDOA 2DM5A 1VWRB 1H91A 1YP6A 3SLTA 4ZHCA 1VPRA 1SWBA 3KZIO 4A60A 1FEMA 1MX8A 5HAEA 2G5LA 1BBPA 4DQ3A 2YNKA 2DJFA 2P8GA 4CDDA 3WOVA 1B8EA 2CZUA 3ELXA 3BS0A 3AA6B 3VE2A 2A8GA 1PM1X 4AZOA 3NX2A 1T68X 5JDPA 4KH8A 2CZTA 3TZGA 1GT1A 1JBHA 1T16A 4YFPA 4FRTA 3APXA 1X8NA 2K4TA 3CBSA 2I5ZO 1STSB 2RTFB 1GT5A 1RAVA 4NYQA 5B5GA 4GH7A 3PP6A 3WJBA 1Y53X 1ERXA 2JU7A 2R4NA 3FIDA 3LHNA 1U18A 2FR2A 1SWFA 2RN4A 3RDMA 1UZ2X 2ACOA 3HWFA 2GE4A 1QJ9A 1CBQA 3V8UA 4DQ4A 2F1CX 3P6GA 5D48A 3UPGA 5K06A 2RTOB 3SZVA 3RBYA 4A1HA 2KW1A 1SWSA 2OL6O 4UB8O 3LK2B 1RXHA 1KT7A 4ZHHA 2X55A 3P24A 2ANSA 4QYNA 1VWHB 2RTEB 1YIVA 1STRB 2LHFA 3VZWX 2ERVA 2WJRA 2Q2MA 4Y59A 4C00A 5HZ6A 1B4MA 4ORXA 4BX5A 4KRAA 1VWLB 4BQUA 5C0NA 2M06A 5ADXK 1D3SA 4AKRB 5B27A 1HMSA 4AFKA 1BLRA 2RTKA 3STKA 1JJJA 1W6FA 4RLCA 4LKTA 5B29A 1QY0A 4CSBA 4ZGUA 4GKCA 2RTLA 4AZQA 2WVPA 4G76A 2IZCB 2ACPX 2RTJA 4OMXA 3NR3A 5F1EA 5TISO 2ALLX 1KQWA 4LZVA 1BM5A 2F1VA 4XMGA 3HWEA 3T24A 5FENA 3WI5A 3TGBA 2R74A 4GRJA 2OVAA 1I9HA 3WJCA 1KT6A 3T20A 4ODDA 1PEEA 3VGWA 3UEVA 3HWBA 4IB6A 2WPUA 4NV8A 2QM9A 4FMSA 4GCSA 3VG3A 2BLGA 4O9SA 1QJPA 1ACDA 4EQAC 3AA0A 3DWOX 4GNYA 2G8CO 2A5CA 4CPHB 3RDSA 1FE3A 3ZWEA 1RXJA 4OS8A 1BT9A 3BX7A 4DCBA 3VE1A 2KZ7B 3IFBA 1Y52X 2JN3A 2FHLA 4DNEA 4N58A 3UEWA 4Y0QA 3FA6A 1SMPI 2A3FX 5HZ9A 1OPAA 1SY0A 4GGTA 5H9AA 4KT5A 1HBQA 1I04A 5DL7A 5F2BA 3KVNA 2JQYA 4BBOA 5FQ6E 1ZRYA 1UYNX 3P6FA 2HNXA 4FT6A 2OY1O 2R4LA 1UYOX 2PRNA 2RTBB 1VWQB 5HA0A 3JQOA 2OY5O 3VU1A 1T1LA 4ZFXA 5HCDC 5D8JA 1MEPA 1X8OA 4LQZA 3ZUOA 1MK5A 2N2LA 2Y2XA 1HXLA 4IMOA 1B0OA 1HXXA 4GZVA 2W2FA 3FEPA 2FWVA 5EDBA 3O22A 1ZNLA 2UZ2A 4FESA 3K19A 2JOZA 3DTQA 1ORMA 2Y0LA 5HTEA 3NQ9A 4N75A 1PMPA 4PJ2A 4JHQA 4YMYA 1GFNA 2QTKA 1KZWA 4RUUA 4YKOA 3AAEB 2MHLA 2XE3A 1U0XA 3WZNA 1AELA 4O3XB 2XSTA 1TW4A 3U0DA 4IBAA 1VWEB 2AT8X 1ZHYA 3MVFA 5LJKA 4FRXA 5H2FO 3SLJA 3BU1A 1IZNB 1VWMB 3FR5A 2K23A 4KC7A 3PPTA 3EW2A 2JMMA 4U8UM 5IO6A 2Y0KA 4U46A 5LJDA 2RD7C 4I6SA 5HCEC 2POAA 4CDCA 3FA9A 1BH3A 3X00A 4UU2A 4I3CA 3ZW2A 8PRNA 2KXPA 2PORA 3RZYA 3HW9A 3VPJE 2O62A 4D64A 2IZGB 2QO4A 4PSQA 3EMNX 3LK2A 4I60A 2JU3A 1HXUA 3ZZVA 2KTSA 1PHOA 2WQ9A 2Y3EA 1BJ7A 4BOEA 4FSOA 3TGAA 1SY2A 1N9YA 4GCPA 1TVQA 5EPQA 5G26A 4HPDA 4M6SA 1SWJA 1GFOA 3UEXA 2Y0HA 4CDFA 4GU8A 3NPOA 4O4OA 4OMWA 2AVIA 3SYSA 2HZQA 1GX3A 4ES7A 1ZNEA 3A2SX 1TOUA 4N59A 4AKRA 5DL5A 1Y0GA 1VWJB 2OL7A 5GTIO 3VG4A 3BDRA 3Q6LA 3O19A 3MM0A 4ZHGA 2WWPA 3HPEA 5BVSA 2KC0A 1RLBE 5AFUL 4FGIB 4I9RA 3FDCA 4GJSA 4N7DA 1QWDA 1OBPA 1B56A 4AZPA 3QKGA 1MM4A 3IA8A 2OY7A 2GTLO 2RCTA 2KT4B 2LFOA 1HQQA 3G7XA 4MEEA 3RY2A 4PJ0O 2F73A 1JYJA 5L8IA 4RJWA 6PRNA 1R0UA 4NNSA 1RSTB 2L9CA 4HPCA 5EDCA 2AT5X 4GGRA 1SWTA 3VHIA 2RTMA 2IZFB 3SOTA 1VWNB 2YMSA 3SZIA 2VFCA 4FBRA 1Q9FA 4AZMA 2OYBO 3EM0A 4MVIA 4CPHA 4WFVA 2X4MA 3PGSA 5FQ8E 2Z4IA 1K3BA 1SWOA 2KZ7A 4YBUA 4B61A 3RDXA 1S2PA 3APUA 4CDEA 3VHHA 3AEHA 4EXZA 4N74A 2WEXA 1JV4A 1CJ5A 4ON1A 1QG5A 4AYDC 2LBAA 2RTDB 1GFQA 3BX8A 4O4SA 4YVBA 1SREA 3F8AA 4I95A 4WFUA 4Z6JA 1NP4A 4FZLA 4C4VB 2IZLB 4XMEA 1P4TA 5B5EO 4FZMA 2OVSA 3LK42 4XMHA 4GK9A 4QGWA 1E5PA 1EIOA 2IFBA 1GM6A 4D6AA 5HZ8A 3KFHA 3S5VA 1QY2A 3AA1B 3WYPA 4IB7A 4XNLA 4QAEA 2RTQB 2OF8A 4O49A 2LBVA 2GJ5A 1X8UA 4U9CA 1VWDB 1EI5A 3C76X 4AZRA 2RTAA 4U8UN 2AMMX 1KGLA 1W5RA 4OKAA 2LA7A 1PBOA 1QFTA 1TOWA 3NSGA 1DZKA 4ORRA 4PR7A 4RL9A 2QO5A 2IZJA 3AAEA 5FVNA 1BRQA 2CBSA 3NQ3A 1DZMA 1S7DA 1U17A 2R4OA 2RCQA 5BYPA 5H9KA 1YWDA 1QJ8A 4GETA 3NX1A 4BX6B 3F9DA 1IZNA 3S5XA 1SWAA 2QO6A 2RTIB 1ZNGA 1SY1A 2W81C 4IB8A 1Y9LA 4YDAA 1BXWA 2XKLA 3FR2A 4HFOA 2Q9SA 2NNEA 2WUTA 5CHKA 1PRNA 1IJ8A 1ML7A 1HN2A 1HMRA 4ZHDA 3RDUA 2Q39A 1SWQA 1ZNHA 5HZ5A 3RE6A 2CM4A 5T5FA 3T0SA 2ZAGA 5DG4A 4NP1A 1JQPA 2FS7A 1YS5A 4YH0A 1JYDA 5FQ7E 1MOYA 2WEWA 1VWCB 4HPAA 2R89A 3ZUIA 4A1YA 2OZQA 2M4LA 1HY2A 3WU2O 2IWVA 5KHPA 3VZUX 1N43A 2M07A 2QOMA 1WUBA 3DSZA 3BY0A 3RDQA 4NW4A 2FLJA 1KXOA 5LJGA 3CQNA 3MBTA 3O2YA 4HPBA 1LDOA 2ZLDA 2Z4HA 1XCAA 5GTHO 1KOIA 3WZOA 3EMMA 1EQDA 1A2DA 3G7GA 3EBKA 3RWXA 5HBSA 2OMFA 4XNKA 1JMXA 3LK3A 1MDCA 3HWDA 4E1TA 4KR8A 2GH7A 1BSOA 1S44A 2X8FA 3VG2A 3C78X 1CBRA 3SAOA 4R0BA 3FYFA 1SWCA 2L67A 1I06A 4OELA 3ZI8A 3BS2A 3H3IA 3NBXX 1CBSA 1VWIB 3FLLA 4O3ZA 2MNHA 1LFOA 4ML7B 5EEDA 2UYWA 3VG6A 3FMZA 4G75A 2CM9A 1KT4A 3AKMA 5ADXL 5KAIO 2LB6A 1N0SA 2X27X 1PTSA 4LSFA 4IL6O 4JFBA 3ZW1B 1QABE 1A3YA 4TKHA 2RTPB 4TLJA 2AT3X 1ERBA 4ORSA 2F09A 1SLDB 4RLBA 2GC9A 4C4VA 1SLFB 3AA7B 4YGZA 3APWA 4AYID 3KFFA 3GAQA 2W80C 1AQBA 3PORA 3AA1A 3DWNA 1GXAA 2XE5A 3D96A 4FQBB 1VWKB 1LCZA 4ZCBA 5DPQA 3WI4A 1JIWI 1YWAA 1T8VA 5IYUA 4PUXA 1Y9TA 5CE4A 3T2WA 3WZPA 2KTDA 4AYNA 1LELA 3SZJA 3AA6A 2IZBA 2X56A 1SWLA 5CYBA 4ZH6A 1NBXA 5BVQA 1DV9A 2AT0X 3P6HA 2C1QA 2IZDB 3Q34A 1GFPA 2BSZA 4BUMX 4QRLA 4O3WA 4BX6A
chains in the Genus database with same CATH topology
2QOSC 2PY1A 1JBHA 1OBQA 5EDCA 1UREA 2AT5X 4YFPA 3ELZA 4YFRA 2AT6X 3AAAA 2OFMX 4FRTA 3APXA 1X8NA 2HZRA 4I3BA 5KIDA 2NNQA 4IABA 2K4TA 2W2BA 3SOTA 3CBSA 1G90A 2YMSA 5BVTA 3E3CA 1GT5A 4FBRA 3SY9A 1LPJA 4NYQA 3WJFA 4YDBA 1GX9A 1P6PA 5KICA 1Q9FA 4E1SA 3FR4A 3P6EA 4GH7A 3VZTX 1SXUA 3PP6A 3WJBA 4AZMA 3EM0A 4MVIA 1EIIA 4WFVA 1ERXA 2JU7A 1A57A 1GX8A 3LHNA 5FQ8E 4CK4A 1U18A 2FR2A 2Z4IA 3I17A 1LF7A 4FUVA 2KZ7A 5AQ6A 1OEJA 1OPFA 2RN4A 3POQA 1UZ2X 2ACOA 3HWFA 4YBUA 1ZHWA 3D95A 1QJ9A 2GE4A 3O0EA 4B61A 1CBQA 3V8UA 4Z3TA 4DQ4A 1S2PA 3AKNA 3APUA 1SA8A 1QFVA 3P6GA 5D48A 2MM3A 3UPGA 5K06A 4AYHA 4EXZA 3SZVA 3RBYA 2WEXA 4A1HA 2Q2PA 1IKEA 2KW1A 5EZ2A 3I0AA 4QGVA 3VG7A 1HMTA 3PH5A 3LK2B 4L1NA 2G78A 1JV4A 1MX7A 1CJ5A 4ON1A 1KT7A 1ZNDA 4ZHHA 1QY1A 3P24A 1QG5A 4AYDC 2ANSA 2LBAA 4QYNA 4QQ1A 1GFQA 3BX8A 4O4SA 3SY7A 1FELA 1YIVA 3FELA 2LHFA 4O3YA 4Y0RA 1DFVA 1MVGA 2GTLM 2WQAE 3F8AA 4I95A 4WFUA 3VZWX 4YGHA 3OBLA 3S26A 3S60A 1IW2A 1NP4A 1XKIA 2R73A 2X8SA 4ORUA 5LJHA 2ERVA 4FZLA 2Q2MA 1GFMA 3APVA 1IFCA 4NYRA 2HLVA 4XMEA 5HZ6A 1B4MA 4RUNA 3TZSA 1P4TA 4FZMA 2NNDA 2OVSA 1I4UA 4EEJA 4ALBA 2GTFX 4U8UO 3LK42 4ORXA 4XMHA 4GK9A 4KRAA 2X8TA 3EBWA 4QGWA 4BQUA 1G85A 4FOZA 1E5PA 4QGXA 5C0NA 3STNA 2M06A 5ADXK 5PRNA 1EIOA 2IFBA 1GM6A 4I3DA 5H8TA 4D6AA 1D3SA 3KFHA 1QY2A 1BRPA 1ZNKA 3S5VA 3VG5A 4IMNA 5HZ8A 3AA1B 4AKRB 2JU8A 1LNMA 2HMBA 1EUOA 1JJXA 5B27A 4M7MA 4MVKA 1HMSA 1DZPA 2AKQA 2Y7SA 4AFKA 1CRBA 4IB7A 1BLRA 4XMDA 1X71A 1E54A 4XNLA 3STKA 4QAEA 1JJJA 1Q9GA 2A2UA 4O49A 4RLCA 4LKTA 5B29A 2ASNX 2LBVA 1QY0A 4AZLA 4CSBA 4ZGUA 2GJ5A 4JGLA 1X8UA 3F6ZB 4GKCA 4U9CA 3OE3A 1EI5A 3C76X 4AZQA 4ZJ0A 4AZRA 4G76A 4OS3A 4U8UN 2AMMX 2ACPX 5JR8A 2XTQA 3B2KA 4OMXA 1KGLA 3FW4A 3NR3A 5F1EA 1MPFA 3SZDA 2A2GA 4QZTA 4EDEA 2ALLX 2OVDA 3ZQ3A 1SY3A 2LA7A 1KQWA 4LZVA 1BM5A 2F1VA 1PBOA 4XMGA 1KT5A 3HWEA 3T24A 2X46A 3MX7A 5FENA 3TGBA 3WI5A 1QFTA 4NNTA 4ORYA 2R74A 1TOWA 2FGQX 3OD9A 4A8ZA 4BVMA 3NSGA 4GRJA 1DZKA 4ORRA 1SXXA 1VYGA 2OVAA 4INNA 4RL9A 1CBIA 2QO5A 3AAEA 3WJCA 2ZAIA 1KT6A 4ZGFA 1BRQA 5FVNA 2CBSA 3NQ3A 1DZMA 1S7DA 4AYMC 3T20A 1U17A 4N7CA 4TJZA 2JMBA 4ODDA 3CBCA 4QYPA 4LSIA 5GV0A 2RCQA 1PEEA 5BYPA 2FGRA 5H9KA 1IFBA 1YWDA 3KZAA 3UEVA 2W2AA 1QJ8A 2OVEA 3D97A 2O4VA 4GETA 3HWBA 3NX1A 5D47A 3F9DA 4OS0A 4KCAA 3C77X 2LKKA 1IZNA 1DZJA 3S5XA 3JTYA 2QO6A 4IB6A 1ZNGA 3CWKA 3AAAB 1SY1A 2W81C 4IB8A 1Y9LA 4IB9A 5EEEA 4YDAA 1BXWA 2QM9A 2BS6A 2XTRA 2A0AA 2XKLA 2G7BA 4FMSA 3FR2A 4HFOA 4XMCA 1FENA 4GCSA 5AFUK 2Q9SA 5FAZA 3P02A 2NNEA 3BU9A 3VG3A 1HQPA 1YUPA 2BLGA 2WUTA 1PRNA 4KIIA 3RSWA 1ML7A 3FYXA 4O9SA 1QJPA 2QMIA 1ACDA 3HK1A 4EQAC 1ADLA 2A13A 1HN2A 4TKBA 3FA7A 5EE2A 1HMRA 4ZHDA 3AA0A 3CQRA 3GP6A 5D4AA 4GNYA 4KR4A 1SXYA 3JSQA 4O4XA 2J4UP 3ZWEA 1EXSA 1FE3A 1LIBA 1LKEA 2Q39A 4KC8A 1OSMA 4ORWA 4OS8A 1G74A 3B2IA 1BT9A 1ZNHA 5HZ5A 3BX7A 4O4UA 2CM4A 3VE1A 3IFBA 4AW8A 2KZ7B 2ZAGA 4LSHA 2CBRA 5T5FA 3T0SA 2JN3A 3NP1A 4WHIA 1LIEA 3BRNA 5HA1A 3ZW1A 3WBGA 5DG4A 4N58A 3UEWA 4NP1A 4Y0QA 3NQKA 3EYCA 1JZUA 4D5UA 1I05A 2BT9A 2FS7A 2WR6A 4ALOA 2YG2A 1YS5A 5H9LA 1Z24A 4YH0A 3FA6A 1SMPI 2N2MA 5HCCC 4TKJA 1JYDA 3U03A 1H6S1 3HOLA 2A3FX 3C5OA 1SXWA 1ALBA 5HZ9A 5FQ7E 4ID2A 4EFGA 1OPAA 1SY0A 1IIUA 5H9AA 2WEWA 4HPAA 4KT5A 1HBQA 2Q4NA 1I04A 3DA3A 3PRNA 5DL7A 5LJBA 3ZUIA 3KQ0A 1LIFA 3TGCA 4A1YA 4YCEA 4K19A 2OZQA 2M4LA 4ARHA 5FQ6E 2LFUA 1ZRYA 5LKFA 3P6FA 2R56A 2HNXA 1G5WA 3AA7A 3QRCA 4FT6A 5F7GA 2PRNA 1G7NA 2G79A 2L68A 2ZFGA 5HA0A 5IO5A 4YGGA 4MVLA 4YFQA 3KFGA 3JQOA 3VU1A 3JS1A 5LJCA 4ZFXA 2BHVA 3B2JA 3WJGA 5HCDC 5D8JA 5KHPA 3VZUX 2XE2A 1X8OA 2M07A 2AL0X 2FT9A 4LQZA 4D6BA 3DSZA 3LK41 3BY0A 2YPVA 2N93A 4NW4A 2FLJA 3RKGA 3ZUOA 1KXOA 4COTA 4C69X 1ZHTA 2NP1A 5LJGA 3CQNA 2N2LA 2Y2XA 3SYBA 3MBTA 3O2YA 1GT1A 3UU2A 4IMOA 1A18A 2K0LA 3PQSA 4HPBA 5DL6A 1B0OA 2OFRX 5HZQA 1HXXA 3POXA 4GZVA 4GF4A 2RQ0A 2W2FA 4Y0SA 3FEPA 2FWVA 4LZUA 5EDBA 2ZLDA 4IAWA 2Z4HA 1XCAA 3K3LA 3O22A 3PECA 2FS6A 1KOIA 1ZNLA 1ICMA 3EMMA 4FESA 3K19A 2JOZA 3FEKA 1GKAA 1EQDA 1A2DA 1O8VA 4GE1A 3G7GA 1NP1A 2KD2A 3EBKA 2MJIA 3DTQA 3RWXA 1ORMA 4MISA 1TXLA 2Y0LA 3WJDA 5HTEA 5F6BA 5HBSA 2OMFA 4XNKA 4ZHFA 4GNWA 3NQ9A 1E00A 3POUA 2RA6A 4FZNA 5H9NA 4GCQA 7PRNA 1O1UA 3TF6A 5L8OA 1GT4A 3LK3A 3KVDD 4RJXA 1PMPA 1MDCA 4PJ2A 3RBHA 2EU7X 3BLGA 3HWDA 4E1TA 4KR8A 1L6MA 4YMYA 3PEDA 1GFNA 1HBPA 3WVMA 2X45A 5AJCA 1BSOA 2QTKA 1BWYA 1KZWA 4RUUA 5IO7A 1S44A 2X8FA 4YKOA 3VG2A 2MHLA 3ZW0A 3AAEB 3NADA 3LK3B 4GHBA 3OJYC 2KDYA 3C78X 2XE3A 1U0XA 1CBRA 4AYEC 3SAOA 1AELA 3N91A 4D65A 4O3XB 3VY8X 2MHDA 4R0BA 2XSTA 3FYFA 5FFHA 5AEOA 2L67A 1BSYA 1TW4A 3U0DA 4IBAA 1I06A 1ICNA 3ZI8A 5D45A 2AT8X 3BS2A 1ZHYA 3H3IA 3MVFA 5LJKA 5AJBA 4FRXA 3NBXX 2F1TA 1CBSA 3BU1A 4WBKA 3PQUA 3CR6A 1IZNB 1KZXA 3FR5A 4LKPA 2K23A 3FLLA 4KC7A 4NLJA 2HYSA 4O3ZA 1X8QA 3U9PC 2MNHA 1LFOA 4Y0PA 3HWGA 2AH7X 1GT3A 3PPTA 4QZUA 3GE2A 1THQA 2JMMA 4ML7B 4YBPA 2XG6A 2GTLN 4L3RA 2FR3A 4U8UM 3UAQA 5EEDA 3FW5A 5IO6A 2Y0KA 2J1NA 4FBOA 3VG6A 5DL8A 1YWBA 3P6CA 3FMZA 5LJDA 3WXQA 2RD7C 4I6SA 2ODJA 4G75A 3PH6A 1EPBA 2CM9A 1E06A 5HCEC 1HXTA 1KT4A 3FA8A 3AKMA 1YWCA 4FBVA 2POAA 3WJEA 3AA0B 4AZNA 1NGLA 3FA9A 4NLIA 1BH3A 5ADXL 2LB6A 1N0SA 3KFIA 2FRSA 2X27X 4U3QA 3VY9X 4ZR2A 4LSFA 4UU2A 3FIQA 4I3CA 1VYFA 2WSJA 3LV4A 3ZW2A 8PRNA 5HTDA 2KXPA 2PORA 4JFBA 1O1VA 3RZYA 3ZW1B 3HW9A 5D5DA 3VPJE 4QNIA 2O62A 4D64A 1BSQA 2FTBA 3BSZE 1EALA 1QABE 1A3YA 4HWMA 4TKHA 4MIRA 1FDQA 1GGLA 4TLJA 2KXPB 2E4JA 2QO4A 3L4RA 1X8PA 3B2HA 4PSQA 1YP7A 2AT3X 4XMFA 1ERBA 3EMNX 1EW3A 3LK2A 4JCHA 1FTPA 5HWZA 2JU3A 4ORSA 2F09A 1BEBA 1MUPA 1HXUA 1KQXA 3HOEA 3UEUA 1AB0A 2K62A 1QQSA 3ZZVA 2KTSA 4MVEA 1PHOA 4RLBA 3D4RA 1EPAA 2WQ9A 1BJ7A 4BOEA 1T0VA 4FSOA 3TGAA 1SY2A 1MM5A 4GCPA 1TVQA 5EPQA 5G26A 2GC9A 4HPDA 4M6SA 1GFOA 4FSPA 3AA7B 4YGZA 3APWA 4AYID 3UEXA 3KFFA 4HPCA 2Y0HA 4AKMA 3GAQA 4GU8A 3NPOA 4O4OA 5F58A 4CV7A 1DF3A 4YKMA 4LSEA 4OMWA 3DA4A 1OEEA 2L5PA 3T1DA 2W80C 4ZH9A 1AQBA 3P6DA 4TNNA 4UU3A 1KT3A 2XMXA 2MO5A 3SYSA 4TQ2A 2HZQA 4GDZA 4IAXA 2BS5A 4ES7A 1DC9A 1E02A 1ZNEA 3A2SX 1TOUA 3AA1A 3PORA 4N59A 5DL5A 4AKRA 1GXAA 2XE5A 2DM5A 1H91A 1YP6A 3D96A 1IKJA 4ZHCA 3B2LA 2JW1A 4FQBB 1ZHZA 3BDRA 1VPRA 3Q6LA 4ZCBA 3VG4A 1RBPA 4F4BA 5DPQA 5LKEA 3WI4A 1JIWI 3O19A 4ZHGA 2WWPA 4A60A 2KC0A 1YWAA 1T8VA 5BVSA 1FEMA 1LIDA 1RLBE 4FGIB 1ZHXA 4PUXA 4I9RA 1Y9TA 5AFUL 5IYUA 1MX8A 5CE4A 4N7DA 1QWDA 2MWHA 5HAEA 1D2UA 1OBPA 3CMPA 1BBPA 2KTDA 1OEKA 4AYNA 1B56A 4AZPA 3QKGA 1GKAB 4DQ3A 1MM4A 2YNKA 3IA8A 3AA6A 2P8GA 1OPBA 3STMX 5L8NA 3WOVA 1B8EA 1AVGI 5CYBA 2CZUA 3ELXA 2GTLO 3HTYA 4ZH6A 2RCTA 4AUIA 2KT4B 5BVQA 3VE2A 4YCHA 5F6ZA 1DV9A 2AT0X 3P6HA 3AA6B 1LICA 2LFOA 3G7XA 1PM1X 4AZOA 1GFPA 2F73A 3NX2A 4BUMX 4I9SA 1JYJA 3QRAA 1T68X 5L8IA 5JDPA 3ZW0B 4QRLA 4O3WA 4KH8A 4RJWA 6PRNA 2CZTA 1R0UA 1X89A 1OBUA 3FENA 4NNSA 3TZGA 2XE1A 2L9CA 5LJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Z A;  3HOL A;  5EE2 A;  4U9C A;  4AYD C;  3UAQ A;  4AYI D;  4O4X A;  4QQ1 A;  2KDY A;  3V8U A;  2KC0 A;  4Z3T A;  3VE2 A;  4AYE C;  2Y7S A;  4O3Y A;  4O3X B;  2YPV A;  2W80 C;  4O4U A;  3VE1 A;  2W81 C;  5T5F A;  4O49 A;  2LFU A;  4O3W A;  4AYN A;  3HOE A;  3PQS A;  1YS5 A;  4AYM C;  3PQU A;  3KVD D; 
#chains in the Genus database with same CATH topology
 2OF9 A;  2PY1 A;  1URE A;  3ELZ A;  4YFR A;  2OFM X;  1VWA B;  4I3B A;  4BX7 B;  1SWR A;  2NNQ A;  2W2B A;  3E3C A;  1SWD A;  1LPJ A;  4YDB A;  1P6P A;  3FR4 A;  5IXG A;  3VZT X;  3CKG A;  1EII A;  1SRI A;  1A57 A;  1GX8 A;  5B5F A;  4CK4 A;  1VWG B;  5AQ6 A;  4Z2V A;  1OEJ A;  3POQ A;  3O0E A;  3AKN A;  1SA8 A;  4Y5D A;  4NV7 A;  1VWP B;  3A0B O;  2MM3 A;  1KL3 A;  1SRG A;  3I0A A;  4QGV A;  3VG7 A;  2G78 A;  1MX7 A;  1QY1 A;  2RTN B;  4QQ1 A;  3MG5 A;  3SY7 A;  4O3Y A;  4Y0R A;  1DFV A;  1MVG A;  2GTL M;  4YGH A;  3OBL A;  3S26 A;  3S60 A;  1IW2 A;  1XKI A;  1W4T A;  3APV A;  2Y32 A;  2HLV A;  4RUN A;  3TZS A;  2NND A;  1I4U A;  4EEJ A;  4ALB A;  2GTF X;  4U8U O;  2RTR B;  2X8T A;  3EBW A;  1G85 A;  4FOZ A;  1MM9 A;  5PRN A;  4I3D A;  5H8T A;  1ZNK A;  1BRP A;  3VG5 A;  4IMN A;  1LNM A;  2HMB A;  1EUO A;  4M7M A;  1CRB A;  5K68 A;  1SWH A;  1Q9G A;  2A2U A;  2ASN X;  3DZM A;  4AZL A;  3F6Z B;  2RTC B;  3OE3 A;  4ZJ0 A;  2XTQ A;  1MPF A;  3QQ2 A;  2OVD A;  3EC5 A;  3ZQ3 A;  5B10 O;  2X46 A;  4NNT A;  4ORY A;  3D9W A;  2FGQ X;  4BVM A;  3EW1 A;  1CBI A;  4ZGF A;  1RSU B;  3PK2 A;  4AYM C;  5G38 A;  5IRU A;  4LSI A;  3CBC A;  2OVE A;  3D97 A;  2O4V A;  1AVD A;  4Z2O A;  4OS0 A;  4IRW A;  2LKK A;  3JTY A;  2WJQ A;  3CWK A;  3AAA B;  1Y55 X;  2BS6 A;  2XTR A;  2G7B A;  4XMC A;  1FEN A;  3WYQ A;  1YUP A;  2I5V O;  2FKJ A;  4KII A;  3RSW A;  2QMI A;  2A13 A;  4TKB A;  5EE2 A;  3FA7 A;  3GP6 A;  5D4A A;  2C4I A;  1SXY A;  4O4X A;  2X34 A;  5IRA A;  1LKE A;  1SLG B;  4ORW A;  4GGZ A;  4AW8 A;  3PF1 A;  2CBR A;  3NP1 A;  4WHI A;  1LIE A;  3BRN A;  5HA1 A;  3ZW1 A;  3EYC A;  1JZU A;  4D5U A;  1I05 A;  2WR6 A;  4ALO A;  2YG2 A;  5H9L A;  1Z24 A;  2N2M A;  5HCC C;  4TKJ A;  3U03 A;  1H6S 1;  4K3C A;  1SXW A;  4C5P A;  2FHN X;  5K67 A;  5LJB A;  3KQ0 A;  1LIF A;  3TGC A;  4YCE A;  4K19 A;  1G5W A;  3AA7 A;  5F7G A;  5CSE A;  1G7N A;  2G79 A;  2L68 A;  2ZFG A;  1NQN A;  5IO5 A;  4YGG A;  4MVL A;  4YFQ A;  1STP A;  3PGU A;  2Y3F A;  3JS1 A;  2AXT O;  1VWO B;  3B2J A;  2XE2 A;  2AL0 X;  2YPV A;  1KL4 A;  3RKG A;  4COT A;  4EKV A;  3SYB A;  1JJU A;  1A18 A;  2K0L A;  1AVE A;  4GF4 A;  2RQ0 A;  2IZK A;  4Y0S A;  4Z28 A;  4Z2P A;  4BCS A;  2A5B A;  3FEK A;  2FGS A;  4GE1 A;  1NP1 A;  2KD2 A;  2MJI A;  5F6B A;  4GNW A;  2RA6 A;  4FZN A;  5H9N A;  1LCV A;  1O1U A;  5G3A A;  3RBH A;  3BLG A;  1LCW A;  1HBP A;  3WVM A;  3PGR A;  1BWY A;  3NAD A;  4GHB A;  3OJY C;  3T6L A;  2KDY A;  2R4P A;  4D65 A;  3N91 A;  2MHD A;  5FFH A;  5AEO A;  1ICN A;  5D45 A;  5JD2 A;  4BX7 A;  1N7Y A;  3PQU A;  3CR6 A;  1KZX A;  3U9P C;  5DL8 A;  4NLJ A;  2HYS A;  1X8Q A;  4Y0P A;  3GE2 A;  1THQ A;  2PI3 O;  2GTL N;  3UAQ A;  3FW5 A;  2J1N A;  2IZE B;  3P6C A;  2ODJ A;  3PH6 A;  1EPB A;  4FBV A;  1NGL A;  1SWE A;  4NLI A;  2FRS A;  4U3Q A;  3VY9 X;  1PBY A;  3LV4 A;  4QNI A;  1S5L O;  2R88 A;  1EAL A;  4GD9 A;  4MIR A;  1GGL A;  2KXP B;  2E4J A;  3L4R A;  1X8P A;  3B2H A;  1YP7 A;  1FTP A;  5HWZ A;  1BEB A;  1MUP A;  2IZI A;  2BC3 A;  1KQX A;  2K62 A;  1QQS A;  1T0V A;  4BJ8 A;  4AKM A;  3PDF A;  2IWW A;  1NDJ A;  4CV7 A;  4LSE A;  2L5P A;  3T1D A;  4ZH9 A;  5L3Y A;  3P6D A;  4UU3 A;  1KT3 A;  2XMX A;  2MO5 A;  4GDZ A;  4IAX A;  2BS5 A;  1DC9 A;  1E02 A;  1WBI A;  1OSP O;  1VWB B;  2OY8 A;  1IKJ A;  3B2L A;  1ZHZ A;  2JW1 A;  1K24 A;  1LUQ A;  1RBP A;  4F4B A;  5LKE A;  1LID A;  1N9M A;  1ZHX A;  3A0H O;  2MWH A;  1D2U A;  3CMP A;  1OEK A;  1SRF A;  1GKA B;  1OPB A;  2IZA A;  3STM X;  5L8N A;  1I78 A;  1AVG I;  3HTY A;  5IRW A;  4AUI A;  2QCB A;  4YCH A;  5F6Z A;  1LIC A;  1E2T A;  4I9S A;  3WZQ A;  3QRA A;  5B66 O;  4BGF A;  3ZW0 B;  5B11 O;  1X89 A;  3FEN A;  1OBU A;  2XE1 A;  5LJE A;  2QOS C;  2CAM A;  1OBQ A;  2AT6 X;  2OFA A;  3AAA A;  2HZR A;  5KID A;  4IAB A;  1G90 A;  5BVT A;  3SY9 A;  3WJF A;  1GX9 A;  5KIC A;  4E1S A;  3P6E A;  1SXU A;  3NJT A;  3I17 A;  2X9K A;  2JGS A;  1LF7 A;  4FUV A;  1OPF A;  2RTG B;  3LTW A;  1ZHW A;  3D95 A;  4Z3T A;  1FJ1 E;  1QFV A;  2F01 A;  5G39 A;  2FKG A;  2ZSC A;  4AYH A;  3CKF A;  5B2A O;  2Q2P A;  1IKE A;  5EZ2 A;  1HMT A;  3PH5 A;  4L1N A;  1NC9 A;  1ZND A;  1FEL A;  3FEL A;  2WQA E;  2X8S A;  2R73 A;  4ORU A;  5LJH A;  5KAF O;  4CPF A;  4K3B A;  1GFM A;  1KL5 A;  1IFC A;  4NYR A;  2RTH B;  4JNJ A;  1SWK A;  4QGX A;  3STN A;  2JU8 A;  1JJX A;  4MVK A;  1DZP A;  2AKQ A;  2Y7S A;  4XMD A;  1X71 A;  1E54 A;  5B3M O;  2OFB A;  4JGL A;  4OS3 A;  5JR8 A;  3B2K A;  3SZD A;  1VYO A;  3FW4 A;  4CTD A;  2A2G A;  4QZT A;  4EDE A;  1SY3 A;  2DJG A;  1KT5 A;  5E79 O;  3MX7 A;  3SZH A;  3OD9 A;  4A8Z A;  1SXX A;  1VYG A;  4INN A;  2ZAI A;  1NQM A;  4N7C A;  4TJZ A;  2JMB A;  5GV0 A;  4QYP A;  2FGR A;  1IFB A;  3KZA A;  2W2A A;  5D47 A;  4KCA A;  3C77 X;  1DZJ A;  2VDF A;  4IB9 A;  5EEE A;  2A0A A;  5AFU K;  5FAZ A;  3P02 A;  3BU9 A;  1HQP A;  3FYX A;  3HK1 A;  1VWF B;  1ADL A;  1SRJ A;  1DF8 A;  3JCU O;  3CQR A;  4KR4 A;  3JSQ A;  2J4U P;  1EXS A;  1LIB A;  4KC8 A;  1OSM A;  1G74 A;  3B2I A;  1RXK A;  4O4U A;  4LSH A;  3VHM A;  3WBG A;  3NQK A;  2BT9 A;  4JO6 A;  4GUZ A;  3HOL A;  3C5O A;  1ALB A;  3BRY A;  4ID2 A;  4EFG A;  4CPI A;  1IIU A;  3AUM O;  2Q4N A;  3DA3 A;  3PRN A;  4UB6 O;  3RE5 A;  4ARH A;  2LFU A;  5LKF A;  2R56 A;  4CPE A;  3QRC A;  3T6F A;  1SWG A;  4Z27 A;  2OL8 O;  3KFG A;  2HKD A;  5LJC A;  2BHV A;  3WJG A;  1SRH A;  2FT9 A;  4BX5 B;  4D6B A;  3LK4 1;  2N93 A;  4GDA A;  4C69 X;  1ZHT A;  2NP1 A;  3UU2 A;  1SWP A;  3PQS A;  5DL6 A;  2OFR X;  5HZQ A;  3POX A;  4LZU A;  4IAW A;  1SLE B;  3K3L A;  2R8A A;  3PEC A;  2FS6 A;  1ICM A;  1GKA A;  1O8V A;  4B55 A;  3BRZ A;  4MIS A;  1TXL A;  3WJD A;  4ZHF A;  1E00 A;  3POU A;  4OEM A;  4GCQ A;  7PRN A;  3TF6 A;  5L8O A;  1GT4 A;  4RJX A;  3KVD D;  2EU7 X;  1L6M A;  4GJV A;  3PED A;  2IZH B;  2X45 A;  5AJC A;  2X32 A;  5IO7 A;  3ZW0 A;  1JMZ A;  3LK3 B;  3T2X A;  2MF6 A;  4AYE C;  3VY8 X;  1HXZ A;  1KFF A;  1BSY A;  5AJB A;  2F1T A;  2C1S A;  4WBK A;  4LKP A;  1LDQ A;  2AH7 X;  3HWG A;  1GT3 A;  4QZU A;  2XG6 A;  4YBP A;  4L3R A;  2FR3 A;  4FBO A;  1YWB A;  3WXQ A;  1E06 A;  1HXT A;  3FA8 A;  1YWC A;  3WJE A;  3AA0 B;  4AZN A;  1SWN A;  3KFI A;  4ZR2 A;  3FIQ A;  1VYF A;  2WSJ A;  5HTD A;  1O1V A;  5D5D A;  1BSQ A;  2FTB A;  3BSZ E;  4HWM A;  2AF5 A;  1FDQ A;  4XMF A;  1EW3 A;  4JCH A;  1N4J A;  3HOE A;  3UEU A;  1AB0 A;  4MVE A;  3D4R A;  1EPA A;  2VFB A;  1MM5 A;  4FSP A;  3RY1 A;  3SLO A;  4FQE A;  5F58 A;  1DF3 A;  4YKM A;  3DA4 A;  1OEE A;  4TNN A;  1SWU A;  4TQ2 A;  3RDO A;  2DM5 A;  1VWR B;  1H91 A;  1YP6 A;  3SLT A;  4ZHC A;  1VPR A;  1SWB A;  3KZI O;  4A60 A;  1FEM A;  1MX8 A;  5HAE A;  2G5L A;  1BBP A;  4DQ3 A;  2YNK A;  2DJF A;  2P8G A;  4CDD A;  3WOV A;  1B8E A;  2CZU A;  3ELX A;  3BS0 A;  3AA6 B;  3VE2 A;  2A8G A;  1PM1 X;  4AZO A;  3NX2 A;  1T68 X;  5JDP A;  4KH8 A;  2CZT A;  3TZG A;  1GT1 A;  1JBH A;  1T16 A;  4YFP A;  4FRT A;  3APX A;  1X8N A;  2K4T A;  3CBS A;  2I5Z O;  1STS B;  2RTF B;  1GT5 A;  1RAV A;  4NYQ A;  5B5G A;  4GH7 A;  3PP6 A;  3WJB A;  1Y53 X;  1ERX A;  2JU7 A;  2R4N A;  3FID A;  3LHN A;  1U18 A;  2FR2 A;  1SWF A;  2RN4 A;  3RDM A;  1UZ2 X;  2ACO A;  3HWF A;  2GE4 A;  1QJ9 A;  1CBQ A;  3V8U A;  4DQ4 A;  2F1C X;  3P6G A;  5D48 A;  3UPG A;  5K06 A;  2RTO B;  3SZV A;  3RBY A;  4A1H A;  2KW1 A;  1SWS A;  2OL6 O;  4UB8 O;  3LK2 B;  1RXH A;  1KT7 A;  4ZHH A;  2X55 A;  3P24 A;  2ANS A;  4QYN A;  1VWH B;  2RTE B;  1YIV A;  1STR B;  2LHF A;  3VZW X;  2ERV A;  2WJR A;  2Q2M A;  4Y59 A;  4C00 A;  5HZ6 A;  1B4M A;  4ORX A;  4BX5 A;  4KRA A;  1VWL B;  4BQU A;  5C0N A;  2M06 A;  5ADX K;  1D3S A;  4AKR B;  5B27 A;  1HMS A;  4AFK A;  1BLR A;  2RTK A;  3STK A;  1JJJ A;  1W6F A;  4RLC A;  4LKT A;  5B29 A;  1QY0 A;  4CSB A;  4ZGU A;  4GKC A;  2RTL A;  4AZQ A;  2WVP A;  4G76 A;  2IZC B;  2ACP X;  2RTJ A;  4OMX A;  3NR3 A;  5F1E A;  5TIS O;  2ALL X;  1KQW A;  4LZV A;  1BM5 A;  2F1V A;  4XMG A;  3HWE A;  3T24 A;  5FEN A;  3WI5 A;  3TGB A;  2R74 A;  4GRJ A;  2OVA A;  1I9H A;  3WJC A;  1KT6 A;  3T20 A;  4ODD A;  1PEE A;  3VGW A;  3UEV A;  3HWB A;  4IB6 A;  2WPU A;  4NV8 A;  2QM9 A;  4FMS A;  4GCS A;  3VG3 A;  2BLG A;  4O9S A;  1QJP A;  1ACD A;  4EQA C;  3AA0 A;  3DWO X;  4GNY A;  2G8C O;  2A5C A;  4CPH B;  3RDS A;  1FE3 A;  3ZWE A;  1RXJ A;  4OS8 A;  1BT9 A;  3BX7 A;  4DCB A;  3VE1 A;  2KZ7 B;  3IFB A;  1Y52 X;  2JN3 A;  2FHL A;  4DNE A;  4N58 A;  3UEW A;  4Y0Q A;  3FA6 A;  1SMP I;  2A3F X;  5HZ9 A;  1OPA A;  1SY0 A;  4GGT A;  5H9A A;  4KT5 A;  1HBQ A;  1I04 A;  5DL7 A;  5F2B A;  3KVN A;  2JQY A;  4BBO A;  5FQ6 E;  1ZRY A;  1UYN X;  3P6F A;  2HNX A;  4FT6 A;  2OY1 O;  2R4L A;  1UYO X;  2PRN A;  2RTB B;  1VWQ B;  5HA0 A;  3JQO A;  2OY5 O;  3VU1 A;  1T1L A;  4ZFX A;  5HCD C;  5D8J A;  1MEP A;  1X8O A;  4LQZ A;  3ZUO A;  1MK5 A;  2N2L A;  2Y2X A;  1HXL A;  4IMO A;  1B0O A;  1HXX A;  4GZV A;  2W2F A;  3FEP A;  2FWV A;  5EDB A;  3O22 A;  1ZNL A;  2UZ2 A;  4FES A;  3K19 A;  2JOZ A;  3DTQ A;  1ORM A;  2Y0L A;  5HTE A;  3NQ9 A;  4N75 A;  1PMP A;  4PJ2 A;  4JHQ A;  4YMY A;  1GFN A;  2QTK A;  1KZW A;  4RUU A;  4YKO A;  3AAE B;  2MHL A;  2XE3 A;  1U0X A;  3WZN A;  1AEL A;  4O3X B;  2XST A;  1TW4 A;  3U0D A;  4IBA A;  1VWE B;  2AT8 X;  1ZHY A;  3MVF A;  5LJK A;  4FRX A;  5H2F O;  3SLJ A;  3BU1 A;  1IZN B;  1VWM B;  3FR5 A;  2K23 A;  4KC7 A;  3PPT A;  3EW2 A;  2JMM A;  4U8U M;  5IO6 A;  2Y0K A;  4U46 A;  5LJD A;  2RD7 C;  4I6S A;  5HCE C;  2POA A;  4CDC A;  3FA9 A;  1BH3 A;  3X00 A;  4UU2 A;  4I3C A;  3ZW2 A;  8PRN A;  2KXP A;  2POR A;  3RZY A;  3HW9 A;  3VPJ E;  2O62 A;  4D64 A;  2IZG B;  2QO4 A;  4PSQ A;  3EMN X;  3LK2 A;  4I60 A;  2JU3 A;  1HXU A;  3ZZV A;  2KTS A;  1PHO A;  2WQ9 A;  2Y3E A;  1BJ7 A;  4BOE A;  4FSO A;  3TGA A;  1SY2 A;  1N9Y A;  4GCP A;  1TVQ A;  5EPQ A;  5G26 A;  4HPD A;  4M6S A;  1SWJ A;  1GFO A;  3UEX A;  2Y0H A;  4CDF A;  4GU8 A;  3NPO A;  4O4O A;  4OMW A;  2AVI A;  3SYS A;  2HZQ A;  1GX3 A;  4ES7 A;  1ZNE A;  3A2S X;  1TOU A;  4N59 A;  4AKR A;  5DL5 A;  1Y0G A;  1VWJ B;  2OL7 A;  5GTI O;  3VG4 A;  3BDR A;  3Q6L A;  3O19 A;  3MM0 A;  4ZHG A;  2WWP A;  3HPE A;  5BVS A;  2KC0 A;  1RLB E;  5AFU L;  4FGI B;  4I9R A;  3FDC A;  4GJS A;  4N7D A;  1QWD A;  1OBP A;  1B56 A;  4AZP A;  3QKG A;  1MM4 A;  3IA8 A;  2OY7 A;  2GTL O;  2RCT A;  2KT4 B;  2LFO A;  1HQQ A;  3G7X A;  4MEE A;  3RY2 A;  4PJ0 O;  2F73 A;  1JYJ A;  5L8I A;  4RJW A;  6PRN A;  1R0U A;  4NNS A;  1RST B;  2L9C A;  4HPC A;  5EDC A;  2AT5 X;  4GGR A;  1SWT A;  3VHI A;  2RTM A;  2IZF B;  3SOT A;  1VWN B;  2YMS A;  3SZI A;  2VFC A;  4FBR A;  1Q9F A;  4AZM A;  2OYB O;  3EM0 A;  4MVI A;  4CPH A;  4WFV A;  2X4M A;  3PGS A;  5FQ8 E;  2Z4I A;  1K3B A;  1SWO A;  2KZ7 A;  4YBU A;  4B61 A;  3RDX A;  1S2P A;  3APU A;  4CDE A;  3VHH A;  3AEH A;  4EXZ A;  4N74 A;  2WEX A;  1JV4 A;  1CJ5 A;  4ON1 A;  1QG5 A;  4AYD C;  2LBA A;  2RTD B;  1GFQ A;  3BX8 A;  4O4S A;  4YVB A;  1SRE A;  3F8A A;  4I95 A;  4WFU A;  4Z6J A;  1NP4 A;  4FZL A;  4C4V B;  2IZL B;  4XME A;  1P4T A;  5B5E O;  4FZM A;  2OVS A;  3LK4 2;  4XMH A;  4GK9 A;  4QGW A;  1E5P A;  1EIO A;  2IFB A;  1GM6 A;  4D6A A;  5HZ8 A;  3KFH A;  3S5V A;  1QY2 A;  3AA1 B;  3WYP A;  4IB7 A;  4XNL A;  4QAE A;  2RTQ B;  2OF8 A;  4O49 A;  2LBV A;  2GJ5 A;  1X8U A;  4U9C A;  1VWD B;  1EI5 A;  3C76 X;  4AZR A;  2RTA A;  4U8U N;  2AMM X;  1KGL A;  1W5R A;  4OKA A;  2LA7 A;  1PBO A;  1QFT A;  1TOW A;  3NSG A;  1DZK A;  4ORR A;  4PR7 A;  4RL9 A;  2QO5 A;  2IZJ A;  3AAE A;  5FVN A;  1BRQ A;  2CBS A;  3NQ3 A;  1DZM A;  1S7D A;  1U17 A;  2R4O A;  2RCQ A;  5BYP A;  5H9K A;  1YWD A;  1QJ8 A;  4GET A;  3NX1 A;  4BX6 B;  3F9D A;  1IZN A;  3S5X A;  1SWA A;  2QO6 A;  2RTI B;  1ZNG A;  1SY1 A;  2W81 C;  4IB8 A;  1Y9L A;  4YDA A;  1BXW A;  2XKL A;  3FR2 A;  4HFO A;  2Q9S A;  2NNE A;  2WUT A;  5CHK A;  1PRN A;  1IJ8 A;  1ML7 A;  1HN2 A;  1HMR A;  4ZHD A;  3RDU A;  2Q39 A;  1SWQ A;  1ZNH A;  5HZ5 A;  3RE6 A;  2CM4 A;  5T5F A;  3T0S A;  2ZAG A;  5DG4 A;  4NP1 A;  1JQP A;  2FS7 A;  1YS5 A;  4YH0 A;  1JYD A;  5FQ7 E;  1MOY A;  2WEW A;  1VWC B;  4HPA A;  2R89 A;  3ZUI A;  4A1Y A;  2OZQ A;  2M4L A;  1HY2 A;  3WU2 O;  2IWV A;  5KHP A;  3VZU X;  1N43 A;  2M07 A;  2QOM A;  1WUB A;  3DSZ A;  3BY0 A;  3RDQ A;  4NW4 A;  2FLJ A;  1KXO A;  5LJG A;  3CQN A;  3MBT A;  3O2Y A;  4HPB A;  1LDO A;  2ZLD A;  2Z4H A;  1XCA A;  5GTH O;  1KOI A;  3WZO A;  3EMM A;  1EQD A;  1A2D A;  3G7G A;  3EBK A;  3RWX A;  5HBS A;  2OMF A;  4XNK A;  1JMX A;  3LK3 A;  1MDC A;  3HWD A;  4E1T A;  4KR8 A;  2GH7 A;  1BSO A;  1S44 A;  2X8F A;  3VG2 A;  3C78 X;  1CBR A;  3SAO A;  4R0B A;  3FYF A;  1SWC A;  2L67 A;  1I06 A;  4OEL A;  3ZI8 A;  3BS2 A;  3H3I A;  3NBX X;  1CBS A;  1VWI B;  3FLL A;  4O3Z A;  2MNH A;  1LFO A;  4ML7 B;  5EED A;  2UYW A;  3VG6 A;  3FMZ A;  4G75 A;  2CM9 A;  1KT4 A;  3AKM A;  5ADX L;  5KAI O;  2LB6 A;  1N0S A;  2X27 X;  1PTS A;  4LSF A;  4IL6 O;  4JFB A;  3ZW1 B;  1QAB E;  1A3Y A;  4TKH A;  2RTP B;  4TLJ A;  2AT3 X;  1ERB A;  4ORS A;  2F09 A;  1SLD B;  4RLB A;  2GC9 A;  4C4V A;  1SLF B;  3AA7 B;  4YGZ A;  3APW A;  4AYI D;  3KFF A;  3GAQ A;  2W80 C;  1AQB A;  3POR A;  3AA1 A;  3DWN A;  1GXA A;  2XE5 A;  3D96 A;  4FQB B;  1VWK B;  1LCZ A;  4ZCB A;  5DPQ A;  3WI4 A;  1JIW I;  1YWA A;  1T8V A;  5IYU A;  4PUX A;  1Y9T A;  5CE4 A;  3T2W A;  3WZP A;  2KTD A;  4AYN A;  1LEL A;  3SZJ A;  3AA6 A;  2IZB A;  2X56 A;  1SWL A;  5CYB A;  4ZH6 A;  1NBX A;  5BVQ A;  1DV9 A;  2AT0 X;  3P6H A;  2C1Q A;  2IZD B;  3Q34 A;  1GFP A;  2BSZ A;  4BUM X;  4QRL A;  4O3W A;  4BX6 A; 
#chains in the Genus database with same CATH homology
 2QOS C;  2PY1 A;  1JBH A;  1OBQ A;  5EDC A;  1URE A;  2AT5 X;  4YFP A;  3ELZ A;  4YFR A;  2AT6 X;  3AAA A;  2OFM X;  4FRT A;  3APX A;  1X8N A;  2HZR A;  4I3B A;  5KID A;  2NNQ A;  4IAB A;  2K4T A;  2W2B A;  3SOT A;  3CBS A;  1G90 A;  2YMS A;  5BVT A;  3E3C A;  1GT5 A;  4FBR A;  3SY9 A;  1LPJ A;  4NYQ A;  3WJF A;  4YDB A;  1GX9 A;  1P6P A;  5KIC A;  1Q9F A;  4E1S A;  3FR4 A;  3P6E A;  4GH7 A;  3VZT X;  1SXU A;  3PP6 A;  3WJB A;  4AZM A;  3EM0 A;  4MVI A;  1EII A;  4WFV A;  1ERX A;  2JU7 A;  1A57 A;  1GX8 A;  3LHN A;  5FQ8 E;  4CK4 A;  1U18 A;  2FR2 A;  2Z4I A;  3I17 A;  1LF7 A;  4FUV A;  2KZ7 A;  5AQ6 A;  1OEJ A;  1OPF A;  2RN4 A;  3POQ A;  1UZ2 X;  2ACO A;  3HWF A;  4YBU A;  1ZHW A;  3D95 A;  1QJ9 A;  2GE4 A;  3O0E A;  4B61 A;  1CBQ A;  3V8U A;  4Z3T A;  4DQ4 A;  1S2P A;  3AKN A;  3APU A;  1SA8 A;  1QFV A;  3P6G A;  5D48 A;  2MM3 A;  3UPG A;  5K06 A;  4AYH A;  4EXZ A;  3SZV A;  3RBY A;  2WEX A;  4A1H A;  2Q2P A;  1IKE A;  2KW1 A;  5EZ2 A;  3I0A A;  4QGV A;  3VG7 A;  1HMT A;  3PH5 A;  3LK2 B;  4L1N A;  2G78 A;  1JV4 A;  1MX7 A;  1CJ5 A;  4ON1 A;  1KT7 A;  1ZND A;  4ZHH A;  1QY1 A;  3P24 A;  1QG5 A;  4AYD C;  2ANS A;  2LBA A;  4QYN A;  4QQ1 A;  1GFQ A;  3BX8 A;  4O4S A;  3SY7 A;  1FEL A;  1YIV A;  3FEL A;  2LHF A;  4O3Y A;  4Y0R A;  1DFV A;  1MVG A;  2GTL M;  2WQA E;  3F8A A;  4I95 A;  4WFU A;  3VZW X;  4YGH A;  3OBL A;  3S26 A;  3S60 A;  1IW2 A;  1NP4 A;  1XKI A;  2R73 A;  2X8S A;  4ORU A;  5LJH A;  2ERV A;  4FZL A;  2Q2M A;  1GFM A;  3APV A;  1IFC A;  4NYR A;  2HLV A;  4XME A;  5HZ6 A;  1B4M A;  4RUN A;  3TZS A;  1P4T A;  4FZM A;  2NND A;  2OVS A;  1I4U A;  4EEJ A;  4ALB A;  2GTF X;  4U8U O;  3LK4 2;  4ORX A;  4XMH A;  4GK9 A;  4KRA A;  2X8T A;  3EBW A;  4QGW A;  4BQU A;  1G85 A;  4FOZ A;  1E5P A;  4QGX A;  5C0N A;  3STN A;  2M06 A;  5ADX K;  5PRN A;  1EIO A;  2IFB A;  1GM6 A;  4I3D A;  5H8T A;  4D6A A;  1D3S A;  3KFH A;  1QY2 A;  1BRP A;  1ZNK A;  3S5V A;  3VG5 A;  4IMN A;  5HZ8 A;  3AA1 B;  4AKR B;  2JU8 A;  1LNM A;  2HMB A;  1EUO A;  1JJX A;  5B27 A;  4M7M A;  4MVK A;  1HMS A;  1DZP A;  2AKQ A;  2Y7S A;  4AFK A;  1CRB A;  4IB7 A;  1BLR A;  4XMD A;  1X71 A;  1E54 A;  4XNL A;  3STK A;  4QAE A;  1JJJ A;  1Q9G A;  2A2U A;  4O49 A;  4RLC A;  4LKT A;  5B29 A;  2ASN X;  2LBV A;  1QY0 A;  4AZL A;  4CSB A;  4ZGU A;  2GJ5 A;  4JGL A;  1X8U A;  3F6Z B;  4GKC A;  4U9C A;  3OE3 A;  1EI5 A;  3C76 X;  4AZQ A;  4ZJ0 A;  4AZR A;  4G76 A;  4OS3 A;  4U8U N;  2AMM X;  2ACP X;  5JR8 A;  2XTQ A;  3B2K A;  4OMX A;  1KGL A;  3FW4 A;  3NR3 A;  5F1E A;  1MPF A;  3SZD A;  2A2G A;  4QZT A;  4EDE A;  2ALL X;  2OVD A;  3ZQ3 A;  1SY3 A;  2LA7 A;  1KQW A;  4LZV A;  1BM5 A;  2F1V A;  1PBO A;  4XMG A;  1KT5 A;  3HWE A;  3T24 A;  2X46 A;  3MX7 A;  5FEN A;  3TGB A;  3WI5 A;  1QFT A;  4NNT A;  4ORY A;  2R74 A;  1TOW A;  2FGQ X;  3OD9 A;  4A8Z A;  4BVM A;  3NSG A;  4GRJ A;  1DZK A;  4ORR A;  1SXX A;  1VYG A;  2OVA A;  4INN A;  4RL9 A;  1CBI A;  2QO5 A;  3AAE A;  3WJC A;  2ZAI A;  1KT6 A;  4ZGF A;  1BRQ A;  5FVN A;  2CBS A;  3NQ3 A;  1DZM A;  1S7D A;  4AYM C;  3T20 A;  1U17 A;  4N7C A;  4TJZ A;  2JMB A;  4ODD A;  3CBC A;  4QYP A;  4LSI A;  5GV0 A;  2RCQ A;  1PEE A;  5BYP A;  2FGR A;  5H9K A;  1IFB A;  1YWD A;  3KZA A;  3UEV A;  2W2A A;  1QJ8 A;  2OVE A;  3D97 A;  2O4V A;  4GET A;  3HWB A;  3NX1 A;  5D47 A;  3F9D A;  4OS0 A;  4KCA A;  3C77 X;  2LKK A;  1IZN A;  1DZJ A;  3S5X A;  3JTY A;  2QO6 A;  4IB6 A;  1ZNG A;  3CWK A;  3AAA B;  1SY1 A;  2W81 C;  4IB8 A;  1Y9L A;  4IB9 A;  5EEE A;  4YDA A;  1BXW A;  2QM9 A;  2BS6 A;  2XTR A;  2A0A A;  2XKL A;  2G7B A;  4FMS A;  3FR2 A;  4HFO A;  4XMC A;  1FEN A;  4GCS A;  5AFU K;  2Q9S A;  5FAZ A;  3P02 A;  2NNE A;  3BU9 A;  3VG3 A;  1HQP A;  1YUP A;  2BLG A;  2WUT A;  1PRN A;  4KII A;  3RSW A;  1ML7 A;  3FYX A;  4O9S A;  1QJP A;  2QMI A;  1ACD A;  3HK1 A;  4EQA C;  1ADL A;  2A13 A;  1HN2 A;  4TKB A;  3FA7 A;  5EE2 A;  1HMR A;  4ZHD A;  3AA0 A;  3CQR A;  3GP6 A;  5D4A A;  4GNY A;  4KR4 A;  1SXY A;  3JSQ A;  4O4X A;  2J4U P;  3ZWE A;  1EXS A;  1FE3 A;  1LIB A;  1LKE A;  2Q39 A;  4KC8 A;  1OSM A;  4ORW A;  4OS8 A;  1G74 A;  3B2I A;  1BT9 A;  1ZNH A;  5HZ5 A;  3BX7 A;  4O4U A;  2CM4 A;  3VE1 A;  3IFB A;  4AW8 A;  2KZ7 B;  2ZAG A;  4LSH A;  2CBR A;  5T5F A;  3T0S A;  2JN3 A;  3NP1 A;  4WHI A;  1LIE A;  3BRN A;  5HA1 A;  3ZW1 A;  3WBG A;  5DG4 A;  4N58 A;  3UEW A;  4NP1 A;  4Y0Q A;  3NQK A;  3EYC A;  1JZU A;  4D5U A;  1I05 A;  2BT9 A;  2FS7 A;  2WR6 A;  4ALO A;  2YG2 A;  1YS5 A;  5H9L A;  1Z24 A;  4YH0 A;  3FA6 A;  1SMP I;  2N2M A;  5HCC C;  4TKJ A;  1JYD A;  3U03 A;  1H6S 1;  3HOL A;  2A3F X;  3C5O A;  1SXW A;  1ALB A;  5HZ9 A;  5FQ7 E;  4ID2 A;  4EFG A;  1OPA A;  1SY0 A;  1IIU A;  5H9A A;  2WEW A;  4HPA A;  4KT5 A;  1HBQ A;  2Q4N A;  1I04 A;  3DA3 A;  3PRN A;  5DL7 A;  5LJB A;  3ZUI A;  3KQ0 A;  1LIF A;  3TGC A;  4A1Y A;  4YCE A;  4K19 A;  2OZQ A;  2M4L A;  4ARH A;  5FQ6 E;  2LFU A;  1ZRY A;  5LKF A;  3P6F A;  2R56 A;  2HNX A;  1G5W A;  3AA7 A;  3QRC A;  4FT6 A;  5F7G A;  2PRN A;  1G7N A;  2G79 A;  2L68 A;  2ZFG A;  5HA0 A;  5IO5 A;  4YGG A;  4MVL A;  4YFQ A;  3KFG A;  3JQO A;  3VU1 A;  3JS1 A;  5LJC A;  4ZFX A;  2BHV A;  3B2J A;  3WJG A;  5HCD C;  5D8J A;  5KHP A;  3VZU X;  2XE2 A;  1X8O A;  2M07 A;  2AL0 X;  2FT9 A;  4LQZ A;  4D6B A;  3DSZ A;  3LK4 1;  3BY0 A;  2YPV A;  2N93 A;  4NW4 A;  2FLJ A;  3RKG A;  3ZUO A;  1KXO A;  4COT A;  4C69 X;  1ZHT A;  2NP1 A;  5LJG A;  3CQN A;  2N2L A;  2Y2X A;  3SYB A;  3MBT A;  3O2Y A;  1GT1 A;  3UU2 A;  4IMO A;  1A18 A;  2K0L A;  3PQS A;  4HPB A;  5DL6 A;  1B0O A;  2OFR X;  5HZQ A;  1HXX A;  3POX A;  4GZV A;  4GF4 A;  2RQ0 A;  2W2F A;  4Y0S A;  3FEP A;  2FWV A;  4LZU A;  5EDB A;  2ZLD A;  4IAW A;  2Z4H A;  1XCA A;  3K3L A;  3O22 A;  3PEC A;  2FS6 A;  1KOI A;  1ZNL A;  1ICM A;  3EMM A;  4FES A;  3K19 A;  2JOZ A;  3FEK A;  1GKA A;  1EQD A;  1A2D A;  1O8V A;  4GE1 A;  3G7G A;  1NP1 A;  2KD2 A;  3EBK A;  2MJI A;  3DTQ A;  3RWX A;  1ORM A;  4MIS A;  1TXL A;  2Y0L A;  3WJD A;  5HTE A;  5F6B A;  5HBS A;  2OMF A;  4XNK A;  4ZHF A;  4GNW A;  3NQ9 A;  1E00 A;  3POU A;  2RA6 A;  4FZN A;  5H9N A;  4GCQ A;  7PRN A;  1O1U A;  3TF6 A;  5L8O A;  1GT4 A;  3LK3 A;  3KVD D;  4RJX A;  1PMP A;  1MDC A;  4PJ2 A;  3RBH A;  2EU7 X;  3BLG A;  3HWD A;  4E1T A;  4KR8 A;  1L6M A;  4YMY A;  3PED A;  1GFN A;  1HBP A;  3WVM A;  2X45 A;  5AJC A;  1BSO A;  2QTK A;  1BWY A;  1KZW A;  4RUU A;  5IO7 A;  1S44 A;  2X8F A;  4YKO A;  3VG2 A;  2MHL A;  3ZW0 A;  3AAE B;  3NAD A;  3LK3 B;  4GHB A;  3OJY C;  2KDY A;  3C78 X;  2XE3 A;  1U0X A;  1CBR A;  4AYE C;  3SAO A;  1AEL A;  3N91 A;  4D65 A;  4O3X B;  3VY8 X;  2MHD A;  4R0B A;  2XST A;  3FYF A;  5FFH A;  5AEO A;  2L67 A;  1BSY A;  1TW4 A;  3U0D A;  4IBA A;  1I06 A;  1ICN A;  3ZI8 A;  5D45 A;  2AT8 X;  3BS2 A;  1ZHY A;  3H3I A;  3MVF A;  5LJK A;  5AJB A;  4FRX A;  3NBX X;  2F1T A;  1CBS A;  3BU1 A;  4WBK A;  3PQU A;  3CR6 A;  1IZN B;  1KZX A;  3FR5 A;  4LKP A;  2K23 A;  3FLL A;  4KC7 A;  4NLJ A;  2HYS A;  4O3Z A;  1X8Q A;  3U9P C;  2MNH A;  1LFO A;  4Y0P A;  3HWG A;  2AH7 X;  1GT3 A;  3PPT A;  4QZU A;  3GE2 A;  1THQ A;  2JMM A;  4ML7 B;  4YBP A;  2XG6 A;  2GTL N;  4L3R A;  2FR3 A;  4U8U M;  3UAQ A;  5EED A;  3FW5 A;  5IO6 A;  2Y0K A;  2J1N A;  4FBO A;  3VG6 A;  5DL8 A;  1YWB A;  3P6C A;  3FMZ A;  5LJD A;  3WXQ A;  2RD7 C;  4I6S A;  2ODJ A;  4G75 A;  3PH6 A;  1EPB A;  2CM9 A;  1E06 A;  5HCE C;  1HXT A;  1KT4 A;  3FA8 A;  3AKM A;  1YWC A;  4FBV A;  2POA A;  3WJE A;  3AA0 B;  4AZN A;  1NGL A;  3FA9 A;  4NLI A;  1BH3 A;  5ADX L;  2LB6 A;  1N0S A;  3KFI A;  2FRS A;  2X27 X;  4U3Q A;  3VY9 X;  4ZR2 A;  4LSF A;  4UU2 A;  3FIQ A;  4I3C A;  1VYF A;  2WSJ A;  3LV4 A;  3ZW2 A;  8PRN A;  5HTD A;  2KXP A;  2POR A;  4JFB A;  1O1V A;  3RZY A;  3ZW1 B;  3HW9 A;  5D5D A;  3VPJ E;  4QNI A;  2O62 A;  4D64 A;  1BSQ A;  2FTB A;  3BSZ E;  1EAL A;  1QAB E;  1A3Y A;  4HWM A;  4TKH A;  4MIR A;  1FDQ A;  1GGL A;  4TLJ A;  2KXP B;  2E4J A;  2QO4 A;  3L4R A;  1X8P A;  3B2H A;  4PSQ A;  1YP7 A;  2AT3 X;  4XMF A;  1ERB A;  3EMN X;  1EW3 A;  3LK2 A;  4JCH A;  1FTP A;  5HWZ A;  2JU3 A;  4ORS A;  2F09 A;  1BEB A;  1MUP A;  1HXU A;  1KQX A;  3HOE A;  3UEU A;  1AB0 A;  2K62 A;  1QQS A;  3ZZV A;  2KTS A;  4MVE A;  1PHO A;  4RLB A;  3D4R A;  1EPA A;  2WQ9 A;  1BJ7 A;  4BOE A;  1T0V A;  4FSO A;  3TGA A;  1SY2 A;  1MM5 A;  4GCP A;  1TVQ A;  5EPQ A;  5G26 A;  2GC9 A;  4HPD A;  4M6S A;  1GFO A;  4FSP A;  3AA7 B;  4YGZ A;  3APW A;  4AYI D;  3UEX A;  3KFF A;  4HPC A;  2Y0H A;  4AKM A;  3GAQ A;  4GU8 A;  3NPO A;  4O4O A;  5F58 A;  4CV7 A;  1DF3 A;  4YKM A;  4LSE A;  4OMW A;  3DA4 A;  1OEE A;  2L5P A;  3T1D A;  2W80 C;  4ZH9 A;  1AQB A;  3P6D A;  4TNN A;  4UU3 A;  1KT3 A;  2XMX A;  2MO5 A;  3SYS A;  4TQ2 A;  2HZQ A;  4GDZ A;  4IAX A;  2BS5 A;  4ES7 A;  1DC9 A;  1E02 A;  1ZNE A;  3A2S X;  1TOU A;  3AA1 A;  3POR A;  4N59 A;  5DL5 A;  4AKR A;  1GXA A;  2XE5 A;  2DM5 A;  1H91 A;  1YP6 A;  3D96 A;  1IKJ A;  4ZHC A;  3B2L A;  2JW1 A;  4FQB B;  1ZHZ A;  3BDR A;  1VPR A;  3Q6L A;  4ZCB A;  3VG4 A;  1RBP A;  4F4B A;  5DPQ A;  5LKE A;  3WI4 A;  1JIW I;  3O19 A;  4ZHG A;  2WWP A;  4A60 A;  2KC0 A;  1YWA A;  1T8V A;  5BVS A;  1FEM A;  1LID A;  1RLB E;  4FGI B;  1ZHX A;  4PUX A;  4I9R A;  1Y9T A;  5AFU L;  5IYU A;  1MX8 A;  5CE4 A;  4N7D A;  1QWD A;  2MWH A;  5HAE A;  1D2U A;  1OBP A;  3CMP A;  1BBP A;  2KTD A;  1OEK A;  4AYN A;  1B56 A;  4AZP A;  3QKG A;  1GKA B;  4DQ3 A;  1MM4 A;  2YNK A;  3IA8 A;  3AA6 A;  2P8G A;  1OPB A;  3STM X;  5L8N A;  3WOV A;  1B8E A;  1AVG I;  5CYB A;  2CZU A;  3ELX A;  2GTL O;  3HTY A;  4ZH6 A;  2RCT A;  4AUI A;  2KT4 B;  5BVQ A;  3VE2 A;  4YCH A;  5F6Z A;  1DV9 A;  2AT0 X;  3P6H A;  3AA6 B;  1LIC A;  2LFO A;  3G7X A;  1PM1 X;  4AZO A;  1GFP A;  2F73 A;  3NX2 A;  4BUM X;  4I9S A;  1JYJ A;  3QRA A;  1T68 X;  5L8I A;  5JDP A;  3ZW0 B;  4QRL A;  4O3W A;  4KH8 A;  4RJW A;  6PRN A;  2CZT A;  1R0U A;  1X89 A;  1OBU A;  3FEN A;  4NNS A;  3TZG A;  2XE1 A;  2L9C A;  5LJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...