3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
4AKRA 1IZNB 3AA6A 4AKRB 3AA7A 3AAAA 3AA7B 3LK42 3AA1B 5AFUK 3AA0A 5AFUL 3AAEA 3LK41 3LK3B 3LK3A 3AAAB 2KXPB 2KZ7B 2KXPA 2KZ7A 1IZNA 3AA1A 3AA6B 3LK2B 3LK2A 3AAEB 5ADXL 5ADXK 3AA0B
chains in the Genus database with same CATH superfamily
3FZKB 3UUMA 2N2NA 2CWYA 3NJTA 1IJ6A 3AE5A 5AFUK 3UFEA 1NWMX 4YTMA 2XY8B 3VY9X 4FJOA 2F1CX 2N2MA 3FBLA 4JI5T 2XE1A 3POQA 2XE5A 5KAFO 3LDQB 1I94T 5FY7A 2XZEA 3BK9A 2DI4A 5PRNA 3C5OA 2QYWA 2HHHT 5T5FA 3RC8A 2G0UA 4KX6A 3JAEA 1J5ET 2A72A 3AEBA 4X5TA 4HWHA 2K0LA 4GOUA 2IDOB 4YLHA 2KZ7A 1HCIA 3GA8A 3PURA 2WS3A 4U7YA 5ETWA 4D5UA 1KK7A 5JR9B 4O3XB 2Q9QD 1U4QA 4JI1T 1IJ5A 3CKDA 3A7MA 3UPGA 5EE2A 4HFBA 3L3PA 2KZ7B 5AQNB 5FL0A 5FVLA 4FZMA 5E79O 4IE6A 3FXDB 2N1GA 3KV4A 3BS0A 1YS5A 4LSFA 3ZLIA 4ZI7E 2CLYC 1T7SA 1V9DA 4ZI2C 1P4TA 3P4QA 3K8PC 3PJAJ 2V5CA 3WI3A 3RBHA 3EHZA 1T16A 1D1AA 1T98A 3T1YT 1Q9GA 4P1NA 2YN6A 2YDQA 5F5WA 2NOXA 3KDSE 4EAHA 3UU3A 2LSKA 2RP4A 3PU8A 3ZJ2A 3ZYMA 2VKOA 4DV7T 2XTRA 2H7OA 2YOEA 3RRWA 2ZM6T 2M06A 4TZ4C 1UX4A 1BH3A 3HR0A 4LSEA 3CWZB 2M6IA 4X66T 4YSXA 4YXDA 1J1JA 2CBIA 5ABEA 4KRAA 2SPCA 3AA0A 2YK0A 3BQIA 2D0UA 3NVOA 4WBOA 4E1TA 4HEAA 3ZSSA 3CVRA 1ZEEA 5AQJB 5E0OA 5JDQA 4IE4A 2D2SA 2EHOD 2V7JA 4Z90A 2MHLA 5JDHA 1ZHXA 4HFIA 4WZXA 4G2AA 2XQ5A 4HWDA 2CXFA 5AQGB 2KXPB 3PUVF 5JR9A 2YPVA 3O1HA 5G38A 3UTKA 4FESA 4HWCA 5G39A 4Z8XA 5AQQB 5ABHA 4RLCA 3O0EA 4PJ0O 4CI1B 2Z6EA 1GFQA 3HOLA 3KBTA 5L3DB 4FT6A 1BR2A 3AE6A 4XNLA 4JEUB 4I55E 4EOZB 3CIRA 5H6RB 1HG2A 1XMOT 3MA9A 1WCRA 3BQLA 5H2FO 3BQKA 2Y7SA 5EK4A 2IUBA 4FZLA 2X0LB 4ILCA 2WWVA 2MOZA 3OPCA 4H9SE 2VWAA 2DCFA 2K9AA 1B7TA 3ZMTB 5G3AA 3POUA 4JFBA 2IAKA 4EB6E 1H6S1 3DJBA 1LRZA 1XDOA 5AQFB 5LYJE 2YU1A 2WWUA 2UXBT 2VB6A 2J47A 4X1YE 2O4VA 5JDMA 5TAOA 5FKYA 5HEOA 3ZMZB 4IE5A 3AE1A 5BMVE 2V26A 3AECA 1T72A 4H9NC 3GN5A 3T0SA 2X0YA 5L47A 2IIUA 4B3RT 1OXZA 3TLSA 2UUAT 3O9XA 5HEJA 3G06A 4HTEA 1OEDA 4PK6A 3ONJA 4UIGA 2BS3A 3NBXX 3SYBA 3IBPA 3NZPA 3OBVE 4U33A 3O1JA 3V8UA 5L2LA 1VCSA 2LJLA 2HPLA 4DV6T 4JYAT 3MK7C 3LBXB 4N74A 5KX5E 4U9CA 4UB8O 2P9BA 4LFBT 1R8IA 2W63A 1CUNA 2D5UA 4FSOA 2VVSA 5LHHB 2ODVA 2BS2A 2AE9A 3RX6A 3VRBA 4UELA 1UX5A 3T8OA 5J1GA 4DNDA 3ESLA 3LBXA 5KDMC 4A56A 5HXEA 3FZHB 2LLYA 4TN7B 3RQWA 3ETVA 2VL0A 2XAQB 5AQTB 4OFZA 2YKSA 3AAEB 2KMFA 3IHRA 2DWKA 2UUBT 5JH7E 4O8SA 1E54A 5AQRB 4AKRB 2V5DA 3JC6D 3IEEA 2W4XA 3ONXA 4BA9A 4WYVA 1FMWA 3M3ZB 2K3WA 3LSVA 3VE1A 4GK0E 5LA6E 1W9RA 1UURA 1LVFA 3UQ7A 4KMCA 3PQUA 2CM0A 4A97A 2BG9A 3PJAA 1NENA 1XMQT 1UGOA 2LHFA 4MBQA 2LRLA 4AKGA 1H7CA 5F8PA 3E22E 2V7IA 4AQGA 2WVPA 2V7KA 4KR4A 3LG7A 2X9KA 2ZLYA 1DU2A 5LNKA 4O2BE 4WW0A 4QH1A 4FI5A 4PJNA 1FMVA 2XAFB 3EDUA 2IHR1 2BS4A 3C51A 4AKLA 5HXRA 4EGWA 3TZGA 3QNUA 1MM4A 2E8IA 3PUQA 1MNEA 4FRTA 4RJXA 2JIWA 1OEDC 3RIFA 2XASB 3P4SA 4YJ3E 4B6XA 4IDNA 2R8AA 4EEBA 3JC6C 3QB5A 3P7IA 4NUVA 2KSRA 3VR9A 2NW7A 2H89A 1D0ZA 1WFDA 5BR8T 3SFDA 4L5GA 3A8YC 2X66A 4TWDA 3P4RA 3AA6B 3P4WA 5JDGA 4ILUA 2FJBA 3AEAA 1SA0E 2IMLA 1WRDA 5GONE 4ISTA 2CRBA 4DR7T 4E7SA 3RIAA 3EDVA 3JADA 3NSGA 1G90A 2LM9A 2JMKA 2PBIA 5EK3A 2R88A 4QH5A 3V5SA 4TUYE 4OHFA 2X68A 5JVDE 1GFOA 2C5KT 2GE4A 3AB3B 4UB6O 2A9UA 4Z3TA 2VKDA 5LJNA 1IBKT 2BVMA 4XNKA 3UU4A 4ILAA 2BG9C 2NR4A 2KT9A 3PRNA 2CPTA 1THQA 2LEHA 4G63A 4JI8T 2XM2A 4JBWF 4KHZF 4IDOA 4N58A 5LOVE 4I4TE 3VZUX 4FOZA 4JI7T 5JDFA 2D9DA 4ZI3C 2WP9A 2XQ4A 2XTLA 3JTYA 4IL6O 2HPJA 5FXZA 2DL1A 4UEMA 3JCUO 2VVNA 4IHJE 4DMWA 3AA6A 3OKQA 4P0BA 1E1HB 3RIUA 3RYHE 5A1LA 4O4XA 3KINB 3HL6A 1M62A 4AYID 5L3CB 5HCMA 3KV9A 2GK9A 3RYCE 1D1CA 1OPFA 3C4ZA 3DP7A 3U78A 1KEYA 2L3LA 1MMNA 3QUJA 2R4NA 2XTQA 2X27X 2XMXA 4OK0A 3TLTA 2CBJA 5AQLB 4YSYA 4CN6A 2B76A 5CB4E 2N2LA 3AE8A 5ABFA 1KNZA 4PFPA 3MXZA 4GYSA 4O49A 1MMDA 2CCQA 3UUNA 5L3EB 1ZHTA 1FJGT 2YU2A 4CXXA 3NZQA 2YNKA 5FXWA 5IHYA 4PR7A 5IYZE 3AA7A 4NPPA 3PUZF 4AYEC 3KVAA 2J4GA 4IIJE 5LMNT 3SYSA 3ZEFB 1OWAA 3HKDE 3CX7B 3R84B 3VE2A 1HNXT 2LKGA 2VASA 4G76A 1FIOA 3RPUA 2A3DA 3DA4A 1BR1A 1HXXA 4LF5T 4EZ4A 2KLQA 3EABA 2Y2XA 5M4YA 2VQFT 3UAQA 3GP6A 4D65A 2V7LA 3UT5E 2WJQA 2UXDT 2Y8DA 3I9WA 5AQMB 3AVSA 3ZT7A 4CXWA 2WU2A 2KNDA 1Y01A 2D0TA 5LG3A 4JI6T 2LSIA 4JI3T 4DR6T 1G73A 2UU9T 3NRXA 1MM5A 3FYXA 5LMUT 4K3BA 3WI5A 3K1SA 3I1AA 4TNWA 2XG6A 3T20A 1KFYA 1GFMA 1MIWA 3P50A 5GTHO 2JMMA 3B5MA 4ZHQE 2FBWA 5FVNA 2ODUA 4PNIA 4O3WA 4XBFB 2VK9A 4CN4A 1L0VA 2WU5A 3NKZA 2ZM2A 4CI3B 2F1VA 4PUXA 3Q5WA 3AAIA 5DL5A 3A5XA 2DWGA 2DHRA 1M7KA 5AQSB 3ZPOA 5CJ5A 4JV5T 1MNDA 2C5JA 2HH7A 2R4LA 2MYSA 3AXJA 2LT3A 3PQSA 4QXHB 3VRAA 3T1HT 4KR8A 2CHOA 5DQVA 4H63V 5L3BB 4I0UA 4DBRA 2XE3A 4U2ZA 3N9PA 2FJDA 3G7GA 2CXLA 1X79A 4DR2T 1PRNA 3L8RA 4TV9E 3POXA 2QA7A 4BJMA 2WM9A 2MTQA 2V6YB 4BJNA 2NTXA 3KV6A 4ZXLA 5JDPA 2X0HA 5JTGA 2XSAA 4J2CA 1E7PA 4RL9A 3SY7A 5FMNA 1BXWA 5G26A 4ZS2A 3UU2A 3BRZA 4IE7A 4L9IA 2F4VT 2XQ9A 2ZFGA 3W15B 2ACXA 5LGNB 4GHBA 7PRNA 3N2GE 3L09A 4Z91A 3ZMVB 3CMLA 4GIWA 4IT4A 4Q25A 1NAFA 4O4JE 3M65A 4ANJA 4IL4A 1MMGA 3AE2A 3FZFB 3NRYA 4CN1A 4UVCB 3P4PA 4X20E 1HR0T 4KBMB 2XQ3A 5DL6A 1ORMA 4GKKT 5J2TE 4PK5A 1XNQT 4DV0T 3FB2A 5FY0A 4G75A 3OYXA 3IA3A 6PRNA 4U72A 1N32T 4LSIA 2CMRA 5DQWA 4AQFA 4EZHA 1IAPA 3D0TA 3ZC0A 3AXJB 4B3TT 2K48A 5HEUA 4PK4A 1WLXA 4YTNA 3HA4A 4UVBB 3J7Yq 4ZEYA 4X65T 1I6ZA 4ISSA 4C4VA 1WYCA 2LKHA 2VQET 4ASKA 5LG4A 4CXYA 3PUWF 2LHNA 1IBMT 3CX8B 4B3MT 5B5EO 2WDRA 4IREA 1LVKA 5HXSA 4LF8T 2IWVA 3AAAB 4C00A 2LM2A 1ZV4X 2CHNA 3PU3A 3O1IA 1QJPA 3ZKRA 2RPAA 2ERVA 5HYAA 4HKAA 3GMIA 4DV2T 4JLEA 4B61A 4EIWA 4HFEA 3MJXA 4IDQA 3AAEA 4HFCA 2AXTO 2WDQA 5JQGE 3Q5XA 3SZVA 2MAWA 3VKGA 4AIUA 3VHLA 1W09A 3J9X1 2F1TA 1AJ3A 2LSGA 3PGSA 4H9PC 2N9DA 4H9OC 4DR4T 2NW8A 3CPZA 3TKLB 5KAIO 3E08A 2WCAA 4IGUA 4O4HE 3UU6A 4ZZCA 4U3CA 2I6HA 2IW5B 2X67A 1XZYA 3O4XE 2WQYA 2OLTA 4UF0B 1HX8A 3Q2MA 3PUSA 4QX8B 4O2AE 4UV9B 2E9XC 3B57A 3OJAA 2Q9QA 3AE3A 2VKHA 1E2AA 2ZM0A 2V7MA 2KINB 2DNXA 2JMHA 4X64T 2MBGA 3N9LA 5AQHB 3RHWA 3UULA 5KMGP 1N34T 8PRNA 5FVKA 5FYMA 2LRKA 1N36T 4LF9T 2WY2A 2E9XA 4L0RA 3TLWA 5IWAT 3K3QC 2M67A 3KFWX 2OA5A 2KWHA 2QGSA 2W00A 4AI6A 5L3GB 1YD8G 1T1LA 5CGMA 3AAAA 4TX5A 3RC3A 3CX6B 4AYDC 2FJEA 3ZT5A 4TWHA 3A2SX 3Q9DA 3H37A 3RI5A 2VURA 2BG9B 3UUBA 3ZYLA 5J2UE 4N59A 2XPKA 2V6XA 1JNZA 4UV8B 3ZSTA 4F4BA 3VKHA 3C50A 4GCPA 4GK5E 5C2TA 2J1NA 5AQKB 3ZT6A 3LK3B 2I0MA 1O3XA 1GQEA 3LK2B 3MZKB 4QQ1A 5ADXL 1MPFA 2WZHA 3K19A 4E1SA 4YHJA 3FHNA 3PGRA 4LMKA 2XSBA 3SWHA 4ERRA 2IWWA 3Q5DA 2XAJB 4DV3T 1ZP0A 5EK2A 4KP3C 3ZN1B 1MMAA 2B1EA 4I43B 2JQQA 2JRKA 5L4EA 3QOFA 2I59A 2CLYB 4AXPA 5F3JA 4DBQA 3DZMA 2L8KA 3V5UA 5HCJA 5J0ZA 1SE7A 2XUEA 5AQUB 4CI2B 2YDRA 3VZWX 2WSSV 3S4UA 2LHRA 4KUMB 4V1Av 4QWNB 4FZNA 3LFMA 4UXNB 2WZIA 5H6QB 5FP3A 4X1IE 4NXMT 2EHOB 3VR8A 2UXNB 4HFDA 4E7ZA 2FJAA 5HXCA 3HKEE 2EHOC 3EVYA 4HGAA 2X51A 4DR3T 4PAGA 4XZCA 3CQXC 5DL7A 4MHCA 2IC9A 5AQPB 2H7VC 4KI0F 1QJ9A 5LP6E 3JAFA 3OVUA 2HN2A 4YJ2E 3DWOX 5L4HA 3RYFE 4ADZA 1MIVA 1SHZC 4PJJA 4ZZBA 4A98A 1ZHZA 3LK41 3N2KE 4UR9A 5FY1A 3UQ4A 4YFSA 1VRBA 2XHEB 5DL8A 2A2FX 2M6BA 5C3JA 4IDZA 2Y0KA 3CQGB 2BG9E 4CQIA 4OYKA 4DMVA 3RH3A 2ZMAA 3N2OA 3KVDD 5EZYE 4C90A 4PJLA 3DA3A 4LF7T 2BKOA 5HEGA 2UXCT 2PORA 3AA1A 3PUGA 5AQIB 1ZHYA 2R4OA 1HNWT 2V6YA 2K5BB 3KBUA 2XJ7A 2Y0LA 3I0QA 3RRCA 5JRCA 2K4TA 1U5PA 5FXXA 3E0ZA 5HWYA 4FQEA 3ZYKA 4HWFA 2VKJA 5AQOB 4YTPA 2DLRA 1GFNA 1NEKA 4BUMX 3ETUA 4A5XA 1Q9FA 3PORA 4QHOA 4JI4T 3C4XA 2ZM8A 2CWOA 4FUVA 2H3RA 4I50E 4GF4A 4U74A 3DTOA 3OYZA 2JQ9A 3VU7H 3VZTX 4CZZB 1ZHWA 5JR9C 4OYJA 1HNZT 2KXPA 2H88A 2CA5A 3BRYA 3B13A 5IYUA 2FGQX 4HE8A 2XM1A 4QXBB 1SUMB 4HWIB 2JQYA 5LGTB 4NXNT 3LJCA 2ODJA 5HWXA 3UFGA 4LF6T 3RIUC 5CFBA 2XQ8A 5B66O 1KNRA 1ZKEA 1OSMA 2PRNA 4MLKA 4QX7B 4LMJA 2E2AA 1PHOA 4BAYB 4ZI3D 4AKMA 2NP9A 2BBHA 3PV0F 3UU8A 3AE9A 2W61A 2E9XD 2LSJA 3HKCE 4PJMA 3ZMSB 4AISA 3A0BO 3PUXF 4TWFA 4DV4T 4AZLA 4DUZT 1S35A 5IUXA 1W0AA 2FGRA 2PTFA 5FL1A 3EI0A 1US7B 3MKDA 4AUIA 4ZOLE 3ANWB 3PE0A 3AA1B 2WAUA 4LFCT 5D5DA 3CQCB 3F2EA 1BT9A 1VCTA 2QRXA 2LE8A 5JDNA 4IDPA 4OX9T 3AE7A 3FZLB 4AQYT 5JRCB 4YSZA 2ES0A 3QRAA 5DJQC 4QXCB 1HXTA 4H9RC 4F6RC 1BR0A 3PDYA 1QJ8A 3SOLA 3SY9A 5KXJA 4DV1T 1D0YA 2W62A 2CEAA 1KF6A 2QVAA 2Y48B 3T24A 4MALA 3KV5A 4JI0T 1BR4A 1WYBA 2BZBA 3AA0B 3C64A 3FZMB 2WMOA 1IZNB 3ZMUB 2KC0A 2WJRA 3ZJ1A 4LSHA 3WU2O 3JCFA 4O3ZA 3ABVA 2Q9QB 4O4UA 4ZI2D 4PFOA 1S5LO 2FUPA 4TV8E 5ADXK 1G8XA 4LFAT 2J1DG 1ZOYA 1HG5A 3SS1A 3WAJA 3N9QA 4GYRA 2MPKA 2V1DB 4HN9A 2HN1A 4DVDA 4CTDA 2W2UA 4HFHA 4C69X 4QKNA 3C4WA 3AEDA 3C98B 1OEDB 5CA1E 4EV6A 3SFEA 2XAGB 2YEVC 3I0OA 2AXDS 4FMSA 2X9WA 4O4LE 4DR1T 5HXHA 3UUXB 4WBNE 3N9OA 1YKHB 3N5LA 3ZN0B 4XAXB 4RJWA 2LSYA 2UUCT 3HI2A 1XNRT 3F31A 1W0BA 2ZLDA 2X9YA 3RYIE 5AQVB 3ANWA 2WB5A 1WR0A 4LF4T 1LKXA 2IC6A 2J4UP 1EZ3A 4U2YA 1QLBA 4DV5T 3ONLC 1HXUA 2RA1A 1Y64B 3HKBE 3GN5B 1YQ3A 3QB5K 1XDPA 4EYUA 2X9HA 3LK2A 3VY8X 3H3MA 4GCQA 4AKRA 4AYNA 4DUYT 3RKOA 4YY3T 4IE0A 1HFAA 3QK6A 2BVLA 1QUUA 2MNHA 5LBQB 2XQAA 5L3FB 3F57A 1JNRA 3QRCA 3X1DA 4COFA 1IZNA 3EAMA 2OV9A 2E5LT 4GCSA 1HX1B 3MACA 5LCYA 3DWNA 4U7IA 1QSDA 1T8BA 4RLBA 4NUUA 1MIYA 3FXEB 1UCUA 1S94A 1WR6A 4HFVA 2YINA 1Z0PA 2CXDA 2L9QA 3N9MA 3HOEA 4DR5T 5FXVA 2NTYA 2R89A 4MFRA 4YT0A 1J5WA 4D64A 1GFPA 3RGLA 2WBLA 1X9BA 4TNVA 5LB7B 4FRXA 3TLVA 1N33T 2JQHA 3PF1A 4P09A 3CK6A 3RF1A 4AQFC 1UK5A 3QC9A 4LMLA 3KVBA 2Q9QC 5ABGA 2OMFA 4C4VB 5HAXA 1HF8A 2E9XB 3AEFA 3PGUA 2KDYA 2CE7A 2WMNA 4M1PA 4H63H 3A0HO 4X1KE 3WI4A 1HTJF 5AFUL 1FEWA 3PUAA 3L39A 4AKIA 4FSPA 3AEGA 3HWBA 2R6GF 4EXTA 2KWIB 4JCHA 3EMNX 1VOMA 3FBZA 2XQ6A 4UF0A 2XQ7A 3N9NA 3I9YA 4X62T 3RLFF 2W80C 5LXTE 5TISO 4DIDB 2LOPA 4PW8A 2XAHB 2X9XA 2PJQA 3H3AA 3K3OA 3R6NA 2W66A 2UXXB 2W81C 4UVAB 4F8HA 1UUSA 5CA0E 4DO0A 2LOSA 3SZDA 3IF8B 2JQKA 4YHHT 5JDLA 3ZCIA 3NWIA 2W67A 4K0KT 1D1BA 1OEDE 3WAKA 2R4PA 4AKHA 3PTRB 1ZHCA 1HS7A 2C0SA 3KZIO 2JPFA 1D0XA 3AE4A 3ZC1A 4KHPT 2BKPA 5C8YE 3LK42 5FNVE 2EHOA 4K3CA 5DABA 4N75A 1YKEB 5LHGB 3K3NA 4K0UA 2BBJA 4ILBA 4P0AA 3RQUA 2Y0HA 1YQ4A 2E5VA 4NIQA 2LFUA 3GWHA 4JUYA 4EYYR 5JREA 3U3IA 2PFVA 4N78D 3LK3A 2J62A 1XWMA 3HW9A 1KNPA 4JEHB 4QH4A 2PG8A 4AFKA 2WDVA 2Y6XA 2C5IT 2W0GA 3OTOT 3Q5EA 1YXRA 4ZS3A 4JI2T 4GKJT 4AYMC 4IL9A 3AA7B 1YW0A 1CHUA 3EUHA 2ACZA 2NWBA 3AVRA 4U31A 2M07A 4B3ST 5GTIO 4H9QC 5LGUB 2XQYA 5HEHA 4O4IE 1Z8UA 3P8CD 4EEDA 3TLUA 3PUYF 2QTKA 2YDSA 2BKNA 2NW9A 3SRZA 4C91A 5ABFB 5LHIB 3RKGA 2VL8A 4WNKA 2K24A 3UU5A 2BDEA 2XE2A 5LJMA 2JJ9A 3AEEA 5LBMA 2V8SV 3ZCJA 4O3YA 1IBLT 5GV0A
chains in the Genus database with same CATH topology
5LG4A 1US7B 3TZGA 3MKDA 4AUIA 4CXYA 4ZOLE 2LHNA 3UUMA 2N2NA 3ANWB 2CWYA 3PE0A 2E8IA 1MM4A 3CX8B 1IJ6A 3AA1B 2WAUA 5AFUK 3PUQA 5D5DA 1MNEA 3CQCB 4FRTA 3F2EA 3UFEA 1LVKA 5HXSA 1BT9A 1NWMX 2LE8A 5JDNA 4RJXA 3AAAB 2XASB 3VY9X 4FJOA 4YJ3E 2N2MA 4B6XA 3FBLA 1ZV4X 3PU3A 2XE1A 3O1IA 3POQA 2XE5A 1QJPA 5JRCB 3JC6C 5FY7A 2ERVA 2ES0A 3BK9A 5HYAA 3QRAA 4HKAA 2DI4A 3GMIA 3P7IA 4QXCB 5DJQC 5PRNA 1HXTA 3C5OA 4NUVA 4JLEA 4H9RC 4B61A 4EIWA 5T5FA 3RC8A 2G0UA 2NW7A 1D0ZA 3MJXA 2A72A 4F6RC 1BR0A 2K0LA 3AAEA 3PDYA 1QJ8A 3SOLA 5JQGE 4L5GA 4GOUA 3SY9A 2X66A 1D0YA 2W62A 3Q5XA 3SZVA 2CEAA 4YLHA 2KZ7A 3AA6B 1HCIA 3GA8A 2Y48B 3PURA 5JDGA 3T24A 4ILUA 4MALA 3KV5A 1BR4A 3VKGA 1WYBA 5ETWA 2BZBA 3AA0B 3VHLA 4D5UA 3C64A 1SA0E 1KK7A 3J9X1 5JR9B 4O3XB 2WMOA 1IZNB 3ZMUB 1WRDA 2Q9QD 1AJ3A 1U4QA 2LSGA 2F1TA 2KC0A 5GONE 3ZJ1A 4LSHA 4ISTA 1IJ5A 3CKDA 4H9PC 4O3ZA 2N9DA 4H9OC 4E7SA 3UPGA 2NW8A 3EDVA 3CPZA 3TKLB 2Q9QB 3E08A 4O4HE 4IGUA 4O4UA 5EE2A 4ZI2D 3NSGA 3L3PA 2KZ7B 1G90A 2LM9A 4PFOA 2JMKA 2IW5B 4FZMA 2X67A 2PBIA 5EK3A 4IE6A 4TV8E 5ADXK 1G8XA 3FXDB 2J1DG 3O4XE 2N1GA 3KV4A 1HG5A 4UF0B 1HX8A 3SS1A 4TUYE 3V5SA 4OHFA 3WAJA 3N9QA 3Q2MA 4GYRA 3PUSA 4QX8B 1YS5A 4O2AE 4UV9B 2V1DB 2X68A 4LSFA 4HN9A 5JVDE 2C5KT 2E9XC 3B57A 3ZLIA 2CLYC 3AB3B 4DVDA 4ZI7E 1GFOA 2GE4A 1V9DA 4C69X 3OJAA 4Z3TA 2VKDA 5LJNA 4QKNA 3C4WA 2BVMA 2Q9QA 4XNKA 4ZI2C 2VKHA 2ZM0A 2V7MA 3C98B 2KT9A 5CA1E 1P4TA 3K8PC 3PRNA 2KINB 1THQA 2LEHA 2XAGB 4G63A 2DNXA 2YEVC 3I0OA 3WI3A 2JMHA 2MBGA 4FMSA 3RBHA 2X9WA 4O4LE 3N9LA 5HXHA 4N58A 5LOVE 4I4TE 3UULA 5KMGP 3VZUX 3UUXB 4FOZA 8PRNA 4WBNE 3N9OA 5JDFA 5FYMA 1YKHB 1D1AA 3N5LA 4ZI3C 1T98A 4XAXB 3ZN0B 4RJWA 2XTLA 2LSYA 2E9XA 4L0RA 3HI2A 3JTYA 2HPJA 1Q9GA 3F31A 3K3QC 2M67A 2NOXA 5FXZA 2ZLDA 2X9YA 3KDSE 4EAHA 2LSKA 2RP4A 3PU8A 3ZJ2A 4UEMA 3KFWX 3RYIE 2VKOA 3ZYMA 2OA5A 2XTRA 2KWHA 3ANWA 2H7OA 3RRWA 2M06A 4TZ4C 2QGSA 1UX4A 4IHJE 2W00A 4AI6A 5L3GB 1BH3A 1YD8G 3HR0A 4LSEA 3CWZB 1LKXA 2IC6A 2J4UP 4DMWA 1EZ3A 3AA6A 3AAAA 3OKQA 4TX5A 3RC3A 3CX6B 4AYDC 4P0BA 1E1HB 3RYHE 5A1LA 4KRAA 2SPCA 3A2SX 3AA0A 1HXUA 3KINB 4O4XA 3HL6A 3Q9DA 2YK0A 3BQIA 3H37A 2D0UA 4WBOA 5L3CB 3KV9A 4AYID 2GK9A 2RA1A 1Y64B 4HEAA 3HKBE 3RYCE 4E1TA 3GN5B 1D1CA 1OPFA 3C4ZA 3DP7A 3U78A 3CVRA 2L3LA 1MMNA 3QUJA 2XTQA 2X27X 3ZYLA 4EYUA 5EK2A 2XMXA 1ZEEA 5J2UE 2X9HA 4OK0A 5E0OA 5JDQA 4N59A 4IE4A 3LK2A 2D2SA 2EHOD 3VY8X 5GV0A 4GCQA 5CB4E 2N2LA 4UV8B 4AKRA 4AYNA 4F4BA 2V7JA 3VKHA 3RKOA 4IE0A 3C50A 1HFAA 1KNZA 3QK6A 2MHLA 5JDHA 2BVLA 4GK5E 2J1NA 1QUUA 2MNHA 4GCPA 1ZHXA 4PFPA 5LBQB 5L3FB 3MXZA 4GYSA 4G2AA 4O49A 1MMDA 3LK3B 2CXFA 3F57A 2CCQA 3UUNA 5L3EB 1O3XA 2KXPB 3QRCA 5JR9A 2YPVA 1IZNA 3O1HA 1ZHTA 3UTKA 4GCSA 3LK2B 3MZKB 4QQ1A 3MACA 5LCYA 2YU2A 4CXXA 3NZQA 5ADXL 1MPFA 4FESA 2YNKA 3K19A 1QSDA 5FXWA 4Z8XA 4YHJA 5IHYA 4E1SA 3FHNA 4RLCA 4RLBA 3O0EA 4CI1B 4NUUA 2Z6EA 3SWHA 1GFQA 1MIYA 4ERRA 5IYZE 3AA7A 3KBTA 3HOLA 4AYEC 2XAJB 5L3DB 1BR2A 4FT6A 3FXEB 1UCUA 3KVAA 4I55E 4JEUB 4KP3C 4EOZB 1HG2A 1S94A 1WR6A 4HFVA 4IIJE 5H6RB 3ZN1B 1MMAA 2B1EA 3MA9A 4I43B 2JQQA 2YINA 3BQLA 3BQKA 3SYSA 1Z0PA 2CXDA 2JRKA 2L9QA 3ZEFB 2Y7SA 3N9MA 1OWAA 5EK4A 3HOEA 2I59A 3HKDE 5FXVA 4FZLA 2NTYA 3CX7B 2CLYB 3R84B 4MFRA 2X0LB 4AXPA 5F3JA 3VE2A 4D64A 4DBQA 1GFPA 2L8KA 2WBLA 2MOZA 4H9SE 2VWAA 4FRXA 2VASA 3V5UA 4G76A 2DCFA 1FIOA 3RPUA 2K9AA 2A3DA 3DA4A 1B7TA 3ZMTB 1BR1A 1HXXA 4P09A 4EZ4A 3POUA 4JFBA 4AQFC 2XUEA 2IAKA 3QC9A 3KVBA 4CI2B 2Q9QC 3VZWX 2WSSV 2KLQA 3S4UA 2Y2XA 5M4YA 2OMFA 4EB6E 3UAQA 2LHRA 4KUMB 3GP6A 4V1Av 4D65A 4QWNB 4FZNA 2V7LA 1H6S1 3DJBA 3UT5E 1LRZA 3LFMA 5HAXA 1HF8A 4UXNB 2Y8DA 2E9XB 5LYJE 2YU1A 3I9WA 5H6QB 5FP3A 2WWUA 3AVSA 4X1IE 2EHOB 4CXWA 2VB6A 2KDYA 2KNDA 2CE7A 2WMNA 2D0TA 4X1YE 2O4VA 4M1PA 2UXNB 4H63H 5JDMA 4X1KE 3WI4A 1HTJF 2LSIA 1G73A 4E7ZA 5AFUL 5TAOA 1FEWA 3PUAA 3NRXA 4AKIA 5HXCA 3ZMZB 4FSPA 3HKEE 2EHOC 4IE5A 1MM5A 3EVYA 4HGAA 3HWBA 2X51A 4EXTA 5BMVE 2V26A 2KWIB 4PAGA 4XZCA 3FYXA 4JCHA 4H9NC 3CQXC 3EMNX 5DL7A 4MHCA 3WI5A 1VOMA 2IC9A 3FBZA 2H7VC 3I1AA 1QJ9A 4UF0A 5LP6E 3GN5A 3T0SA 3N9NA 4YJ2E 2XG6A 3I9YA 3T20A 2W80C 3RYFE 5LXTE 4ADZA 1MIVA 1OXZA 1GFMA 2LOPA 4PW8A 2XAHB 1SHZC 4PJJA 2X9XA 1ZHZA 3O9XA 3LK41 2PJQA 3N2KE 3H3AA 5FY1A 3K3OA 1MIWA 4XNLA 4YFSA 3R6NA 4HTEA 2JMMA 2UXXB 1VRBA 2XHEB 4PK6A 4ZHQE 2A2FX 2W81C 5DL8A 5FVNA 4UVAB 4UIGA 5CA0E 2ODUA 4PNIA 4DO0A 4O3WA 4XBFB 2LOSA 2VK9A 3NBXX 4IDZA 3IBPA 2Y0KA 3SYBA 3CQGB 3SZDA 3NZPA 4CQIA 3IF8B 4OYKA 4DMVA 3RH3A 3OBVE 3O1JA 3V8UA 2ZMAA 5L2LA 5JDLA 3ZCIA 2LJLA 2ZM2A 3N2OA 4CI3B 2HPLA 2F1VA 3KVDD 3MK7C 5EZYE 4PUXA 3Q5WA 3AAIA 3LBXB 5KX5E 4U9CA 2P9BA 3A5XA 4PJLA 4C90A 3DA3A 5DL5A 1D1BA 3WAKA 2DWGA 2W63A 2PORA 2DHRA 4AKHA 1CUNA 3PTRB 3AA1A 3PUGA 2D5UA 1ZHYA 3ZPOA 1ZHCA 1HS7A 1MNDA 2C0SA 2C5JA 2HH7A 4FSOA 3KBUA 2K5BB 2MYSA 2JPFA 2LT3A 1D0XA 3PQSA 4QXHB 5LHHB 4KR8A 2ODVA 2Y0LA 5DQVA 4H63V 3RX6A 3ZC1A 3I0QA 4UELA 5L3BB 4DBRA 1UX5A 3RRCA 3T8OA 3LK42 5C8YE 3N9PA 2XE3A 5JRCA 2K4TA 5J1GA 1U5PA 4DNDA 5FXXA 3G7GA 3ESLA 3LBXA 2CXLA 1X79A 3E0ZA 5FNVE 4A56A 5HXEA 5HWYA 5KDMC 2EHOA 4TN7B 1PRNA 4TV9E 3ZYKA 2VKJA 5DABA 3POXA 3ETVA 2DLRA 1GFNA 1YKEB 2XAQB 2QA7A 4BJMA 5LHGB 2WM9A 3K3NA 4BUMX 3ETUA 4OFZA 3AAEB 4K0UA 2KMFA 2MTQA 2DWKA 3IHRA 4BJNA 2NTXA 4P0AA 2Y0HA 1Q9FA 3KV6A 5JH7E 3PORA 5JDPA 4QHOA 3C4XA 2ZM8A 2CWOA 4O8SA 2LFUA 3GWHA 1E54A 4AKRB 4JUYA 4EYYR 4J2CA 4FUVA 2H3RA 3JC6D 4I50E 5JREA 4RL9A 3SY7A 3IEEA 4GF4A 3U3IA 4U74A 2PFVA 4N78D 3DTOA 3OYZA 5FMNA 3VU7H 1BXWA 3ONXA 3VZTX 4BA9A 5G26A 4ZS2A 4CZZB 3UU2A 4IE7A 4L9IA 3LK3A 1ZHWA 5JR9C 4OYJA 3HW9A 1FMWA 2ZFGA 3W15B 2KXPA 4JEHB 2ACXA 5LGNB 4AFKA 2PG8A 3VE1A 4GHBA 7PRNA 2CA5A 3B13A 3N2GE 2Y6XA 3L09A 2C5IT 4GK0E 3CMLA 3ZMVB 2W0GA 4GIWA 5IYUA 5LA6E 4HE8A 2FGQX 4ZS3A 4QXBB 1NAFA 5LGTB 4O4JE 1LVFA 3LJCA 4AYMC 3AA7B 1YW0A 3EUHA 4KMCA 5HWXA 2NWBA 3AVRA 2ODJA 3PQUA 3M65A 4ANJA 2M07A 2CM0A 1MMGA 4H9QC 5LGUB 3NRYA 1ZKEA 2XQYA 4UVCB 4O4IE 1OSMA 2PRNA 4X20E 4MLKA 4KBMB 5DL6A 3P8CD 1ORMA 4QX7B 5J2TE 4PK5A 1PHOA 4BAYB 3FB2A 2LHFA 4MBQA 4ZI3D 4AKMA 2NP9A 5FY0A 4AKGA 3OYXA 1H7CA 2QTKA 5F8PA 2NW9A 4G75A 6PRNA 3SRZA 4U72A 4C91A 3E22E 5LHIB 4LSIA 2CMRA 2VL8A 2V7IA 5DQWA 2W61A 4WNKA 4AQFA 4EZHA 2E9XD 1IAPA 3D0TA 4AQGA 3ZC0A 2K48A 2V7KA 4KR4A 3LG7A 2K24A 2LSJA 2ZLYA 3HKCE 4PK4A 1WLXA 2BDEA 4PJMA 5LNKA 3ZMSB 2XE2A 3HA4A 5LJMA 2JJ9A 4UVBB 4O2BE 3J7Yq 4AZLA 4WW0A 4FI5A 4ISSA 1S35A 4PJNA 5LBMA 1WYCA 1FMVA 2XAFB 3EDUA 3ZCJA 2FGRA 3C51A 4AKLA 4O3YA 5HXRA 4ASKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR A;  1IZN B;  3AA6 A;  4AKR B;  3AA7 A;  3AAA A;  3AA7 B;  3LK4 2;  3AA1 B;  5AFU K;  3AA0 A;  5AFU L;  3AAE A;  3LK4 1;  3LK3 B;  3LK3 A;  3AAA B;  2KXP B;  2KZ7 B;  2KXP A;  2KZ7 A;  1IZN A;  3AA1 A;  3AA6 B;  3LK2 B;  3LK2 A;  3AAE B;  5ADX L;  5ADX K;  3AA0 B; 
#chains in the Genus database with same CATH topology
 3FZK B;  3UUM A;  2N2N A;  2CWY A;  3NJT A;  1IJ6 A;  3AE5 A;  5AFU K;  3UFE A;  1NWM X;  4YTM A;  2XY8 B;  3VY9 X;  4FJO A;  2F1C X;  2N2M A;  3FBL A;  4JI5 T;  2XE1 A;  3POQ A;  2XE5 A;  5KAF O;  3LDQ B;  1I94 T;  5FY7 A;  2XZE A;  3BK9 A;  2DI4 A;  5PRN A;  3C5O A;  2QYW A;  2HHH T;  5T5F A;  3RC8 A;  2G0U A;  4KX6 A;  3JAE A;  1J5E T;  2A72 A;  3AEB A;  4X5T A;  4HWH A;  2K0L A;  4GOU A;  2IDO B;  4YLH A;  2KZ7 A;  1HCI A;  3GA8 A;  3PUR A;  2WS3 A;  4U7Y A;  5ETW A;  4D5U A;  1KK7 A;  5JR9 B;  4O3X B;  2Q9Q D;  1U4Q A;  4JI1 T;  1IJ5 A;  3CKD A;  3A7M A;  3UPG A;  5EE2 A;  4HFB A;  3L3P A;  2KZ7 B;  5AQN B;  5FL0 A;  5FVL A;  4FZM A;  5E79 O;  4IE6 A;  3FXD B;  2N1G A;  3KV4 A;  3BS0 A;  1YS5 A;  4LSF A;  3ZLI A;  4ZI7 E;  2CLY C;  1T7S A;  1V9D A;  4ZI2 C;  1P4T A;  3P4Q A;  3K8P C;  3PJA J;  2V5C A;  3WI3 A;  3RBH A;  3EHZ A;  1T16 A;  1D1A A;  1T98 A;  3T1Y T;  1Q9G A;  4P1N A;  2YN6 A;  2YDQ A;  5F5W A;  2NOX A;  3KDS E;  4EAH A;  3UU3 A;  2LSK A;  2RP4 A;  3PU8 A;  3ZJ2 A;  3ZYM A;  2VKO A;  4DV7 T;  2XTR A;  2H7O A;  2YOE A;  3RRW A;  2ZM6 T;  2M06 A;  4TZ4 C;  1UX4 A;  1BH3 A;  3HR0 A;  4LSE A;  3CWZ B;  2M6I A;  4X66 T;  4YSX A;  4YXD A;  1J1J A;  2CBI A;  5ABE A;  4KRA A;  2SPC A;  3AA0 A;  2YK0 A;  3BQI A;  2D0U A;  3NVO A;  4WBO A;  4E1T A;  4HEA A;  3ZSS A;  3CVR A;  1ZEE A;  5AQJ B;  5E0O A;  5JDQ A;  4IE4 A;  2D2S A;  2EHO D;  2V7J A;  4Z90 A;  2MHL A;  5JDH A;  1ZHX A;  4HFI A;  4WZX A;  4G2A A;  2XQ5 A;  4HWD A;  2CXF A;  5AQG B;  2KXP B;  3PUV F;  5JR9 A;  2YPV A;  3O1H A;  5G38 A;  3UTK A;  4FES A;  4HWC A;  5G39 A;  4Z8X A;  5AQQ B;  5ABH A;  4RLC A;  3O0E A;  4PJ0 O;  4CI1 B;  2Z6E A;  1GFQ A;  3HOL A;  3KBT A;  5L3D B;  4FT6 A;  1BR2 A;  3AE6 A;  4XNL A;  4JEU B;  4I55 E;  4EOZ B;  3CIR A;  5H6R B;  1HG2 A;  1XMO T;  3MA9 A;  1WCR A;  3BQL A;  5H2F O;  3BQK A;  2Y7S A;  5EK4 A;  2IUB A;  4FZL A;  2X0L B;  4ILC A;  2WWV A;  2MOZ A;  3OPC A;  4H9S E;  2VWA A;  2DCF A;  2K9A A;  1B7T A;  3ZMT B;  5G3A A;  3POU A;  4JFB A;  2IAK A;  4EB6 E;  1H6S 1;  3DJB A;  1LRZ A;  1XDO A;  5AQF B;  5LYJ E;  2YU1 A;  2WWU A;  2UXB T;  2VB6 A;  2J47 A;  4X1Y E;  2O4V A;  5JDM A;  5TAO A;  5FKY A;  5HEO A;  3ZMZ B;  4IE5 A;  3AE1 A;  5BMV E;  2V26 A;  3AEC A;  1T72 A;  4H9N C;  3GN5 A;  3T0S A;  2X0Y A;  5L47 A;  2IIU A;  4B3R T;  1OXZ A;  3TLS A;  2UUA T;  3O9X A;  5HEJ A;  3G06 A;  4HTE A;  1OED A;  4PK6 A;  3ONJ A;  4UIG A;  2BS3 A;  3NBX X;  3SYB A;  3IBP A;  3NZP A;  3OBV E;  4U33 A;  3O1J A;  3V8U A;  5L2L A;  1VCS A;  2LJL A;  2HPL A;  4DV6 T;  4JYA T;  3MK7 C;  3LBX B;  4N74 A;  5KX5 E;  4U9C A;  4UB8 O;  2P9B A;  4LFB T;  1R8I A;  2W63 A;  1CUN A;  2D5U A;  4FSO A;  2VVS A;  5LHH B;  2ODV A;  2BS2 A;  2AE9 A;  3RX6 A;  3VRB A;  4UEL A;  1UX5 A;  3T8O A;  5J1G A;  4DND A;  3ESL A;  3LBX A;  5KDM C;  4A56 A;  5HXE A;  3FZH B;  2LLY A;  4TN7 B;  3RQW A;  3ETV A;  2VL0 A;  2XAQ B;  5AQT B;  4OFZ A;  2YKS A;  3AAE B;  2KMF A;  3IHR A;  2DWK A;  2UUB T;  5JH7 E;  4O8S A;  1E54 A;  5AQR B;  4AKR B;  2V5D A;  3JC6 D;  3IEE A;  2W4X A;  3ONX A;  4BA9 A;  4WYV A;  1FMW A;  3M3Z B;  2K3W A;  3LSV A;  3VE1 A;  4GK0 E;  5LA6 E;  1W9R A;  1UUR A;  1LVF A;  3UQ7 A;  4KMC A;  3PQU A;  2CM0 A;  4A97 A;  2BG9 A;  3PJA A;  1NEN A;  1XMQ T;  1UGO A;  2LHF A;  4MBQ A;  2LRL A;  4AKG A;  1H7C A;  5F8P A;  3E22 E;  2V7I A;  4AQG A;  2WVP A;  2V7K A;  4KR4 A;  3LG7 A;  2X9K A;  2ZLY A;  1DU2 A;  5LNK A;  4O2B E;  4WW0 A;  4QH1 A;  4FI5 A;  4PJN A;  1FMV A;  2XAF B;  3EDU A;  2IHR 1;  2BS4 A;  3C51 A;  4AKL A;  5HXR A;  4EGW A;  3TZG A;  3QNU A;  1MM4 A;  2E8I A;  3PUQ A;  1MNE A;  4FRT A;  4RJX A;  2JIW A;  1OED C;  3RIF A;  2XAS B;  3P4S A;  4YJ3 E;  4B6X A;  4IDN A;  2R8A A;  4EEB A;  3JC6 C;  3QB5 A;  3P7I A;  4NUV A;  2KSR A;  3VR9 A;  2NW7 A;  2H89 A;  1D0Z A;  1WFD A;  5BR8 T;  3SFD A;  4L5G A;  3A8Y C;  2X66 A;  4TWD A;  3P4R A;  3AA6 B;  3P4W A;  5JDG A;  4ILU A;  2FJB A;  3AEA A;  1SA0 E;  2IML A;  1WRD A;  5GON E;  4IST A;  2CRB A;  4DR7 T;  4E7S A;  3RIA A;  3EDV A;  3JAD A;  3NSG A;  1G90 A;  2LM9 A;  2JMK A;  2PBI A;  5EK3 A;  2R88 A;  4QH5 A;  3V5S A;  4TUY E;  4OHF A;  2X68 A;  5JVD E;  1GFO A;  2C5K T;  2GE4 A;  3AB3 B;  4UB6 O;  2A9U A;  4Z3T A;  2VKD A;  5LJN A;  1IBK T;  2BVM A;  4XNK A;  3UU4 A;  4ILA A;  2BG9 C;  2NR4 A;  2KT9 A;  3PRN A;  2CPT A;  1THQ A;  2LEH A;  4G63 A;  4JI8 T;  2XM2 A;  4JBW F;  4KHZ F;  4IDO A;  4N58 A;  5LOV E;  4I4T E;  3VZU X;  4FOZ A;  4JI7 T;  5JDF A;  2D9D A;  4ZI3 C;  2WP9 A;  2XQ4 A;  2XTL A;  3JTY A;  4IL6 O;  2HPJ A;  5FXZ A;  2DL1 A;  4UEM A;  3JCU O;  2VVN A;  4IHJ E;  4DMW A;  3AA6 A;  3OKQ A;  4P0B A;  1E1H B;  3RIU A;  3RYH E;  5A1L A;  4O4X A;  3KIN B;  3HL6 A;  1M62 A;  4AYI D;  5L3C B;  5HCM A;  3KV9 A;  2GK9 A;  3RYC E;  1D1C A;  1OPF A;  3C4Z A;  3DP7 A;  3U78 A;  1KEY A;  2L3L A;  1MMN A;  3QUJ A;  2R4N A;  2XTQ A;  2X27 X;  2XMX A;  4OK0 A;  3TLT A;  2CBJ A;  5AQL B;  4YSY A;  4CN6 A;  2B76 A;  5CB4 E;  2N2L A;  3AE8 A;  5ABF A;  1KNZ A;  4PFP A;  3MXZ A;  4GYS A;  4O49 A;  1MMD A;  2CCQ A;  3UUN A;  5L3E B;  1ZHT A;  1FJG T;  2YU2 A;  4CXX A;  3NZQ A;  2YNK A;  5FXW A;  5IHY A;  4PR7 A;  5IYZ E;  3AA7 A;  4NPP A;  3PUZ F;  4AYE C;  3KVA A;  2J4G A;  4IIJ E;  5LMN T;  3SYS A;  3ZEF B;  1OWA A;  3HKD E;  3CX7 B;  3R84 B;  3VE2 A;  1HNX T;  2LKG A;  2VAS A;  4G76 A;  1FIO A;  3RPU A;  2A3D A;  3DA4 A;  1BR1 A;  1HXX A;  4LF5 T;  4EZ4 A;  2KLQ A;  3EAB A;  2Y2X A;  5M4Y A;  2VQF T;  3UAQ A;  3GP6 A;  4D65 A;  2V7L A;  3UT5 E;  2WJQ A;  2UXD T;  2Y8D A;  3I9W A;  5AQM B;  3AVS A;  3ZT7 A;  4CXW A;  2WU2 A;  2KND A;  1Y01 A;  2D0T A;  5LG3 A;  4JI6 T;  2LSI A;  4JI3 T;  4DR6 T;  1G73 A;  2UU9 T;  3NRX A;  1MM5 A;  3FYX A;  5LMU T;  4K3B A;  3WI5 A;  3K1S A;  3I1A A;  4TNW A;  2XG6 A;  3T20 A;  1KFY A;  1GFM A;  1MIW A;  3P50 A;  5GTH O;  2JMM A;  3B5M A;  4ZHQ E;  2FBW A;  5FVN A;  2ODU A;  4PNI A;  4O3W A;  4XBF B;  2VK9 A;  4CN4 A;  1L0V A;  2WU5 A;  3NKZ A;  2ZM2 A;  4CI3 B;  2F1V A;  4PUX A;  3Q5W A;  3AAI A;  5DL5 A;  3A5X A;  2DWG A;  2DHR A;  1M7K A;  5AQS B;  3ZPO A;  5CJ5 A;  4JV5 T;  1MND A;  2C5J A;  2HH7 A;  2R4L A;  2MYS A;  3AXJ A;  2LT3 A;  3PQS A;  4QXH B;  3VRA A;  3T1H T;  4KR8 A;  2CHO A;  5DQV A;  4H63 V;  5L3B B;  4I0U A;  4DBR A;  2XE3 A;  4U2Z A;  3N9P A;  2FJD A;  3G7G A;  2CXL A;  1X79 A;  4DR2 T;  1PRN A;  3L8R A;  4TV9 E;  3POX A;  2QA7 A;  4BJM A;  2WM9 A;  2MTQ A;  2V6Y B;  4BJN A;  2NTX A;  3KV6 A;  4ZXL A;  5JDP A;  2X0H A;  5JTG A;  2XSA A;  4J2C A;  1E7P A;  4RL9 A;  3SY7 A;  5FMN A;  1BXW A;  5G26 A;  4ZS2 A;  3UU2 A;  3BRZ A;  4IE7 A;  4L9I A;  2F4V T;  2XQ9 A;  2ZFG A;  3W15 B;  2ACX A;  5LGN B;  4GHB A;  7PRN A;  3N2G E;  3L09 A;  4Z91 A;  3ZMV B;  3CML A;  4GIW A;  4IT4 A;  4Q25 A;  1NAF A;  4O4J E;  3M65 A;  4ANJ A;  4IL4 A;  1MMG A;  3AE2 A;  3FZF B;  3NRY A;  4CN1 A;  4UVC B;  3P4P A;  4X20 E;  1HR0 T;  4KBM B;  2XQ3 A;  5DL6 A;  1ORM A;  4GKK T;  5J2T E;  4PK5 A;  1XNQ T;  4DV0 T;  3FB2 A;  5FY0 A;  4G75 A;  3OYX A;  3IA3 A;  6PRN A;  4U72 A;  1N32 T;  4LSI A;  2CMR A;  5DQW A;  4AQF A;  4EZH A;  1IAP A;  3D0T A;  3ZC0 A;  3AXJ B;  4B3T T;  2K48 A;  5HEU A;  4PK4 A;  1WLX A;  4YTN A;  3HA4 A;  4UVB B;  3J7Y q;  4ZEY A;  4X65 T;  1I6Z A;  4ISS A;  4C4V A;  1WYC A;  2LKH A;  2VQE T;  4ASK A;  5LG4 A;  4CXY A;  3PUW F;  2LHN A;  1IBM T;  3CX8 B;  4B3M T;  5B5E O;  2WDR A;  4IRE A;  1LVK A;  5HXS A;  4LF8 T;  2IWV A;  3AAA B;  4C00 A;  2LM2 A;  1ZV4 X;  2CHN A;  3PU3 A;  3O1I A;  1QJP A;  3ZKR A;  2RPA A;  2ERV A;  5HYA A;  4HKA A;  3GMI A;  4DV2 T;  4JLE A;  4B61 A;  4EIW A;  4HFE A;  3MJX A;  4IDQ A;  3AAE A;  4HFC A;  2AXT O;  2WDQ A;  5JQG E;  3Q5X A;  3SZV A;  2MAW A;  3VKG A;  4AIU A;  3VHL A;  1W09 A;  3J9X 1;  2F1T A;  1AJ3 A;  2LSG A;  3PGS A;  4H9P C;  2N9D A;  4H9O C;  4DR4 T;  2NW8 A;  3CPZ A;  3TKL B;  5KAI O;  3E08 A;  2WCA A;  4IGU A;  4O4H E;  3UU6 A;  4ZZC A;  4U3C A;  2I6H A;  2IW5 B;  2X67 A;  1XZY A;  3O4X E;  2WQY A;  2OLT A;  4UF0 B;  1HX8 A;  3Q2M A;  3PUS A;  4QX8 B;  4O2A E;  4UV9 B;  2E9X C;  3B57 A;  3OJA A;  2Q9Q A;  3AE3 A;  2VKH A;  1E2A A;  2ZM0 A;  2V7M A;  2KIN B;  2DNX A;  2JMH A;  4X64 T;  2MBG A;  3N9L A;  5AQH B;  3RHW A;  3UUL A;  5KMG P;  1N34 T;  8PRN A;  5FVK A;  5FYM A;  2LRK A;  1N36 T;  4LF9 T;  2WY2 A;  2E9X A;  4L0R A;  3TLW A;  5IWA T;  3K3Q C;  2M67 A;  3KFW X;  2OA5 A;  2KWH A;  2QGS A;  2W00 A;  4AI6 A;  5L3G B;  1YD8 G;  1T1L A;  5CGM A;  3AAA A;  4TX5 A;  3RC3 A;  3CX6 B;  4AYD C;  2FJE A;  3ZT5 A;  4TWH A;  3A2S X;  3Q9D A;  3H37 A;  3RI5 A;  2VUR A;  2BG9 B;  3UUB A;  3ZYL A;  5J2U E;  4N59 A;  2XPK A;  2V6X A;  1JNZ A;  4UV8 B;  3ZST A;  4F4B A;  3VKH A;  3C50 A;  4GCP A;  4GK5 E;  5C2T A;  2J1N A;  5AQK B;  3ZT6 A;  3LK3 B;  2I0M A;  1O3X A;  1GQE A;  3LK2 B;  3MZK B;  4QQ1 A;  5ADX L;  1MPF A;  2WZH A;  3K19 A;  4E1S A;  4YHJ A;  3FHN A;  3PGR A;  4LMK A;  2XSB A;  3SWH A;  4ERR A;  2IWW A;  3Q5D A;  2XAJ B;  4DV3 T;  1ZP0 A;  5EK2 A;  4KP3 C;  3ZN1 B;  1MMA A;  2B1E A;  4I43 B;  2JQQ A;  2JRK A;  5L4E A;  3QOF A;  2I59 A;  2CLY B;  4AXP A;  5F3J A;  4DBQ A;  3DZM A;  2L8K A;  3V5U A;  5HCJ A;  5J0Z A;  1SE7 A;  2XUE A;  5AQU B;  4CI2 B;  2YDR A;  3VZW X;  2WSS V;  3S4U A;  2LHR A;  4KUM B;  4V1A v;  4QWN B;  4FZN A;  3LFM A;  4UXN B;  2WZI A;  5H6Q B;  5FP3 A;  4X1I E;  4NXM T;  2EHO B;  3VR8 A;  2UXN B;  4HFD A;  4E7Z A;  2FJA A;  5HXC A;  3HKE E;  2EHO C;  3EVY A;  4HGA A;  2X51 A;  4DR3 T;  4PAG A;  4XZC A;  3CQX C;  5DL7 A;  4MHC A;  2IC9 A;  5AQP B;  2H7V C;  4KI0 F;  1QJ9 A;  5LP6 E;  3JAF A;  3OVU A;  2HN2 A;  4YJ2 E;  3DWO X;  5L4H A;  3RYF E;  4ADZ A;  1MIV A;  1SHZ C;  4PJJ A;  4ZZB A;  4A98 A;  1ZHZ A;  3LK4 1;  3N2K E;  4UR9 A;  5FY1 A;  3UQ4 A;  4YFS A;  1VRB A;  2XHE B;  5DL8 A;  2A2F X;  2M6B A;  5C3J A;  4IDZ A;  2Y0K A;  3CQG B;  2BG9 E;  4CQI A;  4OYK A;  4DMV A;  3RH3 A;  2ZMA A;  3N2O A;  3KVD D;  5EZY E;  4C90 A;  4PJL A;  3DA3 A;  4LF7 T;  2BKO A;  5HEG A;  2UXC T;  2POR A;  3AA1 A;  3PUG A;  5AQI B;  1ZHY A;  2R4O A;  1HNW T;  2V6Y A;  2K5B B;  3KBU A;  2XJ7 A;  2Y0L A;  3I0Q A;  3RRC A;  5JRC A;  2K4T A;  1U5P A;  5FXX A;  3E0Z A;  5HWY A;  4FQE A;  3ZYK A;  4HWF A;  2VKJ A;  5AQO B;  4YTP A;  2DLR A;  1GFN A;  1NEK A;  4BUM X;  3ETU A;  4A5X A;  1Q9F A;  3POR A;  4QHO A;  4JI4 T;  3C4X A;  2ZM8 A;  2CWO A;  4FUV A;  2H3R A;  4I50 E;  4GF4 A;  4U74 A;  3DTO A;  3OYZ A;  2JQ9 A;  3VU7 H;  3VZT X;  4CZZ B;  1ZHW A;  5JR9 C;  4OYJ A;  1HNZ T;  2KXP A;  2H88 A;  2CA5 A;  3BRY A;  3B13 A;  5IYU A;  2FGQ X;  4HE8 A;  2XM1 A;  4QXB B;  1SUM B;  4HWI B;  2JQY A;  5LGT B;  4NXN T;  3LJC A;  2ODJ A;  5HWX A;  3UFG A;  4LF6 T;  3RIU C;  5CFB A;  2XQ8 A;  5B66 O;  1KNR A;  1ZKE A;  1OSM A;  2PRN A;  4MLK A;  4QX7 B;  4LMJ A;  2E2A A;  1PHO A;  4BAY B;  4ZI3 D;  4AKM A;  2NP9 A;  2BBH A;  3PV0 F;  3UU8 A;  3AE9 A;  2W61 A;  2E9X D;  2LSJ A;  3HKC E;  4PJM A;  3ZMS B;  4AIS A;  3A0B O;  3PUX F;  4TWF A;  4DV4 T;  4AZL A;  4DUZ T;  1S35 A;  5IUX A;  1W0A A;  2FGR A;  2PTF A;  5FL1 A;  3EI0 A;  1US7 B;  3MKD A;  4AUI A;  4ZOL E;  3ANW B;  3PE0 A;  3AA1 B;  2WAU A;  4LFC T;  5D5D A;  3CQC B;  3F2E A;  1BT9 A;  1VCT A;  2QRX A;  2LE8 A;  5JDN A;  4IDP A;  4OX9 T;  3AE7 A;  3FZL B;  4AQY T;  5JRC B;  4YSZ A;  2ES0 A;  3QRA A;  5DJQ C;  4QXC B;  1HXT A;  4H9R C;  4F6R C;  1BR0 A;  3PDY A;  1QJ8 A;  3SOL A;  3SY9 A;  5KXJ A;  4DV1 T;  1D0Y A;  2W62 A;  2CEA A;  1KF6 A;  2QVA A;  2Y48 B;  3T24 A;  4MAL A;  3KV5 A;  4JI0 T;  1BR4 A;  1WYB A;  2BZB A;  3AA0 B;  3C64 A;  3FZM B;  2WMO A;  1IZN B;  3ZMU B;  2KC0 A;  2WJR A;  3ZJ1 A;  4LSH A;  3WU2 O;  3JCF A;  4O3Z A;  3ABV A;  2Q9Q B;  4O4U A;  4ZI2 D;  4PFO A;  1S5L O;  2FUP A;  4TV8 E;  5ADX K;  1G8X A;  4LFA T;  2J1D G;  1ZOY A;  1HG5 A;  3SS1 A;  3WAJ A;  3N9Q A;  4GYR A;  2MPK A;  2V1D B;  4HN9 A;  2HN1 A;  4DVD A;  4CTD A;  2W2U A;  4HFH A;  4C69 X;  4QKN A;  3C4W A;  3AED A;  3C98 B;  1OED B;  5CA1 E;  4EV6 A;  3SFE A;  2XAG B;  2YEV C;  3I0O A;  2AXD S;  4FMS A;  2X9W A;  4O4L E;  4DR1 T;  5HXH A;  3UUX B;  4WBN E;  3N9O A;  1YKH B;  3N5L A;  3ZN0 B;  4XAX B;  4RJW A;  2LSY A;  2UUC T;  3HI2 A;  1XNR T;  3F31 A;  1W0B A;  2ZLD A;  2X9Y A;  3RYI E;  5AQV B;  3ANW A;  2WB5 A;  1WR0 A;  4LF4 T;  1LKX A;  2IC6 A;  2J4U P;  1EZ3 A;  4U2Y A;  1QLB A;  4DV5 T;  3ONL C;  1HXU A;  2RA1 A;  1Y64 B;  3HKB E;  3GN5 B;  1YQ3 A;  3QB5 K;  1XDP A;  4EYU A;  2X9H A;  3LK2 A;  3VY8 X;  3H3M A;  4GCQ A;  4AKR A;  4AYN A;  4DUY T;  3RKO A;  4YY3 T;  4IE0 A;  1HFA A;  3QK6 A;  2BVL A;  1QUU A;  2MNH A;  5LBQ B;  2XQA A;  5L3F B;  3F57 A;  1JNR A;  3QRC A;  3X1D A;  4COF A;  1IZN A;  3EAM A;  2OV9 A;  2E5L T;  4GCS A;  1HX1 B;  3MAC A;  5LCY A;  3DWN A;  4U7I A;  1QSD A;  1T8B A;  4RLB A;  4NUU A;  1MIY A;  3FXE B;  1UCU A;  1S94 A;  1WR6 A;  4HFV A;  2YIN A;  1Z0P A;  2CXD A;  2L9Q A;  3N9M A;  3HOE A;  4DR5 T;  5FXV A;  2NTY A;  2R89 A;  4MFR A;  4YT0 A;  1J5W A;  4D64 A;  1GFP A;  3RGL A;  2WBL A;  1X9B A;  4TNV A;  5LB7 B;  4FRX A;  3TLV A;  1N33 T;  2JQH A;  3PF1 A;  4P09 A;  3CK6 A;  3RF1 A;  4AQF C;  1UK5 A;  3QC9 A;  4LML A;  3KVB A;  2Q9Q C;  5ABG A;  2OMF A;  4C4V B;  5HAX A;  1HF8 A;  2E9X B;  3AEF A;  3PGU A;  2KDY A;  2CE7 A;  2WMN A;  4M1P A;  4H63 H;  3A0H O;  4X1K E;  3WI4 A;  1HTJ F;  5AFU L;  1FEW A;  3PUA A;  3L39 A;  4AKI A;  4FSP A;  3AEG A;  3HWB A;  2R6G F;  4EXT A;  2KWI B;  4JCH A;  3EMN X;  1VOM A;  3FBZ A;  2XQ6 A;  4UF0 A;  2XQ7 A;  3N9N A;  3I9Y A;  4X62 T;  3RLF F;  2W80 C;  5LXT E;  5TIS O;  4DID B;  2LOP A;  4PW8 A;  2XAH B;  2X9X A;  2PJQ A;  3H3A A;  3K3O A;  3R6N A;  2W66 A;  2UXX B;  2W81 C;  4UVA B;  4F8H A;  1UUS A;  5CA0 E;  4DO0 A;  2LOS A;  3SZD A;  3IF8 B;  2JQK A;  4YHH T;  5JDL A;  3ZCI A;  3NWI A;  2W67 A;  4K0K T;  1D1B A;  1OED E;  3WAK A;  2R4P A;  4AKH A;  3PTR B;  1ZHC A;  1HS7 A;  2C0S A;  3KZI O;  2JPF A;  1D0X A;  3AE4 A;  3ZC1 A;  4KHP T;  2BKP A;  5C8Y E;  3LK4 2;  5FNV E;  2EHO A;  4K3C A;  5DAB A;  4N75 A;  1YKE B;  5LHG B;  3K3N A;  4K0U A;  2BBJ A;  4ILB A;  4P0A A;  3RQU A;  2Y0H A;  1YQ4 A;  2E5V A;  4NIQ A;  2LFU A;  3GWH A;  4JUY A;  4EYY R;  5JRE A;  3U3I A;  2PFV A;  4N78 D;  3LK3 A;  2J62 A;  1XWM A;  3HW9 A;  1KNP A;  4JEH B;  4QH4 A;  2PG8 A;  4AFK A;  2WDV A;  2Y6X A;  2C5I T;  2W0G A;  3OTO T;  3Q5E A;  1YXR A;  4ZS3 A;  4JI2 T;  4GKJ T;  4AYM C;  4IL9 A;  3AA7 B;  1YW0 A;  1CHU A;  3EUH A;  2ACZ A;  2NWB A;  3AVR A;  4U31 A;  2M07 A;  4B3S T;  5GTI O;  4H9Q C;  5LGU B;  2XQY A;  5HEH A;  4O4I E;  1Z8U A;  3P8C D;  4EED A;  3TLU A;  3PUY F;  2QTK A;  2YDS A;  2BKN A;  2NW9 A;  3SRZ A;  4C91 A;  5ABF B;  5LHI B;  3RKG A;  2VL8 A;  4WNK A;  2K24 A;  3UU5 A;  2BDE A;  2XE2 A;  5LJM A;  2JJ9 A;  3AEE A;  5LBM A;  2V8S V;  3ZCJ A;  4O3Y A;  1IBL T;  5GV0 A; 
#chains in the Genus database with same CATH homology
 5LG4 A;  1US7 B;  3TZG A;  3MKD A;  4AUI A;  4CXY A;  4ZOL E;  2LHN A;  3UUM A;  2N2N A;  3ANW B;  2CWY A;  3PE0 A;  2E8I A;  1MM4 A;  3CX8 B;  1IJ6 A;  3AA1 B;  2WAU A;  5AFU K;  3PUQ A;  5D5D A;  1MNE A;  3CQC B;  4FRT A;  3F2E A;  3UFE A;  1LVK A;  5HXS A;  1BT9 A;  1NWM X;  2LE8 A;  5JDN A;  4RJX A;  3AAA B;  2XAS B;  3VY9 X;  4FJO A;  4YJ3 E;  2N2M A;  4B6X A;  3FBL A;  1ZV4 X;  3PU3 A;  2XE1 A;  3O1I A;  3POQ A;  2XE5 A;  1QJP A;  5JRC B;  3JC6 C;  5FY7 A;  2ERV A;  2ES0 A;  3BK9 A;  5HYA A;  3QRA A;  4HKA A;  2DI4 A;  3GMI A;  3P7I A;  4QXC B;  5DJQ C;  5PRN A;  1HXT A;  3C5O A;  4NUV A;  4JLE A;  4H9R C;  4B61 A;  4EIW A;  5T5F A;  3RC8 A;  2G0U A;  2NW7 A;  1D0Z A;  3MJX A;  2A72 A;  4F6R C;  1BR0 A;  2K0L A;  3AAE A;  3PDY A;  1QJ8 A;  3SOL A;  5JQG E;  4L5G A;  4GOU A;  3SY9 A;  2X66 A;  1D0Y A;  2W62 A;  3Q5X A;  3SZV A;  2CEA A;  4YLH A;  2KZ7 A;  3AA6 B;  1HCI A;  3GA8 A;  2Y48 B;  3PUR A;  5JDG A;  3T24 A;  4ILU A;  4MAL A;  3KV5 A;  1BR4 A;  3VKG A;  1WYB A;  5ETW A;  2BZB A;  3AA0 B;  3VHL A;  4D5U A;  3C64 A;  1SA0 E;  1KK7 A;  3J9X 1;  5JR9 B;  4O3X B;  2WMO A;  1IZN B;  3ZMU B;  1WRD A;  2Q9Q D;  1AJ3 A;  1U4Q A;  2LSG A;  2F1T A;  2KC0 A;  5GON E;  3ZJ1 A;  4LSH A;  4IST A;  1IJ5 A;  3CKD A;  4H9P C;  4O3Z A;  2N9D A;  4H9O C;  4E7S A;  3UPG A;  2NW8 A;  3EDV A;  3CPZ A;  3TKL B;  2Q9Q B;  3E08 A;  4O4H E;  4IGU A;  4O4U A;  5EE2 A;  4ZI2 D;  3NSG A;  3L3P A;  2KZ7 B;  1G90 A;  2LM9 A;  4PFO A;  2JMK A;  2IW5 B;  4FZM A;  2X67 A;  2PBI A;  5EK3 A;  4IE6 A;  4TV8 E;  5ADX K;  1G8X A;  3FXD B;  2J1D G;  3O4X E;  2N1G A;  3KV4 A;  1HG5 A;  4UF0 B;  1HX8 A;  3SS1 A;  4TUY E;  3V5S A;  4OHF A;  3WAJ A;  3N9Q A;  3Q2M A;  4GYR A;  3PUS A;  4QX8 B;  1YS5 A;  4O2A E;  4UV9 B;  2V1D B;  2X68 A;  4LSF A;  4HN9 A;  5JVD E;  2C5K T;  2E9X C;  3B57 A;  3ZLI A;  2CLY C;  3AB3 B;  4DVD A;  4ZI7 E;  1GFO A;  2GE4 A;  1V9D A;  4C69 X;  3OJA A;  4Z3T A;  2VKD A;  5LJN A;  4QKN A;  3C4W A;  2BVM A;  2Q9Q A;  4XNK A;  4ZI2 C;  2VKH A;  2ZM0 A;  2V7M A;  3C98 B;  2KT9 A;  5CA1 E;  1P4T A;  3K8P C;  3PRN A;  2KIN B;  1THQ A;  2LEH A;  2XAG B;  4G63 A;  2DNX A;  2YEV C;  3I0O A;  3WI3 A;  2JMH A;  2MBG A;  4FMS A;  3RBH A;  2X9W A;  4O4L E;  3N9L A;  5HXH A;  4N58 A;  5LOV E;  4I4T E;  3UUL A;  5KMG P;  3VZU X;  3UUX B;  4FOZ A;  8PRN A;  4WBN E;  3N9O A;  5JDF A;  5FYM A;  1YKH B;  1D1A A;  3N5L A;  4ZI3 C;  1T98 A;  4XAX B;  3ZN0 B;  4RJW A;  2XTL A;  2LSY A;  2E9X A;  4L0R A;  3HI2 A;  3JTY A;  2HPJ A;  1Q9G A;  3F31 A;  3K3Q C;  2M67 A;  2NOX A;  5FXZ A;  2ZLD A;  2X9Y A;  3KDS E;  4EAH A;  2LSK A;  2RP4 A;  3PU8 A;  3ZJ2 A;  4UEM A;  3KFW X;  3RYI E;  2VKO A;  3ZYM A;  2OA5 A;  2XTR A;  2KWH A;  3ANW A;  2H7O A;  3RRW A;  2M06 A;  4TZ4 C;  2QGS A;  1UX4 A;  4IHJ E;  2W00 A;  4AI6 A;  5L3G B;  1BH3 A;  1YD8 G;  3HR0 A;  4LSE A;  3CWZ B;  1LKX A;  2IC6 A;  2J4U P;  4DMW A;  1EZ3 A;  3AA6 A;  3AAA A;  3OKQ A;  4TX5 A;  3RC3 A;  3CX6 B;  4AYD C;  4P0B A;  1E1H B;  3RYH E;  5A1L A;  4KRA A;  2SPC A;  3A2S X;  3AA0 A;  1HXU A;  3KIN B;  4O4X A;  3HL6 A;  3Q9D A;  2YK0 A;  3BQI A;  3H37 A;  2D0U A;  4WBO A;  5L3C B;  3KV9 A;  4AYI D;  2GK9 A;  2RA1 A;  1Y64 B;  4HEA A;  3HKB E;  3RYC E;  4E1T A;  3GN5 B;  1D1C A;  1OPF A;  3C4Z A;  3DP7 A;  3U78 A;  3CVR A;  2L3L A;  1MMN A;  3QUJ A;  2XTQ A;  2X27 X;  3ZYL A;  4EYU A;  5EK2 A;  2XMX A;  1ZEE A;  5J2U E;  2X9H A;  4OK0 A;  5E0O A;  5JDQ A;  4N59 A;  4IE4 A;  3LK2 A;  2D2S A;  2EHO D;  3VY8 X;  5GV0 A;  4GCQ A;  5CB4 E;  2N2L A;  4UV8 B;  4AKR A;  4AYN A;  4F4B A;  2V7J A;  3VKH A;  3RKO A;  4IE0 A;  3C50 A;  1HFA A;  1KNZ A;  3QK6 A;  2MHL A;  5JDH A;  2BVL A;  4GK5 E;  2J1N A;  1QUU A;  2MNH A;  4GCP A;  1ZHX A;  4PFP A;  5LBQ B;  5L3F B;  3MXZ A;  4GYS A;  4G2A A;  4O49 A;  1MMD A;  3LK3 B;  2CXF A;  3F57 A;  2CCQ A;  3UUN A;  5L3E B;  1O3X A;  2KXP B;  3QRC A;  5JR9 A;  2YPV A;  1IZN A;  3O1H A;  1ZHT A;  3UTK A;  4GCS A;  3LK2 B;  3MZK B;  4QQ1 A;  3MAC A;  5LCY A;  2YU2 A;  4CXX A;  3NZQ A;  5ADX L;  1MPF A;  4FES A;  2YNK A;  3K19 A;  1QSD A;  5FXW A;  4Z8X A;  4YHJ A;  5IHY A;  4E1S A;  3FHN A;  4RLC A;  4RLB A;  3O0E A;  4CI1 B;  4NUU A;  2Z6E A;  3SWH A;  1GFQ A;  1MIY A;  4ERR A;  5IYZ E;  3AA7 A;  3KBT A;  3HOL A;  4AYE C;  2XAJ B;  5L3D B;  1BR2 A;  4FT6 A;  3FXE B;  1UCU A;  3KVA A;  4I55 E;  4JEU B;  4KP3 C;  4EOZ B;  1HG2 A;  1S94 A;  1WR6 A;  4HFV A;  4IIJ E;  5H6R B;  3ZN1 B;  1MMA A;  2B1E A;  3MA9 A;  4I43 B;  2JQQ A;  2YIN A;  3BQL A;  3BQK A;  3SYS A;  1Z0P A;  2CXD A;  2JRK A;  2L9Q A;  3ZEF B;  2Y7S A;  3N9M A;  1OWA A;  5EK4 A;  3HOE A;  2I59 A;  3HKD E;  5FXV A;  4FZL A;  2NTY A;  3CX7 B;  2CLY B;  3R84 B;  4MFR A;  2X0L B;  4AXP A;  5F3J A;  3VE2 A;  4D64 A;  4DBQ A;  1GFP A;  2L8K A;  2WBL A;  2MOZ A;  4H9S E;  2VWA A;  4FRX A;  2VAS A;  3V5U A;  4G76 A;  2DCF A;  1FIO A;  3RPU A;  2K9A A;  2A3D A;  3DA4 A;  1B7T A;  3ZMT B;  1BR1 A;  1HXX A;  4P09 A;  4EZ4 A;  3POU A;  4JFB A;  4AQF C;  2XUE A;  2IAK A;  3QC9 A;  3KVB A;  4CI2 B;  2Q9Q C;  3VZW X;  2WSS V;  2KLQ A;  3S4U A;  2Y2X A;  5M4Y A;  2OMF A;  4EB6 E;  3UAQ A;  2LHR A;  4KUM B;  3GP6 A;  4V1A v;  4D65 A;  4QWN B;  4FZN A;  2V7L A;  1H6S 1;  3DJB A;  3UT5 E;  1LRZ A;  3LFM A;  5HAX A;  1HF8 A;  4UXN B;  2Y8D A;  2E9X B;  5LYJ E;  2YU1 A;  3I9W A;  5H6Q B;  5FP3 A;  2WWU A;  3AVS A;  4X1I E;  2EHO B;  4CXW A;  2VB6 A;  2KDY A;  2KND A;  2CE7 A;  2WMN A;  2D0T A;  4X1Y E;  2O4V A;  4M1P A;  2UXN B;  4H63 H;  5JDM A;  4X1K E;  3WI4 A;  1HTJ F;  2LSI A;  1G73 A;  4E7Z A;  5AFU L;  5TAO A;  1FEW A;  3PUA A;  3NRX A;  4AKI A;  5HXC A;  3ZMZ B;  4FSP A;  3HKE E;  2EHO C;  4IE5 A;  1MM5 A;  3EVY A;  4HGA A;  3HWB A;  2X51 A;  4EXT A;  5BMV E;  2V26 A;  2KWI B;  4PAG A;  4XZC A;  3FYX A;  4JCH A;  4H9N C;  3CQX C;  3EMN X;  5DL7 A;  4MHC A;  3WI5 A;  1VOM A;  2IC9 A;  3FBZ A;  2H7V C;  3I1A A;  1QJ9 A;  4UF0 A;  5LP6 E;  3GN5 A;  3T0S A;  3N9N A;  4YJ2 E;  2XG6 A;  3I9Y A;  3T20 A;  2W80 C;  3RYF E;  5LXT E;  4ADZ A;  1MIV A;  1OXZ A;  1GFM A;  2LOP A;  4PW8 A;  2XAH B;  1SHZ C;  4PJJ A;  2X9X A;  1ZHZ A;  3O9X A;  3LK4 1;  2PJQ A;  3N2K E;  3H3A A;  5FY1 A;  3K3O A;  1MIW A;  4XNL A;  4YFS A;  3R6N A;  4HTE A;  2JMM A;  2UXX B;  1VRB A;  2XHE B;  4PK6 A;  4ZHQ E;  2A2F X;  2W81 C;  5DL8 A;  5FVN A;  4UVA B;  4UIG A;  5CA0 E;  2ODU A;  4PNI A;  4DO0 A;  4O3W A;  4XBF B;  2LOS A;  2VK9 A;  3NBX X;  4IDZ A;  3IBP A;  2Y0K A;  3SYB A;  3CQG B;  3SZD A;  3NZP A;  4CQI A;  3IF8 B;  4OYK A;  4DMV A;  3RH3 A;  3OBV E;  3O1J A;  3V8U A;  2ZMA A;  5L2L A;  5JDL A;  3ZCI A;  2LJL A;  2ZM2 A;  3N2O A;  4CI3 B;  2HPL A;  2F1V A;  3KVD D;  3MK7 C;  5EZY E;  4PUX A;  3Q5W A;  3AAI A;  3LBX B;  5KX5 E;  4U9C A;  2P9B A;  3A5X A;  4PJL A;  4C90 A;  3DA3 A;  5DL5 A;  1D1B A;  3WAK A;  2DWG A;  2W63 A;  2POR A;  2DHR A;  4AKH A;  1CUN A;  3PTR B;  3AA1 A;  3PUG A;  2D5U A;  1ZHY A;  3ZPO A;  1ZHC A;  1HS7 A;  1MND A;  2C0S A;  2C5J A;  2HH7 A;  4FSO A;  3KBU A;  2K5B B;  2MYS A;  2JPF A;  2LT3 A;  1D0X A;  3PQS A;  4QXH B;  5LHH B;  4KR8 A;  2ODV A;  2Y0L A;  5DQV A;  4H63 V;  3RX6 A;  3ZC1 A;  3I0Q A;  4UEL A;  5L3B B;  4DBR A;  1UX5 A;  3RRC A;  3T8O A;  3LK4 2;  5C8Y E;  3N9P A;  2XE3 A;  5JRC A;  2K4T A;  5J1G A;  1U5P A;  4DND A;  5FXX A;  3G7G A;  3ESL A;  3LBX A;  2CXL A;  1X79 A;  3E0Z A;  5FNV E;  4A56 A;  5HXE A;  5HWY A;  5KDM C;  2EHO A;  4TN7 B;  1PRN A;  4TV9 E;  3ZYK A;  2VKJ A;  5DAB A;  3POX A;  3ETV A;  2DLR A;  1GFN A;  1YKE B;  2XAQ B;  2QA7 A;  4BJM A;  5LHG B;  2WM9 A;  3K3N A;  4BUM X;  3ETU A;  4OFZ A;  3AAE B;  4K0U A;  2KMF A;  2MTQ A;  2DWK A;  3IHR A;  4BJN A;  2NTX A;  4P0A A;  2Y0H A;  1Q9F A;  3KV6 A;  5JH7 E;  3POR A;  5JDP A;  4QHO A;  3C4X A;  2ZM8 A;  2CWO A;  4O8S A;  2LFU A;  3GWH A;  1E54 A;  4AKR B;  4JUY A;  4EYY R;  4J2C A;  4FUV A;  2H3R A;  3JC6 D;  4I50 E;  5JRE A;  4RL9 A;  3SY7 A;  3IEE A;  4GF4 A;  3U3I A;  4U74 A;  2PFV A;  4N78 D;  3DTO A;  3OYZ A;  5FMN A;  3VU7 H;  1BXW A;  3ONX A;  3VZT X;  4BA9 A;  5G26 A;  4ZS2 A;  4CZZ B;  3UU2 A;  4IE7 A;  4L9I A;  3LK3 A;  1ZHW A;  5JR9 C;  4OYJ A;  3HW9 A;  1FMW A;  2ZFG A;  3W15 B;  2KXP A;  4JEH B;  2ACX A;  5LGN B;  4AFK A;  2PG8 A;  3VE1 A;  4GHB A;  7PRN A;  2CA5 A;  3B13 A;  3N2G E;  2Y6X A;  3L09 A;  2C5I T;  4GK0 E;  3CML A;  3ZMV B;  2W0G A;  4GIW A;  5IYU A;  5LA6 E;  4HE8 A;  2FGQ X;  4ZS3 A;  4QXB B;  1NAF A;  5LGT B;  4O4J E;  1LVF A;  3LJC A;  4AYM C;  3AA7 B;  1YW0 A;  3EUH A;  4KMC A;  5HWX A;  2NWB A;  3AVR A;  2ODJ A;  3PQU A;  3M65 A;  4ANJ A;  2M07 A;  2CM0 A;  1MMG A;  4H9Q C;  5LGU B;  3NRY A;  1ZKE A;  2XQY A;  4UVC B;  4O4I E;  1OSM A;  2PRN A;  4X20 E;  4MLK A;  4KBM B;  5DL6 A;  3P8C D;  1ORM A;  4QX7 B;  5J2T E;  4PK5 A;  1PHO A;  4BAY B;  3FB2 A;  2LHF A;  4MBQ A;  4ZI3 D;  4AKM A;  2NP9 A;  5FY0 A;  4AKG A;  3OYX A;  1H7C A;  2QTK A;  5F8P A;  2NW9 A;  4G75 A;  6PRN A;  3SRZ A;  4U72 A;  4C91 A;  3E22 E;  5LHI B;  4LSI A;  2CMR A;  2VL8 A;  2V7I A;  5DQW A;  2W61 A;  4WNK A;  4AQF A;  4EZH A;  2E9X D;  1IAP A;  3D0T A;  4AQG A;  3ZC0 A;  2K48 A;  2V7K A;  4KR4 A;  3LG7 A;  2K24 A;  2LSJ A;  2ZLY A;  3HKC E;  4PK4 A;  1WLX A;  2BDE A;  4PJM A;  5LNK A;  3ZMS B;  2XE2 A;  3HA4 A;  5LJM A;  2JJ9 A;  4UVB B;  4O2B E;  3J7Y q;  4AZL A;  4WW0 A;  4FI5 A;  4ISS A;  1S35 A;  4PJN A;  5LBM A;  1WYC A;  1FMV A;  2XAF B;  3EDU A;  3ZCJ A;  2FGR A;  3C51 A;  4AKL A;  4O3Y A;  5HXR A;  4ASK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...