3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
3LK2A 3LK3A 4AKRB 3AA1A 2KZ7B 5AFUL 3LK2B 3LK3B 3LK41 3AA1B 3AA6A 3AA7A 3AAEA 2KXPA 1IZNA 3LK42 5AFUK 3AA6B 3AA0A 3AA7B 3AAEB 2KXPB 1IZNB 3AAAA 3AA0B 5ADXL 3AAAB 4AKRA 2KZ7A 5ADXK
chains in the Genus database with same CATH superfamily
5B5EO 4N75A 4ILBA 2K0LA 4OYJA 4XNLA 3AA6A 1D1CA 2N2NA 3B13A 2A3DA 4PR7A 2NR4A 4IDOA 2XTQA 2XMXA 2W4XA 2FJEA 4P0AA 2PTFA 2XQ8A 3AEEA 4WBOA 2CA5A 5ABHA 5D5DA 2LM9A 2XQ4A 1UURA 2KDYA 2XAJB 2XY8B 2CM0A 2LSGA 1BT9A 2CXLA 3JTYA 2M67A 2UXNB 2NW7A 4A5XA 2DWKA 4RJXA 4DR7T 4QXHB 3KV9A 4EYYR 3KV4A 2V7LA 3CPZA 4CQIA 2YPVA 5FL0A 3CWZB 4QX8B 4Z90A 1BR1A 5FXWA 4KUMB 3E22E 1KFYA 4ZS3A 5LXTE 5DL8A 4C4VB 2N2LA 2XPKA 1US7B 3L3PA 3DWOX 5LNKA 1OEDE 1ZHXA 5DJQC 4BJNA 5HXHA 1OXZA 3RKOA 4MALA 2KZ7B 5E79O 4TX5A 2R4OA 1Q9FA 5FKYA 4G76A 3EDUA 3T24A 2UXBT 2KSRA 2HH7A 2YINA 3AE5A 3E0ZA 1HNZT 2WZHA 4C4VA 3KV5A 4NUUA 4KRAA 2XQAA 4DR1T 1VCTA 5ADXL 5CGMA 1E7PA 2KZ7A 2LSIA 4YY3T 2E5VA 5JDHA 2X66A 2C5KT 3ZCIA 1IBMT 5AQJB 3V5SA 1OEDB 2LFUA 4UXNB 2XTRA 2E2AA 4ZEYA 5EK2A 4DR6T 3F57A 4B61A 1SA0E 2Y0KA 4CXYA 1GFMA 1OEDA 4LSFA 2WWVA 5EE2A 5GTHO 4Z3TA 4JI7T 4ZOLE 3EDVA 5L3EB 2N1GA 2PG8A 2JQHA 3NJTA 4FI5A 3HOLA 4TV9E 4P09A 4ZZCA 5IWAT 5L3BB 2BG9C 5JR9C 4BAYB 4JI3T 3RHWA 2LRKA 1V9DA 3ZT7A 2IIUA 5TAOA 2BBJA 4AQYT 3NSGA 4YHJA 1GFQA 1E1HB 4FRXA 5C3JA 2AXDS 5AQKB 1Z8UA 3A8YC 2XUEA 5AQLB 2XE1A 1GQEA 2E8IA 4TV8E 5AQUB 5M4YA 1ZOYA 3QK6A 3UUMA 3VY9X 3TLUA 3UAQA 3VKHA 3TKLB 5FVKA 3JCUO 2I59A 1IAPA 2DHRA 4UVBB 5LBMA 4GKJT 3H3MA 3O1IA 4K0KT 3CX8B 1DU2A 5ETWA 2W00A 2IAKA 3K3NA 3UU6A 5H6QB 2X0YA 5L3CB 4AYID 2LSKA 4DV0T 5AQQB 4DR2T 2ES0A 2RP4A 4ZXLA 4D65A 4PNIA 4O2BE 1IZNB 1D1AA 3PU8A 2CBIA 4PJMA 1WCRA 4JFBA 1HTJF 3R84B 2CEAA 1IZNA 3UU5A 1MIVA 2NTXA 4H9NC 3AE2A 3SFEA 3V5UA 3NBXX 2CWOA 3VU7H 3RYFE 5CFBA 2XM2A 4O4UA 4O3ZA 2H89A 1YQ4A 4QH1A 1OSMA 3KZIO 4DV5T 5L2LA 2E5LT 4EEBA 2FGQX 2UXXB 3ANWB 5FXXA 2YU1A 4O49A 5JTGA 2H3RA 1UX5A 3PJAA 4KBMB 2VASA 2J1DG 4X65T 2ZM6T 2FBWA 4JI1T 2VVSA 4LF5T 2RPAA 4U74A 3Q5WA 5PRNA 3N2KE 5J2TE 2YEVC 3F31A 1WLXA 3A0BO 4LSHA 3ZMSB 2Y48B 1UX4A 4N58A 5L47A 4XBFB 4I55E 2V6XA 2I6HA 2UUCT 2EHOC 1WYBA 2QVAA 4GIWA 4JUYA 4G2AA 3ZMZB 3VE1A 3G06A 4MBQA 2DLRA 2WWUA 1UK5A 3V8UA 1ZHYA 4E1TA 2XQYA 2H7VC 3HKCE 3HWBA 3ESLA 5AQNB 2F1TA 3KDSE 3PU3A 3HKDE 5LJMA 3LG7A 1S35A 3RIUC 3RRCA 3A2SX 4HEAA 5GONE 2JJ9A 3PUGA 4LF9T 4YTPA 4EV6A 2XZEA 5HXCA 2R6GF 3JADA 3FB2A 1MMNA 3AE4A 3ABVA 2EHOD 3GP6A 5JDFA 2IUBA 4UF0B 3QRCA 3B57A 4QX7B 3ETVA 4EAHA 3VRAA 3PUQA 5J1GA 2WDVA 1ZEEA 3N9OA 3DA3A 4AUIA 3O9XA 3AE1A 3N9QA 3F2EA 1Y64B 3C51A 4EZHA 1BR2A 4UF0A 3K19A 4MFRA 1GFOA 2LJLA 4DMVA 1ZP0A 3MZKB 1HXTA 4LFBT 1D0XA 1XMQT 2B1EA 2G0UA 2BKOA 2W67A 2V8SV 4IGUA 4FT6A 4PJNA 4FMSA 1FMVA 1KNPA 1QJPA 4K3BA 2NW9A 2LM2A 1PHOA 1D0ZA 2QA7A 3CQXC 2W61A 4F6RC 5CA0E 1ZHWA 3POUA 5LB7B 4UIGA 5HEHA 3ZC0A 3N9NA 3SYBA 5FXZA 1LKXA 3L39A 5EZYE 2VKJA 2JQKA 1N33T 3KVDD 5C2TA 2SPCA 1H6S1 3ETUA 4UEMA 1NWMX 3W15B 5ABFB 1UUSA 3HI2A 2JIWA 3JCFA 2Y0LA 3DJBA 4HWIB 4KHZF 5JDLA 5C8YE 3J7Yq 2WU5A 3AEBA 3H37A 3SRZA 3QUJA 3N9MA 1NAFA 3IA3A 4IDNA 2XQ9A 4JLEA 3UFGA 2O4VA 4L5GA 5IUXA 5ABFA 5J2UE 5KMGP 4HWCA 4TWDA 3PE0A 5G3AA 2MYSA 2MBGA 3PTRB 4YSYA 2K48A 2X27X 4O4XA 1N34T 2KC0A 2LSJA 2E9XC 4EB6E 4X64T 3VZUX 5LGUB 2IMLA 3OPCA 2VKOA 3P7IA 4B6XA 5F8PA 4H63H 1LVFA 4YSXA 4P1NA 2BG9B 5JR9B 3PGRA 2QRXA 1N36T 2K24A 5AQIB 2V7KA 2YU2A 3ZCJA 2CXFA 2WMNA 3I9WA 2XAFB 3VRBA 5JREA 4XAXB 2BG9A 5JR9A 4JI8T 3TLVA 4D5UA 2CBJA 3HL6A 5HXRA 5LHGB 5JDPA 2E9XD 5DL5A 4WNKA 4WZXA 2XAHB 4X66T 4YFSA 4AQGA 4JV5T 1OPFA 4O3XB 2W2UA 5LHHB 3FBLA 3PUSA 3AXJB 2N9DA 3QC9A 2XJ7A 2WBLA 2UXCT 4GOUA 5FMNA 3RQUA 4CXWA 3AB3B 3FZMB 4CI1B 1P4TA 3NZQA 4O8SA 4PJLA 3UUNA 4FZNA 3AA1B 3M3ZB 4UV8B 4QXCB 2W0GA 3AXJA 4EIWA 5HEUA 2VK9A 4OHFA 4G63A 2JMKA 3AA0B 3VZTX 2D2SA 2P9BA 3OKQA 2MTQA 5AQHB 2ERVA 2FGRA 2M6BA 5LP6E 3UUBA 4AI6A 4KP3C 1D1BA 2VVNA 3AA1A 3UU8A 2MHLA 3LJCA 2Y8DA 5HWXA 5FVNA 6PRNA 1KF6A 3AA0A 3DA4A 5JRCB 3ZSSA 4I43B 4N74A 3DWNA 2M07A 2Y2XA 5HCJA 3O1JA 3TLWA 2BVMA 4GK5E 4IE5A 3MXZA 4N59A 5AQFB 3D0TA 4TWHA 3WI3A 2JQ9A 2V6YB 5AQSB 3BQLA 5JRCA 2CMRA 3C50A 2J4GA 4FZMA 3MK7C 4HFEA 2QGSA 1XMOT 3WU2O 3FBZA 5L4EA 4PJJA 3NRXA 3N5LA 1SHZC 2WAUA 3QB5K 1S94A 3SZDA 2V6YA 4C91A 4DBRA 4MHCA 5G26A 2YNKA 2XTLA 1GFPA 2DL1A 4U2YA 2D0TA 2BKNA 5L3FB 2D5UA 3J9X1 3PUWF 4CN1A 3K3OA 2EHOB 2ZMAA 4A97A 3CK6A 4AKRB 1MM4A 1HNXT 4IDZA 2BS2A 5LBQB 4CI3B 3ZYMA 3FHNA 4LMKA 2XM1A 4UB8O 2L3LA 4I50E 3WAJA 2K3WA 4ZS2A 2EHOA 3UU4A 2HN2A 2Q9QC 2V7JA 4EGWA 2ZFGA 2ZM8A 4AKRA 1B7TA 4QWNB 2UU9T 1T1LA 2WS3A 4GK0E 3ZN1B 1M7KA 5IYZE 2UUBT 1YQ3A 1XNQT 2CHOA 4UB6O 3QNUA 4ANJA 4AFKA 1YW0A 1MM5A 4PJ0O 2KNDA 3RIUA 3FXDB 2X0HA 4X1KE 4NXNT 3AAAB 2OLTA 2R4PA 4FESA 3O4XE 1HR0T 4RJWA 4U7YA 5GV0A 3Q5EA 4DR3T 3OYZA 3OVUA 4X5TA 3VKGA 4H9OC 3CX7B 4OYKA 2Q9QD 5JDMA 3AAAA 1W0BA 4M1PA 5J0ZA 1UGOA 5DQVA 5JQGE 4AKGA 2BVLA 1O3XA 4IT4A 2XSAA 4JI5T 4DV3T 4EXTA 4WYVA 3K8PC 2CPTA 2VL0A 4AKMA 3P4WA 2JQQA 3BRYA 4LF8T 2RA1A 4GHBA 3N2GE 3RX6A 4AIUA 3K1SA 2X9KA 4PAGA 4ZI3C 2V5CA 4GYSA 3NWIA 3RLFF 2LHRA 4AZLA 2VKDA 3TZGA 2WY2A 3HOEA 4X20E 3PUZF 3GMIA 1G8XA 1QJ9A 5FY0A 2FJBA 2BS4A 1VRBA 5EK4A 1J5WA 2VKHA 3L09A 3CX6B 4YTMA 2MOZA 1XNRT 3POXA 4CN4A 3LFMA 3PGUA 3NRYA 1ZHTA 4KI0F 5BMVE 2M6IA 3T0SA 5HEGA 1T7SA 3I9YA 2WM9A 4EEDA 1M62A 1T16A 4ZI3D 4ZI2C 1YS5A 3ZJ1A 3JAFA 5G39A 4U3CA 3LK41 4ZHQE 5JDGA 1D0YA 3UU3A 3ANWA 2E9XB 5LG4A 2V7MA 3AEDA 5FNVE 2Y6XA 4OX9T 3AE9A 5B66O 1J1JA 3I0QA 2LLYA 4U9CA 3WI4A 1S5LO 3NZPA 3EMNX 2E9XA 2HHHT 3SOLA 4V1Av 4ASKA 3SY9A 4YSZA 3RH3A 1ZHCA 3U3IA 1YKEB 1MIYA 3VHLA 4CXXA 4ZI2D 3PF1A 3ZMTB 1ORMA 2Y7SA 7PRNA 4N78D 3C5OA 5DL6A 2NTYA 1EZ3A 2PFVA 3LK2B 1HG2A 4L9IA 3OBVE 2WJQA 5HYAA 4AYNA 2LSYA 3VR8A 3VZWX 4O4JE 1FMWA 5FP3A 2W62A 4IREA 4JYAT 3LK2A 3EVYA 5DQWA 3QRAA 3EHZA 4FSOA 2Z6EA 2NWBA 5LG3A 1Y01A 3BQIA 4IDPA 3KINB 1KNZA 2CCQA 2VWAA 1ZV4X 4DV4T 3GN5B 4C90A 2XQ3A 2C5JA 2F1CX 3N2OA 1W0AA 4L0RA 1KNRA 3RGLA 2JMMA 3FZFB 1HS7A 1MMAA 2YDRA 4NPPA 4LF6T 4A56A 3AE3A 1MMGA 2X9XA 5HCMA 4HFCA 5LMNT 3GN5A 1X79A 1CUNA 4AKLA 2XG6A 2W81C 3O1HA 5HEOA 1E2AA 4H63V 3AEGA 3CQGB 2CLYC 3DTOA 4AQFC 3P4RA 4E7SA 4K0UA 4ZZBA 1MPFA 5DL7A 4NXMT 4QH5A 3I0OA 5L3DB 4O2AE 2X0LB 2V7IA 4IE0A 2ACXA 3B5MA 2J47A 1ZKEA 4JEHB 2NP9A 4IE6A 3SYSA 2ODVA 3EABA 4JI2T 3C4XA 2IHR1 4JI0T 1QUUA 3LBXB 5IHYA 3RC8A 3RYIE 1PRNA 1BR0A 4U31A 5AQMB 5LHIB 3BS0A 4CTDA 1L0VA 2I0MA 1WFDA 3VY8X 3QB5A 2VURA 4K3CA 2D9DA 3CIRA 2H88A 2WB5A 4MLKA 3OTOT 4ISSA 4BUMX 2BG9E 4H9PC 3ZYKA 3UQ7A 4AYDC 3DP7A 3DZMA 1WR0A 4HFVA 1HFAA 5CA1E 3AAEB 4PK4A 3ZSTA 2XQ6A 2WCAA 4GKKT 2R4NA 2WQYA 3A7MA 2V26A 1MIWA 2VQFT 3ZYLA 5LGTB 1Q9GA 3VE2A 3RYCE 1U5PA 2YN6A 4JI6T 2Q9QB 4DR4T 5FYMA 2C5IT 2YOEA 4KX6A 2MPKA 2FUPA 2K4TA 3AAEA 1R8IA 2W63A 3U78A 2WDQA 4TWFA 3HA4A 3A5XA 3RF1A 1LVKA 2R4LA 5KAFO 1XDOA 4LSEA 2GK9A 4COFA 5JDNA 2Q9QA 2UXDT 4AXPA 3O0EA 2CWYA 3FXEB 1T72A 2L8KA 4X1IE 3PUXF 4EZ4A 2HPLA 3MA9A 1G73A 4Q25A 3E08A 2ZLDA 2KWIB 3CKDA 2IWVA 2C0SA 4JEUB 4AYEC 4C69X 3ZT6A 5F5WA 3UQ4A 1HX8A 5AQTB 1T98A 2PORA 4RLBA 1QLBA 1UCUA 2F4VT 3Q2MA 4FRTA 3TLSA 4H9RC 3PUYF 4HWDA 4PFPA 4IL9A 2DNXA 4J2CA 3UU2A 4H9SE 2NW8A 3L8RA 5H2FO 4TUYE 2J1NA 1QJ8A 4DUZT 4U72A 3AECA 3PV0F 2A2FX 3VR9A 3FZLB 2LHFA 2WVPA 3AE7A 4TZ4C 1XWMA 2Y0HA 2KXPB 3RKGA 1IJ5A 4HFHA 3ONLC 1WYCA 4RLCA 5KXJA 1I94T 3ZMUB 5KAIO 3KVAA 5AQPB 4HN9A 2LT3A 3HKBE 2JPFA 3FZKB 3Q9DA 2CE7A 2KWHA 4YXDA 1BH3A 2IC9A 2KXPA 2DWGA 2LRLA 3LSVA 3SWHA 3PDYA 5F3JA 4H9QC 2KT9A 4DO0A 1IJ6A 4B3RT 3KVBA 5JVDE 3PUAA 3UTKA 2AXTO 4DV6T 4QHOA 3AEFA 3ZMVB 5GTIO 4ZI7E 5JDQA 3LK3B 4BA9A 3PGSA 5HWYA 5LA6E 5H6RB 4GCSA 3ONXA 1HX1B 2CHNA 3UFEA 2V5DA 4O4IE 3ZEFB 1BXWA 4ILUA 3A0HO 4DMWA 4JI4T 3LK3A 2JRKA 2ODUA 4LMJA 4KR8A 4O3WA 4DV1T 4E7ZA 3AA7B 1SE7A 3TLTA 4C00A 2W66A 1I6ZA 1HXXA 1BR4A 3BQKA 2XQ7A 4DUYT 2ODJA 3M65A 2QYWA 2WMOA 8PRNA 5G38A 3C64A 2L9QA 3AA7A 4G75A 1WR6A 4DBQA 2YDSA 4LFAT 3KBTA 3CQCB 5DABA 4UV9B 3CMLA 2KMFA 4QH4A 4QKNA 2A9UA 3UT5E 5TISO 3P8CD 3SY7A 5FY7A 2CXDA 1HXUA 3HR0A 3Q5DA 1VCSA 3ZKRA 3K3QC 4HGAA 4EOZB 4HWFA 5BR8T 2X9HA 1YXRA 3KFWX 4UELA 3AVRA 3T1HT 4IE4A 4LMLA 4GCPA 5LCYA 4YLHA 4DIDB 4QXBB 2J62A 5EK3A 2NOXA 3QOFA 2BZBA 5AQOB 2VB6A 1N32T 4JBWF 3PQSA 4UR9A 4YJ2E 1FIOA 3EAMA 2CLYB 4ILAA 2HN1A 1G90A 5CJ5A 3PORA 2LKGA 4GCQA 4NIQA 3IF8B 1THQA 4D64A 2R88A 5KDMC 4PW8A 5FY1A 5LMUT 5KX5E 4XZCA 4TNWA 3NKZA 1MMDA 2FJDA 4HFIA 1SUMB 2X67A 1E54A 2YDQA 3PJAJ 4NUVA 1OWAA 2XASB 2X9YA 3RYHE 4B3TT 3WI5A 4AQFA 3UUXB 1LRZA 4BJMA 1U4QA 4FZLA 4RL9A 3PQUA 3I1AA 3GA8A 1FJGT 2JMHA 2KLQA 2DCFA 4FUVA 4Z91A 4KMCA 3T20A 4OK0A 4ADZA 3OYXA 4YJ3E 1X9BA 5HXEA 4AKIA 5LOVE 4FQEA 3C4WA 4IE7A 4HFBA 2VQET 5LGNB 1H7CA 2IWWA 5AFUK 4UVCB 3ZJ2A 4DNDA 2PBIA 5ABGA 2XAGB 2R89A 3FZHB 4WW0A 2XE3A 2W80C 4PUXA 5AQVB 2BDEA 4PK6A 4LSIA 1HF8A 2LOSA 2YKSA 4UVAB 3ZN0B 2WU2A 1ZHZA 2LKHA 1KEYA 1NENA 3AE8A 4FJOA 3SS1A 2PRNA 2R8AA 4HE8A 4IL4A 5LYJE 3BK9A 2IW5B 2ZM2A 1MNDA 4CI2B 3RBHA 3ZC1A 3EUHA 2CRBA 1NEKA 3JAEA 2X68A 2BKPA 3RRWA 5L4HA 4U33A 1OEDC 1T8BA 4CZZB 3P4QA 5FVLA 2WP9A 3SZVA 1VOMA 3UULA 2WDRA 4YHHT 3T1YT 2IDOB 3MACA 4WBNE 3AAIA 5LJNA 1QSDA 3RI5A 4YT0A 5FXVA 1MNEA 4IHJE 2LHNA 2HPJA 2K5BB 5T5FA 3PRNA 3KV6A 2XE2A 3G7GA 4F8HA 4I4TE 4Z8XA 3LK42 1IBKT 2ACZA 1XZYA 2X51A 2IC6A 3NVOA 4B3MT 4TN7B 2J4UP 3AVSA 1Z0PA 1XDPA 3RQWA 3R6NA 3GWHA 4FOZA 3CVRA 3RPUA 2LEHA 4DVDA 2AE9A 3IBPA 4O4LE 3RIFA 3AEAA 2QTKA 4O3YA 3MJXA 2XHEB 5HAXA 2F1VA 4HKAA 2K9AA 1JNRA 4GF4A 3ZLIA 4LF7T 4EYUA 2OA5A 2M06A 4KHPT 1YKHB 4X1YE 4I0UA 4DR5T 3Q5XA 1GFNA 4DV7T 5E0OA 5HXSA 3X1DA 3P4PA 3N9PA 3PUVF 4HWHA 3RC3A 3ZT5A 2MNHA 4IIJE 2WZIA 2BS3A 3MKDA 2OMFA 4AKHA 5AFUL 4JCHA 3PURA 3C4ZA 3POQA 2BBHA 4YTNA 4CN6A 4XNKA 2XQ5A 2LE8A 3N9LA 2H7OA 3BRZA 2B76A 5HEJA 4IL6O 3ONJA 1CHUA 4B3ST 3LBXA 4A98A 2JQYA 5A1LA 4LFCT 2ZM0A 4P0BA 2UUAT 2DI4A 1HCIA 3HKEE 5AQRB 3OJAA 3ZPOA 1W09A 4QQ1A 1YD8G 4ERRA 2GE4A 1W9RA 3JC6C 3P4SA 2VL8A 3UPGA 2PJQA 1KK7A 4F4BA 3EI0A 4KR4A 5ADXK 4PFOA 2X9WA 5ABEA 5JH7E 4GYRA 3WAKA 1JNZA 3IEEA 2A72A 5AQGB 4AYMC 5IYUA 2OV9A 2FJAA 3LDQB 4HTEA 1J5ET 4ISTA 4DV2T 1AJ3A 2V1DB 4IDQA 2KINB 4FSPA 3RIAA 2XSBA 4LF4T 3S4UA 3FYXA 3C98B 3HW9A 3JC6D 2N2MA 3IHRA 2D0UA 2ZLYA 4OFZA 4ILCA 4O4HE 1WRDA 3H3AA 2XE5A 4TNVA 2WSSV 2XAQB 3KBUA 5CB4E 1IBLT 1HG5A 4HFDA 4E1SA 3AA6B 1FEWA 4PK5A 4X62T 3P50A 4U2ZA 3SFDA 4AISA 3T8OA 1HNWT 2WJRA 3AE6A 5L3GB 5FL1A 4U7IA 2MAWA 2LOPA 2YK0A
chains in the Genus database with same CATH topology
4FT6A 4PJNA 4FMSA 4QKNA 1FMVA 2K0LA 4OYJA 3LK41 4ZHQE 5JDGA 4XNLA 1QJPA 1D0YA 3AA6A 3UT5E 1D1CA 3ANWA 3P8CD 2NW9A 1PHOA 2N2NA 2E9XB 5LG4A 3B13A 1D0ZA 3SY7A 5FY7A 2CXDA 2V7MA 1HXUA 2QA7A 3CQXC 3HR0A 2W61A 4F6RC 2A3DA 3K3QC 5FNVE 2Y6XA 5CA0E 4HGAA 1ZHWA 3POUA 4EOZB 2XTQA 3I0QA 2X9HA 3KFWX 4UELA 2XMXA 3AVRA 4U9CA 4P0AA 3WI4A 4UIGA 3NZPA 4WBOA 3ZC0A 3N9NA 4IE4A 2CA5A 3SYBA 5FXZA 1LKXA 4GCPA 3EMNX 2E9XA 2LM9A 5LCYA 5D5DA 3SOLA 4V1Av 4YLHA 5EZYE 4ASKA 2VKJA 2KDYA 2XAJB 3SY9A 3RH3A 3KVDD 1ZHCA 2CM0A 2LSGA 2SPCA 1YKEB 2CXLA 3U3IA 1BT9A 1MIYA 4QXBB 3JTYA 2M67A 3VHLA 1H6S1 4CXXA 2UXNB 3ETUA 4ZI2D 4AYEC 7PRNA 5EK3A 4UEMA 2NOXA 1NWMX 3ZMTB 2NW7A 1ORMA 2Y7SA 2BZBA 2DWKA 3W15B 4RJXA 2VB6A 4N78D 3C5OA 5DL6A 3PQSA 4QXHB 2NTYA 3KV9A 3HI2A 4EYYR 3KV4A 2V7LA 2Y0LA 3DJBA 4YJ2E 1FIOA 3CPZA 4CQIA 5JDLA 1EZ3A 2CLYB 5C8YE 3J7Yq 2YPVA 1G90A 2PFVA 3H37A 1HG2A 3LK2B 3CWZB 3QUJA 4L9IA 3N9MA 3OBVE 4QX8B 3SRZA 3PORA 4GCQA 1NAFA 1BR1A 3IF8B 5FXWA 1THQA 4D64A 4KUMB 4JLEA 5HYAA 2O4VA 4AYNA 3E22E 2LSYA 4ZS3A 5LXTE 5KDMC 4PW8A 4L5GA 3VZWX 5FY1A 4O4JE 5DL8A 5KX5E 4XZCA 5J2UE 5KMGP 2N2LA 1FMWA 3PE0A 2MYSA 2MBGA 3PTRB 2W62A 5FP3A 1US7B 3L3PA 1MMDA 2K48A 5LNKA 2X27X 4O4XA 2X67A 2KC0A 1E54A 5DJQC 4BJNA 5HXHA 1OXZA 2LSJA 3RKOA 1ZHXA 2E9XC 4EB6E 4NUVA 4MALA 3LK2A 1OWAA 2XASB 2X9YA 3EVYA 2KZ7B 5DQWA 3RYHE 3QRAA 3VZUX 3WI5A 4TX5A 4AQFA 1Q9FA 4G76A 3EDUA 5LGUB 4FSOA 3T24A 3UUXB 1LRZA 2VKOA 2Z6EA 3P7IA 5F8PA 4B6XA 4BJMA 1U4QA 2NWBA 4H63H 4FZLA 1LVFA 2HH7A 2YINA 3E0ZA 3BQIA 1KNZA 3KINB 4RL9A 3PQUA 2CCQA 3I1AA 5JR9B 2VWAA 3GA8A 2JMHA 2KLQA 1ZV4X 3KV5A 4NUUA 2DCFA 4KRAA 3GN5B 4C90A 5ADXL 2K24A 4FUVA 2V7KA 2YU2A 2C5JA 4KMCA 3T20A 4OK0A 3N2OA 3ZCJA 4ADZA 4L0RA 2KZ7A 3OYXA 2JMMA 2LSIA 4YJ3E 2CXFA 1HS7A 2WMNA 3I9WA 2XAFB 1MMAA 5JDHA 5HXEA 5JREA 4XAXB 2X66A 5LOVE 2C5KT 4AKIA 3ZCIA 3C4WA 4A56A 4IE7A 5JR9A 1MMGA 2X9XA 3V5SA 5LGNB 1H7CA 2LFUA 4UXNB 5AFUK 3GN5A 2XTRA 4D5UA 5EK2A 1X79A 1CUNA 4UVCB 4AKLA 2XG6A 3ZJ2A 3O1HA 4DNDA 2W81C 3HL6A 3F57A 4H63V 5HXRA 4B61A 2PBIA 3CQGB 2CLYC 1SA0E 3DTOA 5LHGB 2Y0KA 2E9XD 4CXYA 2XAGB 5DL5A 4WNKA 5JDPA 4AQFC 4E7SA 4K0UA 1GFMA 1MPFA 2XAHB 4WW0A 5DL7A 4LSFA 2XE3A 2W80C 4YFSA 4PUXA 3I0OA 4AQGA 2BDEA 5L3DB 1OPFA 4O2AE 4PK6A 4LSIA 2X0LB 2V7IA 5EE2A 4O3XB 4IE0A 4Z3TA 5LHHB 1HF8A 4ZOLE 3EDVA 3FBLA 2LOSA 5L3EB 2N1GA 2ACXA 3PUSA 3QC9A 2N9DA 4UVAB 3ZN0B 2PG8A 1ZHZA 1ZKEA 4JEHB 2NP9A 2WBLA 4FI5A 4FJOA 3SS1A 4GOUA 4TV9E 5FMNA 2PRNA 3HOLA 4P09A 4CXWA 4IE6A 3AB3B 3SYSA 4HE8A 2ODVA 3C4XA 5L3BB 5LYJE 3BK9A 4CI1B 4BAYB 5JR9C 1P4TA 3NZQA 4O8SA 4PJLA 2IW5B 1V9DA 3UUNA 1QUUA 3LBXB 4FZNA 5IHYA 2ZM2A 3AA1B 3RC8A 1MNDA 4UV8B 3RYIE 5TAOA 4CI2B 4QXCB 3RBHA 3NSGA 3ZC1A 1PRNA 3EUHA 2W0GA 1BR0A 4YHJA 4EIWA 1GFQA 1E1HB 2VK9A 5LHIB 2X68A 4OHFA 4G63A 4FRXA 2JMKA 3AA0B 3RRWA 3VZTX 2D2SA 2P9BA 3OKQA 2XUEA 2MTQA 3VY8X 2ERVA 2FGRA 5LP6E 4AI6A 2XE1A 4KP3C 2E8IA 4MLKA 1D1BA 4TV8E 4CZZB 4ISSA 4BUMX 3AA1A 5M4YA 4H9PC 3ZYKA 3QK6A 2MHLA 3UUMA 3LJCA 2Y8DA 4AYDC 3VY9X 3SZVA 5HWXA 5FVNA 1VOMA 3DP7A 3UAQA 3UULA 3VKHA 3TKLB 6PRNA 3MACA 4WBNE 3AA0A 3DA4A 4HFVA 1HFAA 5JRCB 5CA1E 3AAEB 4PK4A 3AAIA 2I59A 4I43B 5LJNA 1IAPA 2DHRA 4UVBB 1QSDA 5LBMA 2M07A 2Y2XA 5FXVA 3O1JA 3O1IA 2V26A 1MNEA 3CX8B 2LHNA 4IHJE 1MIWA 2HPJA 2BVMA 3ZYLA 2K5BB 5ETWA 5LGTB 4GK5E 1Q9GA 2W00A 5T5FA 2IAKA 3VE2A 3PRNA 3RYCE 3K3NA 3KV6A 4IE5A 1U5PA 3MXZA 4N59A 2Q9QB 5H6QB 3D0TA 5FYMA 2C5IT 5L3CB 2XE2A 2LSKA 3WI3A 4AYID 3G7GA 3BQLA 5JRCA 2K4TA 2CMRA 2ES0A 3C50A 3AAEA 2RP4A 4I4TE 4Z8XA 4D65A 3LK42 4PNIA 4FZMA 3MK7C 2X51A 2W63A 2QGSA 4O2BE 2IC6A 3U78A 1IZNB 4TN7B 3HA4A 3A5XA 2J4UP 3FBZA 1LVKA 3AVSA 1Z0PA 4PJJA 1D1AA 3NRXA 3PU8A 3N5LA 1SHZC 2WAUA 4LSEA 2GK9A 5JDNA 2Q9QA 3R6NA 3GWHA 4FOZA 3CVRA 1S94A 3SZDA 3RPUA 4AXPA 3O0EA 4PJMA 4C91A 2LEHA 4DBRA 2CWYA 3FXEB 4MHCA 5G26A 4JFBA 1HTJF 2L8KA 4X1IE 4DVDA 2YNKA 4EZ4A 2HPLA 2XTLA 3IBPA 4O4LE 1GFPA 3MA9A 3R84B 2CEAA 1G73A 1IZNA 2ZLDA 3E08A 2QTKA 1MIVA 2NTXA 4H9NC 4O3YA 2KWIB 3CKDA 3MJXA 2D0TA 2C0SA 2XHEB 3NBXX 2CWOA 4JEUB 5HAXA 3V5UA 3VU7H 2D5UA 4HKAA 5L3FB 2F1VA 2K9AA 3J9X1 4C69X 3RYFE 4GF4A 3K3OA 3ZLIA 2EHOB 4EYUA 2OA5A 4O4UA 4O3ZA 2ZMAA 1HX8A 2M06A 4AKRB 1OSMA 1MM4A 1T98A 5L2LA 4IDZA 2PORA 4RLBA 5LBQB 4CI3B 3ZYMA 1UCUA 1YKHB 3FHNA 4X1YE 2FGQX 3Q2MA 3Q5XA 2UXXB 4FRTA 2L3LA 4H9RC 3ANWB 4PFPA 5FXXA 4I50E 2YU1A 4O49A 2DNXA 4J2CA 3WAJA 1GFNA 4H9SE 3UU2A 2NW8A 5E0OA 4ZS2A 5HXSA 2EHOA 2H3RA 2Q9QC 1UX5A 3N9PA 2V7JA 4TUYE 3RC3A 2J1NA 2ZFGA 2ZM8A 1QJ8A 1B7TA 4KBMB 4AKRA 4QWNB 2MNHA 2VASA 4IIJE 2J1DG 4U72A 4GK0E 3MKDA 2OMFA 4AKHA 5AFUL 4JCHA 2A2FX 3PURA 3ZN1B 3C4ZA 2LHFA 5IYZE 4TZ4C 3POQA 4U74A 4ANJA 4XNKA 4AFKA 2LE8A 1YW0A 3Q5WA 1MM5A 2KXPB 3N2KE 3N9LA 2Y0HA 5PRNA 1IJ5A 2H7OA 2KNDA 5J2TE 3FXDB 1WYCA 4X1KE 4RLCA 2YEVC 3AAAB 3ZMUB 3KVAA 3F31A 3O4XE 4FESA 1WLXA 4HN9A 4RJWA 4LSHA 2LT3A 5GV0A 3HKBE 3LBXA 3ZMSB 2JPFA 2Y48B 1UX4A 4N58A 3OYZA 3Q9DA 5A1LA 2ZM0A 4P0BA 2DI4A 1HCIA 2CE7A 2KWHA 1BH3A 3VKGA 4XBFB 3HKEE 4H9OC 4I55E 2IC9A 2KXPA 2DWGA 3OJAA 3ZPOA 2EHOC 3CX7B 4QQ1A 4OYKA 1WYBA 3SWHA 1YD8G 3PDYA 4GIWA 5F3JA 4ERRA 4H9QC 4JUYA 2GE4A 4G2AA 2Q9QD 5JDMA 3AAAA 3ZMZB 2KT9A 3JC6C 4DO0A 1IJ6A 4M1PA 2VL8A 3VE1A 3KVBA 4MBQA 5DQVA 5JVDE 5JQGE 4AKGA 2PJQA 2BVLA 3UPGA 1KK7A 1O3XA 3PUAA 4F4BA 4KR4A 3UTKA 2DLRA 2WWUA 5ADXK 3V8UA 4PFOA 2X9WA 4QHOA 3ZMVB 1ZHYA 4E1TA 2XQYA 2H7VC 3HKCE 5JH7E 3HWBA 3ESLA 2F1TA 4EXTA 4ZI7E 4GYRA 5JDQA 3LK3B 3WAKA 3K8PC 3KDSE 4AKMA 4BA9A 3PU3A 3HKDE 5LJMA 5HWYA 3LG7A 1S35A 5LA6E 3IEEA 2JQQA 2A72A 3RRCA 3A2SX 2RA1A 5H6RB 4AYMC 4HEAA 5IYUA 5GONE 4GCSA 3ONXA 4GHBA 3N2GE 3RX6A 2JJ9A 3PUGA 3UFEA 4PAGA 4O4IE 4ZI3C 4GYSA 3ZEFB 1BXWA 4HTEA 4ILUA 2LHRA 4ISTA 5HXCA 4DMWA 2VKDA 4AZLA 1AJ3A 3TZGA 3LK3A 2V1DB 3HOEA 2JRKA 4X20E 2KINB 2ODUA 4FSPA 3GMIA 1G8XA 1QJ9A 3FB2A 1MMNA 5FY0A 4KR8A 2EHOD 3GP6A 1VRBA 4O3WA 5EK4A 5JDFA 3S4UA 4E7ZA 3FYXA 3C98B 3AA7B 4UF0B 3QRCA 2VKHA 3B57A 3HW9A 3JC6D 4QX7B 3L09A 2N2MA 3IHRA 3ETVA 2D0UA 2ZLYA 3CX6B 4EAHA 2MOZA 4OFZA 3PUQA 3POXA 5J1GA 1HXXA 1BR4A 1ZEEA 3LFMA 3BQKA 4O4HE 3N9OA 1WRDA 3H3AA 2ODJA 3M65A 2XE5A 3NRYA 1ZHTA 3O9XA 2WSSV 3DA3A 4AUIA 3N9QA 2XAQB 3KBUA 5CB4E 2WMOA 3F2EA 5BMVE 1Y64B 3C51A 4EZHA 3T0SA 1HG5A 8PRNA 1BR2A 3C64A 2L9QA 4UF0A 3AA7A 4MFRA 3K19A 4G75A 3I9YA 1WR6A 2WM9A 1GFOA 2LJLA 4E1SA 3AA6B 4DMVA 1FEWA 4DBQA 4PK5A 3MZKB 1HXTA 3KBTA 3CQCB 4ZI3D 4ZI2C 1D0XA 3T8OA 5DABA 2B1EA 2G0UA 4UV9B 5L3GB 1YS5A 3CMLA 2KMFA 2LOPA 3ZJ1A 4IGUA 2YK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK2 A;  3LK3 A;  4AKR B;  3AA1 A;  2KZ7 B;  5AFU L;  3LK2 B;  3LK3 B;  3LK4 1;  3AA1 B;  3AA6 A;  3AA7 A;  3AAE A;  2KXP A;  1IZN A;  3LK4 2;  5AFU K;  3AA6 B;  3AA0 A;  3AA7 B;  3AAE B;  2KXP B;  1IZN B;  3AAA A;  3AA0 B;  5ADX L;  3AAA B;  4AKR A;  2KZ7 A;  5ADX K; 
#chains in the Genus database with same CATH topology
 5B5E O;  4N75 A;  4ILB A;  2K0L A;  4OYJ A;  4XNL A;  3AA6 A;  1D1C A;  2N2N A;  3B13 A;  2A3D A;  4PR7 A;  2NR4 A;  4IDO A;  2XTQ A;  2XMX A;  2W4X A;  2FJE A;  4P0A A;  2PTF A;  2XQ8 A;  3AEE A;  4WBO A;  2CA5 A;  5ABH A;  5D5D A;  2LM9 A;  2XQ4 A;  1UUR A;  2KDY A;  2XAJ B;  2XY8 B;  2CM0 A;  2LSG A;  1BT9 A;  2CXL A;  3JTY A;  2M67 A;  2UXN B;  2NW7 A;  4A5X A;  2DWK A;  4RJX A;  4DR7 T;  4QXH B;  3KV9 A;  4EYY R;  3KV4 A;  2V7L A;  3CPZ A;  4CQI A;  2YPV A;  5FL0 A;  3CWZ B;  4QX8 B;  4Z90 A;  1BR1 A;  5FXW A;  4KUM B;  3E22 E;  1KFY A;  4ZS3 A;  5LXT E;  5DL8 A;  4C4V B;  2N2L A;  2XPK A;  1US7 B;  3L3P A;  3DWO X;  5LNK A;  1OED E;  1ZHX A;  5DJQ C;  4BJN A;  5HXH A;  1OXZ A;  3RKO A;  4MAL A;  2KZ7 B;  5E79 O;  4TX5 A;  2R4O A;  1Q9F A;  5FKY A;  4G76 A;  3EDU A;  3T24 A;  2UXB T;  2KSR A;  2HH7 A;  2YIN A;  3AE5 A;  3E0Z A;  1HNZ T;  2WZH A;  4C4V A;  3KV5 A;  4NUU A;  4KRA A;  2XQA A;  4DR1 T;  1VCT A;  5ADX L;  5CGM A;  1E7P A;  2KZ7 A;  2LSI A;  4YY3 T;  2E5V A;  5JDH A;  2X66 A;  2C5K T;  3ZCI A;  1IBM T;  5AQJ B;  3V5S A;  1OED B;  2LFU A;  4UXN B;  2XTR A;  2E2A A;  4ZEY A;  5EK2 A;  4DR6 T;  3F57 A;  4B61 A;  1SA0 E;  2Y0K A;  4CXY A;  1GFM A;  1OED A;  4LSF A;  2WWV A;  5EE2 A;  5GTH O;  4Z3T A;  4JI7 T;  4ZOL E;  3EDV A;  5L3E B;  2N1G A;  2PG8 A;  2JQH A;  3NJT A;  4FI5 A;  3HOL A;  4TV9 E;  4P09 A;  4ZZC A;  5IWA T;  5L3B B;  2BG9 C;  5JR9 C;  4BAY B;  4JI3 T;  3RHW A;  2LRK A;  1V9D A;  3ZT7 A;  2IIU A;  5TAO A;  2BBJ A;  4AQY T;  3NSG A;  4YHJ A;  1GFQ A;  1E1H B;  4FRX A;  5C3J A;  2AXD S;  5AQK B;  1Z8U A;  3A8Y C;  2XUE A;  5AQL B;  2XE1 A;  1GQE A;  2E8I A;  4TV8 E;  5AQU B;  5M4Y A;  1ZOY A;  3QK6 A;  3UUM A;  3VY9 X;  3TLU A;  3UAQ A;  3VKH A;  3TKL B;  5FVK A;  3JCU O;  2I59 A;  1IAP A;  2DHR A;  4UVB B;  5LBM A;  4GKJ T;  3H3M A;  3O1I A;  4K0K T;  3CX8 B;  1DU2 A;  5ETW A;  2W00 A;  2IAK A;  3K3N A;  3UU6 A;  5H6Q B;  2X0Y A;  5L3C B;  4AYI D;  2LSK A;  4DV0 T;  5AQQ B;  4DR2 T;  2ES0 A;  2RP4 A;  4ZXL A;  4D65 A;  4PNI A;  4O2B E;  1IZN B;  1D1A A;  3PU8 A;  2CBI A;  4PJM A;  1WCR A;  4JFB A;  1HTJ F;  3R84 B;  2CEA A;  1IZN A;  3UU5 A;  1MIV A;  2NTX A;  4H9N C;  3AE2 A;  3SFE A;  3V5U A;  3NBX X;  2CWO A;  3VU7 H;  3RYF E;  5CFB A;  2XM2 A;  4O4U A;  4O3Z A;  2H89 A;  1YQ4 A;  4QH1 A;  1OSM A;  3KZI O;  4DV5 T;  5L2L A;  2E5L T;  4EEB A;  2FGQ X;  2UXX B;  3ANW B;  5FXX A;  2YU1 A;  4O49 A;  5JTG A;  2H3R A;  1UX5 A;  3PJA A;  4KBM B;  2VAS A;  2J1D G;  4X65 T;  2ZM6 T;  2FBW A;  4JI1 T;  2VVS A;  4LF5 T;  2RPA A;  4U74 A;  3Q5W A;  5PRN A;  3N2K E;  5J2T E;  2YEV C;  3F31 A;  1WLX A;  3A0B O;  4LSH A;  3ZMS B;  2Y48 B;  1UX4 A;  4N58 A;  5L47 A;  4XBF B;  4I55 E;  2V6X A;  2I6H A;  2UUC T;  2EHO C;  1WYB A;  2QVA A;  4GIW A;  4JUY A;  4G2A A;  3ZMZ B;  3VE1 A;  3G06 A;  4MBQ A;  2DLR A;  2WWU A;  1UK5 A;  3V8U A;  1ZHY A;  4E1T A;  2XQY A;  2H7V C;  3HKC E;  3HWB A;  3ESL A;  5AQN B;  2F1T A;  3KDS E;  3PU3 A;  3HKD E;  5LJM A;  3LG7 A;  1S35 A;  3RIU C;  3RRC A;  3A2S X;  4HEA A;  5GON E;  2JJ9 A;  3PUG A;  4LF9 T;  4YTP A;  4EV6 A;  2XZE A;  5HXC A;  2R6G F;  3JAD A;  3FB2 A;  1MMN A;  3AE4 A;  3ABV A;  2EHO D;  3GP6 A;  5JDF A;  2IUB A;  4UF0 B;  3QRC A;  3B57 A;  4QX7 B;  3ETV A;  4EAH A;  3VRA A;  3PUQ A;  5J1G A;  2WDV A;  1ZEE A;  3N9O A;  3DA3 A;  4AUI A;  3O9X A;  3AE1 A;  3N9Q A;  3F2E A;  1Y64 B;  3C51 A;  4EZH A;  1BR2 A;  4UF0 A;  3K19 A;  4MFR A;  1GFO A;  2LJL A;  4DMV A;  1ZP0 A;  3MZK B;  1HXT A;  4LFB T;  1D0X A;  1XMQ T;  2B1E A;  2G0U A;  2BKO A;  2W67 A;  2V8S V;  4IGU A;  4FT6 A;  4PJN A;  4FMS A;  1FMV A;  1KNP A;  1QJP A;  4K3B A;  2NW9 A;  2LM2 A;  1PHO A;  1D0Z A;  2QA7 A;  3CQX C;  2W61 A;  4F6R C;  5CA0 E;  1ZHW A;  3POU A;  5LB7 B;  4UIG A;  5HEH A;  3ZC0 A;  3N9N A;  3SYB A;  5FXZ A;  1LKX A;  3L39 A;  5EZY E;  2VKJ A;  2JQK A;  1N33 T;  3KVD D;  5C2T A;  2SPC A;  1H6S 1;  3ETU A;  4UEM A;  1NWM X;  3W15 B;  5ABF B;  1UUS A;  3HI2 A;  2JIW A;  3JCF A;  2Y0L A;  3DJB A;  4HWI B;  4KHZ F;  5JDL A;  5C8Y E;  3J7Y q;  2WU5 A;  3AEB A;  3H37 A;  3SRZ A;  3QUJ A;  3N9M A;  1NAF A;  3IA3 A;  4IDN A;  2XQ9 A;  4JLE A;  3UFG A;  2O4V A;  4L5G A;  5IUX A;  5ABF A;  5J2U E;  5KMG P;  4HWC A;  4TWD A;  3PE0 A;  5G3A A;  2MYS A;  2MBG A;  3PTR B;  4YSY A;  2K48 A;  2X27 X;  4O4X A;  1N34 T;  2KC0 A;  2LSJ A;  2E9X C;  4EB6 E;  4X64 T;  3VZU X;  5LGU B;  2IML A;  3OPC A;  2VKO A;  3P7I A;  4B6X A;  5F8P A;  4H63 H;  1LVF A;  4YSX A;  4P1N A;  2BG9 B;  5JR9 B;  3PGR A;  2QRX A;  1N36 T;  2K24 A;  5AQI B;  2V7K A;  2YU2 A;  3ZCJ A;  2CXF A;  2WMN A;  3I9W A;  2XAF B;  3VRB A;  5JRE A;  4XAX B;  2BG9 A;  5JR9 A;  4JI8 T;  3TLV A;  4D5U A;  2CBJ A;  3HL6 A;  5HXR A;  5LHG B;  5JDP A;  2E9X D;  5DL5 A;  4WNK A;  4WZX A;  2XAH B;  4X66 T;  4YFS A;  4AQG A;  4JV5 T;  1OPF A;  4O3X B;  2W2U A;  5LHH B;  3FBL A;  3PUS A;  3AXJ B;  2N9D A;  3QC9 A;  2XJ7 A;  2WBL A;  2UXC T;  4GOU A;  5FMN A;  3RQU A;  4CXW A;  3AB3 B;  3FZM B;  4CI1 B;  1P4T A;  3NZQ A;  4O8S A;  4PJL A;  3UUN A;  4FZN A;  3AA1 B;  3M3Z B;  4UV8 B;  4QXC B;  2W0G A;  3AXJ A;  4EIW A;  5HEU A;  2VK9 A;  4OHF A;  4G63 A;  2JMK A;  3AA0 B;  3VZT X;  2D2S A;  2P9B A;  3OKQ A;  2MTQ A;  5AQH B;  2ERV A;  2FGR A;  2M6B A;  5LP6 E;  3UUB A;  4AI6 A;  4KP3 C;  1D1B A;  2VVN A;  3AA1 A;  3UU8 A;  2MHL A;  3LJC A;  2Y8D A;  5HWX A;  5FVN A;  6PRN A;  1KF6 A;  3AA0 A;  3DA4 A;  5JRC B;  3ZSS A;  4I43 B;  4N74 A;  3DWN A;  2M07 A;  2Y2X A;  5HCJ A;  3O1J A;  3TLW A;  2BVM A;  4GK5 E;  4IE5 A;  3MXZ A;  4N59 A;  5AQF B;  3D0T A;  4TWH A;  3WI3 A;  2JQ9 A;  2V6Y B;  5AQS B;  3BQL A;  5JRC A;  2CMR A;  3C50 A;  2J4G A;  4FZM A;  3MK7 C;  4HFE A;  2QGS A;  1XMO T;  3WU2 O;  3FBZ A;  5L4E A;  4PJJ A;  3NRX A;  3N5L A;  1SHZ C;  2WAU A;  3QB5 K;  1S94 A;  3SZD A;  2V6Y A;  4C91 A;  4DBR A;  4MHC A;  5G26 A;  2YNK A;  2XTL A;  1GFP A;  2DL1 A;  4U2Y A;  2D0T A;  2BKN A;  5L3F B;  2D5U A;  3J9X 1;  3PUW F;  4CN1 A;  3K3O A;  2EHO B;  2ZMA A;  4A97 A;  3CK6 A;  4AKR B;  1MM4 A;  1HNX T;  4IDZ A;  2BS2 A;  5LBQ B;  4CI3 B;  3ZYM A;  3FHN A;  4LMK A;  2XM1 A;  4UB8 O;  2L3L A;  4I50 E;  3WAJ A;  2K3W A;  4ZS2 A;  2EHO A;  3UU4 A;  2HN2 A;  2Q9Q C;  2V7J A;  4EGW A;  2ZFG A;  2ZM8 A;  4AKR A;  1B7T A;  4QWN B;  2UU9 T;  1T1L A;  2WS3 A;  4GK0 E;  3ZN1 B;  1M7K A;  5IYZ E;  2UUB T;  1YQ3 A;  1XNQ T;  2CHO A;  4UB6 O;  3QNU A;  4ANJ A;  4AFK A;  1YW0 A;  1MM5 A;  4PJ0 O;  2KND A;  3RIU A;  3FXD B;  2X0H A;  4X1K E;  4NXN T;  3AAA B;  2OLT A;  2R4P A;  4FES A;  3O4X E;  1HR0 T;  4RJW A;  4U7Y A;  5GV0 A;  3Q5E A;  4DR3 T;  3OYZ A;  3OVU A;  4X5T A;  3VKG A;  4H9O C;  3CX7 B;  4OYK A;  2Q9Q D;  5JDM A;  3AAA A;  1W0B A;  4M1P A;  5J0Z A;  1UGO A;  5DQV A;  5JQG E;  4AKG A;  2BVL A;  1O3X A;  4IT4 A;  2XSA A;  4JI5 T;  4DV3 T;  4EXT A;  4WYV A;  3K8P C;  2CPT A;  2VL0 A;  4AKM A;  3P4W A;  2JQQ A;  3BRY A;  4LF8 T;  2RA1 A;  4GHB A;  3N2G E;  3RX6 A;  4AIU A;  3K1S A;  2X9K A;  4PAG A;  4ZI3 C;  2V5C A;  4GYS A;  3NWI A;  3RLF F;  2LHR A;  4AZL A;  2VKD A;  3TZG A;  2WY2 A;  3HOE A;  4X20 E;  3PUZ F;  3GMI A;  1G8X A;  1QJ9 A;  5FY0 A;  2FJB A;  2BS4 A;  1VRB A;  5EK4 A;  1J5W A;  2VKH A;  3L09 A;  3CX6 B;  4YTM A;  2MOZ A;  1XNR T;  3POX A;  4CN4 A;  3LFM A;  3PGU A;  3NRY A;  1ZHT A;  4KI0 F;  5BMV E;  2M6I A;  3T0S A;  5HEG A;  1T7S A;  3I9Y A;  2WM9 A;  4EED A;  1M62 A;  1T16 A;  4ZI3 D;  4ZI2 C;  1YS5 A;  3ZJ1 A;  3JAF A;  5G39 A;  4U3C A;  3LK4 1;  4ZHQ E;  5JDG A;  1D0Y A;  3UU3 A;  3ANW A;  2E9X B;  5LG4 A;  2V7M A;  3AED A;  5FNV E;  2Y6X A;  4OX9 T;  3AE9 A;  5B66 O;  1J1J A;  3I0Q A;  2LLY A;  4U9C A;  3WI4 A;  1S5L O;  3NZP A;  3EMN X;  2E9X A;  2HHH T;  3SOL A;  4V1A v;  4ASK A;  3SY9 A;  4YSZ A;  3RH3 A;  1ZHC A;  3U3I A;  1YKE B;  1MIY A;  3VHL A;  4CXX A;  4ZI2 D;  3PF1 A;  3ZMT B;  1ORM A;  2Y7S A;  7PRN A;  4N78 D;  3C5O A;  5DL6 A;  2NTY A;  1EZ3 A;  2PFV A;  3LK2 B;  1HG2 A;  4L9I A;  3OBV E;  2WJQ A;  5HYA A;  4AYN A;  2LSY A;  3VR8 A;  3VZW X;  4O4J E;  1FMW A;  5FP3 A;  2W62 A;  4IRE A;  4JYA T;  3LK2 A;  3EVY A;  5DQW A;  3QRA A;  3EHZ A;  4FSO A;  2Z6E A;  2NWB A;  5LG3 A;  1Y01 A;  3BQI A;  4IDP A;  3KIN B;  1KNZ A;  2CCQ A;  2VWA A;  1ZV4 X;  4DV4 T;  3GN5 B;  4C90 A;  2XQ3 A;  2C5J A;  2F1C X;  3N2O A;  1W0A A;  4L0R A;  1KNR A;  3RGL A;  2JMM A;  3FZF B;  1HS7 A;  1MMA A;  2YDR A;  4NPP A;  4LF6 T;  4A56 A;  3AE3 A;  1MMG A;  2X9X A;  5HCM A;  4HFC A;  5LMN T;  3GN5 A;  1X79 A;  1CUN A;  4AKL A;  2XG6 A;  2W81 C;  3O1H A;  5HEO A;  1E2A A;  4H63 V;  3AEG A;  3CQG B;  2CLY C;  3DTO A;  4AQF C;  3P4R A;  4E7S A;  4K0U A;  4ZZB A;  1MPF A;  5DL7 A;  4NXM T;  4QH5 A;  3I0O A;  5L3D B;  4O2A E;  2X0L B;  2V7I A;  4IE0 A;  2ACX A;  3B5M A;  2J47 A;  1ZKE A;  4JEH B;  2NP9 A;  4IE6 A;  3SYS A;  2ODV A;  3EAB A;  4JI2 T;  3C4X A;  2IHR 1;  4JI0 T;  1QUU A;  3LBX B;  5IHY A;  3RC8 A;  3RYI E;  1PRN A;  1BR0 A;  4U31 A;  5AQM B;  5LHI B;  3BS0 A;  4CTD A;  1L0V A;  2I0M A;  1WFD A;  3VY8 X;  3QB5 A;  2VUR A;  4K3C A;  2D9D A;  3CIR A;  2H88 A;  2WB5 A;  4MLK A;  3OTO T;  4ISS A;  4BUM X;  2BG9 E;  4H9P C;  3ZYK A;  3UQ7 A;  4AYD C;  3DP7 A;  3DZM A;  1WR0 A;  4HFV A;  1HFA A;  5CA1 E;  3AAE B;  4PK4 A;  3ZST A;  2XQ6 A;  2WCA A;  4GKK T;  2R4N A;  2WQY A;  3A7M A;  2V26 A;  1MIW A;  2VQF T;  3ZYL A;  5LGT B;  1Q9G A;  3VE2 A;  3RYC E;  1U5P A;  2YN6 A;  4JI6 T;  2Q9Q B;  4DR4 T;  5FYM A;  2C5I T;  2YOE A;  4KX6 A;  2MPK A;  2FUP A;  2K4T A;  3AAE A;  1R8I A;  2W63 A;  3U78 A;  2WDQ A;  4TWF A;  3HA4 A;  3A5X A;  3RF1 A;  1LVK A;  2R4L A;  5KAF O;  1XDO A;  4LSE A;  2GK9 A;  4COF A;  5JDN A;  2Q9Q A;  2UXD T;  4AXP A;  3O0E A;  2CWY A;  3FXE B;  1T72 A;  2L8K A;  4X1I E;  3PUX F;  4EZ4 A;  2HPL A;  3MA9 A;  1G73 A;  4Q25 A;  3E08 A;  2ZLD A;  2KWI B;  3CKD A;  2IWV A;  2C0S A;  4JEU B;  4AYE C;  4C69 X;  3ZT6 A;  5F5W A;  3UQ4 A;  1HX8 A;  5AQT B;  1T98 A;  2POR A;  4RLB A;  1QLB A;  1UCU A;  2F4V T;  3Q2M A;  4FRT A;  3TLS A;  4H9R C;  3PUY F;  4HWD A;  4PFP A;  4IL9 A;  2DNX A;  4J2C A;  3UU2 A;  4H9S E;  2NW8 A;  3L8R A;  5H2F O;  4TUY E;  2J1N A;  1QJ8 A;  4DUZ T;  4U72 A;  3AEC A;  3PV0 F;  2A2F X;  3VR9 A;  3FZL B;  2LHF A;  2WVP A;  3AE7 A;  4TZ4 C;  1XWM A;  2Y0H A;  2KXP B;  3RKG A;  1IJ5 A;  4HFH A;  3ONL C;  1WYC A;  4RLC A;  5KXJ A;  1I94 T;  3ZMU B;  5KAI O;  3KVA A;  5AQP B;  4HN9 A;  2LT3 A;  3HKB E;  2JPF A;  3FZK B;  3Q9D A;  2CE7 A;  2KWH A;  4YXD A;  1BH3 A;  2IC9 A;  2KXP A;  2DWG A;  2LRL A;  3LSV A;  3SWH A;  3PDY A;  5F3J A;  4H9Q C;  2KT9 A;  4DO0 A;  1IJ6 A;  4B3R T;  3KVB A;  5JVD E;  3PUA A;  3UTK A;  2AXT O;  4DV6 T;  4QHO A;  3AEF A;  3ZMV B;  5GTI O;  4ZI7 E;  5JDQ A;  3LK3 B;  4BA9 A;  3PGS A;  5HWY A;  5LA6 E;  5H6R B;  4GCS A;  3ONX A;  1HX1 B;  2CHN A;  3UFE A;  2V5D A;  4O4I E;  3ZEF B;  1BXW A;  4ILU A;  3A0H O;  4DMW A;  4JI4 T;  3LK3 A;  2JRK A;  2ODU A;  4LMJ A;  4KR8 A;  4O3W A;  4DV1 T;  4E7Z A;  3AA7 B;  1SE7 A;  3TLT A;  4C00 A;  2W66 A;  1I6Z A;  1HXX A;  1BR4 A;  3BQK A;  2XQ7 A;  4DUY T;  2ODJ A;  3M65 A;  2QYW A;  2WMO A;  8PRN A;  5G38 A;  3C64 A;  2L9Q A;  3AA7 A;  4G75 A;  1WR6 A;  4DBQ A;  2YDS A;  4LFA T;  3KBT A;  3CQC B;  5DAB A;  4UV9 B;  3CML A;  2KMF A;  4QH4 A;  4QKN A;  2A9U A;  3UT5 E;  5TIS O;  3P8C D;  3SY7 A;  5FY7 A;  2CXD A;  1HXU A;  3HR0 A;  3Q5D A;  1VCS A;  3ZKR A;  3K3Q C;  4HGA A;  4EOZ B;  4HWF A;  5BR8 T;  2X9H A;  1YXR A;  3KFW X;  4UEL A;  3AVR A;  3T1H T;  4IE4 A;  4LML A;  4GCP A;  5LCY A;  4YLH A;  4DID B;  4QXB B;  2J62 A;  5EK3 A;  2NOX A;  3QOF A;  2BZB A;  5AQO B;  2VB6 A;  1N32 T;  4JBW F;  3PQS A;  4UR9 A;  4YJ2 E;  1FIO A;  3EAM A;  2CLY B;  4ILA A;  2HN1 A;  1G90 A;  5CJ5 A;  3POR A;  2LKG A;  4GCQ A;  4NIQ A;  3IF8 B;  1THQ A;  4D64 A;  2R88 A;  5KDM C;  4PW8 A;  5FY1 A;  5LMU T;  5KX5 E;  4XZC A;  4TNW A;  3NKZ A;  1MMD A;  2FJD A;  4HFI A;  1SUM B;  2X67 A;  1E54 A;  2YDQ A;  3PJA J;  4NUV A;  1OWA A;  2XAS B;  2X9Y A;  3RYH E;  4B3T T;  3WI5 A;  4AQF A;  3UUX B;  1LRZ A;  4BJM A;  1U4Q A;  4FZL A;  4RL9 A;  3PQU A;  3I1A A;  3GA8 A;  1FJG T;  2JMH A;  2KLQ A;  2DCF A;  4FUV A;  4Z91 A;  4KMC A;  3T20 A;  4OK0 A;  4ADZ A;  3OYX A;  4YJ3 E;  1X9B A;  5HXE A;  4AKI A;  5LOV E;  4FQE A;  3C4W A;  4IE7 A;  4HFB A;  2VQE T;  5LGN B;  1H7C A;  2IWW A;  5AFU K;  4UVC B;  3ZJ2 A;  4DND A;  2PBI A;  5ABG A;  2XAG B;  2R89 A;  3FZH B;  4WW0 A;  2XE3 A;  2W80 C;  4PUX A;  5AQV B;  2BDE A;  4PK6 A;  4LSI A;  1HF8 A;  2LOS A;  2YKS A;  4UVA B;  3ZN0 B;  2WU2 A;  1ZHZ A;  2LKH A;  1KEY A;  1NEN A;  3AE8 A;  4FJO A;  3SS1 A;  2PRN A;  2R8A A;  4HE8 A;  4IL4 A;  5LYJ E;  3BK9 A;  2IW5 B;  2ZM2 A;  1MND A;  4CI2 B;  3RBH A;  3ZC1 A;  3EUH A;  2CRB A;  1NEK A;  3JAE A;  2X68 A;  2BKP A;  3RRW A;  5L4H A;  4U33 A;  1OED C;  1T8B A;  4CZZ B;  3P4Q A;  5FVL A;  2WP9 A;  3SZV A;  1VOM A;  3UUL A;  2WDR A;  4YHH T;  3T1Y T;  2IDO B;  3MAC A;  4WBN E;  3AAI A;  5LJN A;  1QSD A;  3RI5 A;  4YT0 A;  5FXV A;  1MNE A;  4IHJ E;  2LHN A;  2HPJ A;  2K5B B;  5T5F A;  3PRN A;  3KV6 A;  2XE2 A;  3G7G A;  4F8H A;  4I4T E;  4Z8X A;  3LK4 2;  1IBK T;  2ACZ A;  1XZY A;  2X51 A;  2IC6 A;  3NVO A;  4B3M T;  4TN7 B;  2J4U P;  3AVS A;  1Z0P A;  1XDP A;  3RQW A;  3R6N A;  3GWH A;  4FOZ A;  3CVR A;  3RPU A;  2LEH A;  4DVD A;  2AE9 A;  3IBP A;  4O4L E;  3RIF A;  3AEA A;  2QTK A;  4O3Y A;  3MJX A;  2XHE B;  5HAX A;  2F1V A;  4HKA A;  2K9A A;  1JNR A;  4GF4 A;  3ZLI A;  4LF7 T;  4EYU A;  2OA5 A;  2M06 A;  4KHP T;  1YKH B;  4X1Y E;  4I0U A;  4DR5 T;  3Q5X A;  1GFN A;  4DV7 T;  5E0O A;  5HXS A;  3X1D A;  3P4P A;  3N9P A;  3PUV F;  4HWH A;  3RC3 A;  3ZT5 A;  2MNH A;  4IIJ E;  2WZI A;  2BS3 A;  3MKD A;  2OMF A;  4AKH A;  5AFU L;  4JCH A;  3PUR A;  3C4Z A;  3POQ A;  2BBH A;  4YTN A;  4CN6 A;  4XNK A;  2XQ5 A;  2LE8 A;  3N9L A;  2H7O A;  3BRZ A;  2B76 A;  5HEJ A;  4IL6 O;  3ONJ A;  1CHU A;  4B3S T;  3LBX A;  4A98 A;  2JQY A;  5A1L A;  4LFC T;  2ZM0 A;  4P0B A;  2UUA T;  2DI4 A;  1HCI A;  3HKE E;  5AQR B;  3OJA A;  3ZPO A;  1W09 A;  4QQ1 A;  1YD8 G;  4ERR A;  2GE4 A;  1W9R A;  3JC6 C;  3P4S A;  2VL8 A;  3UPG A;  2PJQ A;  1KK7 A;  4F4B A;  3EI0 A;  4KR4 A;  5ADX K;  4PFO A;  2X9W A;  5ABE A;  5JH7 E;  4GYR A;  3WAK A;  1JNZ A;  3IEE A;  2A72 A;  5AQG B;  4AYM C;  5IYU A;  2OV9 A;  2FJA A;  3LDQ B;  4HTE A;  1J5E T;  4IST A;  4DV2 T;  1AJ3 A;  2V1D B;  4IDQ A;  2KIN B;  4FSP A;  3RIA A;  2XSB A;  4LF4 T;  3S4U A;  3FYX A;  3C98 B;  3HW9 A;  3JC6 D;  2N2M A;  3IHR A;  2D0U A;  2ZLY A;  4OFZ A;  4ILC A;  4O4H E;  1WRD A;  3H3A A;  2XE5 A;  4TNV A;  2WSS V;  2XAQ B;  3KBU A;  5CB4 E;  1IBL T;  1HG5 A;  4HFD A;  4E1S A;  3AA6 B;  1FEW A;  4PK5 A;  4X62 T;  3P50 A;  4U2Z A;  3SFD A;  4AIS A;  3T8O A;  1HNW T;  2WJR A;  3AE6 A;  5L3G B;  5FL1 A;  4U7I A;  2MAW A;  2LOP A;  2YK0 A; 
#chains in the Genus database with same CATH homology
 4FT6 A;  4PJN A;  4FMS A;  4QKN A;  1FMV A;  2K0L A;  4OYJ A;  3LK4 1;  4ZHQ E;  5JDG A;  4XNL A;  1QJP A;  1D0Y A;  3AA6 A;  3UT5 E;  1D1C A;  3ANW A;  3P8C D;  2NW9 A;  1PHO A;  2N2N A;  2E9X B;  5LG4 A;  3B13 A;  1D0Z A;  3SY7 A;  5FY7 A;  2CXD A;  2V7M A;  1HXU A;  2QA7 A;  3CQX C;  3HR0 A;  2W61 A;  4F6R C;  2A3D A;  3K3Q C;  5FNV E;  2Y6X A;  5CA0 E;  4HGA A;  1ZHW A;  3POU A;  4EOZ B;  2XTQ A;  3I0Q A;  2X9H A;  3KFW X;  4UEL A;  2XMX A;  3AVR A;  4U9C A;  4P0A A;  3WI4 A;  4UIG A;  3NZP A;  4WBO A;  3ZC0 A;  3N9N A;  4IE4 A;  2CA5 A;  3SYB A;  5FXZ A;  1LKX A;  4GCP A;  3EMN X;  2E9X A;  2LM9 A;  5LCY A;  5D5D A;  3SOL A;  4V1A v;  4YLH A;  5EZY E;  4ASK A;  2VKJ A;  2KDY A;  2XAJ B;  3SY9 A;  3RH3 A;  3KVD D;  1ZHC A;  2CM0 A;  2LSG A;  2SPC A;  1YKE B;  2CXL A;  3U3I A;  1BT9 A;  1MIY A;  4QXB B;  3JTY A;  2M67 A;  3VHL A;  1H6S 1;  4CXX A;  2UXN B;  3ETU A;  4ZI2 D;  4AYE C;  7PRN A;  5EK3 A;  4UEM A;  2NOX A;  1NWM X;  3ZMT B;  2NW7 A;  1ORM A;  2Y7S A;  2BZB A;  2DWK A;  3W15 B;  4RJX A;  2VB6 A;  4N78 D;  3C5O A;  5DL6 A;  3PQS A;  4QXH B;  2NTY A;  3KV9 A;  3HI2 A;  4EYY R;  3KV4 A;  2V7L A;  2Y0L A;  3DJB A;  4YJ2 E;  1FIO A;  3CPZ A;  4CQI A;  5JDL A;  1EZ3 A;  2CLY B;  5C8Y E;  3J7Y q;  2YPV A;  1G90 A;  2PFV A;  3H37 A;  1HG2 A;  3LK2 B;  3CWZ B;  3QUJ A;  4L9I A;  3N9M A;  3OBV E;  4QX8 B;  3SRZ A;  3POR A;  4GCQ A;  1NAF A;  1BR1 A;  3IF8 B;  5FXW A;  1THQ A;  4D64 A;  4KUM B;  4JLE A;  5HYA A;  2O4V A;  4AYN A;  3E22 E;  2LSY A;  4ZS3 A;  5LXT E;  5KDM C;  4PW8 A;  4L5G A;  3VZW X;  5FY1 A;  4O4J E;  5DL8 A;  5KX5 E;  4XZC A;  5J2U E;  5KMG P;  2N2L A;  1FMW A;  3PE0 A;  2MYS A;  2MBG A;  3PTR B;  2W62 A;  5FP3 A;  1US7 B;  3L3P A;  1MMD A;  2K48 A;  5LNK A;  2X27 X;  4O4X A;  2X67 A;  2KC0 A;  1E54 A;  5DJQ C;  4BJN A;  5HXH A;  1OXZ A;  2LSJ A;  3RKO A;  1ZHX A;  2E9X C;  4EB6 E;  4NUV A;  4MAL A;  3LK2 A;  1OWA A;  2XAS B;  2X9Y A;  3EVY A;  2KZ7 B;  5DQW A;  3RYH E;  3QRA A;  3VZU X;  3WI5 A;  4TX5 A;  4AQF A;  1Q9F A;  4G76 A;  3EDU A;  5LGU B;  4FSO A;  3T24 A;  3UUX B;  1LRZ A;  2VKO A;  2Z6E A;  3P7I A;  5F8P A;  4B6X A;  4BJM A;  1U4Q A;  2NWB A;  4H63 H;  4FZL A;  1LVF A;  2HH7 A;  2YIN A;  3E0Z A;  3BQI A;  1KNZ A;  3KIN B;  4RL9 A;  3PQU A;  2CCQ A;  3I1A A;  5JR9 B;  2VWA A;  3GA8 A;  2JMH A;  2KLQ A;  1ZV4 X;  3KV5 A;  4NUU A;  2DCF A;  4KRA A;  3GN5 B;  4C90 A;  5ADX L;  2K24 A;  4FUV A;  2V7K A;  2YU2 A;  2C5J A;  4KMC A;  3T20 A;  4OK0 A;  3N2O A;  3ZCJ A;  4ADZ A;  4L0R A;  2KZ7 A;  3OYX A;  2JMM A;  2LSI A;  4YJ3 E;  2CXF A;  1HS7 A;  2WMN A;  3I9W A;  2XAF B;  1MMA A;  5JDH A;  5HXE A;  5JRE A;  4XAX B;  2X66 A;  5LOV E;  2C5K T;  4AKI A;  3ZCI A;  3C4W A;  4A56 A;  4IE7 A;  5JR9 A;  1MMG A;  2X9X A;  3V5S A;  5LGN B;  1H7C A;  2LFU A;  4UXN B;  5AFU K;  3GN5 A;  2XTR A;  4D5U A;  5EK2 A;  1X79 A;  1CUN A;  4UVC B;  4AKL A;  2XG6 A;  3ZJ2 A;  3O1H A;  4DND A;  2W81 C;  3HL6 A;  3F57 A;  4H63 V;  5HXR A;  4B61 A;  2PBI A;  3CQG B;  2CLY C;  1SA0 E;  3DTO A;  5LHG B;  2Y0K A;  2E9X D;  4CXY A;  2XAG B;  5DL5 A;  4WNK A;  5JDP A;  4AQF C;  4E7S A;  4K0U A;  1GFM A;  1MPF A;  2XAH B;  4WW0 A;  5DL7 A;  4LSF A;  2XE3 A;  2W80 C;  4YFS A;  4PUX A;  3I0O A;  4AQG A;  2BDE A;  5L3D B;  1OPF A;  4O2A E;  4PK6 A;  4LSI A;  2X0L B;  2V7I A;  5EE2 A;  4O3X B;  4IE0 A;  4Z3T A;  5LHH B;  1HF8 A;  4ZOL E;  3EDV A;  3FBL A;  2LOS A;  5L3E B;  2N1G A;  2ACX A;  3PUS A;  3QC9 A;  2N9D A;  4UVA B;  3ZN0 B;  2PG8 A;  1ZHZ A;  1ZKE A;  4JEH B;  2NP9 A;  2WBL A;  4FI5 A;  4FJO A;  3SS1 A;  4GOU A;  4TV9 E;  5FMN A;  2PRN A;  3HOL A;  4P09 A;  4CXW A;  4IE6 A;  3AB3 B;  3SYS A;  4HE8 A;  2ODV A;  3C4X A;  5L3B B;  5LYJ E;  3BK9 A;  4CI1 B;  4BAY B;  5JR9 C;  1P4T A;  3NZQ A;  4O8S A;  4PJL A;  2IW5 B;  1V9D A;  3UUN A;  1QUU A;  3LBX B;  4FZN A;  5IHY A;  2ZM2 A;  3AA1 B;  3RC8 A;  1MND A;  4UV8 B;  3RYI E;  5TAO A;  4CI2 B;  4QXC B;  3RBH A;  3NSG A;  3ZC1 A;  1PRN A;  3EUH A;  2W0G A;  1BR0 A;  4YHJ A;  4EIW A;  1GFQ A;  1E1H B;  2VK9 A;  5LHI B;  2X68 A;  4OHF A;  4G63 A;  4FRX A;  2JMK A;  3AA0 B;  3RRW A;  3VZT X;  2D2S A;  2P9B A;  3OKQ A;  2XUE A;  2MTQ A;  3VY8 X;  2ERV A;  2FGR A;  5LP6 E;  4AI6 A;  2XE1 A;  4KP3 C;  2E8I A;  4MLK A;  1D1B A;  4TV8 E;  4CZZ B;  4ISS A;  4BUM X;  3AA1 A;  5M4Y A;  4H9P C;  3ZYK A;  3QK6 A;  2MHL A;  3UUM A;  3LJC A;  2Y8D A;  4AYD C;  3VY9 X;  3SZV A;  5HWX A;  5FVN A;  1VOM A;  3DP7 A;  3UAQ A;  3UUL A;  3VKH A;  3TKL B;  6PRN A;  3MAC A;  4WBN E;  3AA0 A;  3DA4 A;  4HFV A;  1HFA A;  5JRC B;  5CA1 E;  3AAE B;  4PK4 A;  3AAI A;  2I59 A;  4I43 B;  5LJN A;  1IAP A;  2DHR A;  4UVB B;  1QSD A;  5LBM A;  2M07 A;  2Y2X A;  5FXV A;  3O1J A;  3O1I A;  2V26 A;  1MNE A;  3CX8 B;  2LHN A;  4IHJ E;  1MIW A;  2HPJ A;  2BVM A;  3ZYL A;  2K5B B;  5ETW A;  5LGT B;  4GK5 E;  1Q9G A;  2W00 A;  5T5F A;  2IAK A;  3VE2 A;  3PRN A;  3RYC E;  3K3N A;  3KV6 A;  4IE5 A;  1U5P A;  3MXZ A;  4N59 A;  2Q9Q B;  5H6Q B;  3D0T A;  5FYM A;  2C5I T;  5L3C B;  2XE2 A;  2LSK A;  3WI3 A;  4AYI D;  3G7G A;  3BQL A;  5JRC A;  2K4T A;  2CMR A;  2ES0 A;  3C50 A;  3AAE A;  2RP4 A;  4I4T E;  4Z8X A;  4D65 A;  3LK4 2;  4PNI A;  4FZM A;  3MK7 C;  2X51 A;  2W63 A;  2QGS A;  4O2B E;  2IC6 A;  3U78 A;  1IZN B;  4TN7 B;  3HA4 A;  3A5X A;  2J4U P;  3FBZ A;  1LVK A;  3AVS A;  1Z0P A;  4PJJ A;  1D1A A;  3NRX A;  3PU8 A;  3N5L A;  1SHZ C;  2WAU A;  4LSE A;  2GK9 A;  5JDN A;  2Q9Q A;  3R6N A;  3GWH A;  4FOZ A;  3CVR A;  1S94 A;  3SZD A;  3RPU A;  4AXP A;  3O0E A;  4PJM A;  4C91 A;  2LEH A;  4DBR A;  2CWY A;  3FXE B;  4MHC A;  5G26 A;  4JFB A;  1HTJ F;  2L8K A;  4X1I E;  4DVD A;  2YNK A;  4EZ4 A;  2HPL A;  2XTL A;  3IBP A;  4O4L E;  1GFP A;  3MA9 A;  3R84 B;  2CEA A;  1G73 A;  1IZN A;  2ZLD A;  3E08 A;  2QTK A;  1MIV A;  2NTX A;  4H9N C;  4O3Y A;  2KWI B;  3CKD A;  3MJX A;  2D0T A;  2C0S A;  2XHE B;  3NBX X;  2CWO A;  4JEU B;  5HAX A;  3V5U A;  3VU7 H;  2D5U A;  4HKA A;  5L3F B;  2F1V A;  2K9A A;  3J9X 1;  4C69 X;  3RYF E;  4GF4 A;  3K3O A;  3ZLI A;  2EHO B;  4EYU A;  2OA5 A;  4O4U A;  4O3Z A;  2ZMA A;  1HX8 A;  2M06 A;  4AKR B;  1OSM A;  1MM4 A;  1T98 A;  5L2L A;  4IDZ A;  2POR A;  4RLB A;  5LBQ B;  4CI3 B;  3ZYM A;  1UCU A;  1YKH B;  3FHN A;  4X1Y E;  2FGQ X;  3Q2M A;  3Q5X A;  2UXX B;  4FRT A;  2L3L A;  4H9R C;  3ANW B;  4PFP A;  5FXX A;  4I50 E;  2YU1 A;  4O49 A;  2DNX A;  4J2C A;  3WAJ A;  1GFN A;  4H9S E;  3UU2 A;  2NW8 A;  5E0O A;  4ZS2 A;  5HXS A;  2EHO A;  2H3R A;  2Q9Q C;  1UX5 A;  3N9P A;  2V7J A;  4TUY E;  3RC3 A;  2J1N A;  2ZFG A;  2ZM8 A;  1QJ8 A;  1B7T A;  4KBM B;  4AKR A;  4QWN B;  2MNH A;  2VAS A;  4IIJ E;  2J1D G;  4U72 A;  4GK0 E;  3MKD A;  2OMF A;  4AKH A;  5AFU L;  4JCH A;  2A2F X;  3PUR A;  3ZN1 B;  3C4Z A;  2LHF A;  5IYZ E;  4TZ4 C;  3POQ A;  4U74 A;  4ANJ A;  4XNK A;  4AFK A;  2LE8 A;  1YW0 A;  3Q5W A;  1MM5 A;  2KXP B;  3N2K E;  3N9L A;  2Y0H A;  5PRN A;  1IJ5 A;  2H7O A;  2KND A;  5J2T E;  3FXD B;  1WYC A;  4X1K E;  4RLC A;  2YEV C;  3AAA B;  3ZMU B;  3KVA A;  3F31 A;  3O4X E;  4FES A;  1WLX A;  4HN9 A;  4RJW A;  4LSH A;  2LT3 A;  5GV0 A;  3HKB E;  3LBX A;  3ZMS B;  2JPF A;  2Y48 B;  1UX4 A;  4N58 A;  3OYZ A;  3Q9D A;  5A1L A;  2ZM0 A;  4P0B A;  2DI4 A;  1HCI A;  2CE7 A;  2KWH A;  1BH3 A;  3VKG A;  4XBF B;  3HKE E;  4H9O C;  4I55 E;  2IC9 A;  2KXP A;  2DWG A;  3OJA A;  3ZPO A;  2EHO C;  3CX7 B;  4QQ1 A;  4OYK A;  1WYB A;  3SWH A;  1YD8 G;  3PDY A;  4GIW A;  5F3J A;  4ERR A;  4H9Q C;  4JUY A;  2GE4 A;  4G2A A;  2Q9Q D;  5JDM A;  3AAA A;  3ZMZ B;  2KT9 A;  3JC6 C;  4DO0 A;  1IJ6 A;  4M1P A;  2VL8 A;  3VE1 A;  3KVB A;  4MBQ A;  5DQV A;  5JVD E;  5JQG E;  4AKG A;  2PJQ A;  2BVL A;  3UPG A;  1KK7 A;  1O3X A;  3PUA A;  4F4B A;  4KR4 A;  3UTK A;  2DLR A;  2WWU A;  5ADX K;  3V8U A;  4PFO A;  2X9W A;  4QHO A;  3ZMV B;  1ZHY A;  4E1T A;  2XQY A;  2H7V C;  3HKC E;  5JH7 E;  3HWB A;  3ESL A;  2F1T A;  4EXT A;  4ZI7 E;  4GYR A;  5JDQ A;  3LK3 B;  3WAK A;  3K8P C;  3KDS E;  4AKM A;  4BA9 A;  3PU3 A;  3HKD E;  5LJM A;  5HWY A;  3LG7 A;  1S35 A;  5LA6 E;  3IEE A;  2JQQ A;  2A72 A;  3RRC A;  3A2S X;  2RA1 A;  5H6R B;  4AYM C;  4HEA A;  5IYU A;  5GON E;  4GCS A;  3ONX A;  4GHB A;  3N2G E;  3RX6 A;  2JJ9 A;  3PUG A;  3UFE A;  4PAG A;  4O4I E;  4ZI3 C;  4GYS A;  3ZEF B;  1BXW A;  4HTE A;  4ILU A;  2LHR A;  4IST A;  5HXC A;  4DMW A;  2VKD A;  4AZL A;  1AJ3 A;  3TZG A;  3LK3 A;  2V1D B;  3HOE A;  2JRK A;  4X20 E;  2KIN B;  2ODU A;  4FSP A;  3GMI A;  1G8X A;  1QJ9 A;  3FB2 A;  1MMN A;  5FY0 A;  4KR8 A;  2EHO D;  3GP6 A;  1VRB A;  4O3W A;  5EK4 A;  5JDF A;  3S4U A;  4E7Z A;  3FYX A;  3C98 B;  3AA7 B;  4UF0 B;  3QRC A;  2VKH A;  3B57 A;  3HW9 A;  3JC6 D;  4QX7 B;  3L09 A;  2N2M A;  3IHR A;  3ETV A;  2D0U A;  2ZLY A;  3CX6 B;  4EAH A;  2MOZ A;  4OFZ A;  3PUQ A;  3POX A;  5J1G A;  1HXX A;  1BR4 A;  1ZEE A;  3LFM A;  3BQK A;  4O4H E;  3N9O A;  1WRD A;  3H3A A;  2ODJ A;  3M65 A;  2XE5 A;  3NRY A;  1ZHT A;  3O9X A;  2WSS V;  3DA3 A;  4AUI A;  3N9Q A;  2XAQ B;  3KBU A;  5CB4 E;  2WMO A;  3F2E A;  5BMV E;  1Y64 B;  3C51 A;  4EZH A;  3T0S A;  1HG5 A;  8PRN A;  1BR2 A;  3C64 A;  2L9Q A;  4UF0 A;  3AA7 A;  4MFR A;  3K19 A;  4G75 A;  3I9Y A;  1WR6 A;  2WM9 A;  1GFO A;  2LJL A;  4E1S A;  3AA6 B;  4DMV A;  1FEW A;  4DBQ A;  4PK5 A;  3MZK B;  1HXT A;  3KBT A;  3CQC B;  4ZI3 D;  4ZI2 C;  1D0X A;  3T8O A;  5DAB A;  2B1E A;  2G0U A;  4UV9 B;  5L3G B;  1YS5 A;  3CML A;  2KMF A;  2LOP A;  3ZJ1 A;  4IGU A;  2YK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...