4U9CA

Structure of the lbpb n-lobe from neisseria meningitidis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
286
Chain Sequence
PVNRPAVGAAMRLPRRNIASYKPDKHQAEEHLPLKEKDILFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKEKTSEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGSTDLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVNPNEPKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNSVFGVFAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lactoferrin-binding protein B
publication title The structure of lactoferrin-binding protein B from Neisseria meningitidis suggests roles in iron acquisition and neutralization of host defences.
pubmed doi rcsb
source organism Neisseria meningitidis cu385
molecule tags Lactoferrin-binding protein
total genus 89
structure length 286
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u9cA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4u9cA02
4O3YA 1YS5A 2YPVA 2KC0A 3VE1A 4O4UA 2Y7SA 4O49A 2KDYA 4Z3TA 2W80C 2LFUA 3HOEA 3KVDD 4O3WA 3PQSA 4AYMC 4O4XA 4AYEC 3UAQA 3VE2A 4AYID 4U9CA 5T5FA 4O3ZA 4AYDC 4O3XB 3PQUA 4QQ1A 2W81C 4AYNA 3V8UA 5EE2A 3HOLA
chains in the Genus database with same CATH superfamily
2OY1O 3CQNA 3PEDA 4CDEA 2G7BA 4N75A 3ZUOA 1S7DA 1HXXA 4YKMA 4AFKA 4QYNA 1SRGA 3KFIA 1N7YA 3SZIA 4A1YA 2GTFX 2A0AA 1ORMA 3HTYA 1VWDB 1MM5A 1OEKA 1CBIA 5G3AA 1OSPO 3SY7A 4B61A 3C76X 2LKKA 4EXZA 1I04A 1SWTA 3DSZA 3K3LA 2GTLM 2RTJA 3LK3B 1GT5A 1G5WA 2XE1A 3STKA 5AFUL 1E06A 2ZSCA 4UU3A 1JYDA 3I17A 4QGWA 4ZHCA 2N2MA 1YS5A 3EYCA 3C78X 3RBHA 2CZTA 3KVDD 3VG4A 5H9LA 2MWHA 4AZPA 3ZW2A 4QRLA 3CKGA 3FEKA 4GU8A 1AELA 1HY2A 1SWLA 1ADLA 4YCEA 3QRCA 3WJFA 4Z27A 2RTAA 4O4UA 5KAIO 3O0EA 2RTHB 5BVQA 3NPOA 1QQSA 2HMBA 3B2IA 3AAAA 4BX6B 3QRAA 2IZHB 4ON1A 4QNIA 3TF6A 1LICA 1DZKA 1NBXA 2OL7A 4UB8O 4AKMA 4ZFXA 4OS8A 2KD2A 2WQAE 2KTDA 2X8FA 4AZOA 3STNA 3FR2A 4YFRA 1HBQA 1FTPA 3FMZA 2W2FA 3T2XA 4E1TA 5FENA 2R74A 2XG6A 1EXSA 4I60A 1R0UA 2OFAA 3T1DA 1W5RA 5HAEA 1QY2A 2X46A 4KT5A 2Y3FA 1VWKB 1LDQA 2IZDB 2RQ0A 2X56A 2C1SA 2NNEA 4FUVA 2FHNX 4FZNA 4N74A 2OF9A 4AYDC 2M4LA 3HW9A 2JN3A 4AKRA 2M06A 3RY2A 4U8UM 1KT5A 4JCHA 2K62A 1N0SA 1I9HA 3UEUA 2FKGA 2NNQA 1GKAB 2A13A 2W80C 2LFUA 1VWBB 2FR3A 5HA1A 5AQ6A 4AYID 1KXOA 4FGIB 2RTOB 1ML7A 1Y9TA 3IFBA 2WEXA 2AVIA 2HNXA 2BT9A 3VZTX 4GK9A 1HMTA 1H6S1 4WBKA 5HCEC 4PJ2A 4BX7B 4HPAA 1EIOA 2F01A 2DJGA 2KT4B 3IA8A 3F6ZB 4OMWA 2RA6A 1PBYA 3SZHA 4JFBA 4N58A 2XE3A 1A18A 2VFBA 3BX8A 3MM0A 3LK3A 4HWMA 4FRTA 2Y7SA 4Z28A 3VHMA 3AKNA 1GFQA 4O4SA 1RBPA 5KIDA 4U9CA 2G78A 4NLJA 1T1LA 2QM9A 5K06A 1SWCA 2FT9A 1VYFA 4GZVA 4Z3TA 1EPAA 1GX9A 4GHBA 4NLIA 3PDFA 2FRSA 4PSQA 4QAEA 1SA8A 1KT3A 3UEWA 4Y0SA 2IFBA 4QZTA 4KC8A 2WQ9A 3JTYA 5LJBA 5FQ6E 1KGLA 1BSQA 3P6GA 2I5ZO 3UAQA 3SY9A 4XNKA 3MBTA 1SWBA 3BS2A 3KFFA 3MVFA 2JU3A 3RDMA 2X4MA 2ACPX 4ZHGA 5IRAA 2QTKA 2XTQA 4COTA 1I06A 2L68A 1D2UA 4IAWA 3ELZA 3HK1A 2YNKA 1LIDA 3CBCA 1EIIA 3Q34A 4KRAA 1RLBE 2ZLDA 2OYBO 4AUIA 1HQQA 2G79A 5HZ5A 1ZHTA 1STRB 2BC3A 4XNLA 4GDZA 3P6FA 3HPEA 2OFMX 2BS6A 4XMFA 4YMYA 4PUXA 4FBVA 5CYBA 3RE5A 1GKAA 5K68A 1JMXA 1G90A 3T24A 3TZSA 2QOMA 4IABA 3WOVA 4Y0QA 2KXPB 2DM5A 2GH7A 1U18A 5EPQA 1I05A 1WUBA 1NC9A 5FQ8E 3WYPA 5CE4A 4QGXA 1PRNA 2CAMA 1TOWA 2N2LA 4LSFA 4GNWA 4EKVA 3D4RA 2BSZA 3SLJA 2E4JA 4BX7A 1ALBA 1CJ5A 4QGVA 3P6HA 1AVEA 4RUUA 3KFHA 1G74A 4JNJA 4NP1A 3PH5A 1TXLA 5LJEA 1DZMA 4LZVA 4DQ3A 5HTEA 2LA7A 4CDFA 5HZ9A 5IRUA 4BJ8A 3DWOX 3H3IA 1E5PA 4AYNA 4ZH9A 4FBRA 2GE4A 1YP7A 3F8AA 4C5PA 1I78A 1GFOA 4YGHA 5LKEA 5B10O 3RY1A 4XMGA 4OS0A 4O3WA 1CBQA 1E2TA 1SLFB 2GC9A 1SWAA 4U3QA 1D3SA 1LIEA 4ALOA 4MVKA 5HZ8A 4A8ZA 5F6ZA 2JMMA 4G75A 4YVBA 1KOIA 2AF5A 1SRFA 4O4XA 1SLDB 5DG4A 3ZWEA 3STMX 1MOYA 5H9NA 5G39A 1LIBA 4D6BA 3BLGA 3VG6A 1ZNHA 3WJDA 1Q9GA 4I6SA 3FIDA 3WU2O 3OE3A 4ORUA 1VWLB 4CTDA 3VG7A 1FE3A 3CMPA 1NP4A 1IKEA 4MVIA 1O1UA 2MO5A 1HN2A 3PORA 3Q6LA 1MX7A 4TNNA 1DF3A 3S60A 1SRIA 1EUOA 4BX5B 3HWFA 3P24A 4PR7A 4EQAC 4ML7B 1VPRA 4YGGA 3APWA 2M07A 3VZUX 4N59A 1KT4A 5K67A 3L4RA 2OMFA 1Y53X 4KC7A 2IWWA 2XE2A 1TW4A 5GTHO 3APXA 5D4AA 4HPBA 4LKPA 5B5GA 5LJHA 1LCVA 2KXPA 1LFOA 4LSIA 3VG5A 3FA6A 4KR4A 2LFOA 3BU9A 3AAEB 1IFBA 2KZ7A 3WJGA 3SZVA 3AUMO 1BWYA 2PRNA 3BSZE 4I3CA 2K4TA 4OS3A 2ANSA 2A5BA 2VFCA 2QO6A 2C1QA 2FWVA 1OPBA 1SXXA 4FMSA 2IWVA 2R4PA 4D5UA 1YWAA 1SRHA 2OY7A 3LK41 1ZRYA 2OFRX 3VGWA 3GP6A 4UB6O 3OD9A 2OVAA 2AMMX 2R56A 1FDQA 4YKOA 5F58A 2HYSA 3BRZA 4C69X 3PGSA 3B2LA 4ID2A 1MUPA 1RAVA 4M7MA 5IO5A 1K3BA 4AZMA 3VHIA 1SY1A 4XMCA 1VWGB 3FA9A 4FSOA 2A3FX 3ZZVA 3SLOA 5H9AA 5C0NA 1OBUA 1HMRA 5EDCA 3HOLA 1MEPA 4MISA 4NV8A 2WVPA 2AT8X 3D95A 3B2JA 1YP6A 3UEXA 5L8NA 1SY0A 4ARHA 4GD9A 2YG2A 2W2AA 3BDRA 4N7CA 3O22A 2ERVA 3LTWA 4ORRA 2Q2MA 2KDYA 1KQWA 2QO4A 3NJTA 1YUPA 5E79O 3RDXA 5HCCC 4HPDA 2L9CA 4ORSA 2MJIA 1SWHA 4Y0PA 1PEEA 3AA7B 1UYNX 3CKFA 2X27X 4BX5A 2YPVA 1PBOA 3EW1A 3MX7A 2OVSA 3VPJE 5KICA 1GT1A 2R8AA 3DWNA 3TZGA 1IKJA 3RKGA 5DL6A 2WPUA 1NGLA 1B56A 4BGFA 3WI4A 2RTQB 2GTLO 1MK5A 4JHQA 4YBPA 3SAOA 1VWPB 4WHIA 2FS6A 1OBPA 1GFMA 2R73A 1SWJA 1SRJA 5DPQA 2WJQA 1DZPA 3PF1A 2LB6A 3AAEA 1FELA 1KZWA 4E1SA 1DF8A 2R4OA 4QYPA 2X8SA 4FSPA 3UU2A 4FOZA 3TGBA 2FKJA 4IB6A 3G7XA 2OY8A 5LJGA 1AB0A 1G85A 4G76A 5GTIO 3WXQA 1VWRB 2WUTA 1SWKA 1LCWA 3GE2A 3RBYA 3POXA 2KW1A 1X8QA 5EE2A 1JQPA 2IZIA 2LBAA 1EALA 5D47A 2OY5O 5LJDA 5AJBA 2RN4A 3AA6B 2GTLN 1SWEA 4WFUA 1HMSA 3SYBA 3VG3A 3BS0A 1KT6A 3WYQA 4ZGUA 4CPIA 3O19A 4L1NA 3VHHA 1T68X 1U0XA 5JR8A 4BUMX 2RD7C 1HXTA 2IZAA 5BYPA 2FGRA 2KTSA 4RLBA 4L3RA 4Z2OA 4ODDA 5HA0A 5HZQA 4NNTA 4UU2A 4PJ0O 1KT7A 2WJRA 1MDCA 2RTPB 3T6FA 3PH6A 3RZYA 4KR8A 2AL0X 4LSEA 5FVNA 4U8UO 1Q9FA 3P6EA 5B29A 1T0VA 3NX1A 3OBLA 4AYEC 3MG5A 3WBGA 3EMMA 1N4JA 3ZQ3A 1BEBA 5B3MO 2MF6A 2R88A 3FR4A 4BQUA 4DQ4A 5TISO 4OEMA 1AQBA 1OPFA 1BM5A 3AA7A 5HCDC 1IZNB 1A57A 1MPFA 3PQUA 1KFFA 3ZW0B 2XKLA 5CHKA 4D65A 4O4OA 4KIIA 1IJ8A 4DNEA 1BRPA 1ZNGA 1ZHXA 2IZCB 4Z6JA 2NP1A 4ORWA 5D5DA 2FS7A 4ORYA 2O62A 2CM4A 3KVNA 5D45A 2OVDA 3PPTA 4U8UN 2CM9A 3TGAA 4OKAA 2R4NA 3PP6A 1EI5A 4Y59A 1T16A 4KCAA 4C00A 3T0SA 3PGUA 2OF8A 2Z4HA 2RTDB 5B2AO 1OSMA 4O3XB 1SWNA 3UEVA 1T8VA 4IB9A 2QCBA 1E02A 2UYWA 1ICMA 1QY0A 2WSJA 1SWSA 1OEEA 2HKDA 3U9PC 3D96A 1W6FA 4NW4A 1VWHB 4IL6O 1YWCA 1ZNEA 2AT0X 1YWBA 2KZ7B 3S5VA 2F1CX 2RTKA 2Q4NA 3UPGA 2X9KA 4WFVA 4BVMA 5DL8A 4GH7A 3AA6A 2DJFA 2FHLA 4I3BA 1VWOB 5H9KA 4FZMA 1K24A 1RSUB 3HOEA 4I3DA 3FLLA 4ZH6A 2AT6X 1DZJA 4BCSA 4N7DA 2X55A 1HQPA 1B8EA 1VWFB 2BLGA 4RLCA 2MHDA 2Y2XA 3CBSA 6PRNA 3KZIO 3ZW1B 2R4LA 1VWNB 1X8UA 3HWGA 1VWJB 4YDBA 1EW3A 3FW4A 4K3BA 5IO7A 2LBVA 1ACDA 3D9WA 2XMXA 1AVGI 2RTBB 1SWDA 3A0HO 4F4BA 5H8TA 2W2BA 3PECA 1O1VA 3EW2A 3S5XA 4RJWA 5HTDA 2XSTA 1G7NA 3NP1A 1AVDA 1ERXA 2PI3O 4YGZA 4XMHA 4GETA 1NQMA 3BX7A 2ACOA 1BBPA 4FQBB 5GV0A 5IYUA 3F9DA 1EQDA 2ALLX 2MHLA 4YFQA 5L8IA 3LK42 1IZNA 3WJCA 5EEEA 3ZW0A 1FEMA 4O3ZA 1ERBA 2Y0HA 2JMBA 4I95A 1UYOX 3RDSA 1CBRA 4EEJA 3POQA 3DZMA 1CBSA 4ORXA 2IZBA 1KL5A 4IBAA 5KHPA 3VZWX 5AJCA 1VWQB 5G38A 3FELA 3O2YA 2RTNB 3B2HA 1LUQA 1UZ2X 1YIVA 4Y5DA 1ZNDA 2IZFB 5H2FO 3FIQA 3A0BO 1BT9A 5B5FA 3NX2A 4HPCA 1SLGB 5BVTA 4CPEA 2WWPA 4RL9A 2Q2PA 3AEHA 1BJ7A 3EBWA 2FR2A 1JZUA 3VE1A 4TKBA 1RXJA 2FTBA 1X8OA 1TOUA 3WZPA 5L8OA 4NV7A 4ZHDA 4GJVA 3G7GA 4AZNA 3PRNA 2CBSA 3VU1A 1SWQA 4BOEA 3T6LA 2AKQA 2X34A 5ADXK 2F73A 4CK4A 4AZQA 1SWRA 1QABE 3FEPA 3U0DA 2JQYA 2FGQX 3WI5A 2Y0KA 8PRNA 5D48A 4RJXA 2I5VO 4EFGA 4BBOA 3U03A 2A5CA 1X8NA 3ZW1A 3TGCA 2MNHA 5T5FA 4D64A 1S5LO 4LSHA 2C4IA 4M6SA 1U17A 4JGLA 4AZRA 3DA3A 3POUA 1SY3A 1A2DA 1GXAA 4O49A 3NQKA 1SXYA 5D8JA 4YFPA 1N9YA 2J1NA 1VYOA 3ZUIA 4IRWA 3SZDA 4U46A 1JMZA 1ZHWA 1QJPA 4IB8A 1UREA 2G5LA 1KL4A 3RWXA 1SWPA 1LF7A 4QZUA 4ZR2A 1JJXA 1GX3A 2WEWA 4C4VB 3AA1B 1GGLA 4I9RA 3C77X 1Y55X 3EM0A 5DL7A 4RUNA 3WJBA 2X32A 1QWDA 3VG2A 1LIFA 4Z2VA 5EDBA 3DA4A 1IIUA 3JCUO 4AW8A 2RTEB 2IZGB 3KZAA 3N91A 2CZUA 4ZJ0A 1X8PA 1XCAA 4NNSA 1KZXA 2Y3EA 2WR6A 1XKIA 1VWCB 2Y0LA 2L67A 4K3CA 2R89A 1PMPA 1NP1A 1Y9LA 3WZNA 1SMPI 2ODJA 1FENA 4MEEA 1NQNA 5F6BA 1VWIB 3SLTA 2YMSA 5AFUK 2AH7X 1OBQA 5IXGA 4TJZA 7PRNA 5B11O 1LELA 3CR6A 4OMXA 1QJ8A 2F1VA 1HXLA 2EU7X 5KAFO 3SZJA 5IRWA 2QMIA 3WZQA 2N93A 1JV4A 2UZ2A 3BY0A 3VE2A 1STPA 5B66O 5LKFA 3QKGA 1BH3A 1QY1A 4XMEA 3LHNA 1RXHA 3LK2B 4CV7A 3FYXA 3B2KA 2IZLB 5JD2A 2Q9SA 3RSWA 2RTMA 5LJKA 4LKTA 3BU1A 1QG5A 4AZLA 3NSGA 3OJYC 1H91A 4FQEA 3FW5A 1SLEB 4Y0RA 1DC9A 4GCPA 3WVMA 1JBHA 4JO6A 3NBXX 3C5OA 1LKEA 4B55A 5B5EO 1GM6A 1CRBA 4GGRA 4ALBA 3E3CA 1E54A 2ASNX 4YBUA 3D97A 2A2GA 1QFTA 2QO5A 1SY2A 2Z4IA 4FRXA 2AXTO 1SWOA 4R0BA 2PORA 1HBPA 1JYJA 1S2PA 1KL3A 3FA8A 2RTLA 4C4VA 4LZUA 3AA1A 2JGSA 4NYRA 1IW2A 1ZHZA 2JOZA 4OELA 4IMNA 4YH0A 1X89A 4HFOA 5DL5A 2RCTA 1I4UA 2Y32A 4I9SA 1ZHYA 1NDJA 3AKMA 3I0AA 2A2UA 3NQ3A 1BXWA 4IB7A 1VWAB 1SREA 3SYSA 3WZOA 4GRJA 1LPJA 3DTQA 2BHVA 1KQXA 3PGRA 2JU7A 1PM1X 2OFBA 3FA7A 1BSOA 3PK2A 4EDEA 2ZFGA 1DFVA 1EPBA 1THQA 5F2BA 4CDCA 4ZGFA 3FYFA 4BX6A 4CPHB 4FESA 1MVGA 2KC0A 1Y52X 1DV9A 3LV4A 4K19A 3X00A 5CSEA 4INNA 1BRQA 1RXKA 1GT4A 4CPFA 2A8GA 2F09A 3FENA 1VYGA 4TKJA 2G8CO 1BLRA 1E00A 2Q39A 3WJEA 1PTSA 4GJSA 1B0OA 5HZ6A 3AA0B 4TQ2A 2OVEA 2CBRA 3P02A 3GAQA 1FJ1E 5F7GA 2ZAGA 2RTCB 3HWBA 1P4TA 4FBOA 3LK2A 3T2WA 3CWKA 2OL8O 4FZLA 4O3YA 1N43A 3NQ9A 2FLJA 4KH8A 4CDDA 2K0LA 1OPAA 4Z2PA 1RSTB 4GCQA 1SXUA 1W4TA 2F1TA 1OEJA 4NYQA 4MVLA 3KFGA 1WBIA 5JDPA 5F1EA 2ZAIA 2NNDA 1A3YA 4O9SA 2JW1A 2XTRA 3JQOA 4IAXA 4GCSA 2O4VA 3FR5A 3ZI8A 3PQSA 2HZRA 4AYHA 4GUZA 4ZHHA 2RTGB 2RTRB 4A60A 1YWDA 1S44A 1VWMB 3BRNA 1GFPA 1SWUA 1ICNA 4GF4A 1L6MA 3K19A 5L3YA 5LJCA 5EZ2A 1PHOA 3CQRA 4GGTA 2J4UP 3RE6A 4MIRA 3A2SX 2IZJA 2RCQA 2W81C 2FGSA 3RDUA 1MX8A 1SWFA 1QFVA 1SWGA 2MM3A 5FFHA 2OL6O 4YCHA 4CSBA 1ZNLA 2VDFA 1B4MA 4YDAA 3RDQA 1HXUA 3BRYA 3APVA 5FQ7E 2HLVA 2QOSC 1GX8A 1TVQA 4IMOA 1STSB 5AEOA 3S26A 3FDCA 4ZCBA 4AYMC 3VY9X 5PRNA 2PY1A 3P6CA 2HZQA 4ES7A 4GKCA 4CPHA 3T20A 3EMNX 2L5PA 3JS1A 4ZHFA 2X45A 2P8GA 1BSYA 3QQ2A 3VY8X 3RDOA 3NADA 1HXZA 5FAZA 1Z24A 4TKHA 1SXWA 2BS5A 3EC5A 2RTFB 4XMDA 4GGZA 3AAAB 1MM4A 5ADXL 1O8VA 1LDOA 1X71A 5BVSA 3AA0A 1GT3A 2K23A 2IZKA 3KQ0A 5HBSA 1IFCA 3HWDA 1LCZA 5EEDA 2JU8A 2XE5A 4GNYA 3P6DA 4DCBA 4D6AA 1VWEB 2RTIB 4TLJA 3NR3A 3EBKA 2IZEB 2OZQA 2AT3X 1QJ9A 1JIWI 1ZNKA 4GE1A 1JJJA 3JSQA 3HWEA 1GFNA 2GJ5A 4LQZA 3V8UA 4FT6A 2AT5X 3SOTA 1MM9A 4MVEA 2LHFA 4AKRB 5IO6A 1Y0GA 1N9MA 5HWZA 5G26A 4GDAA 3APUA 4A1HA 5B27A 2POAA 1JJUA 1LNMA 2X8TA 3ELXA 4QQ1A 1P6PA
chains in the Genus database with same CATH topology
5F6ZA 2JMMA 4G75A 1QY1A 4XMEA 3CQNA 1ZNGA 1ZHXA 3PEDA 1KOIA 3LHNA 2G7BA 3LK2B 4CV7A 3ZUOA 3FYXA 1S7DA 3B2KA 2NP1A 1HXXA 4YKMA 4ORWA 5D5DA 2Q9SA 3RSWA 2FS7A 4ORYA 4O4XA 4AFKA 2O62A 4LKTA 3BU1A 5DG4A 4QYNA 3ZWEA 1QG5A 2CM4A 3STMX 5LJKA 4AZLA 3NSGA 5D45A 2OVDA 3PPTA 3KFIA 5H9NA 3OJYC 4U8UN 1H91A 2CM9A 3TGAA 3FW5A 4A1YA 2GTFX 2A0AA 3PP6A 1EI5A 4Y0RA 3HTYA 1ORMA 1DC9A 1LIBA 4D6BA 4GCPA 3WVMA 3BLGA 3VG6A 1MM5A 1ZNHA 1OEKA 1CBIA 4KCAA 1JBHA 3SY7A 3T0SA 3NBXX 3WJDA 1Q9GA 3C5OA 1LKEA 4I6SA 4B61A 3C76X 2LKKA 4EXZA 1GM6A 2Z4HA 1I04A 3OE3A 1CRBA 3DSZA 3K3LA 4ORUA 2GTLM 3LK3B 3VG7A 4ALBA 1GT5A 1FE3A 3CMPA 1NP4A 3E3CA 1G5WA 1OSMA 1E54A 2XE1A 3STKA 5AFUL 2ASNX 4O3XB 1IKEA 1E06A 3UEVA 4MVIA 1O1UA 1T8VA 4IB9A 4UU3A 2MO5A 1JYDA 1HN2A 3I17A 4QGWA 4YBUA 3PORA 1E02A 4ZHCA 1ICMA 3D97A 2A2GA 1MX7A 3Q6LA 4TNNA 1DF3A 1QY0A 2N2MA 3S60A 3EYCA 1YS5A 3C78X 1QFTA 2QO5A 3RBHA 2WSJA 1SY2A 2Z4IA 1OEEA 2CZTA 4FRXA 3KVDD 3U9PC 1EUOA 3VG4A 3D96A 4R0BA 2PORA 1HBPA 1JYJA 5H9LA 1S2PA 4NW4A 3HWFA 3FA8A 2MWHA 4AZPA 1YWCA 3ZW2A 1ZNEA 2AT0X 1YWBA 3P24A 4QRLA 3S5VA 2KZ7B 4EQAC 4ML7B 2Q4NA 4LZUA 3FEKA 3AA1A 3UPGA 4WFVA 4GU8A 1AELA 1VPRA 1IW2A 4NYRA 1ZHZA 4BVMA 2JOZA 5DL8A 4YGGA 4GH7A 3AA6A 4IMNA 3APWA 1ADLA 4YH0A 1X89A 4YCEA 2M07A 3QRCA 3WJFA 4I3BA 3VZUX 4N59A 1KT4A 4HFOA 5DL5A 3L4RA 5H9KA 2RCTA 2OMFA 1I4UA 1ZHYA 4I9SA 4O4UA 4FZMA 3AKMA 3I0AA 2A2UA 3NQ3A 3O0EA 5BVQA 3NPOA 4KC7A 1BXWA 4IB7A 1QQSA 3HOEA 2XE2A 1TW4A 2HMBA 3B2IA 3FLLA 3APXA 4I3DA 5D4AA 4ZH6A 3AAAA 4HPBA 2AT6X 1DZJA 3QRAA 4N7DA 1HQPA 1B8EA 4LKPA 3SYSA 4ON1A 4QNIA 2BLGA 5LJHA 4RLCA 3TF6A 2MHDA 2Y2XA 1LICA 3CBSA 2KXPA 6PRNA 1DZKA 3ZW1B 4GRJA 1LFOA 1X8UA 1LPJA 3DTQA 2BHVA 1KQXA 4LSIA 4AKMA 3VG5A 4ZFXA 3FA6A 4KR4A 2LFOA 3BU9A 3AAEB 4OS8A 1IFBA 3HWGA 2KZ7A 2KD2A 2WQAE 2KTDA 2JU7A 2X8FA 4YDBA 3WJGA 4AZOA 1EW3A 3STNA 1PM1X 3FR2A 3FW4A 3SZVA 1BWYA 2PRNA 4YFRA 5IO7A 1HBQA 3FA7A 1FTPA 2LBVA 3BSZE 1BSOA 3FMZA 4EDEA 1ACDA 2ZFGA 4I3CA 2W2FA 2XMXA 1DFVA 1AVGI 1EPBA 1THQA 4E1TA 4F4BA 5FENA 5H8TA 2K4TA 2R74A 2ANSA 4OS3A 2W2BA 2XG6A 2QO6A 1EXSA 1R0UA 3PECA 3T1DA 1O1VA 5HAEA 2FWVA 1QY2A 3S5XA 4RJWA 1OPBA 5HTDA 2X46A 1SXXA 2XSTA 4FMSA 4ZGFA 3FYFA 4KT5A 4FESA 1MVGA 1G7NA 2KC0A 4D5UA 1YWAA 1DV9A 3LV4A 3NP1A 4K19A 1ERXA 4INNA 3LK41 1BRQA 2RQ0A 4YGZA 4XMHA 1ZRYA 2OFRX 4GETA 2NNEA 4FUVA 3GP6A 3OD9A 2OVAA 3BX7A 2ACOA 1BBPA 4FQBB 1GT4A 4FZNA 5GV0A 3HWBA 2AMMX 5IYUA 2F09A 2M4LA 3HW9A 2JN3A 2R56A 3F9DA 4AYDC 3FENA 2M06A 1FDQA 4AKRA 1VYGA 4TKJA 1EQDA 4YKOA 4U8UM 5F58A 1KT5A 4JCHA 2ALLX 2HYSA 1BLRA 1E00A 2MHLA 2K62A 1N0SA 4C69X 3UEUA 2Q39A 3B2LA 4ID2A 2NNQA 3WJEA 1GKAB 4YFQA 1MUPA 2A13A 1B0OA 5L8IA 2W80C 3LK42 1IZNA 2LFUA 4M7MA 5IO5A 4AZMA 3WJCA 5EEEA 2FR3A 3ZW0A 1SY1A 4XMCA 5HZ6A 3AA0B 5HA1A 4TQ2A 5AQ6A 3FA9A 4FSOA 2A3FX 2OVEA 3ZZVA 2CBRA 3P02A 3GAQA 4AYID 5F7GA 1FEMA 2ZAGA 1KXOA 1ERBA 4FGIB 2JMBA 1ML7A 1Y9TA 4O3ZA 4I95A 1OBUA 3IFBA 5H9AA 5C0NA 2WEXA 1P4TA 4FBOA 3LK2A 2HNXA 3CWKA 1HMRA 2BT9A 5EDCA 3HOLA 1CBRA 4EEJA 3VZTX 3POQA 4FZLA 4GK9A 1HMTA 4MISA 4O3YA 1CBSA 4ORXA 3NQ9A 1H6S1 4IBAA 2AT8X 2FLJA 4WBKA 5HCEC 4KH8A 4PJ2A 3D95A 2K0LA 4HPAA 5KHPA 3B2JA 1EIOA 1YP6A 3VZWX 1OPAA 5AJCA 3UEXA 5L8NA 1SY0A 4ARHA 4GCQA 1SXUA 2F1TA 1OEJA 2YG2A 4NYQA 2KT4B 3FELA 3F6ZB 3IA8A 3O2YA 4OMWA 4MVLA 2RA6A 2W2AA 3KFGA 4JFBA 4N58A 3B2HA 2XE3A 5JDPA 3BDRA 4N7CA 5F1EA 2ZAIA 1UZ2X 3O22A 1YIVA 2NNDA 1A18A 1A3YA 4O9SA 1ZNDA 2JW1A 2XTRA 3JQOA 3BX8A 4IAXA 2ERVA 4GCSA 3FIQA 3LK3A 4HWMA 4ORRA 2O4VA 2Q2MA 3FR5A 1BT9A 2KDYA 2Y7SA 3ZI8A 4A8ZA 3NX2A 4HPCA 1KQWA 3AKNA 2QO4A 1GFQA 4O4SA 1YUPA 3PQSA 1RBPA 2HZRA 4AYHA 5BVTA 5HCCC 5KIDA 4HPDA 4ZHHA 2L9CA 4ORSA 2MJIA 2WWPA 4U9CA 2G78A 4NLJA 4A60A 4Y0PA 1YWDA 2QM9A 5K06A 1S44A 2FT9A 1PEEA 3AA7B 4RL9A 2Q2PA 3BRNA 1BJ7A 1GFPA 3EBWA 2X27X 1ICNA 1VYFA 2FR2A 1JZUA 2YPVA 3VE1A 1PBOA 3MX7A 4TKBA 4GZVA 2OVSA 4GF4A 2FTBA 3VPJE 1EPAA 5KICA 1GX9A 3VY9X 4Z3TA 4GHBA 4NLIA 1L6MA 1TOUA 1GT1A 1X8OA 3K19A 5L8OA 4ZHDA 5LJCA 3TZGA 2FRSA 5EZ2A 1PHOA 3CQRA 1IKJA 3RKGA 2J4UP 3G7GA 4MIRA 4PSQA 4AZNA 5DL6A 4QAEA 1NGLA 1SA8A 3A2SX 1B56A 3PRNA 2RCQA 1KT3A 2CBSA 3VU1A 2W81C 4BOEA 2AKQA 3UEWA 4Y0SA 5ADXK 2F73A 1MX8A 3WI4A 4CK4A 2IFBA 1QFVA 2GTLO 4AZQA 3FEPA 1QABE 4QZTA 3U0DA 4YBPA 3SAOA 2MM3A 4KC8A 2FGQX 3WI5A 2Y0KA 4WHIA 5FFHA 8PRNA 4YCHA 2FS6A 2WQ9A 1OBPA 5D48A 1GFMA 2R73A 5LJBA 3JTYA 4RJXA 5FQ6E 1KGLA 4CSBA 4EFGA 1BSQA 5DPQA 3U03A 3P6GA 1X8NA 1DZPA 3ZW1A 1ZNLA 1B4MA 4YDAA 3TGCA 2LB6A 3UAQA 2MNHA 1HXUA 5T5FA 4D64A 3SY9A 4LSHA 3AAEA 4XNKA 4M6SA 3APVA 1U17A 3MBTA 4JGLA 5FQ7E 2HLVA 1FELA 3BS2A 4AZRA 1KZWA 3DA3A 3POUA 3KFFA 2QOSC 3MVFA 4E1SA 1GX8A 2JU3A 1TVQA 1SY3A 2X8SA 4IMOA 4QYPA 4FSPA 3UU2A 5AEOA 4FOZA 2ACPX 4ZHGA 4AYMC 1A2DA 1GXAA 4O49A 3TGBA 3NQKA 3S26A 4IB6A 3G7XA 5LJGA 1SXYA 4ZCBA 5D8JA 1AB0A 4YFPA 2QTKA 1G85A 2J1NA 3ZUIA 2PY1A 3WXQA 3P6CA 4COTA 2XTQA 4G76A 2WUTA 1I06A 5PRNA 2L68A 1D2UA 4IAWA 3ELZA 3HK1A 3SZDA 3GE2A 2HZQA 1LIDA 3CBCA 3RBYA 4ES7A 2YNKA 1ZHWA 3POXA 4GKCA 1QJPA 4IB8A 2KW1A 1UREA 3T20A 1EIIA 3EMNX 3RWXA 2L5PA 3JS1A 1LF7A 1RLBE 2ZLDA 4KRAA 1X8QA 4ZHFA 5EE2A 4QZUA 4ZR2A 4AUIA 2LBAA 1JJXA 2WEWA 2X45A 3AA1B 2G79A 2P8GA 5D47A 1EALA 1BSYA 1GGLA 5HZ5A 5LJDA 1ZHTA 5AJBA 3VY8X 4I9RA 2RN4A 4XNLA 4GDZA 3AA6B 2GTLN 3C77X 3NADA 4WFUA 3P6FA 1HMSA 2OFMX 3SYBA 3VG3A 2BS6A 4XMFA 3EM0A 1KT6A 5FAZA 4YMYA 4PUXA 5DL7A 4FBVA 5CYBA 4ZGUA 1Z24A 4RUNA 1SXWA 3O19A 4TKHA 2BS5A 4L1NA 4XMDA 3WJBA 1GKAA 1QWDA 1T68X 3AAAB 1MM4A 1U0XA 3VG2A 5JR8A 4BUMX 5ADXL 1LIFA 2RD7C 1O8VA 1G90A 5EDBA 1X71A 1HXTA 3DA4A 5BVSA 3T24A 3AA0A 3TZSA 1GT3A 1IIUA 2Y0HA 4IABA 3WOVA 2K23A 4Y0QA 4AW8A 2KXPB 5BYPA 2FGRA 2KTSA 2DM5A 3KQ0A 3KZAA 3N91A 1U18A 2CZUA 4ZJ0A 4RLBA 5EPQA 4L3RA 1I05A 1X8PA 1XCAA 5HBSA 4ODDA 1IFCA 5HA0A 5HZQA 4NNTA 4UU2A 3HWDA 5FQ8E 4NNSA 1KT7A 5EEDA 5CE4A 1KZXA 1MDCA 4QGXA 1PRNA 1TOWA 2N2LA 2JU8A 2XE5A 4GNYA 4LSFA 4GNWA 3P6DA 3D4RA 2WR6A 1XKIA 3PH6A 2E4JA 3RZYA 4D6AA 4KR8A 1ALBA 1CJ5A 4QGVA 3P6HA 4RUUA 2AL0X 3KFHA 2L67A 2Y0LA 4LSEA 1G74A 4TLJA 3NR3A 4NP1A 3EBKA 3PH5A 1TXLA 5LJEA 2OZQA 2AT3X 1QJ9A 1DZMA 1PMPA 4LZVA 1JIWI 4DQ3A 1ZNKA 5FVNA 1NP1A 4U8UO 2LA7A 3P6EA 5HTEA 1Q9FA 1Y9LA 4GE1A 1SMPI 5B29A 1T0VA 3NX1A 1FENA 3OBLA 5HZ9A 1JJJA 2ODJA 4AYEC 5F6BA 3JSQA 3HWEA 2YMSA 1GFNA 5AFUK 3H3IA 1E5PA 4AYNA 2GJ5A 4LQZA 3V8UA 4FT6A 3WBGA 3EMMA 4ZH9A 4FBRA 2AT5X 2AH7X 2GE4A 1YP7A 1OBQA 3F8AA 3SOTA 3ZQ3A 1BEBA 1GFOA 4TJZA 7PRNA 4MVEA 4YGHA 5LKEA 2LHFA 4AKRB 3FR4A 5IO6A 3CR6A 4OMXA 4XMGA 4BQUA 1QJ8A 2F1VA 1BH3A 2EU7X 5HWZA 4DQ4A 4OS0A 4FRTA 4O3WA 1CBQA 5G26A 3APUA 1AQBA 1OPFA 4A1HA 2QMIA 5B27A 1BM5A 2N93A 2POAA 2GC9A 1JV4A 3AA7A 1LNMA 3BY0A 5HCDC 2X8TA 4U3QA 1IZNB 3ELXA 1D3SA 3VE2A 1LIEA 1A57A 5LKFA 4ALOA 1MPFA 3PQUA 3ZW0B 4QQ1A 2XKLA 4MVKA 3QKGA 5HZ8A 4D65A 4O4OA 1P6PA 4KIIA 1BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Y A;  1YS5 A;  2YPV A;  2KC0 A;  3VE1 A;  4O4U A;  2Y7S A;  4O49 A;  2KDY A;  4Z3T A;  2W80 C;  2LFU A;  3HOE A;  3KVD D;  4O3W A;  3PQS A;  4AYM C;  4O4X A;  4AYE C;  3UAQ A;  3VE2 A;  4AYI D;  4U9C A;  5T5F A;  4O3Z A;  4AYD C;  4O3X B;  3PQU A;  4QQ1 A;  2W81 C;  4AYN A;  3V8U A;  5EE2 A;  3HOL A; 
#chains in the Genus database with same CATH topology
 2OY1 O;  3CQN A;  3PED A;  4CDE A;  2G7B A;  4N75 A;  3ZUO A;  1S7D A;  1HXX A;  4YKM A;  4AFK A;  4QYN A;  1SRG A;  3KFI A;  1N7Y A;  3SZI A;  4A1Y A;  2GTF X;  2A0A A;  1ORM A;  3HTY A;  1VWD B;  1MM5 A;  1OEK A;  1CBI A;  5G3A A;  1OSP O;  3SY7 A;  4B61 A;  3C76 X;  2LKK A;  4EXZ A;  1I04 A;  1SWT A;  3DSZ A;  3K3L A;  2GTL M;  2RTJ A;  3LK3 B;  1GT5 A;  1G5W A;  2XE1 A;  3STK A;  5AFU L;  1E06 A;  2ZSC A;  4UU3 A;  1JYD A;  3I17 A;  4QGW A;  4ZHC A;  2N2M A;  1YS5 A;  3EYC A;  3C78 X;  3RBH A;  2CZT A;  3KVD D;  3VG4 A;  5H9L A;  2MWH A;  4AZP A;  3ZW2 A;  4QRL A;  3CKG A;  3FEK A;  4GU8 A;  1AEL A;  1HY2 A;  1SWL A;  1ADL A;  4YCE A;  3QRC A;  3WJF A;  4Z27 A;  2RTA A;  4O4U A;  5KAI O;  3O0E A;  2RTH B;  5BVQ A;  3NPO A;  1QQS A;  2HMB A;  3B2I A;  3AAA A;  4BX6 B;  3QRA A;  2IZH B;  4ON1 A;  4QNI A;  3TF6 A;  1LIC A;  1DZK A;  1NBX A;  2OL7 A;  4UB8 O;  4AKM A;  4ZFX A;  4OS8 A;  2KD2 A;  2WQA E;  2KTD A;  2X8F A;  4AZO A;  3STN A;  3FR2 A;  4YFR A;  1HBQ A;  1FTP A;  3FMZ A;  2W2F A;  3T2X A;  4E1T A;  5FEN A;  2R74 A;  2XG6 A;  1EXS A;  4I60 A;  1R0U A;  2OFA A;  3T1D A;  1W5R A;  5HAE A;  1QY2 A;  2X46 A;  4KT5 A;  2Y3F A;  1VWK B;  1LDQ A;  2IZD B;  2RQ0 A;  2X56 A;  2C1S A;  2NNE A;  4FUV A;  2FHN X;  4FZN A;  4N74 A;  2OF9 A;  4AYD C;  2M4L A;  3HW9 A;  2JN3 A;  4AKR A;  2M06 A;  3RY2 A;  4U8U M;  1KT5 A;  4JCH A;  2K62 A;  1N0S A;  1I9H A;  3UEU A;  2FKG A;  2NNQ A;  1GKA B;  2A13 A;  2W80 C;  2LFU A;  1VWB B;  2FR3 A;  5HA1 A;  5AQ6 A;  4AYI D;  1KXO A;  4FGI B;  2RTO B;  1ML7 A;  1Y9T A;  3IFB A;  2WEX A;  2AVI A;  2HNX A;  2BT9 A;  3VZT X;  4GK9 A;  1HMT A;  1H6S 1;  4WBK A;  5HCE C;  4PJ2 A;  4BX7 B;  4HPA A;  1EIO A;  2F01 A;  2DJG A;  2KT4 B;  3IA8 A;  3F6Z B;  4OMW A;  2RA6 A;  1PBY A;  3SZH A;  4JFB A;  4N58 A;  2XE3 A;  1A18 A;  2VFB A;  3BX8 A;  3MM0 A;  3LK3 A;  4HWM A;  4FRT A;  2Y7S A;  4Z28 A;  3VHM A;  3AKN A;  1GFQ A;  4O4S A;  1RBP A;  5KID A;  4U9C A;  2G78 A;  4NLJ A;  1T1L A;  2QM9 A;  5K06 A;  1SWC A;  2FT9 A;  1VYF A;  4GZV A;  4Z3T A;  1EPA A;  1GX9 A;  4GHB A;  4NLI A;  3PDF A;  2FRS A;  4PSQ A;  4QAE A;  1SA8 A;  1KT3 A;  3UEW A;  4Y0S A;  2IFB A;  4QZT A;  4KC8 A;  2WQ9 A;  3JTY A;  5LJB A;  5FQ6 E;  1KGL A;  1BSQ A;  3P6G A;  2I5Z O;  3UAQ A;  3SY9 A;  4XNK A;  3MBT A;  1SWB A;  3BS2 A;  3KFF A;  3MVF A;  2JU3 A;  3RDM A;  2X4M A;  2ACP X;  4ZHG A;  5IRA A;  2QTK A;  2XTQ A;  4COT A;  1I06 A;  2L68 A;  1D2U A;  4IAW A;  3ELZ A;  3HK1 A;  2YNK A;  1LID A;  3CBC A;  1EII A;  3Q34 A;  4KRA A;  1RLB E;  2ZLD A;  2OYB O;  4AUI A;  1HQQ A;  2G79 A;  5HZ5 A;  1ZHT A;  1STR B;  2BC3 A;  4XNL A;  4GDZ A;  3P6F A;  3HPE A;  2OFM X;  2BS6 A;  4XMF A;  4YMY A;  4PUX A;  4FBV A;  5CYB A;  3RE5 A;  1GKA A;  5K68 A;  1JMX A;  1G90 A;  3T24 A;  3TZS A;  2QOM A;  4IAB A;  3WOV A;  4Y0Q A;  2KXP B;  2DM5 A;  2GH7 A;  1U18 A;  5EPQ A;  1I05 A;  1WUB A;  1NC9 A;  5FQ8 E;  3WYP A;  5CE4 A;  4QGX A;  1PRN A;  2CAM A;  1TOW A;  2N2L A;  4LSF A;  4GNW A;  4EKV A;  3D4R A;  2BSZ A;  3SLJ A;  2E4J A;  4BX7 A;  1ALB A;  1CJ5 A;  4QGV A;  3P6H A;  1AVE A;  4RUU A;  3KFH A;  1G74 A;  4JNJ A;  4NP1 A;  3PH5 A;  1TXL A;  5LJE A;  1DZM A;  4LZV A;  4DQ3 A;  5HTE A;  2LA7 A;  4CDF A;  5HZ9 A;  5IRU A;  4BJ8 A;  3DWO X;  3H3I A;  1E5P A;  4AYN A;  4ZH9 A;  4FBR A;  2GE4 A;  1YP7 A;  3F8A A;  4C5P A;  1I78 A;  1GFO A;  4YGH A;  5LKE A;  5B10 O;  3RY1 A;  4XMG A;  4OS0 A;  4O3W A;  1CBQ A;  1E2T A;  1SLF B;  2GC9 A;  1SWA A;  4U3Q A;  1D3S A;  1LIE A;  4ALO A;  4MVK A;  5HZ8 A;  4A8Z A;  5F6Z A;  2JMM A;  4G75 A;  4YVB A;  1KOI A;  2AF5 A;  1SRF A;  4O4X A;  1SLD B;  5DG4 A;  3ZWE A;  3STM X;  1MOY A;  5H9N A;  5G39 A;  1LIB A;  4D6B A;  3BLG A;  3VG6 A;  1ZNH A;  3WJD A;  1Q9G A;  4I6S A;  3FID A;  3WU2 O;  3OE3 A;  4ORU A;  1VWL B;  4CTD A;  3VG7 A;  1FE3 A;  3CMP A;  1NP4 A;  1IKE A;  4MVI A;  1O1U A;  2MO5 A;  1HN2 A;  3POR A;  3Q6L A;  1MX7 A;  4TNN A;  1DF3 A;  3S60 A;  1SRI A;  1EUO A;  4BX5 B;  3HWF A;  3P24 A;  4PR7 A;  4EQA C;  4ML7 B;  1VPR A;  4YGG A;  3APW A;  2M07 A;  3VZU X;  4N59 A;  1KT4 A;  5K67 A;  3L4R A;  2OMF A;  1Y53 X;  4KC7 A;  2IWW A;  2XE2 A;  1TW4 A;  5GTH O;  3APX A;  5D4A A;  4HPB A;  4LKP A;  5B5G A;  5LJH A;  1LCV A;  2KXP A;  1LFO A;  4LSI A;  3VG5 A;  3FA6 A;  4KR4 A;  2LFO A;  3BU9 A;  3AAE B;  1IFB A;  2KZ7 A;  3WJG A;  3SZV A;  3AUM O;  1BWY A;  2PRN A;  3BSZ E;  4I3C A;  2K4T A;  4OS3 A;  2ANS A;  2A5B A;  2VFC A;  2QO6 A;  2C1Q A;  2FWV A;  1OPB A;  1SXX A;  4FMS A;  2IWV A;  2R4P A;  4D5U A;  1YWA A;  1SRH A;  2OY7 A;  3LK4 1;  1ZRY A;  2OFR X;  3VGW A;  3GP6 A;  4UB6 O;  3OD9 A;  2OVA A;  2AMM X;  2R56 A;  1FDQ A;  4YKO A;  5F58 A;  2HYS A;  3BRZ A;  4C69 X;  3PGS A;  3B2L A;  4ID2 A;  1MUP A;  1RAV A;  4M7M A;  5IO5 A;  1K3B A;  4AZM A;  3VHI A;  1SY1 A;  4XMC A;  1VWG B;  3FA9 A;  4FSO A;  2A3F X;  3ZZV A;  3SLO A;  5H9A A;  5C0N A;  1OBU A;  1HMR A;  5EDC A;  3HOL A;  1MEP A;  4MIS A;  4NV8 A;  2WVP A;  2AT8 X;  3D95 A;  3B2J A;  1YP6 A;  3UEX A;  5L8N A;  1SY0 A;  4ARH A;  4GD9 A;  2YG2 A;  2W2A A;  3BDR A;  4N7C A;  3O22 A;  2ERV A;  3LTW A;  4ORR A;  2Q2M A;  2KDY A;  1KQW A;  2QO4 A;  3NJT A;  1YUP A;  5E79 O;  3RDX A;  5HCC C;  4HPD A;  2L9C A;  4ORS A;  2MJI A;  1SWH A;  4Y0P A;  1PEE A;  3AA7 B;  1UYN X;  3CKF A;  2X27 X;  4BX5 A;  2YPV A;  1PBO A;  3EW1 A;  3MX7 A;  2OVS A;  3VPJ E;  5KIC A;  1GT1 A;  2R8A A;  3DWN A;  3TZG A;  1IKJ A;  3RKG A;  5DL6 A;  2WPU A;  1NGL A;  1B56 A;  4BGF A;  3WI4 A;  2RTQ B;  2GTL O;  1MK5 A;  4JHQ A;  4YBP A;  3SAO A;  1VWP B;  4WHI A;  2FS6 A;  1OBP A;  1GFM A;  2R73 A;  1SWJ A;  1SRJ A;  5DPQ A;  2WJQ A;  1DZP A;  3PF1 A;  2LB6 A;  3AAE A;  1FEL A;  1KZW A;  4E1S A;  1DF8 A;  2R4O A;  4QYP A;  2X8S A;  4FSP A;  3UU2 A;  4FOZ A;  3TGB A;  2FKJ A;  4IB6 A;  3G7X A;  2OY8 A;  5LJG A;  1AB0 A;  1G85 A;  4G76 A;  5GTI O;  3WXQ A;  1VWR B;  2WUT A;  1SWK A;  1LCW A;  3GE2 A;  3RBY A;  3POX A;  2KW1 A;  1X8Q A;  5EE2 A;  1JQP A;  2IZI A;  2LBA A;  1EAL A;  5D47 A;  2OY5 O;  5LJD A;  5AJB A;  2RN4 A;  3AA6 B;  2GTL N;  1SWE A;  4WFU A;  1HMS A;  3SYB A;  3VG3 A;  3BS0 A;  1KT6 A;  3WYQ A;  4ZGU A;  4CPI A;  3O19 A;  4L1N A;  3VHH A;  1T68 X;  1U0X A;  5JR8 A;  4BUM X;  2RD7 C;  1HXT A;  2IZA A;  5BYP A;  2FGR A;  2KTS A;  4RLB A;  4L3R A;  4Z2O A;  4ODD A;  5HA0 A;  5HZQ A;  4NNT A;  4UU2 A;  4PJ0 O;  1KT7 A;  2WJR A;  1MDC A;  2RTP B;  3T6F A;  3PH6 A;  3RZY A;  4KR8 A;  2AL0 X;  4LSE A;  5FVN A;  4U8U O;  1Q9F A;  3P6E A;  5B29 A;  1T0V A;  3NX1 A;  3OBL A;  4AYE C;  3MG5 A;  3WBG A;  3EMM A;  1N4J A;  3ZQ3 A;  1BEB A;  5B3M O;  2MF6 A;  2R88 A;  3FR4 A;  4BQU A;  4DQ4 A;  5TIS O;  4OEM A;  1AQB A;  1OPF A;  1BM5 A;  3AA7 A;  5HCD C;  1IZN B;  1A57 A;  1MPF A;  3PQU A;  1KFF A;  3ZW0 B;  2XKL A;  5CHK A;  4D65 A;  4O4O A;  4KII A;  1IJ8 A;  4DNE A;  1BRP A;  1ZNG A;  1ZHX A;  2IZC B;  4Z6J A;  2NP1 A;  4ORW A;  5D5D A;  2FS7 A;  4ORY A;  2O62 A;  2CM4 A;  3KVN A;  5D45 A;  2OVD A;  3PPT A;  4U8U N;  2CM9 A;  3TGA A;  4OKA A;  2R4N A;  3PP6 A;  1EI5 A;  4Y59 A;  1T16 A;  4KCA A;  4C00 A;  3T0S A;  3PGU A;  2OF8 A;  2Z4H A;  2RTD B;  5B2A O;  1OSM A;  4O3X B;  1SWN A;  3UEV A;  1T8V A;  4IB9 A;  2QCB A;  1E02 A;  2UYW A;  1ICM A;  1QY0 A;  2WSJ A;  1SWS A;  1OEE A;  2HKD A;  3U9P C;  3D96 A;  1W6F A;  4NW4 A;  1VWH B;  4IL6 O;  1YWC A;  1ZNE A;  2AT0 X;  1YWB A;  2KZ7 B;  3S5V A;  2F1C X;  2RTK A;  2Q4N A;  3UPG A;  2X9K A;  4WFV A;  4BVM A;  5DL8 A;  4GH7 A;  3AA6 A;  2DJF A;  2FHL A;  4I3B A;  1VWO B;  5H9K A;  4FZM A;  1K24 A;  1RSU B;  3HOE A;  4I3D A;  3FLL A;  4ZH6 A;  2AT6 X;  1DZJ A;  4BCS A;  4N7D A;  2X55 A;  1HQP A;  1B8E A;  1VWF B;  2BLG A;  4RLC A;  2MHD A;  2Y2X A;  3CBS A;  6PRN A;  3KZI O;  3ZW1 B;  2R4L A;  1VWN B;  1X8U A;  3HWG A;  1VWJ B;  4YDB A;  1EW3 A;  3FW4 A;  4K3B A;  5IO7 A;  2LBV A;  1ACD A;  3D9W A;  2XMX A;  1AVG I;  2RTB B;  1SWD A;  3A0H O;  4F4B A;  5H8T A;  2W2B A;  3PEC A;  1O1V A;  3EW2 A;  3S5X A;  4RJW A;  5HTD A;  2XST A;  1G7N A;  3NP1 A;  1AVD A;  1ERX A;  2PI3 O;  4YGZ A;  4XMH A;  4GET A;  1NQM A;  3BX7 A;  2ACO A;  1BBP A;  4FQB B;  5GV0 A;  5IYU A;  3F9D A;  1EQD A;  2ALL X;  2MHL A;  4YFQ A;  5L8I A;  3LK4 2;  1IZN A;  3WJC A;  5EEE A;  3ZW0 A;  1FEM A;  4O3Z A;  1ERB A;  2Y0H A;  2JMB A;  4I95 A;  1UYO X;  3RDS A;  1CBR A;  4EEJ A;  3POQ A;  3DZM A;  1CBS A;  4ORX A;  2IZB A;  1KL5 A;  4IBA A;  5KHP A;  3VZW X;  5AJC A;  1VWQ B;  5G38 A;  3FEL A;  3O2Y A;  2RTN B;  3B2H A;  1LUQ A;  1UZ2 X;  1YIV A;  4Y5D A;  1ZND A;  2IZF B;  5H2F O;  3FIQ A;  3A0B O;  1BT9 A;  5B5F A;  3NX2 A;  4HPC A;  1SLG B;  5BVT A;  4CPE A;  2WWP A;  4RL9 A;  2Q2P A;  3AEH A;  1BJ7 A;  3EBW A;  2FR2 A;  1JZU A;  3VE1 A;  4TKB A;  1RXJ A;  2FTB A;  1X8O A;  1TOU A;  3WZP A;  5L8O A;  4NV7 A;  4ZHD A;  4GJV A;  3G7G A;  4AZN A;  3PRN A;  2CBS A;  3VU1 A;  1SWQ A;  4BOE A;  3T6L A;  2AKQ A;  2X34 A;  5ADX K;  2F73 A;  4CK4 A;  4AZQ A;  1SWR A;  1QAB E;  3FEP A;  3U0D A;  2JQY A;  2FGQ X;  3WI5 A;  2Y0K A;  8PRN A;  5D48 A;  4RJX A;  2I5V O;  4EFG A;  4BBO A;  3U03 A;  2A5C A;  1X8N A;  3ZW1 A;  3TGC A;  2MNH A;  5T5F A;  4D64 A;  1S5L O;  4LSH A;  2C4I A;  4M6S A;  1U17 A;  4JGL A;  4AZR A;  3DA3 A;  3POU A;  1SY3 A;  1A2D A;  1GXA A;  4O49 A;  3NQK A;  1SXY A;  5D8J A;  4YFP A;  1N9Y A;  2J1N A;  1VYO A;  3ZUI A;  4IRW A;  3SZD A;  4U46 A;  1JMZ A;  1ZHW A;  1QJP A;  4IB8 A;  1URE A;  2G5L A;  1KL4 A;  3RWX A;  1SWP A;  1LF7 A;  4QZU A;  4ZR2 A;  1JJX A;  1GX3 A;  2WEW A;  4C4V B;  3AA1 B;  1GGL A;  4I9R A;  3C77 X;  1Y55 X;  3EM0 A;  5DL7 A;  4RUN A;  3WJB A;  2X32 A;  1QWD A;  3VG2 A;  1LIF A;  4Z2V A;  5EDB A;  3DA4 A;  1IIU A;  3JCU O;  4AW8 A;  2RTE B;  2IZG B;  3KZA A;  3N91 A;  2CZU A;  4ZJ0 A;  1X8P A;  1XCA A;  4NNS A;  1KZX A;  2Y3E A;  2WR6 A;  1XKI A;  1VWC B;  2Y0L A;  2L67 A;  4K3C A;  2R89 A;  1PMP A;  1NP1 A;  1Y9L A;  3WZN A;  1SMP I;  2ODJ A;  1FEN A;  4MEE A;  1NQN A;  5F6B A;  1VWI B;  3SLT A;  2YMS A;  5AFU K;  2AH7 X;  1OBQ A;  5IXG A;  4TJZ A;  7PRN A;  5B11 O;  1LEL A;  3CR6 A;  4OMX A;  1QJ8 A;  2F1V A;  1HXL A;  2EU7 X;  5KAF O;  3SZJ A;  5IRW A;  2QMI A;  3WZQ A;  2N93 A;  1JV4 A;  2UZ2 A;  3BY0 A;  3VE2 A;  1STP A;  5B66 O;  5LKF A;  3QKG A;  1BH3 A;  1QY1 A;  4XME A;  3LHN A;  1RXH A;  3LK2 B;  4CV7 A;  3FYX A;  3B2K A;  2IZL B;  5JD2 A;  2Q9S A;  3RSW A;  2RTM A;  5LJK A;  4LKT A;  3BU1 A;  1QG5 A;  4AZL A;  3NSG A;  3OJY C;  1H91 A;  4FQE A;  3FW5 A;  1SLE B;  4Y0R A;  1DC9 A;  4GCP A;  3WVM A;  1JBH A;  4JO6 A;  3NBX X;  3C5O A;  1LKE A;  4B55 A;  5B5E O;  1GM6 A;  1CRB A;  4GGR A;  4ALB A;  3E3C A;  1E54 A;  2ASN X;  4YBU A;  3D97 A;  2A2G A;  1QFT A;  2QO5 A;  1SY2 A;  2Z4I A;  4FRX A;  2AXT O;  1SWO A;  4R0B A;  2POR A;  1HBP A;  1JYJ A;  1S2P A;  1KL3 A;  3FA8 A;  2RTL A;  4C4V A;  4LZU A;  3AA1 A;  2JGS A;  4NYR A;  1IW2 A;  1ZHZ A;  2JOZ A;  4OEL A;  4IMN A;  4YH0 A;  1X89 A;  4HFO A;  5DL5 A;  2RCT A;  1I4U A;  2Y32 A;  4I9S A;  1ZHY A;  1NDJ A;  3AKM A;  3I0A A;  2A2U A;  3NQ3 A;  1BXW A;  4IB7 A;  1VWA B;  1SRE A;  3SYS A;  3WZO A;  4GRJ A;  1LPJ A;  3DTQ A;  2BHV A;  1KQX A;  3PGR A;  2JU7 A;  1PM1 X;  2OFB A;  3FA7 A;  1BSO A;  3PK2 A;  4EDE A;  2ZFG A;  1DFV A;  1EPB A;  1THQ A;  5F2B A;  4CDC A;  4ZGF A;  3FYF A;  4BX6 A;  4CPH B;  4FES A;  1MVG A;  2KC0 A;  1Y52 X;  1DV9 A;  3LV4 A;  4K19 A;  3X00 A;  5CSE A;  4INN A;  1BRQ A;  1RXK A;  1GT4 A;  4CPF A;  2A8G A;  2F09 A;  3FEN A;  1VYG A;  4TKJ A;  2G8C O;  1BLR A;  1E00 A;  2Q39 A;  3WJE A;  1PTS A;  4GJS A;  1B0O A;  5HZ6 A;  3AA0 B;  4TQ2 A;  2OVE A;  2CBR A;  3P02 A;  3GAQ A;  1FJ1 E;  5F7G A;  2ZAG A;  2RTC B;  3HWB A;  1P4T A;  4FBO A;  3LK2 A;  3T2W A;  3CWK A;  2OL8 O;  4FZL A;  4O3Y A;  1N43 A;  3NQ9 A;  2FLJ A;  4KH8 A;  4CDD A;  2K0L A;  1OPA A;  4Z2P A;  1RST B;  4GCQ A;  1SXU A;  1W4T A;  2F1T A;  1OEJ A;  4NYQ A;  4MVL A;  3KFG A;  1WBI A;  5JDP A;  5F1E A;  2ZAI A;  2NND A;  1A3Y A;  4O9S A;  2JW1 A;  2XTR A;  3JQO A;  4IAX A;  4GCS A;  2O4V A;  3FR5 A;  3ZI8 A;  3PQS A;  2HZR A;  4AYH A;  4GUZ A;  4ZHH A;  2RTG B;  2RTR B;  4A60 A;  1YWD A;  1S44 A;  1VWM B;  3BRN A;  1GFP A;  1SWU A;  1ICN A;  4GF4 A;  1L6M A;  3K19 A;  5L3Y A;  5LJC A;  5EZ2 A;  1PHO A;  3CQR A;  4GGT A;  2J4U P;  3RE6 A;  4MIR A;  3A2S X;  2IZJ A;  2RCQ A;  2W81 C;  2FGS A;  3RDU A;  1MX8 A;  1SWF A;  1QFV A;  1SWG A;  2MM3 A;  5FFH A;  2OL6 O;  4YCH A;  4CSB A;  1ZNL A;  2VDF A;  1B4M A;  4YDA A;  3RDQ A;  1HXU A;  3BRY A;  3APV A;  5FQ7 E;  2HLV A;  2QOS C;  1GX8 A;  1TVQ A;  4IMO A;  1STS B;  5AEO A;  3S26 A;  3FDC A;  4ZCB A;  4AYM C;  3VY9 X;  5PRN A;  2PY1 A;  3P6C A;  2HZQ A;  4ES7 A;  4GKC A;  4CPH A;  3T20 A;  3EMN X;  2L5P A;  3JS1 A;  4ZHF A;  2X45 A;  2P8G A;  1BSY A;  3QQ2 A;  3VY8 X;  3RDO A;  3NAD A;  1HXZ A;  5FAZ A;  1Z24 A;  4TKH A;  1SXW A;  2BS5 A;  3EC5 A;  2RTF B;  4XMD A;  4GGZ A;  3AAA B;  1MM4 A;  5ADX L;  1O8V A;  1LDO A;  1X71 A;  5BVS A;  3AA0 A;  1GT3 A;  2K23 A;  2IZK A;  3KQ0 A;  5HBS A;  1IFC A;  3HWD A;  1LCZ A;  5EED A;  2JU8 A;  2XE5 A;  4GNY A;  3P6D A;  4DCB A;  4D6A A;  1VWE B;  2RTI B;  4TLJ A;  3NR3 A;  3EBK A;  2IZE B;  2OZQ A;  2AT3 X;  1QJ9 A;  1JIW I;  1ZNK A;  4GE1 A;  1JJJ A;  3JSQ A;  3HWE A;  1GFN A;  2GJ5 A;  4LQZ A;  3V8U A;  4FT6 A;  2AT5 X;  3SOT A;  1MM9 A;  4MVE A;  2LHF A;  4AKR B;  5IO6 A;  1Y0G A;  1N9M A;  5HWZ A;  5G26 A;  4GDA A;  3APU A;  4A1H A;  5B27 A;  2POA A;  1JJU A;  1LNM A;  2X8T A;  3ELX A;  4QQ1 A;  1P6P A; 
#chains in the Genus database with same CATH homology
 5F6Z A;  2JMM A;  4G75 A;  1QY1 A;  4XME A;  3CQN A;  1ZNG A;  1ZHX A;  3PED A;  1KOI A;  3LHN A;  2G7B A;  3LK2 B;  4CV7 A;  3ZUO A;  3FYX A;  1S7D A;  3B2K A;  2NP1 A;  1HXX A;  4YKM A;  4ORW A;  5D5D A;  2Q9S A;  3RSW A;  2FS7 A;  4ORY A;  4O4X A;  4AFK A;  2O62 A;  4LKT A;  3BU1 A;  5DG4 A;  4QYN A;  3ZWE A;  1QG5 A;  2CM4 A;  3STM X;  5LJK A;  4AZL A;  3NSG A;  5D45 A;  2OVD A;  3PPT A;  3KFI A;  5H9N A;  3OJY C;  4U8U N;  1H91 A;  2CM9 A;  3TGA A;  3FW5 A;  4A1Y A;  2GTF X;  2A0A A;  3PP6 A;  1EI5 A;  4Y0R A;  3HTY A;  1ORM A;  1DC9 A;  1LIB A;  4D6B A;  4GCP A;  3WVM A;  3BLG A;  3VG6 A;  1MM5 A;  1ZNH A;  1OEK A;  1CBI A;  4KCA A;  1JBH A;  3SY7 A;  3T0S A;  3NBX X;  3WJD A;  1Q9G A;  3C5O A;  1LKE A;  4I6S A;  4B61 A;  3C76 X;  2LKK A;  4EXZ A;  1GM6 A;  2Z4H A;  1I04 A;  3OE3 A;  1CRB A;  3DSZ A;  3K3L A;  4ORU A;  2GTL M;  3LK3 B;  3VG7 A;  4ALB A;  1GT5 A;  1FE3 A;  3CMP A;  1NP4 A;  3E3C A;  1G5W A;  1OSM A;  1E54 A;  2XE1 A;  3STK A;  5AFU L;  2ASN X;  4O3X B;  1IKE A;  1E06 A;  3UEV A;  4MVI A;  1O1U A;  1T8V A;  4IB9 A;  4UU3 A;  2MO5 A;  1JYD A;  1HN2 A;  3I17 A;  4QGW A;  4YBU A;  3POR A;  1E02 A;  4ZHC A;  1ICM A;  3D97 A;  2A2G A;  1MX7 A;  3Q6L A;  4TNN A;  1DF3 A;  1QY0 A;  2N2M A;  3S60 A;  3EYC A;  1YS5 A;  3C78 X;  1QFT A;  2QO5 A;  3RBH A;  2WSJ A;  1SY2 A;  2Z4I A;  1OEE A;  2CZT A;  4FRX A;  3KVD D;  3U9P C;  1EUO A;  3VG4 A;  3D96 A;  4R0B A;  2POR A;  1HBP A;  1JYJ A;  5H9L A;  1S2P A;  4NW4 A;  3HWF A;  3FA8 A;  2MWH A;  4AZP A;  1YWC A;  3ZW2 A;  1ZNE A;  2AT0 X;  1YWB A;  3P24 A;  4QRL A;  3S5V A;  2KZ7 B;  4EQA C;  4ML7 B;  2Q4N A;  4LZU A;  3FEK A;  3AA1 A;  3UPG A;  4WFV A;  4GU8 A;  1AEL A;  1VPR A;  1IW2 A;  4NYR A;  1ZHZ A;  4BVM A;  2JOZ A;  5DL8 A;  4YGG A;  4GH7 A;  3AA6 A;  4IMN A;  3APW A;  1ADL A;  4YH0 A;  1X89 A;  4YCE A;  2M07 A;  3QRC A;  3WJF A;  4I3B A;  3VZU X;  4N59 A;  1KT4 A;  4HFO A;  5DL5 A;  3L4R A;  5H9K A;  2RCT A;  2OMF A;  1I4U A;  1ZHY A;  4I9S A;  4O4U A;  4FZM A;  3AKM A;  3I0A A;  2A2U A;  3NQ3 A;  3O0E A;  5BVQ A;  3NPO A;  4KC7 A;  1BXW A;  4IB7 A;  1QQS A;  3HOE A;  2XE2 A;  1TW4 A;  2HMB A;  3B2I A;  3FLL A;  3APX A;  4I3D A;  5D4A A;  4ZH6 A;  3AAA A;  4HPB A;  2AT6 X;  1DZJ A;  3QRA A;  4N7D A;  1HQP A;  1B8E A;  4LKP A;  3SYS A;  4ON1 A;  4QNI A;  2BLG A;  5LJH A;  4RLC A;  3TF6 A;  2MHD A;  2Y2X A;  1LIC A;  3CBS A;  2KXP A;  6PRN A;  1DZK A;  3ZW1 B;  4GRJ A;  1LFO A;  1X8U A;  1LPJ A;  3DTQ A;  2BHV A;  1KQX A;  4LSI A;  4AKM A;  3VG5 A;  4ZFX A;  3FA6 A;  4KR4 A;  2LFO A;  3BU9 A;  3AAE B;  4OS8 A;  1IFB A;  3HWG A;  2KZ7 A;  2KD2 A;  2WQA E;  2KTD A;  2JU7 A;  2X8F A;  4YDB A;  3WJG A;  4AZO A;  1EW3 A;  3STN A;  1PM1 X;  3FR2 A;  3FW4 A;  3SZV A;  1BWY A;  2PRN A;  4YFR A;  5IO7 A;  1HBQ A;  3FA7 A;  1FTP A;  2LBV A;  3BSZ E;  1BSO A;  3FMZ A;  4EDE A;  1ACD A;  2ZFG A;  4I3C A;  2W2F A;  2XMX A;  1DFV A;  1AVG I;  1EPB A;  1THQ A;  4E1T A;  4F4B A;  5FEN A;  5H8T A;  2K4T A;  2R74 A;  2ANS A;  4OS3 A;  2W2B A;  2XG6 A;  2QO6 A;  1EXS A;  1R0U A;  3PEC A;  3T1D A;  1O1V A;  5HAE A;  2FWV A;  1QY2 A;  3S5X A;  4RJW A;  1OPB A;  5HTD A;  2X46 A;  1SXX A;  2XST A;  4FMS A;  4ZGF A;  3FYF A;  4KT5 A;  4FES A;  1MVG A;  1G7N A;  2KC0 A;  4D5U A;  1YWA A;  1DV9 A;  3LV4 A;  3NP1 A;  4K19 A;  1ERX A;  4INN A;  3LK4 1;  1BRQ A;  2RQ0 A;  4YGZ A;  4XMH A;  1ZRY A;  2OFR X;  4GET A;  2NNE A;  4FUV A;  3GP6 A;  3OD9 A;  2OVA A;  3BX7 A;  2ACO A;  1BBP A;  4FQB B;  1GT4 A;  4FZN A;  5GV0 A;  3HWB A;  2AMM X;  5IYU A;  2F09 A;  2M4L A;  3HW9 A;  2JN3 A;  2R56 A;  3F9D A;  4AYD C;  3FEN A;  2M06 A;  1FDQ A;  4AKR A;  1VYG A;  4TKJ A;  1EQD A;  4YKO A;  4U8U M;  5F58 A;  1KT5 A;  4JCH A;  2ALL X;  2HYS A;  1BLR A;  1E00 A;  2MHL A;  2K62 A;  1N0S A;  4C69 X;  3UEU A;  2Q39 A;  3B2L A;  4ID2 A;  2NNQ A;  3WJE A;  1GKA B;  4YFQ A;  1MUP A;  2A13 A;  1B0O A;  5L8I A;  2W80 C;  3LK4 2;  1IZN A;  2LFU A;  4M7M A;  5IO5 A;  4AZM A;  3WJC A;  5EEE A;  2FR3 A;  3ZW0 A;  1SY1 A;  4XMC A;  5HZ6 A;  3AA0 B;  5HA1 A;  4TQ2 A;  5AQ6 A;  3FA9 A;  4FSO A;  2A3F X;  2OVE A;  3ZZV A;  2CBR A;  3P02 A;  3GAQ A;  4AYI D;  5F7G A;  1FEM A;  2ZAG A;  1KXO A;  1ERB A;  4FGI B;  2JMB A;  1ML7 A;  1Y9T A;  4O3Z A;  4I95 A;  1OBU A;  3IFB A;  5H9A A;  5C0N A;  2WEX A;  1P4T A;  4FBO A;  3LK2 A;  2HNX A;  3CWK A;  1HMR A;  2BT9 A;  5EDC A;  3HOL A;  1CBR A;  4EEJ A;  3VZT X;  3POQ A;  4FZL A;  4GK9 A;  1HMT A;  4MIS A;  4O3Y A;  1CBS A;  4ORX A;  3NQ9 A;  1H6S 1;  4IBA A;  2AT8 X;  2FLJ A;  4WBK A;  5HCE C;  4KH8 A;  4PJ2 A;  3D95 A;  2K0L A;  4HPA A;  5KHP A;  3B2J A;  1EIO A;  1YP6 A;  3VZW X;  1OPA A;  5AJC A;  3UEX A;  5L8N A;  1SY0 A;  4ARH A;  4GCQ A;  1SXU A;  2F1T A;  1OEJ A;  2YG2 A;  4NYQ A;  2KT4 B;  3FEL A;  3F6Z B;  3IA8 A;  3O2Y A;  4OMW A;  4MVL A;  2RA6 A;  2W2A A;  3KFG A;  4JFB A;  4N58 A;  3B2H A;  2XE3 A;  5JDP A;  3BDR A;  4N7C A;  5F1E A;  2ZAI A;  1UZ2 X;  3O22 A;  1YIV A;  2NND A;  1A18 A;  1A3Y A;  4O9S A;  1ZND A;  2JW1 A;  2XTR A;  3JQO A;  3BX8 A;  4IAX A;  2ERV A;  4GCS A;  3FIQ A;  3LK3 A;  4HWM A;  4ORR A;  2O4V A;  2Q2M A;  3FR5 A;  1BT9 A;  2KDY A;  2Y7S A;  3ZI8 A;  4A8Z A;  3NX2 A;  4HPC A;  1KQW A;  3AKN A;  2QO4 A;  1GFQ A;  4O4S A;  1YUP A;  3PQS A;  1RBP A;  2HZR A;  4AYH A;  5BVT A;  5HCC C;  5KID A;  4HPD A;  4ZHH A;  2L9C A;  4ORS A;  2MJI A;  2WWP A;  4U9C A;  2G78 A;  4NLJ A;  4A60 A;  4Y0P A;  1YWD A;  2QM9 A;  5K06 A;  1S44 A;  2FT9 A;  1PEE A;  3AA7 B;  4RL9 A;  2Q2P A;  3BRN A;  1BJ7 A;  1GFP A;  3EBW A;  2X27 X;  1ICN A;  1VYF A;  2FR2 A;  1JZU A;  2YPV A;  3VE1 A;  1PBO A;  3MX7 A;  4TKB A;  4GZV A;  2OVS A;  4GF4 A;  2FTB A;  3VPJ E;  1EPA A;  5KIC A;  1GX9 A;  3VY9 X;  4Z3T A;  4GHB A;  4NLI A;  1L6M A;  1TOU A;  1GT1 A;  1X8O A;  3K19 A;  5L8O A;  4ZHD A;  5LJC A;  3TZG A;  2FRS A;  5EZ2 A;  1PHO A;  3CQR A;  1IKJ A;  3RKG A;  2J4U P;  3G7G A;  4MIR A;  4PSQ A;  4AZN A;  5DL6 A;  4QAE A;  1NGL A;  1SA8 A;  3A2S X;  1B56 A;  3PRN A;  2RCQ A;  1KT3 A;  2CBS A;  3VU1 A;  2W81 C;  4BOE A;  2AKQ A;  3UEW A;  4Y0S A;  5ADX K;  2F73 A;  1MX8 A;  3WI4 A;  4CK4 A;  2IFB A;  1QFV A;  2GTL O;  4AZQ A;  3FEP A;  1QAB E;  4QZT A;  3U0D A;  4YBP A;  3SAO A;  2MM3 A;  4KC8 A;  2FGQ X;  3WI5 A;  2Y0K A;  4WHI A;  5FFH A;  8PRN A;  4YCH A;  2FS6 A;  2WQ9 A;  1OBP A;  5D48 A;  1GFM A;  2R73 A;  5LJB A;  3JTY A;  4RJX A;  5FQ6 E;  1KGL A;  4CSB A;  4EFG A;  1BSQ A;  5DPQ A;  3U03 A;  3P6G A;  1X8N A;  1DZP A;  3ZW1 A;  1ZNL A;  1B4M A;  4YDA A;  3TGC A;  2LB6 A;  3UAQ A;  2MNH A;  1HXU A;  5T5F A;  4D64 A;  3SY9 A;  4LSH A;  3AAE A;  4XNK A;  4M6S A;  3APV A;  1U17 A;  3MBT A;  4JGL A;  5FQ7 E;  2HLV A;  1FEL A;  3BS2 A;  4AZR A;  1KZW A;  3DA3 A;  3POU A;  3KFF A;  2QOS C;  3MVF A;  4E1S A;  1GX8 A;  2JU3 A;  1TVQ A;  1SY3 A;  2X8S A;  4IMO A;  4QYP A;  4FSP A;  3UU2 A;  5AEO A;  4FOZ A;  2ACP X;  4ZHG A;  4AYM C;  1A2D A;  1GXA A;  4O49 A;  3TGB A;  3NQK A;  3S26 A;  4IB6 A;  3G7X A;  5LJG A;  1SXY A;  4ZCB A;  5D8J A;  1AB0 A;  4YFP A;  2QTK A;  1G85 A;  2J1N A;  3ZUI A;  2PY1 A;  3WXQ A;  3P6C A;  4COT A;  2XTQ A;  4G76 A;  2WUT A;  1I06 A;  5PRN A;  2L68 A;  1D2U A;  4IAW A;  3ELZ A;  3HK1 A;  3SZD A;  3GE2 A;  2HZQ A;  1LID A;  3CBC A;  3RBY A;  4ES7 A;  2YNK A;  1ZHW A;  3POX A;  4GKC A;  1QJP A;  4IB8 A;  2KW1 A;  1URE A;  3T20 A;  1EII A;  3EMN X;  3RWX A;  2L5P A;  3JS1 A;  1LF7 A;  1RLB E;  2ZLD A;  4KRA A;  1X8Q A;  4ZHF A;  5EE2 A;  4QZU A;  4ZR2 A;  4AUI A;  2LBA A;  1JJX A;  2WEW A;  2X45 A;  3AA1 B;  2G79 A;  2P8G A;  5D47 A;  1EAL A;  1BSY A;  1GGL A;  5HZ5 A;  5LJD A;  1ZHT A;  5AJB A;  3VY8 X;  4I9R A;  2RN4 A;  4XNL A;  4GDZ A;  3AA6 B;  2GTL N;  3C77 X;  3NAD A;  4WFU A;  3P6F A;  1HMS A;  2OFM X;  3SYB A;  3VG3 A;  2BS6 A;  4XMF A;  3EM0 A;  1KT6 A;  5FAZ A;  4YMY A;  4PUX A;  5DL7 A;  4FBV A;  5CYB A;  4ZGU A;  1Z24 A;  4RUN A;  1SXW A;  3O19 A;  4TKH A;  2BS5 A;  4L1N A;  4XMD A;  3WJB A;  1GKA A;  1QWD A;  1T68 X;  3AAA B;  1MM4 A;  1U0X A;  3VG2 A;  5JR8 A;  4BUM X;  5ADX L;  1LIF A;  2RD7 C;  1O8V A;  1G90 A;  5EDB A;  1X71 A;  1HXT A;  3DA4 A;  5BVS A;  3T24 A;  3AA0 A;  3TZS A;  1GT3 A;  1IIU A;  2Y0H A;  4IAB A;  3WOV A;  2K23 A;  4Y0Q A;  4AW8 A;  2KXP B;  5BYP A;  2FGR A;  2KTS A;  2DM5 A;  3KQ0 A;  3KZA A;  3N91 A;  1U18 A;  2CZU A;  4ZJ0 A;  4RLB A;  5EPQ A;  4L3R A;  1I05 A;  1X8P A;  1XCA A;  5HBS A;  4ODD A;  1IFC A;  5HA0 A;  5HZQ A;  4NNT A;  4UU2 A;  3HWD A;  5FQ8 E;  4NNS A;  1KT7 A;  5EED A;  5CE4 A;  1KZX A;  1MDC A;  4QGX A;  1PRN A;  1TOW A;  2N2L A;  2JU8 A;  2XE5 A;  4GNY A;  4LSF A;  4GNW A;  3P6D A;  3D4R A;  2WR6 A;  1XKI A;  3PH6 A;  2E4J A;  3RZY A;  4D6A A;  4KR8 A;  1ALB A;  1CJ5 A;  4QGV A;  3P6H A;  4RUU A;  2AL0 X;  3KFH A;  2L67 A;  2Y0L A;  4LSE A;  1G74 A;  4TLJ A;  3NR3 A;  4NP1 A;  3EBK A;  3PH5 A;  1TXL A;  5LJE A;  2OZQ A;  2AT3 X;  1QJ9 A;  1DZM A;  1PMP A;  4LZV A;  1JIW I;  4DQ3 A;  1ZNK A;  5FVN A;  1NP1 A;  4U8U O;  2LA7 A;  3P6E A;  5HTE A;  1Q9F A;  1Y9L A;  4GE1 A;  1SMP I;  5B29 A;  1T0V A;  3NX1 A;  1FEN A;  3OBL A;  5HZ9 A;  1JJJ A;  2ODJ A;  4AYE C;  5F6B A;  3JSQ A;  3HWE A;  2YMS A;  1GFN A;  5AFU K;  3H3I A;  1E5P A;  4AYN A;  2GJ5 A;  4LQZ A;  3V8U A;  4FT6 A;  3WBG A;  3EMM A;  4ZH9 A;  4FBR A;  2AT5 X;  2AH7 X;  2GE4 A;  1YP7 A;  1OBQ A;  3F8A A;  3SOT A;  3ZQ3 A;  1BEB A;  1GFO A;  4TJZ A;  7PRN A;  4MVE A;  4YGH A;  5LKE A;  2LHF A;  4AKR B;  3FR4 A;  5IO6 A;  3CR6 A;  4OMX A;  4XMG A;  4BQU A;  1QJ8 A;  2F1V A;  1BH3 A;  2EU7 X;  5HWZ A;  4DQ4 A;  4OS0 A;  4FRT A;  4O3W A;  1CBQ A;  5G26 A;  3APU A;  1AQB A;  1OPF A;  4A1H A;  2QMI A;  5B27 A;  1BM5 A;  2N93 A;  2POA A;  2GC9 A;  1JV4 A;  3AA7 A;  1LNM A;  3BY0 A;  5HCD C;  2X8T A;  4U3Q A;  1IZN B;  3ELX A;  1D3S A;  3VE2 A;  1LIE A;  1A57 A;  5LKF A;  4ALO A;  1MPF A;  3PQU A;  3ZW0 B;  4QQ1 A;  2XKL A;  4MVK A;  3QKG A;  5HZ8 A;  4D65 A;  4O4O A;  1P6P A;  4KII A;  1BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...