3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
1IZNA 3AAEA 2KXPA 3AA1B 3AA6B 3LK41 2KZ7A 5AFUL 3AA1A 3AA6A 3LK2B 5ADXK 4AKRB 3AAAB 3AA0B 3LK2A 4AKRA 5AFUK 3LK42 3AAAA 3AA0A 3AA7B 1IZNB 3AAEB 3LK3B 5ADXL 2KXPB 2KZ7B 3LK3A 3AA7A
chains in the Genus database with same CATH superfamily
4QH5A 4JI1T 3BQIA 2KXPA 3NRXA 3I0QA 3WAKA 2CXFA 1MM5A 3VRAA 2M07A 5AQVB 2SPCA 2X0YA 5J1GA 4YSYA 1N36T 4XAXB 5C3JA 3I0OA 2R88A 4IE5A 2OA5A 2Y6XA 4BJMA 4B61A 3SZDA 3NKZA 4BA9A 3AEAA 3AB3B 4YXDA 5E0OA 4CQIA 1D0ZA 2VB6A 4HWHA 3UU3A 1THQA 5F5WA 5TAOA 5HXEA 3WI5A 5FY7A 2W61A 4YHHT 2DWGA 4TNVA 3SYSA 4U9CA 3V5SA 2BVMA 1H6S1 3RYCE 1WRDA 4K0KT 3LSVA 1CHUA 1OEDC 3PURA 2BG9E 2EHOC 2J47A 4HKAA 3ZC0A 2A3DA 3ZYKA 2W62A 4DV2T 5GONE 4DUYT 3X1DA 4FMSA 1D0YA 2CBIA 3B13A 3PUWF 2HN2A 4AYNA 4U33A 2CHNA 4U31A 4DIDB 2R8AA 4GCSA 3VY9X 2OMFA 2FJEA 2PG8A 2V1DB 4DR3T 2MOZA 4J2CA 4FQEA 4X1KE 3AA7B 2KWIB 2JMHA 4QKNA 4WNKA 3TLUA 2WJRA 1XZYA 2YDQA 3V5UA 2V5CA 4X62T 4H9RC 2PRNA 3T20A 4YSXA 3EI0A 5TISO 3H37A 2J62A 4N78D 4AKMA 1MPFA 2V7MA 2L3LA 2IHR1 4FI5A 5LP6E 5HAXA 4UR9A 2YK0A 2J4GA 5LHIB 4O3ZA 3DWOX 4B3ST 2EHOD 3P7IA 4A97A 3C50A 4AKHA 3ONLC 2X51A 2NW7A 4FZMA 3RQWA 2X67A 2LM2A 2V6YA 5FXXA 3SWHA 4HWDA 4FSOA 3LK41 5AQNB 2L9QA 4PJMA 3ZCJA 1HXUA 1ZHXA 4JV5T 3LJCA 1SA0E 4RL9A 5ADXK 2CHOA 3M65A 4IDPA 4RJXA 3UU5A 2WP9A 2WM9A 3PDYA 1ORMA 2XAQB 1JNRA 2V26A 3DZMA 2X0LB 3RC3A 4F4BA 3Q9DA 4UEMA 2KWHA 5JR9B 1FJGT 1NWMX 1J1JA 2XE5A 3N9PA 4ILBA 5GTIO 3ZJ2A 4TZ4C 3NJTA 5AQOB 4X20E 2VWAA 1R8IA 4EAHA 2VKJA 3C98B 2LSIA 4NPPA 1Z0PA 2X9HA 1VOMA 4UXNB 2A2FX 2CLYC 2Y48B 3C4WA 1W9RA 2PFVA 5LG3A 4I55E 4N58A 2IAKA 5L3FB 2A72A 5L4EA 4GHBA 3ZMSB 5B66O 4IE7A 2DWKA 2BKNA 4C90A 1KF6A 5HEGA 5HWYA 3Q5DA 2WS3A 5F3JA 3ZMUB 3PUAA 4TN7B 1MIWA 5AQFB 4TWFA 4X64T 4ZZBA 4HE8A 1XNRT 3ANWA 4E7ZA 1GQEA 1S35A 4DR7T 2UUBT 5KAIO 4JLEA 2DCFA 2MHLA 1Z8UA 2W67A 2B1EA 3EDUA 2CPTA 5L3GB 3N2KE 2VKOA 5IHYA 3K3QC 3QNUA 4H9NC 3T0SA 5HEUA 1MMNA 3MXZA 5JDGA 2KT9A 5KAFO 4PFOA 4GK5E 1WYCA 2UXBT 4D65A 1UK5A 1BR2A 2WB5A 2Y7SA 4HFBA 2YNKA 2Q9QA 2G0UA 4DBQA 1WYBA 2BS4A 5ETWA 4IIJE 1ZOYA 3ZT5A 3DWNA 4JEUB 1GFOA 4TV9E 3AA1A 2JQKA 1BT9A 5JDQA 3HWBA 2I0MA 1T72A 3P4RA 1MIYA 5L3DB 1QJPA 4AQGA 2LE8A 4HN9A 5EK3A 1X9BA 2FGQX 1FIOA 3OPCA 4U3CA 2CCQA 4MALA 5F8PA 4DV6T 4ZS2A 1UCUA 3PF1A 4YY3T 4G63A 4IT4A 4O4LE 2C0SA 5M4YA 4CN1A 2FJAA 3O1IA 4O8SA 4EOZB 2C5KT 3CIRA 5JDFA 4L5GA 5ADXL 1HG2A 3E08A 2BS2A 4HWIB 3ZN1B 3AXJB 3RX6A 1KEYA 3RQUA 2WDRA 4C4VA 3KVDD 4JI2T 3BQKA 5FY1A 3RHWA 2BVLA 2XQ5A 3KV5A 1T7SA 2LRLA 4PFPA 4IL4A 3AE3A 5IUXA 2DI4A 2YU1A 5LBMA 2LRKA 4U72A 5LMNT 5FXZA 2LKHA 2Y2XA 4IDNA 4QQ1A 3SRZA 4TV8E 3AE5A 2BG9A 2JQHA 2HHHT 5FYMA 1M62A 2CMRA 5AQKB 3A7MA 1KNRA 1U4QA 5JRCA 5AQGB 1GFQA 4C91A 1VCSA 4IDZA 3UPGA 2WMOA 2VKDA 3EHZA 4CXYA 1IZNB 1Q9GA 2NTXA 3OYXA 4ANJA 4UB6O 1OEDE 2X9KA 4DR6T 5LHGB 1G90A 4XNKA 5JDNA 2Z6EA 3F31A 4GK0E 2V8SV 3K8PC 4NXMT 4K3BA 4Z3TA 4QWNB 2BBHA 2XTLA 2B76A 4RLCA 1QJ8A 2NW8A 3JCUO 3POXA 4H9SE 2R4LA 4GIWA 4ILUA 6PRNA 4ZI3D 3KDSE 2N1GA 3AE6A 3DA3A 2VQFT 3E22E 4KR4A 2BBJA 3LK2A 3BQLA 4HWFA 3ZT6A 4EB6E 4LF9T 3OYZA 4F8HA 4KX6A 3A2SX 3ZC1A 1WFDA 3BK9A 2E8IA 5H2FO 3GN5B 3HOLA 5AQJB 3PU3A 5JTGA 3NSGA 4UV9B 3SOLA 1MNEA 2V7JA 4QXCB 3O9XA 4WYVA 3K19A 5L2LA 4PK5A 4GYRA 5L3CB 5D5DA 3WU2O 4BJNA 3JADA 3RC8A 4DV3T 2PJQA 3ZJ1A 3CK6A 1LRZA 2I6HA 3RF1A 2XQ9A 3NWIA 5CJ5A 3UU8A 1VRBA 2E2AA 4PJJA 2H89A 5EK4A 4COFA 2E5VA 2Y0KA 3VY8X 3NVOA 5EE2A 2KZ7B 3N2GE 3AAEA 5L4HA 5CA0E 2ZM2A 3DJBA 5JDLA 2ZLYA 3AE7A 4UF0A 4B6XA 4AXPA 5FY0A 4DUZT 2XQ6A 1US7B 4PUXA 4AYID 3QK6A 4RJWA 5FL0A 2BS3A 3UU4A 2VL8A 3PUSA 3RIUC 3KFWX 3H3AA 2H7OA 2X9XA 4TUYE 4DV1T 2XM2A 3AVSA 2RPAA 3RYHE 3ZEFB 2ES0A 5G26A 5LB7B 4IE6A 2K9AA 5HXCA 1G73A 2FJDA 1PRNA 5EK2A 3N2OA 2XSBA 5DQWA 4ZHQE 5JDHA 1ZHWA 1ZKEA 1HNZT 4YTPA 4HFDA 3NZQA 4AZLA 2ZM0A 5IWAT 3MACA 2D5UA 3MK7C 1B7TA 5L3EB 1N34T 4A56A 4FJOA 2LFUA 3Q5WA 2HPLA 1D1CA 4TWDA 3A0HO 1FEWA 1HNWT 1BH3A 4AQYT 4JFBA 1OPFA 1J5WA 3VKGA 3IA3A 2MBGA 1D1AA 4ISTA 3ZYMA 4CI3B 3HKEE 1KNPA 4F6RC 2XUEA 3ZPOA 4UVAB 4ZI2D 1G8XA 1OSMA 4IE4A 3PQUA 2NW9A 1P4TA 2N2LA 5JVDE 4PNIA 3PTRB 5LJMA 5JH7E 1YD8G 3VRBA 2X9YA 3VHLA 2XE2A 3PUGA 3TLSA 1UX5A 1HNXT 3UTKA 2XE1A 3OVUA 2CEAA 2NTYA 2J1DG 1I6ZA 4X1IE 3HOEA 3VR8A 8PRNA 4MLKA 3Q2MA 4EIWA 3P4QA 3P50A 4WBOA 5LGUB 5JQGE 4AQFC 1XMOT 4DO0A 2CA5A 4DMWA 4A5XA 4P09A 4B3MT 2XSAA 4AYDC 4O2BE 2CXDA 5DABA 3SYBA 4JI7T 4AKRB 4Q25A 4FRXA 4KBMB 4UELA 5LG4A 3QUJA 1YQ4A 3U78A 5FVKA 3OTOT 4LF6T 4D64A 3SFDA 2A9UA 2KC0A 2LKGA 3PGUA 4EGWA 3AA0B 5A1LA 5G39A 3KV4A 1HCIA 5T5FA 3VKHA 4HFIA 2XAHB 5HCMA 3UULA 2P9BA 3ZYLA 5J2TE 4FESA 4JI4T 4JBWF 2K0LA 2XMXA 2J4UP 1NAFA 1OEDA 2EHOA 3ZMZB 5LJNA 3AAIA 4WBNE 2E9XD 3GWHA 5AFUK 5ABFA 2K48A 4KUMB 2K4TA 3C4XA 3C64A 5CA1E 2JPFA 2X9WA 2XJ7A 4TX5A 4DV4T 2GE4A 3FYXA 5AQRB 1UUSA 4O3WA 3VE2A 4X65T 2XY8B 1DU2A 4GYSA 4OFZA 3N9OA 2LSGA 5CGMA 5AQPB 2W00A 3LG7A 2LHNA 2CBJA 3SS1A 4YTNA 1E1HB 3W15B 3FZKB 4DVDA 5DL5A 3TLTA 5H6RB 1HS7A 4IREA 1QUUA 2VK9A 3MJXA 4A98A 5FVLA 2Q9QD 2JMMA 1HF8A 2UXXB 4YFSA 4AQFA 3ZKRA 3PE0A 3RI5A 1ZHTA 3HA4A 3D0TA 2VQET 3IEEA 4EEBA 3EVYA 4NUVA 2D9DA 1HTJF 4GF4A 4JI5T 3DP7A 1L0VA 3AE4A 3RBHA 3OJAA 3CWZB 4HTEA 4M1PA 3RGLA 1BR1A 1AJ3A 3AAAA 2MTQA 5ABEA 4WZXA 2VVNA 5CFBA 4P0BA 4IL9A 1MMGA 4O49A 3C51A 2MNHA 2FUPA 4ZEYA 3POUA 3CMLA 4UV8B 5HXHA 2WY2A 4DNDA 4K3CA 2QRXA 2ZLDA 3G06A 3CPZA 2ODVA 3TLVA 3PU8A 3VR9A 2V5DA 5FXWA 4AI6A 2WWVA 1SE7A 3EAMA 1YKHB 2IMLA 3UUNA 4DV0T 3I9YA 3PJAJ 1ZV4X 2CWOA 5C2TA 1HX8A 1WCRA 3AA6B 5C8YE 5B5EO 2DHRA 1BXWA 2LM9A 5HEOA 4U74A 4NUUA 2HN1A 5KXJA 2L8KA 1HXTA 3KINB 3UAQA 5JREA 3EDVA 3I9WA 3VZUX 3MKDA 3QRCA 4QXBB 5AFUL 3JC6D 4HFVA 2K3WA 3MZKB 3PJAA 4G2AA 4ZI3C 4Z90A 2VL0A 4V1Av 1OWAA 1N33T 4HGAA 4LSHA 2NP9A 2KSRA 4AFKA 2XTQA 1IAPA 4HFHA 3ZT7A 5GTHO 2LOSA 4D5UA 5G3AA 4BUMX 3AE9A 3PUZF 4KI0F 1HXXA 4IDQA 1WLXA 4JUYA 2M6BA 4EZ4A 4DV7T 3ZLIA 3NZPA 4CXXA 3H3MA 4XNLA 5LOVE 5CB4E 4UVCB 4IGUA 3PRNA 4YHJA 4JCHA 5JR9C 3P8CD 2I59A 5AQMB 2E9XB 4C69X 4MBQA 3ANWB 3RLFF 3CX8B 4E7SA 2DLRA 1GFMA 4HWCA 4H63V 2MPKA 1XNQT 4AKIA 4LFBT 3ETVA 3PUXF 2R4OA 4ASKA 2QVAA 3A8YC 4LMKA 4Z8XA 1HG5A 1NENA 4O4IE 3LDQB 5LMUT 5GV0A 2MAWA 3UU6A 1JNZA 2D2SA 2XTRA 3PUQA 3DTOA 2CM0A 1W0BA 4O4HE 2ZMAA 1YS5A 4IDOA 2UUCT 5HEHA 4DR1T 5FKYA 4ZS3A 2W66A 3AA7A 5KDMC 2MYSA 4WW0A 2Q9QB 4CXWA 2F1VA 2XQ8A 3O1JA 3O0EA 5LXTE 4KHZF 1XWMA 5IYUA 3GMIA 2IW5B 2HH7A 2XASB 2QTKA 3AE8A 3CX6B 3SZVA 2JMKA 3HL6A 3CQGB 2LHFA 3MA9A 4O4XA 4AKRA 4B3TT 4HEAA 4XBFB 5KMGP 1SUMB 1KFYA 3F2EA 2XAJB 3VE1A 2XQAA 3L8RA 4JI8T 4L9IA 3C5OA 2VKHA 3HKDE 2LSYA 3LFMA 4LFCT 2XQ7A 1H7CA 4KP3C 3B5MA 4TNWA 4XZCA 3QOFA 5HWXA 3T1HT 2XQYA 2XAFB 4PJNA 4C4VB 4PJ0O 2ODUA 5JR9A 4LSEA 3AVRA 2WZHA 4ZI2C 1LKXA 4DR4T 4FOZA 3PGRA 4N74A 2ACXA 1ZP0A 2KLQA 4DV5T 2R89A 2X0HA 2XHEB 2YKSA 3P4PA 2H7VC 2IIUA 2WMNA 3N9QA 3L3PA 1MIVA 4H9OC 2KNDA 2F4VT 5AQIB 2CE7A 1HFAA 2C5IT 3PQSA 1OXZA 2BG9B 4H9QC 2Y8DA 4OX9T 4O3XB 1E54A 3SFEA 3NBXX 4I43B 3UFGA 4DR2T 5JRCB 1UURA 4PW8A 5AQHB 2W63A 1IJ6A 2NWBA 4PJLA 4CN4A 3FBLA 2N2MA 1ZHZA 4AYEC 5JDMA 1IJ5A 3UUBA 3A0BO 1ZEEA 1S5LO 1E2AA 4C00A 4JYAT 3CQXC 3KZIO 3OBVE 5JDPA 5IYZE 5AQUB 5AQLB 2ERVA 3T8OA 1S94A 4YJ3E 4Z91A 1MMDA 2F1TA 2X68A 4NXNT 4QXHB 2W2UA 2OLTA 4CI2B 2XQ4A 3AECA 4DMVA 3SY9A 1WR0A 2LLYA 7PRNA 2YEVC 5J0ZA 4CN6A 2M06A 2AXDS 4MHCA 3LK2B 5G38A 4KMCA 3RRWA 4EYYR 1YXRA 3TZGA 5AQSB 4KRAA 2XM1A 5LHHB 3KV9A 5BMVE 1CUNA 2E9XC 2XQ3A 3LK3B 4YLHA 2UUAT 1QSDA 3GA8A 3Q5XA 2LSJA 4DBRA 3RIUA 2IDOB 3UQ4A 4IHJE 2XG6A 2ZM8A 4EEDA 3KV6A 1UX4A 5LYJE 2W4XA 5AQQB 4P1NA 2RP4A 3E0ZA 2M6IA 2NR4A 3EMNX 5KX5E 5J2UE 2DL1A 1GFPA 2RA1A 1QJ9A 4FZNA 4UVBB 4PR7A 5HYAA 2UU9T 4LSFA 4JI3T 3RRCA 3LBXB 2K24A 1YW0A 2CWYA 4FT6A 4AUIA 3ONXA 3AA6A 1W0AA 3AXJA 3HR0A 1IBKT 1I94T 3ABVA 2LHRA 3PV0F 1FMWA 3CVRA 3CX7B 1QLBA 2Q9QC 4FSPA 4ADZA 4I4TE 4KHPT 2XZEA 3AAEB 1IBLT 1T98A 4G75A 5FVNA 4ZI7E 1ZHYA 4LF8T 3RYIE 2QA7A 4UF0B 3R6NA 3G7GA 4JEHB 2D0TA 4AYMC 2WDVA 2IC9A 2WAUA 3QB5K 2N2NA 5LGNB 2XAGB 2FGRA 2KXPB 5AQTB 3O1HA 1T16A 3IHRA 3SY7A 2W0GA 5L3BB 4OK0A 2KINB 3QC9A 4X1YE 2YN6A 3FZHB 3AEFA 2ACZA 4ZOLE 5DL8A 3CQCB 2JJ9A 1IZNA 4YSZA 3HI2A 5HEJA 1E7PA 3Q5EA 2LOPA 2VASA 3BRYA 3J7Yq 5DL6A 1Y64B 2E9XA 2BDEA 1N32T 3JCFA 2UXNB 3KBTA 2WJQA 2JQQA 3T1YT 2E5LT 2H3RA 3FZMB 1KK7A 1LVFA 2WCAA 2AE9A 4FRTA 1HR0T 3FBZA 3KVBA 4ISSA 2F1CX 4U2ZA 2FBWA 1WR6A 1X79A 2LT3A 3NRYA 4UB8O 3KBUA 4TWHA 5FNVE 2CXLA 3ONJA 1LVKA 2DNXA 4BAYB 1FMVA 2BG9C 2R4NA 1VCTA 3PGSA 3WI3A 3UFEA 2W80C 2BZBA 4LF5T 1D0XA 4GCPA 2ODJA 3GN5A 4L0RA 2YPVA 1BR4A 4ILAA 3ETUA 2LEHA 4QX8B 2WVPA 3JC6C 2OV9A 4B3RT 1Q9FA 1ZHCA 3M3ZB 3S4UA 1XMQT 4ILCA 4IL6O 1MM4A 2AXTO 3RIFA 3L39A 4EXTA 3AEBA 3PUYF 2J1NA 4E1SA 1T8BA 2WU5A 2R4PA 3QB5A 3JTYA 3EUHA 3UT5E 2CRBA 2W81C 3ESLA 2IWWA 4X66T 2BKPA 2C5JA 2V6XA 1J5ET 2WSSV 2ZM6T 3K3OA 3VU7H 2KMFA 2JRKA 4LSIA 2VURA 4I0UA 4H9PC 4OYKA 4FUVA 3AEEA 4DR5T 5FMNA 3OKQA 2LSKA 2YINA 2KZ7A 5FL1A 4PAGA 3BS0A 1D1BA 3FXDB 1NEKA 2WQYA 3N5LA 3ZSTA 2V6YB 4CI1B 1YKEB 2JQYA 3FXEB 5DQVA 3IBPA 2VVSA 5E79O 3TKLB 3RKOA 4I50E 3TLWA 3HW9A 4ZXLA 3HKCE 4YTMA 3ZSSA 5LBQB 4MFRA 4LMLA 4PK4A 2X66A 3R84B 3KVAA 5HXRA 4LF4T 2HPJA 3IF8B 3RH3A 2PTFA 3JAEA 1U5PA 2QYWA 1HX1B 1OEDB 4P0AA 5LA6E 3RPUA 2EHOB 4N59A 4YJ2E 5ABFB 3ZMVB 2YDRA 3K3NA 3BRZA 3QRAA 4N75A 3P4SA 4X5TA 4HFEA 4AKLA 5EZYE 2JQ9A 4EYUA 3FHNA 3JAFA 4LMJA 3PUVF 1SHZC 4QX7B 2WU2A 4ZZCA 3CKDA 3P4WA 3J9X1 3B57A 3HKBE 5ABGA 5BR8T 4U7YA 2YOEA 3EABA 2IUBA 2K5BB 3A5XA 2V7IA 2M67A 2WBLA 2ZFGA 4JI0T 3L09A 3FZFB 1V9DA 4UIGA 3RKGA 2N9DA 2WWUA 4NIQA 3UU2A 1YQ3A 2D0UA 4YT0A 2UXCT 1PHOA 4CZZB 5L47A 1MMAA 3N9MA 5DJQC 2O4VA 4E1TA 3LK42 2NOXA 3ZCIA 5PRNA 4EZHA 1O3XA 2H88A 3AEDA 4AISA 2FJBA 3GP6A 2WDQA 3VZWX 3UQ7A 4PK6A 5ABHA 2KDYA 2WZIA 2UXDT 3FB2A 2BKOA 1Y01A 4GKKT 1BR0A 1XDOA 1IBMT 3AAAB 4H63H 4O3YA 3O4XE 3C4ZA 1XDPA 4O2AE 4LFAT 4IE0A 3RYFE 5DL7A 5LGTB 3V8UA 4CTDA 5HXSA 4AIUA 3UUMA 3ZN0B 3DA4A 5LNKA 3LK3A 3AA1B 1T1LA 1MNDA 3POQA 3UUXB 3VZTX 4OYJA 2QGSA 4QHOA 2YU2A 4G76A 3I1AA 4U2YA 4GKJT 4RLBA 4QH4A 4OHFA 2PORA 5H6QB 4HFCA 2YDSA 3WAJA 4JI6T 1GFNA 5FP3A 2LJLA 5FXVA 3LBXA 4QH1A 3ZMTB 2Y0LA 2V7LA 2CLYB 4GOUA 4K0UA 3RIAA 5HCJA 4FZLA 3FZLB 1UGOA 3AA0A 2Y0HA 3AE2A 3AE1A 3N9LA 1EZ3A 2IWVA 2XE3A 1W09A 2X27X 4AKGA 4KR8A 2JIWA 4GCQA 3T24A 3F57A 2R6GF 4LF7T 2V7KA 4ERRA 1KNZA 3N9NA 3K1SA 4O4UA 3AEGA 1M7KA 2IC6A 3U3IA 3WI4A 5LCYA 2PBIA 4EV6A 2XPKA 3PORA 4U7IA 4O4JE 2GK9A
chains in the Genus database with same CATH topology
4O49A 2K24A 3BQIA 2KXPA 3NRXA 1YW0A 3C51A 5LHGB 3I0QA 3WAKA 1G90A 2CWYA 2MNHA 4FT6A 2CXFA 4XNKA 4AUIA 3ONXA 5JDNA 3AA6A 1MM5A 2Z6EA 3HR0A 3F31A 4GK0E 3K8PC 3POUA 3CMLA 2M07A 4Z3TA 4QWNB 2LHRA 1FMWA 2XTLA 4UV8B 5HXHA 2SPCA 3CVRA 5J1GA 3CX7B 4DNDA 4XAXB 4RLCA 2Q9QC 4FSPA 3I0OA 4I4TE 4ADZA 1QJ8A 3AAEB 2NW8A 4IE5A 2ZLDA 4H9SE 3POXA 1T98A 4G75A 5FVNA 2OA5A 2Y6XA 4ZI7E 3CPZA 2ODVA 4GIWA 4BJMA 4ILUA 1ZHYA 3RYIE 4ZI3D 2QA7A 6PRNA 4UF0B 3R6NA 3PU8A 3KDSE 4B61A 3SZDA 2N1GA 3G7GA 5FXWA 4JEHB 3DA3A 4BA9A 3AB3B 2D0TA 3E22E 4AI6A 4KR4A 4AYMC 5E0OA 3LK2A 3BQLA 1YKHB 2IC9A 3UUNA 4CQIA 1D0ZA 4EB6E 2VB6A 2WAUA 3OYZA 3I9YA 2N2NA 5LGNB 1THQA 3A2SX 2XAGB 3ZC1A 1ZV4X 2CWOA 5TAOA 2KXPB 2FGRA 5HXEA 3WI5A 1HX8A 3BK9A 2E8IA 5FY7A 3O1HA 2W61A 3GN5B 3HOLA 3SY7A 2DWGA 3AA6B 3IHRA 2W0GA 3SYSA 3PU3A 3NSGA 4UV9B 5C8YE 5L3BB 2DHRA 4U9CA 3V5SA 2BVMA 3SOLA 3RYCE 4OK0A 2KINB 1BXWA 1MNEA 1H6S1 2V7JA 1WRDA 3QC9A 4X1YE 4QXCB 2LM9A 3PURA 3O9XA 2EHOC 4U74A 3K19A 5L2LA 4HKAA 4NUUA 4PK5A 4ZOLE 3ZC0A 2A3DA 2L8KA 4GYRA 3ZYKA 5L3CB 2W62A 1HXTA 5D5DA 3KINB 3UAQA 4BJNA 5JREA 3RC8A 3EDVA 3I9WA 3VZUX 2PJQA 5GONE 3ZJ1A 3MKDA 1LRZA 5DL8A 3CQCB 2JJ9A 3QRCA 1IZNA 4QXBB 5AFUL 1D0YA 4FMSA 3B13A 4AYNA 3HI2A 3JC6D 1VRBA 4HFVA 3MZKB 4G2AA 4ZI3C 2LOPA 4PJJA 2VASA 1OWAA 4V1Av 4HGAA 4GCSA 5EK4A 3J7Yq 3VY9X 5DL6A 2OMFA 1Y64B 2PG8A 2E9XA 4LSHA 2NP9A 2Y0KA 2V1DB 2BDEA 2MOZA 4J2CA 2XTQA 3VY8X 4X1KE 4AFKA 1IAPA 3AA7B 2KWIB 2UXNB 3KBTA 2JMHA 4QKNA 5EE2A 4WNKA 2KZ7B 3N2GE 2JQQA 2H3RA 3AAEA 2LOSA 1KK7A 1LVFA 5CA0E 2ZM2A 4D5UA 3DJBA 3V5UA 5JDLA 4FRTA 2ZLYA 3FBZA 3KVBA 4ISSA 4UF0A 4B6XA 4H9RC 2PRNA 4BUMX 1WR6A 3T20A 1X79A 2LT3A 4AXPA 5FY0A 3NRYA 3H37A 3KBUA 1HXXA 1US7B 4PUXA 5FNVE 4AYID 2CXLA 4N78D 4AKMA 3QK6A 1WLXA 4JUYA 1MPFA 1LVKA 2DNXA 2V7MA 2L3LA 4FI5A 4RJWA 4BAYB 5LP6E 5HAXA 1FMVA 2VL8A 2YK0A 3WI3A 3PUSA 3UFEA 4EZ4A 5LHIB 4O3ZA 3ZLIA 2W80C 2BZBA 3KFWX 3NZPA 1D0XA 4CXXA 4GCPA 5LOVE 2EHOD 3H3AA 3GN5A 4L0RA 5CB4E 2ODJA 4XNLA 2H7OA 2X9XA 3P7IA 4UVCB 2YPVA 4TUYE 1BR4A 4IGUA 3PRNA 4YHJA 4JCHA 5JR9C 3C50A 3P8CD 2I59A 3ETUA 2LEHA 4AKHA 2E9XB 3AVSA 4QX8B 3JC6C 4C69X 4MBQA 3ANWB 2X51A 1Q9FA 1ZHCA 3RYHE 2NW7A 3ZEFB 3S4UA 4FZMA 2X67A 3CX8B 5FXXA 1MM4A 4E7SA 2ES0A 2DLRA 1GFMA 4EXTA 4H63V 3SWHA 2J1NA 5G26A 4E1SA 4AKIA 3ETVA 4IE6A 4ASKA 4FSOA 3LK41 2K9AA 2L9QA 4PJMA 3JTYA 4Z8XA 5HXCA 1G73A 3ZCJA 1HXUA 1ZHXA 1HG5A 3EUHA 1PRNA 4O4IE 3UT5E 3LJCA 1SA0E 4RL9A 5ADXK 5EK2A 3N2OA 2W81C 3ESLA 3M65A 5GV0A 4RJXA 5DQWA 4ZHQE 5JDHA 2D2SA 2XTRA 3PUQA 2C5JA 2WM9A 1ZKEA 3DTOA 2CM0A 1ZHWA 2WSSV 3PDYA 3NZQA 4O4HE 1ORMA 3K3OA 3VU7H 2XAQB 2KMFA 4AZLA 2JRKA 2V26A 4LSIA 2ZMAA 2ZM0A 1YS5A 3MACA 2X0LB 3RC3A 2D5UA 4H9PC 3MK7C 1B7TA 5L3EB 4F4BA 4OYKA 4A56A 4FJOA 4ZS3A 4FUVA 3Q9DA 2LFUA 3Q5WA 2HPLA 1D1CA 5FMNA 5KDMC 2MYSA 2KWHA 3OKQA 4UEMA 5JR9B 2LSKA 1NWMX 2YINA 2KZ7A 2XE5A 3N9PA 3ZJ2A 4TZ4C 4PAGA 1FEWA 4WW0A 4X20E 2VWAA 1BH3A 2Q9QB 4EAHA 2VKJA 3C98B 1D1BA 2LSIA 4CXWA 3FXDB 4JFBA 1OPFA 2X9HA 1Z0PA 3VKGA 2F1VA 2MBGA 1VOMA 4UXNB 3N5LA 1D1AA 3O1JA 2A2FX 4ISTA 2CLYC 5LXTE 4CI1B 3O0EA 1YKEB 2Y48B 3C4WA 2PFVA 3FXEB 3ZYMA 5DQVA 4CI3B 5IYUA 3GMIA 3HKEE 4I55E 4F6RC 3IBPA 2IW5B 4N58A 2XUEA 2HH7A 3TKLB 3RKOA 2XASB 3ZPOA 2IAKA 5L3FB 2A72A 4GHBA 4I50E 4UVAB 2QTKA 3ZMSB 3HW9A 4IE7A 2DWKA 4C90A 1G8XA 3CX6B 3HKCE 2JMKA 3HL6A 5LBQB 4ZI2D 4MFRA 1OSMA 3SZVA 4IE4A 3PQUA 4PK4A 5HWYA 2X66A 5F3JA 3ZMUB 3R84B 3PUAA 3KVAA 4TN7B 3CQGB 5HXRA 1MIWA 2LHFA 2NW9A 1P4TA 2N2LA 3MA9A 5JVDE 4O4XA 4AKRA 2HPJA 4HEAA 4PNIA 3PTRB 4HE8A 4XBFB 5KMGP 5LJMA 3ANWA 3IF8B 3RH3A 1YD8G 5JH7E 3F2EA 4E7ZA 2XAJB 2X9YA 3VE1A 1U5PA 3VHLA 2XE2A 3PUGA 1UX5A 1S35A 4L9IA 3C5OA 3UTKA 4P0AA 5LA6E 3RPUA 2EHOB 2XE1A 2CEAA 4JLEA 2DCFA 2NTYA 2VKHA 3HKDE 2J1DG 4X1IE 2MHLA 2LSYA 3HOEA 4N59A 4YJ2E 8PRNA 4MLKA 3ZMVB 3K3NA 3Q2MA 3LFMA 3QRAA 2B1EA 4EIWA 3EDUA 4AKLA 5L3GB 3N2KE 2VKOA 5EZYE 4E1TA 4WBOA 3K3QC 5IHYA 4EYUA 1H7CA 4H9NC 5LGUB 3T0SA 4KP3C 4AQFC 5JQGE 3FHNA 1SHZC 4XZCA 4DO0A 2CA5A 5HWXA 4DMWA 4QX7B 1MMNA 2XQYA 3MXZA 3CKDA 5JDGA 4P09A 2KT9A 4AYDC 3J9X1 3B57A 2XAFB 4PJNA 4PFOA 4GK5E 1WYCA 2ODUA 4O2BE 2CXDA 3HKBE 4D65A 5JR9A 5DABA 3SYBA 4LSEA 1BR2A 2K5BB 3AVRA 4AKRB 2Y7SA 3A5XA 2V7IA 4ZI2C 1LKXA 2M67A 2YNKA 2Q9QA 2WBLA 4FRXA 4FOZA 2G0UA 4KBMB 4DBQA 1WYBA 2ACXA 4UELA 5LG4A 3QUJA 2ZFGA 3L09A 3U78A 1V9DA 5ETWA 4UIGA 2KLQA 4IIJE 2N9DA 4D64A 2XHEB 3PQSA 2WWUA 2H7VC 4JEUB 1GFOA 4TV9E 2WMNA 3UU2A 2KC0A 3AA1A 1BT9A 2D0UA 5JDQA 3HWBA 3N9QA 3L3PA 1MIVA 4H9OC 2KNDA 1PHOA 4CZZB 3AA0B 2O4VA 2CE7A 5A1LA 1MMAA 1HFAA 1MIYA 2C5IT 1OXZA 3N9MA 5DJQC 2LE8A 4AQGA 3KV4A 5L3DB 1QJPA 3LK42 4H9QC 2Y8DA 1HCIA 5T5FA 4HN9A 3VKHA 5EK3A 4O3XB 1E54A 2NOXA 2FGQX 1FIOA 3NBXX 4I43B 3ZCIA 5PRNA 2XAHB 4EZHA 5JRCB 1O3XA 4PW8A 2CCQA 4MALA 2P9BA 3UULA 3ZYLA 5J2TE 5F8PA 4FESA 2K0LA 2XMXA 3GP6A 2W63A 2J4UP 3VZWX 3AA7A 1IJ6A 4PK6A 1UCUA 2NWBA 4PJLA 4ZS2A 2KDYA 1NAFA 3FBLA 3FB2A 4G63A 2N2MA 1ZHZA 1BR0A 2EHOA 4O4LE 3ZMZB 4AYEC 5LJNA 3AAIA 3AAAB 4WBNE 5JDMA 4H63H 1IJ5A 2E9XD 2C0SA 3GWHA 3O4XE 4O3YA 5M4YA 3C4ZA 5AFUK 3O1IA 4O8SA 2K48A 4KUMB 4EOZB 2K4TA 2C5KT 4O2AE 1ZEEA 3C4XA 4IE0A 3RYFE 3C64A 5CA1E 2JPFA 5DL7A 5LGTB 3CQXC 5JDFA 4L5GA 5ADXL 1HG2A 3V8UA 2X9WA 4TX5A 5HXSA 3E08A 3UUMA 3ZN0B 3DA4A 5LNKA 3ZN1B 3LK3A 2GE4A 3AA1B 3OBVE 3FYXA 1MNDA 5JDPA 5IYZE 3POQA 3RX6A 2ERVA 3UUXB 3T8OA 4O3WA 1S94A 3VE2A 4OYJA 2QGSA 4QHOA 4YJ3E 3VZTX 1MMDA 4GYSA 2F1TA 2X68A 2YU2A 4OFZA 4QXHB 3KVDD 3N9OA 4G76A 2LSGA 3I1AA 4CI2B 2W00A 3LG7A 4RLBA 4OHFA 2PORA 2LHNA 5H6QB 3SS1A 4DMVA 3BQKA 3SY9A 1E1HB 5FY1A 3W15B 2BVLA 3KV5A 3WAJA 7PRNA 4DVDA 2YEVC 5DL5A 1GFNA 5FP3A 2LJLA 4PFPA 5FXVA 3LBXA 5H6RB 2M06A 4MHCA 1HS7A 3ZMTB 2Y0LA 3LK2B 1QUUA 2V7LA 2VK9A 3MJXA 2CLYB 2DI4A 2YU1A 4GOUA 4KMCA 5LBMA 3RRWA 2Q9QD 4U72A 4EYYR 2JMMA 4K0UA 5FXZA 3TZGA 4FZLA 2Y2XA 1HF8A 2UXXB 4YFSA 4AQFA 4KRAA 4QQ1A 3SRZA 3AA0A 5LHHB 3PE0A 3KV9A 4TV8E 2Y0HA 5BMVE 1CUNA 2E9XC 3N9LA 1EZ3A 3HA4A 1ZHTA 3LK3B 2XE3A 4YLHA 3D0TA 1QSDA 3GA8A 3Q5XA 2LSJA 4DBRA 5FYMA 2X27X 4AKGA 2CMRA 4KR8A 4GCQA 3T24A 3F57A 1U4QA 3IEEA 4IHJE 2XG6A 5JRCA 3EVYA 2ZM8A 4NUVA 2V7KA 4ERRA 1KNZA 3N9NA 1GFQA 3KV6A 4C91A 1UX4A 5LYJE 1HTJF 4O4UA 4GF4A 4IDZA 3DP7A 2RP4A 3UPGA 3E0ZA 2IC6A 2WMOA 3U3IA 3RBHA 2VKDA 3OJAA 3EMNX 3CWZB 4HTEA 4M1PA 3WI4A 1BR1A 5KX5E 1AJ3A 3AAAA 4CXYA 5LCYA 5J2UE 2PBIA 1GFPA 2RA1A 2MTQA 1QJ9A 4FZNA 4UVBB 3PORA 1IZNB 5HYAA 4P0BA 2NTXA 3OYXA 1MMGA 1Q9GA 4ANJA 4O4JE 4LSFA 2GK9A 3RRCA 3LBXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN A;  3AAE A;  2KXP A;  3AA1 B;  3AA6 B;  3LK4 1;  2KZ7 A;  5AFU L;  3AA1 A;  3AA6 A;  3LK2 B;  5ADX K;  4AKR B;  3AAA B;  3AA0 B;  3LK2 A;  4AKR A;  5AFU K;  3LK4 2;  3AAA A;  3AA0 A;  3AA7 B;  1IZN B;  3AAE B;  3LK3 B;  5ADX L;  2KXP B;  2KZ7 B;  3LK3 A;  3AA7 A; 
#chains in the Genus database with same CATH topology
 4QH5 A;  4JI1 T;  3BQI A;  2KXP A;  3NRX A;  3I0Q A;  3WAK A;  2CXF A;  1MM5 A;  3VRA A;  2M07 A;  5AQV B;  2SPC A;  2X0Y A;  5J1G A;  4YSY A;  1N36 T;  4XAX B;  5C3J A;  3I0O A;  2R88 A;  4IE5 A;  2OA5 A;  2Y6X A;  4BJM A;  4B61 A;  3SZD A;  3NKZ A;  4BA9 A;  3AEA A;  3AB3 B;  4YXD A;  5E0O A;  4CQI A;  1D0Z A;  2VB6 A;  4HWH A;  3UU3 A;  1THQ A;  5F5W A;  5TAO A;  5HXE A;  3WI5 A;  5FY7 A;  2W61 A;  4YHH T;  2DWG A;  4TNV A;  3SYS A;  4U9C A;  3V5S A;  2BVM A;  1H6S 1;  3RYC E;  1WRD A;  4K0K T;  3LSV A;  1CHU A;  1OED C;  3PUR A;  2BG9 E;  2EHO C;  2J47 A;  4HKA A;  3ZC0 A;  2A3D A;  3ZYK A;  2W62 A;  4DV2 T;  5GON E;  4DUY T;  3X1D A;  4FMS A;  1D0Y A;  2CBI A;  3B13 A;  3PUW F;  2HN2 A;  4AYN A;  4U33 A;  2CHN A;  4U31 A;  4DID B;  2R8A A;  4GCS A;  3VY9 X;  2OMF A;  2FJE A;  2PG8 A;  2V1D B;  4DR3 T;  2MOZ A;  4J2C A;  4FQE A;  4X1K E;  3AA7 B;  2KWI B;  2JMH A;  4QKN A;  4WNK A;  3TLU A;  2WJR A;  1XZY A;  2YDQ A;  3V5U A;  2V5C A;  4X62 T;  4H9R C;  2PRN A;  3T20 A;  4YSX A;  3EI0 A;  5TIS O;  3H37 A;  2J62 A;  4N78 D;  4AKM A;  1MPF A;  2V7M A;  2L3L A;  2IHR 1;  4FI5 A;  5LP6 E;  5HAX A;  4UR9 A;  2YK0 A;  2J4G A;  5LHI B;  4O3Z A;  3DWO X;  4B3S T;  2EHO D;  3P7I A;  4A97 A;  3C50 A;  4AKH A;  3ONL C;  2X51 A;  2NW7 A;  4FZM A;  3RQW A;  2X67 A;  2LM2 A;  2V6Y A;  5FXX A;  3SWH A;  4HWD A;  4FSO A;  3LK4 1;  5AQN B;  2L9Q A;  4PJM A;  3ZCJ A;  1HXU A;  1ZHX A;  4JV5 T;  3LJC A;  1SA0 E;  4RL9 A;  5ADX K;  2CHO A;  3M65 A;  4IDP A;  4RJX A;  3UU5 A;  2WP9 A;  2WM9 A;  3PDY A;  1ORM A;  2XAQ B;  1JNR A;  2V26 A;  3DZM A;  2X0L B;  3RC3 A;  4F4B A;  3Q9D A;  4UEM A;  2KWH A;  5JR9 B;  1FJG T;  1NWM X;  1J1J A;  2XE5 A;  3N9P A;  4ILB A;  5GTI O;  3ZJ2 A;  4TZ4 C;  3NJT A;  5AQO B;  4X20 E;  2VWA A;  1R8I A;  4EAH A;  2VKJ A;  3C98 B;  2LSI A;  4NPP A;  1Z0P A;  2X9H A;  1VOM A;  4UXN B;  2A2F X;  2CLY C;  2Y48 B;  3C4W A;  1W9R A;  2PFV A;  5LG3 A;  4I55 E;  4N58 A;  2IAK A;  5L3F B;  2A72 A;  5L4E A;  4GHB A;  3ZMS B;  5B66 O;  4IE7 A;  2DWK A;  2BKN A;  4C90 A;  1KF6 A;  5HEG A;  5HWY A;  3Q5D A;  2WS3 A;  5F3J A;  3ZMU B;  3PUA A;  4TN7 B;  1MIW A;  5AQF B;  4TWF A;  4X64 T;  4ZZB A;  4HE8 A;  1XNR T;  3ANW A;  4E7Z A;  1GQE A;  1S35 A;  4DR7 T;  2UUB T;  5KAI O;  4JLE A;  2DCF A;  2MHL A;  1Z8U A;  2W67 A;  2B1E A;  3EDU A;  2CPT A;  5L3G B;  3N2K E;  2VKO A;  5IHY A;  3K3Q C;  3QNU A;  4H9N C;  3T0S A;  5HEU A;  1MMN A;  3MXZ A;  5JDG A;  2KT9 A;  5KAF O;  4PFO A;  4GK5 E;  1WYC A;  2UXB T;  4D65 A;  1UK5 A;  1BR2 A;  2WB5 A;  2Y7S A;  4HFB A;  2YNK A;  2Q9Q A;  2G0U A;  4DBQ A;  1WYB A;  2BS4 A;  5ETW A;  4IIJ E;  1ZOY A;  3ZT5 A;  3DWN A;  4JEU B;  1GFO A;  4TV9 E;  3AA1 A;  2JQK A;  1BT9 A;  5JDQ A;  3HWB A;  2I0M A;  1T72 A;  3P4R A;  1MIY A;  5L3D B;  1QJP A;  4AQG A;  2LE8 A;  4HN9 A;  5EK3 A;  1X9B A;  2FGQ X;  1FIO A;  3OPC A;  4U3C A;  2CCQ A;  4MAL A;  5F8P A;  4DV6 T;  4ZS2 A;  1UCU A;  3PF1 A;  4YY3 T;  4G63 A;  4IT4 A;  4O4L E;  2C0S A;  5M4Y A;  4CN1 A;  2FJA A;  3O1I A;  4O8S A;  4EOZ B;  2C5K T;  3CIR A;  5JDF A;  4L5G A;  5ADX L;  1HG2 A;  3E08 A;  2BS2 A;  4HWI B;  3ZN1 B;  3AXJ B;  3RX6 A;  1KEY A;  3RQU A;  2WDR A;  4C4V A;  3KVD D;  4JI2 T;  3BQK A;  5FY1 A;  3RHW A;  2BVL A;  2XQ5 A;  3KV5 A;  1T7S A;  2LRL A;  4PFP A;  4IL4 A;  3AE3 A;  5IUX A;  2DI4 A;  2YU1 A;  5LBM A;  2LRK A;  4U72 A;  5LMN T;  5FXZ A;  2LKH A;  2Y2X A;  4IDN A;  4QQ1 A;  3SRZ A;  4TV8 E;  3AE5 A;  2BG9 A;  2JQH A;  2HHH T;  5FYM A;  1M62 A;  2CMR A;  5AQK B;  3A7M A;  1KNR A;  1U4Q A;  5JRC A;  5AQG B;  1GFQ A;  4C91 A;  1VCS A;  4IDZ A;  3UPG A;  2WMO A;  2VKD A;  3EHZ A;  4CXY A;  1IZN B;  1Q9G A;  2NTX A;  3OYX A;  4ANJ A;  4UB6 O;  1OED E;  2X9K A;  4DR6 T;  5LHG B;  1G90 A;  4XNK A;  5JDN A;  2Z6E A;  3F31 A;  4GK0 E;  2V8S V;  3K8P C;  4NXM T;  4K3B A;  4Z3T A;  4QWN B;  2BBH A;  2XTL A;  2B76 A;  4RLC A;  1QJ8 A;  2NW8 A;  3JCU O;  3POX A;  4H9S E;  2R4L A;  4GIW A;  4ILU A;  6PRN A;  4ZI3 D;  3KDS E;  2N1G A;  3AE6 A;  3DA3 A;  2VQF T;  3E22 E;  4KR4 A;  2BBJ A;  3LK2 A;  3BQL A;  4HWF A;  3ZT6 A;  4EB6 E;  4LF9 T;  3OYZ A;  4F8H A;  4KX6 A;  3A2S X;  3ZC1 A;  1WFD A;  3BK9 A;  2E8I A;  5H2F O;  3GN5 B;  3HOL A;  5AQJ B;  3PU3 A;  5JTG A;  3NSG A;  4UV9 B;  3SOL A;  1MNE A;  2V7J A;  4QXC B;  3O9X A;  4WYV A;  3K19 A;  5L2L A;  4PK5 A;  4GYR A;  5L3C B;  5D5D A;  3WU2 O;  4BJN A;  3JAD A;  3RC8 A;  4DV3 T;  2PJQ A;  3ZJ1 A;  3CK6 A;  1LRZ A;  2I6H A;  3RF1 A;  2XQ9 A;  3NWI A;  5CJ5 A;  3UU8 A;  1VRB A;  2E2A A;  4PJJ A;  2H89 A;  5EK4 A;  4COF A;  2E5V A;  2Y0K A;  3VY8 X;  3NVO A;  5EE2 A;  2KZ7 B;  3N2G E;  3AAE A;  5L4H A;  5CA0 E;  2ZM2 A;  3DJB A;  5JDL A;  2ZLY A;  3AE7 A;  4UF0 A;  4B6X A;  4AXP A;  5FY0 A;  4DUZ T;  2XQ6 A;  1US7 B;  4PUX A;  4AYI D;  3QK6 A;  4RJW A;  5FL0 A;  2BS3 A;  3UU4 A;  2VL8 A;  3PUS A;  3RIU C;  3KFW X;  3H3A A;  2H7O A;  2X9X A;  4TUY E;  4DV1 T;  2XM2 A;  3AVS A;  2RPA A;  3RYH E;  3ZEF B;  2ES0 A;  5G26 A;  5LB7 B;  4IE6 A;  2K9A A;  5HXC A;  1G73 A;  2FJD A;  1PRN A;  5EK2 A;  3N2O A;  2XSB A;  5DQW A;  4ZHQ E;  5JDH A;  1ZHW A;  1ZKE A;  1HNZ T;  4YTP A;  4HFD A;  3NZQ A;  4AZL A;  2ZM0 A;  5IWA T;  3MAC A;  2D5U A;  3MK7 C;  1B7T A;  5L3E B;  1N34 T;  4A56 A;  4FJO A;  2LFU A;  3Q5W A;  2HPL A;  1D1C A;  4TWD A;  3A0H O;  1FEW A;  1HNW T;  1BH3 A;  4AQY T;  4JFB A;  1OPF A;  1J5W A;  3VKG A;  3IA3 A;  2MBG A;  1D1A A;  4IST A;  3ZYM A;  4CI3 B;  3HKE E;  1KNP A;  4F6R C;  2XUE A;  3ZPO A;  4UVA B;  4ZI2 D;  1G8X A;  1OSM A;  4IE4 A;  3PQU A;  2NW9 A;  1P4T A;  2N2L A;  5JVD E;  4PNI A;  3PTR B;  5LJM A;  5JH7 E;  1YD8 G;  3VRB A;  2X9Y A;  3VHL A;  2XE2 A;  3PUG A;  3TLS A;  1UX5 A;  1HNX T;  3UTK A;  2XE1 A;  3OVU A;  2CEA A;  2NTY A;  2J1D G;  1I6Z A;  4X1I E;  3HOE A;  3VR8 A;  8PRN A;  4MLK A;  3Q2M A;  4EIW A;  3P4Q A;  3P50 A;  4WBO A;  5LGU B;  5JQG E;  4AQF C;  1XMO T;  4DO0 A;  2CA5 A;  4DMW A;  4A5X A;  4P09 A;  4B3M T;  2XSA A;  4AYD C;  4O2B E;  2CXD A;  5DAB A;  3SYB A;  4JI7 T;  4AKR B;  4Q25 A;  4FRX A;  4KBM B;  4UEL A;  5LG4 A;  3QUJ A;  1YQ4 A;  3U78 A;  5FVK A;  3OTO T;  4LF6 T;  4D64 A;  3SFD A;  2A9U A;  2KC0 A;  2LKG A;  3PGU A;  4EGW A;  3AA0 B;  5A1L A;  5G39 A;  3KV4 A;  1HCI A;  5T5F A;  3VKH A;  4HFI A;  2XAH B;  5HCM A;  3UUL A;  2P9B A;  3ZYL A;  5J2T E;  4FES A;  4JI4 T;  4JBW F;  2K0L A;  2XMX A;  2J4U P;  1NAF A;  1OED A;  2EHO A;  3ZMZ B;  5LJN A;  3AAI A;  4WBN E;  2E9X D;  3GWH A;  5AFU K;  5ABF A;  2K48 A;  4KUM B;  2K4T A;  3C4X A;  3C64 A;  5CA1 E;  2JPF A;  2X9W A;  2XJ7 A;  4TX5 A;  4DV4 T;  2GE4 A;  3FYX A;  5AQR B;  1UUS A;  4O3W A;  3VE2 A;  4X65 T;  2XY8 B;  1DU2 A;  4GYS A;  4OFZ A;  3N9O A;  2LSG A;  5CGM A;  5AQP B;  2W00 A;  3LG7 A;  2LHN A;  2CBJ A;  3SS1 A;  4YTN A;  1E1H B;  3W15 B;  3FZK B;  4DVD A;  5DL5 A;  3TLT A;  5H6R B;  1HS7 A;  4IRE A;  1QUU A;  2VK9 A;  3MJX A;  4A98 A;  5FVL A;  2Q9Q D;  2JMM A;  1HF8 A;  2UXX B;  4YFS A;  4AQF A;  3ZKR A;  3PE0 A;  3RI5 A;  1ZHT A;  3HA4 A;  3D0T A;  2VQE T;  3IEE A;  4EEB A;  3EVY A;  4NUV A;  2D9D A;  1HTJ F;  4GF4 A;  4JI5 T;  3DP7 A;  1L0V A;  3AE4 A;  3RBH A;  3OJA A;  3CWZ B;  4HTE A;  4M1P A;  3RGL A;  1BR1 A;  1AJ3 A;  3AAA A;  2MTQ A;  5ABE A;  4WZX A;  2VVN A;  5CFB A;  4P0B A;  4IL9 A;  1MMG A;  4O49 A;  3C51 A;  2MNH A;  2FUP A;  4ZEY A;  3POU A;  3CML A;  4UV8 B;  5HXH A;  2WY2 A;  4DND A;  4K3C A;  2QRX A;  2ZLD A;  3G06 A;  3CPZ A;  2ODV A;  3TLV A;  3PU8 A;  3VR9 A;  2V5D A;  5FXW A;  4AI6 A;  2WWV A;  1SE7 A;  3EAM A;  1YKH B;  2IML A;  3UUN A;  4DV0 T;  3I9Y A;  3PJA J;  1ZV4 X;  2CWO A;  5C2T A;  1HX8 A;  1WCR A;  3AA6 B;  5C8Y E;  5B5E O;  2DHR A;  1BXW A;  2LM9 A;  5HEO A;  4U74 A;  4NUU A;  2HN1 A;  5KXJ A;  2L8K A;  1HXT A;  3KIN B;  3UAQ A;  5JRE A;  3EDV A;  3I9W A;  3VZU X;  3MKD A;  3QRC A;  4QXB B;  5AFU L;  3JC6 D;  4HFV A;  2K3W A;  3MZK B;  3PJA A;  4G2A A;  4ZI3 C;  4Z90 A;  2VL0 A;  4V1A v;  1OWA A;  1N33 T;  4HGA A;  4LSH A;  2NP9 A;  2KSR A;  4AFK A;  2XTQ A;  1IAP A;  4HFH A;  3ZT7 A;  5GTH O;  2LOS A;  4D5U A;  5G3A A;  4BUM X;  3AE9 A;  3PUZ F;  4KI0 F;  1HXX A;  4IDQ A;  1WLX A;  4JUY A;  2M6B A;  4EZ4 A;  4DV7 T;  3ZLI A;  3NZP A;  4CXX A;  3H3M A;  4XNL A;  5LOV E;  5CB4 E;  4UVC B;  4IGU A;  3PRN A;  4YHJ A;  4JCH A;  5JR9 C;  3P8C D;  2I59 A;  5AQM B;  2E9X B;  4C69 X;  4MBQ A;  3ANW B;  3RLF F;  3CX8 B;  4E7S A;  2DLR A;  1GFM A;  4HWC A;  4H63 V;  2MPK A;  1XNQ T;  4AKI A;  4LFB T;  3ETV A;  3PUX F;  2R4O A;  4ASK A;  2QVA A;  3A8Y C;  4LMK A;  4Z8X A;  1HG5 A;  1NEN A;  4O4I E;  3LDQ B;  5LMU T;  5GV0 A;  2MAW A;  3UU6 A;  1JNZ A;  2D2S A;  2XTR A;  3PUQ A;  3DTO A;  2CM0 A;  1W0B A;  4O4H E;  2ZMA A;  1YS5 A;  4IDO A;  2UUC T;  5HEH A;  4DR1 T;  5FKY A;  4ZS3 A;  2W66 A;  3AA7 A;  5KDM C;  2MYS A;  4WW0 A;  2Q9Q B;  4CXW A;  2F1V A;  2XQ8 A;  3O1J A;  3O0E A;  5LXT E;  4KHZ F;  1XWM A;  5IYU A;  3GMI A;  2IW5 B;  2HH7 A;  2XAS B;  2QTK A;  3AE8 A;  3CX6 B;  3SZV A;  2JMK A;  3HL6 A;  3CQG B;  2LHF A;  3MA9 A;  4O4X A;  4AKR A;  4B3T T;  4HEA A;  4XBF B;  5KMG P;  1SUM B;  1KFY A;  3F2E A;  2XAJ B;  3VE1 A;  2XQA A;  3L8R A;  4JI8 T;  4L9I A;  3C5O A;  2VKH A;  3HKD E;  2LSY A;  3LFM A;  4LFC T;  2XQ7 A;  1H7C A;  4KP3 C;  3B5M A;  4TNW A;  4XZC A;  3QOF A;  5HWX A;  3T1H T;  2XQY A;  2XAF B;  4PJN A;  4C4V B;  4PJ0 O;  2ODU A;  5JR9 A;  4LSE A;  3AVR A;  2WZH A;  4ZI2 C;  1LKX A;  4DR4 T;  4FOZ A;  3PGR A;  4N74 A;  2ACX A;  1ZP0 A;  2KLQ A;  4DV5 T;  2R89 A;  2X0H A;  2XHE B;  2YKS A;  3P4P A;  2H7V C;  2IIU A;  2WMN A;  3N9Q A;  3L3P A;  1MIV A;  4H9O C;  2KND A;  2F4V T;  5AQI B;  2CE7 A;  1HFA A;  2C5I T;  3PQS A;  1OXZ A;  2BG9 B;  4H9Q C;  2Y8D A;  4OX9 T;  4O3X B;  1E54 A;  3SFE A;  3NBX X;  4I43 B;  3UFG A;  4DR2 T;  5JRC B;  1UUR A;  4PW8 A;  5AQH B;  2W63 A;  1IJ6 A;  2NWB A;  4PJL A;  4CN4 A;  3FBL A;  2N2M A;  1ZHZ A;  4AYE C;  5JDM A;  1IJ5 A;  3UUB A;  3A0B O;  1ZEE A;  1S5L O;  1E2A A;  4C00 A;  4JYA T;  3CQX C;  3KZI O;  3OBV E;  5JDP A;  5IYZ E;  5AQU B;  5AQL B;  2ERV A;  3T8O A;  1S94 A;  4YJ3 E;  4Z91 A;  1MMD A;  2F1T A;  2X68 A;  4NXN T;  4QXH B;  2W2U A;  2OLT A;  4CI2 B;  2XQ4 A;  3AEC A;  4DMV A;  3SY9 A;  1WR0 A;  2LLY A;  7PRN A;  2YEV C;  5J0Z A;  4CN6 A;  2M06 A;  2AXD S;  4MHC A;  3LK2 B;  5G38 A;  4KMC A;  3RRW A;  4EYY R;  1YXR A;  3TZG A;  5AQS B;  4KRA A;  2XM1 A;  5LHH B;  3KV9 A;  5BMV E;  1CUN A;  2E9X C;  2XQ3 A;  3LK3 B;  4YLH A;  2UUA T;  1QSD A;  3GA8 A;  3Q5X A;  2LSJ A;  4DBR A;  3RIU A;  2IDO B;  3UQ4 A;  4IHJ E;  2XG6 A;  2ZM8 A;  4EED A;  3KV6 A;  1UX4 A;  5LYJ E;  2W4X A;  5AQQ B;  4P1N A;  2RP4 A;  3E0Z A;  2M6I A;  2NR4 A;  3EMN X;  5KX5 E;  5J2U E;  2DL1 A;  1GFP A;  2RA1 A;  1QJ9 A;  4FZN A;  4UVB B;  4PR7 A;  5HYA A;  2UU9 T;  4LSF A;  4JI3 T;  3RRC A;  3LBX B;  2K24 A;  1YW0 A;  2CWY A;  4FT6 A;  4AUI A;  3ONX A;  3AA6 A;  1W0A A;  3AXJ A;  3HR0 A;  1IBK T;  1I94 T;  3ABV A;  2LHR A;  3PV0 F;  1FMW A;  3CVR A;  3CX7 B;  1QLB A;  2Q9Q C;  4FSP A;  4ADZ A;  4I4T E;  4KHP T;  2XZE A;  3AAE B;  1IBL T;  1T98 A;  4G75 A;  5FVN A;  4ZI7 E;  1ZHY A;  4LF8 T;  3RYI E;  2QA7 A;  4UF0 B;  3R6N A;  3G7G A;  4JEH B;  2D0T A;  4AYM C;  2WDV A;  2IC9 A;  2WAU A;  3QB5 K;  2N2N A;  5LGN B;  2XAG B;  2FGR A;  2KXP B;  5AQT B;  3O1H A;  1T16 A;  3IHR A;  3SY7 A;  2W0G A;  5L3B B;  4OK0 A;  2KIN B;  3QC9 A;  4X1Y E;  2YN6 A;  3FZH B;  3AEF A;  2ACZ A;  4ZOL E;  5DL8 A;  3CQC B;  2JJ9 A;  1IZN A;  4YSZ A;  3HI2 A;  5HEJ A;  1E7P A;  3Q5E A;  2LOP A;  2VAS A;  3BRY A;  3J7Y q;  5DL6 A;  1Y64 B;  2E9X A;  2BDE A;  1N32 T;  3JCF A;  2UXN B;  3KBT A;  2WJQ A;  2JQQ A;  3T1Y T;  2E5L T;  2H3R A;  3FZM B;  1KK7 A;  1LVF A;  2WCA A;  2AE9 A;  4FRT A;  1HR0 T;  3FBZ A;  3KVB A;  4ISS A;  2F1C X;  4U2Z A;  2FBW A;  1WR6 A;  1X79 A;  2LT3 A;  3NRY A;  4UB8 O;  3KBU A;  4TWH A;  5FNV E;  2CXL A;  3ONJ A;  1LVK A;  2DNX A;  4BAY B;  1FMV A;  2BG9 C;  2R4N A;  1VCT A;  3PGS A;  3WI3 A;  3UFE A;  2W80 C;  2BZB A;  4LF5 T;  1D0X A;  4GCP A;  2ODJ A;  3GN5 A;  4L0R A;  2YPV A;  1BR4 A;  4ILA A;  3ETU A;  2LEH A;  4QX8 B;  2WVP A;  3JC6 C;  2OV9 A;  4B3R T;  1Q9F A;  1ZHC A;  3M3Z B;  3S4U A;  1XMQ T;  4ILC A;  4IL6 O;  1MM4 A;  2AXT O;  3RIF A;  3L39 A;  4EXT A;  3AEB A;  3PUY F;  2J1N A;  4E1S A;  1T8B A;  2WU5 A;  2R4P A;  3QB5 A;  3JTY A;  3EUH A;  3UT5 E;  2CRB A;  2W81 C;  3ESL A;  2IWW A;  4X66 T;  2BKP A;  2C5J A;  2V6X A;  1J5E T;  2WSS V;  2ZM6 T;  3K3O A;  3VU7 H;  2KMF A;  2JRK A;  4LSI A;  2VUR A;  4I0U A;  4H9P C;  4OYK A;  4FUV A;  3AEE A;  4DR5 T;  5FMN A;  3OKQ A;  2LSK A;  2YIN A;  2KZ7 A;  5FL1 A;  4PAG A;  3BS0 A;  1D1B A;  3FXD B;  1NEK A;  2WQY A;  3N5L A;  3ZST A;  2V6Y B;  4CI1 B;  1YKE B;  2JQY A;  3FXE B;  5DQV A;  3IBP A;  2VVS A;  5E79 O;  3TKL B;  3RKO A;  4I50 E;  3TLW A;  3HW9 A;  4ZXL A;  3HKC E;  4YTM A;  3ZSS A;  5LBQ B;  4MFR A;  4LML A;  4PK4 A;  2X66 A;  3R84 B;  3KVA A;  5HXR A;  4LF4 T;  2HPJ A;  3IF8 B;  3RH3 A;  2PTF A;  3JAE A;  1U5P A;  2QYW A;  1HX1 B;  1OED B;  4P0A A;  5LA6 E;  3RPU A;  2EHO B;  4N59 A;  4YJ2 E;  5ABF B;  3ZMV B;  2YDR A;  3K3N A;  3BRZ A;  3QRA A;  4N75 A;  3P4S A;  4X5T A;  4HFE A;  4AKL A;  5EZY E;  2JQ9 A;  4EYU A;  3FHN A;  3JAF A;  4LMJ A;  3PUV F;  1SHZ C;  4QX7 B;  2WU2 A;  4ZZC A;  3CKD A;  3P4W A;  3J9X 1;  3B57 A;  3HKB E;  5ABG A;  5BR8 T;  4U7Y A;  2YOE A;  3EAB A;  2IUB A;  2K5B B;  3A5X A;  2V7I A;  2M67 A;  2WBL A;  2ZFG A;  4JI0 T;  3L09 A;  3FZF B;  1V9D A;  4UIG A;  3RKG A;  2N9D A;  2WWU A;  4NIQ A;  3UU2 A;  1YQ3 A;  2D0U A;  4YT0 A;  2UXC T;  1PHO A;  4CZZ B;  5L47 A;  1MMA A;  3N9M A;  5DJQ C;  2O4V A;  4E1T A;  3LK4 2;  2NOX A;  3ZCI A;  5PRN A;  4EZH A;  1O3X A;  2H88 A;  3AED A;  4AIS A;  2FJB A;  3GP6 A;  2WDQ A;  3VZW X;  3UQ7 A;  4PK6 A;  5ABH A;  2KDY A;  2WZI A;  2UXD T;  3FB2 A;  2BKO A;  1Y01 A;  4GKK T;  1BR0 A;  1XDO A;  1IBM T;  3AAA B;  4H63 H;  4O3Y A;  3O4X E;  3C4Z A;  1XDP A;  4O2A E;  4LFA T;  4IE0 A;  3RYF E;  5DL7 A;  5LGT B;  3V8U A;  4CTD A;  5HXS A;  4AIU A;  3UUM A;  3ZN0 B;  3DA4 A;  5LNK A;  3LK3 A;  3AA1 B;  1T1L A;  1MND A;  3POQ A;  3UUX B;  3VZT X;  4OYJ A;  2QGS A;  4QHO A;  2YU2 A;  4G76 A;  3I1A A;  4U2Y A;  4GKJ T;  4RLB A;  4QH4 A;  4OHF A;  2POR A;  5H6Q B;  4HFC A;  2YDS A;  3WAJ A;  4JI6 T;  1GFN A;  5FP3 A;  2LJL A;  5FXV A;  3LBX A;  4QH1 A;  3ZMT B;  2Y0L A;  2V7L A;  2CLY B;  4GOU A;  4K0U A;  3RIA A;  5HCJ A;  4FZL A;  3FZL B;  1UGO A;  3AA0 A;  2Y0H A;  3AE2 A;  3AE1 A;  3N9L A;  1EZ3 A;  2IWV A;  2XE3 A;  1W09 A;  2X27 X;  4AKG A;  4KR8 A;  2JIW A;  4GCQ A;  3T24 A;  3F57 A;  2R6G F;  4LF7 T;  2V7K A;  4ERR A;  1KNZ A;  3N9N A;  3K1S A;  4O4U A;  3AEG A;  1M7K A;  2IC6 A;  3U3I A;  3WI4 A;  5LCY A;  2PBI A;  4EV6 A;  2XPK A;  3POR A;  4U7I A;  4O4J E;  2GK9 A; 
#chains in the Genus database with same CATH homology
 4O49 A;  2K24 A;  3BQI A;  2KXP A;  3NRX A;  1YW0 A;  3C51 A;  5LHG B;  3I0Q A;  3WAK A;  1G90 A;  2CWY A;  2MNH A;  4FT6 A;  2CXF A;  4XNK A;  4AUI A;  3ONX A;  5JDN A;  3AA6 A;  1MM5 A;  2Z6E A;  3HR0 A;  3F31 A;  4GK0 E;  3K8P C;  3POU A;  3CML A;  2M07 A;  4Z3T A;  4QWN B;  2LHR A;  1FMW A;  2XTL A;  4UV8 B;  5HXH A;  2SPC A;  3CVR A;  5J1G A;  3CX7 B;  4DND A;  4XAX B;  4RLC A;  2Q9Q C;  4FSP A;  3I0O A;  4I4T E;  4ADZ A;  1QJ8 A;  3AAE B;  2NW8 A;  4IE5 A;  2ZLD A;  4H9S E;  3POX A;  1T98 A;  4G75 A;  5FVN A;  2OA5 A;  2Y6X A;  4ZI7 E;  3CPZ A;  2ODV A;  4GIW A;  4BJM A;  4ILU A;  1ZHY A;  3RYI E;  4ZI3 D;  2QA7 A;  6PRN A;  4UF0 B;  3R6N A;  3PU8 A;  3KDS E;  4B61 A;  3SZD A;  2N1G A;  3G7G A;  5FXW A;  4JEH B;  3DA3 A;  4BA9 A;  3AB3 B;  2D0T A;  3E22 E;  4AI6 A;  4KR4 A;  4AYM C;  5E0O A;  3LK2 A;  3BQL A;  1YKH B;  2IC9 A;  3UUN A;  4CQI A;  1D0Z A;  4EB6 E;  2VB6 A;  2WAU A;  3OYZ A;  3I9Y A;  2N2N A;  5LGN B;  1THQ A;  3A2S X;  2XAG B;  3ZC1 A;  1ZV4 X;  2CWO A;  5TAO A;  2KXP B;  2FGR A;  5HXE A;  3WI5 A;  1HX8 A;  3BK9 A;  2E8I A;  5FY7 A;  3O1H A;  2W61 A;  3GN5 B;  3HOL A;  3SY7 A;  2DWG A;  3AA6 B;  3IHR A;  2W0G A;  3SYS A;  3PU3 A;  3NSG A;  4UV9 B;  5C8Y E;  5L3B B;  2DHR A;  4U9C A;  3V5S A;  2BVM A;  3SOL A;  3RYC E;  4OK0 A;  2KIN B;  1BXW A;  1MNE A;  1H6S 1;  2V7J A;  1WRD A;  3QC9 A;  4X1Y E;  4QXC B;  2LM9 A;  3PUR A;  3O9X A;  2EHO C;  4U74 A;  3K19 A;  5L2L A;  4HKA A;  4NUU A;  4PK5 A;  4ZOL E;  3ZC0 A;  2A3D A;  2L8K A;  4GYR A;  3ZYK A;  5L3C B;  2W62 A;  1HXT A;  5D5D A;  3KIN B;  3UAQ A;  4BJN A;  5JRE A;  3RC8 A;  3EDV A;  3I9W A;  3VZU X;  2PJQ A;  5GON E;  3ZJ1 A;  3MKD A;  1LRZ A;  5DL8 A;  3CQC B;  2JJ9 A;  3QRC A;  1IZN A;  4QXB B;  5AFU L;  1D0Y A;  4FMS A;  3B13 A;  4AYN A;  3HI2 A;  3JC6 D;  1VRB A;  4HFV A;  3MZK B;  4G2A A;  4ZI3 C;  2LOP A;  4PJJ A;  2VAS A;  1OWA A;  4V1A v;  4HGA A;  4GCS A;  5EK4 A;  3J7Y q;  3VY9 X;  5DL6 A;  2OMF A;  1Y64 B;  2PG8 A;  2E9X A;  4LSH A;  2NP9 A;  2Y0K A;  2V1D B;  2BDE A;  2MOZ A;  4J2C A;  2XTQ A;  3VY8 X;  4X1K E;  4AFK A;  1IAP A;  3AA7 B;  2KWI B;  2UXN B;  3KBT A;  2JMH A;  4QKN A;  5EE2 A;  4WNK A;  2KZ7 B;  3N2G E;  2JQQ A;  2H3R A;  3AAE A;  2LOS A;  1KK7 A;  1LVF A;  5CA0 E;  2ZM2 A;  4D5U A;  3DJB A;  3V5U A;  5JDL A;  4FRT A;  2ZLY A;  3FBZ A;  3KVB A;  4ISS A;  4UF0 A;  4B6X A;  4H9R C;  2PRN A;  4BUM X;  1WR6 A;  3T20 A;  1X79 A;  2LT3 A;  4AXP A;  5FY0 A;  3NRY A;  3H37 A;  3KBU A;  1HXX A;  1US7 B;  4PUX A;  5FNV E;  4AYI D;  2CXL A;  4N78 D;  4AKM A;  3QK6 A;  1WLX A;  4JUY A;  1MPF A;  1LVK A;  2DNX A;  2V7M A;  2L3L A;  4FI5 A;  4RJW A;  4BAY B;  5LP6 E;  5HAX A;  1FMV A;  2VL8 A;  2YK0 A;  3WI3 A;  3PUS A;  3UFE A;  4EZ4 A;  5LHI B;  4O3Z A;  3ZLI A;  2W80 C;  2BZB A;  3KFW X;  3NZP A;  1D0X A;  4CXX A;  4GCP A;  5LOV E;  2EHO D;  3H3A A;  3GN5 A;  4L0R A;  5CB4 E;  2ODJ A;  4XNL A;  2H7O A;  2X9X A;  3P7I A;  4UVC B;  2YPV A;  4TUY E;  1BR4 A;  4IGU A;  3PRN A;  4YHJ A;  4JCH A;  5JR9 C;  3C50 A;  3P8C D;  2I59 A;  3ETU A;  2LEH A;  4AKH A;  2E9X B;  3AVS A;  4QX8 B;  3JC6 C;  4C69 X;  4MBQ A;  3ANW B;  2X51 A;  1Q9F A;  1ZHC A;  3RYH E;  2NW7 A;  3ZEF B;  3S4U A;  4FZM A;  2X67 A;  3CX8 B;  5FXX A;  1MM4 A;  4E7S A;  2ES0 A;  2DLR A;  1GFM A;  4EXT A;  4H63 V;  3SWH A;  2J1N A;  5G26 A;  4E1S A;  4AKI A;  3ETV A;  4IE6 A;  4ASK A;  4FSO A;  3LK4 1;  2K9A A;  2L9Q A;  4PJM A;  3JTY A;  4Z8X A;  5HXC A;  1G73 A;  3ZCJ A;  1HXU A;  1ZHX A;  1HG5 A;  3EUH A;  1PRN A;  4O4I E;  3UT5 E;  3LJC A;  1SA0 E;  4RL9 A;  5ADX K;  5EK2 A;  3N2O A;  2W81 C;  3ESL A;  3M65 A;  5GV0 A;  4RJX A;  5DQW A;  4ZHQ E;  5JDH A;  2D2S A;  2XTR A;  3PUQ A;  2C5J A;  2WM9 A;  1ZKE A;  3DTO A;  2CM0 A;  1ZHW A;  2WSS V;  3PDY A;  3NZQ A;  4O4H E;  1ORM A;  3K3O A;  3VU7 H;  2XAQ B;  2KMF A;  4AZL A;  2JRK A;  2V26 A;  4LSI A;  2ZMA A;  2ZM0 A;  1YS5 A;  3MAC A;  2X0L B;  3RC3 A;  2D5U A;  4H9P C;  3MK7 C;  1B7T A;  5L3E B;  4F4B A;  4OYK A;  4A56 A;  4FJO A;  4ZS3 A;  4FUV A;  3Q9D A;  2LFU A;  3Q5W A;  2HPL A;  1D1C A;  5FMN A;  5KDM C;  2MYS A;  2KWH A;  3OKQ A;  4UEM A;  5JR9 B;  2LSK A;  1NWM X;  2YIN A;  2KZ7 A;  2XE5 A;  3N9P A;  3ZJ2 A;  4TZ4 C;  4PAG A;  1FEW A;  4WW0 A;  4X20 E;  2VWA A;  1BH3 A;  2Q9Q B;  4EAH A;  2VKJ A;  3C98 B;  1D1B A;  2LSI A;  4CXW A;  3FXD B;  4JFB A;  1OPF A;  2X9H A;  1Z0P A;  3VKG A;  2F1V A;  2MBG A;  1VOM A;  4UXN B;  3N5L A;  1D1A A;  3O1J A;  2A2F X;  4IST A;  2CLY C;  5LXT E;  4CI1 B;  3O0E A;  1YKE B;  2Y48 B;  3C4W A;  2PFV A;  3FXE B;  3ZYM A;  5DQV A;  4CI3 B;  5IYU A;  3GMI A;  3HKE E;  4I55 E;  4F6R C;  3IBP A;  2IW5 B;  4N58 A;  2XUE A;  2HH7 A;  3TKL B;  3RKO A;  2XAS B;  3ZPO A;  2IAK A;  5L3F B;  2A72 A;  4GHB A;  4I50 E;  4UVA B;  2QTK A;  3ZMS B;  3HW9 A;  4IE7 A;  2DWK A;  4C90 A;  1G8X A;  3CX6 B;  3HKC E;  2JMK A;  3HL6 A;  5LBQ B;  4ZI2 D;  4MFR A;  1OSM A;  3SZV A;  4IE4 A;  3PQU A;  4PK4 A;  5HWY A;  2X66 A;  5F3J A;  3ZMU B;  3R84 B;  3PUA A;  3KVA A;  4TN7 B;  3CQG B;  5HXR A;  1MIW A;  2LHF A;  2NW9 A;  1P4T A;  2N2L A;  3MA9 A;  5JVD E;  4O4X A;  4AKR A;  2HPJ A;  4HEA A;  4PNI A;  3PTR B;  4HE8 A;  4XBF B;  5KMG P;  5LJM A;  3ANW A;  3IF8 B;  3RH3 A;  1YD8 G;  5JH7 E;  3F2E A;  4E7Z A;  2XAJ B;  2X9Y A;  3VE1 A;  1U5P A;  3VHL A;  2XE2 A;  3PUG A;  1UX5 A;  1S35 A;  4L9I A;  3C5O A;  3UTK A;  4P0A A;  5LA6 E;  3RPU A;  2EHO B;  2XE1 A;  2CEA A;  4JLE A;  2DCF A;  2NTY A;  2VKH A;  3HKD E;  2J1D G;  4X1I E;  2MHL A;  2LSY A;  3HOE A;  4N59 A;  4YJ2 E;  8PRN A;  4MLK A;  3ZMV B;  3K3N A;  3Q2M A;  3LFM A;  3QRA A;  2B1E A;  4EIW A;  3EDU A;  4AKL A;  5L3G B;  3N2K E;  2VKO A;  5EZY E;  4E1T A;  4WBO A;  3K3Q C;  5IHY A;  4EYU A;  1H7C A;  4H9N C;  5LGU B;  3T0S A;  4KP3 C;  4AQF C;  5JQG E;  3FHN A;  1SHZ C;  4XZC A;  4DO0 A;  2CA5 A;  5HWX A;  4DMW A;  4QX7 B;  1MMN A;  2XQY A;  3MXZ A;  3CKD A;  5JDG A;  4P09 A;  2KT9 A;  4AYD C;  3J9X 1;  3B57 A;  2XAF B;  4PJN A;  4PFO A;  4GK5 E;  1WYC A;  2ODU A;  4O2B E;  2CXD A;  3HKB E;  4D65 A;  5JR9 A;  5DAB A;  3SYB A;  4LSE A;  1BR2 A;  2K5B B;  3AVR A;  4AKR B;  2Y7S A;  3A5X A;  2V7I A;  4ZI2 C;  1LKX A;  2M67 A;  2YNK A;  2Q9Q A;  2WBL A;  4FRX A;  4FOZ A;  2G0U A;  4KBM B;  4DBQ A;  1WYB A;  2ACX A;  4UEL A;  5LG4 A;  3QUJ A;  2ZFG A;  3L09 A;  3U78 A;  1V9D A;  5ETW A;  4UIG A;  2KLQ A;  4IIJ E;  2N9D A;  4D64 A;  2XHE B;  3PQS A;  2WWU A;  2H7V C;  4JEU B;  1GFO A;  4TV9 E;  2WMN A;  3UU2 A;  2KC0 A;  3AA1 A;  1BT9 A;  2D0U A;  5JDQ A;  3HWB A;  3N9Q A;  3L3P A;  1MIV A;  4H9O C;  2KND A;  1PHO A;  4CZZ B;  3AA0 B;  2O4V A;  2CE7 A;  5A1L A;  1MMA A;  1HFA A;  1MIY A;  2C5I T;  1OXZ A;  3N9M A;  5DJQ C;  2LE8 A;  4AQG A;  3KV4 A;  5L3D B;  1QJP A;  3LK4 2;  4H9Q C;  2Y8D A;  1HCI A;  5T5F A;  4HN9 A;  3VKH A;  5EK3 A;  4O3X B;  1E54 A;  2NOX A;  2FGQ X;  1FIO A;  3NBX X;  4I43 B;  3ZCI A;  5PRN A;  2XAH B;  4EZH A;  5JRC B;  1O3X A;  4PW8 A;  2CCQ A;  4MAL A;  2P9B A;  3UUL A;  3ZYL A;  5J2T E;  5F8P A;  4FES A;  2K0L A;  2XMX A;  3GP6 A;  2W63 A;  2J4U P;  3VZW X;  3AA7 A;  1IJ6 A;  4PK6 A;  1UCU A;  2NWB A;  4PJL A;  4ZS2 A;  2KDY A;  1NAF A;  3FBL A;  3FB2 A;  4G63 A;  2N2M A;  1ZHZ A;  1BR0 A;  2EHO A;  4O4L E;  3ZMZ B;  4AYE C;  5LJN A;  3AAI A;  3AAA B;  4WBN E;  5JDM A;  4H63 H;  1IJ5 A;  2E9X D;  2C0S A;  3GWH A;  3O4X E;  4O3Y A;  5M4Y A;  3C4Z A;  5AFU K;  3O1I A;  4O8S A;  2K48 A;  4KUM B;  4EOZ B;  2K4T A;  2C5K T;  4O2A E;  1ZEE A;  3C4X A;  4IE0 A;  3RYF E;  3C64 A;  5CA1 E;  2JPF A;  5DL7 A;  5LGT B;  3CQX C;  5JDF A;  4L5G A;  5ADX L;  1HG2 A;  3V8U A;  2X9W A;  4TX5 A;  5HXS A;  3E08 A;  3UUM A;  3ZN0 B;  3DA4 A;  5LNK A;  3ZN1 B;  3LK3 A;  2GE4 A;  3AA1 B;  3OBV E;  3FYX A;  1MND A;  5JDP A;  5IYZ E;  3POQ A;  3RX6 A;  2ERV A;  3UUX B;  3T8O A;  4O3W A;  1S94 A;  3VE2 A;  4OYJ A;  2QGS A;  4QHO A;  4YJ3 E;  3VZT X;  1MMD A;  4GYS A;  2F1T A;  2X68 A;  2YU2 A;  4OFZ A;  4QXH B;  3KVD D;  3N9O A;  4G76 A;  2LSG A;  3I1A A;  4CI2 B;  2W00 A;  3LG7 A;  4RLB A;  4OHF A;  2POR A;  2LHN A;  5H6Q B;  3SS1 A;  4DMV A;  3BQK A;  3SY9 A;  1E1H B;  5FY1 A;  3W15 B;  2BVL A;  3KV5 A;  3WAJ A;  7PRN A;  4DVD A;  2YEV C;  5DL5 A;  1GFN A;  5FP3 A;  2LJL A;  4PFP A;  5FXV A;  3LBX A;  5H6R B;  2M06 A;  4MHC A;  1HS7 A;  3ZMT B;  2Y0L A;  3LK2 B;  1QUU A;  2V7L A;  2VK9 A;  3MJX A;  2CLY B;  2DI4 A;  2YU1 A;  4GOU A;  4KMC A;  5LBM A;  3RRW A;  2Q9Q D;  4U72 A;  4EYY R;  2JMM A;  4K0U A;  5FXZ A;  3TZG A;  4FZL A;  2Y2X A;  1HF8 A;  2UXX B;  4YFS A;  4AQF A;  4KRA A;  4QQ1 A;  3SRZ A;  3AA0 A;  5LHH B;  3PE0 A;  3KV9 A;  4TV8 E;  2Y0H A;  5BMV E;  1CUN A;  2E9X C;  3N9L A;  1EZ3 A;  3HA4 A;  1ZHT A;  3LK3 B;  2XE3 A;  4YLH A;  3D0T A;  1QSD A;  3GA8 A;  3Q5X A;  2LSJ A;  4DBR A;  5FYM A;  2X27 X;  4AKG A;  2CMR A;  4KR8 A;  4GCQ A;  3T24 A;  3F57 A;  1U4Q A;  3IEE A;  4IHJ E;  2XG6 A;  5JRC A;  3EVY A;  2ZM8 A;  4NUV A;  2V7K A;  4ERR A;  1KNZ A;  3N9N A;  1GFQ A;  3KV6 A;  4C91 A;  1UX4 A;  5LYJ E;  1HTJ F;  4O4U A;  4GF4 A;  4IDZ A;  3DP7 A;  2RP4 A;  3UPG A;  3E0Z A;  2IC6 A;  2WMO A;  3U3I A;  3RBH A;  2VKD A;  3OJA A;  3EMN X;  3CWZ B;  4HTE A;  4M1P A;  3WI4 A;  1BR1 A;  5KX5 E;  1AJ3 A;  3AAA A;  4CXY A;  5LCY A;  5J2U E;  2PBI A;  1GFP A;  2RA1 A;  2MTQ A;  1QJ9 A;  4FZN A;  4UVB B;  3POR A;  1IZN B;  5HYA A;  4P0B A;  2NTX A;  3OYX A;  1MMG A;  1Q9G A;  4ANJ A;  4O4J E;  4LSF A;  2GK9 A;  3RRC A;  3LBX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...