3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
3LK42 2KXPB 1IZNB 5AFUK 3AAAB 3AA0B 4AKRA 3AAEA 3AAAA 3AA6A 3AA6B 2KXPA 5AFUL 4AKRB 3AA0A 3AA7B 3LK2B 3AA1B 1IZNA 5ADXL 3LK3B 3AA1A 2KZ7B 3AA7A 2KZ7A 5ADXK 3AAEB 3LK3A 3LK41 3LK2A
chains in the Genus database with same CATH superfamily
1OSMA 5LJMA 2NWBA 4JI4T 4HWIB 3AA6A 4U72A 2HPJA 4CI2B 3POXA 1ZOYA 4Q25A 5T5FA 2CMRA 4YFSA 4QHOA 2V8SV 2XQ3A 4COFA 3UU2A 2W67A 3LSVA 1Q9FA 3P4SA 3ZJ1A 2B76A 5AQHB 2PTFA 3KBTA 2JQYA 4CXWA 2IAKA 3RYHE 1IBLT 4DVDA 1HG5A 1OXZA 2FJAA 2V6YA 3HOEA 2KINB 3PUZF 1JNZA 4JI5T 4AQGA 2PJQA 3QNUA 3SY9A 3PQSA 3L09A 5H6RB 3LK3B 4Z90A 2C5KT 1EZ3A 3SZDA 5F5WA 3AEBA 1NWMX 1Z0PA 4ISSA 1T8BA 1WR6A 4XNKA 1WFDA 7PRNA 1CHUA 4HWFA 2C5IT 3RC3A 3EAMA 4LSHA 5HXHA 3I1AA 4RLBA 4CN4A 2KWHA 4JI1T 4HGAA 5J2TE 3OJAA 3JC6D 5JDFA 2W00A 5ABHA 3P4WA 4QXBB 2V7MA 4JEUB 4GCQA 2LFUA 2L8KA 3OPCA 2CLYB 4N74A 3C4ZA 1MIYA 2WJRA 4UB6O 3K3NA 2ZFGA 2VQFT 2JMKA 1QUUA 2VKOA 4WBNE 4HFIA 3SFEA 4B61A 5L3FB 5H2FO 4X1KE 4QH1A 4A97A 1R8IA 3NRYA 2ODJA 4AKMA 1ZEEA 3AEEA 3Q5DA 3KV9A 2JQQA 4GYRA 2WSSV 2R6GF 4LFAT 5LXTE 2MNHA 4OYKA 1OEDB 3QRAA 2NP9A 2IWWA 2WB5A 3I9WA 2BG9E 5BR8T 4B3MT 1GQEA 4U3CA 4AI6A 3ZPOA 1YQ4A 4N75A 4D64A 3UT5E 2LEHA 3AEDA 3FZLB 4KI0F 1GFOA 4ZEYA 4DV6T 2DI4A 5AFUK 4HWHA 2NW7A 4DUYT 4ZI3D 2KXPA 2LSKA 3DA3A 2XAGB 4BAYB 2XTRA 2DWGA 3HR0A 1THQA 4LSIA 3H37A 5LMUT 1OEDE 2D0UA 3T20A 4HKAA 5J1GA 4NUVA 1S94A 5JQGE 4UR9A 4UVAB 3GA8A 3LK41 2X9YA 5F3JA 2OLTA 4DV0T 3J7Yq 2WU2A 2R4OA 1N34T 2HPLA 4YJ3E 5JDGA 3GN5A 1T7SA 1PHOA 2VB6A 2YU1A 3ONXA 3P4RA 1H6S1 3R6NA 4HFHA 3TLUA 4UB8O 1AJ3A 1E54A 4I0UA 4I4TE 4HFDA 5J2UE 2NOXA 3RI5A 1BXWA 4IDQA 5IUXA 2JMMA 1D0YA 4MHCA 3JCFA 2C5JA 2BS4A 4L0RA 2WMNA 2XAQB 1WYCA 2JPFA 3PUAA 2M06A 4UF0B 3CVRA 3F2EA 2MAWA 2VL8A 3LDQB 3T0SA 3ZSTA 2X0HA 3VZUX 1OWAA 3LG7A 4U9CA 3M65A 2IC9A 2BDEA 5HEHA 1KNZA 3K3QC 2LHRA 3K8PC 1G90A 2H89A 5DL6A 2LOPA 4ZOLE 4YHHT 3RYCE 2R4LA 3T1HT 4DO0A 3RH3A 3RRWA 1OEDC 3I9YA 1ZHYA 3QC9A 3VKGA 3CX8B 2CLYC 5AQUB 4PJJA 4EEDA 3RIUA 3NSGA 1I6ZA 3ZT5A 4X64T 4JBWF 4QQ1A 2ZLYA 4FUVA 4QX8B 2QA7A 4DV3T 3CX7B 3O1IA 4JI3T 4IHJE 1P4TA 3IEEA 4AYMC 5FL1A 3WU2O 1BR1A 2DL1A 5FY1A 3ZCJA 4TWFA 2BBHA 4EB6E 4ANJA 2UXCT 4H9SE 3Q5WA 5HCJA 2J4UP 1E1HB 3AVRA 2L3LA 3VR8A 3RIUC 3ZYKA 5JH7E 4X66T 4MLKA 4I43B 4TV8E 4HWCA 1QLBA 5LCYA 1XNQT 2X68A 3L3PA 3V5UA 3AEFA 2J1DG 2IC6A 3SOLA 4YTNA 3W15B 1LKXA 3I0OA 3BQIA 2QRXA 2ZM2A 1MM5A 4G63A 1YXRA 1L0VA 3POQA 3LBXB 4AKGA 1HF8A 5L3DB 4ZI3C 3NJTA 2BBJA 5LB7B 3ZLIA 4JCHA 1HTJF 4XZCA 4FOZA 2CHOA 1UCUA 2XQYA 3ZMZB 2XAHB 3C98B 2K0LA 3ANWB 3PORA 2GK9A 2AE9A 3G7GA 4LF9T 4FZLA 2LE8A 2QVAA 4WW0A 2D2SA 3VHLA 5AQSB 3PUQA 2XQ9A 4PK5A 1D1AA 4AIUA 4E1TA 5FXWA 5CJ5A 1W0BA 2XQ4A 3JAFA 3AE9A 3C51A 4RJXA 1YS5A 4ASKA 4EZHA 3SWHA 3N2KE 2WS3A 5FXXA 1QJ9A 1XDOA 5TAOA 3SYSA 1KF6A 2X66A 4WNKA 5JTGA 2V5CA 3UFEA 2XE5A 1BR0A 2W81C 4V1Av 3FZMB 4UXNB 3AE7A 2LSGA 1QJPA 3LJCA 1GFNA 4UEMA 3A7MA 2KC0A 2RP4A 5AQVB 2KDYA 1MMAA 4O4HE 1G8XA 3RQWA 3N5LA 1G73A 5HCMA 4AKRB 4ERRA 3UQ7A 5ADXL 1KNRA 3OTOT 5AQKB 5CA1E 4NXNT 3IA3A 2W66A 4O49A 4L9IA 4YY3T 4YJ2E 4BJNA 4FSPA 3A0HO 3I0QA 2MYSA 3IHRA 5C2TA 2BZBA 1IBKT 2M67A 3BS0A 3UPGA 4KBMB 2CRBA 1YD8G 4FJOA 1BT9A 4IL4A 2VKHA 2CPTA 5ABGA 4EYUA 5FVKA 2W4XA 4YSXA 5C8YE 4C00A 3CKDA 2UXXB 3EDVA 2BG9B 3KVDD 1US7B 2X9XA 3CMLA 3WI5A 2LOSA 5L2LA 4NIQA 4QH4A 4YLHA 3GN5B 3SYBA 3NZPA 3KV4A 1MMGA 4TN7B 5AQQB 2YU2A 4FESA 2J47A 5JDHA 5KXJA 5AQJB 3FZFB 1HNZT 3ABVA 5ABFA 4E1SA 2ZM8A 2ODVA 4C4VA 5L3CB 3H3MA 5LGUB 3EI0A 2X9HA 4A5XA 4JUYA 2XASB 4X62T 2E2AA 2XAJB 3RIAA 4ZI2D 2JJ9A 5ADXK 2W62A 3CIRA 3UUXB 4PK6A 4WBOA 5FKYA 3ZN1B 2ACXA 3F57A 4D5UA 2L9QA 2XQAA 3K1SA 4U7IA 5JVDE 2ACZA 4YSYA 6PRNA 4F6RC 3POUA 4IE0A 4CN6A 2YOEA 4OFZA 3VKHA 3UU8A 4GCSA 2R88A 2LKGA 3TLVA 4G75A 4AZLA 5H6QB 2XE2A 3TLWA 3KVBA 2DLRA 4ILBA 3PE0A 2ES0A 4UV8B 4ADZA 1KK7A 1IBMT 2PRNA 4A56A 3QOFA 5L3BB 1E2AA 2G0UA 3PGUA 4EXTA 3ANWA 3DA4A 3OYXA 3QUJA 5D5DA 3VZTX 4C91A 3PUYF 4ISTA 3L8RA 2LSJA 3X1DA 3KBUA 2BS2A 4H9QC 2AXTO 5JDLA 4HFVA 2XG6A 4IDNA 4JI2T 2XSBA 4DV4T 4DBRA 3B13A 3UFGA 4P09A 4ZI7E 1BR4A 3EHZA 2FJDA 4DR3T 4XBFB 3FZKB 2LM9A 2BG9C 3UUNA 3OVUA 4U2YA 2DHRA 5AQNB 5IHYA 5FYMA 3RIFA 4GIWA 4UVCB 1QJ8A 1IAPA 3AA0B 1W0AA 3VY9X 2UUAT 1ZHXA 2WWVA 3DZMA 3TZGA 2MTQA 3IF8B 4ZZCA 4N59A 3AE1A 1X9BA 4FRTA 3D0TA 1WLXA 2WZHA 2DNXA 4FZNA 2XM2A 2MBGA 2W2UA 4P1NA 4IE5A 2A9UA 2JQKA 3UU3A 2BVLA 4IL9A 3KINB 5L4EA 3MACA 2YN6A 5JREA 3KFWX 4IT4A 4GK0E 3B5MA 4EAHA 3PJAA 1ZHCA 3U3IA 4ZXLA 4FMSA 4NXMT 1J5ET 4WZXA 2WAUA 2MOZA 4G2AA 3HI2A 3T24A 1MMNA 3HOLA 5KAFO 5FMNA 2LJLA 3CX6B 4DR4T 2Q9QD 3JC6C 3LK42 2XHEB 5FY0A 2LKHA 4L5GA 2YNKA 2OA5A 4H9PC 2W80C 2J62A 4OHFA 5AQFB 3SY7A 1WR0A 1UX4A 2XQ8A 5EZYE 3N9LA 4GOUA 4K3CA 1HX1B 4K0UA 2H7VC 3S4UA 2VKDA 3G06A 4X1IE 1ZHWA 1GFMA 4FQEA 3ZEFB 3PJAJ 3C5OA 4LMKA 2OMFA 2IDOB 3O1JA 3CK6A 4CXYA 2Q9QC 4AQYT 2J1NA 4DR5T 1ZHTA 4YT0A 3N9NA 2QYWA 4D65A 2IWVA 3N2GE 2P9BA 2A72A 2WWUA 2X51A 5ETWA 3ETVA 4X20E 5BMVE 1B7TA 3HKDE 1FEWA 5LHGB 4K0KT 4ZZBA 4JI0T 2YK0A 4B3RT 3ZT7A 2V7IA 3VR9A 5AQTB 1WCRA 4P0AA 3UU6A 3PUWF 2N2LA 3AE5A 4H9RC 5CGMA 1MIWA 1MMDA 5IYUA 4HFBA 4HE8A 3RHWA 4JEHB 4U7YA 2Y2XA 4NUUA 1J1JA 1YKHB 4O3XB 2KMFA 4LMJA 2H3RA 2PFVA 3CQXC 2CM0A 4PUXA 5JR9C 3ZMTB 3KZIO 3RGLA 1MNDA 3TKLB 2X9KA 2JIWA 4IL6O 3KV6A 5HXRA 3UULA 4GK5E 3PGRA 2IUBA 3FB2A 4CN1A 3VRBA 4DIDB 4WYVA 3VY8X 3RYFE 3AVSA 3ZC1A 4JI7T 3DWOX 4PFPA 3ZC0A 5B66O 2E9XD 2CXDA 1KFYA 3ZMUB 2H88A 3NKZA 4F8HA 5ABFB 3AA6B 1HXTA 1U4QA 3PUXF 3FXDB 4B3TT 3PU8A 5DL5A 2XM1A 2Q9QB 4AYDC 5G38A 2D5UA 2BG9A 5JDNA 3AE8A 2D9DA 3CQCB 2XQ6A 4GYSA 4YSZA 2XPKA 3AXJA 3P4QA 3RQUA 2F4VT 5HAXA 3E08A 1BH3A 5FY7A 3AAIA 3AA1A 4BUMX 1N36T 2E9XC 3V8UA 3EVYA 4CI3B 4EZ4A 4ZS2A 4JV5T 4JFBA 3PV0F 1D1BA 1ZKEA 4B6XA 3P7IA 1JNRA 2PBIA 2HN2A 4YTPA 5LYJE 2YINA 5CFBA 5HWXA 3ZYLA 1MNEA 4HTEA 2CWYA 2CEAA 3ZKRA 4O2AE 2VVSA 5EK4A 3P4PA 2XTQA 5JR9A 2VVNA 1IZNB 4DMWA 1SA0E 4H63V 3AAEA 4HFEA 4AKIA 4LF7T 2V5DA 4PJNA 4KHZF 2BVMA 2XZEA 4AKHA 2KLQA 2XQ7A 4AYNA 1XMOT 1HX8A 4QH5A 1WYBA 4JYAT 3FHNA 2F1TA 4AKLA 2FGQX 2LRKA 2DCFA 1E7PA 5FVLA 3E0ZA 3VRAA 2WP9A 2JQ9A 1UUSA 5LJNA 2YDSA 4DR1T 3TLTA 3RX6A 2ZLDA 4LF4T 5GTIO 2WY2A 3FXEB 1FMWA 2X27X 4O4JE 5HXCA 5AQMB 4GKJT 4C90A 2KXPB 1NEKA 5AQPB 4ZHQE 3IBPA 3DWNA 5G26A 2VKJA 4O4LE 2V7KA 3AA0A 4PNIA 3BK9A 4KR4A 1GFPA 3ZMSB 3JAEA 2HHHT 3Q5XA 5HXSA 1S35A 3Q5EA 4G76A 5AQGB 4FZMA 3MKDA 3ESLA 2E9XB 1KNPA 4KR8A 3MA9A 5HEOA 3KVAA 5PRNA 4AQFA 2WDQA 3SS1A 2QGSA 3HKEE 4NPPA 4AYEC 1FJGT 2YDRA 3KV5A 4B3ST 4MBQA 2LLYA 4HFCA 2J4GA 2BKPA 4UV9B 1M7KA 5DQWA 2LM2A 1T72A 4X5TA 3QRCA 5B5EO 2WQYA 2R89A 3T1YT 3N2OA 3P50A 4DV5T 3AEAA 3C4WA 5LNKA 4QXHB 1FMVA 5JDMA 4UELA 2IMLA 5L47A 2BS3A 4TNVA 2E5VA 1HXUA 1YW0A 3FBLA 3UTKA 2VL0A 5AQOB 4O3YA 3RPUA 2CE7A 1YKEB 4I50E 4KRAA 2PG8A 3NBXX 2KZ7B 3AB3B 4DNDA 2XUEA 4C4VB 3BQLA 1XMQT 5LHHB 2I59A 3HA4A 5LGNB 2BKNA 3Q9DA 4UVBB 3WAKA 4YTMA 2MPKA 3CWZB 4OK0A 2UXNB 4IE4A 2IW5B 3CQGB 4O2BE 2HN1A 2LSIA 3GP6A 5LMNT 3EMNX 3ZSSA 4PJ0O 3AE4A 5JDPA 2KNDA 5ABEA 4O4IE 1ZV4X 5AFUL 4LF5T 4IE6A 2O4VA 1W9RA 4TV9E 4PR7A 4IIJE 4TUYE 4JI6T 2YPVA 1IJ5A 4ILAA 3AAEB 2PORA 3ZT6A 4KP3C 3EUHA 4RJWA 3P8CD 4DR7T 2JMHA 3PUSA 3ZMVB 2XTLA 1VCSA 2BKOA 3RKGA 2HH7A 5TISO 3AA7A 2V26A 1D1CA 3QB5K 1N33T 1UK5A 5G39A 4YHJA 5HXEA 5AQLB 2XMXA 1SUMB 4LSFA 2XSAA 2XE3A 3VE1A 3NRXA 3N9PA 3B57A 3AA1B 4EIWA 4DV1T 2K5BB 3U78A 1XNRT 2X0LB 4O4UA 2FBWA 1SHZC 3AECA 3RYIE 4FT6A 4X1YE 2N2MA 1XZYA 1NAFA 2IHR1 3OKQA 3PGSA 2K24A 2LT3A 4H9NC 4PFOA 5FXVA 2V7LA 3L39A 2YKSA 4XNLA 2DWKA 3J9X1 2I6HA 4OX9T 4I55E 5GTHO 3LK2A 2V6XA 5CA0E 4AKRA 4AFKA 4PAGA 5LBMA 2FGRA 3MJXA 4U31A 2XE1A 2WMOA 5L3GB 5DQVA 4HN9A 2K9AA 4OYJA 3PQUA 5IYZE 2VQET 5HEGA 2Y48B 3TLSA 3RKOA 4UIGA 3RLFF 1ORMA 4RL9A 2ODUA 3ONJA 5JDQA 3O0EA 2WJQA 2KWIB 4AQFC 4Z91A 2UUBT 2CXLA 3UU5A 1KEYA 3DTOA 3PURA 4XAXB 2JQHA 1ZP0A 5IWAT 4DR2T 2WDVA 5DABA 5HYAA 2R4PA 4GCPA 4C69X 1IJ6A 3SRZA 4DV7T 3ZJ2A 1D0XA 1Y64B 2FJBA 2QTKA 2F1VA 4LFCT 2CBJA 3MZKB 3O4XE 4RLCA 3AAAA 2UXBT 1H7CA 2VURA 3OBVE 4KX6A 4GKKT 2K3WA 1HR0T 1UGOA 1WRDA 5M4YA 5EE2A 3PUGA 5AQRB 3HW9A 4KHPT 3AE3A 1VCTA 2WBLA 2CA5A 5L3EB 4DR6T 2X0YA 2X9WA 5KMGP 2N2NA 2W61A 5J0ZA 2WVPA 3AEGA 3NVOA 3PUVF 5HWYA 2D0TA 1MM4A 3A8YC 2VASA 4N78D 1Z8UA 2V1DB 4U2ZA 3UU4A 2H7OA 1GFQA 2VK9A 1O3XA 2YDQA 4IE7A 2NW8A 3K19A 2NR4A 3PF1A 4Z8XA 4IDPA 5FNVE 4H63H 4QXCB 2CXFA 4QX7B 4BJMA 5FL0A 4LF6T 4DBQA 3ZCIA 3K3OA 1HNXT 4O8SA 5DL8A 4GF4A 1HCIA 3EDUA 5FXZA 2F1CX 5LGTB 3A5XA 3PDYA 5JRCB 2FUPA 4HWDA 3PTRB 1HNWT 3N9MA 2UXDT 2B1EA 4N58A 1M62A 3JCUO 1U5PA 1W09A 1Q9GA 3UUBA 2E8IA 3N9OA 2E9XA 3HWBA 3RF1A 2XY8B 2A2FX 4UF0A 4MFRA 3FZHB 5E79O 2SPCA 1FIOA 2WDRA 3MXZA 1V9DA 2R4NA 3DJBA 2KSRA 1DU2A 5G3AA 3FYXA 3E22E 2XAFB 1OPFA 5GONE 2MHLA 3WI4A 3ZN0B 3C64A 3F31A 4FI5A 2VWAA 3GWHA 1LVKA 4DMVA 2RPAA 2AXDS 3MK7C 5A1LA 2ZMAA 2EHOB 4E7SA 5FP3A 2IIUA 3GMIA 4P0BA 3SFDA 2UU9T 1T1LA 4Z3TA 4TWDA 1UX5A 3O1HA 2LHNA 4M1PA 2LRLA 4TX5A 3QK6A 2N1GA 2LSYA 4CQIA 1XDPA 5KAIO 4EGWA 2LHFA 2W63A 1Y01A 5JR9B 5LOVE 3DP7A 3NWIA 3RBHA 1YQ3A 3PU3A 4KMCA 4EYYR 2N9DA 5DL7A 1UURA 1T16A 2M6IA 2Z6EA 2RA1A 4LFBT 3AE6A 1X79A 1PRNA 2CHNA 4J2CA 1T98A 1HG2A 4IGUA 4QKNA 3A2SX 2M6BA 3BQKA 5LA6E 2KZ7A 5EK3A 3UAQA 3ZYMA 5LP6E 2GE4A 4LSEA 4TWHA 4CXXA 4CTDA 4LMLA 4U74A 4PJMA 1VRBA 4IDZA 4AUIA 4IDOA 4HEAA 3NZQA 3UQ4A 4QWNB 3HKBE 3SZVA 3VZWX 5HEUA 3WI3A 5CB4E 2NW9A 2Q9QA 2WZIA 2I0MA 3HL6A 5LBQB 5DJQC 1OEDA 1VOMA 2CCQA 5C3JA 2OV9A 3WAJA 2Y6XA 3ONLC 1SE7A 2V7JA 4DV2T 5AQIB 2CWOA 5GV0A 2Y0HA 3LBXA 3AE2A 4GHBA 1XWMA 3BRZA 5KDMC 3PRNA 3AAAB 3JADA 3A0BO 3V5SA 4U33A 3KDSE 4AYID 3HKCE 3CPZA 1CUNA 4ILUA 2K48A 2ZM0A 4E7ZA 5F8PA 2EHOC 3RC8A 3M3ZB 3UUMA 1N32T 3O9XA 3FBZA 2V6YB 2R8AA 1HS7A 4CZZB 2JRKA 2XJ7A 1BR2A 3JTYA 8PRNA 4FRXA 5LHIB 2YEVC 4K3BA 3LK3A 2W0GA 2KT9A 4LF8T 5KX5E 4AXPA 3ETUA 3QB5A 5FVNA 2C0SA 2NTXA 3LK2B 5L4HA 2WM9A 3Q2MA 2ERVA 2EHOD 1I94T 1ZHZA 3C50A 4A98A 2X67A 4MALA 2Y0KA 5LG4A 4EOZB 4FSOA 4AISA 2CBIA 3VE2A 3RRCA 3OYZA 3LFMA 1S5LO 2EHOA 1IZNA 4DUZT 3N9QA 1LRZA 3VU7H 2XQ5A 2FJEA 4O3WA 2K4TA 3T8OA 2Y7SA 4BA9A 2Y0LA 2WCAA 4O4XA 4F4BA 2WU5A 4CI1B 5EK2A 4PJLA 2A3DA 4O3ZA 1J5WA 5E0OA 4PW8A 4IREA 1QSDA 2NTYA 4ZS3A 1HXXA 1LVFA 2Y8DA 3H3AA 3C4XA 2E5LT 1HFAA 4EV6A 3R84B 1MIVA 2ZM6T 2M07A 4PK4A 3BRYA 4H9OC 4KUMB 4EEBA 3AXJB 4JLEA 3AA7B 3EABA 4X65T 4TZ4C 4TNWA 1MPFA 1NENA 4YXDA 2UUCT 4ILCA 4JI8T 4ZI2C 5HEJA 5JRCA 5LG3A 1D0ZA
chains in the Genus database with same CATH topology
1OSMA 4PFPA 5LJMA 2QTKA 2NWBA 3ZC0A 2F1VA 2E9XD 3MZKB 3O4XE 2CXDA 4RLCA 3ZMUB 3AAAA 3AA6A 4U72A 4O49A 3AA6B 2HPJA 1H7CA 4L9IA 4CI2B 4YJ2E 3POXA 4BJNA 1HXTA 4FSPA 1U4QA 3OBVE 3I0QA 5T5FA 2CMRA 2MYSA 3FXDB 3IHRA 4YFSA 4QHOA 3PU8A 5DL5A 1WRDA 3UU2A 5M4YA 5EE2A 2BZBA 3PUGA 1Q9FA 2M67A 3HW9A 3ZJ1A 3UPGA 2Q9QB 2WBLA 3KBTA 4KBMB 4CXWA 4AYDC 2D5UA 1YD8G 2IAKA 2CA5A 4FJOA 5JDNA 3RYHE 1BT9A 4DVDA 1HG5A 3CQCB 1OXZA 2VKHA 4GYSA 5L3EB 3HOEA 2KINB 2X9WA 5KMGP 2N2NA 2W61A 4EYUA 4AQGA 2PJQA 5HAXA 3E08A 5C8YE 1BH3A 3PQSA 5HWYA 3SY9A 2D0TA 3L09A 5H6RB 3LK3B 3AAIA 5FY7A 1MM4A 3AA1A 2VASA 2C5KT 3CKDA 4N78D 4BUMX 2E9XC 1EZ3A 2UXXB 3V8UA 3EVYA 3SZDA 3EDVA 2V1DB 4CI3B 4EZ4A 4ZS2A 1US7B 3KVDD 1PRNA 2X9XA 1NWMX 3CMLA 4JFBA 3WI5A 1Z0PA 2LOSA 5L2LA 2H7OA 4YLHA 1GFQA 1D1BA 3GN5B 4ISSA 3SYBA 1WR6A 1ZKEA 3NZPA 2VK9A 4B6XA 3KV4A 1O3XA 3P7IA 4XNKA 1MMGA 4IE7A 4TN7B 4KR4A 7PRNA 2NW8A 2PBIA 3K19A 2C5IT 2YU2A 3RC3A 5LYJE 2YINA 4FESA 5JDHA 4Z8XA 4LSHA 5HXHA 3I1AA 5HWXA 3ZYLA 5FNVE 4RLBA 4H63H 1MNEA 2CXFA 4HTEA 2KWHA 4QXCB 2CWYA 4QX7B 4BJMA 2CEAA 4E1SA 4DBQA 4HGAA 3ZCIA 4O2AE 5J2TE 2ZM8A 3JC6D 3OJAA 2ODVA 3K3OA 2W00A 4O8SA 5EK4A 5JDFA 4QXBB 2V7MA 2XTQA 5DL8A 4JEUB 5JR9A 4GF4A 1HCIA 3EDUA 5L3CB 5FXZA 4GCQA 5LGTB 1IZNB 3A5XA 3PDYA 4DMWA 5JRCB 1SA0E 5LGUB 4H63V 2X9HA 3AAEA 2LFUA 3PTRB 4JUYA 2L8KA 4AKIA 3N9MA 2B1EA 4N58A 2CLYB 2XASB 4PJNA 2BVMA 4AKHA 3C4ZA 2KLQA 1U5PA 1MIYA 4AYNA 1Q9GA 1HX8A 3K3NA 2ZFGA 2E8IA 1WYBA 3FHNA 3N9OA 2F1TA 4AKLA 2FGQX 2JMKA 2XAJB 1QUUA 2E9XA 2DCFA 4ZI2D 3HWBA 2VKOA 4WBNE 2JJ9A 5ADXK 2W62A 2A2FX 3UUXB 4B61A 5L3FB 4X1KE 3E0ZA 4UF0A 4MFRA 4PK6A 2SPCA 3NRYA 1FIOA 4WBOA 2ODJA 4AKMA 3MXZA 1ZEEA 3ZN1B 2ACXA 5LJNA 3KV9A 2JQQA 4GYRA 3F57A 4D5UA 2WSSV 1V9DA 2L9QA 3RX6A 2ZLDA 2MNHA 3DJBA 5LXTE 4OYKA 3QRAA 2NP9A 5JVDE 6PRNA 4F6RC 3I9WA 3FYXA 3POUA 3FXEB 1FMWA 4IE0A 3E22E 2X27X 4O4JE 4AI6A 4OFZA 3ZPOA 4D64A 2XAFB 1OPFA 3UT5E 2LEHA 5HXCA 5GONE 1GFOA 2MHLA 3VKHA 4C90A 2KXPB 4GCSA 3WI4A 4G75A 4AZLA 2DI4A 3C64A 3ZN0B 3F31A 3IBPA 4FI5A 5H6QB 4ZHQE 5AFUK 2XE2A 2VWAA 3GWHA 1LVKA 2NW7A 4DMVA 5G26A 2VKJA 4O4LE 4ZI3D 3KVBA 2DLRA 2KXPA 2V7KA 1Y64B 3AA0A 2LSKA 3MK7C 5A1LA 3PE0A 4PNIA 2ES0A 3BK9A 4UV8B 4ADZA 3DA3A 2XAGB 4BAYB 2ZMAA 1GFPA 2XTRA 3ZMSB 2EHOB 1KK7A 2DWGA 2PRNA 3Q5XA 4E7SA 3HR0A 4A56A 5FP3A 1THQA 4LSIA 3H37A 2D0UA 3T20A 5L3BB 5HXSA 4HKAA 3GMIA 5J1GA 4P0BA 4NUVA 1S35A 1S94A 5JQGE 4Z3TA 4UVAB 2G0UA 1UX5A 3GA8A 4G76A 3O1HA 4FZMA 3LK41 2LHNA 3MKDA 3ESLA 4EXTA 2E9XB 3ANWA 2X9YA 4M1PA 5F3JA 4TX5A 3DA4A 3OYXA 3QUJA 4KR8A 3MA9A 5D5DA 3VZTX 3KVAA 3QK6A 4C91A 3J7Yq 2N1GA 5PRNA 2LSYA 4AQFA 4ISTA 2LSJA 3KBUA 4H9QC 4CQIA 2HPLA 4YJ3E 3SS1A 4HFVA 5JDLA 2QGSA 3GN5A 5JDGA 3HKEE 4AYEC 2XG6A 2LHFA 1PHOA 2YU1A 2VB6A 3KV5A 3ONXA 1H6S1 3R6NA 2W63A 4MBQA 1AJ3A 1E54A 5JR9B 5LOVE 4DBRA 3B13A 4I4TE 5J2UE 2NOXA 4P09A 1BXWA 4ZI7E 1BR4A 4UV9B 3DP7A 3RBHA 4XBFB 2JMMA 5DQWA 2LM9A 1D0YA 3PU3A 4KMCA 3QRCA 4EYYR 2N9DA 5DL7A 4MHCA 2C5JA 4L0RA 2WMNA 3UUNA 2XAQB 1WYCA 2RA1A 2JPFA 2Z6EA 3N2OA 3PUAA 2M06A 1X79A 4J2CA 3CVRA 4UF0B 1T98A 1HG2A 3F2EA 2DHRA 3C4WA 4IGUA 4QKNA 2VL8A 5FYMA 5IHYA 5LNKA 4GIWA 4QXHB 3A2SX 3BQKA 3T0SA 5LA6E 3VZUX 4UVCB 1FMVA 5EK3A 2KZ7A 1OWAA 3UAQA 3LG7A 5JDMA 4UELA 4U9CA 3ZYMA 3M65A 2IC9A 2BDEA 5LP6E 1KNZA 1QJ8A 3K3QC 1HXUA 2GE4A 4LSEA 1IAPA 1YW0A 2LHRA 3K8PC 1G90A 3AA0B 5DL6A 3FBLA 3UTKA 4CXXA 2LOPA 3VY9X 1ZHXA 4O3YA 4U74A 3RPUA 4PJMA 2CE7A 4ZOLE 1VRBA 3RYCE 1YKEB 4IDZA 4AUIA 4I50E 3TZGA 4KRAA 2MTQA 2PG8A 3IF8B 4N59A 4HEAA 4DO0A 3NBXX 3NZQA 4QWNB 3RH3A 3RRWA 4FRTA 2KZ7B 3D0TA 3AB3B 3HKBE 3SZVA 1WLXA 3VZWX 4DNDA 3I9YA 1ZHYA 2DNXA 2XUEA 3QC9A 3VKGA 3BQLA 4FZNA 3WI3A 5CB4E 2NW9A 3CX8B 2Q9QA 2CLYC 2MBGA 5LHHB 4PJJA 2I59A 3NSGA 3HL6A 3HA4A 4IE5A 5LBQB 5LGNB 5DJQC 1VOMA 3Q9DA 2CCQA 4QQ1A 2ZLYA 4UVBB 3WAKA 2BVLA 4FUVA 4QX8B 3KINB 3CWZB 2QA7A 4OK0A 3MACA 2Y6XA 3WAJA 5JREA 2UXNB 3CX7B 3O1IA 4IE4A 2IW5B 3CQGB 3KFWX 4IHJE 4O2BE 2V7JA 1P4TA 3IEEA 4AYMC 1BR1A 4GK0E 2CWOA 5FY1A 5GV0A 2LSIA 2Y0HA 3LBXA 3ZCJA 3GP6A 3EMNX 4EB6E 4EAHA 4GHBA 4ANJA 5JDPA 2KNDA 1ZHCA 5KDMC 3PRNA 3AAAB 3U3IA 4H9SE 3Q5WA 3V5SA 4FMSA 2J4UP 1E1HB 3AVRA 4O4IE 2L3LA 1ZV4X 2WAUA 5AFUL 2MOZA 4IE6A 2O4VA 4G2AA 3HI2A 3KDSE 3T24A 4AYID 3HKCE 1MMNA 4TV9E 3ZYKA 3HOLA 4IIJE 4TUYE 5JH7E 4MLKA 3CPZA 1CUNA 4I43B 4ILUA 2K48A 5FMNA 4TV8E 2YPVA 1IJ5A 2LJLA 3CX6B 2ZM0A 5LCYA 3AAEB 4E7ZA 5F8PA 2PORA 4KP3C 3EUHA 2X68A 3L3PA 2Q9QD 3V5UA 4RJWA 3JC6C 2EHOC 3LK42 3P8CD 2XHEB 3RC8A 2JMHA 5FY0A 3PUSA 4L5GA 3ZMVB 2YNKA 2J1DG 2IC6A 3SOLA 2XTLA 3W15B 1LKXA 3I0OA 3UUMA 2OA5A 3BQIA 4H9PC 2W80C 2ZM2A 3O9XA 1MM5A 4OHFA 4G63A 3SY7A 3FBZA 3POQA 1UX4A 3LBXB 4AKGA 2HH7A 1HF8A 1HS7A 5EZYE 3AA7A 4CZZB 2V26A 1D1CA 3N9LA 4GOUA 5L3DB 4ZI3C 2JRKA 3JTYA 1BR2A 8PRNA 4FRXA 4K0UA 4YHJA 5LHIB 2YEVC 3LK3A 2W0GA 2H7VC 5HXEA 3ZLIA 4JCHA 3S4UA 2KT9A 2VKDA 5KX5E 1HTJF 4X1IE 1ZHWA 4XZCA 4AXPA 2XMXA 4FOZA 3ETUA 4LSFA 5FVNA 1UCUA 1GFMA 2XQYA 3ZMZB 3ZEFB 2XAHB 2C0SA 3C98B 3C5OA 2XE3A 2K0LA 3VE1A 3ANWB 2NTXA 3LK2B 3NRXA 2WM9A 2GK9A 3N9PA 3B57A 3Q2MA 3AA1B 2OMFA 4EIWA 3PORA 2K5BB 2ERVA 3O1JA 3U78A 2EHOD 4CXYA 2Q9QC 2X0LB 4O4UA 1ZHZA 1SHZC 3RYIE 3G7GA 4FT6A 3C50A 4X1YE 2J1NA 1ZHTA 3N9NA 2X67A 2N2MA 4FZLA 4MALA 1NAFA 2LE8A 4D65A 4WW0A 2D2SA 2Y0KA 3N2GE 2P9BA 3VHLA 5LG4A 2A72A 2WWUA 2X51A 3PUQA 4EOZB 4FSOA 5ETWA 4PK5A 1D1AA 3ETVA 3VE2A 4X20E 3RRCA 3OKQA 3OYZA 5BMVE 3LFMA 5FXWA 1B7TA 2K24A 2LT3A 3HKDE 1FEWA 4E1TA 4H9NC 2EHOA 4PFOA 5FXVA 1IZNA 5LHGB 3C51A 3N9QA 1LRZA 2V7LA 4RJXA 3VU7H 2YK0A 1YS5A 4XNLA 4O3WA 2DWKA 2K4TA 3J9X1 3T8OA 4ASKA 4EZHA 2V7IA 3SWHA 2Y7SA 4BA9A 3N2KE 5FXXA 1QJ9A 2Y0LA 4P0AA 4I55E 3LK2A 5TAOA 5CA0E 4O4XA 2N2LA 4F4BA 3SYSA 4H9RC 2X66A 4CI1B 4WNKA 5EK2A 4AKRA 3UFEA 1MIWA 2A3DA 1MMDA 4PJLA 4AFKA 4PAGA 2XE5A 5IYUA 4O3ZA 5E0OA 4HE8A 4PW8A 1QSDA 5LBMA 1BR0A 4JEHB 2FGRA 2NTYA 4ZS3A 2W81C 3MJXA 4V1Av 1HXXA 2Y2XA 1LVFA 2Y8DA 3H3AA 4NUUA 4UXNB 2XE1A 1YKHB 4O3XB 2KMFA 3C4XA 2WMOA 2H3RA 2LSGA 2PFVA 1HFAA 3CQXC 5DQVA 5L3GB 2CM0A 4HN9A 2K9AA 1QJPA 3LJCA 4OYJA 3R84B 5IYZE 1MIVA 1GFNA 3PQUA 4PUXA 5JR9C 2Y48B 3RKOA 4UIGA 3ZMTB 1ORMA 2M07A 4UEMA 4RL9A 2ODUA 4PK4A 2KC0A 2RP4A 4H9OC 2KDYA 5JDQA 1MMAA 4KUMB 4O4HE 1MNDA 3TKLB 3O0EA 1G8XA 2KWIB 4AQFC 4JLEA 2CXLA 3N5LA 1G73A 3KV6A 4AKRB 3DTOA 5HXRA 3AA7B 3PURA 4GK5E 4XAXB 3UULA 4ERRA 4TZ4C 3FB2A 5ADXL 1MPFA 3VY8X 3RYFE 4ZI2C 3AVSA 5DABA 3ZC1A 5HYAA 4C69X 4GCPA 5JRCA 5CA1E 1IJ6A 3SRZA 1D0ZA 3ZJ2A 1D0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 2;  2KXP B;  1IZN B;  5AFU K;  3AAA B;  3AA0 B;  4AKR A;  3AAE A;  3AAA A;  3AA6 A;  3AA6 B;  2KXP A;  5AFU L;  4AKR B;  3AA0 A;  3AA7 B;  3LK2 B;  3AA1 B;  1IZN A;  5ADX L;  3LK3 B;  3AA1 A;  2KZ7 B;  3AA7 A;  2KZ7 A;  5ADX K;  3AAE B;  3LK3 A;  3LK4 1;  3LK2 A; 
#chains in the Genus database with same CATH topology
 1OSM A;  5LJM A;  2NWB A;  4JI4 T;  4HWI B;  3AA6 A;  4U72 A;  2HPJ A;  4CI2 B;  3POX A;  1ZOY A;  4Q25 A;  5T5F A;  2CMR A;  4YFS A;  4QHO A;  2V8S V;  2XQ3 A;  4COF A;  3UU2 A;  2W67 A;  3LSV A;  1Q9F A;  3P4S A;  3ZJ1 A;  2B76 A;  5AQH B;  2PTF A;  3KBT A;  2JQY A;  4CXW A;  2IAK A;  3RYH E;  1IBL T;  4DVD A;  1HG5 A;  1OXZ A;  2FJA A;  2V6Y A;  3HOE A;  2KIN B;  3PUZ F;  1JNZ A;  4JI5 T;  4AQG A;  2PJQ A;  3QNU A;  3SY9 A;  3PQS A;  3L09 A;  5H6R B;  3LK3 B;  4Z90 A;  2C5K T;  1EZ3 A;  3SZD A;  5F5W A;  3AEB A;  1NWM X;  1Z0P A;  4ISS A;  1T8B A;  1WR6 A;  4XNK A;  1WFD A;  7PRN A;  1CHU A;  4HWF A;  2C5I T;  3RC3 A;  3EAM A;  4LSH A;  5HXH A;  3I1A A;  4RLB A;  4CN4 A;  2KWH A;  4JI1 T;  4HGA A;  5J2T E;  3OJA A;  3JC6 D;  5JDF A;  2W00 A;  5ABH A;  3P4W A;  4QXB B;  2V7M A;  4JEU B;  4GCQ A;  2LFU A;  2L8K A;  3OPC A;  2CLY B;  4N74 A;  3C4Z A;  1MIY A;  2WJR A;  4UB6 O;  3K3N A;  2ZFG A;  2VQF T;  2JMK A;  1QUU A;  2VKO A;  4WBN E;  4HFI A;  3SFE A;  4B61 A;  5L3F B;  5H2F O;  4X1K E;  4QH1 A;  4A97 A;  1R8I A;  3NRY A;  2ODJ A;  4AKM A;  1ZEE A;  3AEE A;  3Q5D A;  3KV9 A;  2JQQ A;  4GYR A;  2WSS V;  2R6G F;  4LFA T;  5LXT E;  2MNH A;  4OYK A;  1OED B;  3QRA A;  2NP9 A;  2IWW A;  2WB5 A;  3I9W A;  2BG9 E;  5BR8 T;  4B3M T;  1GQE A;  4U3C A;  4AI6 A;  3ZPO A;  1YQ4 A;  4N75 A;  4D64 A;  3UT5 E;  2LEH A;  3AED A;  3FZL B;  4KI0 F;  1GFO A;  4ZEY A;  4DV6 T;  2DI4 A;  5AFU K;  4HWH A;  2NW7 A;  4DUY T;  4ZI3 D;  2KXP A;  2LSK A;  3DA3 A;  2XAG B;  4BAY B;  2XTR A;  2DWG A;  3HR0 A;  1THQ A;  4LSI A;  3H37 A;  5LMU T;  1OED E;  2D0U A;  3T20 A;  4HKA A;  5J1G A;  4NUV A;  1S94 A;  5JQG E;  4UR9 A;  4UVA B;  3GA8 A;  3LK4 1;  2X9Y A;  5F3J A;  2OLT A;  4DV0 T;  3J7Y q;  2WU2 A;  2R4O A;  1N34 T;  2HPL A;  4YJ3 E;  5JDG A;  3GN5 A;  1T7S A;  1PHO A;  2VB6 A;  2YU1 A;  3ONX A;  3P4R A;  1H6S 1;  3R6N A;  4HFH A;  3TLU A;  4UB8 O;  1AJ3 A;  1E54 A;  4I0U A;  4I4T E;  4HFD A;  5J2U E;  2NOX A;  3RI5 A;  1BXW A;  4IDQ A;  5IUX A;  2JMM A;  1D0Y A;  4MHC A;  3JCF A;  2C5J A;  2BS4 A;  4L0R A;  2WMN A;  2XAQ B;  1WYC A;  2JPF A;  3PUA A;  2M06 A;  4UF0 B;  3CVR A;  3F2E A;  2MAW A;  2VL8 A;  3LDQ B;  3T0S A;  3ZST A;  2X0H A;  3VZU X;  1OWA A;  3LG7 A;  4U9C A;  3M65 A;  2IC9 A;  2BDE A;  5HEH A;  1KNZ A;  3K3Q C;  2LHR A;  3K8P C;  1G90 A;  2H89 A;  5DL6 A;  2LOP A;  4ZOL E;  4YHH T;  3RYC E;  2R4L A;  3T1H T;  4DO0 A;  3RH3 A;  3RRW A;  1OED C;  3I9Y A;  1ZHY A;  3QC9 A;  3VKG A;  3CX8 B;  2CLY C;  5AQU B;  4PJJ A;  4EED A;  3RIU A;  3NSG A;  1I6Z A;  3ZT5 A;  4X64 T;  4JBW F;  4QQ1 A;  2ZLY A;  4FUV A;  4QX8 B;  2QA7 A;  4DV3 T;  3CX7 B;  3O1I A;  4JI3 T;  4IHJ E;  1P4T A;  3IEE A;  4AYM C;  5FL1 A;  3WU2 O;  1BR1 A;  2DL1 A;  5FY1 A;  3ZCJ A;  4TWF A;  2BBH A;  4EB6 E;  4ANJ A;  2UXC T;  4H9S E;  3Q5W A;  5HCJ A;  2J4U P;  1E1H B;  3AVR A;  2L3L A;  3VR8 A;  3RIU C;  3ZYK A;  5JH7 E;  4X66 T;  4MLK A;  4I43 B;  4TV8 E;  4HWC A;  1QLB A;  5LCY A;  1XNQ T;  2X68 A;  3L3P A;  3V5U A;  3AEF A;  2J1D G;  2IC6 A;  3SOL A;  4YTN A;  3W15 B;  1LKX A;  3I0O A;  3BQI A;  2QRX A;  2ZM2 A;  1MM5 A;  4G63 A;  1YXR A;  1L0V A;  3POQ A;  3LBX B;  4AKG A;  1HF8 A;  5L3D B;  4ZI3 C;  3NJT A;  2BBJ A;  5LB7 B;  3ZLI A;  4JCH A;  1HTJ F;  4XZC A;  4FOZ A;  2CHO A;  1UCU A;  2XQY A;  3ZMZ B;  2XAH B;  3C98 B;  2K0L A;  3ANW B;  3POR A;  2GK9 A;  2AE9 A;  3G7G A;  4LF9 T;  4FZL A;  2LE8 A;  2QVA A;  4WW0 A;  2D2S A;  3VHL A;  5AQS B;  3PUQ A;  2XQ9 A;  4PK5 A;  1D1A A;  4AIU A;  4E1T A;  5FXW A;  5CJ5 A;  1W0B A;  2XQ4 A;  3JAF A;  3AE9 A;  3C51 A;  4RJX A;  1YS5 A;  4ASK A;  4EZH A;  3SWH A;  3N2K E;  2WS3 A;  5FXX A;  1QJ9 A;  1XDO A;  5TAO A;  3SYS A;  1KF6 A;  2X66 A;  4WNK A;  5JTG A;  2V5C A;  3UFE A;  2XE5 A;  1BR0 A;  2W81 C;  4V1A v;  3FZM B;  4UXN B;  3AE7 A;  2LSG A;  1QJP A;  3LJC A;  1GFN A;  4UEM A;  3A7M A;  2KC0 A;  2RP4 A;  5AQV B;  2KDY A;  1MMA A;  4O4H E;  1G8X A;  3RQW A;  3N5L A;  1G73 A;  5HCM A;  4AKR B;  4ERR A;  3UQ7 A;  5ADX L;  1KNR A;  3OTO T;  5AQK B;  5CA1 E;  4NXN T;  3IA3 A;  2W66 A;  4O49 A;  4L9I A;  4YY3 T;  4YJ2 E;  4BJN A;  4FSP A;  3A0H O;  3I0Q A;  2MYS A;  3IHR A;  5C2T A;  2BZB A;  1IBK T;  2M67 A;  3BS0 A;  3UPG A;  4KBM B;  2CRB A;  1YD8 G;  4FJO A;  1BT9 A;  4IL4 A;  2VKH A;  2CPT A;  5ABG A;  4EYU A;  5FVK A;  2W4X A;  4YSX A;  5C8Y E;  4C00 A;  3CKD A;  2UXX B;  3EDV A;  2BG9 B;  3KVD D;  1US7 B;  2X9X A;  3CML A;  3WI5 A;  2LOS A;  5L2L A;  4NIQ A;  4QH4 A;  4YLH A;  3GN5 B;  3SYB A;  3NZP A;  3KV4 A;  1MMG A;  4TN7 B;  5AQQ B;  2YU2 A;  4FES A;  2J47 A;  5JDH A;  5KXJ A;  5AQJ B;  3FZF B;  1HNZ T;  3ABV A;  5ABF A;  4E1S A;  2ZM8 A;  2ODV A;  4C4V A;  5L3C B;  3H3M A;  5LGU B;  3EI0 A;  2X9H A;  4A5X A;  4JUY A;  2XAS B;  4X62 T;  2E2A A;  2XAJ B;  3RIA A;  4ZI2 D;  2JJ9 A;  5ADX K;  2W62 A;  3CIR A;  3UUX B;  4PK6 A;  4WBO A;  5FKY A;  3ZN1 B;  2ACX A;  3F57 A;  4D5U A;  2L9Q A;  2XQA A;  3K1S A;  4U7I A;  5JVD E;  2ACZ A;  4YSY A;  6PRN A;  4F6R C;  3POU A;  4IE0 A;  4CN6 A;  2YOE A;  4OFZ A;  3VKH A;  3UU8 A;  4GCS A;  2R88 A;  2LKG A;  3TLV A;  4G75 A;  4AZL A;  5H6Q B;  2XE2 A;  3TLW A;  3KVB A;  2DLR A;  4ILB A;  3PE0 A;  2ES0 A;  4UV8 B;  4ADZ A;  1KK7 A;  1IBM T;  2PRN A;  4A56 A;  3QOF A;  5L3B B;  1E2A A;  2G0U A;  3PGU A;  4EXT A;  3ANW A;  3DA4 A;  3OYX A;  3QUJ A;  5D5D A;  3VZT X;  4C91 A;  3PUY F;  4IST A;  3L8R A;  2LSJ A;  3X1D A;  3KBU A;  2BS2 A;  4H9Q C;  2AXT O;  5JDL A;  4HFV A;  2XG6 A;  4IDN A;  4JI2 T;  2XSB A;  4DV4 T;  4DBR A;  3B13 A;  3UFG A;  4P09 A;  4ZI7 E;  1BR4 A;  3EHZ A;  2FJD A;  4DR3 T;  4XBF B;  3FZK B;  2LM9 A;  2BG9 C;  3UUN A;  3OVU A;  4U2Y A;  2DHR A;  5AQN B;  5IHY A;  5FYM A;  3RIF A;  4GIW A;  4UVC B;  1QJ8 A;  1IAP A;  3AA0 B;  1W0A A;  3VY9 X;  2UUA T;  1ZHX A;  2WWV A;  3DZM A;  3TZG A;  2MTQ A;  3IF8 B;  4ZZC A;  4N59 A;  3AE1 A;  1X9B A;  4FRT A;  3D0T A;  1WLX A;  2WZH A;  2DNX A;  4FZN A;  2XM2 A;  2MBG A;  2W2U A;  4P1N A;  4IE5 A;  2A9U A;  2JQK A;  3UU3 A;  2BVL A;  4IL9 A;  3KIN B;  5L4E A;  3MAC A;  2YN6 A;  5JRE A;  3KFW X;  4IT4 A;  4GK0 E;  3B5M A;  4EAH A;  3PJA A;  1ZHC A;  3U3I A;  4ZXL A;  4FMS A;  4NXM T;  1J5E T;  4WZX A;  2WAU A;  2MOZ A;  4G2A A;  3HI2 A;  3T24 A;  1MMN A;  3HOL A;  5KAF O;  5FMN A;  2LJL A;  3CX6 B;  4DR4 T;  2Q9Q D;  3JC6 C;  3LK4 2;  2XHE B;  5FY0 A;  2LKH A;  4L5G A;  2YNK A;  2OA5 A;  4H9P C;  2W80 C;  2J62 A;  4OHF A;  5AQF B;  3SY7 A;  1WR0 A;  1UX4 A;  2XQ8 A;  5EZY E;  3N9L A;  4GOU A;  4K3C A;  1HX1 B;  4K0U A;  2H7V C;  3S4U A;  2VKD A;  3G06 A;  4X1I E;  1ZHW A;  1GFM A;  4FQE A;  3ZEF B;  3PJA J;  3C5O A;  4LMK A;  2OMF A;  2IDO B;  3O1J A;  3CK6 A;  4CXY A;  2Q9Q C;  4AQY T;  2J1N A;  4DR5 T;  1ZHT A;  4YT0 A;  3N9N A;  2QYW A;  4D65 A;  2IWV A;  3N2G E;  2P9B A;  2A72 A;  2WWU A;  2X51 A;  5ETW A;  3ETV A;  4X20 E;  5BMV E;  1B7T A;  3HKD E;  1FEW A;  5LHG B;  4K0K T;  4ZZB A;  4JI0 T;  2YK0 A;  4B3R T;  3ZT7 A;  2V7I A;  3VR9 A;  5AQT B;  1WCR A;  4P0A A;  3UU6 A;  3PUW F;  2N2L A;  3AE5 A;  4H9R C;  5CGM A;  1MIW A;  1MMD A;  5IYU A;  4HFB A;  4HE8 A;  3RHW A;  4JEH B;  4U7Y A;  2Y2X A;  4NUU A;  1J1J A;  1YKH B;  4O3X B;  2KMF A;  4LMJ A;  2H3R A;  2PFV A;  3CQX C;  2CM0 A;  4PUX A;  5JR9 C;  3ZMT B;  3KZI O;  3RGL A;  1MND A;  3TKL B;  2X9K A;  2JIW A;  4IL6 O;  3KV6 A;  5HXR A;  3UUL A;  4GK5 E;  3PGR A;  2IUB A;  3FB2 A;  4CN1 A;  3VRB A;  4DID B;  4WYV A;  3VY8 X;  3RYF E;  3AVS A;  3ZC1 A;  4JI7 T;  3DWO X;  4PFP A;  3ZC0 A;  5B66 O;  2E9X D;  2CXD A;  1KFY A;  3ZMU B;  2H88 A;  3NKZ A;  4F8H A;  5ABF B;  3AA6 B;  1HXT A;  1U4Q A;  3PUX F;  3FXD B;  4B3T T;  3PU8 A;  5DL5 A;  2XM1 A;  2Q9Q B;  4AYD C;  5G38 A;  2D5U A;  2BG9 A;  5JDN A;  3AE8 A;  2D9D A;  3CQC B;  2XQ6 A;  4GYS A;  4YSZ A;  2XPK A;  3AXJ A;  3P4Q A;  3RQU A;  2F4V T;  5HAX A;  3E08 A;  1BH3 A;  5FY7 A;  3AAI A;  3AA1 A;  4BUM X;  1N36 T;  2E9X C;  3V8U A;  3EVY A;  4CI3 B;  4EZ4 A;  4ZS2 A;  4JV5 T;  4JFB A;  3PV0 F;  1D1B A;  1ZKE A;  4B6X A;  3P7I A;  1JNR A;  2PBI A;  2HN2 A;  4YTP A;  5LYJ E;  2YIN A;  5CFB A;  5HWX A;  3ZYL A;  1MNE A;  4HTE A;  2CWY A;  2CEA A;  3ZKR A;  4O2A E;  2VVS A;  5EK4 A;  3P4P A;  2XTQ A;  5JR9 A;  2VVN A;  1IZN B;  4DMW A;  1SA0 E;  4H63 V;  3AAE A;  4HFE A;  4AKI A;  4LF7 T;  2V5D A;  4PJN A;  4KHZ F;  2BVM A;  2XZE A;  4AKH A;  2KLQ A;  2XQ7 A;  4AYN A;  1XMO T;  1HX8 A;  4QH5 A;  1WYB A;  4JYA T;  3FHN A;  2F1T A;  4AKL A;  2FGQ X;  2LRK A;  2DCF A;  1E7P A;  5FVL A;  3E0Z A;  3VRA A;  2WP9 A;  2JQ9 A;  1UUS A;  5LJN A;  2YDS A;  4DR1 T;  3TLT A;  3RX6 A;  2ZLD A;  4LF4 T;  5GTI O;  2WY2 A;  3FXE B;  1FMW A;  2X27 X;  4O4J E;  5HXC A;  5AQM B;  4GKJ T;  4C90 A;  2KXP B;  1NEK A;  5AQP B;  4ZHQ E;  3IBP A;  3DWN A;  5G26 A;  2VKJ A;  4O4L E;  2V7K A;  3AA0 A;  4PNI A;  3BK9 A;  4KR4 A;  1GFP A;  3ZMS B;  3JAE A;  2HHH T;  3Q5X A;  5HXS A;  1S35 A;  3Q5E A;  4G76 A;  5AQG B;  4FZM A;  3MKD A;  3ESL A;  2E9X B;  1KNP A;  4KR8 A;  3MA9 A;  5HEO A;  3KVA A;  5PRN A;  4AQF A;  2WDQ A;  3SS1 A;  2QGS A;  3HKE E;  4NPP A;  4AYE C;  1FJG T;  2YDR A;  3KV5 A;  4B3S T;  4MBQ A;  2LLY A;  4HFC A;  2J4G A;  2BKP A;  4UV9 B;  1M7K A;  5DQW A;  2LM2 A;  1T72 A;  4X5T A;  3QRC A;  5B5E O;  2WQY A;  2R89 A;  3T1Y T;  3N2O A;  3P50 A;  4DV5 T;  3AEA A;  3C4W A;  5LNK A;  4QXH B;  1FMV A;  5JDM A;  4UEL A;  2IML A;  5L47 A;  2BS3 A;  4TNV A;  2E5V A;  1HXU A;  1YW0 A;  3FBL A;  3UTK A;  2VL0 A;  5AQO B;  4O3Y A;  3RPU A;  2CE7 A;  1YKE B;  4I50 E;  4KRA A;  2PG8 A;  3NBX X;  2KZ7 B;  3AB3 B;  4DND A;  2XUE A;  4C4V B;  3BQL A;  1XMQ T;  5LHH B;  2I59 A;  3HA4 A;  5LGN B;  2BKN A;  3Q9D A;  4UVB B;  3WAK A;  4YTM A;  2MPK A;  3CWZ B;  4OK0 A;  2UXN B;  4IE4 A;  2IW5 B;  3CQG B;  4O2B E;  2HN1 A;  2LSI A;  3GP6 A;  5LMN T;  3EMN X;  3ZSS A;  4PJ0 O;  3AE4 A;  5JDP A;  2KND A;  5ABE A;  4O4I E;  1ZV4 X;  5AFU L;  4LF5 T;  4IE6 A;  2O4V A;  1W9R A;  4TV9 E;  4PR7 A;  4IIJ E;  4TUY E;  4JI6 T;  2YPV A;  1IJ5 A;  4ILA A;  3AAE B;  2POR A;  3ZT6 A;  4KP3 C;  3EUH A;  4RJW A;  3P8C D;  4DR7 T;  2JMH A;  3PUS A;  3ZMV B;  2XTL A;  1VCS A;  2BKO A;  3RKG A;  2HH7 A;  5TIS O;  3AA7 A;  2V26 A;  1D1C A;  3QB5 K;  1N33 T;  1UK5 A;  5G39 A;  4YHJ A;  5HXE A;  5AQL B;  2XMX A;  1SUM B;  4LSF A;  2XSA A;  2XE3 A;  3VE1 A;  3NRX A;  3N9P A;  3B57 A;  3AA1 B;  4EIW A;  4DV1 T;  2K5B B;  3U78 A;  1XNR T;  2X0L B;  4O4U A;  2FBW A;  1SHZ C;  3AEC A;  3RYI E;  4FT6 A;  4X1Y E;  2N2M A;  1XZY A;  1NAF A;  2IHR 1;  3OKQ A;  3PGS A;  2K24 A;  2LT3 A;  4H9N C;  4PFO A;  5FXV A;  2V7L A;  3L39 A;  2YKS A;  4XNL A;  2DWK A;  3J9X 1;  2I6H A;  4OX9 T;  4I55 E;  5GTH O;  3LK2 A;  2V6X A;  5CA0 E;  4AKR A;  4AFK A;  4PAG A;  5LBM A;  2FGR A;  3MJX A;  4U31 A;  2XE1 A;  2WMO A;  5L3G B;  5DQV A;  4HN9 A;  2K9A A;  4OYJ A;  3PQU A;  5IYZ E;  2VQE T;  5HEG A;  2Y48 B;  3TLS A;  3RKO A;  4UIG A;  3RLF F;  1ORM A;  4RL9 A;  2ODU A;  3ONJ A;  5JDQ A;  3O0E A;  2WJQ A;  2KWI B;  4AQF C;  4Z91 A;  2UUB T;  2CXL A;  3UU5 A;  1KEY A;  3DTO A;  3PUR A;  4XAX B;  2JQH A;  1ZP0 A;  5IWA T;  4DR2 T;  2WDV A;  5DAB A;  5HYA A;  2R4P A;  4GCP A;  4C69 X;  1IJ6 A;  3SRZ A;  4DV7 T;  3ZJ2 A;  1D0X A;  1Y64 B;  2FJB A;  2QTK A;  2F1V A;  4LFC T;  2CBJ A;  3MZK B;  3O4X E;  4RLC A;  3AAA A;  2UXB T;  1H7C A;  2VUR A;  3OBV E;  4KX6 A;  4GKK T;  2K3W A;  1HR0 T;  1UGO A;  1WRD A;  5M4Y A;  5EE2 A;  3PUG A;  5AQR B;  3HW9 A;  4KHP T;  3AE3 A;  1VCT A;  2WBL A;  2CA5 A;  5L3E B;  4DR6 T;  2X0Y A;  2X9W A;  5KMG P;  2N2N A;  2W61 A;  5J0Z A;  2WVP A;  3AEG A;  3NVO A;  3PUV F;  5HWY A;  2D0T A;  1MM4 A;  3A8Y C;  2VAS A;  4N78 D;  1Z8U A;  2V1D B;  4U2Z A;  3UU4 A;  2H7O A;  1GFQ A;  2VK9 A;  1O3X A;  2YDQ A;  4IE7 A;  2NW8 A;  3K19 A;  2NR4 A;  3PF1 A;  4Z8X A;  4IDP A;  5FNV E;  4H63 H;  4QXC B;  2CXF A;  4QX7 B;  4BJM A;  5FL0 A;  4LF6 T;  4DBQ A;  3ZCI A;  3K3O A;  1HNX T;  4O8S A;  5DL8 A;  4GF4 A;  1HCI A;  3EDU A;  5FXZ A;  2F1C X;  5LGT B;  3A5X A;  3PDY A;  5JRC B;  2FUP A;  4HWD A;  3PTR B;  1HNW T;  3N9M A;  2UXD T;  2B1E A;  4N58 A;  1M62 A;  3JCU O;  1U5P A;  1W09 A;  1Q9G A;  3UUB A;  2E8I A;  3N9O A;  2E9X A;  3HWB A;  3RF1 A;  2XY8 B;  2A2F X;  4UF0 A;  4MFR A;  3FZH B;  5E79 O;  2SPC A;  1FIO A;  2WDR A;  3MXZ A;  1V9D A;  2R4N A;  3DJB A;  2KSR A;  1DU2 A;  5G3A A;  3FYX A;  3E22 E;  2XAF B;  1OPF A;  5GON E;  2MHL A;  3WI4 A;  3ZN0 B;  3C64 A;  3F31 A;  4FI5 A;  2VWA A;  3GWH A;  1LVK A;  4DMV A;  2RPA A;  2AXD S;  3MK7 C;  5A1L A;  2ZMA A;  2EHO B;  4E7S A;  5FP3 A;  2IIU A;  3GMI A;  4P0B A;  3SFD A;  2UU9 T;  1T1L A;  4Z3T A;  4TWD A;  1UX5 A;  3O1H A;  2LHN A;  4M1P A;  2LRL A;  4TX5 A;  3QK6 A;  2N1G A;  2LSY A;  4CQI A;  1XDP A;  5KAI O;  4EGW A;  2LHF A;  2W63 A;  1Y01 A;  5JR9 B;  5LOV E;  3DP7 A;  3NWI A;  3RBH A;  1YQ3 A;  3PU3 A;  4KMC A;  4EYY R;  2N9D A;  5DL7 A;  1UUR A;  1T16 A;  2M6I A;  2Z6E A;  2RA1 A;  4LFB T;  3AE6 A;  1X79 A;  1PRN A;  2CHN A;  4J2C A;  1T98 A;  1HG2 A;  4IGU A;  4QKN A;  3A2S X;  2M6B A;  3BQK A;  5LA6 E;  2KZ7 A;  5EK3 A;  3UAQ A;  3ZYM A;  5LP6 E;  2GE4 A;  4LSE A;  4TWH A;  4CXX A;  4CTD A;  4LML A;  4U74 A;  4PJM A;  1VRB A;  4IDZ A;  4AUI A;  4IDO A;  4HEA A;  3NZQ A;  3UQ4 A;  4QWN B;  3HKB E;  3SZV A;  3VZW X;  5HEU A;  3WI3 A;  5CB4 E;  2NW9 A;  2Q9Q A;  2WZI A;  2I0M A;  3HL6 A;  5LBQ B;  5DJQ C;  1OED A;  1VOM A;  2CCQ A;  5C3J A;  2OV9 A;  3WAJ A;  2Y6X A;  3ONL C;  1SE7 A;  2V7J A;  4DV2 T;  5AQI B;  2CWO A;  5GV0 A;  2Y0H A;  3LBX A;  3AE2 A;  4GHB A;  1XWM A;  3BRZ A;  5KDM C;  3PRN A;  3AAA B;  3JAD A;  3A0B O;  3V5S A;  4U33 A;  3KDS E;  4AYI D;  3HKC E;  3CPZ A;  1CUN A;  4ILU A;  2K48 A;  2ZM0 A;  4E7Z A;  5F8P A;  2EHO C;  3RC8 A;  3M3Z B;  3UUM A;  1N32 T;  3O9X A;  3FBZ A;  2V6Y B;  2R8A A;  1HS7 A;  4CZZ B;  2JRK A;  2XJ7 A;  1BR2 A;  3JTY A;  8PRN A;  4FRX A;  5LHI B;  2YEV C;  4K3B A;  3LK3 A;  2W0G A;  2KT9 A;  4LF8 T;  5KX5 E;  4AXP A;  3ETU A;  3QB5 A;  5FVN A;  2C0S A;  2NTX A;  3LK2 B;  5L4H A;  2WM9 A;  3Q2M A;  2ERV A;  2EHO D;  1I94 T;  1ZHZ A;  3C50 A;  4A98 A;  2X67 A;  4MAL A;  2Y0K A;  5LG4 A;  4EOZ B;  4FSO A;  4AIS A;  2CBI A;  3VE2 A;  3RRC A;  3OYZ A;  3LFM A;  1S5L O;  2EHO A;  1IZN A;  4DUZ T;  3N9Q A;  1LRZ A;  3VU7 H;  2XQ5 A;  2FJE A;  4O3W A;  2K4T A;  3T8O A;  2Y7S A;  4BA9 A;  2Y0L A;  2WCA A;  4O4X A;  4F4B A;  2WU5 A;  4CI1 B;  5EK2 A;  4PJL A;  2A3D A;  4O3Z A;  1J5W A;  5E0O A;  4PW8 A;  4IRE A;  1QSD A;  2NTY A;  4ZS3 A;  1HXX A;  1LVF A;  2Y8D A;  3H3A A;  3C4X A;  2E5L T;  1HFA A;  4EV6 A;  3R84 B;  1MIV A;  2ZM6 T;  2M07 A;  4PK4 A;  3BRY A;  4H9O C;  4KUM B;  4EEB A;  3AXJ B;  4JLE A;  3AA7 B;  3EAB A;  4X65 T;  4TZ4 C;  4TNW A;  1MPF A;  1NEN A;  4YXD A;  2UUC T;  4ILC A;  4JI8 T;  4ZI2 C;  5HEJ A;  5JRC A;  5LG3 A;  1D0Z A; 
#chains in the Genus database with same CATH homology
 1OSM A;  4PFP A;  5LJM A;  2QTK A;  2NWB A;  3ZC0 A;  2F1V A;  2E9X D;  3MZK B;  3O4X E;  2CXD A;  4RLC A;  3ZMU B;  3AAA A;  3AA6 A;  4U72 A;  4O49 A;  3AA6 B;  2HPJ A;  1H7C A;  4L9I A;  4CI2 B;  4YJ2 E;  3POX A;  4BJN A;  1HXT A;  4FSP A;  1U4Q A;  3OBV E;  3I0Q A;  5T5F A;  2CMR A;  2MYS A;  3FXD B;  3IHR A;  4YFS A;  4QHO A;  3PU8 A;  5DL5 A;  1WRD A;  3UU2 A;  5M4Y A;  5EE2 A;  2BZB A;  3PUG A;  1Q9F A;  2M67 A;  3HW9 A;  3ZJ1 A;  3UPG A;  2Q9Q B;  2WBL A;  3KBT A;  4KBM B;  4CXW A;  4AYD C;  2D5U A;  1YD8 G;  2IAK A;  2CA5 A;  4FJO A;  5JDN A;  3RYH E;  1BT9 A;  4DVD A;  1HG5 A;  3CQC B;  1OXZ A;  2VKH A;  4GYS A;  5L3E B;  3HOE A;  2KIN B;  2X9W A;  5KMG P;  2N2N A;  2W61 A;  4EYU A;  4AQG A;  2PJQ A;  5HAX A;  3E08 A;  5C8Y E;  1BH3 A;  3PQS A;  5HWY A;  3SY9 A;  2D0T A;  3L09 A;  5H6R B;  3LK3 B;  3AAI A;  5FY7 A;  1MM4 A;  3AA1 A;  2VAS A;  2C5K T;  3CKD A;  4N78 D;  4BUM X;  2E9X C;  1EZ3 A;  2UXX B;  3V8U A;  3EVY A;  3SZD A;  3EDV A;  2V1D B;  4CI3 B;  4EZ4 A;  4ZS2 A;  1US7 B;  3KVD D;  1PRN A;  2X9X A;  1NWM X;  3CML A;  4JFB A;  3WI5 A;  1Z0P A;  2LOS A;  5L2L A;  2H7O A;  4YLH A;  1GFQ A;  1D1B A;  3GN5 B;  4ISS A;  3SYB A;  1WR6 A;  1ZKE A;  3NZP A;  2VK9 A;  4B6X A;  3KV4 A;  1O3X A;  3P7I A;  4XNK A;  1MMG A;  4IE7 A;  4TN7 B;  4KR4 A;  7PRN A;  2NW8 A;  2PBI A;  3K19 A;  2C5I T;  2YU2 A;  3RC3 A;  5LYJ E;  2YIN A;  4FES A;  5JDH A;  4Z8X A;  4LSH A;  5HXH A;  3I1A A;  5HWX A;  3ZYL A;  5FNV E;  4RLB A;  4H63 H;  1MNE A;  2CXF A;  4HTE A;  2KWH A;  4QXC B;  2CWY A;  4QX7 B;  4BJM A;  2CEA A;  4E1S A;  4DBQ A;  4HGA A;  3ZCI A;  4O2A E;  5J2T E;  2ZM8 A;  3JC6 D;  3OJA A;  2ODV A;  3K3O A;  2W00 A;  4O8S A;  5EK4 A;  5JDF A;  4QXB B;  2V7M A;  2XTQ A;  5DL8 A;  4JEU B;  5JR9 A;  4GF4 A;  1HCI A;  3EDU A;  5L3C B;  5FXZ A;  4GCQ A;  5LGT B;  1IZN B;  3A5X A;  3PDY A;  4DMW A;  5JRC B;  1SA0 E;  5LGU B;  4H63 V;  2X9H A;  3AAE A;  2LFU A;  3PTR B;  4JUY A;  2L8K A;  4AKI A;  3N9M A;  2B1E A;  4N58 A;  2CLY B;  2XAS B;  4PJN A;  2BVM A;  4AKH A;  3C4Z A;  2KLQ A;  1U5P A;  1MIY A;  4AYN A;  1Q9G A;  1HX8 A;  3K3N A;  2ZFG A;  2E8I A;  1WYB A;  3FHN A;  3N9O A;  2F1T A;  4AKL A;  2FGQ X;  2JMK A;  2XAJ B;  1QUU A;  2E9X A;  2DCF A;  4ZI2 D;  3HWB A;  2VKO A;  4WBN E;  2JJ9 A;  5ADX K;  2W62 A;  2A2F X;  3UUX B;  4B61 A;  5L3F B;  4X1K E;  3E0Z A;  4UF0 A;  4MFR A;  4PK6 A;  2SPC A;  3NRY A;  1FIO A;  4WBO A;  2ODJ A;  4AKM A;  3MXZ A;  1ZEE A;  3ZN1 B;  2ACX A;  5LJN A;  3KV9 A;  2JQQ A;  4GYR A;  3F57 A;  4D5U A;  2WSS V;  1V9D A;  2L9Q A;  3RX6 A;  2ZLD A;  2MNH A;  3DJB A;  5LXT E;  4OYK A;  3QRA A;  2NP9 A;  5JVD E;  6PRN A;  4F6R C;  3I9W A;  3FYX A;  3POU A;  3FXE B;  1FMW A;  4IE0 A;  3E22 E;  2X27 X;  4O4J E;  4AI6 A;  4OFZ A;  3ZPO A;  4D64 A;  2XAF B;  1OPF A;  3UT5 E;  2LEH A;  5HXC A;  5GON E;  1GFO A;  2MHL A;  3VKH A;  4C90 A;  2KXP B;  4GCS A;  3WI4 A;  4G75 A;  4AZL A;  2DI4 A;  3C64 A;  3ZN0 B;  3F31 A;  3IBP A;  4FI5 A;  5H6Q B;  4ZHQ E;  5AFU K;  2XE2 A;  2VWA A;  3GWH A;  1LVK A;  2NW7 A;  4DMV A;  5G26 A;  2VKJ A;  4O4L E;  4ZI3 D;  3KVB A;  2DLR A;  2KXP A;  2V7K A;  1Y64 B;  3AA0 A;  2LSK A;  3MK7 C;  5A1L A;  3PE0 A;  4PNI A;  2ES0 A;  3BK9 A;  4UV8 B;  4ADZ A;  3DA3 A;  2XAG B;  4BAY B;  2ZMA A;  1GFP A;  2XTR A;  3ZMS B;  2EHO B;  1KK7 A;  2DWG A;  2PRN A;  3Q5X A;  4E7S A;  3HR0 A;  4A56 A;  5FP3 A;  1THQ A;  4LSI A;  3H37 A;  2D0U A;  3T20 A;  5L3B B;  5HXS A;  4HKA A;  3GMI A;  5J1G A;  4P0B A;  4NUV A;  1S35 A;  1S94 A;  5JQG E;  4Z3T A;  4UVA B;  2G0U A;  1UX5 A;  3GA8 A;  4G76 A;  3O1H A;  4FZM A;  3LK4 1;  2LHN A;  3MKD A;  3ESL A;  4EXT A;  2E9X B;  3ANW A;  2X9Y A;  4M1P A;  5F3J A;  4TX5 A;  3DA4 A;  3OYX A;  3QUJ A;  4KR8 A;  3MA9 A;  5D5D A;  3VZT X;  3KVA A;  3QK6 A;  4C91 A;  3J7Y q;  2N1G A;  5PRN A;  2LSY A;  4AQF A;  4IST A;  2LSJ A;  3KBU A;  4H9Q C;  4CQI A;  2HPL A;  4YJ3 E;  3SS1 A;  4HFV A;  5JDL A;  2QGS A;  3GN5 A;  5JDG A;  3HKE E;  4AYE C;  2XG6 A;  2LHF A;  1PHO A;  2YU1 A;  2VB6 A;  3KV5 A;  3ONX A;  1H6S 1;  3R6N A;  2W63 A;  4MBQ A;  1AJ3 A;  1E54 A;  5JR9 B;  5LOV E;  4DBR A;  3B13 A;  4I4T E;  5J2U E;  2NOX A;  4P09 A;  1BXW A;  4ZI7 E;  1BR4 A;  4UV9 B;  3DP7 A;  3RBH A;  4XBF B;  2JMM A;  5DQW A;  2LM9 A;  1D0Y A;  3PU3 A;  4KMC A;  3QRC A;  4EYY R;  2N9D A;  5DL7 A;  4MHC A;  2C5J A;  4L0R A;  2WMN A;  3UUN A;  2XAQ B;  1WYC A;  2RA1 A;  2JPF A;  2Z6E A;  3N2O A;  3PUA A;  2M06 A;  1X79 A;  4J2C A;  3CVR A;  4UF0 B;  1T98 A;  1HG2 A;  3F2E A;  2DHR A;  3C4W A;  4IGU A;  4QKN A;  2VL8 A;  5FYM A;  5IHY A;  5LNK A;  4GIW A;  4QXH B;  3A2S X;  3BQK A;  3T0S A;  5LA6 E;  3VZU X;  4UVC B;  1FMV A;  5EK3 A;  2KZ7 A;  1OWA A;  3UAQ A;  3LG7 A;  5JDM A;  4UEL A;  4U9C A;  3ZYM A;  3M65 A;  2IC9 A;  2BDE A;  5LP6 E;  1KNZ A;  1QJ8 A;  3K3Q C;  1HXU A;  2GE4 A;  4LSE A;  1IAP A;  1YW0 A;  2LHR A;  3K8P C;  1G90 A;  3AA0 B;  5DL6 A;  3FBL A;  3UTK A;  4CXX A;  2LOP A;  3VY9 X;  1ZHX A;  4O3Y A;  4U74 A;  3RPU A;  4PJM A;  2CE7 A;  4ZOL E;  1VRB A;  3RYC E;  1YKE B;  4IDZ A;  4AUI A;  4I50 E;  3TZG A;  4KRA A;  2MTQ A;  2PG8 A;  3IF8 B;  4N59 A;  4HEA A;  4DO0 A;  3NBX X;  3NZQ A;  4QWN B;  3RH3 A;  3RRW A;  4FRT A;  2KZ7 B;  3D0T A;  3AB3 B;  3HKB E;  3SZV A;  1WLX A;  3VZW X;  4DND A;  3I9Y A;  1ZHY A;  2DNX A;  2XUE A;  3QC9 A;  3VKG A;  3BQL A;  4FZN A;  3WI3 A;  5CB4 E;  2NW9 A;  3CX8 B;  2Q9Q A;  2CLY C;  2MBG A;  5LHH B;  4PJJ A;  2I59 A;  3NSG A;  3HL6 A;  3HA4 A;  4IE5 A;  5LBQ B;  5LGN B;  5DJQ C;  1VOM A;  3Q9D A;  2CCQ A;  4QQ1 A;  2ZLY A;  4UVB B;  3WAK A;  2BVL A;  4FUV A;  4QX8 B;  3KIN B;  3CWZ B;  2QA7 A;  4OK0 A;  3MAC A;  2Y6X A;  3WAJ A;  5JRE A;  2UXN B;  3CX7 B;  3O1I A;  4IE4 A;  2IW5 B;  3CQG B;  3KFW X;  4IHJ E;  4O2B E;  2V7J A;  1P4T A;  3IEE A;  4AYM C;  1BR1 A;  4GK0 E;  2CWO A;  5FY1 A;  5GV0 A;  2LSI A;  2Y0H A;  3LBX A;  3ZCJ A;  3GP6 A;  3EMN X;  4EB6 E;  4EAH A;  4GHB A;  4ANJ A;  5JDP A;  2KND A;  1ZHC A;  5KDM C;  3PRN A;  3AAA B;  3U3I A;  4H9S E;  3Q5W A;  3V5S A;  4FMS A;  2J4U P;  1E1H B;  3AVR A;  4O4I E;  2L3L A;  1ZV4 X;  2WAU A;  5AFU L;  2MOZ A;  4IE6 A;  2O4V A;  4G2A A;  3HI2 A;  3KDS E;  3T24 A;  4AYI D;  3HKC E;  1MMN A;  4TV9 E;  3ZYK A;  3HOL A;  4IIJ E;  4TUY E;  5JH7 E;  4MLK A;  3CPZ A;  1CUN A;  4I43 B;  4ILU A;  2K48 A;  5FMN A;  4TV8 E;  2YPV A;  1IJ5 A;  2LJL A;  3CX6 B;  2ZM0 A;  5LCY A;  3AAE B;  4E7Z A;  5F8P A;  2POR A;  4KP3 C;  3EUH A;  2X68 A;  3L3P A;  2Q9Q D;  3V5U A;  4RJW A;  3JC6 C;  2EHO C;  3LK4 2;  3P8C D;  2XHE B;  3RC8 A;  2JMH A;  5FY0 A;  3PUS A;  4L5G A;  3ZMV B;  2YNK A;  2J1D G;  2IC6 A;  3SOL A;  2XTL A;  3W15 B;  1LKX A;  3I0O A;  3UUM A;  2OA5 A;  3BQI A;  4H9P C;  2W80 C;  2ZM2 A;  3O9X A;  1MM5 A;  4OHF A;  4G63 A;  3SY7 A;  3FBZ A;  3POQ A;  1UX4 A;  3LBX B;  4AKG A;  2HH7 A;  1HF8 A;  1HS7 A;  5EZY E;  3AA7 A;  4CZZ B;  2V26 A;  1D1C A;  3N9L A;  4GOU A;  5L3D B;  4ZI3 C;  2JRK A;  3JTY A;  1BR2 A;  8PRN A;  4FRX A;  4K0U A;  4YHJ A;  5LHI B;  2YEV C;  3LK3 A;  2W0G A;  2H7V C;  5HXE A;  3ZLI A;  4JCH A;  3S4U A;  2KT9 A;  2VKD A;  5KX5 E;  1HTJ F;  4X1I E;  1ZHW A;  4XZC A;  4AXP A;  2XMX A;  4FOZ A;  3ETU A;  4LSF A;  5FVN A;  1UCU A;  1GFM A;  2XQY A;  3ZMZ B;  3ZEF B;  2XAH B;  2C0S A;  3C98 B;  3C5O A;  2XE3 A;  2K0L A;  3VE1 A;  3ANW B;  2NTX A;  3LK2 B;  3NRX A;  2WM9 A;  2GK9 A;  3N9P A;  3B57 A;  3Q2M A;  3AA1 B;  2OMF A;  4EIW A;  3POR A;  2K5B B;  2ERV A;  3O1J A;  3U78 A;  2EHO D;  4CXY A;  2Q9Q C;  2X0L B;  4O4U A;  1ZHZ A;  1SHZ C;  3RYI E;  3G7G A;  4FT6 A;  3C50 A;  4X1Y E;  2J1N A;  1ZHT A;  3N9N A;  2X67 A;  2N2M A;  4FZL A;  4MAL A;  1NAF A;  2LE8 A;  4D65 A;  4WW0 A;  2D2S A;  2Y0K A;  3N2G E;  2P9B A;  3VHL A;  5LG4 A;  2A72 A;  2WWU A;  2X51 A;  3PUQ A;  4EOZ B;  4FSO A;  5ETW A;  4PK5 A;  1D1A A;  3ETV A;  3VE2 A;  4X20 E;  3RRC A;  3OKQ A;  3OYZ A;  5BMV E;  3LFM A;  5FXW A;  1B7T A;  2K24 A;  2LT3 A;  3HKD E;  1FEW A;  4E1T A;  4H9N C;  2EHO A;  4PFO A;  5FXV A;  1IZN A;  5LHG B;  3C51 A;  3N9Q A;  1LRZ A;  2V7L A;  4RJX A;  3VU7 H;  2YK0 A;  1YS5 A;  4XNL A;  4O3W A;  2DWK A;  2K4T A;  3J9X 1;  3T8O A;  4ASK A;  4EZH A;  2V7I A;  3SWH A;  2Y7S A;  4BA9 A;  3N2K E;  5FXX A;  1QJ9 A;  2Y0L A;  4P0A A;  4I55 E;  3LK2 A;  5TAO A;  5CA0 E;  4O4X A;  2N2L A;  4F4B A;  3SYS A;  4H9R C;  2X66 A;  4CI1 B;  4WNK A;  5EK2 A;  4AKR A;  3UFE A;  1MIW A;  2A3D A;  1MMD A;  4PJL A;  4AFK A;  4PAG A;  2XE5 A;  5IYU A;  4O3Z A;  5E0O A;  4HE8 A;  4PW8 A;  1QSD A;  5LBM A;  1BR0 A;  4JEH B;  2FGR A;  2NTY A;  4ZS3 A;  2W81 C;  3MJX A;  4V1A v;  1HXX A;  2Y2X A;  1LVF A;  2Y8D A;  3H3A A;  4NUU A;  4UXN B;  2XE1 A;  1YKH B;  4O3X B;  2KMF A;  3C4X A;  2WMO A;  2H3R A;  2LSG A;  2PFV A;  1HFA A;  3CQX C;  5DQV A;  5L3G B;  2CM0 A;  4HN9 A;  2K9A A;  1QJP A;  3LJC A;  4OYJ A;  3R84 B;  5IYZ E;  1MIV A;  1GFN A;  3PQU A;  4PUX A;  5JR9 C;  2Y48 B;  3RKO A;  4UIG A;  3ZMT B;  1ORM A;  2M07 A;  4UEM A;  4RL9 A;  2ODU A;  4PK4 A;  2KC0 A;  2RP4 A;  4H9O C;  2KDY A;  5JDQ A;  1MMA A;  4KUM B;  4O4H E;  1MND A;  3TKL B;  3O0E A;  1G8X A;  2KWI B;  4AQF C;  4JLE A;  2CXL A;  3N5L A;  1G73 A;  3KV6 A;  4AKR B;  3DTO A;  5HXR A;  3AA7 B;  3PUR A;  4GK5 E;  4XAX B;  3UUL A;  4ERR A;  4TZ4 C;  3FB2 A;  5ADX L;  1MPF A;  3VY8 X;  3RYF E;  4ZI2 C;  3AVS A;  5DAB A;  3ZC1 A;  5HYA A;  4C69 X;  4GCP A;  5JRC A;  5CA1 E;  1IJ6 A;  3SRZ A;  1D0Z A;  3ZJ2 A;  1D0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...