4U9CA

Structure of the lbpb n-lobe from neisseria meningitidis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
286
Chain Sequence
PVNRPAVGAAMRLPRRNIASYKPDKHQAEEHLPLKEKDILFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKEKTSEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGSTDLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVNPNEPKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNSVFGVFAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lactoferrin-binding protein
molecule keywords Lactoferrin-binding protein B
publication title The structure of lactoferrin-binding protein B from Neisseria meningitidis suggests roles in iron acquisition and neutralization of host defences.
pubmed doi rcsb
source organism Neisseria meningitidis cu385
total genus 89
structure length 286
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u9cA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4u9cA02
3VE1A 2W81C 4AYNA 4O3XB 3PQUA 5EE2A 3V8UA 2KDYA 4AYDC 4O4XA 4U9CA 2Y7SA 2LFUA 4O3WA 4Z3TA 4AYMC 5T5FA 4AYEC 3HOLA 3PQSA 3KVDD 4QQ1A 2KC0A 3VE2A 4O3YA 4O49A 2W80C 3HOEA 3UAQA 4O3ZA 1YS5A 4O4UA 4AYID 2YPVA
chains in the Genus database with same CATH superfamily
5G26A 4A1YA 3VHMA 1AQBA 3G7XA 1B4MA 1SWNA 2KZ7B 1MX8A 3VGWA 2ODJA 2XTQA 1S44A 1GFNA 1SWKA 1JYDA 3VE1A 4PR7A 2FS6A 1VWRB 1ADLA 4Y0PA 3OJYC 1YP7A 4GE1A 1GT5A 2P8GA 1PHOA 3FA6A 2WPUA 4O4UA 2YPVA 4AYHA 1PTSA 3B2IA 2FGRA 3AA7B 1U0XA 2XG6A 5E79O 3O2YA 2K4TA 6PRNA 2IZKA 4PJ2A 1IIUA 1DZPA 4CPIA 5IO7A 1HXUA 3ZUOA 4D64A 4B61A 4NLIA 2OL7A 1ERXA 1SMPI 2QTKA 1IKEA 3NQKA 1P6PA 1FJ1E 3BRZA 3FLLA 1MX7A 5HZQA 2R4PA 2J1NA 1DC9A 1VWCB 5EEDA 4YGHA 3P6GA 4NW4A 1PEEA 1K3BA 1EALA 1JYJA 3WYPA 3T6LA 1ZNEA 4U46A 5DG4A 3EMNX 1YWCA 4YKMA 1N7YA 4IAWA 1KQXA 3NADA 3PGSA 3D9WA 3X00A 1SY3A 1MM9A 3I17A 5KICA 1Q9FA 4PUXA 3CKFA 2CBSA 1SWBA 2JOZA 5F6BA 2PORA 4AYNA 1NC9A 3VG6A 3SLJA 2GC9A 5K68A 2R74A 1HXLA 4A1HA 4Z3TA 3ZW0B 1FENA 1W4TA 2QOSC 4GCQA 1FDQA 2HKDA 4GD9A 3JTYA 1E2TA 2HZQA 4BX5A 3AKMA 1KT3A 3N91A 5CHKA 4IL6O 1JMXA 3BS0A 3BDRA 3BX8A 4JHQA 4QGWA 2ANSA 3MG5A 1QJPA 4C5PA 1QY1A 4KT5A 1LCWA 5K06A 2IWWA 1I05A 1VWJB 4FZNA 3PEDA 1VWMB 1SWAA 4FQBB 3WVMA 2G5LA 1IFCA 5B5GA 2Z4HA 1U17A 1Y9LA 4I3BA 1SXYA 4QZUA 4MVKA 4EQAC 3ZW1A 5C0NA 3C5OA 1HBQA 2BHVA 2JW1A 2IZDB 4YFQA 2KXPB 3QQ2A 4M7MA 1G90A 5DPQA 1VYFA 2FHNX 4U8UN 4Z6JA 2RTRB 1SWCA 1N43A 1QQSA 1GX9A 5IO5A 3KFHA 3QKGA 4MVLA 4ZGFA 4NYRA 1OBUA 2Y32A 2GJ5A 1SWUA 4FGIB 3FYFA 2OY7A 1DF3A 4ZJ0A 1LIDA 5H9LA 3AAAB 3ZI8A 3SZVA 1A3YA 1ZHWA 1DZMA 4ZHDA 3HK1A 2HMBA 4D6AA 4N7DA 4CDEA 4GJSA 3LK2B 1N4JA 2RTAA 2OVSA 2O4VA 1K24A 5DL8A 3WJGA 1CBRA 2A2GA 5F6ZA 3BU9A 2VFBA 2F1CX 2KC0A 1ML7A 1MDCA 3P6EA 3UEXA 1W5RA 4CPFA 3VZWX 4GUZA 3KFIA 3NP1A 4GDAA 1JMZA 3RDSA 4ZFXA 2O62A 2RTDB 5BVSA 4XNKA 5HAEA 4OS0A 3AA1A 1I4UA 1ACDA 4FZLA 3WU2O 4XNLA 5TISO 3WI4A 1OBQA 4L3RA 4LSEA 3FIDA 3CQRA 4MISA 1RLBE 4YH0A 4YBUA 1KT4A 1B56A 2XKLA 5B66O 2X4MA 2OL6O 4GNYA 3P02A 3NX1A 2IZAA 2XSTA 3GAQA 4OS3A 2BS5A 4KR8A 3NX2A 1VWFB 4LQZA 4Y59A 3ELXA 1SWTA 5HWZA 4ORRA 2QO4A 4C4VB 1QG5A 5L8NA 4BX6B 1GXAA 3QRAA 3ELZA 1PM1X 4AZOA 4QGXA 1MPFA 2AVIA 3F6ZB 4UB8O 1SWGA 2W81C 4MVIA 2OFBA 5IRUA 1JIWI 4KIIA 1HQQA 2XE2A 2NNDA 2BS6A 2A0AA 2RTNB 3POXA 2RTMA 2IZFB 5LJEA 5JR8A 2Y3EA 3SY7A 2LBAA 1I06A 5F7GA 1EW3A 2M07A 3NR3A 4YGZA 1R0UA 2RTQB 5IRWA 3B2HA 4YVBA 3UU2A 4ORYA 5FAZA 1BEBA 2W2FA 2RN4A 1HXTA 2Q4NA 1SWSA 3U03A 1ZHZA 4NNSA 1KOIA 4EEJA 5HZ9A 2IZLB 1QABE 1XCAA 5FENA 1SXWA 1EXSA 2WEXA 4L1NA 1SLDB 2MJIA 5EZ2A 1LDOA 5HTEA 2AT6X 2Y3FA 4CPEA 2OY1O 4WFUA 1RAVA 2X8TA 3PQSA 4GCPA 1FEMA 3MBTA 3AA6B 3K19A 4OKAA 4CPHB 3UEUA 1NDJA 1U18A 1UZ2X 4DNEA 2W2AA 4FRXA 1I78A 2ERVA 8PRNA 2MO5A 1QJ8A 4COTA 4BOEA 5EDCA 4BX7A 1JV4A 4I9SA 4AZQA 3ZZVA 3RDMA 3ZWEA 2A2UA 3Q6LA 4I95A 4ZHCA 3CBCA 4GZVA 4QRLA 1ZNLA 4YCEA 3DA3A 2F1VA 3FEPA 2AKQA 1THQA 4Z27A 2I5ZO 3H3IA 3BLGA 3VY9X 2AT0X 1LPJA 2R56A 4LKPA 2NNEA 4TKJA 4AZMA 2YG2A 2FS7A 2GTLN 4TLJA 1OEKA 4AKRA 1Z24A 3UPGA 3PK2A 1B0OA 1LELA 3RY2A 4AW8A 3BS2A 4FMSA 3LK3B 4LZVA 4DQ4A 3CMPA 1S7DA 3O0EA 1FTPA 3DSZA 3APVA 1VWBB 3OD9A 1PBYA 3PRNA 2L68A 1LUQA 2IZJA 4EDEA 2F1TA 2M06A 3T6FA 4N7CA 3FR5A 1SRFA 3C77X 1TOWA 1VWQB 4IB6A 1IZNB 3MX7A 4N58A 3EBKA 2N2MA 2RTKA 4FSPA 4ML7B 4AYID 4AYEC 2CZUA 4O3XB 3WJDA 2KD2A 4U9CA 4DCBA 3FYXA 5LJKA 1SWRA 1DF8A 2CBRA 2FRSA 4INNA 4KR4A 2OF8A 3WZNA 5FVNA 1OEJA 1EPAA 1BT9A 4QQ1A 4BQUA 2RTBB 4ID2A 1LICA 2RTPB 2OY8A 4G75A 3AA7A 1VPRA 1VWDB 4ZH6A 3DWNA 4KRAA 2Y0LA 1KZWA 4LSHA 2R4OA 1HXXA 5LJCA 4GGZA 5D8JA 3RDQA 2XMXA 2ZSCA 4U8UO 4FRTA 5DL6A 2JQYA 3AKNA 3APUA 1LDQA 1QWDA 1GKAB 4HFOA 5IXGA 1X8PA 1OSMA 2JGSA 1NQNA 2CM4A 2X32A 5B3MO 2N2LA 3HWGA 2FHLA 5K67A 3SYSA 1SXUA 1SLGB 4D65A 4I3CA 2MF6A 3A2SX 1X8UA 4ZCBA 3B2KA 3FA8A 2G7BA 2R73A 2IFBA 3SAOA 3VPJE 1OBPA 2IZGB 4BGFA 5B5FA 1E00A 2AXTO 1YS5A 2IZBA 5LJDA 2CM9A 4TKBA 5B27A 1KT7A 1UREA 3KZAA 3SY9A 5LJBA 3O19A 4UU2A 4OMWA 1G7NA 4FBVA 3PGUA 5DL7A 2AH7X 4RL9A 5BVTA 4GU8A 4ZHHA 3P6CA 3A0BO 1KL5A 2RTLA 3OE3A 2G79A 1SXXA 5EPQA 1KQWA 2HLVA 3U9PC 3VG7A 1BRPA 5IRAA 4Z2PA 2KTSA 2FGSA 1O8VA 4IMNA 4RJWA 5KIDA 1DFVA 3HOEA 2RD7C 4R0BA 4PJ0O 1E06A 1SREA 4N74A 2MWHA 4BX5B 1SWQA 1S5LO 1RSTB 1QY0A 4CDCA 2A5CA 2OF9A 5H9NA 3WJFA 3KFFA 4K3CA 1HBPA 2L5PA 5CYBA 1CRBA 2EU7X 5EE2A 2RTJA 2NP1A 5LJGA 3PH6A 2FWVA 5KAFO 4ON1A 1FELA 4XMGA 1HY2A 1SWEA 1EUOA 2AT8X 1MM4A 1WUBA 2WR6A 4TNNA 2W80C 3F9DA 2VDFA 3PP6A 3UEVA 5BVQA 1W6FA 4U3QA 3VG2A 3FIQA 4AFKA 4ODDA 1KXOA 3VG5A 2AT5X 1VWEB 1VWLB 2RTFB 2CAMA 3CQNA 2ZAGA 4YBPA 1E02A 2X34A 4ZH9A 5L3YA 2Q9SA 2LBVA 5CE4A 4FESA 3LK2A 5LKFA 4ORXA 3WZOA 4GF4A 3PDFA 2FR2A 1YUPA 2ZFGA 4ZGUA 3RDUA 1CBIA 3D4RA 3RKGA 2E4JA 5LKEA 5GTHO 1MM5A 1VWGB 1KZXA 2QM9A 3LV4A 1SLEB 1SRIA 2MM3A 2C4IA 4KC8A 1NGLA 5JD2A 4GRJA 2FTBA 1LIEA 3FW5A 1RSUB 1Y55X 2UZ2A 1UYNX 5T5FA 2FLJA 4RUNA 2KTDA 4BBOA 2RTEB 5FFHA 2Z4IA 4QGVA 1X71A 3UAQA 3D96A 1VWKB 2R4LA 5FQ7E 5L8OA 3IFBA 3WI5A 1D2UA 3B2JA 2FR3A 4O4XA 1SWLA 4U8UM 3RDXA 1STPA 4O4SA 3GE2A 1BXWA 2BT9A 4FQEA 4NYQA 1KT6A 1LNMA 4N59A 4CV7A 1VYGA 1O1VA 3RE6A 3HWBA 1LF7A 4ORWA 3VZUX 1Y52X 2MHLA 4GKCA 2GE4A 4G76A 5G39A 5HZ6A 4RUUA 5H9KA 4LKTA 3T20A 2LA7A 2UYWA 3AAEB 4BX6A 4AZRA 4RLCA 2Q39A 5D4AA 2C1QA 1LIFA 3WZQA 1HMRA 3GP6A 1GX3A 2MHDA 4D6BA 2ZAIA 3KVNA 3VHHA 4UB6O 1ZHYA 5D47A 4FOZA 2F09A 1ZRYA 4XMFA 1TOUA 3U0DA 4A60A 3CWKA 3UEWA 4I60A 1OSPO 1CJ5A 1DZJA 3BRYA 3VG3A 5G38A 3AA0B 4OELA 3LTWA 5AJCA 1EQDA 4ES7A 1JZUA 3NBXX 1P4TA 4B55A 1ZNHA 4UU3A 2A5BA 2RTHB 3QRCA 2MNHA 3CR6A 1LIBA 4CK4A 4FBRA 5B5EO 3EC5A 5AJBA 3SLTA 1QFTA 2LKKA 2QOMA 2GH7A 1GX8A 4GH7A 1GT4A 1BSQA 3B2LA 3C78X 4JO6A 1LFOA 3STMX 1HMTA 3NQ9A 2HNXA 4CPHA 3DA4A 3D95A 2OZQA 3C76X 4AYDC 3NJTA 1BRQA 3RWXA 2A3FX 4C69X 3FW4A 4CDDA 4PSQA 3BX7A 1B8EA 2RTGB 2OY5O 1SY2A 2ALLX 3D97A 3PORA 2IZIA 4M6SA 1SRHA 2OFRX 3AUMO 2HZRA 3VHIA 1ICNA 2WSJA 3FR4A 1ZHXA 1EPBA 5KHPA 3LK42 4O9SA 3APWA 2OVEA 3JSQA 4JFBA 3SLOA 2XE3A 2AF5A 3FEKA 2AMMX 5PRNA 5B2AO 1SY0A 4QYPA 1SY1A 4EKVA 4YDAA 3P6DA 5AQ6A 1RXHA 4IB7A 2CZTA 5H9AA 4BCSA 3HWFA 5AFUK 1MEPA 3BRNA 4MEEA 1JQPA 3JCUO 3APXA 4N75A 2X45A 4WBKA 5DL5A 2JN3A 4GDZA 3HPEA 3A0HO 3PH5A 3TF6A 4ORUA 2POAA 4Z28A 1QFVA 4NV8A 5AEOA 3HOLA 3MM0A 4ORSA 3S26A 4AKRB 1MK5A 3PPTA 3PQUA 4FT6A 1AB0A 2KZ7A 2PY1A 3DWOX 1N9YA 1IZNA 2OL8O 3RE5A 2K0LA 3SZHA 3EBWA 3VE2A 4D5UA 3EW2A 1RXKA 4CTDA 5EDBA 5B10O 2FT9A 1GM6A 3TGAA 1ERBA 2L67A 4HPAA 2VFCA 2WVPA 2Q2PA 3WYQA 4XMCA 4O3WA 5H8TA 4QNIA 3BSZE 1EIOA 3KZIO 1WBIA 4WHIA 4TKHA 2X55A 2A8GA 1OPFA 3IA8A 3FMZA 4RLBA 2JU8A 5HA0A 1BSYA 4RJXA 3V8UA 5AFUL 3WOVA 5IO6A 2GTLM 1HQPA 2X27X 1RXJA 2F73A 1IJ8A 3SZIA 1SA8A 3VZTX 4HPDA 4Y0RA 1GKAA 2FKGA 1G85A 2WUTA 1GGLA 1EIIA 4EXZA 1AVGI 2OVAA 1QJ9A 2Y0KA 3LK41 4LSFA 3NPOA 4Z2OA 1KL4A 1TXLA 1SWPA 3G7GA 1SWHA 1KGLA 2QMIA 4HPBA 3KVDD 4IABA 1SWFA 2KT4B 4IB9A 4HPCA 5BYPA 1YIVA 2Q2MA 3JQOA 2OVDA 2X9KA 1NP4A 3RZYA 1TW4A 1OPBA 3RDOA 3FENA 2WQAE 1AELA 1BM5A 3BY0A 1YWDA 3FA9A 4MVEA 1OPAA 2YNKA 1H91A 2XE1A 5KAIO 4IMOA 4KH8A 2OYBO 4OEMA 1BWYA 3JS1A 3HTYA 3FR2A 5HTDA 3ZW0A 1X8OA 1JJXA 4WFVA 4EFGA 1MUPA 3P6FA 1SWJA 2DJFA 4AZNA 4NV7A 1O1UA 1SLFB 3DZMA 2G8CO 3I0AA 4I3DA 1A18A 2RTOB 4Y0SA 3PECA 1ICMA 1PRNA 3TZSA 1T8VA 1YP6A 2WQ9A 4QYNA 1PBOA 1SRJA 2HYSA 4O3YA 2KW1A 5GV0A 3T1DA 3T2WA 5FQ6E 4ZHFA 1GT3A 1QY2A 2AT3X 4AKMA 3S60A 1VWIB 4OMXA 4IAXA 4GJVA 3K3LA 2QCBA 1VYOA 1E54A 2X46A 1A57A 1STRB 3F8AA 2ACOA 4IBAA 5F58A 1BJ7A 4K3BA 2FGQX 4ALOA 4ZHGA 2C1SA 5D45A 2KXPA 4GCSA 1T0VA 1MOYA 4AYMC 2RTCB 4GGRA 3O22A 2BLGA 4I6SA 2R4NA 2N93A 3ZW1B 1BLRA 2DJGA 2QO6A 3Q34A 3TGCA 1FE3A 2OFAA 5HBSA 4Y5DA 4GK9A 3VU1A 4XMEA 3FA7A 3AAAA 4YGGA 1X89A 2LFUA 1XKIA 2G78A 5HCDC 1X8NA 4AZLA 3E3CA 1TVQA 3MVFA 3STKA 1ZNDA 4GHBA 3RBYA 1KL3A 2W2BA 4TJZA 4QZTA 3T0SA 2LFOA 2K62A 4E1TA 2F01A 4ALBA 1HMSA 3CKGA 3OBLA 2JMBA 4CDFA 4YDBA 2ZLDA 1HXZA 1BH3A 1T1LA 4FBOA 3KFGA 3BU1A 1ORMA 1RBPA 1STSB 4C00A 2A13A 3EM0A 3PGRA 2WJQA 3S5VA 1GFMA 2WWPA 4NLJA 4XMHA 1CBSA 5F2BA 2KDYA 4FZMA 2I5VO 3WJCA 4IRWA 2K23A 5FQ8E 2RCTA 3L4RA 1Y0GA 1SRGA 4YCHA 4GGTA 1BBPA 4JCHA 2LHFA 4LZUA 3HWEA 5G3AA 3WZPA 5IYUA 3AA1B 4K19A 1LCVA 2RA6A 5HCEC 1NQMA 4LSIA 3AAEA 1EI5A 2PRNA 4C4VA 3KQ0A 5GTIO 1L6MA 3RY1A 3T2XA 2GTLO 2NNQA 1KT5A 2QO5A 4QAEA 3VY8X 4MIRA 2IZHB 2X56A 1CBQA 1KFFA 4ZR2A 5HA1A 4A8ZA 5F1EA 1LCZA 1N9MA 3AEHA 5HCCC 1JJJA 3WJBA 3WBGA 3SOTA 2OMFA 3AA0A 5ADXK 1GFPA 4O4OA 1Q9GA 1A2DA 3FELA 4F4BA 5CSEA 1BSOA 5D5DA 3ZQ3A 3SZJA 2RCQA 1GT1A 1JBHA 2Y7SA 3ZUIA 1NP1A 1IFBA 3TGBA 4JGLA 3EMMA 4Y0QA 1I04A 3P24A 1AVDA 4GETA 4AZPA 4GNWA 4CSBA 3POQA 2IZCB 2JMMA 1Y53X 2JU7A 5HZ8A 1G74A 1DV9A 1VWOB 3P6HA 4ARHA 3LHNA 4IB8A 2X8SA 1E5PA 4NP1A 1Y9TA 4BJ8A 2PI3O 3AA6A 5B29A 1IW2A 3HW9A 3CBSA 2AL0X 2M4LA 3WJEA 3RBHA 2JU3A 5L8IA 1OEEA 1SWDA 3WXQA 2R8AA 1GFOA 2IWVA 2J4UP 1YWAA 4FUVA 2RTIB 2RQ0A 4DQ3A 2XTRA 2L9CA 2XE5A 4YKOA 3NQ3A 2X8FA 3FDCA 1SWOA 1VWNB 4E1SA 5EEEA 2BC3A 5ADXL 1I9HA 1T16A 4I9RA 2DM5A 1ZNGA 1G5WA 5H2FO 2GTFX 2IZEB 4KCAA 3T24A 4BX7B 3HWDA 2BSZA 1JJUA 1HN2A 2ACPX 1DZKA 1YWBA 1GFQA 3RSWA 5HZ5A 1UYOX 2OFMX 1NBXA 3ZW2A 2ASNX 4O49A 3EW1A 5LJHA 2FKJA 4O3ZA 1LKEA 4OS8A 1VWAB 2YMSA 4YFPA 1PMPA 4HWMA 3LK3A 3VG4A 1VWHB 4Z2VA 2R88A 7PRNA 1S2PA 1IKJA 4BVMA 3SZDA 1VWPB 4FSOA 2Y0HA 1ALBA 2R89A 5JDPA 2WJRA 1ZHTA 3POUA 5B11O 1H6S1 3PF1A 4TQ2A 4XMDA 2Y2XA 3EYCA 4YFRA 1X8QA 1ZNKA 2LB6A 5D48A 1N0SA 4JNJA 3SYBA 3S5XA 3NSGA 1MVGA 4BUMX 2WEWA 4KC7A 3TZGA 4YMYA 4NNTA 3STNA 1AVEA 4AUIA 3DTQA 1D3SA 1T68X
chains in the Genus database with same CATH topology
5G26A 5FENA 1SXWA 1EXSA 2WEXA 3I0AA 4I3DA 4KC8A 2MJIA 4L1NA 5EZ2A 4A1YA 1A18A 1NGLA 4GRJA 2FTBA 1AQBA 5HTEA 3G7XA 4Y0SA 1LIEA 2AT6X 3PECA 1ICMA 1PRNA 3FW5A 1T8VA 3TZSA 1B4MA 2KZ7B 1YP6A 2WQ9A 4WFUA 1MX8A 4QYNA 1PBOA 2X8TA 5T5FA 2FLJA 3PQSA 2HYSA 4GCPA 4RUNA 2ODJA 1FEMA 4O3YA 2KTDA 2KW1A 2XTQA 5GV0A 3T1DA 3MBTA 1S44A 5FFHA 2Z4IA 5FQ6E 4QGVA 4ZHFA 1GFNA 1X71A 3UAQA 3AA6B 1GT3A 3D96A 1JYDA 3K19A 1QY2A 3VE1A 5FQ7E 5L8OA 2FS6A 2AT3X 3IFBA 3S60A 3UEUA 3WI5A 4AKMA 1U18A 4OMXA 1D2UA 4IAXA 1UZ2X 1ADLA 3B2JA 3K3LA 2FR3A 4O4XA 2W2AA 4Y0PA 4U8UM 4FRXA 3OJYC 3GE2A 4O4SA 1BXWA 2BT9A 1E54A 2X46A 1A57A 1YP7A 8PRNA 2ERVA 3F8AA 4GE1A 2ACOA 1KT6A 1LNMA 4NYQA 4IBAA 5F58A 4N59A 2MO5A 1GT5A 1VYGA 4CV7A 2P8GA 1PHOA 1O1VA 1QJ8A 4COTA 1LF7A 4ORWA 4BOEA 3HWBA 1BJ7A 3FA6A 3VZUX 4O4UA 5EDCA 2MHLA 2YPVA 2FGQX 1JV4A 4GKCA 4ALOA 4AYHA 2GE4A 4I9SA 4AZQA 4ZHGA 4G76A 3B2IA 2FGRA 3AA7B 5HZ6A 3ZZVA 1U0XA 4RUUA 3ZWEA 5D45A 2KXPA 2XG6A 5H9KA 2A2UA 4GCSA 3Q6LA 3O2YA 4I95A 4LKTA 3T20A 1T0VA 4ZHCA 2K4TA 3CBCA 6PRNA 4AYMC 2LA7A 3AAEB 4GZVA 4PJ2A 1IIUA 1DZPA 4AZRA 4QRLA 3O22A 2BLGA 5IO7A 1ZNLA 4YCEA 2Q39A 4RLCA 4I6SA 5D4AA 3DA3A 2F1VA 1HXUA 3FEPA 3ZUOA 1LIFA 1HMRA 3GP6A 2N93A 3ZW1B 4D64A 4B61A 4NLIA 1BLRA 2QO6A 3TGCA 2AKQA 1ERXA 1SMPI 1FE3A 2MHDA 5HBSA 2QTKA 1THQA 1IKEA 4GK9A 3VU1A 3NQKA 3H3IA 1P6PA 4D6BA 2ZAIA 3BLGA 1MX7A 3FLLA 5HZQA 4XMEA 3FA7A 2J1NA 1ZHYA 3VY9X 1DC9A 2AT0X 5EEDA 3AAAA 4YGHA 4YGGA 1LPJA 1X89A 3P6GA 4NW4A 1XKIA 2R56A 4LKPA 2G78A 2NNEA 5D47A 1PEEA 2LFUA 1EALA 4FOZA 4TKJA 5HCDC 1JYJA 2F09A 1ZRYA 1X8NA 4AZLA 3E3CA 1TVQA 3MVFA 4AZMA 1ZNEA 4XMFA 3STKA 1ZNDA 1TOUA 2YG2A 3U0DA 4A60A 4GHBA 2FS7A 2GTLN 3RBYA 4TLJA 3CWKA 3UEWA 1OEKA 4AKRA 1Z24A 5DG4A 3EMNX 1YWCA 1DZJA 4YKMA 1CJ5A 3UPGA 1B0OA 2W2BA 4TJZA 3VG3A 4QZTA 3T0SA 4IAWA 3AA0B 2LFOA 2K62A 4AW8A 5AJCA 1KQXA 3BS2A 3NADA 1EQDA 4E1TA 4ES7A 4FMSA 1JZUA 4ALBA 3NBXX 1HMSA 1P4TA 3LK3B 3OBLA 4LZVA 4DQ4A 1ZNHA 2JMBA 4UU3A 3CMPA 1S7DA 1SY3A 3O0EA 1FTPA 3I17A 3DSZA 3QRCA 3APVA 3OD9A 5KICA 1Q9FA 3PRNA 4PUXA 2MNHA 3CR6A 1LIBA 2CBSA 4YDBA 4CK4A 2L68A 4FBRA 2ZLDA 4EDEA 2F1TA 2JOZA 5AJBA 2M06A 5F6BA 1BH3A 2PORA 1QFTA 4AYNA 2LKKA 4N7CA 3FR5A 4FBOA 3KFGA 3BU1A 3C77X 1GX8A 3VG6A 1ORMA 4GH7A 1TOWA 1GT4A 2GC9A 1BSQA 3B2LA 3C78X 2R74A 1RBPA 4A1HA 4Z3TA 3ZW0B 2A13A 1FENA 3EM0A 4IB6A 1LFOA 1IZNB 2QOSC 4GCQA 3STMX 3MX7A 3S5VA 1FDQA 1GFMA 4N58A 3EBKA 1HMTA 2N2MA 3JTYA 2HZQA 3NQ9A 4FSPA 2WWPA 4ML7B 4NLJA 4XMHA 2HNXA 3DA4A 4AYID 4AYEC 1CBSA 3D95A 2CZUA 3AKMA 1KT3A 3N91A 2OZQA 4O3XB 2KDYA 4FZMA 3C76X 4AYDC 3WJDA 2KD2A 3BDRA 3BX8A 4U9CA 3FYXA 3WJCA 1BRQA 2CBRA 2FRSA 2K23A 2A3FX 4QGWA 3RWXA 2ANSA 5LJKA 4C69X 3FW4A 2RCTA 4INNA 5FQ8E 4KR4A 3L4RA 1QJPA 1QY1A 4PSQA 4YCHA 5FVNA 1OEJA 3BX7A 1EPAA 1B8EA 4KT5A 1BT9A 1SY2A 4QQ1A 1BBPA 4BQUA 2LHFA 2ALLX 4JCHA 3D97A 5K06A 4LZUA 3PORA 4ID2A 3HWEA 5IYUA 3AA1B 4M6SA 1I05A 1LICA 4K19A 4G75A 2RA6A 3AA7A 1VPRA 2OFRX 4FZNA 3PEDA 5HCEC 4ZH6A 4KRAA 4FQBB 3WVMA 2HZRA 2Y0LA 1KZWA 4LSIA 4LSHA 1IFCA 1ICNA 2WSJA 3FR4A 2Z4HA 1ZHXA 3AAEA 1U17A 1Y9LA 4I3BA 1HXXA 1SXYA 5LJCA 1EI5A 5D8JA 2PRNA 4QZUA 1EPBA 4MVKA 3KQ0A 4EQAC 2XMXA 5KHPA 3LK42 4O9SA 1L6MA 4U8UO 3APWA 3ZW1A 2OVEA 3JSQA 5C0NA 2GTLO 3C5OA 4JFBA 2NNQA 1KT5A 2QO5A 4QAEA 1HBQA 2BHVA 3VY8X 2XE3A 4FRTA 4MIRA 5DL6A 3FEKA 1CBQA 3AKNA 3APUA 1QWDA 4BUMX 1GKAB 4ZR2A 2AMMX 2JW1A 5PRNA 4YFQA 1SY0A 5HA1A 4QYPA 1SY1A 4HFOA 2KXPB 1X8PA 1OSMA 4A8ZA 2CM4A 4YDAA 3P6DA 4M7MA 5AQ6A 4IB7A 1G90A 2CZTA 5DPQA 5F1EA 5H9AA 1VYFA 2N2LA 3HWFA 5AFUK 3BRNA 4U8UN 5HCCC 1JJJA 3HWGA 3WJBA 3WBGA 3SOTA 1QQSA 1GX9A 3APXA 5IO5A 2OMFA 3SYSA 3AA0A 1SXUA 3KFHA 2X45A 4WBKA 1GFPA 5DL5A 5ADXK 3QKGA 4MVLA 4ZGFA 4NYRA 4O4OA 1OBUA 2JN3A 2GJ5A 4FGIB 4GDZA 4D65A 3FYFA 4I3CA 1Q9GA 1A2DA 3FELA 4F4BA 1DF3A 1BSOA 3A2SX 4ZJ0A 5D5DA 1LIDA 3PH5A 3TF6A 3ZQ3A 2RCQA 1X8UA 4ORUA 4ZCBA 3B2KA 5H9LA 1GT1A 2POAA 1JBHA 3ZUIA 2Y7SA 1NP1A 3ZI8A 1QFVA 1IFBA 3AAAB 3FA8A 5AEOA 2G7BA 2R73A 3TGBA 4JGLA 2IFBA 3EMMA 3SAOA 3HOLA 3SZVA 3VPJE 4ORSA 4Y0QA 3S26A 1A3YA 1OBPA 1I04A 1ZHWA 4AKRB 1E00A 3P24A 1YS5A 1DZMA 4TKBA 5LJDA 2CM9A 4ZHDA 4GETA 4AZPA 3HK1A 4GNWA 1KT7A 1UREA 3PPTA 5B27A 2HMBA 4CSBA 3POQA 3KZAA 2JMMA 4D6AA 3SY9A 2JU7A 3PQUA 5HZ8A 1G74A 5LJBA 4N7DA 4FT6A 1AB0A 3O19A 4UU2A 1DV9A 4OMWA 1G7NA 2KZ7A 2PY1A 3LK2B 4FBVA 2OVSA 2O4VA 1IZNA 3P6HA 4ARHA 5DL8A 3LHNA 3WJGA 5DL7A 4IB8A 1CBRA 2A2GA 2AH7X 2X8SA 5BVTA 5F6ZA 3BU9A 2K0LA 1E5PA 4NP1A 1Y9TA 4RL9A 3EBWA 2KC0A 4GU8A 3VE2A 4ZHHA 4D5UA 1ML7A 3P6CA 1MDCA 3P6EA 3UEXA 3AA6A 5B29A 5EDBA 1IW2A 3VZWX 2FT9A 1GM6A 3HW9A 3OE3A 3TGAA 3CBSA 2G79A 1ERBA 1SXXA 2L67A 4HPAA 2AL0X 2M4LA 2Q2PA 5EPQA 3KFIA 1KQWA 2HLVA 3NP1A 4XMCA 3U9PC 3VG7A 3WJEA 4O3WA 3RBHA 4ZFXA 2JU3A 5H8TA 2O62A 5L8IA 1OEEA 1BRPA 4QNIA 5BVSA 3BSZE 4XNKA 1EIOA 2KTSA 3WXQA 5HAEA 1GFOA 4OS0A 3AA1A 4WHIA 1I4UA 1O8VA 2J4UP 1ACDA 4IMNA 4TKHA 4RJWA 1YWAA 4FUVA 4FZLA 5KIDA 1OPFA 2RQ0A 1DFVA 3HOEA 4DQ3A 2XTRA 2L9CA 3IA8A 4XNLA 3WI4A 1OBQA 2RD7C 3FMZA 4R0BA 2XE5A 4RLBA 1E06A 2JU8A 4L3RA 4YKOA 5HA0A 1BSYA 3NQ3A 2MWHA 4LSEA 4RJXA 2X8FA 3CQRA 4MISA 1RLBE 4YH0A 3V8UA 5AFUL 4YBUA 3WOVA 5IO6A 1KT4A 1B56A 1QY0A 2XKLA 2GTLM 4E1SA 5EEEA 1HQPA 2X27X 5ADXL 2F73A 5H9NA 4GNYA 1SA8A 3WJFA 3P02A 4I9RA 4HPDA 2DM5A 3NX1A 3VZTX 1ZNGA 2XSTA 1G5WA 2GTFX 3KFFA 3GAQA 4OS3A 2BS5A 4KCAA 4KR8A 4Y0RA 1HBPA 1GKAA 1G85A 2L5PA 5CYBA 2WUTA 1CRBA 3NX2A 1GGLA 1EIIA 4EXZA 3T24A 1AVGI 4LQZA 2OVAA 1QJ9A 2Y0KA 3LK41 2EU7X 5EE2A 3HWDA 2NP1A 4LSFA 5LJGA 3NPOA 3PH6A 3ELXA 1HN2A 2ACPX 2FWVA 1TXLA 1DZKA 4ON1A 3G7GA 1YWBA 1GFQA 1KGLA 5HWZA 1FELA 4XMGA 3RSWA 4ORRA 5HZ5A 2QO4A 2QMIA 4HPBA 2OFMX 1QG5A 1EUOA 3ZW2A 5L8NA 3KVDD 2ASNX 2AT8X 1GXAA 3QRAA 4O49A 1MM4A 4IABA 2WR6A 3ELZA 1PM1X 4TNNA 4AZOA 2W80C 5LJHA 3F9DA 3PP6A 4O3ZA 4QGXA 1LKEA 4OS8A 3UEVA 1MPFA 5BVQA 3F6ZB 2W81C 2KT4B 2YMSA 4YFPA 4MVIA 1PMPA 4IB9A 4HWMA 4HPCA 4U3QA 5BYPA 1YIVA 1JIWI 2Q2MA 3JQOA 3VG2A 3LK3A 3FIQA 2OVDA 4KIIA 3VG4A 4AFKA 2XE2A 4ODDA 1KXOA 3VG5A 2NNDA 2BS6A 7PRNA 1NP4A 3RZYA 2A0AA 1S2PA 1IKJA 2AT5X 1TW4A 4BVMA 1OPBA 3SZDA 3POXA 3FENA 2WQAE 2ZAGA 3CQNA 3BY0A 1AELA 4YBPA 1BM5A 4FSOA 1YWDA 1ALBA 5LJEA 2Y0HA 5JDPA 1E02A 3FA9A 4MVEA 5JR8A 1OPAA 1ZHTA 3POUA 3SY7A 1H6S1 2LBAA 4TQ2A 2YNKA 4ZH9A 1H91A 4XMDA 2XE1A 4IMOA 2Y2XA 4KH8A 2Q9SA 3EYCA 2LBVA 5CE4A 4YFRA 1X8QA 4FESA 1I06A 1ZNKA 2LB6A 1EW3A 5D48A 5F7GA 1BWYA 2M07A 3LK2A 5LKFA 3JS1A 3HTYA 3NR3A 4YGZA 1N0SA 4ORXA 1R0UA 3FR2A 5HTDA 3SYBA 4GF4A 3ZW0A 3B2HA 2FR2A 1X8OA 1YUPA 4ORYA 3S5XA 1JJXA 2ZFGA 3UU2A 4ZGUA 4WFVA 3NSGA 1MVGA 5FAZA 4EFGA 1CBIA 1MUPA 1BEBA 2E4JA 2WEWA 3D4RA 4KC7A 3RKGA 2W2FA 5LKEA 3TZGA 3P6FA 4YMYA 2RN4A 1HXTA 2Q4NA 4NNTA 1MM5A 3U03A 3STNA 4AZNA 4NNSA 1KZXA 1KOIA 2QM9A 1ZHZA 4EEJA 5HZ9A 3LV4A 4AUIA 3DTQA 1O1UA 1D3SA 1QABE 1T68X 1XCAA 2MM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VE1 A;  2W81 C;  4AYN A;  4O3X B;  3PQU A;  5EE2 A;  3V8U A;  2KDY A;  4AYD C;  4O4X A;  4U9C A;  2Y7S A;  2LFU A;  4O3W A;  4Z3T A;  4AYM C;  5T5F A;  4AYE C;  3HOL A;  3PQS A;  3KVD D;  4QQ1 A;  2KC0 A;  3VE2 A;  4O3Y A;  4O49 A;  2W80 C;  3HOE A;  3UAQ A;  4O3Z A;  1YS5 A;  4O4U A;  4AYI D;  2YPV A; 
#chains in the Genus database with same CATH topology
 5G26 A;  4A1Y A;  3VHM A;  1AQB A;  3G7X A;  1B4M A;  1SWN A;  2KZ7 B;  1MX8 A;  3VGW A;  2ODJ A;  2XTQ A;  1S44 A;  1GFN A;  1SWK A;  1JYD A;  3VE1 A;  4PR7 A;  2FS6 A;  1VWR B;  1ADL A;  4Y0P A;  3OJY C;  1YP7 A;  4GE1 A;  1GT5 A;  2P8G A;  1PHO A;  3FA6 A;  2WPU A;  4O4U A;  2YPV A;  4AYH A;  1PTS A;  3B2I A;  2FGR A;  3AA7 B;  1U0X A;  2XG6 A;  5E79 O;  3O2Y A;  2K4T A;  6PRN A;  2IZK A;  4PJ2 A;  1IIU A;  1DZP A;  4CPI A;  5IO7 A;  1HXU A;  3ZUO A;  4D64 A;  4B61 A;  4NLI A;  2OL7 A;  1ERX A;  1SMP I;  2QTK A;  1IKE A;  3NQK A;  1P6P A;  1FJ1 E;  3BRZ A;  3FLL A;  1MX7 A;  5HZQ A;  2R4P A;  2J1N A;  1DC9 A;  1VWC B;  5EED A;  4YGH A;  3P6G A;  4NW4 A;  1PEE A;  1K3B A;  1EAL A;  1JYJ A;  3WYP A;  3T6L A;  1ZNE A;  4U46 A;  5DG4 A;  3EMN X;  1YWC A;  4YKM A;  1N7Y A;  4IAW A;  1KQX A;  3NAD A;  3PGS A;  3D9W A;  3X00 A;  1SY3 A;  1MM9 A;  3I17 A;  5KIC A;  1Q9F A;  4PUX A;  3CKF A;  2CBS A;  1SWB A;  2JOZ A;  5F6B A;  2POR A;  4AYN A;  1NC9 A;  3VG6 A;  3SLJ A;  2GC9 A;  5K68 A;  2R74 A;  1HXL A;  4A1H A;  4Z3T A;  3ZW0 B;  1FEN A;  1W4T A;  2QOS C;  4GCQ A;  1FDQ A;  2HKD A;  4GD9 A;  3JTY A;  1E2T A;  2HZQ A;  4BX5 A;  3AKM A;  1KT3 A;  3N91 A;  5CHK A;  4IL6 O;  1JMX A;  3BS0 A;  3BDR A;  3BX8 A;  4JHQ A;  4QGW A;  2ANS A;  3MG5 A;  1QJP A;  4C5P A;  1QY1 A;  4KT5 A;  1LCW A;  5K06 A;  2IWW A;  1I05 A;  1VWJ B;  4FZN A;  3PED A;  1VWM B;  1SWA A;  4FQB B;  3WVM A;  2G5L A;  1IFC A;  5B5G A;  2Z4H A;  1U17 A;  1Y9L A;  4I3B A;  1SXY A;  4QZU A;  4MVK A;  4EQA C;  3ZW1 A;  5C0N A;  3C5O A;  1HBQ A;  2BHV A;  2JW1 A;  2IZD B;  4YFQ A;  2KXP B;  3QQ2 A;  4M7M A;  1G90 A;  5DPQ A;  1VYF A;  2FHN X;  4U8U N;  4Z6J A;  2RTR B;  1SWC A;  1N43 A;  1QQS A;  1GX9 A;  5IO5 A;  3KFH A;  3QKG A;  4MVL A;  4ZGF A;  4NYR A;  1OBU A;  2Y32 A;  2GJ5 A;  1SWU A;  4FGI B;  3FYF A;  2OY7 A;  1DF3 A;  4ZJ0 A;  1LID A;  5H9L A;  3AAA B;  3ZI8 A;  3SZV A;  1A3Y A;  1ZHW A;  1DZM A;  4ZHD A;  3HK1 A;  2HMB A;  4D6A A;  4N7D A;  4CDE A;  4GJS A;  3LK2 B;  1N4J A;  2RTA A;  2OVS A;  2O4V A;  1K24 A;  5DL8 A;  3WJG A;  1CBR A;  2A2G A;  5F6Z A;  3BU9 A;  2VFB A;  2F1C X;  2KC0 A;  1ML7 A;  1MDC A;  3P6E A;  3UEX A;  1W5R A;  4CPF A;  3VZW X;  4GUZ A;  3KFI A;  3NP1 A;  4GDA A;  1JMZ A;  3RDS A;  4ZFX A;  2O62 A;  2RTD B;  5BVS A;  4XNK A;  5HAE A;  4OS0 A;  3AA1 A;  1I4U A;  1ACD A;  4FZL A;  3WU2 O;  4XNL A;  5TIS O;  3WI4 A;  1OBQ A;  4L3R A;  4LSE A;  3FID A;  3CQR A;  4MIS A;  1RLB E;  4YH0 A;  4YBU A;  1KT4 A;  1B56 A;  2XKL A;  5B66 O;  2X4M A;  2OL6 O;  4GNY A;  3P02 A;  3NX1 A;  2IZA A;  2XST A;  3GAQ A;  4OS3 A;  2BS5 A;  4KR8 A;  3NX2 A;  1VWF B;  4LQZ A;  4Y59 A;  3ELX A;  1SWT A;  5HWZ A;  4ORR A;  2QO4 A;  4C4V B;  1QG5 A;  5L8N A;  4BX6 B;  1GXA A;  3QRA A;  3ELZ A;  1PM1 X;  4AZO A;  4QGX A;  1MPF A;  2AVI A;  3F6Z B;  4UB8 O;  1SWG A;  2W81 C;  4MVI A;  2OFB A;  5IRU A;  1JIW I;  4KII A;  1HQQ A;  2XE2 A;  2NND A;  2BS6 A;  2A0A A;  2RTN B;  3POX A;  2RTM A;  2IZF B;  5LJE A;  5JR8 A;  2Y3E A;  3SY7 A;  2LBA A;  1I06 A;  5F7G A;  1EW3 A;  2M07 A;  3NR3 A;  4YGZ A;  1R0U A;  2RTQ B;  5IRW A;  3B2H A;  4YVB A;  3UU2 A;  4ORY A;  5FAZ A;  1BEB A;  2W2F A;  2RN4 A;  1HXT A;  2Q4N A;  1SWS A;  3U03 A;  1ZHZ A;  4NNS A;  1KOI A;  4EEJ A;  5HZ9 A;  2IZL B;  1QAB E;  1XCA A;  5FEN A;  1SXW A;  1EXS A;  2WEX A;  4L1N A;  1SLD B;  2MJI A;  5EZ2 A;  1LDO A;  5HTE A;  2AT6 X;  2Y3F A;  4CPE A;  2OY1 O;  4WFU A;  1RAV A;  2X8T A;  3PQS A;  4GCP A;  1FEM A;  3MBT A;  3AA6 B;  3K19 A;  4OKA A;  4CPH B;  3UEU A;  1NDJ A;  1U18 A;  1UZ2 X;  4DNE A;  2W2A A;  4FRX A;  1I78 A;  2ERV A;  8PRN A;  2MO5 A;  1QJ8 A;  4COT A;  4BOE A;  5EDC A;  4BX7 A;  1JV4 A;  4I9S A;  4AZQ A;  3ZZV A;  3RDM A;  3ZWE A;  2A2U A;  3Q6L A;  4I95 A;  4ZHC A;  3CBC A;  4GZV A;  4QRL A;  1ZNL A;  4YCE A;  3DA3 A;  2F1V A;  3FEP A;  2AKQ A;  1THQ A;  4Z27 A;  2I5Z O;  3H3I A;  3BLG A;  3VY9 X;  2AT0 X;  1LPJ A;  2R56 A;  4LKP A;  2NNE A;  4TKJ A;  4AZM A;  2YG2 A;  2FS7 A;  2GTL N;  4TLJ A;  1OEK A;  4AKR A;  1Z24 A;  3UPG A;  3PK2 A;  1B0O A;  1LEL A;  3RY2 A;  4AW8 A;  3BS2 A;  4FMS A;  3LK3 B;  4LZV A;  4DQ4 A;  3CMP A;  1S7D A;  3O0E A;  1FTP A;  3DSZ A;  3APV A;  1VWB B;  3OD9 A;  1PBY A;  3PRN A;  2L68 A;  1LUQ A;  2IZJ A;  4EDE A;  2F1T A;  2M06 A;  3T6F A;  4N7C A;  3FR5 A;  1SRF A;  3C77 X;  1TOW A;  1VWQ B;  4IB6 A;  1IZN B;  3MX7 A;  4N58 A;  3EBK A;  2N2M A;  2RTK A;  4FSP A;  4ML7 B;  4AYI D;  4AYE C;  2CZU A;  4O3X B;  3WJD A;  2KD2 A;  4U9C A;  4DCB A;  3FYX A;  5LJK A;  1SWR A;  1DF8 A;  2CBR A;  2FRS A;  4INN A;  4KR4 A;  2OF8 A;  3WZN A;  5FVN A;  1OEJ A;  1EPA A;  1BT9 A;  4QQ1 A;  4BQU A;  2RTB B;  4ID2 A;  1LIC A;  2RTP B;  2OY8 A;  4G75 A;  3AA7 A;  1VPR A;  1VWD B;  4ZH6 A;  3DWN A;  4KRA A;  2Y0L A;  1KZW A;  4LSH A;  2R4O A;  1HXX A;  5LJC A;  4GGZ A;  5D8J A;  3RDQ A;  2XMX A;  2ZSC A;  4U8U O;  4FRT A;  5DL6 A;  2JQY A;  3AKN A;  3APU A;  1LDQ A;  1QWD A;  1GKA B;  4HFO A;  5IXG A;  1X8P A;  1OSM A;  2JGS A;  1NQN A;  2CM4 A;  2X32 A;  5B3M O;  2N2L A;  3HWG A;  2FHL A;  5K67 A;  3SYS A;  1SXU A;  1SLG B;  4D65 A;  4I3C A;  2MF6 A;  3A2S X;  1X8U A;  4ZCB A;  3B2K A;  3FA8 A;  2G7B A;  2R73 A;  2IFB A;  3SAO A;  3VPJ E;  1OBP A;  2IZG B;  4BGF A;  5B5F A;  1E00 A;  2AXT O;  1YS5 A;  2IZB A;  5LJD A;  2CM9 A;  4TKB A;  5B27 A;  1KT7 A;  1URE A;  3KZA A;  3SY9 A;  5LJB A;  3O19 A;  4UU2 A;  4OMW A;  1G7N A;  4FBV A;  3PGU A;  5DL7 A;  2AH7 X;  4RL9 A;  5BVT A;  4GU8 A;  4ZHH A;  3P6C A;  3A0B O;  1KL5 A;  2RTL A;  3OE3 A;  2G79 A;  1SXX A;  5EPQ A;  1KQW A;  2HLV A;  3U9P C;  3VG7 A;  1BRP A;  5IRA A;  4Z2P A;  2KTS A;  2FGS A;  1O8V A;  4IMN A;  4RJW A;  5KID A;  1DFV A;  3HOE A;  2RD7 C;  4R0B A;  4PJ0 O;  1E06 A;  1SRE A;  4N74 A;  2MWH A;  4BX5 B;  1SWQ A;  1S5L O;  1RST B;  1QY0 A;  4CDC A;  2A5C A;  2OF9 A;  5H9N A;  3WJF A;  3KFF A;  4K3C A;  1HBP A;  2L5P A;  5CYB A;  1CRB A;  2EU7 X;  5EE2 A;  2RTJ A;  2NP1 A;  5LJG A;  3PH6 A;  2FWV A;  5KAF O;  4ON1 A;  1FEL A;  4XMG A;  1HY2 A;  1SWE A;  1EUO A;  2AT8 X;  1MM4 A;  1WUB A;  2WR6 A;  4TNN A;  2W80 C;  3F9D A;  2VDF A;  3PP6 A;  3UEV A;  5BVQ A;  1W6F A;  4U3Q A;  3VG2 A;  3FIQ A;  4AFK A;  4ODD A;  1KXO A;  3VG5 A;  2AT5 X;  1VWE B;  1VWL B;  2RTF B;  2CAM A;  3CQN A;  2ZAG A;  4YBP A;  1E02 A;  2X34 A;  4ZH9 A;  5L3Y A;  2Q9S A;  2LBV A;  5CE4 A;  4FES A;  3LK2 A;  5LKF A;  4ORX A;  3WZO A;  4GF4 A;  3PDF A;  2FR2 A;  1YUP A;  2ZFG A;  4ZGU A;  3RDU A;  1CBI A;  3D4R A;  3RKG A;  2E4J A;  5LKE A;  5GTH O;  1MM5 A;  1VWG B;  1KZX A;  2QM9 A;  3LV4 A;  1SLE B;  1SRI A;  2MM3 A;  2C4I A;  4KC8 A;  1NGL A;  5JD2 A;  4GRJ A;  2FTB A;  1LIE A;  3FW5 A;  1RSU B;  1Y55 X;  2UZ2 A;  1UYN X;  5T5F A;  2FLJ A;  4RUN A;  2KTD A;  4BBO A;  2RTE B;  5FFH A;  2Z4I A;  4QGV A;  1X71 A;  3UAQ A;  3D96 A;  1VWK B;  2R4L A;  5FQ7 E;  5L8O A;  3IFB A;  3WI5 A;  1D2U A;  3B2J A;  2FR3 A;  4O4X A;  1SWL A;  4U8U M;  3RDX A;  1STP A;  4O4S A;  3GE2 A;  1BXW A;  2BT9 A;  4FQE A;  4NYQ A;  1KT6 A;  1LNM A;  4N59 A;  4CV7 A;  1VYG A;  1O1V A;  3RE6 A;  3HWB A;  1LF7 A;  4ORW A;  3VZU X;  1Y52 X;  2MHL A;  4GKC A;  2GE4 A;  4G76 A;  5G39 A;  5HZ6 A;  4RUU A;  5H9K A;  4LKT A;  3T20 A;  2LA7 A;  2UYW A;  3AAE B;  4BX6 A;  4AZR A;  4RLC A;  2Q39 A;  5D4A A;  2C1Q A;  1LIF A;  3WZQ A;  1HMR A;  3GP6 A;  1GX3 A;  2MHD A;  4D6B A;  2ZAI A;  3KVN A;  3VHH A;  4UB6 O;  1ZHY A;  5D47 A;  4FOZ A;  2F09 A;  1ZRY A;  4XMF A;  1TOU A;  3U0D A;  4A60 A;  3CWK A;  3UEW A;  4I60 A;  1OSP O;  1CJ5 A;  1DZJ A;  3BRY A;  3VG3 A;  5G38 A;  3AA0 B;  4OEL A;  3LTW A;  5AJC A;  1EQD A;  4ES7 A;  1JZU A;  3NBX X;  1P4T A;  4B55 A;  1ZNH A;  4UU3 A;  2A5B A;  2RTH B;  3QRC A;  2MNH A;  3CR6 A;  1LIB A;  4CK4 A;  4FBR A;  5B5E O;  3EC5 A;  5AJB A;  3SLT A;  1QFT A;  2LKK A;  2QOM A;  2GH7 A;  1GX8 A;  4GH7 A;  1GT4 A;  1BSQ A;  3B2L A;  3C78 X;  4JO6 A;  1LFO A;  3STM X;  1HMT A;  3NQ9 A;  2HNX A;  4CPH A;  3DA4 A;  3D95 A;  2OZQ A;  3C76 X;  4AYD C;  3NJT A;  1BRQ A;  3RWX A;  2A3F X;  4C69 X;  3FW4 A;  4CDD A;  4PSQ A;  3BX7 A;  1B8E A;  2RTG B;  2OY5 O;  1SY2 A;  2ALL X;  3D97 A;  3POR A;  2IZI A;  4M6S A;  1SRH A;  2OFR X;  3AUM O;  2HZR A;  3VHI A;  1ICN A;  2WSJ A;  3FR4 A;  1ZHX A;  1EPB A;  5KHP A;  3LK4 2;  4O9S A;  3APW A;  2OVE A;  3JSQ A;  4JFB A;  3SLO A;  2XE3 A;  2AF5 A;  3FEK A;  2AMM X;  5PRN A;  5B2A O;  1SY0 A;  4QYP A;  1SY1 A;  4EKV A;  4YDA A;  3P6D A;  5AQ6 A;  1RXH A;  4IB7 A;  2CZT A;  5H9A A;  4BCS A;  3HWF A;  5AFU K;  1MEP A;  3BRN A;  4MEE A;  1JQP A;  3JCU O;  3APX A;  4N75 A;  2X45 A;  4WBK A;  5DL5 A;  2JN3 A;  4GDZ A;  3HPE A;  3A0H O;  3PH5 A;  3TF6 A;  4ORU A;  2POA A;  4Z28 A;  1QFV A;  4NV8 A;  5AEO A;  3HOL A;  3MM0 A;  4ORS A;  3S26 A;  4AKR B;  1MK5 A;  3PPT A;  3PQU A;  4FT6 A;  1AB0 A;  2KZ7 A;  2PY1 A;  3DWO X;  1N9Y A;  1IZN A;  2OL8 O;  3RE5 A;  2K0L A;  3SZH A;  3EBW A;  3VE2 A;  4D5U A;  3EW2 A;  1RXK A;  4CTD A;  5EDB A;  5B10 O;  2FT9 A;  1GM6 A;  3TGA A;  1ERB A;  2L67 A;  4HPA A;  2VFC A;  2WVP A;  2Q2P A;  3WYQ A;  4XMC A;  4O3W A;  5H8T A;  4QNI A;  3BSZ E;  1EIO A;  3KZI O;  1WBI A;  4WHI A;  4TKH A;  2X55 A;  2A8G A;  1OPF A;  3IA8 A;  3FMZ A;  4RLB A;  2JU8 A;  5HA0 A;  1BSY A;  4RJX A;  3V8U A;  5AFU L;  3WOV A;  5IO6 A;  2GTL M;  1HQP A;  2X27 X;  1RXJ A;  2F73 A;  1IJ8 A;  3SZI A;  1SA8 A;  3VZT X;  4HPD A;  4Y0R A;  1GKA A;  2FKG A;  1G85 A;  2WUT A;  1GGL A;  1EII A;  4EXZ A;  1AVG I;  2OVA A;  1QJ9 A;  2Y0K A;  3LK4 1;  4LSF A;  3NPO A;  4Z2O A;  1KL4 A;  1TXL A;  1SWP A;  3G7G A;  1SWH A;  1KGL A;  2QMI A;  4HPB A;  3KVD D;  4IAB A;  1SWF A;  2KT4 B;  4IB9 A;  4HPC A;  5BYP A;  1YIV A;  2Q2M A;  3JQO A;  2OVD A;  2X9K A;  1NP4 A;  3RZY A;  1TW4 A;  1OPB A;  3RDO A;  3FEN A;  2WQA E;  1AEL A;  1BM5 A;  3BY0 A;  1YWD A;  3FA9 A;  4MVE A;  1OPA A;  2YNK A;  1H91 A;  2XE1 A;  5KAI O;  4IMO A;  4KH8 A;  2OYB O;  4OEM A;  1BWY A;  3JS1 A;  3HTY A;  3FR2 A;  5HTD A;  3ZW0 A;  1X8O A;  1JJX A;  4WFV A;  4EFG A;  1MUP A;  3P6F A;  1SWJ A;  2DJF A;  4AZN A;  4NV7 A;  1O1U A;  1SLF B;  3DZM A;  2G8C O;  3I0A A;  4I3D A;  1A18 A;  2RTO B;  4Y0S A;  3PEC A;  1ICM A;  1PRN A;  3TZS A;  1T8V A;  1YP6 A;  2WQ9 A;  4QYN A;  1PBO A;  1SRJ A;  2HYS A;  4O3Y A;  2KW1 A;  5GV0 A;  3T1D A;  3T2W A;  5FQ6 E;  4ZHF A;  1GT3 A;  1QY2 A;  2AT3 X;  4AKM A;  3S60 A;  1VWI B;  4OMX A;  4IAX A;  4GJV A;  3K3L A;  2QCB A;  1VYO A;  1E54 A;  2X46 A;  1A57 A;  1STR B;  3F8A A;  2ACO A;  4IBA A;  5F58 A;  1BJ7 A;  4K3B A;  2FGQ X;  4ALO A;  4ZHG A;  2C1S A;  5D45 A;  2KXP A;  4GCS A;  1T0V A;  1MOY A;  4AYM C;  2RTC B;  4GGR A;  3O22 A;  2BLG A;  4I6S A;  2R4N A;  2N93 A;  3ZW1 B;  1BLR A;  2DJG A;  2QO6 A;  3Q34 A;  3TGC A;  1FE3 A;  2OFA A;  5HBS A;  4Y5D A;  4GK9 A;  3VU1 A;  4XME A;  3FA7 A;  3AAA A;  4YGG A;  1X89 A;  2LFU A;  1XKI A;  2G78 A;  5HCD C;  1X8N A;  4AZL A;  3E3C A;  1TVQ A;  3MVF A;  3STK A;  1ZND A;  4GHB A;  3RBY A;  1KL3 A;  2W2B A;  4TJZ A;  4QZT A;  3T0S A;  2LFO A;  2K62 A;  4E1T A;  2F01 A;  4ALB A;  1HMS A;  3CKG A;  3OBL A;  2JMB A;  4CDF A;  4YDB A;  2ZLD A;  1HXZ A;  1BH3 A;  1T1L A;  4FBO A;  3KFG A;  3BU1 A;  1ORM A;  1RBP A;  1STS B;  4C00 A;  2A13 A;  3EM0 A;  3PGR A;  2WJQ A;  3S5V A;  1GFM A;  2WWP A;  4NLJ A;  4XMH A;  1CBS A;  5F2B A;  2KDY A;  4FZM A;  2I5V O;  3WJC A;  4IRW A;  2K23 A;  5FQ8 E;  2RCT A;  3L4R A;  1Y0G A;  1SRG A;  4YCH A;  4GGT A;  1BBP A;  4JCH A;  2LHF A;  4LZU A;  3HWE A;  5G3A A;  3WZP A;  5IYU A;  3AA1 B;  4K19 A;  1LCV A;  2RA6 A;  5HCE C;  1NQM A;  4LSI A;  3AAE A;  1EI5 A;  2PRN A;  4C4V A;  3KQ0 A;  5GTI O;  1L6M A;  3RY1 A;  3T2X A;  2GTL O;  2NNQ A;  1KT5 A;  2QO5 A;  4QAE A;  3VY8 X;  4MIR A;  2IZH B;  2X56 A;  1CBQ A;  1KFF A;  4ZR2 A;  5HA1 A;  4A8Z A;  5F1E A;  1LCZ A;  1N9M A;  3AEH A;  5HCC C;  1JJJ A;  3WJB A;  3WBG A;  3SOT A;  2OMF A;  3AA0 A;  5ADX K;  1GFP A;  4O4O A;  1Q9G A;  1A2D A;  3FEL A;  4F4B A;  5CSE A;  1BSO A;  5D5D A;  3ZQ3 A;  3SZJ A;  2RCQ A;  1GT1 A;  1JBH A;  2Y7S A;  3ZUI A;  1NP1 A;  1IFB A;  3TGB A;  4JGL A;  3EMM A;  4Y0Q A;  1I04 A;  3P24 A;  1AVD A;  4GET A;  4AZP A;  4GNW A;  4CSB A;  3POQ A;  2IZC B;  2JMM A;  1Y53 X;  2JU7 A;  5HZ8 A;  1G74 A;  1DV9 A;  1VWO B;  3P6H A;  4ARH A;  3LHN A;  4IB8 A;  2X8S A;  1E5P A;  4NP1 A;  1Y9T A;  4BJ8 A;  2PI3 O;  3AA6 A;  5B29 A;  1IW2 A;  3HW9 A;  3CBS A;  2AL0 X;  2M4L A;  3WJE A;  3RBH A;  2JU3 A;  5L8I A;  1OEE A;  1SWD A;  3WXQ A;  2R8A A;  1GFO A;  2IWV A;  2J4U P;  1YWA A;  4FUV A;  2RTI B;  2RQ0 A;  4DQ3 A;  2XTR A;  2L9C A;  2XE5 A;  4YKO A;  3NQ3 A;  2X8F A;  3FDC A;  1SWO A;  1VWN B;  4E1S A;  5EEE A;  2BC3 A;  5ADX L;  1I9H A;  1T16 A;  4I9R A;  2DM5 A;  1ZNG A;  1G5W A;  5H2F O;  2GTF X;  2IZE B;  4KCA A;  3T24 A;  4BX7 B;  3HWD A;  2BSZ A;  1JJU A;  1HN2 A;  2ACP X;  1DZK A;  1YWB A;  1GFQ A;  3RSW A;  5HZ5 A;  1UYO X;  2OFM X;  1NBX A;  3ZW2 A;  2ASN X;  4O49 A;  3EW1 A;  5LJH A;  2FKJ A;  4O3Z A;  1LKE A;  4OS8 A;  1VWA B;  2YMS A;  4YFP A;  1PMP A;  4HWM A;  3LK3 A;  3VG4 A;  1VWH B;  4Z2V A;  2R88 A;  7PRN A;  1S2P A;  1IKJ A;  4BVM A;  3SZD A;  1VWP B;  4FSO A;  2Y0H A;  1ALB A;  2R89 A;  5JDP A;  2WJR A;  1ZHT A;  3POU A;  5B11 O;  1H6S 1;  3PF1 A;  4TQ2 A;  4XMD A;  2Y2X A;  3EYC A;  4YFR A;  1X8Q A;  1ZNK A;  2LB6 A;  5D48 A;  1N0S A;  4JNJ A;  3SYB A;  3S5X A;  3NSG A;  1MVG A;  4BUM X;  2WEW A;  4KC7 A;  3TZG A;  4YMY A;  4NNT A;  3STN A;  1AVE A;  4AUI A;  3DTQ A;  1D3S A;  1T68 X; 
#chains in the Genus database with same CATH homology
 5G26 A;  5FEN A;  1SXW A;  1EXS A;  2WEX A;  3I0A A;  4I3D A;  4KC8 A;  2MJI A;  4L1N A;  5EZ2 A;  4A1Y A;  1A18 A;  1NGL A;  4GRJ A;  2FTB A;  1AQB A;  5HTE A;  3G7X A;  4Y0S A;  1LIE A;  2AT6 X;  3PEC A;  1ICM A;  1PRN A;  3FW5 A;  1T8V A;  3TZS A;  1B4M A;  2KZ7 B;  1YP6 A;  2WQ9 A;  4WFU A;  1MX8 A;  4QYN A;  1PBO A;  2X8T A;  5T5F A;  2FLJ A;  3PQS A;  2HYS A;  4GCP A;  4RUN A;  2ODJ A;  1FEM A;  4O3Y A;  2KTD A;  2KW1 A;  2XTQ A;  5GV0 A;  3T1D A;  3MBT A;  1S44 A;  5FFH A;  2Z4I A;  5FQ6 E;  4QGV A;  4ZHF A;  1GFN A;  1X71 A;  3UAQ A;  3AA6 B;  1GT3 A;  3D96 A;  1JYD A;  3K19 A;  1QY2 A;  3VE1 A;  5FQ7 E;  5L8O A;  2FS6 A;  2AT3 X;  3IFB A;  3S60 A;  3UEU A;  3WI5 A;  4AKM A;  1U18 A;  4OMX A;  1D2U A;  4IAX A;  1UZ2 X;  1ADL A;  3B2J A;  3K3L A;  2FR3 A;  4O4X A;  2W2A A;  4Y0P A;  4U8U M;  4FRX A;  3OJY C;  3GE2 A;  4O4S A;  1BXW A;  2BT9 A;  1E54 A;  2X46 A;  1A57 A;  1YP7 A;  8PRN A;  2ERV A;  3F8A A;  4GE1 A;  2ACO A;  1KT6 A;  1LNM A;  4NYQ A;  4IBA A;  5F58 A;  4N59 A;  2MO5 A;  1GT5 A;  1VYG A;  4CV7 A;  2P8G A;  1PHO A;  1O1V A;  1QJ8 A;  4COT A;  1LF7 A;  4ORW A;  4BOE A;  3HWB A;  1BJ7 A;  3FA6 A;  3VZU X;  4O4U A;  5EDC A;  2MHL A;  2YPV A;  2FGQ X;  1JV4 A;  4GKC A;  4ALO A;  4AYH A;  2GE4 A;  4I9S A;  4AZQ A;  4ZHG A;  4G76 A;  3B2I A;  2FGR A;  3AA7 B;  5HZ6 A;  3ZZV A;  1U0X A;  4RUU A;  3ZWE A;  5D45 A;  2KXP A;  2XG6 A;  5H9K A;  2A2U A;  4GCS A;  3Q6L A;  3O2Y A;  4I95 A;  4LKT A;  3T20 A;  1T0V A;  4ZHC A;  2K4T A;  3CBC A;  6PRN A;  4AYM C;  2LA7 A;  3AAE B;  4GZV A;  4PJ2 A;  1IIU A;  1DZP A;  4AZR A;  4QRL A;  3O22 A;  2BLG A;  5IO7 A;  1ZNL A;  4YCE A;  2Q39 A;  4RLC A;  4I6S A;  5D4A A;  3DA3 A;  2F1V A;  1HXU A;  3FEP A;  3ZUO A;  1LIF A;  1HMR A;  3GP6 A;  2N93 A;  3ZW1 B;  4D64 A;  4B61 A;  4NLI A;  1BLR A;  2QO6 A;  3TGC A;  2AKQ A;  1ERX A;  1SMP I;  1FE3 A;  2MHD A;  5HBS A;  2QTK A;  1THQ A;  1IKE A;  4GK9 A;  3VU1 A;  3NQK A;  3H3I A;  1P6P A;  4D6B A;  2ZAI A;  3BLG A;  1MX7 A;  3FLL A;  5HZQ A;  4XME A;  3FA7 A;  2J1N A;  1ZHY A;  3VY9 X;  1DC9 A;  2AT0 X;  5EED A;  3AAA A;  4YGH A;  4YGG A;  1LPJ A;  1X89 A;  3P6G A;  4NW4 A;  1XKI A;  2R56 A;  4LKP A;  2G78 A;  2NNE A;  5D47 A;  1PEE A;  2LFU A;  1EAL A;  4FOZ A;  4TKJ A;  5HCD C;  1JYJ A;  2F09 A;  1ZRY A;  1X8N A;  4AZL A;  3E3C A;  1TVQ A;  3MVF A;  4AZM A;  1ZNE A;  4XMF A;  3STK A;  1ZND A;  1TOU A;  2YG2 A;  3U0D A;  4A60 A;  4GHB A;  2FS7 A;  2GTL N;  3RBY A;  4TLJ A;  3CWK A;  3UEW A;  1OEK A;  4AKR A;  1Z24 A;  5DG4 A;  3EMN X;  1YWC A;  1DZJ A;  4YKM A;  1CJ5 A;  3UPG A;  1B0O A;  2W2B A;  4TJZ A;  3VG3 A;  4QZT A;  3T0S A;  4IAW A;  3AA0 B;  2LFO A;  2K62 A;  4AW8 A;  5AJC A;  1KQX A;  3BS2 A;  3NAD A;  1EQD A;  4E1T A;  4ES7 A;  4FMS A;  1JZU A;  4ALB A;  3NBX X;  1HMS A;  1P4T A;  3LK3 B;  3OBL A;  4LZV A;  4DQ4 A;  1ZNH A;  2JMB A;  4UU3 A;  3CMP A;  1S7D A;  1SY3 A;  3O0E A;  1FTP A;  3I17 A;  3DSZ A;  3QRC A;  3APV A;  3OD9 A;  5KIC A;  1Q9F A;  3PRN A;  4PUX A;  2MNH A;  3CR6 A;  1LIB A;  2CBS A;  4YDB A;  4CK4 A;  2L68 A;  4FBR A;  2ZLD A;  4EDE A;  2F1T A;  2JOZ A;  5AJB A;  2M06 A;  5F6B A;  1BH3 A;  2POR A;  1QFT A;  4AYN A;  2LKK A;  4N7C A;  3FR5 A;  4FBO A;  3KFG A;  3BU1 A;  3C77 X;  1GX8 A;  3VG6 A;  1ORM A;  4GH7 A;  1TOW A;  1GT4 A;  2GC9 A;  1BSQ A;  3B2L A;  3C78 X;  2R74 A;  1RBP A;  4A1H A;  4Z3T A;  3ZW0 B;  2A13 A;  1FEN A;  3EM0 A;  4IB6 A;  1LFO A;  1IZN B;  2QOS C;  4GCQ A;  3STM X;  3MX7 A;  3S5V A;  1FDQ A;  1GFM A;  4N58 A;  3EBK A;  1HMT A;  2N2M A;  3JTY A;  2HZQ A;  3NQ9 A;  4FSP A;  2WWP A;  4ML7 B;  4NLJ A;  4XMH A;  2HNX A;  3DA4 A;  4AYI D;  4AYE C;  1CBS A;  3D95 A;  2CZU A;  3AKM A;  1KT3 A;  3N91 A;  2OZQ A;  4O3X B;  2KDY A;  4FZM A;  3C76 X;  4AYD C;  3WJD A;  2KD2 A;  3BDR A;  3BX8 A;  4U9C A;  3FYX A;  3WJC A;  1BRQ A;  2CBR A;  2FRS A;  2K23 A;  2A3F X;  4QGW A;  3RWX A;  2ANS A;  5LJK A;  4C69 X;  3FW4 A;  2RCT A;  4INN A;  5FQ8 E;  4KR4 A;  3L4R A;  1QJP A;  1QY1 A;  4PSQ A;  4YCH A;  5FVN A;  1OEJ A;  3BX7 A;  1EPA A;  1B8E A;  4KT5 A;  1BT9 A;  1SY2 A;  4QQ1 A;  1BBP A;  4BQU A;  2LHF A;  2ALL X;  4JCH A;  3D97 A;  5K06 A;  4LZU A;  3POR A;  4ID2 A;  3HWE A;  5IYU A;  3AA1 B;  4M6S A;  1I05 A;  1LIC A;  4K19 A;  4G75 A;  2RA6 A;  3AA7 A;  1VPR A;  2OFR X;  4FZN A;  3PED A;  5HCE C;  4ZH6 A;  4KRA A;  4FQB B;  3WVM A;  2HZR A;  2Y0L A;  1KZW A;  4LSI A;  4LSH A;  1IFC A;  1ICN A;  2WSJ A;  3FR4 A;  2Z4H A;  1ZHX A;  3AAE A;  1U17 A;  1Y9L A;  4I3B A;  1HXX A;  1SXY A;  5LJC A;  1EI5 A;  5D8J A;  2PRN A;  4QZU A;  1EPB A;  4MVK A;  3KQ0 A;  4EQA C;  2XMX A;  5KHP A;  3LK4 2;  4O9S A;  1L6M A;  4U8U O;  3APW A;  3ZW1 A;  2OVE A;  3JSQ A;  5C0N A;  2GTL O;  3C5O A;  4JFB A;  2NNQ A;  1KT5 A;  2QO5 A;  4QAE A;  1HBQ A;  2BHV A;  3VY8 X;  2XE3 A;  4FRT A;  4MIR A;  5DL6 A;  3FEK A;  1CBQ A;  3AKN A;  3APU A;  1QWD A;  4BUM X;  1GKA B;  4ZR2 A;  2AMM X;  2JW1 A;  5PRN A;  4YFQ A;  1SY0 A;  5HA1 A;  4QYP A;  1SY1 A;  4HFO A;  2KXP B;  1X8P A;  1OSM A;  4A8Z A;  2CM4 A;  4YDA A;  3P6D A;  4M7M A;  5AQ6 A;  4IB7 A;  1G90 A;  2CZT A;  5DPQ A;  5F1E A;  5H9A A;  1VYF A;  2N2L A;  3HWF A;  5AFU K;  3BRN A;  4U8U N;  5HCC C;  1JJJ A;  3HWG A;  3WJB A;  3WBG A;  3SOT A;  1QQS A;  1GX9 A;  3APX A;  5IO5 A;  2OMF A;  3SYS A;  3AA0 A;  1SXU A;  3KFH A;  2X45 A;  4WBK A;  1GFP A;  5DL5 A;  5ADX K;  3QKG A;  4MVL A;  4ZGF A;  4NYR A;  4O4O A;  1OBU A;  2JN3 A;  2GJ5 A;  4FGI B;  4GDZ A;  4D65 A;  3FYF A;  4I3C A;  1Q9G A;  1A2D A;  3FEL A;  4F4B A;  1DF3 A;  1BSO A;  3A2S X;  4ZJ0 A;  5D5D A;  1LID A;  3PH5 A;  3TF6 A;  3ZQ3 A;  2RCQ A;  1X8U A;  4ORU A;  4ZCB A;  3B2K A;  5H9L A;  1GT1 A;  2POA A;  1JBH A;  3ZUI A;  2Y7S A;  1NP1 A;  3ZI8 A;  1QFV A;  1IFB A;  3AAA B;  3FA8 A;  5AEO A;  2G7B A;  2R73 A;  3TGB A;  4JGL A;  2IFB A;  3EMM A;  3SAO A;  3HOL A;  3SZV A;  3VPJ E;  4ORS A;  4Y0Q A;  3S26 A;  1A3Y A;  1OBP A;  1I04 A;  1ZHW A;  4AKR B;  1E00 A;  3P24 A;  1YS5 A;  1DZM A;  4TKB A;  5LJD A;  2CM9 A;  4ZHD A;  4GET A;  4AZP A;  3HK1 A;  4GNW A;  1KT7 A;  1URE A;  3PPT A;  5B27 A;  2HMB A;  4CSB A;  3POQ A;  3KZA A;  2JMM A;  4D6A A;  3SY9 A;  2JU7 A;  3PQU A;  5HZ8 A;  1G74 A;  5LJB A;  4N7D A;  4FT6 A;  1AB0 A;  3O19 A;  4UU2 A;  1DV9 A;  4OMW A;  1G7N A;  2KZ7 A;  2PY1 A;  3LK2 B;  4FBV A;  2OVS A;  2O4V A;  1IZN A;  3P6H A;  4ARH A;  5DL8 A;  3LHN A;  3WJG A;  5DL7 A;  4IB8 A;  1CBR A;  2A2G A;  2AH7 X;  2X8S A;  5BVT A;  5F6Z A;  3BU9 A;  2K0L A;  1E5P A;  4NP1 A;  1Y9T A;  4RL9 A;  3EBW A;  2KC0 A;  4GU8 A;  3VE2 A;  4ZHH A;  4D5U A;  1ML7 A;  3P6C A;  1MDC A;  3P6E A;  3UEX A;  3AA6 A;  5B29 A;  5EDB A;  1IW2 A;  3VZW X;  2FT9 A;  1GM6 A;  3HW9 A;  3OE3 A;  3TGA A;  3CBS A;  2G79 A;  1ERB A;  1SXX A;  2L67 A;  4HPA A;  2AL0 X;  2M4L A;  2Q2P A;  5EPQ A;  3KFI A;  1KQW A;  2HLV A;  3NP1 A;  4XMC A;  3U9P C;  3VG7 A;  3WJE A;  4O3W A;  3RBH A;  4ZFX A;  2JU3 A;  5H8T A;  2O62 A;  5L8I A;  1OEE A;  1BRP A;  4QNI A;  5BVS A;  3BSZ E;  4XNK A;  1EIO A;  2KTS A;  3WXQ A;  5HAE A;  1GFO A;  4OS0 A;  3AA1 A;  4WHI A;  1I4U A;  1O8V A;  2J4U P;  1ACD A;  4IMN A;  4TKH A;  4RJW A;  1YWA A;  4FUV A;  4FZL A;  5KID A;  1OPF A;  2RQ0 A;  1DFV A;  3HOE A;  4DQ3 A;  2XTR A;  2L9C A;  3IA8 A;  4XNL A;  3WI4 A;  1OBQ A;  2RD7 C;  3FMZ A;  4R0B A;  2XE5 A;  4RLB A;  1E06 A;  2JU8 A;  4L3R A;  4YKO A;  5HA0 A;  1BSY A;  3NQ3 A;  2MWH A;  4LSE A;  4RJX A;  2X8F A;  3CQR A;  4MIS A;  1RLB E;  4YH0 A;  3V8U A;  5AFU L;  4YBU A;  3WOV A;  5IO6 A;  1KT4 A;  1B56 A;  1QY0 A;  2XKL A;  2GTL M;  4E1S A;  5EEE A;  1HQP A;  2X27 X;  5ADX L;  2F73 A;  5H9N A;  4GNY A;  1SA8 A;  3WJF A;  3P02 A;  4I9R A;  4HPD A;  2DM5 A;  3NX1 A;  3VZT X;  1ZNG A;  2XST A;  1G5W A;  2GTF X;  3KFF A;  3GAQ A;  4OS3 A;  2BS5 A;  4KCA A;  4KR8 A;  4Y0R A;  1HBP A;  1GKA A;  1G85 A;  2L5P A;  5CYB A;  2WUT A;  1CRB A;  3NX2 A;  1GGL A;  1EII A;  4EXZ A;  3T24 A;  1AVG I;  4LQZ A;  2OVA A;  1QJ9 A;  2Y0K A;  3LK4 1;  2EU7 X;  5EE2 A;  3HWD A;  2NP1 A;  4LSF A;  5LJG A;  3NPO A;  3PH6 A;  3ELX A;  1HN2 A;  2ACP X;  2FWV A;  1TXL A;  1DZK A;  4ON1 A;  3G7G A;  1YWB A;  1GFQ A;  1KGL A;  5HWZ A;  1FEL A;  4XMG A;  3RSW A;  4ORR A;  5HZ5 A;  2QO4 A;  2QMI A;  4HPB A;  2OFM X;  1QG5 A;  1EUO A;  3ZW2 A;  5L8N A;  3KVD D;  2ASN X;  2AT8 X;  1GXA A;  3QRA A;  4O49 A;  1MM4 A;  4IAB A;  2WR6 A;  3ELZ A;  1PM1 X;  4TNN A;  4AZO A;  2W80 C;  5LJH A;  3F9D A;  3PP6 A;  4O3Z A;  4QGX A;  1LKE A;  4OS8 A;  3UEV A;  1MPF A;  5BVQ A;  3F6Z B;  2W81 C;  2KT4 B;  2YMS A;  4YFP A;  4MVI A;  1PMP A;  4IB9 A;  4HWM A;  4HPC A;  4U3Q A;  5BYP A;  1YIV A;  1JIW I;  2Q2M A;  3JQO A;  3VG2 A;  3LK3 A;  3FIQ A;  2OVD A;  4KII A;  3VG4 A;  4AFK A;  2XE2 A;  4ODD A;  1KXO A;  3VG5 A;  2NND A;  2BS6 A;  7PRN A;  1NP4 A;  3RZY A;  2A0A A;  1S2P A;  1IKJ A;  2AT5 X;  1TW4 A;  4BVM A;  1OPB A;  3SZD A;  3POX A;  3FEN A;  2WQA E;  2ZAG A;  3CQN A;  3BY0 A;  1AEL A;  4YBP A;  1BM5 A;  4FSO A;  1YWD A;  1ALB A;  5LJE A;  2Y0H A;  5JDP A;  1E02 A;  3FA9 A;  4MVE A;  5JR8 A;  1OPA A;  1ZHT A;  3POU A;  3SY7 A;  1H6S 1;  2LBA A;  4TQ2 A;  2YNK A;  4ZH9 A;  1H91 A;  4XMD A;  2XE1 A;  4IMO A;  2Y2X A;  4KH8 A;  2Q9S A;  3EYC A;  2LBV A;  5CE4 A;  4YFR A;  1X8Q A;  4FES A;  1I06 A;  1ZNK A;  2LB6 A;  1EW3 A;  5D48 A;  5F7G A;  1BWY A;  2M07 A;  3LK2 A;  5LKF A;  3JS1 A;  3HTY A;  3NR3 A;  4YGZ A;  1N0S A;  4ORX A;  1R0U A;  3FR2 A;  5HTD A;  3SYB A;  4GF4 A;  3ZW0 A;  3B2H A;  2FR2 A;  1X8O A;  1YUP A;  4ORY A;  3S5X A;  1JJX A;  2ZFG A;  3UU2 A;  4ZGU A;  4WFV A;  3NSG A;  1MVG A;  5FAZ A;  4EFG A;  1CBI A;  1MUP A;  1BEB A;  2E4J A;  2WEW A;  3D4R A;  4KC7 A;  3RKG A;  2W2F A;  5LKE A;  3TZG A;  3P6F A;  4YMY A;  2RN4 A;  1HXT A;  2Q4N A;  4NNT A;  1MM5 A;  3U03 A;  3STN A;  4AZN A;  4NNS A;  1KZX A;  1KOI A;  2QM9 A;  1ZHZ A;  4EEJ A;  5HZ9 A;  3LV4 A;  4AUI A;  3DTQ A;  1O1U A;  1D3S A;  1QAB E;  1T68 X;  1XCA A;  2MM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...