4U9CA

Structure of the lbpb n-lobe from neisseria meningitidis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
286
Chain Sequence
PVNRPAVGAAMRLPRRNIASYKPDKHQAEEHLPLKEKDILFLDGTLKEQADKLKKKINERYSDVRVITSKKEEEKYQYQFVRAGYVFTRAEGKDNEKEKTSEFVNRFSYDGFVYYSGERPSQSLPSAGTVQYSGNWQYMTDAKRHRTGSTDLGYTTYYGNEIGATSYEARDADDREKHPAEYTVDFDNKTLNGKLIKNQYVNPNEPKKPLTIYDITATLDGNRFTGSAKVSTEVKTQHADKEYLFFHTDADQRLEGGFFGDNGEELAGRFISNDNSVFGVFAGKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of lactoferrin-binding protein B from Neisseria meningitidis suggests roles in iron acquisition and neutralization of host defences.
pubmed doi rcsb
source organism Neisseria meningitidis cu385
molecule tags Lactoferrin-binding protein
molecule keywords Lactoferrin-binding protein B
total genus 89
structure length 286
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.250 Mainly Beta Beta Barrel Lipocalin Lipocalin 4u9cA01
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4u9cA02
3HOEA 2W80C 1YS5A 2W81C 3PQUA 4O3ZA 4O4UA 2KDYA 4O49A 2LFUA 4O3XB 3VE2A 4QQ1A 2YPVA 4Z3TA 5T5FA 4O3YA 4AYID 3KVDD 3VE1A 4AYMC 3PQSA 4AYEC 2Y7SA 3V8UA 5EE2A 4AYNA 4AYDC 3HOLA 4O3WA 2KC0A 3UAQA 4O4XA 4U9CA
chains in the Genus database with same CATH superfamily
2OY5O 3WJEA 1X8NA 4LQZA 2FS7A 5G26A 3RDQA 2G79A 1KL3A 1VWEB 1LICA 4RJXA 5D4AA 1VWQB 5G39A 3B2IA 3QRAA 2X46A 4JO6A 4K3CA 4KC7A 2QOSC 4YGGA 1DF8A 1MM4A 4IBAA 3F6ZB 1KT5A 5BVSA 3BU9A 2ALLX 1SWSA 2RTCB 3RDXA 1EPBA 2CAMA 3NADA 1R0UA 1SWJA 1FEMA 4Y0QA 3AA0B 1VWCB 5F6BA 5C0NA 4JHQA 1IFCA 1E2TA 3T1DA 3A2SX 5KIDA 3NP1A 2FKGA 3AKNA 4FESA 4N7DA 4CTDA 1EW3A 1NQMA 2FGSA 3HWEA 1SY0A 2CBSA 4PJ0O 1JQPA 4CDEA 2YMSA 2ASNX 3STNA 2QMIA 3Q34A 2WJQA 1Y9TA 4NV8A 1LPJA 2FGQX 4FZMA 3B2LA 1DZKA 3WI4A 1KZWA 3OJYC 5AQ6A 3WJGA 1S44A 4MVKA 1YS5A 1MEPA 3IFBA 4IMOA 2FGRA 4GKCA 4LZUA 4ID2A 2QOMA 2RTLA 1XCAA 2G5LA 5D47A 4MISA 2Q4NA 4ALBA 2HLVA 2KTDA 3POQA 1NDJA 4GD9A 3KVNA 5LKEA 1EIOA 1SMPI 2RN4A 2Y2XA 1TXLA 3PPTA 3UAQA 3PGRA 2ANSA 2GJ5A 3A0BO 1JMZA 1SWFA 4GH7A 2JGSA 1OEJA 1LCWA 2WEWA 2KDYA 3FA8A 3EBKA 4OMWA 2X56A 4XMDA 1NQNA 4LKPA 4Z6JA 3AA7B 2OFMX 1VWAB 2MM3A 1G85A 2BC3A 1GFQA 3FMZA 1LCVA 1ALBA 1JBHA 4I6SA 1LIFA 1OEKA 4GCQA 5GTHO 4I9SA 5IO6A 2XE3A 2WEXA 5D48A 3DWOX 3A0HO 4I9RA 2Z4IA 1T1LA 1W6FA 2Y32A 1SLEB 1SY3A 4ZHFA 5JD2A 2N93A 2IZLB 1LDOA 5F6ZA 1QQSA 5AJCA 3DA4A 1B0OA 1VWKB 2A5CA 1MK5A 2FS6A 4MIRA 1OEEA 4NYQA 1GKAB 5K67A 5HZQA 3PQUA 4OS8A 1VWHB 4DQ3A 2N2MA 4KR4A 3ZW2A 1SRIA 3WOVA 3KZAA 2WWPA 1HXTA 1ZHZA 4C5PA 1U0XA 3I17A 5FQ8E 3EW1A 2WSJA 2X27X 2ACOA 1ZNEA 1MM9A 5L8OA 1OBQA 3FYXA 3RSWA 2FTBA 3NSGA 4RUUA 1GX8A 4GJSA 1OSPO 1SWDA 1VWRB 2J1NA 3HWFA 3WXQA 1DF3A 2Y0KA 4WHIA 3VG4A 4WFUA 4NNTA 1G5WA 3FYFA 1U18A 2Y7SA 3CWKA 4U46A 4TKHA 3TGBA 1BWYA 1HMSA 2DM5A 5FFHA 5CSEA 1KT6A 4U9CA 4RLCA 1DZJA 4Z28A 4EXZA 1ML7A 3QQ2A 5F1EA 3X00A 5HZ6A 4TKBA 2RTMA 2JN3A 4D5UA 3DTQA 1Y9LA 3EBWA 4QAEA 1SY2A 2M07A 3WJDA 5LJCA 3LK2B 3SZDA 2WUTA 4YMYA 3FR5A 4RJWA 2XMXA 4GDZA 1VWLB 4QGXA 1EXSA 5B66O 5D8JA 1RXJA 1X8QA 3Q6LA 4XMHA 4A1YA 4CPHA 1VWOB 3T6LA 2IZKA 2OL6O 4BCSA 4ZHGA 4AYID 3APWA 5IXGA 4N59A 1GXAA 2A0AA 3AEHA 2GTLO 3SLJA 3T2XA 1LCZA 4TQ2A 3UEWA 1KT3A 2BHVA 3O0EA 5EEDA 4XMEA 5DG4A 4UB6O 4L3RA 3HK1A 1BXWA 3AA6A 4GU8A 5IRUA 3VZUX 3ZW0A 3FIDA 1A57A 3RDUA 2R4OA 2FKJA 4ZFXA 1RXKA 3NR3A 3SLTA 1MUPA 5LKFA 5T5FA 1JZUA 3OBLA 1HXUA 3N91A 3POUA 4R0BA 4QYNA 2POAA 1BH3A 1SRFA 2W2AA 1HXZA 1IJ8A 1LELA 5AFUL 1N0SA 1SRHA 1I06A 2X8FA 2IWWA 3P6HA 5FQ7E 4HPAA 1EQDA 2W2BA 1JJJA 4Y5DA 2AVIA 1X89A 1VWIB 3NQ3A 2QO4A 2X4MA 1E5PA 4DQ4A 4GGTA 4NW4A 4ORYA 3HOLA 3AAEB 4ORSA 2AT3X 3HWDA 5F58A 3RE6A 3E3CA 4K19A 5JR8A 2AT5X 1ICNA 1BM5A 4EDEA 1IKEA 3SY9A 4NP1A 4AYEC 5H9AA 2OYBO 1KOIA 1KT7A 5B5GA 5LJDA 1NP1A 4FRXA 5EZ2A 1MX8A 1CBQA 1BSQA 4Y0SA 2R4NA 4QGWA 1ZHTA 2LB6A 3LK2A 1N9YA 1LDQA 2K0LA 2GTLN 4GNWA 2IZAA 3JS1A 2ODJA 3BS0A 4HPBA 5EPQA 3S26A 4BVMA 3OD9A 3HTYA 3S5XA 2RTFB 1SWBA 4YCHA 3UU2A 4GRJA 3C78X 5HCEC 2JU3A 2RTPB 4ZJ0A 2NNQA 4YBPA 4I3CA 3T6FA 4EKVA 2Q2MA 4FBRA 2G78A 4Z2VA 1SLDB 4IAXA 1IW2A 1E02A 1I78A 2RTAA 1YIVA 2E4JA 3VGWA 1SXWA 2CM4A 4Y0PA 3EM0A 1QWDA 3APXA 2FR3A 3K19A 4AZLA 4CPEA 5LJEA 3O22A 3BDRA 5EEEA 4Z2PA 1SWNA 2XTRA 2PY1A 1EALA 4U8UM 1JMXA 1SWRA 4PUXA 1D2UA 2FR2A 5B11O 3LV4A 1HXLA 4BGFA 2K62A 4RUNA 3RWXA 1FJ1E 1WUBA 3D4RA 5HZ8A 2KW1A 1VWPB 3STMX 2OY7A 1SA8A 4NNSA 3VY8X 1PM1X 2JMBA 1VWNB 3RE5A 5HBSA 4U8UO 2QO5A 5G38A 2GE4A 2IWVA 1HQQA 5DL5A 2DJFA 4CK4A 2OL7A 3HOEA 4AZNA 4GGZA 4NLJA 1VYFA 5HWZA 2IZHB 3EYCA 4O3YA 4XNKA 4BX5A 5KAIO 2IZGB 3SAOA 3CMPA 3WJBA 4KT5A 4IABA 1T0VA 1UYOX 2L67A 4AKRA 2O62A 4ALOA 3FDCA 3WBGA 1VWDB 1YP7A 5B29A 3AKMA 2Q39A 4OMXA 5AEOA 4BUMX 3NQ9A 3PDFA 3PGSA 3ELZA 3WI5A 1HN2A 3DSZA 1JV4A 4GZVA 3PORA 1G74A 2OF8A 5GTIO 4GF4A 2KZ7B 1YWAA 3TGAA 4A8ZA 2K23A 3T2WA 1Y52X 1QY1A 4CDDA 1VYGA 4G76A 2F01A 4ZHDA 4TLJA 3FW5A 1MM5A 2M06A 3CQNA 1E06A 1HMTA 1UZ2X 4ZH6A 4LSEA 4YDAA 2MNHA 1BEBA 4EFGA 4IAWA 7PRNA 1LIDA 2GH7A 1X71A 3P6EA 1OPFA 5ADXL 4YCEA 2OVAA 4I3BA 1BSOA 1TVQA 3SLOA 3CQRA 3CKGA 2FRSA 1H6S1 3KVDD 1X8UA 3JCUO 1SWTA 2R4LA 3LK42 1KFFA 1DZMA 3CBSA 1GGLA 2CBRA 2RCQA 1MDCA 3NQKA 2AT0X 3VU1A 4AZQA 2LBAA 3B2JA 4I95A 4OS3A 1GT3A 2X55A 1MOYA 5BVQA 1N9MA 3PP6A 3PH5A 1ZNKA 1H91A 3ZZVA 4YKMA 3O19A 3AAAA 2RTEB 1ZNHA 1MPFA 4KC8A 2KXPB 3UEVA 1L6MA 5GV0A 5ADXK 4GGRA 2R8AA 2GTFX 4C4VB 2BLGA 2N2LA 1VWJB 3BX7A 4IB6A 1N4JA 3PEDA 1K3BA 4AUIA 5CE4A 3U03A 4TJZA 1FE3A 4DNEA 1ZNLA 4OKAA 3QKGA 3KFHA 2XE1A 1HBQA 4FBOA 3JTYA 2RA6A 4CPIA 4QRLA 3EMNX 1IKJA 1O1UA 2IZJA 1QJ8A 3RBHA 2OVSA 5KICA 3SY7A 1S7DA 4AYNA 1MX7A 3WJFA 5IYUA 4MVIA 4HPDA 5D45A 3EMMA 2AKQA 4C69X 3BRNA 2X32A 3WJCA 3DZMA 1RAVA 1JIWI 3GP6A 2RTIB 2RD7C 4ZHHA 2AXTO 3RBYA 1I9HA 3KFFA 3ZUOA 4FOZA 5AFUK 2F1CX 4EQAC 2A3FX 1PEEA 4RL9A 5HZ5A 3D95A 4ZGFA 1KT4A 2QCBA 4GHBA 2YPVA 4JFBA 4LSFA 5HA1A 3HWBA 3TGCA 5B27A 1ZNDA 4M6SA 1JYDA 3KZIO 3MX7A 1AELA 4O4OA 3MVFA 1BLRA 3VG2A 2G7BA 1SXUA 5L3YA 1QABE 4UU2A 3RY1A 4ML7B 2ERVA 3PF1A 1B4MA 1I04A 2OMFA 1STPA 2L5PA 3APVA 4YGHA 3WVMA 4ORRA 1SWUA 2G8CO 1BRPA 3FR2A 4AW8A 1ORMA 3FA7A 4HPCA 1D3SA 4O4UA 4GJVA 4AZRA 2C1QA 1EIIA 3QRCA 3P24A 3WYQA 1SWHA 3FENA 1QJPA 1T16A 4FRTA 2YNKA 1SLFB 2L9CA 1PBYA 4GNYA 5K06A 3VHIA 2WPUA 1RSUB 3G7GA 3FA9A 4INNA 2R56A 4C4VA 2W2FA 2XE5A 1LKEA 1W5RA 2AT8X 3LK41 1A2DA 3LTWA 3RDOA 3VHHA 4BX7A 4RLBA 2BS6A 3AA6B 2HMBA 1A18A 4Y59A 1ZRYA 4A60A 3AA1A 4XNLA 1VWBB 5LJHA 1A3YA 2R89A 2EU7X 5EDCA 3BY0A 2HZRA 4PSQA 1OPAA 3AUMO 4YFRA 1P6PA 5HCDC 2IZEB 4ARHA 1QY0A 2MO5A 3SZIA 2LFUA 1ZHXA 1LIEA 3STKA 3VE1A 1FENA 1UYNX 3CR6A 3TZGA 1IZNB 4O3WA 1KQWA 4ORUA 3VG3A 3ZW0B 1KL5A 2NNDA 1IIUA 4AZPA 1AQBA 1AVGI 4FGIB 1GX3A 3VZWX 1KL4A 3UEXA 4D6AA 2X8TA 1SLGB 2HKDA 1JJXA 2AL0X 4ORWA 2ZAIA 3FEKA 1SWQA 1XKIA 3U9PC 2KC0A 1SWCA 4IRWA 2FWVA 1UREA 2NNEA 1VWFB 3ZUIA 2XKLA 1ICMA 3VG5A 1G90A 1FELA 4ORXA 3EW2A 4AYMC 2QO6A 4NYRA 4PJ2A 5B2AO 1YWBA 5G3AA 1O1VA 2GC9A 5B3MO 1KGLA 3RKGA 4YBUA 2Z4HA 1I05A 2MWHA 2J4UP 1QFTA 4O3XB 4JCHA 2RQ0A 3LHNA 1QFVA 3SOTA 3V8UA 4CV7A 3NJTA 4N58A 2IZCB 4LKTA 2C4IA 2K4TA 2Y3EA 4ODDA 3C77X 2IZIA 4CPFA 5BVTA 4D6BA 2Y0HA 4CDCA 2X9KA 2Y0LA 4XMGA 5HCCC 3F9DA 5HA0A 4BBOA 8PRNA 1YWDA 1RSTB 2XTQA 4MVLA 3LK3A 3K3LA 3VZTX 1JYJA 4CDFA 2Y3FA 3ZW1A 1S2PA 4Z27A 3AA1B 1DV9A 2C1SA 1STSB 4A1HA 2UYWA 1LF7A 2A2GA 1ZHYA 1SY1A 1U17A 2FLJA 1I4UA 2R74A 2ZSCA 2RCTA 1HQPA 4U3QA 4GUZA 4FQEA 3P02A 2O4VA 3PECA 4IL6O 5BYPA 2JOZA 1E00A 1NGLA 4M7MA 1YWCA 4KIIA 1OSMA 3GE2A 4GDAA 4COTA 1NBXA 3FW4A 4NV7A 2FT9A 3SYBA 2IZFB 4AFKA 4YKOA 4TNNA 2XG6A 1LIBA 3PRNA 2RTGB 4BX7B 1O8VA 3BRYA 3C5OA 5LJGA 2Q9SA 3RY2A 4OEMA 4ZCBA 3D96A 1CBRA 4LZVA 2MHDA 2CM9A 3HWGA 1VPRA 3P6CA 5H8TA 4FBVA 2R88A 4OS0A 2L68A 5IO5A 3LK3B 4QQ1A 3RDSA 4E1SA 2AF5A 3BX8A 4YFQA 4I60A 3ZWEA 2QTKA 4FSPA 4G75A 2OL8O 2ACPX 3P6FA 4GCPA 4HWMA 3VG6A 1TW4A 3BRZA 4IMNA 3F8AA 5DL6A 5CHKA 3ZQ3A 2JU8A 3PGUA 1DZPA 5H2FO 1LFOA 1Y55X 2Q2PA 1CBIA 3SYSA 3WYPA 1VYOA 4YFPA 1FDQA 3MG5A 3HPEA 1BRQA 2F73A 1ERBA 4TKJA 3ZI8A 3VE2A 5FVNA 3EC5A 2RTOB 2JW1A 4ZGUA 4FZLA 4ZR2A 3SZJA 1Q9FA 5FQ6E 4LSIA 3POXA 3BS2A 4AYHA 2OY8A 4QGVA 3T20A 2CZUA 2FHLA 3O2YA 4JNJA 2OFAA 4D64A 2OVEA 1GFNA 3MBTA 2X34A 3GAQA 5IO7A 3L4RA 3TZSA 4K3BA 2WQAE 1ADLA 3FR4A 3D9WA 4YDBA 2FHNX 2WR6A 1PBOA 4N7CA 2LKKA 1TOWA 4B61A 1IFBA 4GETA 4CSBA 5K68A 4F4BA 5HTDA 3WZQA 4O4XA 2W80C 2RTKA 3C76X 3S5VA 1IZNA 4Z3TA 1RLBE 1DFVA 1BJ7A 5HTEA 4PR7A 1HXXA 4GCSA 2OZQA 1THQA 3IA8A 1PHOA 1SWGA 5EDBA 3B2HA 1DC9A 6PRNA 3AAEA 4BX5B 4ZH9A 4MVEA 2OF9A 4CPHB 2X8SA 4KRAA 3KFIA 3CBCA 4XMFA 4GK9A 1GM6A 2OVDA 5IRWA 2RTDB 2MJIA 2XE2A 1SWOA 1G7NA 4BOEA 3MM0A 1AVEA 4MEEA 5TISO 1EPAA 4C00A 2OFBA 2M4LA 1PMPA 2WJRA 4AZOA 3T0SA 2QM9A 1Y0GA 4KH8A 1STRB 4BX6B 3NX2A 1OBPA 4E1TA 2X45A 1QY2A 3FA6A 1ACDA 3NBXX 5DL7A 2ZAGA 5H9LA 1B56A 5L8NA 5B10O 1HY2A 2KD2A 2RTJA 2LA7A 4FQBB 4QYPA 5E79O 4XMCA 4N75A 1LUQA 4IB7A 2MF6A 2IFBA 3S60A 2MHLA 1E54A 5IRAA 1GX9A 1B8EA 1FTPA 4O3ZA 4BX6A 3WZNA 4O4SA 2LHFA 1SWPA 2AT6X 2A2UA 1P4TA 4FMSA 3T24A 1N7YA 2JU7A 1YUPA 3FLLA 1SWEA 1QG5A 5L8IA 1MVGA 3WZPA 1VWMB 2BSZA 4IB8A 3JSQA 3SZVA 4UB8O 3P6GA 1RXHA 3U0DA 4YVBA 3HW9A 1RBPA 4AKRB 2RTNB 1KQXA 4YH0A 1GKAA 1Q9GA 1W4TA 2UZ2A 4QZTA 3SZHA 1EUOA 4AKMA 3AA7A 2I5VO 4EEJA 2A5BA 3WU2O 1ERXA 5HZ9A 4ZHCA 2BT9A 4JGLA 2VDFA 5JDPA 1JJUA 2LFOA 3VHMA 1KZXA 2W81C 1N43A 5D5DA 1GT1A 4Y0RA 2YG2A 1GFMA 4BJ8A 1SXYA 5F2BA 2CZTA 1BBPA 3ZW1B 5LJKA 4FZNA 5KAFO 2RTBB 1KXOA 3APUA 1LNMA 3BSZE 5LJBA 3AA0A 1ZHWA 2OY1O 2F1VA 3OE3A 4U8UN 3PH6A 2GTLM 2HZQA 4DCBA 2KZ7A 4Z2OA 4B55A 2AMMX 3KQ0A 4KCAA 3FIQA 1PTSA 2HYSA 2OFRX 3CKFA 1Y53X 3B2KA 1X8OA 2VFBA 5DL8A 4FSOA 1VWGB 2RTRB 1K24A 1PRNA 1Z24A 2KXPA 4FT6A 2RTQB 4WBKA 2PRNA 5EE2A 1SREA 4FUVA 1TOUA 1SWLA 4WFVA 3FELA 4I3DA 2LBVA 3FEPA 1X8PA 5CYBA 4QNIA 4GE1A 2KT4B 1SRGA 2AH7X 4ES7A 3D97A 3DWNA 2NP1A 2XSTA 4D65A 3RZYA 1WBIA 4N74A 1AVDA 2R4PA 1SRJA 4UU3A 3PQSA 1GFOA 1T8VA 3DA3A 1NP4A 2A8GA 2ZFGA 4ON1A 5F7GA 4KR8A 3BLGA 1CJ5A 2RTHB 3JQOA 4QZUA 3VPJE 2JMMA 5PRNA 3NPOA 4BQUA 3H3IA 2PI3O 2VFCA 3UEUA 2WQ9A 2P8GA 2DJGA 1SWKA 2A13A 3NX1A 5FENA 2R73A 3AAAB 5AJBA 4L1NA 1CBSA 5B5FA 2F1TA 3UPGA 1ZNGA 1GT5A 4HFOA 3G7XA 5B5EO 3I0AA 4AYDC 3RDMA 1BSYA 4NLIA 3KFGA 3TF6A 1GT4A 2WVPA 2PORA 1QJ9A 3VY9X 2IZDB 4O9SA 5FAZA 1EI5A 4O49A 2F09A 5HAEA 1T68X 3BU1A 1NC9A 2HNXA 2BS5A 4YGZA 2JQYA 1SXXA 4IB9A 1OBUA 1OPBA 1AB0A 2ZLDA 3VG7A 3WZOA 1GFPA 5H9KA 4AZMA 4LSHA 3ELXA 1HBPA 1SWAA 1BT9A 2KTSA 2IZBA 5KHPA 1YP6A 5DPQA 3P6DA 4OELA 1CRBA 1HMRA 1S5LO 3PK2A 5H9NA 2I5ZO
chains in the Genus database with same CATH topology
2W2AA 1JYDA 2WQAE 1ADLA 5AFUL 3MX7A 1AELA 3WJEA 4O4OA 3MVFA 3FR4A 1BLRA 1N0SA 1X8NA 3VG2A 4LQZA 1I06A 2FS7A 2G7BA 5G26A 2X8FA 1SXUA 3P6HA 1QABE 4UU2A 4HPAA 2G79A 1EQDA 2W2BA 5FQ7E 1JJJA 4ML7B 4YDBA 1X89A 2WR6A 1PBOA 4N7CA 2ERVA 2LKKA 3NQ3A 1TOWA 4B61A 1LICA 2QO4A 1B4MA 1E5PA 1IFBA 1I04A 4GETA 4CSBA 4DQ4A 2OMFA 4RJXA 4F4BA 2L5PA 5HTDA 4NW4A 3APVA 3HOLA 4ORYA 4YGHA 4ORSA 5D4AA 4ORRA 3WVMA 2AT3X 3AAEB 3HWDA 5F58A 3B2IA 3E3CA 1BRPA 4O4XA 3QRAA 2W80C 3FR2A 4AW8A 4K19A 5JR8A 2AT5X 1ICNA 2X46A 3C76X 3FA7A 1BM5A 1ORMA 4HPCA 4KC7A 4EDEA 1D3SA 4O4UA 1IKEA 3SY9A 3S5VA 2QOSC 4YGGA 1IZNA 4AZRA 4Z3TA 1EIIA 4IBAA 1MM4A 3QRCA 1RLBE 3P24A 4NP1A 3F6ZB 1DFVA 1BJ7A 4AYEC 1KT5A 3FENA 5HTEA 5BVSA 3BU9A 2ALLX 1HXXA 1QJPA 4GCSA 2OZQA 4FRTA 1THQA 2YNKA 5H9AA 2L9CA 1KOIA 1EPBA 3IA8A 4GNYA 1KT7A 5K06A 1PHOA 3NADA 5EDBA 5LJDA 1NP1A 1R0UA 4Y0QA 1FEMA 3B2HA 1DC9A 5EZ2A 1MX8A 4FRXA 1CBQA 1BSQA 4Y0SA 3AAEA 6PRNA 4QGWA 3AA0B 1ZHTA 4ZH9A 4MVEA 5F6BA 5C0NA 2LB6A 3G7GA 3LK2A 1IFCA 2GTLN 3FA9A 2R56A 2X8SA 4GNWA 4INNA 2K0LA 3T1DA 3A2SX 5KIDA 3NP1A 2W2FA 4KRAA 3JS1A 2ODJA 3AKNA 4HPBA 2XE5A 1LKEA 3KFIA 5EPQA 4N7DA 3S26A 4FESA 3CBCA 4XMFA 2AT8X 4GK9A 1GM6A 2OVDA 3OD9A 4BVMA 3LK41 1EW3A 2MJIA 3HTYA 2XE2A 3S5XA 1G7NA 1A2DA 4BOEA 4YCHA 3HWEA 1EPAA 1SY0A 2M4LA 3UU2A 4GRJA 2CBSA 4RLBA 3C78X 1PMPA 2BS6A 2JU3A 5HCEC 3AA6B 2HMBA 4ZJ0A 4AZOA 3T0SA 1A18A 2QM9A 2YMSA 2ASNX 4KH8A 1ZRYA 3STNA 4A60A 3NX2A 2NNQA 4YBPA 2QMIA 3AA1A 1OBPA 4I3CA 4XNLA 4E1TA 5LJHA 2X45A 1A3YA 1QY2A 3FA6A 1Y9TA 1ACDA 1LPJA 2EU7X 2Q2MA 5EDCA 4FBRA 2G78A 3BY0A 2FGQX 4FZMA 3NBXX 3B2LA 2HZRA 5DL7A 1DZKA 2ZAGA 4PSQA 1OPAA 4IAXA 5H9LA 1B56A 3WI4A 1IW2A 1E02A 1KZWA 5L8NA 4YFRA 1YIVA 2E4JA 2KD2A 3OJYC 5AQ6A 1P6PA 3WJGA 5HCDC 1S44A 1SXWA 2LA7A 2CM4A 4MVKA 4FQBB 4QYPA 1YS5A 4Y0PA 3EM0A 1QY0A 2MO5A 1QWDA 4XMCA 4ARHA 3APXA 2LFUA 1ZHXA 1LIEA 4IB7A 2FR3A 3IFBA 3STKA 3K19A 3VE1A 4IMOA 4AZLA 2FGRA 2IFBA 1FENA 4GKCA 4LZUA 3O22A 3S60A 5LJEA 1E54A 2MHLA 3CR6A 4ID2A 3BDRA 3TZGA 1XCAA 5EEEA 1IZNB 5D47A 4O3WA 1KQWA 4ORUA 3VG3A 3ZW0B 4MISA 2NNDA 2Q4NA 1IIUA 1GX9A 4ALBA 2XTRA 2PY1A 2HLVA 4AZPA 1AQBA 1B8EA 2KTDA 3POQA 1AVGI 1EALA 4FGIB 4U8UM 4PUXA 1D2UA 1FTPA 4O3ZA 2FR2A 5LKEA 3VZWX 1EIOA 3LV4A 1SMPI 2K62A 3UEXA 2RN4A 4O4SA 4RUNA 2X8TA 4D6AA 2Y2XA 2LHFA 2AT6X 3RWXA 1JJXA 2AL0X 2A2UA 1TXLA 2ZAIA 3FEKA 3PPTA 4ORWA 1P4TA 4FMSA 3T24A 2JU7A 1YUPA 1XKIA 3FLLA 3U9PC 2KC0A 3D4RA 3UAQA 1QG5A 2KW1A 5L8IA 5HZ8A 1MVGA 2FWVA 3STMX 1UREA 2ANSA 2GJ5A 2NNEA 4IB8A 3JSQA 3ZUIA 1SA8A 4GH7A 4NNSA 3SZVA 1OEJA 2XKLA 1ICMA 3P6GA 2WEWA 2KDYA 3VY8X 1PM1X 2JMBA 3EBKA 3FA8A 4OMWA 3VG5A 3U0DA 1G90A 4XMDA 1FELA 4ORXA 5HBSA 4LKPA 3HW9A 4AYMC 4U8UO 2QO6A 2QO5A 1RBPA 4AKRB 4NYRA 3AA7B 2GE4A 5DL5A 2OFMX 1KQXA 4PJ2A 4CK4A 4YH0A 2MM3A 1GKAA 1G85A 1Q9GA 1YWBA 1O1VA 3HOEA 2GC9A 1GFQA 1KGLA 3RKGA 4QZTA 4AZNA 4YBUA 2Z4HA 3FMZA 1I05A 4NLJA 1VYFA 1ALBA 2MWHA 5HWZA 1EUOA 1JBHA 2J4UP 4I6SA 1QFTA 1LIFA 3EYCA 1OEKA 4AKMA 3AA7A 4O3XB 4GCQA 4JCHA 4O3YA 4EEJA 2RQ0A 4I9SA 3LHNA 5IO6A 2XE3A 4XNKA 1QFVA 3SOTA 3SAOA 3CMPA 3V8UA 4CV7A 2WEXA 5D48A 4KT5A 3WJBA 4N58A 1ERXA 4I9RA 1T0VA 4IABA 5HZ9A 4ZHCA 2BT9A 4JGLA 2L67A 2Z4IA 5JDPA 4AKRA 2O62A 2LFOA 4LKTA 4ALOA 1KZXA 3WBGA 2W81C 5B29A 1YP7A 5D5DA 3AKMA 2Q39A 2K4TA 1GT1A 4OMXA 4Y0RA 2YG2A 4ODDA 5AEOA 1GFMA 3C77X 4BUMX 3NQ9A 5BVTA 1SXYA 2CZTA 3ELZA 3WI5A 4D6BA 1HN2A 1SY3A 1BBPA 3DSZA 4ZHFA 1JV4A 3ZW1B 2N93A 4GZVA 2Y0HA 5LJKA 4FZNA 1KXOA 3APUA 2Y0LA 1LNMA 3BSZE 1G74A 3F9DA 4XMGA 5HA0A 5HCCC 5LJBA 5F6ZA 1QQSA 1YWDA 5AJCA 2XTQA 3AA0A 3DA4A 1B0OA 2KZ7B 4GF4A 1YWAA 4MVLA 2FS6A 4MIRA 1OEEA 4NYQA 3TGAA 3LK3A 3K3LA 1GKAB 3VZTX 1JYJA 5HZQA 3PQUA 4OS8A 4A8ZA 2K23A 1ZHWA 4DQ3A 3ZW1A 2F1VA 3OE3A 1S2PA 4U8UN 1QY1A 3PH6A 2N2MA 3ZW2A 4KR4A 3AA1B 2GTLM 1VYGA 4G76A 3WOVA 1DV9A 3KZAA 2HZQA 4ZHDA 2KZ7A 4TLJA 4A1HA 3FW5A 2WWPA 1MM5A 2M06A 1LF7A 1HXTA 3CQNA 2A2GA 2AMMX 1ZHZA 1E06A 1HMTA 3KQ0A 1UZ2X 4KCAA 1U0XA 3I17A 1ZHYA 3FIQA 5FQ8E 1SY1A 1U17A 2HYSA 2OFRX 4ZH6A 2WSJA 2FLJA 4LSEA 4YDAA 2MNHA 1BEBA 4EFGA 4IAWA 1I4UA 2R74A 2X27X 7PRNA 2ACOA 1LIDA 1ZNEA 3B2KA 2RCTA 1HQPA 4U3QA 1X71A 3P6EA 1X8OA 1OPFA 5ADXL 5DL8A 4YCEA 3P02A 2OVAA 4I3BA 1BSOA 5L8OA 2O4VA 1TVQA 3PECA 4FSOA 3CQRA 1OBQA 3FYXA 3RSWA 2FRSA 2FTBA 1H6S1 1PRNA 5BYPA 1Z24A 2JOZA 3KVDD 3NSGA 1X8UA 4RUUA 1E00A 2KXPA 4FT6A 1NGLA 2PRNA 4WBKA 3LK42 4M7MA 1YWCA 5EE2A 4KIIA 4FUVA 1OSMA 3GE2A 1TOUA 1GX8A 4COTA 3FW4A 1DZMA 2FT9A 4WFVA 3CBSA 3FELA 4I3DA 2LBVA 3SYBA 3FEPA 1X8PA 5CYBA 1GGLA 2CBRA 2RCQA 4QNIA 1MDCA 2J1NA 4GE1A 4AFKA 2KT4B 4YKOA 3HWFA 2AH7X 3WXQA 4ES7A 3D97A 4TNNA 2XG6A 2NP1A 2XSTA 1DF3A 4D65A 3NQKA 3RZYA 1LIBA 2AT0X 4WHIA 2Y0KA 3VG4A 3VU1A 4WFUA 4AZQA 3PRNA 2LBAA 3B2JA 4I95A 4NNTA 4UU3A 4OS3A 3PQSA 1GT3A 1G5WA 5BVQA 3FYFA 1U18A 3PP6A 1O8VA 2Y7SA 1GFOA 1T8VA 3CWKA 3PH5A 1NP4A 3C5OA 3DA3A 5LJGA 2Q9SA 1ZNKA 4TKHA 3TGBA 1H91A 3ZZVA 1BWYA 1HMSA 4ZCBA 4YKMA 3O19A 3D96A 2ZFGA 3AAAA 2DM5A 5FFHA 1ZNHA 1MPFA 1CBRA 4LZVA 1KT6A 4KC8A 4U9CA 3UEVA 4ON1A 2KXPB 4RLCA 1L6MA 2MHDA 2CM9A 1DZJA 1VPRA 3HWGA 3P6CA 5F7GA 4EXZA 5GV0A 4KR8A 5ADXK 1ML7A 3BLGA 5F1EA 5H8TA 5HZ6A 4FBVA 4TKBA 4OS0A 2JN3A 4D5UA 3DTQA 1Y9LA 3EBWA 2GTFX 2L68A 1CJ5A 5IO5A 4QAEA 3LK3B 4QQ1A 1SY2A 2M07A 3WJDA 5LJCA 3LK2B 4E1SA 3JQOA 2BLGA 4QZUA 3VPJE 4IB6A 3BX8A 3BX7A 2N2LA 3SZDA 3PEDA 2WUTA 4YMYA 2JMMA 5PRNA 4YFQA 3FR5A 3ZWEA 4RJWA 3NPOA 4AUIA 5CE4A 3U03A 4TJZA 2QTKA 4BQUA 1FE3A 4GDZA 2XMXA 4FSPA 4QGXA 3H3IA 1EXSA 4G75A 5D8JA 1X8QA 2ACPX 2WQ9A 3P6FA 3Q6LA 4XMHA 3UEUA 2P8GA 4A1YA 4GCPA 4HWMA 3VG6A 1TW4A 4IMNA 1ZNLA 3F8AA 2A13A 3QKGA 5DL6A 3KFHA 3NX1A 2XE1A 5FENA 1HBQA 4FBOA 8PRNA 2R73A 3ZQ3A 3AAAB 2JU8A 5AJBA 2RA6A 3JTYA 4QRLA 3EMNX 1IKJA 4L1NA 1DZPA 4ZHGA 1CBSA 1O1UA 4AYID 1LFOA 1QJ8A 1ZNGA 2F1TA 3UPGA 1GT5A 3RBHA 3APWA 2OVSA 5KICA 4HFOA 4N59A 3SY7A 1GXAA 2A0AA 3G7XA 1S7DA 2Q2PA 1MX7A 3I0AA 3WJFA 4AYDC 4AYNA 5IYUA 2GTLO 4MVIA 1BSYA 4NLIA 1CBIA 3SYSA 3KFGA 4HPDA 5D45A 3TF6A 4YFPA 1FDQA 1GT4A 2AKQA 3EMMA 4TQ2A 4C69X 1BRQA 3UEWA 1KT3A 3BRNA 2BHVA 1QJ9A 2PORA 3WJCA 3O0EA 2F73A 5EEDA 3VY9X 4O9SA 5FAZA 1EI5A 1ERBA 4O49A 4TKJA 2F09A 3ZI8A 4XMEA 5HAEA 3VE2A 1T68X 5DG4A 1JIWI 3GP6A 4L3RA 3HK1A 3BU1A 1BXWA 3AA6A 2RD7C 5FVNA 4GU8A 4ZHHA 3VZUX 2JW1A 3PORA 3RBYA 4ZGUA 2HNXA 4FZLA 2BS5A 4YGZA 3ZW0A 4ZR2A 3KFFA 1Q9FA 3ZUOA 1A57A 1SXXA 4FOZA 4IB9A 5AFUK 4EQAC 2A3FX 1PEEA 4RL9A 5FQ6E 1OBUA 1OPBA 1AB0A 5HZ5A 2ZLDA 3VG7A 3D95A 4ZFXA 4LSIA 3POXA 4ZGFA 5H9KA 4AZMA 3NR3A 1GFPA 4LSHA 3ELXA 1KT4A 4GHBA 1MUPA 3BS2A 4AYHA 5LKFA 2YPVA 4JFBA 5T5FA 1JZUA 1HBPA 3OBLA 1HXUA 4LSFA 1BT9A 4QGVA 3N91A 5HA1A 3HWBA 2KTSA 5KHPA 3POUA 1YP6A 2CZUA 3T20A 5DPQA 3O2YA 4R0BA 3P6DA 1CRBA 4QYNA 2POAA 1HMRA 3TGCA 4D64A 2OVEA 5B27A 1GFNA 3MBTA 5H9NA 1ZNDA 3GAQA 1BH3A 5IO7A 3L4RA 3TZSA 4M6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOE A;  2W80 C;  1YS5 A;  2W81 C;  3PQU A;  4O3Z A;  4O4U A;  2KDY A;  4O49 A;  2LFU A;  4O3X B;  3VE2 A;  4QQ1 A;  2YPV A;  4Z3T A;  5T5F A;  4O3Y A;  4AYI D;  3KVD D;  3VE1 A;  4AYM C;  3PQS A;  4AYE C;  2Y7S A;  3V8U A;  5EE2 A;  4AYN A;  4AYD C;  3HOL A;  4O3W A;  2KC0 A;  3UAQ A;  4O4X A;  4U9C A; 
#chains in the Genus database with same CATH topology
 2OY5 O;  3WJE A;  1X8N A;  4LQZ A;  2FS7 A;  5G26 A;  3RDQ A;  2G79 A;  1KL3 A;  1VWE B;  1LIC A;  4RJX A;  5D4A A;  1VWQ B;  5G39 A;  3B2I A;  3QRA A;  2X46 A;  4JO6 A;  4K3C A;  4KC7 A;  2QOS C;  4YGG A;  1DF8 A;  1MM4 A;  4IBA A;  3F6Z B;  1KT5 A;  5BVS A;  3BU9 A;  2ALL X;  1SWS A;  2RTC B;  3RDX A;  1EPB A;  2CAM A;  3NAD A;  1R0U A;  1SWJ A;  1FEM A;  4Y0Q A;  3AA0 B;  1VWC B;  5F6B A;  5C0N A;  4JHQ A;  1IFC A;  1E2T A;  3T1D A;  3A2S X;  5KID A;  3NP1 A;  2FKG A;  3AKN A;  4FES A;  4N7D A;  4CTD A;  1EW3 A;  1NQM A;  2FGS A;  3HWE A;  1SY0 A;  2CBS A;  4PJ0 O;  1JQP A;  4CDE A;  2YMS A;  2ASN X;  3STN A;  2QMI A;  3Q34 A;  2WJQ A;  1Y9T A;  4NV8 A;  1LPJ A;  2FGQ X;  4FZM A;  3B2L A;  1DZK A;  3WI4 A;  1KZW A;  3OJY C;  5AQ6 A;  3WJG A;  1S44 A;  4MVK A;  1YS5 A;  1MEP A;  3IFB A;  4IMO A;  2FGR A;  4GKC A;  4LZU A;  4ID2 A;  2QOM A;  2RTL A;  1XCA A;  2G5L A;  5D47 A;  4MIS A;  2Q4N A;  4ALB A;  2HLV A;  2KTD A;  3POQ A;  1NDJ A;  4GD9 A;  3KVN A;  5LKE A;  1EIO A;  1SMP I;  2RN4 A;  2Y2X A;  1TXL A;  3PPT A;  3UAQ A;  3PGR A;  2ANS A;  2GJ5 A;  3A0B O;  1JMZ A;  1SWF A;  4GH7 A;  2JGS A;  1OEJ A;  1LCW A;  2WEW A;  2KDY A;  3FA8 A;  3EBK A;  4OMW A;  2X56 A;  4XMD A;  1NQN A;  4LKP A;  4Z6J A;  3AA7 B;  2OFM X;  1VWA B;  2MM3 A;  1G85 A;  2BC3 A;  1GFQ A;  3FMZ A;  1LCV A;  1ALB A;  1JBH A;  4I6S A;  1LIF A;  1OEK A;  4GCQ A;  5GTH O;  4I9S A;  5IO6 A;  2XE3 A;  2WEX A;  5D48 A;  3DWO X;  3A0H O;  4I9R A;  2Z4I A;  1T1L A;  1W6F A;  2Y32 A;  1SLE B;  1SY3 A;  4ZHF A;  5JD2 A;  2N93 A;  2IZL B;  1LDO A;  5F6Z A;  1QQS A;  5AJC A;  3DA4 A;  1B0O A;  1VWK B;  2A5C A;  1MK5 A;  2FS6 A;  4MIR A;  1OEE A;  4NYQ A;  1GKA B;  5K67 A;  5HZQ A;  3PQU A;  4OS8 A;  1VWH B;  4DQ3 A;  2N2M A;  4KR4 A;  3ZW2 A;  1SRI A;  3WOV A;  3KZA A;  2WWP A;  1HXT A;  1ZHZ A;  4C5P A;  1U0X A;  3I17 A;  5FQ8 E;  3EW1 A;  2WSJ A;  2X27 X;  2ACO A;  1ZNE A;  1MM9 A;  5L8O A;  1OBQ A;  3FYX A;  3RSW A;  2FTB A;  3NSG A;  4RUU A;  1GX8 A;  4GJS A;  1OSP O;  1SWD A;  1VWR B;  2J1N A;  3HWF A;  3WXQ A;  1DF3 A;  2Y0K A;  4WHI A;  3VG4 A;  4WFU A;  4NNT A;  1G5W A;  3FYF A;  1U18 A;  2Y7S A;  3CWK A;  4U46 A;  4TKH A;  3TGB A;  1BWY A;  1HMS A;  2DM5 A;  5FFH A;  5CSE A;  1KT6 A;  4U9C A;  4RLC A;  1DZJ A;  4Z28 A;  4EXZ A;  1ML7 A;  3QQ2 A;  5F1E A;  3X00 A;  5HZ6 A;  4TKB A;  2RTM A;  2JN3 A;  4D5U A;  3DTQ A;  1Y9L A;  3EBW A;  4QAE A;  1SY2 A;  2M07 A;  3WJD A;  5LJC A;  3LK2 B;  3SZD A;  2WUT A;  4YMY A;  3FR5 A;  4RJW A;  2XMX A;  4GDZ A;  1VWL B;  4QGX A;  1EXS A;  5B66 O;  5D8J A;  1RXJ A;  1X8Q A;  3Q6L A;  4XMH A;  4A1Y A;  4CPH A;  1VWO B;  3T6L A;  2IZK A;  2OL6 O;  4BCS A;  4ZHG A;  4AYI D;  3APW A;  5IXG A;  4N59 A;  1GXA A;  2A0A A;  3AEH A;  2GTL O;  3SLJ A;  3T2X A;  1LCZ A;  4TQ2 A;  3UEW A;  1KT3 A;  2BHV A;  3O0E A;  5EED A;  4XME A;  5DG4 A;  4UB6 O;  4L3R A;  3HK1 A;  1BXW A;  3AA6 A;  4GU8 A;  5IRU A;  3VZU X;  3ZW0 A;  3FID A;  1A57 A;  3RDU A;  2R4O A;  2FKJ A;  4ZFX A;  1RXK A;  3NR3 A;  3SLT A;  1MUP A;  5LKF A;  5T5F A;  1JZU A;  3OBL A;  1HXU A;  3N91 A;  3POU A;  4R0B A;  4QYN A;  2POA A;  1BH3 A;  1SRF A;  2W2A A;  1HXZ A;  1IJ8 A;  1LEL A;  5AFU L;  1N0S A;  1SRH A;  1I06 A;  2X8F A;  2IWW A;  3P6H A;  5FQ7 E;  4HPA A;  1EQD A;  2W2B A;  1JJJ A;  4Y5D A;  2AVI A;  1X89 A;  1VWI B;  3NQ3 A;  2QO4 A;  2X4M A;  1E5P A;  4DQ4 A;  4GGT A;  4NW4 A;  4ORY A;  3HOL A;  3AAE B;  4ORS A;  2AT3 X;  3HWD A;  5F58 A;  3RE6 A;  3E3C A;  4K19 A;  5JR8 A;  2AT5 X;  1ICN A;  1BM5 A;  4EDE A;  1IKE A;  3SY9 A;  4NP1 A;  4AYE C;  5H9A A;  2OYB O;  1KOI A;  1KT7 A;  5B5G A;  5LJD A;  1NP1 A;  4FRX A;  5EZ2 A;  1MX8 A;  1CBQ A;  1BSQ A;  4Y0S A;  2R4N A;  4QGW A;  1ZHT A;  2LB6 A;  3LK2 A;  1N9Y A;  1LDQ A;  2K0L A;  2GTL N;  4GNW A;  2IZA A;  3JS1 A;  2ODJ A;  3BS0 A;  4HPB A;  5EPQ A;  3S26 A;  4BVM A;  3OD9 A;  3HTY A;  3S5X A;  2RTF B;  1SWB A;  4YCH A;  3UU2 A;  4GRJ A;  3C78 X;  5HCE C;  2JU3 A;  2RTP B;  4ZJ0 A;  2NNQ A;  4YBP A;  4I3C A;  3T6F A;  4EKV A;  2Q2M A;  4FBR A;  2G78 A;  4Z2V A;  1SLD B;  4IAX A;  1IW2 A;  1E02 A;  1I78 A;  2RTA A;  1YIV A;  2E4J A;  3VGW A;  1SXW A;  2CM4 A;  4Y0P A;  3EM0 A;  1QWD A;  3APX A;  2FR3 A;  3K19 A;  4AZL A;  4CPE A;  5LJE A;  3O22 A;  3BDR A;  5EEE A;  4Z2P A;  1SWN A;  2XTR A;  2PY1 A;  1EAL A;  4U8U M;  1JMX A;  1SWR A;  4PUX A;  1D2U A;  2FR2 A;  5B11 O;  3LV4 A;  1HXL A;  4BGF A;  2K62 A;  4RUN A;  3RWX A;  1FJ1 E;  1WUB A;  3D4R A;  5HZ8 A;  2KW1 A;  1VWP B;  3STM X;  2OY7 A;  1SA8 A;  4NNS A;  3VY8 X;  1PM1 X;  2JMB A;  1VWN B;  3RE5 A;  5HBS A;  4U8U O;  2QO5 A;  5G38 A;  2GE4 A;  2IWV A;  1HQQ A;  5DL5 A;  2DJF A;  4CK4 A;  2OL7 A;  3HOE A;  4AZN A;  4GGZ A;  4NLJ A;  1VYF A;  5HWZ A;  2IZH B;  3EYC A;  4O3Y A;  4XNK A;  4BX5 A;  5KAI O;  2IZG B;  3SAO A;  3CMP A;  3WJB A;  4KT5 A;  4IAB A;  1T0V A;  1UYO X;  2L67 A;  4AKR A;  2O62 A;  4ALO A;  3FDC A;  3WBG A;  1VWD B;  1YP7 A;  5B29 A;  3AKM A;  2Q39 A;  4OMX A;  5AEO A;  4BUM X;  3NQ9 A;  3PDF A;  3PGS A;  3ELZ A;  3WI5 A;  1HN2 A;  3DSZ A;  1JV4 A;  4GZV A;  3POR A;  1G74 A;  2OF8 A;  5GTI O;  4GF4 A;  2KZ7 B;  1YWA A;  3TGA A;  4A8Z A;  2K23 A;  3T2W A;  1Y52 X;  1QY1 A;  4CDD A;  1VYG A;  4G76 A;  2F01 A;  4ZHD A;  4TLJ A;  3FW5 A;  1MM5 A;  2M06 A;  3CQN A;  1E06 A;  1HMT A;  1UZ2 X;  4ZH6 A;  4LSE A;  4YDA A;  2MNH A;  1BEB A;  4EFG A;  4IAW A;  7PRN A;  1LID A;  2GH7 A;  1X71 A;  3P6E A;  1OPF A;  5ADX L;  4YCE A;  2OVA A;  4I3B A;  1BSO A;  1TVQ A;  3SLO A;  3CQR A;  3CKG A;  2FRS A;  1H6S 1;  3KVD D;  1X8U A;  3JCU O;  1SWT A;  2R4L A;  3LK4 2;  1KFF A;  1DZM A;  3CBS A;  1GGL A;  2CBR A;  2RCQ A;  1MDC A;  3NQK A;  2AT0 X;  3VU1 A;  4AZQ A;  2LBA A;  3B2J A;  4I95 A;  4OS3 A;  1GT3 A;  2X55 A;  1MOY A;  5BVQ A;  1N9M A;  3PP6 A;  3PH5 A;  1ZNK A;  1H91 A;  3ZZV A;  4YKM A;  3O19 A;  3AAA A;  2RTE B;  1ZNH A;  1MPF A;  4KC8 A;  2KXP B;  3UEV A;  1L6M A;  5GV0 A;  5ADX K;  4GGR A;  2R8A A;  2GTF X;  4C4V B;  2BLG A;  2N2L A;  1VWJ B;  3BX7 A;  4IB6 A;  1N4J A;  3PED A;  1K3B A;  4AUI A;  5CE4 A;  3U03 A;  4TJZ A;  1FE3 A;  4DNE A;  1ZNL A;  4OKA A;  3QKG A;  3KFH A;  2XE1 A;  1HBQ A;  4FBO A;  3JTY A;  2RA6 A;  4CPI A;  4QRL A;  3EMN X;  1IKJ A;  1O1U A;  2IZJ A;  1QJ8 A;  3RBH A;  2OVS A;  5KIC A;  3SY7 A;  1S7D A;  4AYN A;  1MX7 A;  3WJF A;  5IYU A;  4MVI A;  4HPD A;  5D45 A;  3EMM A;  2AKQ A;  4C69 X;  3BRN A;  2X32 A;  3WJC A;  3DZM A;  1RAV A;  1JIW I;  3GP6 A;  2RTI B;  2RD7 C;  4ZHH A;  2AXT O;  3RBY A;  1I9H A;  3KFF A;  3ZUO A;  4FOZ A;  5AFU K;  2F1C X;  4EQA C;  2A3F X;  1PEE A;  4RL9 A;  5HZ5 A;  3D95 A;  4ZGF A;  1KT4 A;  2QCB A;  4GHB A;  2YPV A;  4JFB A;  4LSF A;  5HA1 A;  3HWB A;  3TGC A;  5B27 A;  1ZND A;  4M6S A;  1JYD A;  3KZI O;  3MX7 A;  1AEL A;  4O4O A;  3MVF A;  1BLR A;  3VG2 A;  2G7B A;  1SXU A;  5L3Y A;  1QAB E;  4UU2 A;  3RY1 A;  4ML7 B;  2ERV A;  3PF1 A;  1B4M A;  1I04 A;  2OMF A;  1STP A;  2L5P A;  3APV A;  4YGH A;  3WVM A;  4ORR A;  1SWU A;  2G8C O;  1BRP A;  3FR2 A;  4AW8 A;  1ORM A;  3FA7 A;  4HPC A;  1D3S A;  4O4U A;  4GJV A;  4AZR A;  2C1Q A;  1EII A;  3QRC A;  3P24 A;  3WYQ A;  1SWH A;  3FEN A;  1QJP A;  1T16 A;  4FRT A;  2YNK A;  1SLF B;  2L9C A;  1PBY A;  4GNY A;  5K06 A;  3VHI A;  2WPU A;  1RSU B;  3G7G A;  3FA9 A;  4INN A;  2R56 A;  4C4V A;  2W2F A;  2XE5 A;  1LKE A;  1W5R A;  2AT8 X;  3LK4 1;  1A2D A;  3LTW A;  3RDO A;  3VHH A;  4BX7 A;  4RLB A;  2BS6 A;  3AA6 B;  2HMB A;  1A18 A;  4Y59 A;  1ZRY A;  4A60 A;  3AA1 A;  4XNL A;  1VWB B;  5LJH A;  1A3Y A;  2R89 A;  2EU7 X;  5EDC A;  3BY0 A;  2HZR A;  4PSQ A;  1OPA A;  3AUM O;  4YFR A;  1P6P A;  5HCD C;  2IZE B;  4ARH A;  1QY0 A;  2MO5 A;  3SZI A;  2LFU A;  1ZHX A;  1LIE A;  3STK A;  3VE1 A;  1FEN A;  1UYN X;  3CR6 A;  3TZG A;  1IZN B;  4O3W A;  1KQW A;  4ORU A;  3VG3 A;  3ZW0 B;  1KL5 A;  2NND A;  1IIU A;  4AZP A;  1AQB A;  1AVG I;  4FGI B;  1GX3 A;  3VZW X;  1KL4 A;  3UEX A;  4D6A A;  2X8T A;  1SLG B;  2HKD A;  1JJX A;  2AL0 X;  4ORW A;  2ZAI A;  3FEK A;  1SWQ A;  1XKI A;  3U9P C;  2KC0 A;  1SWC A;  4IRW A;  2FWV A;  1URE A;  2NNE A;  1VWF B;  3ZUI A;  2XKL A;  1ICM A;  3VG5 A;  1G90 A;  1FEL A;  4ORX A;  3EW2 A;  4AYM C;  2QO6 A;  4NYR A;  4PJ2 A;  5B2A O;  1YWB A;  5G3A A;  1O1V A;  2GC9 A;  5B3M O;  1KGL A;  3RKG A;  4YBU A;  2Z4H A;  1I05 A;  2MWH A;  2J4U P;  1QFT A;  4O3X B;  4JCH A;  2RQ0 A;  3LHN A;  1QFV A;  3SOT A;  3V8U A;  4CV7 A;  3NJT A;  4N58 A;  2IZC B;  4LKT A;  2C4I A;  2K4T A;  2Y3E A;  4ODD A;  3C77 X;  2IZI A;  4CPF A;  5BVT A;  4D6B A;  2Y0H A;  4CDC A;  2X9K A;  2Y0L A;  4XMG A;  5HCC C;  3F9D A;  5HA0 A;  4BBO A;  8PRN A;  1YWD A;  1RST B;  2XTQ A;  4MVL A;  3LK3 A;  3K3L A;  3VZT X;  1JYJ A;  4CDF A;  2Y3F A;  3ZW1 A;  1S2P A;  4Z27 A;  3AA1 B;  1DV9 A;  2C1S A;  1STS B;  4A1H A;  2UYW A;  1LF7 A;  2A2G A;  1ZHY A;  1SY1 A;  1U17 A;  2FLJ A;  1I4U A;  2R74 A;  2ZSC A;  2RCT A;  1HQP A;  4U3Q A;  4GUZ A;  4FQE A;  3P02 A;  2O4V A;  3PEC A;  4IL6 O;  5BYP A;  2JOZ A;  1E00 A;  1NGL A;  4M7M A;  1YWC A;  4KII A;  1OSM A;  3GE2 A;  4GDA A;  4COT A;  1NBX A;  3FW4 A;  4NV7 A;  2FT9 A;  3SYB A;  2IZF B;  4AFK A;  4YKO A;  4TNN A;  2XG6 A;  1LIB A;  3PRN A;  2RTG B;  4BX7 B;  1O8V A;  3BRY A;  3C5O A;  5LJG A;  2Q9S A;  3RY2 A;  4OEM A;  4ZCB A;  3D96 A;  1CBR A;  4LZV A;  2MHD A;  2CM9 A;  3HWG A;  1VPR A;  3P6C A;  5H8T A;  4FBV A;  2R88 A;  4OS0 A;  2L68 A;  5IO5 A;  3LK3 B;  4QQ1 A;  3RDS A;  4E1S A;  2AF5 A;  3BX8 A;  4YFQ A;  4I60 A;  3ZWE A;  2QTK A;  4FSP A;  4G75 A;  2OL8 O;  2ACP X;  3P6F A;  4GCP A;  4HWM A;  3VG6 A;  1TW4 A;  3BRZ A;  4IMN A;  3F8A A;  5DL6 A;  5CHK A;  3ZQ3 A;  2JU8 A;  3PGU A;  1DZP A;  5H2F O;  1LFO A;  1Y55 X;  2Q2P A;  1CBI A;  3SYS A;  3WYP A;  1VYO A;  4YFP A;  1FDQ A;  3MG5 A;  3HPE A;  1BRQ A;  2F73 A;  1ERB A;  4TKJ A;  3ZI8 A;  3VE2 A;  5FVN A;  3EC5 A;  2RTO B;  2JW1 A;  4ZGU A;  4FZL A;  4ZR2 A;  3SZJ A;  1Q9F A;  5FQ6 E;  4LSI A;  3POX A;  3BS2 A;  4AYH A;  2OY8 A;  4QGV A;  3T20 A;  2CZU A;  2FHL A;  3O2Y A;  4JNJ A;  2OFA A;  4D64 A;  2OVE A;  1GFN A;  3MBT A;  2X34 A;  3GAQ A;  5IO7 A;  3L4R A;  3TZS A;  4K3B A;  2WQA E;  1ADL A;  3FR4 A;  3D9W A;  4YDB A;  2FHN X;  2WR6 A;  1PBO A;  4N7C A;  2LKK A;  1TOW A;  4B61 A;  1IFB A;  4GET A;  4CSB A;  5K68 A;  4F4B A;  5HTD A;  3WZQ A;  4O4X A;  2W80 C;  2RTK A;  3C76 X;  3S5V A;  1IZN A;  4Z3T A;  1RLB E;  1DFV A;  1BJ7 A;  5HTE A;  4PR7 A;  1HXX A;  4GCS A;  2OZQ A;  1THQ A;  3IA8 A;  1PHO A;  1SWG A;  5EDB A;  3B2H A;  1DC9 A;  6PRN A;  3AAE A;  4BX5 B;  4ZH9 A;  4MVE A;  2OF9 A;  4CPH B;  2X8S A;  4KRA A;  3KFI A;  3CBC A;  4XMF A;  4GK9 A;  1GM6 A;  2OVD A;  5IRW A;  2RTD B;  2MJI A;  2XE2 A;  1SWO A;  1G7N A;  4BOE A;  3MM0 A;  1AVE A;  4MEE A;  5TIS O;  1EPA A;  4C00 A;  2OFB A;  2M4L A;  1PMP A;  2WJR A;  4AZO A;  3T0S A;  2QM9 A;  1Y0G A;  4KH8 A;  1STR B;  4BX6 B;  3NX2 A;  1OBP A;  4E1T A;  2X45 A;  1QY2 A;  3FA6 A;  1ACD A;  3NBX X;  5DL7 A;  2ZAG A;  5H9L A;  1B56 A;  5L8N A;  5B10 O;  1HY2 A;  2KD2 A;  2RTJ A;  2LA7 A;  4FQB B;  4QYP A;  5E79 O;  4XMC A;  4N75 A;  1LUQ A;  4IB7 A;  2MF6 A;  2IFB A;  3S60 A;  2MHL A;  1E54 A;  5IRA A;  1GX9 A;  1B8E A;  1FTP A;  4O3Z A;  4BX6 A;  3WZN A;  4O4S A;  2LHF A;  1SWP A;  2AT6 X;  2A2U A;  1P4T A;  4FMS A;  3T24 A;  1N7Y A;  2JU7 A;  1YUP A;  3FLL A;  1SWE A;  1QG5 A;  5L8I A;  1MVG A;  3WZP A;  1VWM B;  2BSZ A;  4IB8 A;  3JSQ A;  3SZV A;  4UB8 O;  3P6G A;  1RXH A;  3U0D A;  4YVB A;  3HW9 A;  1RBP A;  4AKR B;  2RTN B;  1KQX A;  4YH0 A;  1GKA A;  1Q9G A;  1W4T A;  2UZ2 A;  4QZT A;  3SZH A;  1EUO A;  4AKM A;  3AA7 A;  2I5V O;  4EEJ A;  2A5B A;  3WU2 O;  1ERX A;  5HZ9 A;  4ZHC A;  2BT9 A;  4JGL A;  2VDF A;  5JDP A;  1JJU A;  2LFO A;  3VHM A;  1KZX A;  2W81 C;  1N43 A;  5D5D A;  1GT1 A;  4Y0R A;  2YG2 A;  1GFM A;  4BJ8 A;  1SXY A;  5F2B A;  2CZT A;  1BBP A;  3ZW1 B;  5LJK A;  4FZN A;  5KAF O;  2RTB B;  1KXO A;  3APU A;  1LNM A;  3BSZ E;  5LJB A;  3AA0 A;  1ZHW A;  2OY1 O;  2F1V A;  3OE3 A;  4U8U N;  3PH6 A;  2GTL M;  2HZQ A;  4DCB A;  2KZ7 A;  4Z2O A;  4B55 A;  2AMM X;  3KQ0 A;  4KCA A;  3FIQ A;  1PTS A;  2HYS A;  2OFR X;  3CKF A;  1Y53 X;  3B2K A;  1X8O A;  2VFB A;  5DL8 A;  4FSO A;  1VWG B;  2RTR B;  1K24 A;  1PRN A;  1Z24 A;  2KXP A;  4FT6 A;  2RTQ B;  4WBK A;  2PRN A;  5EE2 A;  1SRE A;  4FUV A;  1TOU A;  1SWL A;  4WFV A;  3FEL A;  4I3D A;  2LBV A;  3FEP A;  1X8P A;  5CYB A;  4QNI A;  4GE1 A;  2KT4 B;  1SRG A;  2AH7 X;  4ES7 A;  3D97 A;  3DWN A;  2NP1 A;  2XST A;  4D65 A;  3RZY A;  1WBI A;  4N74 A;  1AVD A;  2R4P A;  1SRJ A;  4UU3 A;  3PQS A;  1GFO A;  1T8V A;  3DA3 A;  1NP4 A;  2A8G A;  2ZFG A;  4ON1 A;  5F7G A;  4KR8 A;  3BLG A;  1CJ5 A;  2RTH B;  3JQO A;  4QZU A;  3VPJ E;  2JMM A;  5PRN A;  3NPO A;  4BQU A;  3H3I A;  2PI3 O;  2VFC A;  3UEU A;  2WQ9 A;  2P8G A;  2DJG A;  1SWK A;  2A13 A;  3NX1 A;  5FEN A;  2R73 A;  3AAA B;  5AJB A;  4L1N A;  1CBS A;  5B5F A;  2F1T A;  3UPG A;  1ZNG A;  1GT5 A;  4HFO A;  3G7X A;  5B5E O;  3I0A A;  4AYD C;  3RDM A;  1BSY A;  4NLI A;  3KFG A;  3TF6 A;  1GT4 A;  2WVP A;  2POR A;  1QJ9 A;  3VY9 X;  2IZD B;  4O9S A;  5FAZ A;  1EI5 A;  4O49 A;  2F09 A;  5HAE A;  1T68 X;  3BU1 A;  1NC9 A;  2HNX A;  2BS5 A;  4YGZ A;  2JQY A;  1SXX A;  4IB9 A;  1OBU A;  1OPB A;  1AB0 A;  2ZLD A;  3VG7 A;  3WZO A;  1GFP A;  5H9K A;  4AZM A;  4LSH A;  3ELX A;  1HBP A;  1SWA A;  1BT9 A;  2KTS A;  2IZB A;  5KHP A;  1YP6 A;  5DPQ A;  3P6D A;  4OEL A;  1CRB A;  1HMR A;  1S5L O;  3PK2 A;  5H9N A;  2I5Z O; 
#chains in the Genus database with same CATH homology
 2W2A A;  1JYD A;  2WQA E;  1ADL A;  5AFU L;  3MX7 A;  1AEL A;  3WJE A;  4O4O A;  3MVF A;  3FR4 A;  1BLR A;  1N0S A;  1X8N A;  3VG2 A;  4LQZ A;  1I06 A;  2FS7 A;  2G7B A;  5G26 A;  2X8F A;  1SXU A;  3P6H A;  1QAB E;  4UU2 A;  4HPA A;  2G79 A;  1EQD A;  2W2B A;  5FQ7 E;  1JJJ A;  4ML7 B;  4YDB A;  1X89 A;  2WR6 A;  1PBO A;  4N7C A;  2ERV A;  2LKK A;  3NQ3 A;  1TOW A;  4B61 A;  1LIC A;  2QO4 A;  1B4M A;  1E5P A;  1IFB A;  1I04 A;  4GET A;  4CSB A;  4DQ4 A;  2OMF A;  4RJX A;  4F4B A;  2L5P A;  5HTD A;  4NW4 A;  3APV A;  3HOL A;  4ORY A;  4YGH A;  4ORS A;  5D4A A;  4ORR A;  3WVM A;  2AT3 X;  3AAE B;  3HWD A;  5F58 A;  3B2I A;  3E3C A;  1BRP A;  4O4X A;  3QRA A;  2W80 C;  3FR2 A;  4AW8 A;  4K19 A;  5JR8 A;  2AT5 X;  1ICN A;  2X46 A;  3C76 X;  3FA7 A;  1BM5 A;  1ORM A;  4HPC A;  4KC7 A;  4EDE A;  1D3S A;  4O4U A;  1IKE A;  3SY9 A;  3S5V A;  2QOS C;  4YGG A;  1IZN A;  4AZR A;  4Z3T A;  1EII A;  4IBA A;  1MM4 A;  3QRC A;  1RLB E;  3P24 A;  4NP1 A;  3F6Z B;  1DFV A;  1BJ7 A;  4AYE C;  1KT5 A;  3FEN A;  5HTE A;  5BVS A;  3BU9 A;  2ALL X;  1HXX A;  1QJP A;  4GCS A;  2OZQ A;  4FRT A;  1THQ A;  2YNK A;  5H9A A;  2L9C A;  1KOI A;  1EPB A;  3IA8 A;  4GNY A;  1KT7 A;  5K06 A;  1PHO A;  3NAD A;  5EDB A;  5LJD A;  1NP1 A;  1R0U A;  4Y0Q A;  1FEM A;  3B2H A;  1DC9 A;  5EZ2 A;  1MX8 A;  4FRX A;  1CBQ A;  1BSQ A;  4Y0S A;  3AAE A;  6PRN A;  4QGW A;  3AA0 B;  1ZHT A;  4ZH9 A;  4MVE A;  5F6B A;  5C0N A;  2LB6 A;  3G7G A;  3LK2 A;  1IFC A;  2GTL N;  3FA9 A;  2R56 A;  2X8S A;  4GNW A;  4INN A;  2K0L A;  3T1D A;  3A2S X;  5KID A;  3NP1 A;  2W2F A;  4KRA A;  3JS1 A;  2ODJ A;  3AKN A;  4HPB A;  2XE5 A;  1LKE A;  3KFI A;  5EPQ A;  4N7D A;  3S26 A;  4FES A;  3CBC A;  4XMF A;  2AT8 X;  4GK9 A;  1GM6 A;  2OVD A;  3OD9 A;  4BVM A;  3LK4 1;  1EW3 A;  2MJI A;  3HTY A;  2XE2 A;  3S5X A;  1G7N A;  1A2D A;  4BOE A;  4YCH A;  3HWE A;  1EPA A;  1SY0 A;  2M4L A;  3UU2 A;  4GRJ A;  2CBS A;  4RLB A;  3C78 X;  1PMP A;  2BS6 A;  2JU3 A;  5HCE C;  3AA6 B;  2HMB A;  4ZJ0 A;  4AZO A;  3T0S A;  1A18 A;  2QM9 A;  2YMS A;  2ASN X;  4KH8 A;  1ZRY A;  3STN A;  4A60 A;  3NX2 A;  2NNQ A;  4YBP A;  2QMI A;  3AA1 A;  1OBP A;  4I3C A;  4XNL A;  4E1T A;  5LJH A;  2X45 A;  1A3Y A;  1QY2 A;  3FA6 A;  1Y9T A;  1ACD A;  1LPJ A;  2EU7 X;  2Q2M A;  5EDC A;  4FBR A;  2G78 A;  3BY0 A;  2FGQ X;  4FZM A;  3NBX X;  3B2L A;  2HZR A;  5DL7 A;  1DZK A;  2ZAG A;  4PSQ A;  1OPA A;  4IAX A;  5H9L A;  1B56 A;  3WI4 A;  1IW2 A;  1E02 A;  1KZW A;  5L8N A;  4YFR A;  1YIV A;  2E4J A;  2KD2 A;  3OJY C;  5AQ6 A;  1P6P A;  3WJG A;  5HCD C;  1S44 A;  1SXW A;  2LA7 A;  2CM4 A;  4MVK A;  4FQB B;  4QYP A;  1YS5 A;  4Y0P A;  3EM0 A;  1QY0 A;  2MO5 A;  1QWD A;  4XMC A;  4ARH A;  3APX A;  2LFU A;  1ZHX A;  1LIE A;  4IB7 A;  2FR3 A;  3IFB A;  3STK A;  3K19 A;  3VE1 A;  4IMO A;  4AZL A;  2FGR A;  2IFB A;  1FEN A;  4GKC A;  4LZU A;  3O22 A;  3S60 A;  5LJE A;  1E54 A;  2MHL A;  3CR6 A;  4ID2 A;  3BDR A;  3TZG A;  1XCA A;  5EEE A;  1IZN B;  5D47 A;  4O3W A;  1KQW A;  4ORU A;  3VG3 A;  3ZW0 B;  4MIS A;  2NND A;  2Q4N A;  1IIU A;  1GX9 A;  4ALB A;  2XTR A;  2PY1 A;  2HLV A;  4AZP A;  1AQB A;  1B8E A;  2KTD A;  3POQ A;  1AVG I;  1EAL A;  4FGI B;  4U8U M;  4PUX A;  1D2U A;  1FTP A;  4O3Z A;  2FR2 A;  5LKE A;  3VZW X;  1EIO A;  3LV4 A;  1SMP I;  2K62 A;  3UEX A;  2RN4 A;  4O4S A;  4RUN A;  2X8T A;  4D6A A;  2Y2X A;  2LHF A;  2AT6 X;  3RWX A;  1JJX A;  2AL0 X;  2A2U A;  1TXL A;  2ZAI A;  3FEK A;  3PPT A;  4ORW A;  1P4T A;  4FMS A;  3T24 A;  2JU7 A;  1YUP A;  1XKI A;  3FLL A;  3U9P C;  2KC0 A;  3D4R A;  3UAQ A;  1QG5 A;  2KW1 A;  5L8I A;  5HZ8 A;  1MVG A;  2FWV A;  3STM X;  1URE A;  2ANS A;  2GJ5 A;  2NNE A;  4IB8 A;  3JSQ A;  3ZUI A;  1SA8 A;  4GH7 A;  4NNS A;  3SZV A;  1OEJ A;  2XKL A;  1ICM A;  3P6G A;  2WEW A;  2KDY A;  3VY8 X;  1PM1 X;  2JMB A;  3EBK A;  3FA8 A;  4OMW A;  3VG5 A;  3U0D A;  1G90 A;  4XMD A;  1FEL A;  4ORX A;  5HBS A;  4LKP A;  3HW9 A;  4AYM C;  4U8U O;  2QO6 A;  2QO5 A;  1RBP A;  4AKR B;  4NYR A;  3AA7 B;  2GE4 A;  5DL5 A;  2OFM X;  1KQX A;  4PJ2 A;  4CK4 A;  4YH0 A;  2MM3 A;  1GKA A;  1G85 A;  1Q9G A;  1YWB A;  1O1V A;  3HOE A;  2GC9 A;  1GFQ A;  1KGL A;  3RKG A;  4QZT A;  4AZN A;  4YBU A;  2Z4H A;  3FMZ A;  1I05 A;  4NLJ A;  1VYF A;  1ALB A;  2MWH A;  5HWZ A;  1EUO A;  1JBH A;  2J4U P;  4I6S A;  1QFT A;  1LIF A;  3EYC A;  1OEK A;  4AKM A;  3AA7 A;  4O3X B;  4GCQ A;  4JCH A;  4O3Y A;  4EEJ A;  2RQ0 A;  4I9S A;  3LHN A;  5IO6 A;  2XE3 A;  4XNK A;  1QFV A;  3SOT A;  3SAO A;  3CMP A;  3V8U A;  4CV7 A;  2WEX A;  5D48 A;  4KT5 A;  3WJB A;  4N58 A;  1ERX A;  4I9R A;  1T0V A;  4IAB A;  5HZ9 A;  4ZHC A;  2BT9 A;  4JGL A;  2L67 A;  2Z4I A;  5JDP A;  4AKR A;  2O62 A;  2LFO A;  4LKT A;  4ALO A;  1KZX A;  3WBG A;  2W81 C;  5B29 A;  1YP7 A;  5D5D A;  3AKM A;  2Q39 A;  2K4T A;  1GT1 A;  4OMX A;  4Y0R A;  2YG2 A;  4ODD A;  5AEO A;  1GFM A;  3C77 X;  4BUM X;  3NQ9 A;  5BVT A;  1SXY A;  2CZT A;  3ELZ A;  3WI5 A;  4D6B A;  1HN2 A;  1SY3 A;  1BBP A;  3DSZ A;  4ZHF A;  1JV4 A;  3ZW1 B;  2N93 A;  4GZV A;  2Y0H A;  5LJK A;  4FZN A;  1KXO A;  3APU A;  2Y0L A;  1LNM A;  3BSZ E;  1G74 A;  3F9D A;  4XMG A;  5HA0 A;  5HCC C;  5LJB A;  5F6Z A;  1QQS A;  1YWD A;  5AJC A;  2XTQ A;  3AA0 A;  3DA4 A;  1B0O A;  2KZ7 B;  4GF4 A;  1YWA A;  4MVL A;  2FS6 A;  4MIR A;  1OEE A;  4NYQ A;  3TGA A;  3LK3 A;  3K3L A;  1GKA B;  3VZT X;  1JYJ A;  5HZQ A;  3PQU A;  4OS8 A;  4A8Z A;  2K23 A;  1ZHW A;  4DQ3 A;  3ZW1 A;  2F1V A;  3OE3 A;  1S2P A;  4U8U N;  1QY1 A;  3PH6 A;  2N2M A;  3ZW2 A;  4KR4 A;  3AA1 B;  2GTL M;  1VYG A;  4G76 A;  3WOV A;  1DV9 A;  3KZA A;  2HZQ A;  4ZHD A;  2KZ7 A;  4TLJ A;  4A1H A;  3FW5 A;  2WWP A;  1MM5 A;  2M06 A;  1LF7 A;  1HXT A;  3CQN A;  2A2G A;  2AMM X;  1ZHZ A;  1E06 A;  1HMT A;  3KQ0 A;  1UZ2 X;  4KCA A;  1U0X A;  3I17 A;  1ZHY A;  3FIQ A;  5FQ8 E;  1SY1 A;  1U17 A;  2HYS A;  2OFR X;  4ZH6 A;  2WSJ A;  2FLJ A;  4LSE A;  4YDA A;  2MNH A;  1BEB A;  4EFG A;  4IAW A;  1I4U A;  2R74 A;  2X27 X;  7PRN A;  2ACO A;  1LID A;  1ZNE A;  3B2K A;  2RCT A;  1HQP A;  4U3Q A;  1X71 A;  3P6E A;  1X8O A;  1OPF A;  5ADX L;  5DL8 A;  4YCE A;  3P02 A;  2OVA A;  4I3B A;  1BSO A;  5L8O A;  2O4V A;  1TVQ A;  3PEC A;  4FSO A;  3CQR A;  1OBQ A;  3FYX A;  3RSW A;  2FRS A;  2FTB A;  1H6S 1;  1PRN A;  5BYP A;  1Z24 A;  2JOZ A;  3KVD D;  3NSG A;  1X8U A;  4RUU A;  1E00 A;  2KXP A;  4FT6 A;  1NGL A;  2PRN A;  4WBK A;  3LK4 2;  4M7M A;  1YWC A;  5EE2 A;  4KII A;  4FUV A;  1OSM A;  3GE2 A;  1TOU A;  1GX8 A;  4COT A;  3FW4 A;  1DZM A;  2FT9 A;  4WFV A;  3CBS A;  3FEL A;  4I3D A;  2LBV A;  3SYB A;  3FEP A;  1X8P A;  5CYB A;  1GGL A;  2CBR A;  2RCQ A;  4QNI A;  1MDC A;  2J1N A;  4GE1 A;  4AFK A;  2KT4 B;  4YKO A;  3HWF A;  2AH7 X;  3WXQ A;  4ES7 A;  3D97 A;  4TNN A;  2XG6 A;  2NP1 A;  2XST A;  1DF3 A;  4D65 A;  3NQK A;  3RZY A;  1LIB A;  2AT0 X;  4WHI A;  2Y0K A;  3VG4 A;  3VU1 A;  4WFU A;  4AZQ A;  3PRN A;  2LBA A;  3B2J A;  4I95 A;  4NNT A;  4UU3 A;  4OS3 A;  3PQS A;  1GT3 A;  1G5W A;  5BVQ A;  3FYF A;  1U18 A;  3PP6 A;  1O8V A;  2Y7S A;  1GFO A;  1T8V A;  3CWK A;  3PH5 A;  1NP4 A;  3C5O A;  3DA3 A;  5LJG A;  2Q9S A;  1ZNK A;  4TKH A;  3TGB A;  1H91 A;  3ZZV A;  1BWY A;  1HMS A;  4ZCB A;  4YKM A;  3O19 A;  3D96 A;  2ZFG A;  3AAA A;  2DM5 A;  5FFH A;  1ZNH A;  1MPF A;  1CBR A;  4LZV A;  1KT6 A;  4KC8 A;  4U9C A;  3UEV A;  4ON1 A;  2KXP B;  4RLC A;  1L6M A;  2MHD A;  2CM9 A;  1DZJ A;  1VPR A;  3HWG A;  3P6C A;  5F7G A;  4EXZ A;  5GV0 A;  4KR8 A;  5ADX K;  1ML7 A;  3BLG A;  5F1E A;  5H8T A;  5HZ6 A;  4FBV A;  4TKB A;  4OS0 A;  2JN3 A;  4D5U A;  3DTQ A;  1Y9L A;  3EBW A;  2GTF X;  2L68 A;  1CJ5 A;  5IO5 A;  4QAE A;  3LK3 B;  4QQ1 A;  1SY2 A;  2M07 A;  3WJD A;  5LJC A;  3LK2 B;  4E1S A;  3JQO A;  2BLG A;  4QZU A;  3VPJ E;  4IB6 A;  3BX8 A;  3BX7 A;  2N2L A;  3SZD A;  3PED A;  2WUT A;  4YMY A;  2JMM A;  5PRN A;  4YFQ A;  3FR5 A;  3ZWE A;  4RJW A;  3NPO A;  4AUI A;  5CE4 A;  3U03 A;  4TJZ A;  2QTK A;  4BQU A;  1FE3 A;  4GDZ A;  2XMX A;  4FSP A;  4QGX A;  3H3I A;  1EXS A;  4G75 A;  5D8J A;  1X8Q A;  2ACP X;  2WQ9 A;  3P6F A;  3Q6L A;  4XMH A;  3UEU A;  2P8G A;  4A1Y A;  4GCP A;  4HWM A;  3VG6 A;  1TW4 A;  4IMN A;  1ZNL A;  3F8A A;  2A13 A;  3QKG A;  5DL6 A;  3KFH A;  3NX1 A;  2XE1 A;  5FEN A;  1HBQ A;  4FBO A;  8PRN A;  2R73 A;  3ZQ3 A;  3AAA B;  2JU8 A;  5AJB A;  2RA6 A;  3JTY A;  4QRL A;  3EMN X;  1IKJ A;  4L1N A;  1DZP A;  4ZHG A;  1CBS A;  1O1U A;  4AYI D;  1LFO A;  1QJ8 A;  1ZNG A;  2F1T A;  3UPG A;  1GT5 A;  3RBH A;  3APW A;  2OVS A;  5KIC A;  4HFO A;  4N59 A;  3SY7 A;  1GXA A;  2A0A A;  3G7X A;  1S7D A;  2Q2P A;  1MX7 A;  3I0A A;  3WJF A;  4AYD C;  4AYN A;  5IYU A;  2GTL O;  4MVI A;  1BSY A;  4NLI A;  1CBI A;  3SYS A;  3KFG A;  4HPD A;  5D45 A;  3TF6 A;  4YFP A;  1FDQ A;  1GT4 A;  2AKQ A;  3EMM A;  4TQ2 A;  4C69 X;  1BRQ A;  3UEW A;  1KT3 A;  3BRN A;  2BHV A;  1QJ9 A;  2POR A;  3WJC A;  3O0E A;  2F73 A;  5EED A;  3VY9 X;  4O9S A;  5FAZ A;  1EI5 A;  1ERB A;  4O49 A;  4TKJ A;  2F09 A;  3ZI8 A;  4XME A;  5HAE A;  3VE2 A;  1T68 X;  5DG4 A;  1JIW I;  3GP6 A;  4L3R A;  3HK1 A;  3BU1 A;  1BXW A;  3AA6 A;  2RD7 C;  5FVN A;  4GU8 A;  4ZHH A;  3VZU X;  2JW1 A;  3POR A;  3RBY A;  4ZGU A;  2HNX A;  4FZL A;  2BS5 A;  4YGZ A;  3ZW0 A;  4ZR2 A;  3KFF A;  1Q9F A;  3ZUO A;  1A57 A;  1SXX A;  4FOZ A;  4IB9 A;  5AFU K;  4EQA C;  2A3F X;  1PEE A;  4RL9 A;  5FQ6 E;  1OBU A;  1OPB A;  1AB0 A;  5HZ5 A;  2ZLD A;  3VG7 A;  3D95 A;  4ZFX A;  4LSI A;  3POX A;  4ZGF A;  5H9K A;  4AZM A;  3NR3 A;  1GFP A;  4LSH A;  3ELX A;  1KT4 A;  4GHB A;  1MUP A;  3BS2 A;  4AYH A;  5LKF A;  2YPV A;  4JFB A;  5T5F A;  1JZU A;  1HBP A;  3OBL A;  1HXU A;  4LSF A;  1BT9 A;  4QGV A;  3N91 A;  5HA1 A;  3HWB A;  2KTS A;  5KHP A;  3POU A;  1YP6 A;  2CZU A;  3T20 A;  5DPQ A;  3O2Y A;  4R0B A;  3P6D A;  1CRB A;  4QYN A;  2POA A;  1HMR A;  3TGC A;  4D64 A;  2OVE A;  5B27 A;  1GFN A;  3MBT A;  5H9N A;  1ZND A;  3GAQ A;  1BH3 A;  5IO7 A;  3L4R A;  3TZS A;  4M6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...