3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
3AA7B 2KXPB 3AA7A 3AAEB 3AAAB 2KXPA 3AAEA 3LK3B 3AAAA 3LK3A 2KZ7B 2KZ7A 3AA0B 3AA0A 5ADXK 4AKRB 3LK41 4AKRA 5ADXL 3LK2B 5AFUK 5AFUL 3LK2A 3AA6B 3AA6A 3LK42 1IZNB 1IZNA 3AA1B 3AA1A
chains in the Genus database with same CATH superfamily
2NTXA 2AE9A 2CWYA 3NWIA 4PW8A 3V8UA 1KEYA 5HWYA 4DR5T 2FGQX 4OYKA 4UV9B 2GK9A 2XAJB 3MZKB 4D5UA 2EHOD 5F8PA 3PQSA 4B3RT 5D5DA 1LVFA 3T20A 1L0VA 5FL0A 2CLYC 4UEMA 1GFNA 2E9XC 3N2KE 1HG5A 2VQFT 1HNXT 3LK3A 4PFPA 3EVYA 2BS2A 3KFWX 4F4BA 4FT6A 2WBLA 3N2GE 4JUYA 2WMNA 3JC6C 2RPAA 4DV3T 3UU3A 5LGUB 1X9BA 4BA9A 4N58A 4TWDA 4DO0A 5GTHO 4WNKA 4ZI3C 2QYWA 3AAEB 2BG9C 4DR1T 4O49A 3DA4A 2V1DB 3T1YT 3FBZA 5ADXK 2AXDS 4X62T 3JCUO 2W62A 4LSIA 3SZVA 4COFA 3RQUA 1HX8A 5J0ZA 4ZHQE 6PRNA 3VE1A 3LG7A 2W0GA 1H7CA 4U9CA 4AYNA 3AAIA 1SE7A 4PJ0O 2KWIB 3NJTA 1GQEA 2WWUA 1D1CA 3SS1A 1OSMA 5ABHA 2XSAA 4DV2T 4IIJE 3GMIA 4Z90A 4JI0T 4CZZB 4XZCA 3EHZA 2N2MA 3RYIE 4JFBA 4J2CA 3ETVA 5FY7A 1QJPA 3T24A 3POXA 2KC0A 4ISTA 1Z8UA 4A98A 1D1AA 3AAAB 1GFOA 2WZHA 2W61A 5L3EB 3KVBA 3G06A 2UU9T 4AZLA 4HWHA 5LMUT 4FSPA 2Q9QB 1YW0A 4M1PA 2JPFA 4KP3C 4O3XB 1HX1B 3PUGA 3P8CD 1XMOT 4UR9A 3K3OA 3AA1B 2J4GA 3OTOT 1VRBA 2NTYA 4U31A 4O4HE 2IUBA 1I6ZA 3PTRB 2I0MA 5IYUA 1XNRT 1XMQT 1Z0PA 4IE7A 2Y6XA 2LM2A 4H9QC 3TLUA 4I0UA 2LHFA 3VR8A 2A2FX 1T8BA 3I0OA 2L8KA 2XJ7A 1CHUA 3P7IA 5L3BB 5LMNT 4CI3B 2ZFGA 4H9PC 4MALA 2PJQA 2VKOA 2BS3A 5FMNA 2R89A 2XAQB 4ILAA 4AQYT 5AQRB 5EK2A 2ODVA 5HCMA 4CN4A 3UUBA 2B1EA 3WI5A 3AECA 3R6NA 2LRLA 4PK4A 3RKGA 3LK2A 2X0YA 2E5VA 5KX5E 2LT3A 4OX9T 3C4WA 3O9XA 5LG3A 2FJEA 4XAXB 5L3GB 3POQA 3H3MA 3PJAA 4LF6T 2ZLDA 2PBIA 2YU1A 2J47A 1E1HB 3LFMA 4WYVA 3AE6A 3V5UA 5FYMA 2IC6A 3UULA 2IC9A 2UXXB 2O4VA 2WWVA 2LHNA 4PJJA 3FXDB 3P4QA 3BQKA 5LB7B 3P4WA 3UU8A 3PRNA 1QSDA 2WY2A 3QC9A 1V9DA 5HXEA 4NIQA 3LK41 1ZOYA 1NAFA 2XM2A 1W0BA 2J62A 1D0YA 4N74A 2I59A 2NW9A 3C98B 5ABEA 3ZJ1A 1HF8A 1Y64B 1J1JA 3Q2MA 4NXMT 2KDYA 4A97A 4GK0E 1OXZA 5AQUB 3ZCJA 4GKKT 2X68A 5HXRA 3AEDA 3PGRA 4IGUA 5L2LA 1MNEA 2QA7A 1D1BA 3Q5DA 4JI1T 2CMRA 4RLBA 4A56A 4G75A 3EUHA 4YHJA 2PG8A 3ZC1A 4G76A 4QXBB 2H3RA 1SA0E 1IBLT 3PUAA 1KNZA 5TAOA 4TV8E 4L5GA 1I94T 4LF5T 1JNZA 1YQ4A 4KR8A 3KBUA 3CWZB 4N59A 4UVBB 4H63V 2QTKA 4V1Av 1UX5A 4FZLA 4AKRA 2V7KA 5TISO 2CXFA 2WP9A 3F2EA 2QVAA 2EHOC 3FZKB 3NRYA 2X66A 4DBQA 3MKDA 3LK42 3N9MA 2ACZA 4PK6A 2A72A 5HXHA 3K8PC 4XNKA 3PU3A 4JI3T 1U5PA 3L3PA 5E0OA 3C50A 2PORA 1VOMA 4KBMB 4TWFA 2K3WA 2LM9A 3B57A 3A7MA 3HKCE 2XASB 4CXWA 3FYXA 2DCFA 4AKHA 4FQEA 4UV8B 1ZKEA 4OK0A 2NW8A 3ZMSB 4TZ4C 3ONXA 4IL6O 3PF1A 1BR4A 2W81C 2FBWA 5FP3A 2CLYB 4IREA 3GN5B 4NXNT 2E9XB 1M62A 3VZTX 2KINB 4YT0A 3WU2O 4I4TE 2LFUA 4C69X 5AQKB 3EDVA 3EMNX 1YD8G 2K4TA 4FZMA 5EE2A 2A3DA 3ZN1B 3AA0A 4I55E 3RYHE 5FY1A 4JCHA 2BG9B 3VY9X 1KFYA 3H3AA 3SFDA 3NZPA 1HS7A 4H9SE 5CB4E 3PUQA 3NSGA 4IT4A 3SOLA 4B3MT 3E08A 5HXCA 4K0KT 1MMGA 4YLHA 1YKEB 4QH1A 5HEOA 2R4PA 2F1VA 4O4UA 4FSOA 1OEDA 3AXJB 4H9NC 4DBRA 5AQSB 3AE9A 2Y0KA 4CQIA 3CQGB 2ZM6T 2KXPA 4Z8XA 1R8IA 2KZ7A 4PR7A 2JQ9A 4JV5T 2BDEA 1XNQT 2VK9A 2ZM0A 4QX8B 4MFRA 4ZEYA 3Q5WA 1LRZA 4AKMA 3KVDD 2LKHA 4X1IE 4KRAA 3S4UA 4F6RC 4IE6A 5GV0A 4HN9A 3O0EA 3NVOA 4UF0A 4HWDA 3A8YC 5AFUL 4EEBA 1S94A 4X5TA 4YY3T 5JR9C 3TLWA 4FMSA 2N9DA 2Y2XA 2X9YA 4HKAA 3KINB 4HFHA 1VCTA 5H2FO 3PURA 1KNPA 1NENA 5AQJB 1D0ZA 4U7YA 2WU2A 2H88A 2P9BA 5AQNB 2V5CA 2X0HA 5JDGA 4GCPA 3DTOA 4KR4A 3C51A 4EZHA 4WBOA 3VRAA 1DU2A 1T16A 4LSEA 4BJNA 3CIRA 4EV6A 5IYZE 4Z91A 2Y8DA 3UQ4A 4P1NA 4LFAT 4ERRA 1HR0T 3J7Yq 2ZM8A 4O3ZA 2IHR1 3R84B 4ZZBA 3TLVA 3UFEA 4DV1T 2PFVA 2XE3A 3TLSA 3ZSTA 5AQFB 4CI1B 4N78D 3E22E 4AXPA 4LSFA 4RL9A 4EB6E 5JVDE 2ODUA 1GFPA 1ZEEA 4AKLA 2W00A 3AA6A 1PHOA 1ZHWA 4X1KE 5LGTB 3CK6A 1O3XA 3ABVA 1IZNA 4XNLA 5AQTB 3JAEA 1BR2A 4IL4A 2CBIA 4C4VA 3PE0A 5FNVE 5DL5A 2PTFA 5JDPA 1UURA 3OYZA 1MIYA 2BBJA 4YTPA 3G7GA 2H7VC 3RBHA 2M07A 1N32T 3TLTA 3SZDA 4GCQA 5HCJA 3BQLA 1FIOA 3DWNA 4IDNA 2DNXA 3FBLA 3MACA 4CN6A 4HFIA 3RIUC 4H9OC 3KBTA 4C90A 2W66A 2MOZA 4MHCA 1BXWA 2LE8A 3OVUA 5EK4A 4U2YA 1SUMB 1Y01A 4UB6O 3ANWA 1IJ5A 1ZHYA 2YDSA 3C4XA 1UK5A 3NRXA 3L8RA 2DHRA 1J5ET 3CVRA 2H89A 1MMDA 3KV6A 4H63H 4GIWA 2LSJA 3HR0A 4O2AE 5LXTE 2NWBA 5IHYA 2VVNA 4ZI2D 4GF4A 2IWVA 2K9AA 2NR4A 3C4ZA 3BRZA 1QLBA 2PRNA 2QRXA 4YXDA 4DR7T 1IJ6A 2FJDA 3VHLA 3P4PA 2CEAA 3KV9A 4FOZA 2XMXA 2XG6A 4X64T 2KWHA 3MXZA 3SRZA 3QUJA 2W67A 2NP9A 5JDNA 2R8AA 5C2TA 1J5WA 2C0SA 2D5UA 1U4QA 1AJ3A 2ZMAA 3AEAA 5JDHA 2LOSA 2KLQA 5PRNA 2EHOB 4DV0T 4DIDB 1UX4A 4FUVA 4X1YE 2V7JA 2XQ4A 3QB5K 2XZEA 5LG4A 4LF9T 5DQVA 2CRBA 2VKDA 1MM5A 2L3LA 2RP4A 4O3YA 4AKGA 3FB2A 3I9WA 2XHEB 2C5JA 3HW9A 5C3JA 2XQ3A 3AAEA 3EDUA 4DR6T 2Y7SA 5G3AA 4O4JE 2RA1A 2W63A 3VRBA 3ONLC 3Q9DA 4QXHB 3ZT7A 3FZLB 4TN7B 2G0UA 3VZWX 4B61A 4ZI7E 1IAPA 1XDOA 5L47A 4HE8A 4NUUA 3NZQA 2Y0LA 5HAXA 5AQVB 4DUZT 2FUPA 4AYEC 4FI5A 4YFSA 2M6IA 3DA3A 5FVKA 3AE4A 3VKGA 1E54A 3BQIA 4Q25A 5FXZA 5A1LA 2D0UA 2V6YB 2UXNB 5CJ5A 2VL0A 2YU2A 4G2AA 3AAAA 3T8OA 1OEDE 2XAHB 1XZYA 4IE5A 3ZT5A 3QOFA 2MYSA 3BK9A 2Q9QA 5AQOB 3CKDA 3UUMA 2XQ9A 4TX5A 1WRDA 3AA1A 5ABGA 2BS4A 4IHJE 2F4VT 2JMKA 1HNZT 1HFAA 2A9UA 3VKHA 3JAFA 4P0AA 2Y0HA 3EAMA 4GCSA 5J2UE 4O3WA 5KMGP 4JI2T 2XQ6A 4B3ST 1E2AA 2W4XA 3T1HT 4AUIA 3I1AA 1T7SA 2ES0A 4YSXA 3CX8B 4P0BA 4JLEA 2OV9A 3B13A 3N9LA 3FZFB 4O4XA 1HXXA 2HHHT 3ZT6A 4GHBA 1T72A 4U72A 5G38A 4AYID 3W15B 4AI6A 5GTIO 3IBPA 5LHHB 4KMCA 5JR9B 4NUVA 1QJ8A 5JDQA 1US7B 3WI3A 4I43B 2MHLA 3Q5XA 4ILCA 5LA6E 5LHGB 4HTEA 5ABFB 2DL1A 4WZXA 5JRCB 5L4HA 2X9WA 2WQYA 1BT9A 4CXXA 2LSIA 4K3BA 2JQHA 2JJ9A 1MNDA 2V8SV 4QWNB 1UCUA 1XWMA 2JRKA 2MBGA 2VURA 5AQIB 4QHOA 4UXNB 3IF8B 3FZMB 4KHZF 2NOXA 1MMAA 2X0LB 3AVRA 3J9X1 4EXTA 4RJWA 3LJCA 4AQFA 2UXDT 3RI5A 3KZIO 2V7LA 2IWWA 2V7IA 3PDYA 3UU5A 2VL8A 4QX7B 4ADZA 3ZC0A 3FZHB 4EGWA 5HWXA 1HCIA 5H6QB 1YQ3A 3CQCB 5JQGE 3U78A 5HXSA 4E1SA 2BKOA 2XE2A 2MPKA 1T98A 4U33A 2WB5A 3SY9A 4AFKA 2XAFB 4UELA 2LOPA 2R4OA 1CUNA 3P4SA 4LMJA 3UU2A 1FEWA 4HFEA 4LMKA 3AA7B 4PJMA 3AE3A 3AEEA 2WMOA 3ONJA 1X79A 3N2OA 3LBXB 2VWAA 1HTJF 4ZXLA 3N9OA 4ZOLE 2CXDA 2IMLA 4ZI2C 2CCQA 4YSYA 5JREA 3PJAJ 4LFBT 2AXTO 2BKPA 3BRYA 4AIUA 3EI0A 4U2ZA 1W09A 2XUEA 2F1CX 2WCAA 5DL7A 1UUSA 5L4EA 4DR3T 2LJLA 2WVPA 4H9RC 3AEFA 5CA0E 4JBWF 1ORMA 5AQPB 1E7PA 2ACXA 2LEHA 4LFCT 4IDQA 4DMVA 2UUAT 4CN1A 3O4XE 2IIUA 5AQHB 2V7MA 3PU8A 4BAYB 5HEJA 4QH5A 3HWBA 3AE1A 5J1GA 4LF8T 3PUXF 2VKJA 1NEKA 4PNIA 3JADA 1MMNA 2XQ8A 2MAWA 3SYSA 2VVSA 5LNKA 3Q5EA 4O8SA 3C64A 2Y48B 4FRXA 4WBNE 1IBKT 3SWHA 3ZKRA 4PUXA 1B7TA 3HOLA 3A0HO 1QJ9A 1WCRA 4IL9A 3ZMTB 4GK5E 3GN5A 2XTLA 2E9XA 3X1DA 4OYJA 4QH4A 1VCSA 2LRKA 1ZHTA 1LKXA 1P4TA 2WSSV 2X9XA 2I6HA 4HFBA 1N34T 3LK3B 5L3DB 2XM1A 4XBFB 3PUVF 3RC3A 4K3CA 3ESLA 3M65A 4QXCB 2BG9A 1WLXA 4FZNA 2XQ5A 3PGSA 5LP6E 2JQKA 2D0TA 3B5MA 2CM0A 3PGUA 3AE7A 2XQAA 2WDRA 2M6BA 4D64A 3HI2A 3ZN0B 4YTMA 3ZMVB 3K1SA 3AXJA 2XTQA 3K19A 4HWFA 1N36T 5AQLB 3SFEA 3LSVA 1OEDC 2YKSA 1QUUA 1H6S1 4AYMC 3RHWA 4CI2B 5DL6A 3WI4A 4KHPT 2V6XA 1N33T 4PFOA 5KAIO 2VB6A 4A5XA 2M67A 4CTDA 3QK6A 4C00A 2OMFA 2Q9QD 3ZYMA 3I9YA 2IW5B 4IE0A 4B6XA 2D9DA 4QKNA 3N9NA 4YSZA 2V5DA 5AFUK 1BH3A 1FMVA 3A0BO 3UT5E 3AEBA 3LDQB 2OA5A 5AQMB 5J2TE 4JI5T 5KAFO 4LSHA 1MM4A 1T1LA 2BVMA 2WDQA 2YN6A 3P4RA 3RF1A 5CFBA 2MTQA 3ZYLA 5E79O 2WJRA 3CPZA 2E8IA 2LSKA 1FJGT 5JDMA 5EK3A 1WR0A 1ZHCA 2V26A 3VU7H 3RQWA 5G26A 5LGNB 1OWAA 3DP7A 3JTYA 4U3CA 2XQ7A 2R88A 2IDOB 5L3FB 3D0TA 3RIAA 3MJXA 3UAQA 1EZ3A 2N1GA 2YINA 4EYYR 1HXTA 4EEDA 3PUZF 5FKYA 3HA4A 3VR9A 3KDSE 5C8YE 3ZEFB 5GONE 2FJAA 4X65T 2C5KT 3DJBA 4O4LE 3LK2B 3TZGA 3KV5A 4DR4T 5EZYE 3RIFA 4FRTA 2C5IT 2ZLYA 4B3TT 4PK5A 5HEUA 3ZCIA 5JDLA 3ZYKA 4OFZA 2F1TA 3KVAA 2GE4A 1S5LO 4IE4A 5IWAT 1ZP0A 4K0UA 2CE7A 2CXLA 2JIWA 5IUXA 2SPCA 5ETWA 4E7ZA 4KI0F 3PQUA 3ZLIA 3RRCA 3OBVE 5FVNA 2WDVA 5DL8A 5T5FA 3WAKA 4JEUB 2J1DG 3QNUA 1YKHB 4L0RA 2N2LA 3F57A 3MK7C 3CQXC 4U74A 1PRNA 5F5WA 3ZMUB 5FXXA 2W80C 1Q9FA 2X9HA 2BVLA 5JDFA 1ZHXA 3QRAA 4JI6T 3OKQA 2X67A 2WZIA 5LBMA 1SHZC 5KDMC 2NW7A 3PUWF 4KUMB 2UXBT 5KXJA 4EZ4A 2YDQA 4YJ2E 3DWOX 4RLCA 2XY8B 2DLRA 4DR2T 2R4LA 3EABA 3E0ZA 4JEHB 5DJQC 1Q9GA 2BBHA 3I0QA 4UVAB 2E5LT 4G63A 3FXEB 5LJMA 3CX7B 3IEEA 3DZMA 3C5OA 1W9RA 3VE2A 2XAGB 2DWGA 1BR0A 1HNWT 4AYDC 4EIWA 4UB8O 4WW0A 2QGSA 2K24A 2LKGA 4DMWA 2EHOA 2HN1A 3A2SX 8PRNA 4TV9E 3PORA 2ODJA 4AKRB 4JI8T 2YPVA 5LCYA 1ZHZA 4FESA 4C91A 4LF4T 2WJQA 3AE5A 2KSRA 2WAUA 1THQA 2FGRA 4F8HA 4Z3TA 3VY8X 4HFCA 4AISA 2VQET 3CX6B 4TUYE 3BS0A 5LHIB 2LSGA 4DNDA 3GP6A 1G8XA 5HYAA 2DI4A 2HN2A 3RRWA 3TKLB 1GFMA 4EYUA 4TNWA 2E9XD 4E1TA 2X51A 3ZPOA 4EOZB 2BG9E 3ZSSA 3RH3A 3UFGA 4ZS3A 4IDOA 4RJXA 2N2NA 1G90A 3JC6D 3MA9A 4DVDA 3O1JA 2WS3A 2K5BB 4CXYA 2CPTA 2V6YA 4ZI3D 4GYSA 5LBQB 2ZM2A 3AB3B 2XQYA 3AA0B 4JI4T 3AE2A 4IDZA 2LSYA 3ZJ2A 4ANJA 1KK7A 3SYBA 3WAJA 1MPFA 2Z6EA 1W0AA 3OJAA 2M06A 3UPGA 3N9PA 4MBQA 5FY0A 2FJBA 4PJNA 3IA3A 2R4NA 3RKOA 2E2AA 5B66O 2Q9QC 1JNRA 5HEHA 3RLFF 4UIGA 5BR8T 2JMHA 4IDPA 3IHRA 3SY7A 2BZBA 1OEDB 4GKJT 3UU6A 2KT9A 4YTNA 2WU5A 3F31A 4AQGA 2CBJA 2D2SA 4TNVA 5JH7E 5F3JA 2KXPB 2MNHA 4GOUA 4N75A 2KZ7B 4ILBA 1WR6A 4BJMA 3NKZA 5FXVA 2VKHA 3AVSA 4KX6A 4E7SA 4UVCB 1GFQA 4NPPA 3PV0F 5L3CB 2LHRA 3A5XA 1UGOA 5CGMA 4LF7T 4YJ3E 5JR9A 3RPUA 4TWHA 1MIWA 2H7OA 2K48A 3UUXB 5H6RB 4P09A 4UF0B 2WM9A 4DV5T 2YNKA 3HOEA 5HEGA 3PUSA 4QQ1A 4HWCA 5AQQB 5ABFA 5LJNA 2HH7A 2ERVA 4FJOA 3GA8A 5JRCA 3P50A 3CMLA 4HFDA 3M3ZB 3RYFE 4GYRA 3ETUA 4X20E 4O2BE 3L09A 3HKDE 3RYCE 2YDRA 4DV6T 5BMVE 3UU4A 2KNDA 3N9QA 2HPJA 5M4YA 3AEGA 4JI7T 2J1NA 4JYAT 2XE5A 3T0SA 4YHHT 2LLYA 2VASA 3H37A 4BUMX 1D0XA 5FL1A 4LMLA 3K3QC 3V5SA 4AQFC 5DABA 4HGAA 3VZUX 3L39A 5DQWA 3JCFA 2YEVC 2W2UA 4HWIB 4ISSA 4HFVA 3UUNA 1M7KA 1G73A 5CA1E 4DV4T 1FMWA 1HG2A 3QB5A 2XSBA 3AE8A 2CA5A 1OPFA 2XTRA 1ZV4X 3UQ7A 2B76A 4O4IE 2XPKA 3KV4A 2YOEA 1MIVA 4ILUA 3POUA 2CHNA 5AQGB 3HKBE 3AA6B 1NWMX 3FHNA 3UTKA 3U3IA 5B5EO 1BR1A 2UUCT 3ZMZB 2J4UP 1IZNB 3OYXA 4I50E 1WYCA 4DUYT 3HKEE 2DWKA 3AA7A 4C4VB 5FVLA 3QRCA 2JQYA 1LVKA 4ZS2A 4PAGA 3LBXA 2K0LA 2IAKA 5LOVE 4AKIA 2R6GF 3RX6A 3RIUA 1YXRA 3NBXX 3RC8A 1XDPA 7PRNA 3PUYF 4PJLA 2JQQA 4OHFA 2OLTA 2HPLA 3HL6A 2KMFA 1KF6A 2CWOA 2CHOA 5LYJE 5ADXL 4ZZCA 4EAHA 5JTGA 1WFDA 4DV7T 3ANWB 4U7IA 4MLKA 3O1HA 4HEAA 4ASKA 1KNRA 3OPCA 2X27X 4D65A 2BKNA 4X66T 2UUBT 2L9QA 1S35A 2YK0A 2X9KA 1IBMT 2UXCT 3O1IA 2JMMA 1YS5A 5FXWA 3N5LA 3K3NA 1WYBA 4L9IA 1HXUA 2XE1A 3RGLA 5G39A 3GWHA
chains in the Genus database with same CATH topology
3NSGA 5FVNA 2NTXA 2CWYA 5JR9B 4NUVA 3SOLA 1QJ8A 3E08A 4PW8A 5HXCA 5DL8A 3V8UA 5T5FA 3WAKA 1MMGA 5JDQA 4YLHA 4JEUB 2J1DG 1YKEB 5HWYA 2FGQX 2F1VA 1US7B 4O4UA 4OYKA 1YKHB 3WI3A 4L0RA 4UV9B 2N2LA 4FSOA 4I43B 2GK9A 2XAJB 3MZKB 4D5UA 3F57A 3MK7C 3CQXC 2MHLA 4U74A 2EHOD 5F8PA 3Q5XA 4H9NC 4DBRA 3PQSA 5D5DA 1LVFA 5LA6E 5LHGB 1PRNA 3T20A 4HTEA 3ZMUB 5FXXA 2CLYC 4UEMA 2W80C 2Y0KA 4CQIA 1GFNA 1Q9FA 2E9XC 3N2KE 2X9HA 5JRCB 2X9WA 3CQGB 2KXPA 1HG5A 2BVLA 1BT9A 4Z8XA 4CXXA 3LK3A 5JDFA 1ZHXA 3QRAA 2KZ7A 3OKQA 4PFPA 2LSIA 2X67A 3EVYA 5LBMA 3KFWX 2JJ9A 1MNDA 2BDEA 4F4BA 4QWNB 1SHZC 1UCUA 2JRKA 2VK9A 2WBLA 3N2GE 2MBGA 5KDMC 4QHOA 4FT6A 4UXNB 2NW7A 2ZM0A 4JUYA 2WMNA 4KUMB 3JC6C 4MFRA 4QX8B 3IF8B 3Q5WA 4EZ4A 2NOXA 1MMAA 4YJ2E 4RLCA 2X0LB 3AVRA 5LGUB 4BA9A 4N58A 2DLRA 4DO0A 3J9X1 4EXTA 4RJWA 4WNKA 1LRZA 3LJCA 4AKMA 4JEHB 3E0ZA 4ZI3C 4AQFA 5DJQC 1Q9GA 3AAEB 3DA3A 3KVDD 4O49A 4X1IE 4KRAA 3S4UA 3I0QA 4UVAB 4F6RC 4IE6A 3DA4A 2V1DB 4HN9A 2V7LA 3O0EA 5GV0A 2V7IA 3FBZA 3FXEB 3PDYA 3CX7B 3IEEA 4G63A 4UF0A 2VL8A 5LJMA 5ADXK 3C5OA 4QX7B 5AFUL 1S94A 2W62A 5JR9C 4LSIA 4ADZA 3SZVA 3VE2A 4FMSA 2XAGB 3ZC0A 2DWGA 2N9DA 1HX8A 5HWXA 2Y2XA 2X9YA 4HKAA 4ZHQE 1BR0A 1HCIA 3VE1A 4AYDC 6PRNA 3LG7A 4EIWA 4WW0A 2QGSA 2W0GA 5H6QB 1H7CA 3KINB 2K24A 4U9CA 4DMWA 3CQCB 2EHOA 3PURA 5JQGE 4AYNA 3U78A 5HXSA 3AAIA 4E1SA 3A2SX 8PRNA 2KWIB 4TV9E 2XE2A 1D0ZA 3PORA 1T98A 2ODJA 2WWUA 1D1CA 4AKRB 3SS1A 1OSMA 2P9BA 4AFKA 3SY9A 4IIJE 2XAFB 3GMIA 4UELA 4CZZB 2YPVA 2LOPA 4XZCA 5LCYA 5JDGA 1ZHZA 3RYIE 2N2MA 4FESA 4C91A 4GCPA 4JFBA 3DTOA 4J2CA 1CUNA 3ETVA 5FY7A 1QJPA 3T24A 3POXA 2KC0A 1FEWA 4KR4A 3C51A 3UU2A 4ISTA 3AA7B 2WAUA 1D1AA 4PJMA 3AAAB 4EZHA 4WBOA 1THQA 1GFOA 2FGRA 2W61A 5L3EB 4LSEA 2WMOA 1X79A 3N2OA 4BJNA 3LBXB 2VWAA 1HTJF 5IYZE 3VY8X 4Z3TA 2Y8DA 3KVBA 4AZLA 4ERRA 3N9OA 3CX6B 4ZOLE 2CXDA 4TUYE 3J7Yq 4FSPA 2Q9QB 5LHIB 1YW0A 4ZI2C 2ZM8A 2CCQA 4M1PA 5JREA 4O3ZA 2JPFA 3R84B 4KP3C 2LSGA 4O3XB 3UFEA 4DNDA 2PFVA 3PUGA 2XE3A 3P8CD 3GP6A 1G8XA 5HYAA 2DI4A 2XUEA 3RRWA 3K3OA 3AA1B 3TKLB 1GFMA 4EYUA 5DL7A 1VRBA 2E9XD 2NTYA 4E1TA 2LJLA 2X51A 4O4HE 4N78D 4CI1B 4H9RC 3E22E 3PTRB 4AXPA 5CA0E 3ZPOA 4EOZB 1ORMA 4LSFA 5IYUA 2ACXA 4RL9A 2LEHA 3RH3A 4EB6E 5JVDE 2ODUA 4ZS3A 4DMVA 1Z0PA 4IE7A 4RJXA 2N2NA 2Y6XA 1GFPA 1ZEEA 3O4XE 1G90A 4AKLA 2W00A 3AA6A 3JC6D 3MA9A 4H9QC 4DVDA 3O1JA 2V7MA 2K5BB 3PU8A 4CXYA 1PHOA 1ZHWA 4X1KE 5LGTB 1IZNA 1O3XA 4BAYB 2LHFA 3HWBA 4XNLA 2A2FX 1BR2A 3I0OA 2L8KA 4ZI3D 4GYSA 5J1GA 5LBQB 2ZM2A 3AB3B 3PE0A 5FNVE 5DL5A 2VKJA 2XQYA 3AA0B 5JDPA 4IDZA 4PNIA 2LSYA 3OYZA 3ZJ2A 4ANJA 1MIYA 1KK7A 1MMNA 3P7IA 3G7GA 3SYSA 2H7VC 5L3BB 5LNKA 3WAJA 1MPFA 2Z6EA 3RBHA 3SYBA 3OJAA 4O8SA 2M07A 3C64A 2Y48B 2M06A 4CI3B 2ZFGA 4FRXA 3UPGA 3N9PA 3SZDA 4H9PC 4GCQA 3BQLA 4MBQA 1FIOA 4MALA 5FY0A 4WBNE 2PJQA 4PJNA 2VKOA 3RKOA 3SWHA 2DNXA 3FBLA 3MACA 4PUXA 1B7TA 2Q9QC 3HOLA 4H9OC 3KBTA 5FMNA 1QJ9A 4C90A 5AFUK 2XAQB 2MOZA 3ZMTB 4GK5E 5EK2A 4UIGA 3OBVE 2JMHA 2ODVA 4MHCA 1BXWA 3IHRA 2B1EA 2LE8A 3GN5A 2XTLA 3WI5A 2E9XA 5EK4A 2BZBA 3SY7A 3R6NA 4OYJA 2KT9A 4PK4A 3LK2A 5KX5E 2LT3A 1ZHTA 3F31A 4AQGA 3ANWA 1LKXA 1P4TA 1IJ5A 2WSSV 2D2SA 2X9XA 3C4WA 5JH7E 1ZHYA 3O9XA 5F3JA 3C4XA 4XAXB 5L3GB 3POQA 3NRXA 2DHRA 2KXPB 2MNHA 3CVRA 4GOUA 1MMDA 3KV6A 3LK3B 2ZLDA 4H63H 4GIWA 5L3DB 2KZ7B 2PBIA 1WR6A 2YU1A 4BJMA 4XBFB 1E1HB 5FXVA 3RC3A 2VKHA 2LSJA 3LFMA 3AVSA 3V5UA 3HR0A 5FYMA 4E7SA 4O2AE 5LXTE 3ESLA 3M65A 2IC6A 2NWBA 4UVCB 5IHYA 4QXCB 4ZI2D 1WLXA 3UULA 1GFQA 4GF4A 4FZNA 2IC9A 2UXXB 2K9AA 5LP6E 2O4VA 3C4ZA 2LHNA 2D0TA 4PJJA 5L3CB 3FXDB 2LHRA 3A5XA 2CM0A 2PRNA 3BQKA 1IJ6A 3VHLA 2CEAA 4YJ3E 5JR9A 3RPUA 1MIWA 2H7OA 2K48A 3KV9A 3UUXB 5H6RB 4D64A 4FOZA 3HI2A 3ZN0B 2XMXA 3PRNA 4P09A 1QSDA 4UF0B 2XG6A 2WM9A 3ZMVB 2KWHA 3QC9A 1V9DA 5HXEA 2YNKA 3LK41 1NAFA 3HOEA 3MXZA 3SRZA 3QUJA 2NP9A 3PUSA 1D0YA 4QQ1A 5JDNA 2XTQA 2C0SA 2D5UA 1U4QA 2I59A 2ZMAA 1AJ3A 3K19A 2NW9A 5JDHA 2LOSA 2KLQA 3C98B 5PRNA 5LJNA 2HH7A 2ERVA 3ZJ1A 1HF8A 4FJOA 3GA8A 5JRCA 2EHOB 1Y64B 3CMLA 3Q2MA 1QUUA 1H6S1 2KDYA 4AYMC 4GK0E 1UX4A 3RYFE 1OXZA 4GYRA 3ETUA 4FUVA 4X1YE 2V7JA 3ZCJA 4X20E 4CI2B 5DL6A 2X68A 5HXRA 5LG4A 3WI4A 4O2BE 5DQVA 4IGUA 5L2LA 3L09A 4PFOA 2VKDA 3HKDE 3RYCE 1MM5A 2L3LA 5BMVE 1MNEA 2RP4A 4O3YA 2QA7A 1D1BA 4AKGA 2KNDA 3FB2A 3N9QA 2CMRA 2HPJA 2VB6A 3I9WA 5LHHB 2M67A 2XHEB 3QK6A 5M4YA 4RLBA 4A56A 2C5JA 2J1NA 2OMFA 3HW9A 4G75A 2Q9QD 2XE5A 3AAEA 3T0SA 3ZYMA 2VASA 3I9YA 2IW5B 3EDUA 3EUHA 4IE0A 4B6XA 3H37A 4YHJA 4BUMX 1D0XA 2PG8A 4QKNA 3N9NA 3ZC1A 2Y7SA 4O4JE 4G76A 4QXBB 2H3RA 1SA0E 3K3QC 2RA1A 2W63A 3V5SA 4AQFC 3PUAA 4HGAA 5DABA 1BH3A 3Q9DA 1FMVA 3VZUX 4QXHB 5DQWA 1KNZA 2YEVC 3UT5E 5TAOA 4ISSA 4L5GA 4TN7B 4TV8E 4HFVA 3UUNA 1G73A 5CA1E 2G0UA 2OA5A 4KR8A 3KBUA 3CWZB 4N59A 5J2TE 3VZWX 1FMWA 1HG2A 4B61A 4ZI7E 1IAPA 4UVBB 2CA5A 1OPFA 2XTRA 1ZV4X 4HE8A 4NUUA 3NZQA 4LSHA 4O4IE 2Y0LA 4H63V 5HAXA 1MM4A 2BVMA 3KV4A 2QTKA 4AYEC 4V1Av 1UX5A 4FI5A 4YFSA 1MIVA 4ILUA 4FZLA 4AKRA 2V7KA 3POUA 2CXFA 3F2EA 3HKBE 2EHOC 1NWMX 2MTQA 3AA6B 3FHNA 3NRYA 3U3IA 3UTKA 3ZYLA 2X66A 1BR1A 3MKDA 4DBQA 3VKGA 1E54A 3CPZA 2E8IA 3LK42 3ZMZB 2J4UP 2LSKA 3N9MA 1IZNB 3BQIA 3OYXA 4I50E 4PK6A 5FXZA 1WYCA 5A1LA 2D0UA 2A72A 5HXHA 2UXNB 5JDMA 5EK3A 3HKEE 3K8PC 1ZHCA 4XNKA 2DWKA 3PU3A 2V26A 2YU2A 3AA7A 4G2AA 1U5PA 3AAAA 3QRCA 3VU7H 3T8OA 3L3PA 5E0OA 5G26A 3C50A 5LGNB 1LVKA 4ZS2A 1OWAA 2PORA 2XAHB 3LBXA 4PAGA 1VOMA 4IE5A 4KBMB 2K0LA 2IAKA 3DP7A 5LOVE 3JTYA 2MYSA 3BK9A 4AKIA 2LM9A 3B57A 3HKCE 2Q9QA 3RX6A 3CKDA 2XASB 3UUMA 4CXWA 3FYXA 4TX5A 3D0TA 5L3FB 3NBXX 3RC8A 3MJXA 3UAQA 1EZ3A 2DCFA 4AKHA 7PRNA 2N1GA 2YINA 1WRDA 4PJLA 4UV8B 2JQQA 4EYYR 4OHFA 3AA1A 1HXTA 1ZKEA 4OK0A 4IHJE 3HA4A 2JMKA 2NW8A 3ZMSB 4TZ4C 2HPLA 3KDSE 5C8YE 3HL6A 1HFAA 2KMFA 3ONXA 1BR4A 2CWOA 2W81C 5FP3A 3VKHA 3ZEFB 2CLYB 5GONE 3GN5B 5LYJE 4P0AA 2E9XB 2Y0HA 3VZTX 2C5KT 3DJBA 5ADXL 4O4LE 4GCSA 3LK2B 2KINB 4EAHA 3KV5A 3TZGA 5J2UE 4O3WA 5KMGP 3ANWB 4I4TE 2LFUA 4MLKA 5EZYE 3O1HA 4HEAA 4FRTA 2C5IT 2ZLYA 4C69X 4PK5A 4ASKA 3ZCIA 3EDVA 3EMNX 4AUIA 1YD8G 5JDLA 3I1AA 2K4TA 2X27X 3ZYKA 4OFZA 4FZMA 4D65A 5EE2A 2F1TA 2ES0A 3KVAA 3CX8B 2GE4A 4P0BA 2A3DA 2L9QA 4IE4A 3ZN1B 3AA0A 4I55E 1S35A 2YK0A 3RYHE 4JLEA 5FY1A 4JCHA 4K0UA 2CE7A 2CXLA 3B13A 3VY9X 3H3AA 3N9LA 3O1IA 2SPCA 3NZPA 5ETWA 4E7ZA 2JMMA 1YS5A 4O4XA 5FXWA 1HXXA 3N5LA 3K3NA 1HS7A 1WYBA 3PQUA 3ZLIA 4GHBA 3RRCA 4U72A 4H9SE 4L9IA 1HXUA 3W15B 2XE1A 4AYID 4AI6A 5CB4E 3PUQA 3IBPA 4KMCA 3GWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 B;  2KXP B;  3AA7 A;  3AAE B;  3AAA B;  2KXP A;  3AAE A;  3LK3 B;  3AAA A;  3LK3 A;  2KZ7 B;  2KZ7 A;  3AA0 B;  3AA0 A;  5ADX K;  4AKR B;  3LK4 1;  4AKR A;  5ADX L;  3LK2 B;  5AFU K;  5AFU L;  3LK2 A;  3AA6 B;  3AA6 A;  3LK4 2;  1IZN B;  1IZN A;  3AA1 B;  3AA1 A; 
#chains in the Genus database with same CATH topology
 2NTX A;  2AE9 A;  2CWY A;  3NWI A;  4PW8 A;  3V8U A;  1KEY A;  5HWY A;  4DR5 T;  2FGQ X;  4OYK A;  4UV9 B;  2GK9 A;  2XAJ B;  3MZK B;  4D5U A;  2EHO D;  5F8P A;  3PQS A;  4B3R T;  5D5D A;  1LVF A;  3T20 A;  1L0V A;  5FL0 A;  2CLY C;  4UEM A;  1GFN A;  2E9X C;  3N2K E;  1HG5 A;  2VQF T;  1HNX T;  3LK3 A;  4PFP A;  3EVY A;  2BS2 A;  3KFW X;  4F4B A;  4FT6 A;  2WBL A;  3N2G E;  4JUY A;  2WMN A;  3JC6 C;  2RPA A;  4DV3 T;  3UU3 A;  5LGU B;  1X9B A;  4BA9 A;  4N58 A;  4TWD A;  4DO0 A;  5GTH O;  4WNK A;  4ZI3 C;  2QYW A;  3AAE B;  2BG9 C;  4DR1 T;  4O49 A;  3DA4 A;  2V1D B;  3T1Y T;  3FBZ A;  5ADX K;  2AXD S;  4X62 T;  3JCU O;  2W62 A;  4LSI A;  3SZV A;  4COF A;  3RQU A;  1HX8 A;  5J0Z A;  4ZHQ E;  6PRN A;  3VE1 A;  3LG7 A;  2W0G A;  1H7C A;  4U9C A;  4AYN A;  3AAI A;  1SE7 A;  4PJ0 O;  2KWI B;  3NJT A;  1GQE A;  2WWU A;  1D1C A;  3SS1 A;  1OSM A;  5ABH A;  2XSA A;  4DV2 T;  4IIJ E;  3GMI A;  4Z90 A;  4JI0 T;  4CZZ B;  4XZC A;  3EHZ A;  2N2M A;  3RYI E;  4JFB A;  4J2C A;  3ETV A;  5FY7 A;  1QJP A;  3T24 A;  3POX A;  2KC0 A;  4IST A;  1Z8U A;  4A98 A;  1D1A A;  3AAA B;  1GFO A;  2WZH A;  2W61 A;  5L3E B;  3KVB A;  3G06 A;  2UU9 T;  4AZL A;  4HWH A;  5LMU T;  4FSP A;  2Q9Q B;  1YW0 A;  4M1P A;  2JPF A;  4KP3 C;  4O3X B;  1HX1 B;  3PUG A;  3P8C D;  1XMO T;  4UR9 A;  3K3O A;  3AA1 B;  2J4G A;  3OTO T;  1VRB A;  2NTY A;  4U31 A;  4O4H E;  2IUB A;  1I6Z A;  3PTR B;  2I0M A;  5IYU A;  1XNR T;  1XMQ T;  1Z0P A;  4IE7 A;  2Y6X A;  2LM2 A;  4H9Q C;  3TLU A;  4I0U A;  2LHF A;  3VR8 A;  2A2F X;  1T8B A;  3I0O A;  2L8K A;  2XJ7 A;  1CHU A;  3P7I A;  5L3B B;  5LMN T;  4CI3 B;  2ZFG A;  4H9P C;  4MAL A;  2PJQ A;  2VKO A;  2BS3 A;  5FMN A;  2R89 A;  2XAQ B;  4ILA A;  4AQY T;  5AQR B;  5EK2 A;  2ODV A;  5HCM A;  4CN4 A;  3UUB A;  2B1E A;  3WI5 A;  3AEC A;  3R6N A;  2LRL A;  4PK4 A;  3RKG A;  3LK2 A;  2X0Y A;  2E5V A;  5KX5 E;  2LT3 A;  4OX9 T;  3C4W A;  3O9X A;  5LG3 A;  2FJE A;  4XAX B;  5L3G B;  3POQ A;  3H3M A;  3PJA A;  4LF6 T;  2ZLD A;  2PBI A;  2YU1 A;  2J47 A;  1E1H B;  3LFM A;  4WYV A;  3AE6 A;  3V5U A;  5FYM A;  2IC6 A;  3UUL A;  2IC9 A;  2UXX B;  2O4V A;  2WWV A;  2LHN A;  4PJJ A;  3FXD B;  3P4Q A;  3BQK A;  5LB7 B;  3P4W A;  3UU8 A;  3PRN A;  1QSD A;  2WY2 A;  3QC9 A;  1V9D A;  5HXE A;  4NIQ A;  3LK4 1;  1ZOY A;  1NAF A;  2XM2 A;  1W0B A;  2J62 A;  1D0Y A;  4N74 A;  2I59 A;  2NW9 A;  3C98 B;  5ABE A;  3ZJ1 A;  1HF8 A;  1Y64 B;  1J1J A;  3Q2M A;  4NXM T;  2KDY A;  4A97 A;  4GK0 E;  1OXZ A;  5AQU B;  3ZCJ A;  4GKK T;  2X68 A;  5HXR A;  3AED A;  3PGR A;  4IGU A;  5L2L A;  1MNE A;  2QA7 A;  1D1B A;  3Q5D A;  4JI1 T;  2CMR A;  4RLB A;  4A56 A;  4G75 A;  3EUH A;  4YHJ A;  2PG8 A;  3ZC1 A;  4G76 A;  4QXB B;  2H3R A;  1SA0 E;  1IBL T;  3PUA A;  1KNZ A;  5TAO A;  4TV8 E;  4L5G A;  1I94 T;  4LF5 T;  1JNZ A;  1YQ4 A;  4KR8 A;  3KBU A;  3CWZ B;  4N59 A;  4UVB B;  4H63 V;  2QTK A;  4V1A v;  1UX5 A;  4FZL A;  4AKR A;  2V7K A;  5TIS O;  2CXF A;  2WP9 A;  3F2E A;  2QVA A;  2EHO C;  3FZK B;  3NRY A;  2X66 A;  4DBQ A;  3MKD A;  3LK4 2;  3N9M A;  2ACZ A;  4PK6 A;  2A72 A;  5HXH A;  3K8P C;  4XNK A;  3PU3 A;  4JI3 T;  1U5P A;  3L3P A;  5E0O A;  3C50 A;  2POR A;  1VOM A;  4KBM B;  4TWF A;  2K3W A;  2LM9 A;  3B57 A;  3A7M A;  3HKC E;  2XAS B;  4CXW A;  3FYX A;  2DCF A;  4AKH A;  4FQE A;  4UV8 B;  1ZKE A;  4OK0 A;  2NW8 A;  3ZMS B;  4TZ4 C;  3ONX A;  4IL6 O;  3PF1 A;  1BR4 A;  2W81 C;  2FBW A;  5FP3 A;  2CLY B;  4IRE A;  3GN5 B;  4NXN T;  2E9X B;  1M62 A;  3VZT X;  2KIN B;  4YT0 A;  3WU2 O;  4I4T E;  2LFU A;  4C69 X;  5AQK B;  3EDV A;  3EMN X;  1YD8 G;  2K4T A;  4FZM A;  5EE2 A;  2A3D A;  3ZN1 B;  3AA0 A;  4I55 E;  3RYH E;  5FY1 A;  4JCH A;  2BG9 B;  3VY9 X;  1KFY A;  3H3A A;  3SFD A;  3NZP A;  1HS7 A;  4H9S E;  5CB4 E;  3PUQ A;  3NSG A;  4IT4 A;  3SOL A;  4B3M T;  3E08 A;  5HXC A;  4K0K T;  1MMG A;  4YLH A;  1YKE B;  4QH1 A;  5HEO A;  2R4P A;  2F1V A;  4O4U A;  4FSO A;  1OED A;  3AXJ B;  4H9N C;  4DBR A;  5AQS B;  3AE9 A;  2Y0K A;  4CQI A;  3CQG B;  2ZM6 T;  2KXP A;  4Z8X A;  1R8I A;  2KZ7 A;  4PR7 A;  2JQ9 A;  4JV5 T;  2BDE A;  1XNQ T;  2VK9 A;  2ZM0 A;  4QX8 B;  4MFR A;  4ZEY A;  3Q5W A;  1LRZ A;  4AKM A;  3KVD D;  2LKH A;  4X1I E;  4KRA A;  3S4U A;  4F6R C;  4IE6 A;  5GV0 A;  4HN9 A;  3O0E A;  3NVO A;  4UF0 A;  4HWD A;  3A8Y C;  5AFU L;  4EEB A;  1S94 A;  4X5T A;  4YY3 T;  5JR9 C;  3TLW A;  4FMS A;  2N9D A;  2Y2X A;  2X9Y A;  4HKA A;  3KIN B;  4HFH A;  1VCT A;  5H2F O;  3PUR A;  1KNP A;  1NEN A;  5AQJ B;  1D0Z A;  4U7Y A;  2WU2 A;  2H88 A;  2P9B A;  5AQN B;  2V5C A;  2X0H A;  5JDG A;  4GCP A;  3DTO A;  4KR4 A;  3C51 A;  4EZH A;  4WBO A;  3VRA A;  1DU2 A;  1T16 A;  4LSE A;  4BJN A;  3CIR A;  4EV6 A;  5IYZ E;  4Z91 A;  2Y8D A;  3UQ4 A;  4P1N A;  4LFA T;  4ERR A;  1HR0 T;  3J7Y q;  2ZM8 A;  4O3Z A;  2IHR 1;  3R84 B;  4ZZB A;  3TLV A;  3UFE A;  4DV1 T;  2PFV A;  2XE3 A;  3TLS A;  3ZST A;  5AQF B;  4CI1 B;  4N78 D;  3E22 E;  4AXP A;  4LSF A;  4RL9 A;  4EB6 E;  5JVD E;  2ODU A;  1GFP A;  1ZEE A;  4AKL A;  2W00 A;  3AA6 A;  1PHO A;  1ZHW A;  4X1K E;  5LGT B;  3CK6 A;  1O3X A;  3ABV A;  1IZN A;  4XNL A;  5AQT B;  3JAE A;  1BR2 A;  4IL4 A;  2CBI A;  4C4V A;  3PE0 A;  5FNV E;  5DL5 A;  2PTF A;  5JDP A;  1UUR A;  3OYZ A;  1MIY A;  2BBJ A;  4YTP A;  3G7G A;  2H7V C;  3RBH A;  2M07 A;  1N32 T;  3TLT A;  3SZD A;  4GCQ A;  5HCJ A;  3BQL A;  1FIO A;  3DWN A;  4IDN A;  2DNX A;  3FBL A;  3MAC A;  4CN6 A;  4HFI A;  3RIU C;  4H9O C;  3KBT A;  4C90 A;  2W66 A;  2MOZ A;  4MHC A;  1BXW A;  2LE8 A;  3OVU A;  5EK4 A;  4U2Y A;  1SUM B;  1Y01 A;  4UB6 O;  3ANW A;  1IJ5 A;  1ZHY A;  2YDS A;  3C4X A;  1UK5 A;  3NRX A;  3L8R A;  2DHR A;  1J5E T;  3CVR A;  2H89 A;  1MMD A;  3KV6 A;  4H63 H;  4GIW A;  2LSJ A;  3HR0 A;  4O2A E;  5LXT E;  2NWB A;  5IHY A;  2VVN A;  4ZI2 D;  4GF4 A;  2IWV A;  2K9A A;  2NR4 A;  3C4Z A;  3BRZ A;  1QLB A;  2PRN A;  2QRX A;  4YXD A;  4DR7 T;  1IJ6 A;  2FJD A;  3VHL A;  3P4P A;  2CEA A;  3KV9 A;  4FOZ A;  2XMX A;  2XG6 A;  4X64 T;  2KWH A;  3MXZ A;  3SRZ A;  3QUJ A;  2W67 A;  2NP9 A;  5JDN A;  2R8A A;  5C2T A;  1J5W A;  2C0S A;  2D5U A;  1U4Q A;  1AJ3 A;  2ZMA A;  3AEA A;  5JDH A;  2LOS A;  2KLQ A;  5PRN A;  2EHO B;  4DV0 T;  4DID B;  1UX4 A;  4FUV A;  4X1Y E;  2V7J A;  2XQ4 A;  3QB5 K;  2XZE A;  5LG4 A;  4LF9 T;  5DQV A;  2CRB A;  2VKD A;  1MM5 A;  2L3L A;  2RP4 A;  4O3Y A;  4AKG A;  3FB2 A;  3I9W A;  2XHE B;  2C5J A;  3HW9 A;  5C3J A;  2XQ3 A;  3AAE A;  3EDU A;  4DR6 T;  2Y7S A;  5G3A A;  4O4J E;  2RA1 A;  2W63 A;  3VRB A;  3ONL C;  3Q9D A;  4QXH B;  3ZT7 A;  3FZL B;  4TN7 B;  2G0U A;  3VZW X;  4B61 A;  4ZI7 E;  1IAP A;  1XDO A;  5L47 A;  4HE8 A;  4NUU A;  3NZQ A;  2Y0L A;  5HAX A;  5AQV B;  4DUZ T;  2FUP A;  4AYE C;  4FI5 A;  4YFS A;  2M6I A;  3DA3 A;  5FVK A;  3AE4 A;  3VKG A;  1E54 A;  3BQI A;  4Q25 A;  5FXZ A;  5A1L A;  2D0U A;  2V6Y B;  2UXN B;  5CJ5 A;  2VL0 A;  2YU2 A;  4G2A A;  3AAA A;  3T8O A;  1OED E;  2XAH B;  1XZY A;  4IE5 A;  3ZT5 A;  3QOF A;  2MYS A;  3BK9 A;  2Q9Q A;  5AQO B;  3CKD A;  3UUM A;  2XQ9 A;  4TX5 A;  1WRD A;  3AA1 A;  5ABG A;  2BS4 A;  4IHJ E;  2F4V T;  2JMK A;  1HNZ T;  1HFA A;  2A9U A;  3VKH A;  3JAF A;  4P0A A;  2Y0H A;  3EAM A;  4GCS A;  5J2U E;  4O3W A;  5KMG P;  4JI2 T;  2XQ6 A;  4B3S T;  1E2A A;  2W4X A;  3T1H T;  4AUI A;  3I1A A;  1T7S A;  2ES0 A;  4YSX A;  3CX8 B;  4P0B A;  4JLE A;  2OV9 A;  3B13 A;  3N9L A;  3FZF B;  4O4X A;  1HXX A;  2HHH T;  3ZT6 A;  4GHB A;  1T72 A;  4U72 A;  5G38 A;  4AYI D;  3W15 B;  4AI6 A;  5GTI O;  3IBP A;  5LHH B;  4KMC A;  5JR9 B;  4NUV A;  1QJ8 A;  5JDQ A;  1US7 B;  3WI3 A;  4I43 B;  2MHL A;  3Q5X A;  4ILC A;  5LA6 E;  5LHG B;  4HTE A;  5ABF B;  2DL1 A;  4WZX A;  5JRC B;  5L4H A;  2X9W A;  2WQY A;  1BT9 A;  4CXX A;  2LSI A;  4K3B A;  2JQH A;  2JJ9 A;  1MND A;  2V8S V;  4QWN B;  1UCU A;  1XWM A;  2JRK A;  2MBG A;  2VUR A;  5AQI B;  4QHO A;  4UXN B;  3IF8 B;  3FZM B;  4KHZ F;  2NOX A;  1MMA A;  2X0L B;  3AVR A;  3J9X 1;  4EXT A;  4RJW A;  3LJC A;  4AQF A;  2UXD T;  3RI5 A;  3KZI O;  2V7L A;  2IWW A;  2V7I A;  3PDY A;  3UU5 A;  2VL8 A;  4QX7 B;  4ADZ A;  3ZC0 A;  3FZH B;  4EGW A;  5HWX A;  1HCI A;  5H6Q B;  1YQ3 A;  3CQC B;  5JQG E;  3U78 A;  5HXS A;  4E1S A;  2BKO A;  2XE2 A;  2MPK A;  1T98 A;  4U33 A;  2WB5 A;  3SY9 A;  4AFK A;  2XAF B;  4UEL A;  2LOP A;  2R4O A;  1CUN A;  3P4S A;  4LMJ A;  3UU2 A;  1FEW A;  4HFE A;  4LMK A;  3AA7 B;  4PJM A;  3AE3 A;  3AEE A;  2WMO A;  3ONJ A;  1X79 A;  3N2O A;  3LBX B;  2VWA A;  1HTJ F;  4ZXL A;  3N9O A;  4ZOL E;  2CXD A;  2IML A;  4ZI2 C;  2CCQ A;  4YSY A;  5JRE A;  3PJA J;  4LFB T;  2AXT O;  2BKP A;  3BRY A;  4AIU A;  3EI0 A;  4U2Z A;  1W09 A;  2XUE A;  2F1C X;  2WCA A;  5DL7 A;  1UUS A;  5L4E A;  4DR3 T;  2LJL A;  2WVP A;  4H9R C;  3AEF A;  5CA0 E;  4JBW F;  1ORM A;  5AQP B;  1E7P A;  2ACX A;  2LEH A;  4LFC T;  4IDQ A;  4DMV A;  2UUA T;  4CN1 A;  3O4X E;  2IIU A;  5AQH B;  2V7M A;  3PU8 A;  4BAY B;  5HEJ A;  4QH5 A;  3HWB A;  3AE1 A;  5J1G A;  4LF8 T;  3PUX F;  2VKJ A;  1NEK A;  4PNI A;  3JAD A;  1MMN A;  2XQ8 A;  2MAW A;  3SYS A;  2VVS A;  5LNK A;  3Q5E A;  4O8S A;  3C64 A;  2Y48 B;  4FRX A;  4WBN E;  1IBK T;  3SWH A;  3ZKR A;  4PUX A;  1B7T A;  3HOL A;  3A0H O;  1QJ9 A;  1WCR A;  4IL9 A;  3ZMT B;  4GK5 E;  3GN5 A;  2XTL A;  2E9X A;  3X1D A;  4OYJ A;  4QH4 A;  1VCS A;  2LRK A;  1ZHT A;  1LKX A;  1P4T A;  2WSS V;  2X9X A;  2I6H A;  4HFB A;  1N34 T;  3LK3 B;  5L3D B;  2XM1 A;  4XBF B;  3PUV F;  3RC3 A;  4K3C A;  3ESL A;  3M65 A;  4QXC B;  2BG9 A;  1WLX A;  4FZN A;  2XQ5 A;  3PGS A;  5LP6 E;  2JQK A;  2D0T A;  3B5M A;  2CM0 A;  3PGU A;  3AE7 A;  2XQA A;  2WDR A;  2M6B A;  4D64 A;  3HI2 A;  3ZN0 B;  4YTM A;  3ZMV B;  3K1S A;  3AXJ A;  2XTQ A;  3K19 A;  4HWF A;  1N36 T;  5AQL B;  3SFE A;  3LSV A;  1OED C;  2YKS A;  1QUU A;  1H6S 1;  4AYM C;  3RHW A;  4CI2 B;  5DL6 A;  3WI4 A;  4KHP T;  2V6X A;  1N33 T;  4PFO A;  5KAI O;  2VB6 A;  4A5X A;  2M67 A;  4CTD A;  3QK6 A;  4C00 A;  2OMF A;  2Q9Q D;  3ZYM A;  3I9Y A;  2IW5 B;  4IE0 A;  4B6X A;  2D9D A;  4QKN A;  3N9N A;  4YSZ A;  2V5D A;  5AFU K;  1BH3 A;  1FMV A;  3A0B O;  3UT5 E;  3AEB A;  3LDQ B;  2OA5 A;  5AQM B;  5J2T E;  4JI5 T;  5KAF O;  4LSH A;  1MM4 A;  1T1L A;  2BVM A;  2WDQ A;  2YN6 A;  3P4R A;  3RF1 A;  5CFB A;  2MTQ A;  3ZYL A;  5E79 O;  2WJR A;  3CPZ A;  2E8I A;  2LSK A;  1FJG T;  5JDM A;  5EK3 A;  1WR0 A;  1ZHC A;  2V26 A;  3VU7 H;  3RQW A;  5G26 A;  5LGN B;  1OWA A;  3DP7 A;  3JTY A;  4U3C A;  2XQ7 A;  2R88 A;  2IDO B;  5L3F B;  3D0T A;  3RIA A;  3MJX A;  3UAQ A;  1EZ3 A;  2N1G A;  2YIN A;  4EYY R;  1HXT A;  4EED A;  3PUZ F;  5FKY A;  3HA4 A;  3VR9 A;  3KDS E;  5C8Y E;  3ZEF B;  5GON E;  2FJA A;  4X65 T;  2C5K T;  3DJB A;  4O4L E;  3LK2 B;  3TZG A;  3KV5 A;  4DR4 T;  5EZY E;  3RIF A;  4FRT A;  2C5I T;  2ZLY A;  4B3T T;  4PK5 A;  5HEU A;  3ZCI A;  5JDL A;  3ZYK A;  4OFZ A;  2F1T A;  3KVA A;  2GE4 A;  1S5L O;  4IE4 A;  5IWA T;  1ZP0 A;  4K0U A;  2CE7 A;  2CXL A;  2JIW A;  5IUX A;  2SPC A;  5ETW A;  4E7Z A;  4KI0 F;  3PQU A;  3ZLI A;  3RRC A;  3OBV E;  5FVN A;  2WDV A;  5DL8 A;  5T5F A;  3WAK A;  4JEU B;  2J1D G;  3QNU A;  1YKH B;  4L0R A;  2N2L A;  3F57 A;  3MK7 C;  3CQX C;  4U74 A;  1PRN A;  5F5W A;  3ZMU B;  5FXX A;  2W80 C;  1Q9F A;  2X9H A;  2BVL A;  5JDF A;  1ZHX A;  3QRA A;  4JI6 T;  3OKQ A;  2X67 A;  2WZI A;  5LBM A;  1SHZ C;  5KDM C;  2NW7 A;  3PUW F;  4KUM B;  2UXB T;  5KXJ A;  4EZ4 A;  2YDQ A;  4YJ2 E;  3DWO X;  4RLC A;  2XY8 B;  2DLR A;  4DR2 T;  2R4L A;  3EAB A;  3E0Z A;  4JEH B;  5DJQ C;  1Q9G A;  2BBH A;  3I0Q A;  4UVA B;  2E5L T;  4G63 A;  3FXE B;  5LJM A;  3CX7 B;  3IEE A;  3DZM A;  3C5O A;  1W9R A;  3VE2 A;  2XAG B;  2DWG A;  1BR0 A;  1HNW T;  4AYD C;  4EIW A;  4UB8 O;  4WW0 A;  2QGS A;  2K24 A;  2LKG A;  4DMW A;  2EHO A;  2HN1 A;  3A2S X;  8PRN A;  4TV9 E;  3POR A;  2ODJ A;  4AKR B;  4JI8 T;  2YPV A;  5LCY A;  1ZHZ A;  4FES A;  4C91 A;  4LF4 T;  2WJQ A;  3AE5 A;  2KSR A;  2WAU A;  1THQ A;  2FGR A;  4F8H A;  4Z3T A;  3VY8 X;  4HFC A;  4AIS A;  2VQE T;  3CX6 B;  4TUY E;  3BS0 A;  5LHI B;  2LSG A;  4DND A;  3GP6 A;  1G8X A;  5HYA A;  2DI4 A;  2HN2 A;  3RRW A;  3TKL B;  1GFM A;  4EYU A;  4TNW A;  2E9X D;  4E1T A;  2X51 A;  3ZPO A;  4EOZ B;  2BG9 E;  3ZSS A;  3RH3 A;  3UFG A;  4ZS3 A;  4IDO A;  4RJX A;  2N2N A;  1G90 A;  3JC6 D;  3MA9 A;  4DVD A;  3O1J A;  2WS3 A;  2K5B B;  4CXY A;  2CPT A;  2V6Y A;  4ZI3 D;  4GYS A;  5LBQ B;  2ZM2 A;  3AB3 B;  2XQY A;  3AA0 B;  4JI4 T;  3AE2 A;  4IDZ A;  2LSY A;  3ZJ2 A;  4ANJ A;  1KK7 A;  3SYB A;  3WAJ A;  1MPF A;  2Z6E A;  1W0A A;  3OJA A;  2M06 A;  3UPG A;  3N9P A;  4MBQ A;  5FY0 A;  2FJB A;  4PJN A;  3IA3 A;  2R4N A;  3RKO A;  2E2A A;  5B66 O;  2Q9Q C;  1JNR A;  5HEH A;  3RLF F;  4UIG A;  5BR8 T;  2JMH A;  4IDP A;  3IHR A;  3SY7 A;  2BZB A;  1OED B;  4GKJ T;  3UU6 A;  2KT9 A;  4YTN A;  2WU5 A;  3F31 A;  4AQG A;  2CBJ A;  2D2S A;  4TNV A;  5JH7 E;  5F3J A;  2KXP B;  2MNH A;  4GOU A;  4N75 A;  2KZ7 B;  4ILB A;  1WR6 A;  4BJM A;  3NKZ A;  5FXV A;  2VKH A;  3AVS A;  4KX6 A;  4E7S A;  4UVC B;  1GFQ A;  4NPP A;  3PV0 F;  5L3C B;  2LHR A;  3A5X A;  1UGO A;  5CGM A;  4LF7 T;  4YJ3 E;  5JR9 A;  3RPU A;  4TWH A;  1MIW A;  2H7O A;  2K48 A;  3UUX B;  5H6R B;  4P09 A;  4UF0 B;  2WM9 A;  4DV5 T;  2YNK A;  3HOE A;  5HEG A;  3PUS A;  4QQ1 A;  4HWC A;  5AQQ B;  5ABF A;  5LJN A;  2HH7 A;  2ERV A;  4FJO A;  3GA8 A;  5JRC A;  3P50 A;  3CML A;  4HFD A;  3M3Z B;  3RYF E;  4GYR A;  3ETU A;  4X20 E;  4O2B E;  3L09 A;  3HKD E;  3RYC E;  2YDR A;  4DV6 T;  5BMV E;  3UU4 A;  2KND A;  3N9Q A;  2HPJ A;  5M4Y A;  3AEG A;  4JI7 T;  2J1N A;  4JYA T;  2XE5 A;  3T0S A;  4YHH T;  2LLY A;  2VAS A;  3H37 A;  4BUM X;  1D0X A;  5FL1 A;  4LML A;  3K3Q C;  3V5S A;  4AQF C;  5DAB A;  4HGA A;  3VZU X;  3L39 A;  5DQW A;  3JCF A;  2YEV C;  2W2U A;  4HWI B;  4ISS A;  4HFV A;  3UUN A;  1M7K A;  1G73 A;  5CA1 E;  4DV4 T;  1FMW A;  1HG2 A;  3QB5 A;  2XSB A;  3AE8 A;  2CA5 A;  1OPF A;  2XTR A;  1ZV4 X;  3UQ7 A;  2B76 A;  4O4I E;  2XPK A;  3KV4 A;  2YOE A;  1MIV A;  4ILU A;  3POU A;  2CHN A;  5AQG B;  3HKB E;  3AA6 B;  1NWM X;  3FHN A;  3UTK A;  3U3I A;  5B5E O;  1BR1 A;  2UUC T;  3ZMZ B;  2J4U P;  1IZN B;  3OYX A;  4I50 E;  1WYC A;  4DUY T;  3HKE E;  2DWK A;  3AA7 A;  4C4V B;  5FVL A;  3QRC A;  2JQY A;  1LVK A;  4ZS2 A;  4PAG A;  3LBX A;  2K0L A;  2IAK A;  5LOV E;  4AKI A;  2R6G F;  3RX6 A;  3RIU A;  1YXR A;  3NBX X;  3RC8 A;  1XDP A;  7PRN A;  3PUY F;  4PJL A;  2JQQ A;  4OHF A;  2OLT A;  2HPL A;  3HL6 A;  2KMF A;  1KF6 A;  2CWO A;  2CHO A;  5LYJ E;  5ADX L;  4ZZC A;  4EAH A;  5JTG A;  1WFD A;  4DV7 T;  3ANW B;  4U7I A;  4MLK A;  3O1H A;  4HEA A;  4ASK A;  1KNR A;  3OPC A;  2X27 X;  4D65 A;  2BKN A;  4X66 T;  2UUB T;  2L9Q A;  1S35 A;  2YK0 A;  2X9K A;  1IBM T;  2UXC T;  3O1I A;  2JMM A;  1YS5 A;  5FXW A;  3N5L A;  3K3N A;  1WYB A;  4L9I A;  1HXU A;  2XE1 A;  3RGL A;  5G39 A;  3GWH A; 
#chains in the Genus database with same CATH homology
 3NSG A;  5FVN A;  2NTX A;  2CWY A;  5JR9 B;  4NUV A;  3SOL A;  1QJ8 A;  3E08 A;  4PW8 A;  5HXC A;  5DL8 A;  3V8U A;  5T5F A;  3WAK A;  1MMG A;  5JDQ A;  4YLH A;  4JEU B;  2J1D G;  1YKE B;  5HWY A;  2FGQ X;  2F1V A;  1US7 B;  4O4U A;  4OYK A;  1YKH B;  3WI3 A;  4L0R A;  4UV9 B;  2N2L A;  4FSO A;  4I43 B;  2GK9 A;  2XAJ B;  3MZK B;  4D5U A;  3F57 A;  3MK7 C;  3CQX C;  2MHL A;  4U74 A;  2EHO D;  5F8P A;  3Q5X A;  4H9N C;  4DBR A;  3PQS A;  5D5D A;  1LVF A;  5LA6 E;  5LHG B;  1PRN A;  3T20 A;  4HTE A;  3ZMU B;  5FXX A;  2CLY C;  4UEM A;  2W80 C;  2Y0K A;  4CQI A;  1GFN A;  1Q9F A;  2E9X C;  3N2K E;  2X9H A;  5JRC B;  2X9W A;  3CQG B;  2KXP A;  1HG5 A;  2BVL A;  1BT9 A;  4Z8X A;  4CXX A;  3LK3 A;  5JDF A;  1ZHX A;  3QRA A;  2KZ7 A;  3OKQ A;  4PFP A;  2LSI A;  2X67 A;  3EVY A;  5LBM A;  3KFW X;  2JJ9 A;  1MND A;  2BDE A;  4F4B A;  4QWN B;  1SHZ C;  1UCU A;  2JRK A;  2VK9 A;  2WBL A;  3N2G E;  2MBG A;  5KDM C;  4QHO A;  4FT6 A;  4UXN B;  2NW7 A;  2ZM0 A;  4JUY A;  2WMN A;  4KUM B;  3JC6 C;  4MFR A;  4QX8 B;  3IF8 B;  3Q5W A;  4EZ4 A;  2NOX A;  1MMA A;  4YJ2 E;  4RLC A;  2X0L B;  3AVR A;  5LGU B;  4BA9 A;  4N58 A;  2DLR A;  4DO0 A;  3J9X 1;  4EXT A;  4RJW A;  4WNK A;  1LRZ A;  3LJC A;  4AKM A;  4JEH B;  3E0Z A;  4ZI3 C;  4AQF A;  5DJQ C;  1Q9G A;  3AAE B;  3DA3 A;  3KVD D;  4O49 A;  4X1I E;  4KRA A;  3S4U A;  3I0Q A;  4UVA B;  4F6R C;  4IE6 A;  3DA4 A;  2V1D B;  4HN9 A;  2V7L A;  3O0E A;  5GV0 A;  2V7I A;  3FBZ A;  3FXE B;  3PDY A;  3CX7 B;  3IEE A;  4G63 A;  4UF0 A;  2VL8 A;  5LJM A;  5ADX K;  3C5O A;  4QX7 B;  5AFU L;  1S94 A;  2W62 A;  5JR9 C;  4LSI A;  4ADZ A;  3SZV A;  3VE2 A;  4FMS A;  2XAG B;  3ZC0 A;  2DWG A;  2N9D A;  1HX8 A;  5HWX A;  2Y2X A;  2X9Y A;  4HKA A;  4ZHQ E;  1BR0 A;  1HCI A;  3VE1 A;  4AYD C;  6PRN A;  3LG7 A;  4EIW A;  4WW0 A;  2QGS A;  2W0G A;  5H6Q B;  1H7C A;  3KIN B;  2K24 A;  4U9C A;  4DMW A;  3CQC B;  2EHO A;  3PUR A;  5JQG E;  4AYN A;  3U78 A;  5HXS A;  3AAI A;  4E1S A;  3A2S X;  8PRN A;  2KWI B;  4TV9 E;  2XE2 A;  1D0Z A;  3POR A;  1T98 A;  2ODJ A;  2WWU A;  1D1C A;  4AKR B;  3SS1 A;  1OSM A;  2P9B A;  4AFK A;  3SY9 A;  4IIJ E;  2XAF B;  3GMI A;  4UEL A;  4CZZ B;  2YPV A;  2LOP A;  4XZC A;  5LCY A;  5JDG A;  1ZHZ A;  3RYI E;  2N2M A;  4FES A;  4C91 A;  4GCP A;  4JFB A;  3DTO A;  4J2C A;  1CUN A;  3ETV A;  5FY7 A;  1QJP A;  3T24 A;  3POX A;  2KC0 A;  1FEW A;  4KR4 A;  3C51 A;  3UU2 A;  4IST A;  3AA7 B;  2WAU A;  1D1A A;  4PJM A;  3AAA B;  4EZH A;  4WBO A;  1THQ A;  1GFO A;  2FGR A;  2W61 A;  5L3E B;  4LSE A;  2WMO A;  1X79 A;  3N2O A;  4BJN A;  3LBX B;  2VWA A;  1HTJ F;  5IYZ E;  3VY8 X;  4Z3T A;  2Y8D A;  3KVB A;  4AZL A;  4ERR A;  3N9O A;  3CX6 B;  4ZOL E;  2CXD A;  4TUY E;  3J7Y q;  4FSP A;  2Q9Q B;  5LHI B;  1YW0 A;  4ZI2 C;  2ZM8 A;  2CCQ A;  4M1P A;  5JRE A;  4O3Z A;  2JPF A;  3R84 B;  4KP3 C;  2LSG A;  4O3X B;  3UFE A;  4DND A;  2PFV A;  3PUG A;  2XE3 A;  3P8C D;  3GP6 A;  1G8X A;  5HYA A;  2DI4 A;  2XUE A;  3RRW A;  3K3O A;  3AA1 B;  3TKL B;  1GFM A;  4EYU A;  5DL7 A;  1VRB A;  2E9X D;  2NTY A;  4E1T A;  2LJL A;  2X51 A;  4O4H E;  4N78 D;  4CI1 B;  4H9R C;  3E22 E;  3PTR B;  4AXP A;  5CA0 E;  3ZPO A;  4EOZ B;  1ORM A;  4LSF A;  5IYU A;  2ACX A;  4RL9 A;  2LEH A;  3RH3 A;  4EB6 E;  5JVD E;  2ODU A;  4ZS3 A;  4DMV A;  1Z0P A;  4IE7 A;  4RJX A;  2N2N A;  2Y6X A;  1GFP A;  1ZEE A;  3O4X E;  1G90 A;  4AKL A;  2W00 A;  3AA6 A;  3JC6 D;  3MA9 A;  4H9Q C;  4DVD A;  3O1J A;  2V7M A;  2K5B B;  3PU8 A;  4CXY A;  1PHO A;  1ZHW A;  4X1K E;  5LGT B;  1IZN A;  1O3X A;  4BAY B;  2LHF A;  3HWB A;  4XNL A;  2A2F X;  1BR2 A;  3I0O A;  2L8K A;  4ZI3 D;  4GYS A;  5J1G A;  5LBQ B;  2ZM2 A;  3AB3 B;  3PE0 A;  5FNV E;  5DL5 A;  2VKJ A;  2XQY A;  3AA0 B;  5JDP A;  4IDZ A;  4PNI A;  2LSY A;  3OYZ A;  3ZJ2 A;  4ANJ A;  1MIY A;  1KK7 A;  1MMN A;  3P7I A;  3G7G A;  3SYS A;  2H7V C;  5L3B B;  5LNK A;  3WAJ A;  1MPF A;  2Z6E A;  3RBH A;  3SYB A;  3OJA A;  4O8S A;  2M07 A;  3C64 A;  2Y48 B;  2M06 A;  4CI3 B;  2ZFG A;  4FRX A;  3UPG A;  3N9P A;  3SZD A;  4H9P C;  4GCQ A;  3BQL A;  4MBQ A;  1FIO A;  4MAL A;  5FY0 A;  4WBN E;  2PJQ A;  4PJN A;  2VKO A;  3RKO A;  3SWH A;  2DNX A;  3FBL A;  3MAC A;  4PUX A;  1B7T A;  2Q9Q C;  3HOL A;  4H9O C;  3KBT A;  5FMN A;  1QJ9 A;  4C90 A;  5AFU K;  2XAQ B;  2MOZ A;  3ZMT B;  4GK5 E;  5EK2 A;  4UIG A;  3OBV E;  2JMH A;  2ODV A;  4MHC A;  1BXW A;  3IHR A;  2B1E A;  2LE8 A;  3GN5 A;  2XTL A;  3WI5 A;  2E9X A;  5EK4 A;  2BZB A;  3SY7 A;  3R6N A;  4OYJ A;  2KT9 A;  4PK4 A;  3LK2 A;  5KX5 E;  2LT3 A;  1ZHT A;  3F31 A;  4AQG A;  3ANW A;  1LKX A;  1P4T A;  1IJ5 A;  2WSS V;  2D2S A;  2X9X A;  3C4W A;  5JH7 E;  1ZHY A;  3O9X A;  5F3J A;  3C4X A;  4XAX B;  5L3G B;  3POQ A;  3NRX A;  2DHR A;  2KXP B;  2MNH A;  3CVR A;  4GOU A;  1MMD A;  3KV6 A;  3LK3 B;  2ZLD A;  4H63 H;  4GIW A;  5L3D B;  2KZ7 B;  2PBI A;  1WR6 A;  2YU1 A;  4BJM A;  4XBF B;  1E1H B;  5FXV A;  3RC3 A;  2VKH A;  2LSJ A;  3LFM A;  3AVS A;  3V5U A;  3HR0 A;  5FYM A;  4E7S A;  4O2A E;  5LXT E;  3ESL A;  3M65 A;  2IC6 A;  2NWB A;  4UVC B;  5IHY A;  4QXC B;  4ZI2 D;  1WLX A;  3UUL A;  1GFQ A;  4GF4 A;  4FZN A;  2IC9 A;  2UXX B;  2K9A A;  5LP6 E;  2O4V A;  3C4Z A;  2LHN A;  2D0T A;  4PJJ A;  5L3C B;  3FXD B;  2LHR A;  3A5X A;  2CM0 A;  2PRN A;  3BQK A;  1IJ6 A;  3VHL A;  2CEA A;  4YJ3 E;  5JR9 A;  3RPU A;  1MIW A;  2H7O A;  2K48 A;  3KV9 A;  3UUX B;  5H6R B;  4D64 A;  4FOZ A;  3HI2 A;  3ZN0 B;  2XMX A;  3PRN A;  4P09 A;  1QSD A;  4UF0 B;  2XG6 A;  2WM9 A;  3ZMV B;  2KWH A;  3QC9 A;  1V9D A;  5HXE A;  2YNK A;  3LK4 1;  1NAF A;  3HOE A;  3MXZ A;  3SRZ A;  3QUJ A;  2NP9 A;  3PUS A;  1D0Y A;  4QQ1 A;  5JDN A;  2XTQ A;  2C0S A;  2D5U A;  1U4Q A;  2I59 A;  2ZMA A;  1AJ3 A;  3K19 A;  2NW9 A;  5JDH A;  2LOS A;  2KLQ A;  3C98 B;  5PRN A;  5LJN A;  2HH7 A;  2ERV A;  3ZJ1 A;  1HF8 A;  4FJO A;  3GA8 A;  5JRC A;  2EHO B;  1Y64 B;  3CML A;  3Q2M A;  1QUU A;  1H6S 1;  2KDY A;  4AYM C;  4GK0 E;  1UX4 A;  3RYF E;  1OXZ A;  4GYR A;  3ETU A;  4FUV A;  4X1Y E;  2V7J A;  3ZCJ A;  4X20 E;  4CI2 B;  5DL6 A;  2X68 A;  5HXR A;  5LG4 A;  3WI4 A;  4O2B E;  5DQV A;  4IGU A;  5L2L A;  3L09 A;  4PFO A;  2VKD A;  3HKD E;  3RYC E;  1MM5 A;  2L3L A;  5BMV E;  1MNE A;  2RP4 A;  4O3Y A;  2QA7 A;  1D1B A;  4AKG A;  2KND A;  3FB2 A;  3N9Q A;  2CMR A;  2HPJ A;  2VB6 A;  3I9W A;  5LHH B;  2M67 A;  2XHE B;  3QK6 A;  5M4Y A;  4RLB A;  4A56 A;  2C5J A;  2J1N A;  2OMF A;  3HW9 A;  4G75 A;  2Q9Q D;  2XE5 A;  3AAE A;  3T0S A;  3ZYM A;  2VAS A;  3I9Y A;  2IW5 B;  3EDU A;  3EUH A;  4IE0 A;  4B6X A;  3H37 A;  4YHJ A;  4BUM X;  1D0X A;  2PG8 A;  4QKN A;  3N9N A;  3ZC1 A;  2Y7S A;  4O4J E;  4G76 A;  4QXB B;  2H3R A;  1SA0 E;  3K3Q C;  2RA1 A;  2W63 A;  3V5S A;  4AQF C;  3PUA A;  4HGA A;  5DAB A;  1BH3 A;  3Q9D A;  1FMV A;  3VZU X;  4QXH B;  5DQW A;  1KNZ A;  2YEV C;  3UT5 E;  5TAO A;  4ISS A;  4L5G A;  4TN7 B;  4TV8 E;  4HFV A;  3UUN A;  1G73 A;  5CA1 E;  2G0U A;  2OA5 A;  4KR8 A;  3KBU A;  3CWZ B;  4N59 A;  5J2T E;  3VZW X;  1FMW A;  1HG2 A;  4B61 A;  4ZI7 E;  1IAP A;  4UVB B;  2CA5 A;  1OPF A;  2XTR A;  1ZV4 X;  4HE8 A;  4NUU A;  3NZQ A;  4LSH A;  4O4I E;  2Y0L A;  4H63 V;  5HAX A;  1MM4 A;  2BVM A;  3KV4 A;  2QTK A;  4AYE C;  4V1A v;  1UX5 A;  4FI5 A;  4YFS A;  1MIV A;  4ILU A;  4FZL A;  4AKR A;  2V7K A;  3POU A;  2CXF A;  3F2E A;  3HKB E;  2EHO C;  1NWM X;  2MTQ A;  3AA6 B;  3FHN A;  3NRY A;  3U3I A;  3UTK A;  3ZYL A;  2X66 A;  1BR1 A;  3MKD A;  4DBQ A;  3VKG A;  1E54 A;  3CPZ A;  2E8I A;  3LK4 2;  3ZMZ B;  2J4U P;  2LSK A;  3N9M A;  1IZN B;  3BQI A;  3OYX A;  4I50 E;  4PK6 A;  5FXZ A;  1WYC A;  5A1L A;  2D0U A;  2A72 A;  5HXH A;  2UXN B;  5JDM A;  5EK3 A;  3HKE E;  3K8P C;  1ZHC A;  4XNK A;  2DWK A;  3PU3 A;  2V26 A;  2YU2 A;  3AA7 A;  4G2A A;  1U5P A;  3AAA A;  3QRC A;  3VU7 H;  3T8O A;  3L3P A;  5E0O A;  5G26 A;  3C50 A;  5LGN B;  1LVK A;  4ZS2 A;  1OWA A;  2POR A;  2XAH B;  3LBX A;  4PAG A;  1VOM A;  4IE5 A;  4KBM B;  2K0L A;  2IAK A;  3DP7 A;  5LOV E;  3JTY A;  2MYS A;  3BK9 A;  4AKI A;  2LM9 A;  3B57 A;  3HKC E;  2Q9Q A;  3RX6 A;  3CKD A;  2XAS B;  3UUM A;  4CXW A;  3FYX A;  4TX5 A;  3D0T A;  5L3F B;  3NBX X;  3RC8 A;  3MJX A;  3UAQ A;  1EZ3 A;  2DCF A;  4AKH A;  7PRN A;  2N1G A;  2YIN A;  1WRD A;  4PJL A;  4UV8 B;  2JQQ A;  4EYY R;  4OHF A;  3AA1 A;  1HXT A;  1ZKE A;  4OK0 A;  4IHJ E;  3HA4 A;  2JMK A;  2NW8 A;  3ZMS B;  4TZ4 C;  2HPL A;  3KDS E;  5C8Y E;  3HL6 A;  1HFA A;  2KMF A;  3ONX A;  1BR4 A;  2CWO A;  2W81 C;  5FP3 A;  3VKH A;  3ZEF B;  2CLY B;  5GON E;  3GN5 B;  5LYJ E;  4P0A A;  2E9X B;  2Y0H A;  3VZT X;  2C5K T;  3DJB A;  5ADX L;  4O4L E;  4GCS A;  3LK2 B;  2KIN B;  4EAH A;  3KV5 A;  3TZG A;  5J2U E;  4O3W A;  5KMG P;  3ANW B;  4I4T E;  2LFU A;  4MLK A;  5EZY E;  3O1H A;  4HEA A;  4FRT A;  2C5I T;  2ZLY A;  4C69 X;  4PK5 A;  4ASK A;  3ZCI A;  3EDV A;  3EMN X;  4AUI A;  1YD8 G;  5JDL A;  3I1A A;  2K4T A;  2X27 X;  3ZYK A;  4OFZ A;  4FZM A;  4D65 A;  5EE2 A;  2F1T A;  2ES0 A;  3KVA A;  3CX8 B;  2GE4 A;  4P0B A;  2A3D A;  2L9Q A;  4IE4 A;  3ZN1 B;  3AA0 A;  4I55 E;  1S35 A;  2YK0 A;  3RYH E;  4JLE A;  5FY1 A;  4JCH A;  4K0U A;  2CE7 A;  2CXL A;  3B13 A;  3VY9 X;  3H3A A;  3N9L A;  3O1I A;  2SPC A;  3NZP A;  5ETW A;  4E7Z A;  2JMM A;  1YS5 A;  4O4X A;  5FXW A;  1HXX A;  3N5L A;  3K3N A;  1HS7 A;  1WYB A;  3PQU A;  3ZLI A;  4GHB A;  3RRC A;  4U72 A;  4H9S E;  4L9I A;  1HXU A;  3W15 B;  2XE1 A;  4AYI D;  4AI6 A;  5CB4 E;  3PUQ A;  3IBP A;  4KMC A;  3GWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...