3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
2KXPA 4AKRA 2KZ7A 3LK41 3LK42 5ADXL 5AFUL 3LK2A 3LK3B 3AA1B 3AAAB 1IZNB 2KXPB 4AKRB 2KZ7B 3AAEA 5ADXK 5AFUK 3LK2B 3AA6A 3AAEB 3AA7A 3AA0A 3AA6B 3AA7B 3AA0B 3LK3A 3AA1A 3AAAA 1IZNA
chains in the Genus database with same CATH superfamily
5LHIB 4PFOA 1Z8UA 5HYAA 3KVAA 4JV5T 2W00A 4AYMC 4LF7T 1ZHTA 2XQYA 3MXZA 3P8CD 3VZUX 1KNPA 5ABFA 4TWDA 1Z0PA 4UIGA 4TZ4C 4K0KT 4RL9A 2XTQA 5E0OA 1PRNA 3RBHA 2KMFA 4LFCT 2BKOA 5HCJA 3ZMSB 2MHLA 4DUYT 3ONXA 2HHHT 4ILAA 2HN1A 1NENA 3Q5WA 3TLTA 5AQHB 2LEHA 2UXXB 2CA5A 4CXXA 4ILBA 1S5LO 2C5KT 3N5LA 4UF0B 5HEJA 4AYDC 3CMLA 4KR8A 1HNWT 4AYID 4IIJE 4AFKA 2J47A 4GCPA 4MALA 2D2SA 3FYXA 4O4UA 2BG9C 3Q5XA 1BXWA 4AUIA 4EV6A 3EHZA 1DU2A 1H7CA 2H7VC 2BDEA 4UV9B 4KHZF 4IL9A 2CWOA 1VRBA 1YD8G 2QRXA 2XE1A 3PGUA 3LK3A 2JMKA 4KI0F 2XAHB 2W66A 4C4VB 3SZVA 3M3ZB 4MHCA 2WWUA 5DL6A 2Y8DA 4X64T 3KBTA 1NEKA 2ZM0A 4U9CA 3POUA 3L8RA 4F8HA 4LFAT 2J4UP 3AA0B 3CWZB 4QXCB 4PJLA 4UXNB 4AKHA 1E7PA 1SE7A 3PV0F 4EZ4A 4TNVA 3AEFA 3RLFF 3IA3A 4P09A 1XNQT 4FRTA 1WCRA 1T8BA 1MIYA 1HCIA 4PJJA 3A0HO 5HCMA 5F3JA 1OSMA 4UB6O 3UU3A 2X9KA 5GV0A 3GMIA 5HXEA 3FZHB 2XQ8A 4DV7T 3UQ7A 1WRDA 3E08A 3SWHA 3P4WA 2ZLDA 1MIWA 2DWGA 3C98B 3RRWA 4IE5A 2H7OA 1FJGT 2PTFA 3CX6B 4IL4A 4PJNA 4C4VA 4JCHA 2WWVA 1UX4A 5IHYA 5AQPB 4JI2T 3RIUC 4EGWA 5EK2A 3RQWA 2JQQA 3V5SA 5AQKB 2VKHA 1VCTA 1OPFA 1XZYA 4Z90A 3OJAA 3A7MA 2XQ4A 5AQGB 3IF8B 4LF9T 5JDPA 3K1SA 3O0EA 2XZEA 2MTQA 2JQHA 3UUMA 2H88A 3BQIA 2W2UA 3K8PC 2NW9A 4BAYB 3NSGA 3AE4A 5JDNA 3JADA 5JDQA 1KEYA 1FMVA 3ONLC 2UXNB 4HGAA 4DR6T 1WFDA 4IDOA 3EMNX 3PGSA 2XTRA 1XMOT 4AZLA 3ETVA 4IT4A 8PRNA 3P4RA 2WS3A 2CHNA 2DNXA 4IE7A 4B3TT 2XQAA 3RYHE 2IC9A 1X9BA 3K3QC 3OYZA 2N2NA 3GN5B 2X0LB 5KDMC 4OFZA 1N36T 4H63H 5C2TA 2X67A 1MMDA 2XAGB 4CXYA 1SUMB 4FRXA 2WSSV 4A97A 4O4XA 4QQ1A 2JQ9A 4ISTA 2E9XD 2FJEA 4COFA 3ZT7A 4DV4T 1HXTA 3PRNA 2CLYC 3V5UA 2KLQA 1MNDA 5HXHA 5FL1A 5LBMA 2W4XA 3U78A 3SY7A 5J1GA 1WYBA 1XWMA 1J5ET 4AKIA 3FBLA 4BA9A 3PUYF 4KMCA 2KC0A 1T1LA 3QRCA 4DV2T 5AQFB 2YN6A 2EHOC 3FHNA 4FSOA 4O4LE 1HX8A 2BKNA 3Q9DA 2AXTO 4PJ0O 2IWWA 3VE1A 4NUVA 3GWHA 4N74A 2WDQA 4YY3T 1WLXA 2UU9T 1QLBA 3GN5A 3ZT5A 5LG4A 2XY8B 2YK0A 4D64A 3N9MA 3UPGA 4ANJA 3MACA 5CGMA 3DP7A 3UU5A 4DNDA 3B57A 1J1JA 2E5VA 4DBRA 2J62A 4Z8XA 2HPLA 3ZKRA 3HR0A 2KDYA 4AQFC 2F1VA 4YT0A 1J5WA 4PFPA 2IUBA 3ZCIA 4QXBB 2PJQA 5FNVE 4HFHA 4X66T 2DLRA 2JQYA 5LBQB 2WBLA 1I94T 1XNRT 5HEHA 4LSIA 3BRZA 1SA0E 4EEDA 4JI5T 4DO0A 4ADZA 4AIUA 4LSHA 3KV5A 4IHJE 1GFMA 4QXHB 4KP3C 3EI0A 4G75A 5FKYA 3K19A 3ZMVB 1QSDA 1FMWA 3KVDD 1I6ZA 4LMJA 4QH4A 4O49A 3QK6A 4JFBA 3RYCE 4YJ2E 5JR9C 2CBIA 4NPPA 4ZZCA 3DA3A 4TV8E 5LA6E 4WBNE 3RPUA 2KZ7B 3L3PA 3TLUA 2X9XA 1OEDC 2BS4A 2K24A 4DVDA 2LHNA 5HXSA 2NOXA 4C91A 1M7KA 5AFUL 4JI4T 4HFVA 4U72A 3RIAA 4UVCB 3O4XE 1BT9A 2XUEA 3ZJ2A 2E2AA 2L3LA 2KWIB 5ABGA 3M65A 2KWHA 2VL0A 2W61A 2C5JA 3VRAA 5L3EB 5JTGA 2ZFGA 4ZI2C 1EZ3A 3KVBA 1T7SA 3UFGA 4HFCA 2X66A 3KFWX 4GF4A 3NZQA 4GOUA 2X9YA 4XBFB 2LLYA 2CRBA 2MAWA 2YOEA 3SRZA 3ESLA 2CXLA 3UU8A 3BQKA 3NWIA 2K3WA 3JC6C 2WU5A 3VY8X 2KZ7A 2R8AA 4CI3B 5H6RB 4EYYR 4Z3TA 4IGUA 2YINA 5HWXA 2WP9A 5T5FA 4H9QC 4JI8T 5ADXK 5FL0A 3Q5DA 4E7SA 2W63A 5CFBA 4PUXA 3RYIE 2LHRA 3VR9A 3HW9A 4JI1T 4O4HE 3N2KE 4J2CA 5LHGB 2XAJB 3UQ4A 3SYSA 2OA5A 1KNRA 2QYWA 2JQKA 3HWBA 2Q9QC 1E54A 1IBLT 3O1IA 2IAKA 4LF5T 4PW8A 3VU7H 1PHOA 2ACXA 3KV4A 2XQ3A 4DR4T 5KX5E 4NXNT 2YU1A 2R88A 4OK0A 3SY9A 3N2GE 4FJOA 3WI3A 3HI2A 1JNRA 2ES0A 4QHOA 2BBHA 3AECA 1D1BA 3H37A 4CXWA 4I4TE 4EXTA 5G3AA 5B5EO 2WMOA 3LBXA 2GK9A 2XHEB 4UELA 4O2BE 4TNWA 3PTRB 3P4QA 3HA4A 5FXVA 3PUZF 2NTXA 2HPJA 5KMGP 3WI5A 3ZSTA 5LB7B 4YJ3E 2D5UA 2E9XB 2PFVA 2NW8A 2VVSA 3J7Yq 2CE7A 3KDSE 4L5GA 4X1YE 2F1CX 3SOLA 3C4XA 3AE9A 1ORMA 4A56A 4AXPA 5L4HA 5M4YA 3ZEFB 4AYEC 3POXA 3UAQA 2VQET 4UR9A 2CXDA 2ODUA 3RC3A 3SZDA 3AE8A 3MA9A 1G90A 3N9QA 5DQVA 4FOZA 2XE3A 1L0VA 5L3FB 2MOZA 5IUXA 2MNHA 4E1TA 3AE3A 5AFUK 2V7IA 4IE0A 4JEUB 1V9DA 3AAIA 3Q2MA 2XTLA 3SFEA 4X65T 1ZHCA 5ABEA 2E9XA 2LKGA 1ZHZA 2Y7SA 3ZN0B 4HEAA 1HG2A 2V7KA 3TLSA 4DMVA 3C4WA 4QX8B 1LVFA 3A8YC 4DBQA 3PURA 3AEGA 4IREA 5IYZE 3ZSSA 4X62T 2LOPA 3H3AA 1HR0T 3PJAJ 1GFNA 2QTKA 1LKXA 4JBWF 3KBUA 2IC6A 4B3RT 5L4EA 2V7LA 2JMMA 4YTNA 4ZEYA 2I0MA 1MMNA 4JEHB 4YSYA 4JI3T 4GIWA 5JDFA 3R6NA 4WZXA 5L47A 1T98A 5AQNB 4RLBA 5LG3A 4UF0A 1QJPA 4NIQA 4ERRA 1IJ5A 2RP4A 1MIVA 3VZWX 5H6QB 2XAFB 1UK5A 4ZI3C 2OV9A 1BR2A 4U31A 2N1GA 3EABA 2LSKA 1IBKT 3UU2A 2R89A 4WBOA 5GTIO 4F6RC 3KV6A 3AE6A 5DL8A 4D65A 4CN6A 3NRXA 3PUQA 4AKLA 5LHHB 2XM1A 4NUUA 3W15B 2X0HA 4YHHT 4JI7T 1SHZC 5FY1A 4GKKT 4TX5A 5C3JA 3LJCA 1WR6A 4CN4A 2A2FX 4QH5A 3LK42 4PK4A 7PRNA 4TWHA 3ZC0A 4WNKA 3QB5K 4EB6E 4XNKA 2N2LA 1Y64B 3AA0A 2QGSA 1KK7A 2LSGA 2XJ7A 3I0QA 3FZLB 2RPAA 5FY0A 1FEWA 3OBVE 3X1DA 2VVNA 4GHBA 2WM9A 2YU2A 3P4SA 4U2YA 3C4ZA 2WDVA 1E2AA 3PQUA 5AQOB 2LE8A 3N2OA 4HWFA 2FGRA 1CUNA 3MKDA 2W67A 4IDQA 3UUNA 3F2EA 4ZHQE 2XQ6A 1T72A 3AEDA 5JDLA 2V7MA 5EK4A 3TKLB 2LT3A 2A3DA 3DWNA 2JJ9A 5FMNA 4H9NC 2FJAA 2KNDA 4I50E 4Q25A 5DJQC 2XE2A 2KSRA 4AYNA 2YEVC 2VURA 1S94A 3BK9A 2X51A 3NKZA 4JLEA 2NWBA 4IDZA 2LSYA 3UU6A 4N78D 3GP6A 4A5XA 2XSAA 3OTOT 3RIFA 4AQGA 4WYVA 3P7IA 3UUBA 1HTJF 2BG9B 4LF6T 3VKHA 3U3IA 3CQCB 2LOSA 4OX9T 2PG8A 4QX7B 3AE2A 5DL5A 1IBMT 4KRAA 3D0TA 1ZHXA 5ADXL 2O4VA 3CX7B 1YW0A 1GFOA 4ZXLA 3CQGB 3CK6A 1UCUA 1WR0A 2Y2XA 2M6IA 4O4IE 2IMLA 3PJAA 3PORA 2YPVA 4X20E 3IEEA 1T16A 4QWNB 5IYUA 3MJXA 1NWMX 1QJ9A 3QRAA 4CQIA 2UXBT 4DR3T 4O3ZA 1AJ3A 4H9PC 2CXFA 3RRCA 2CHOA 3JAEA 4GCSA 5GTHO 5A1LA 3MK7C 1IJ6A 2PBIA 2BG9A 2W80C 1MM4A 3FZKB 4GKJT 2R6GF 1HNZT 4CN1A 1GFQA 2XM2A 2YNKA 2WCAA 5FVKA 3AB3B 3WAJA 4ISSA 3ZN1B 1G73A 3AA1B 4V1Av 3SYBA 4PNIA 3SS1A 2BZBA 1BR0A 3PUGA 4O8SA 3CPZA 3ZYKA 1BR4A 5LMNT 3N9OA 5ABHA 3O1HA 2NTYA 4HFEA 4LF4T 2Y6XA 2K5BB 5HXCA 3FBZA 3UFEA 2H3RA 1XDPA 5AQSB 3LSVA 3RC8A 3UT5E 2XQ9A 4G63A 3C51A 1M62A 1N33T 1G8XA 3FXDB 2AXDS 4GK5E 3ZJ1A 2WMNA 2WU2A 2X68A 2IWVA 2IW5B 4DV1T 3IHRA 4TWFA 1XMQT 2XQ7A 5C8YE 3CKDA 4LSEA 2ZM8A 1ZHWA 3GA8A 5J0ZA 3OKQA 5FXZA 2MYSA 5HWYA 2V8SV 4FI5A 5HEGA 2JRKA 2ODVA 3FZFB 3Q5EA 2IHR1 2YDRA 3F57A 4B3MT 5FVNA 3AA1A 4U7YA 4O3WA 1D0YA 3NZPA 4X1KE 4H9RC 2R4NA 3V8UA 4FUVA 3L39A 2WAUA 1MMGA 2LM2A 1HXXA 4FZLA 4EAHA 4K0UA 3ZMUB 5FVLA 2XG6A 2CLYB 2W81C 5ETWA 2V7JA 4AQYT 2WDRA 2AE9A 2YDQA 3P4PA 4DV0T 4HWDA 4TUYE 2Y0LA 2V26A 2M67A 3AA6B 3HKCE 2WJRA 3AA7B 3I0OA 3QC9A 3UU4A 2B76A 3VRBA 5FXXA 5LCYA 4JI0T 4QH1A 2EHOB 1KF6A 4YSZA 3HKBE 1D1CA 4H9OC 2UXDT 2BG9E 4U2ZA 1YKEB 4TV9E 1US7B 3TLVA 1NAFA 4KX6A 2OMFA 4AKGA 5EZYE 5CA0E 2XE5A 4B3ST 4FMSA 2K48A 1CHUA 1B7TA 2PRNA 1W0AA 3G06A 2N9DA 2NP9A 3G7GA 2UUCT 2VASA 2X9HA 4IE6A 3ZMTB 4L9IA 5L3BB 4O4JE 3AE5A 4ZS3A 2WY2A 2XQ5A 4EOZB 4K3BA 5EE2A 4DR7T 4PJMA 1D0XA 3PUVF 2WB5A 3JTYA 2NR4A 2RA1A 4XZCA 3FZMB 2BBJA 2CMRA 1P4TA 1QUUA 3CQXC 4N75A 2KT9A 4WW0A 4DR5T 3VHLA 1OWAA 1O3XA 5JREA 2P9BA 3C5OA 1UX5A 3CIRA 3AA7A 2IIUA 1LVKA 4X5TA 2R4PA 5AQQB 5HEUA 4YTMA 2BS3A 4YLHA 2ZMAA 3PQSA 2I6HA 4IE4A 4CTDA 1HFAA 1W0BA 2FBWA 4KBMB 4ZZBA 3JCUO 2K0LA 5JR9B 2BS2A 3QNUA 2HH7A 2YKSA 3PF1A 1OXZA 3AAEB 4P1NA 1MM5A 2X27X 2N2MA 5TISO 2ODJA 2XSBA 4H9SE 5B66O 5G39A 3PGRA 3ZT6A 5KXJA 1QJ8A 5LJMA 2V1DB 4ZI3D 1OEDB 2R4LA 2JPFA 4GK0E 4GCQA 4UV8B 1GFPA 3KZIO 5KAIO 3AEAA 4AQFA 2JIWA 2ZLYA 5TAOA 2BKPA 2CPTA 5JVDE 2C5IT 1HG5A 3PE0A 4KUMB 3QB5A 3T8OA 2MPKA 3E0ZA 5LGTB 2FJDA 2FGQX 1MNEA 3LK2B 1UURA 4ZOLE 3RX6A 4FSPA 5AQUB 3VE2A 4EIWA 4O2AE 2LKHA 5AQMB 1VOMA 4I55E 5JQGE 5JR9A 5DQWA 2VKJA 4GYRA 4OHFA 1KNZA 3HKDE 2ERVA 3AAEA 4O3YA 3LDQB 2CWYA 4Z91A 3FXEB 2V6YB 3C64A 4LMKA 4OYJA 1W09A 4PAGA 4LF8T 4HWCA 5AQLB 4HWHA 5LNKA 5FP3A 5JDGA 2QA7A 2ZM2A 3EVYA 3OVUA 4DV5T 1OEDA 1BH3A 4BUMX 3AAAB 1IZNB 2K9AA 2A9UA 5HAXA 4LSFA 1N32T 3LFMA 3JCFA 4O3XB 2WJQA 2Q9QB 5LMUT 2XASB 5AQTB 1FIOA 2LSIA 3AE1A 4G2AA 3AVSA 3HOLA 3LK2A 3JAFA 4A98A 5JRCB 4P0AA 2KXPB 3CX8B 5LXTE 3QUJA 4HFBA 2LM9A 5KAFO 3N9NA 4HWIB 2PORA 5HEOA 3RKGA 4PR7A 1Y01A 3K3NA 3I1AA 2VKOA 2F4VT 3ONJA 4YFSA 5GONE 5CB4E 3WAKA 2V6YA 4F4BA 2WQYA 3UULA 5J2TE 4JYAT 1THQA 2DCFA 4DR2T 1JNZA 2DWKA 3NRYA 2M07A 4D5UA 4G76A 5LGNB 4IDNA 3I9YA 3AAAA 1IZNA 4P0BA 4QKNA 2EHOD 3NBXX 6PRNA 3E22E 4JI6T 2V5CA 2IDOB 4I0UA 3ZYMA 1HF8A 4CI2B 5FY7A 5LGUB 3DTOA 4TN7B 1YXRA 2Q9QA 3N9PA 1YKHB 3AVRA 5L3DB 2L9QA 5F5WA 2DHRA 1UUSA 2W0GA 5JRCA 4U33A 3UTKA 2KXPA 5JDMA 5FYMA 2E8IA 3IBPA 5G38A 2UUBT 4RLCA 4DV6T 1E1HB 3DA4A 2VWAA 5CA1E 1U5PA 4XAXB 3O9XA 4BJMA 1X79A 4UVAB 3RH3A 3PDYA 2X0YA 3R84B 3RQUA 2H89A 3VKGA 3LK41 5FXWA 3OPCA 4HFDA 1WYCA 4ILUA 4C69X 1IAPA 3ETUA 4ZI7E 2UXCT 4C90A 2C0SA 1UGOA 2D0UA 2F1TA 1YQ4A 4U74A 4HFIA 4JUYA 1OEDE 3C50A 5BR8T 3A2SX 3B5MA 4EYUA 2SPCA 2B1EA 3A5XA 5J2UE 2CCQA 4YXDA 4KHPT 4HN9A 3AE7A 5AQJB 3ZYLA 3EDVA 2X9WA 1YS5A 5AQIB 2LRLA 3K3OA 3WU2O 3P50A 5AQRB 5L3CB 1H6S1 4E1SA 1MPFA 4HE8A 5AQVB 1ZKEA 2J1DG 3TLWA 5IWAT 3NJTA 1VCSA 1XDOA 2DI4A 5L2LA 3OYXA 5DABA 3B13A 1ZEEA 3AXJB 1ZP0A 3ZLIA 3O1JA 4GYSA 4XNLA 3VZTX 3FB2A 4DIDB 4OYKA 1HXUA 2J1NA 3KV9A 3T1YT 2E5LT 2Z6EA 4BJNA 5F8PA 2LFUA 4YSXA 1LRZA 4DMWA 4ZI2D 3RYFE 2VQFT 5HXRA 4MFRA 1Q9GA 5LOVE 4AKRB 3DWOX 2K4TA 2V5DA 4B6XA 4I43B 3ANWB 2E9XC 3ZC1A 2VL8A 4H63V 3JC6D 2MBGA 3PUWF 2Y0KA 3HL6A 4MBQA 4LMLA 4PK6A 4B61A 2D0TA 5LP6E 3CVRA 3RI5A 3ZPOA 1ZV4X 4LFBT 5JDHA 2QVAA 3POQA 4EEBA 3AXJA 4IL6O 4N58A 2ZM6T 2Q9QD 3NVOA 2FUPA 3PU8A 1D0ZA 4UB8O 4DUZT 4UVBB 1ZOYA 2A72A 4AISA 2J4GA 2M6BA 4HTEA 3VR8A 4E7ZA 4FZNA 1YQ3A 4YHJA 2VKDA 4CZZB 3S4UA 3BS0A 2VB6A 4M1PA 3EDUA 3BQLA 4PK5A 1Q9FA 3I9WA 5L3GB 3T0SA 5CJ5A 1W9RA 4ILCA 2V6XA 1HS7A 4AI6A 4AKRA 3EUHA 2Y0HA 4KR4A 2HN2A 3ANWA 3L09A 4EZHA 3A0BO 5BMVE 3RIUA 3T24A 3F31A 5D5DA 3DJBA 2W62A 3RGLA 5E79O 1R8IA 2CEAA 5LJNA 5DL7A 3RF1A 4AKMA 3SFDA 2JMHA 2OLTA 4NXMT 3DZMA 4CI1B 4HKAA 2KINB 3LBXB 4FT6A 4FZMA 3HKEE 2CM0A 2VK9A 3MZKB 4DV3T 4ASKA 1D1AA 2LHFA 2YDSA 4IDPA 3EAMA 3PUAA 3LK3B 1HNXT 3N9LA 2NW7A 2XAQB 3WI4A 2L8KA 4U3CA 4C00A 2D9DA 3RHWA 2BVLA 5LYJE 5G26A 2R4OA 2BVMA 2UUAT 5PRNA 3AEEA 3ZMZB 2G0UA 1U4QA 2M06A 1MMAA 3J9X1 4RJXA 3HOEA 4FESA 2GE4A 3LG7A 1S35A 3PU3A 1GQEA 2WZIA 5H2FO 5ABFB 4U7IA 4N59A 1N34T 1BR1A 3RKOA 4K3CA 2FJBA 5EK3A 3T1HT 3TZGA 3BRYA 3ABVA 2I59A 2WZHA 2XMXA 2Y48B 2LJLA 3KINB 1KFYA 2CBJA 3H3MA 4X1IE 2LSJA 3PUXF 4ZS2A 1HX1B 2WVPA 4MLKA 4FQEA 3AA6A 3T20A 5JH7E 2LRKA 3ZCJA 3UUXB 3VY9X 1ZHYA 3QOFA 4DR1T 4YTPA 2XPKA 4L0RA 3AEBA 4RJWA 2ACZA 2EHOA 2DL1A 4UEMA 3PUSA
chains in the Genus database with same CATH topology
5LHIB 4KRAA 3D0TA 4C91A 1ZHXA 2LSIA 4G2AA 5ADXL 2O4VA 5AFUL 3AVSA 3HOLA 3LK2A 4PFOA 5JRCB 4P0AA 5HYAA 4HFVA 2KXPB 1YW0A 3CX7B 3CX8B 3KVAA 4U72A 5LXTE 1GFOA 2GE4A 3QUJA 4UVCB 3O4XE 3CQGB 2LM9A 1BT9A 3N9NA 2XUEA 1UCUA 2W00A 3ZJ2A 4AYMC 2L3LA 2KWIB 2Y2XA 2PORA 4O4IE 3M65A 2KWHA 2W61A 2C5JA 3K3NA 3I1AA 5L3EB 2VKOA 1ZHTA 4YFSA 3PORA 2XQYA 5GONE 3MXZA 3P8CD 2YPVA 3VZUX 5CB4E 2ZFGA 4X20E 3IEEA 4ZI2C 1EZ3A 3KVBA 3WAKA 4QWNB 1Z0PA 5IYUA 4UIGA 3MJXA 4TZ4C 2X66A 4F4BA 3KFWX 4RL9A 3UULA 4GF4A 3NZQA 4GOUA 1NWMX 1QJ9A 5J2TE 3QRAA 4CQIA 2XTQA 5E0OA 2X9YA 4XBFB 1PRNA 1THQA 3RBHA 2KMFA 2DCFA 3ZMSB 4O3ZA 2MHLA 2DWKA 3NRYA 3SRZA 2M07A 3ESLA 4D5UA 3ONXA 2CXLA 1AJ3A 3BQKA 4G76A 3Q5WA 5LGNB 4H9PC 2CXFA 3RRCA 3I9YA 3JC6C 3AAAA 1IZNA 2LEHA 3VY8X 2UXXB 4P0BA 2KZ7A 4QKNA 2CA5A 2EHOD 3NBXX 5H6RB 4CI3B 4EYYR 4Z3TA 4CXXA 6PRNA 3E22E 4IGUA 2YINA 5HWXA 5T5FA 2C5KT 4H9QC 4GCSA 5ADXK 5A1LA 3N5LA 4UF0B 3ZYMA 3MK7C 1HF8A 1IJ6A 2PBIA 4AYDC 4CI2B 3CMLA 2W80C 4E7SA 2W63A 4PUXA 5FY7A 4KR8A 5LGUB 1MM4A 3DTOA 4TN7B 2Q9QA 3RYIE 2LHRA 3HW9A 4O4HE 3N2KE 1YKHB 3AVRA 3N9PA 4IIJE 4J2CA 4AYID 5LHGB 4AFKA 2XAJB 1GFQA 3SYSA 2YNKA 5L3DB 4GCPA 2OA5A 4MALA 2L9QA 2DHRA 2D2SA 2W0GA 3FYXA 5JRCA 4O4UA 3UTKA 3AB3B 3Q5XA 2KXPA 1BXWA 5JDMA 4AUIA 5FYMA 2E8IA 3HWBA 3WAJA 3IBPA 4ISSA 3ZN1B 1G73A 2Q9QC 1H7CA 2H7VC 3AA1B 1E54A 4V1Av 4RLCA 3O1IA 2IAKA 3SYBA 4PNIA 4PW8A 1E1HB 3SS1A 3DA4A 2BDEA 2VWAA 2BZBA 4UV9B 5CA1E 1BR0A 2CWOA 1U5PA 3PUGA 3CPZA 1VRBA 4O8SA 3VU7H 1PHOA 4XAXB 3O9XA 1YD8G 2ACXA 3ZYKA 1BR4A 3KV4A 2XE1A 3N9OA 4BJMA 3LK3A 1X79A 2JMKA 2YU1A 5KX5E 4OK0A 4UVAB 3RH3A 2XAHB 3SY9A 3N2GE 3O1HA 3PDYA 4FJOA 2NTYA 3WI3A 3R84B 3HI2A 2Y6XA 2ES0A 2K5BB 4QHOA 3FBZA 5HXCA 3UFEA 3VKGA 2H3RA 3LK41 3SZVA 3RC8A 3UT5E 4G63A 5FXWA 3C51A 1D1BA 3H37A 4MHCA 4CXWA 1G8XA 3FXDB 4I4TE 2WWUA 4EXTA 2WMOA 3LBXA 4GK5E 3ZJ1A 5DL6A 2WMNA 2Y8DA 2GK9A 2XHEB 1WYCA 3KBTA 4UELA 4ILUA 2X68A 4O2BE 4C69X 1IAPA 3ETUA 2IW5B 4ZI7E 3PTRB 2ZM0A 3IHRA 4C90A 2C0SA 4U9CA 3POUA 2D0UA 3HA4A 5FXVA 2F1TA 2J4UP 3AA0B 4U74A 2NTXA 3CWZB 4QXCB 5C8YE 2HPJA 3CKDA 5KMGP 4PJLA 4JUYA 4UXNB 4AKHA 3WI5A 3C50A 4LSEA 2ZM8A 4YJ3E 1ZHWA 3GA8A 2D5UA 2E9XB 2PFVA 3OKQA 5FXZA 2MYSA 5HWYA 3A2SX 2NW8A 4EZ4A 4FI5A 3J7Yq 2CE7A 2JRKA 4EYUA 2SPCA 2B1EA 2ODVA 3KDSE 3A5XA 4P09A 5J2UE 2CCQA 4FRTA 4L5GA 4X1YE 3SOLA 4HN9A 1MIYA 3ZYLA 3EDVA 2X9WA 3C4XA 1YS5A 1HCIA 3F57A 4PJJA 5F3JA 1OSMA 1ORMA 4A56A 3GMIA 5GV0A 5HXEA 3K3OA 5FVNA 3AA1A 4O3WA 1D0YA 3NZPA 1WRDA 5L3CB 4X1KE 4AXPA 1H6S1 4H9RC 4E1SA 1MPFA 4HE8A 3V8UA 3E08A 5M4YA 3ZEFB 4AYEC 1ZKEA 4FUVA 2J1DG 3SWHA 2ZLDA 1MIWA 3POXA 2WAUA 3UAQA 2DWGA 3C98B 3RRWA 4IE5A 2H7OA 2CXDA 2DI4A 5L2LA 3OYXA 2ODUA 1MMGA 5DABA 3RC3A 1HXXA 3SZDA 3B13A 3CX6B 4FZLA 4EAHA 3MA9A 1G90A 3N9QA 4PJNA 1ZEEA 4K0UA 5DQVA 3ZMUB 2XE3A 4FOZA 2XG6A 5L3FB 4JCHA 2MOZA 2MNHA 3ZLIA 1UX4A 5IHYA 3O1JA 5EK2A 4GYSA 4E1TA 2CLYB 4XNLA 2W81C 3VZTX 3FB2A 5ETWA 2JQQA 3V5SA 4OYKA 2VKHA 2V7JA 1HXUA 2J1NA 3KV9A 1OPFA 2Z6EA 4BJNA 5AFUK 2V7IA 3OJAA 4IE0A 4JEUB 5F8PA 2LFUA 1V9DA 3AAIA 3IF8B 3Q2MA 5JDPA 1LRZA 2XTLA 4TUYE 4DMWA 2Y0LA 3O0EA 2V26A 4ZI2D 2M67A 1ZHCA 3AA6B 2MTQA 3UUMA 3HKCE 3RYFE 3BQIA 3K8PC 3AA7B 2NW9A 2E9XA 3I0OA 3QC9A 5HXRA 4BAYB 3NSGA 5JDNA 4MFRA 1Q9GA 5JDQA 1ZHZA 5FXXA 2Y7SA 3ZN0B 5LCYA 4HEAA 1HG2A 2EHOB 5LOVE 2V7KA 4DMVA 1FMVA 2UXNB 3C4WA 4QX8B 4HGAA 4AKRB 1LVFA 4DBQA 3PURA 3HKBE 2K4TA 1D1CA 4H9OC 4B6XA 5IYZE 4I43B 3EMNX 3ANWB 2E9XC 2XTRA 3ZC1A 2LOPA 2VL8A 3H3AA 4H63V 3JC6D 1YKEB 4TV9E 2MBGA 1US7B 1NAFA 4AZLA 3ETVA 8PRNA 2OMFA 2Y0KA 1GFNA 4AKGA 2DNXA 5EZYE 4IE7A 5CA0E 2QTKA 1LKXA 3HL6A 2XE5A 4MBQA 4PK6A 4B61A 4FMSA 2K48A 2D0TA 5LP6E 1B7TA 3CVRA 2PRNA 3KBUA 1ZV4X 3RYHE 3ZPOA 2IC6A 2IC9A 2N9DA 2V7LA 3K3QC 3OYZA 2JMMA 2N2NA 2NP9A 5JDHA 3G7GA 3POQA 3GN5B 2VASA 2X0LB 5KDMC 2X9HA 4IE6A 3ZMTB 1MMNA 4L9IA 4OFZA 4JEHB 4H63H 4GIWA 2X67A 4N58A 5L3BB 4O4JE 4ZS3A 1MMDA 2XAGB 4CXYA 5JDFA 4EOZB 5EE2A 3R6NA 2Q9QD 4PJMA 4FRXA 2WSSV 1D0XA 1T98A 3JTYA 4O4XA 4RLBA 4QQ1A 2RA1A 1D0ZA 3PU8A 4ISTA 4XZCA 2E9XD 2CMRA 4UF0A 4UVBB 1QUUA 3CQXC 2A72A 1P4TA 1QJPA 2KT9A 4WW0A 1HXTA 4ERRA 3PRNA 1IJ5A 4HTEA 2CLYC 3VHLA 2RP4A 4E7ZA 4FZNA 3V5UA 2KLQA 1OWAA 1MNDA 4YHJA 1O3XA 1MIVA 2VKDA 5JREA 5HXHA 4CZZB 2P9BA 3S4UA 5LBMA 3C5OA 2VB6A 1UX5A 3U78A 3VZWX 5H6QB 2XAFB 3SY7A 4M1PA 3EDUA 4ZI3C 1LVKA 3AA7A 3BQLA 1BR2A 1WYBA 5J1GA 4AKIA 4PK5A 1Q9FA 3I9WA 2N1GA 3FBLA 5L3GB 3T0SA 4BA9A 4QX7B 4YLHA 2ZMAA 3PQSA 4KMCA 2KC0A 2LSKA 3QRCA 4IE4A 1HS7A 1HFAA 4AI6A 4AKRA 3EUHA 2Y0HA 3UU2A 4WBOA 4KR4A 4KBMB 4F6RC 3ANWA 3KV6A 3L09A 4EZHA 2K0LA 5JR9B 5DL8A 4D65A 5BMVE 2HH7A 3T24A 3NRXA 3F31A 3PUQA 2EHOC 3FHNA 4FSOA 5D5DA 4AKLA 5LHHB 3DJBA 1OXZA 3AAEB 4NUUA 4O4LE 1HX8A 3Q9DA 1MM5A 2W62A 3W15B 2X27X 2N2MA 2ODJA 4H9SE 3VE1A 1SHZC 4NUVA 3GWHA 2CEAA 5FY1A 4TX5A 1WLXA 3LJCA 5LJNA 5DL7A 1WR6A 1QJ8A 3GN5A 4AKMA 2A2FX 3LK42 5LJMA 4PK4A 2V1DB 2JMHA 4ZI3D 5LG4A 7PRNA 2YK0A 4D64A 3N9MA 2JPFA 3ZC0A 4WNKA 4GK0E 3UPGA 4CI1B 4HKAA 4ANJA 3MACA 4EB6E 4XNKA 2KINB 3DP7A 4GCQA 4UV8B 1GFPA 2N2LA 3LBXB 4DNDA 3B57A 4FT6A 1Y64B 4DBRA 3AA0A 4AQFA 2QGSA 2ZLYA 5TAOA 1KK7A 3HKEE 4FZMA 4Z8XA 2HPLA 2CM0A 2LSGA 2VK9A 3HR0A 3I0QA 3MZKB 1D1AA 5JVDE 4ASKA 2LHFA 2C5IT 1HG5A 5FY0A 1FEWA 3OBVE 3PE0A 4GHBA 3PUAA 4KUMB 2WM9A 2YU2A 3LK3B 3N9LA 3T8OA 2KDYA 2NW7A 3E0ZA 4AQFC 5LGTB 2XAQB 2F1VA 3WI4A 3C4ZA 2L8KA 2FGQX 1MNEA 4PFPA 3LK2B 2BVLA 4ZOLE 3ZCIA 5LYJE 3PQUA 3RX6A 5G26A 4FSPA 4QXBB 2BVMA 2LE8A 2PJQA 3N2OA 5FNVE 5PRNA 2FGRA 3ZMZB 2G0UA 1CUNA 2DLRA 3VE2A 4EIWA 3MKDA 3UUNA 4O2AE 5LBQB 1U4QA 2WBLA 2M06A 3F2EA 1MMAA 3J9X1 4RJXA 4ZHQE 3HOEA 1VOMA 4I55E 4FESA 4LSIA 5JQGE 1SA0E 5JR9A 3LG7A 4DO0A 4ADZA 5JDLA 5DQWA 2V7MA 2VKJA 5EK4A 3TKLB 4LSHA 1S35A 3KV5A 3PU3A 2LT3A 4GYRA 4IHJE 2A3DA 4OHFA 4QXHB 4KP3C 1KNZA 1GFMA 4G75A 3HKDE 2ERVA 3AAEA 3K19A 4O3YA 2JJ9A 3ZMVB 4H9NC 5FMNA 2CWYA 1QSDA 3FXEB 1FMWA 2KNDA 4I50E 5DJQC 3KVDD 3C64A 4N59A 4OYJA 1BR1A 2XE2A 3RKOA 4AYNA 4O49A 2YEVC 3QK6A 4PAGA 4JFBA 3RYCE 4YJ2E 5EK3A 1S94A 5JR9C 3BK9A 2X51A 4JLEA 5LNKA 3TZGA 2NWBA 5FP3A 5JDGA 2QA7A 4IDZA 2LSYA 2ZM2A 2I59A 3EVYA 2XMXA 4N78D 3DA3A 1BH3A 2Y48B 2LJLA 4TV8E 3GP6A 3KINB 5LA6E 4WBNE 4BUMX 3AAAB 1IZNB 2K9AA 3RPUA 2KZ7B 4X1IE 2LSJA 3L3PA 5HAXA 4AQGA 4ZS2A 4LSFA 3P7IA 4MLKA 3LFMA 3AA6A 3T20A 2X9XA 5JH7E 3ZCJA 3UUXB 1HTJF 2K24A 4DVDA 3VY9X 1ZHYA 3VKHA 3U3IA 3CQCB 2LHNA 2LOSA 4L0RA 4O3XB 4RJWA 2Q9QB 2XASB 1FIOA 2EHOA 2PG8A 4UEMA 5HXSA 2NOXA 5DL5A 3PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXP A;  4AKR A;  2KZ7 A;  3LK4 1;  3LK4 2;  5ADX L;  5AFU L;  3LK2 A;  3LK3 B;  3AA1 B;  3AAA B;  1IZN B;  2KXP B;  4AKR B;  2KZ7 B;  3AAE A;  5ADX K;  5AFU K;  3LK2 B;  3AA6 A;  3AAE B;  3AA7 A;  3AA0 A;  3AA6 B;  3AA7 B;  3AA0 B;  3LK3 A;  3AA1 A;  3AAA A;  1IZN A; 
#chains in the Genus database with same CATH topology
 5LHI B;  4PFO A;  1Z8U A;  5HYA A;  3KVA A;  4JV5 T;  2W00 A;  4AYM C;  4LF7 T;  1ZHT A;  2XQY A;  3MXZ A;  3P8C D;  3VZU X;  1KNP A;  5ABF A;  4TWD A;  1Z0P A;  4UIG A;  4TZ4 C;  4K0K T;  4RL9 A;  2XTQ A;  5E0O A;  1PRN A;  3RBH A;  2KMF A;  4LFC T;  2BKO A;  5HCJ A;  3ZMS B;  2MHL A;  4DUY T;  3ONX A;  2HHH T;  4ILA A;  2HN1 A;  1NEN A;  3Q5W A;  3TLT A;  5AQH B;  2LEH A;  2UXX B;  2CA5 A;  4CXX A;  4ILB A;  1S5L O;  2C5K T;  3N5L A;  4UF0 B;  5HEJ A;  4AYD C;  3CML A;  4KR8 A;  1HNW T;  4AYI D;  4IIJ E;  4AFK A;  2J47 A;  4GCP A;  4MAL A;  2D2S A;  3FYX A;  4O4U A;  2BG9 C;  3Q5X A;  1BXW A;  4AUI A;  4EV6 A;  3EHZ A;  1DU2 A;  1H7C A;  2H7V C;  2BDE A;  4UV9 B;  4KHZ F;  4IL9 A;  2CWO A;  1VRB A;  1YD8 G;  2QRX A;  2XE1 A;  3PGU A;  3LK3 A;  2JMK A;  4KI0 F;  2XAH B;  2W66 A;  4C4V B;  3SZV A;  3M3Z B;  4MHC A;  2WWU A;  5DL6 A;  2Y8D A;  4X64 T;  3KBT A;  1NEK A;  2ZM0 A;  4U9C A;  3POU A;  3L8R A;  4F8H A;  4LFA T;  2J4U P;  3AA0 B;  3CWZ B;  4QXC B;  4PJL A;  4UXN B;  4AKH A;  1E7P A;  1SE7 A;  3PV0 F;  4EZ4 A;  4TNV A;  3AEF A;  3RLF F;  3IA3 A;  4P09 A;  1XNQ T;  4FRT A;  1WCR A;  1T8B A;  1MIY A;  1HCI A;  4PJJ A;  3A0H O;  5HCM A;  5F3J A;  1OSM A;  4UB6 O;  3UU3 A;  2X9K A;  5GV0 A;  3GMI A;  5HXE A;  3FZH B;  2XQ8 A;  4DV7 T;  3UQ7 A;  1WRD A;  3E08 A;  3SWH A;  3P4W A;  2ZLD A;  1MIW A;  2DWG A;  3C98 B;  3RRW A;  4IE5 A;  2H7O A;  1FJG T;  2PTF A;  3CX6 B;  4IL4 A;  4PJN A;  4C4V A;  4JCH A;  2WWV A;  1UX4 A;  5IHY A;  5AQP B;  4JI2 T;  3RIU C;  4EGW A;  5EK2 A;  3RQW A;  2JQQ A;  3V5S A;  5AQK B;  2VKH A;  1VCT A;  1OPF A;  1XZY A;  4Z90 A;  3OJA A;  3A7M A;  2XQ4 A;  5AQG B;  3IF8 B;  4LF9 T;  5JDP A;  3K1S A;  3O0E A;  2XZE A;  2MTQ A;  2JQH A;  3UUM A;  2H88 A;  3BQI A;  2W2U A;  3K8P C;  2NW9 A;  4BAY B;  3NSG A;  3AE4 A;  5JDN A;  3JAD A;  5JDQ A;  1KEY A;  1FMV A;  3ONL C;  2UXN B;  4HGA A;  4DR6 T;  1WFD A;  4IDO A;  3EMN X;  3PGS A;  2XTR A;  1XMO T;  4AZL A;  3ETV A;  4IT4 A;  8PRN A;  3P4R A;  2WS3 A;  2CHN A;  2DNX A;  4IE7 A;  4B3T T;  2XQA A;  3RYH E;  2IC9 A;  1X9B A;  3K3Q C;  3OYZ A;  2N2N A;  3GN5 B;  2X0L B;  5KDM C;  4OFZ A;  1N36 T;  4H63 H;  5C2T A;  2X67 A;  1MMD A;  2XAG B;  4CXY A;  1SUM B;  4FRX A;  2WSS V;  4A97 A;  4O4X A;  4QQ1 A;  2JQ9 A;  4IST A;  2E9X D;  2FJE A;  4COF A;  3ZT7 A;  4DV4 T;  1HXT A;  3PRN A;  2CLY C;  3V5U A;  2KLQ A;  1MND A;  5HXH A;  5FL1 A;  5LBM A;  2W4X A;  3U78 A;  3SY7 A;  5J1G A;  1WYB A;  1XWM A;  1J5E T;  4AKI A;  3FBL A;  4BA9 A;  3PUY F;  4KMC A;  2KC0 A;  1T1L A;  3QRC A;  4DV2 T;  5AQF B;  2YN6 A;  2EHO C;  3FHN A;  4FSO A;  4O4L E;  1HX8 A;  2BKN A;  3Q9D A;  2AXT O;  4PJ0 O;  2IWW A;  3VE1 A;  4NUV A;  3GWH A;  4N74 A;  2WDQ A;  4YY3 T;  1WLX A;  2UU9 T;  1QLB A;  3GN5 A;  3ZT5 A;  5LG4 A;  2XY8 B;  2YK0 A;  4D64 A;  3N9M A;  3UPG A;  4ANJ A;  3MAC A;  5CGM A;  3DP7 A;  3UU5 A;  4DND A;  3B57 A;  1J1J A;  2E5V A;  4DBR A;  2J62 A;  4Z8X A;  2HPL A;  3ZKR A;  3HR0 A;  2KDY A;  4AQF C;  2F1V A;  4YT0 A;  1J5W A;  4PFP A;  2IUB A;  3ZCI A;  4QXB B;  2PJQ A;  5FNV E;  4HFH A;  4X66 T;  2DLR A;  2JQY A;  5LBQ B;  2WBL A;  1I94 T;  1XNR T;  5HEH A;  4LSI A;  3BRZ A;  1SA0 E;  4EED A;  4JI5 T;  4DO0 A;  4ADZ A;  4AIU A;  4LSH A;  3KV5 A;  4IHJ E;  1GFM A;  4QXH B;  4KP3 C;  3EI0 A;  4G75 A;  5FKY A;  3K19 A;  3ZMV B;  1QSD A;  1FMW A;  3KVD D;  1I6Z A;  4LMJ A;  4QH4 A;  4O49 A;  3QK6 A;  4JFB A;  3RYC E;  4YJ2 E;  5JR9 C;  2CBI A;  4NPP A;  4ZZC A;  3DA3 A;  4TV8 E;  5LA6 E;  4WBN E;  3RPU A;  2KZ7 B;  3L3P A;  3TLU A;  2X9X A;  1OED C;  2BS4 A;  2K24 A;  4DVD A;  2LHN A;  5HXS A;  2NOX A;  4C91 A;  1M7K A;  5AFU L;  4JI4 T;  4HFV A;  4U72 A;  3RIA A;  4UVC B;  3O4X E;  1BT9 A;  2XUE A;  3ZJ2 A;  2E2A A;  2L3L A;  2KWI B;  5ABG A;  3M65 A;  2KWH A;  2VL0 A;  2W61 A;  2C5J A;  3VRA A;  5L3E B;  5JTG A;  2ZFG A;  4ZI2 C;  1EZ3 A;  3KVB A;  1T7S A;  3UFG A;  4HFC A;  2X66 A;  3KFW X;  4GF4 A;  3NZQ A;  4GOU A;  2X9Y A;  4XBF B;  2LLY A;  2CRB A;  2MAW A;  2YOE A;  3SRZ A;  3ESL A;  2CXL A;  3UU8 A;  3BQK A;  3NWI A;  2K3W A;  3JC6 C;  2WU5 A;  3VY8 X;  2KZ7 A;  2R8A A;  4CI3 B;  5H6R B;  4EYY R;  4Z3T A;  4IGU A;  2YIN A;  5HWX A;  2WP9 A;  5T5F A;  4H9Q C;  4JI8 T;  5ADX K;  5FL0 A;  3Q5D A;  4E7S A;  2W63 A;  5CFB A;  4PUX A;  3RYI E;  2LHR A;  3VR9 A;  3HW9 A;  4JI1 T;  4O4H E;  3N2K E;  4J2C A;  5LHG B;  2XAJ B;  3UQ4 A;  3SYS A;  2OA5 A;  1KNR A;  2QYW A;  2JQK A;  3HWB A;  2Q9Q C;  1E54 A;  1IBL T;  3O1I A;  2IAK A;  4LF5 T;  4PW8 A;  3VU7 H;  1PHO A;  2ACX A;  3KV4 A;  2XQ3 A;  4DR4 T;  5KX5 E;  4NXN T;  2YU1 A;  2R88 A;  4OK0 A;  3SY9 A;  3N2G E;  4FJO A;  3WI3 A;  3HI2 A;  1JNR A;  2ES0 A;  4QHO A;  2BBH A;  3AEC A;  1D1B A;  3H37 A;  4CXW A;  4I4T E;  4EXT A;  5G3A A;  5B5E O;  2WMO A;  3LBX A;  2GK9 A;  2XHE B;  4UEL A;  4O2B E;  4TNW A;  3PTR B;  3P4Q A;  3HA4 A;  5FXV A;  3PUZ F;  2NTX A;  2HPJ A;  5KMG P;  3WI5 A;  3ZST A;  5LB7 B;  4YJ3 E;  2D5U A;  2E9X B;  2PFV A;  2NW8 A;  2VVS A;  3J7Y q;  2CE7 A;  3KDS E;  4L5G A;  4X1Y E;  2F1C X;  3SOL A;  3C4X A;  3AE9 A;  1ORM A;  4A56 A;  4AXP A;  5L4H A;  5M4Y A;  3ZEF B;  4AYE C;  3POX A;  3UAQ A;  2VQE T;  4UR9 A;  2CXD A;  2ODU A;  3RC3 A;  3SZD A;  3AE8 A;  3MA9 A;  1G90 A;  3N9Q A;  5DQV A;  4FOZ A;  2XE3 A;  1L0V A;  5L3F B;  2MOZ A;  5IUX A;  2MNH A;  4E1T A;  3AE3 A;  5AFU K;  2V7I A;  4IE0 A;  4JEU B;  1V9D A;  3AAI A;  3Q2M A;  2XTL A;  3SFE A;  4X65 T;  1ZHC A;  5ABE A;  2E9X A;  2LKG A;  1ZHZ A;  2Y7S A;  3ZN0 B;  4HEA A;  1HG2 A;  2V7K A;  3TLS A;  4DMV A;  3C4W A;  4QX8 B;  1LVF A;  3A8Y C;  4DBQ A;  3PUR A;  3AEG A;  4IRE A;  5IYZ E;  3ZSS A;  4X62 T;  2LOP A;  3H3A A;  1HR0 T;  3PJA J;  1GFN A;  2QTK A;  1LKX A;  4JBW F;  3KBU A;  2IC6 A;  4B3R T;  5L4E A;  2V7L A;  2JMM A;  4YTN A;  4ZEY A;  2I0M A;  1MMN A;  4JEH B;  4YSY A;  4JI3 T;  4GIW A;  5JDF A;  3R6N A;  4WZX A;  5L47 A;  1T98 A;  5AQN B;  4RLB A;  5LG3 A;  4UF0 A;  1QJP A;  4NIQ A;  4ERR A;  1IJ5 A;  2RP4 A;  1MIV A;  3VZW X;  5H6Q B;  2XAF B;  1UK5 A;  4ZI3 C;  2OV9 A;  1BR2 A;  4U31 A;  2N1G A;  3EAB A;  2LSK A;  1IBK T;  3UU2 A;  2R89 A;  4WBO A;  5GTI O;  4F6R C;  3KV6 A;  3AE6 A;  5DL8 A;  4D65 A;  4CN6 A;  3NRX A;  3PUQ A;  4AKL A;  5LHH B;  2XM1 A;  4NUU A;  3W15 B;  2X0H A;  4YHH T;  4JI7 T;  1SHZ C;  5FY1 A;  4GKK T;  4TX5 A;  5C3J A;  3LJC A;  1WR6 A;  4CN4 A;  2A2F X;  4QH5 A;  3LK4 2;  4PK4 A;  7PRN A;  4TWH A;  3ZC0 A;  4WNK A;  3QB5 K;  4EB6 E;  4XNK A;  2N2L A;  1Y64 B;  3AA0 A;  2QGS A;  1KK7 A;  2LSG A;  2XJ7 A;  3I0Q A;  3FZL B;  2RPA A;  5FY0 A;  1FEW A;  3OBV E;  3X1D A;  2VVN A;  4GHB A;  2WM9 A;  2YU2 A;  3P4S A;  4U2Y A;  3C4Z A;  2WDV A;  1E2A A;  3PQU A;  5AQO B;  2LE8 A;  3N2O A;  4HWF A;  2FGR A;  1CUN A;  3MKD A;  2W67 A;  4IDQ A;  3UUN A;  3F2E A;  4ZHQ E;  2XQ6 A;  1T72 A;  3AED A;  5JDL A;  2V7M A;  5EK4 A;  3TKL B;  2LT3 A;  2A3D A;  3DWN A;  2JJ9 A;  5FMN A;  4H9N C;  2FJA A;  2KND A;  4I50 E;  4Q25 A;  5DJQ C;  2XE2 A;  2KSR A;  4AYN A;  2YEV C;  2VUR A;  1S94 A;  3BK9 A;  2X51 A;  3NKZ A;  4JLE A;  2NWB A;  4IDZ A;  2LSY A;  3UU6 A;  4N78 D;  3GP6 A;  4A5X A;  2XSA A;  3OTO T;  3RIF A;  4AQG A;  4WYV A;  3P7I A;  3UUB A;  1HTJ F;  2BG9 B;  4LF6 T;  3VKH A;  3U3I A;  3CQC B;  2LOS A;  4OX9 T;  2PG8 A;  4QX7 B;  3AE2 A;  5DL5 A;  1IBM T;  4KRA A;  3D0T A;  1ZHX A;  5ADX L;  2O4V A;  3CX7 B;  1YW0 A;  1GFO A;  4ZXL A;  3CQG B;  3CK6 A;  1UCU A;  1WR0 A;  2Y2X A;  2M6I A;  4O4I E;  2IML A;  3PJA A;  3POR A;  2YPV A;  4X20 E;  3IEE A;  1T16 A;  4QWN B;  5IYU A;  3MJX A;  1NWM X;  1QJ9 A;  3QRA A;  4CQI A;  2UXB T;  4DR3 T;  4O3Z A;  1AJ3 A;  4H9P C;  2CXF A;  3RRC A;  2CHO A;  3JAE A;  4GCS A;  5GTH O;  5A1L A;  3MK7 C;  1IJ6 A;  2PBI A;  2BG9 A;  2W80 C;  1MM4 A;  3FZK B;  4GKJ T;  2R6G F;  1HNZ T;  4CN1 A;  1GFQ A;  2XM2 A;  2YNK A;  2WCA A;  5FVK A;  3AB3 B;  3WAJ A;  4ISS A;  3ZN1 B;  1G73 A;  3AA1 B;  4V1A v;  3SYB A;  4PNI A;  3SS1 A;  2BZB A;  1BR0 A;  3PUG A;  4O8S A;  3CPZ A;  3ZYK A;  1BR4 A;  5LMN T;  3N9O A;  5ABH A;  3O1H A;  2NTY A;  4HFE A;  4LF4 T;  2Y6X A;  2K5B B;  5HXC A;  3FBZ A;  3UFE A;  2H3R A;  1XDP A;  5AQS B;  3LSV A;  3RC8 A;  3UT5 E;  2XQ9 A;  4G63 A;  3C51 A;  1M62 A;  1N33 T;  1G8X A;  3FXD B;  2AXD S;  4GK5 E;  3ZJ1 A;  2WMN A;  2WU2 A;  2X68 A;  2IWV A;  2IW5 B;  4DV1 T;  3IHR A;  4TWF A;  1XMQ T;  2XQ7 A;  5C8Y E;  3CKD A;  4LSE A;  2ZM8 A;  1ZHW A;  3GA8 A;  5J0Z A;  3OKQ A;  5FXZ A;  2MYS A;  5HWY A;  2V8S V;  4FI5 A;  5HEG A;  2JRK A;  2ODV A;  3FZF B;  3Q5E A;  2IHR 1;  2YDR A;  3F57 A;  4B3M T;  5FVN A;  3AA1 A;  4U7Y A;  4O3W A;  1D0Y A;  3NZP A;  4X1K E;  4H9R C;  2R4N A;  3V8U A;  4FUV A;  3L39 A;  2WAU A;  1MMG A;  2LM2 A;  1HXX A;  4FZL A;  4EAH A;  4K0U A;  3ZMU B;  5FVL A;  2XG6 A;  2CLY B;  2W81 C;  5ETW A;  2V7J A;  4AQY T;  2WDR A;  2AE9 A;  2YDQ A;  3P4P A;  4DV0 T;  4HWD A;  4TUY E;  2Y0L A;  2V26 A;  2M67 A;  3AA6 B;  3HKC E;  2WJR A;  3AA7 B;  3I0O A;  3QC9 A;  3UU4 A;  2B76 A;  3VRB A;  5FXX A;  5LCY A;  4JI0 T;  4QH1 A;  2EHO B;  1KF6 A;  4YSZ A;  3HKB E;  1D1C A;  4H9O C;  2UXD T;  2BG9 E;  4U2Z A;  1YKE B;  4TV9 E;  1US7 B;  3TLV A;  1NAF A;  4KX6 A;  2OMF A;  4AKG A;  5EZY E;  5CA0 E;  2XE5 A;  4B3S T;  4FMS A;  2K48 A;  1CHU A;  1B7T A;  2PRN A;  1W0A A;  3G06 A;  2N9D A;  2NP9 A;  3G7G A;  2UUC T;  2VAS A;  2X9H A;  4IE6 A;  3ZMT B;  4L9I A;  5L3B B;  4O4J E;  3AE5 A;  4ZS3 A;  2WY2 A;  2XQ5 A;  4EOZ B;  4K3B A;  5EE2 A;  4DR7 T;  4PJM A;  1D0X A;  3PUV F;  2WB5 A;  3JTY A;  2NR4 A;  2RA1 A;  4XZC A;  3FZM B;  2BBJ A;  2CMR A;  1P4T A;  1QUU A;  3CQX C;  4N75 A;  2KT9 A;  4WW0 A;  4DR5 T;  3VHL A;  1OWA A;  1O3X A;  5JRE A;  2P9B A;  3C5O A;  1UX5 A;  3CIR A;  3AA7 A;  2IIU A;  1LVK A;  4X5T A;  2R4P A;  5AQQ B;  5HEU A;  4YTM A;  2BS3 A;  4YLH A;  2ZMA A;  3PQS A;  2I6H A;  4IE4 A;  4CTD A;  1HFA A;  1W0B A;  2FBW A;  4KBM B;  4ZZB A;  3JCU O;  2K0L A;  5JR9 B;  2BS2 A;  3QNU A;  2HH7 A;  2YKS A;  3PF1 A;  1OXZ A;  3AAE B;  4P1N A;  1MM5 A;  2X27 X;  2N2M A;  5TIS O;  2ODJ A;  2XSB A;  4H9S E;  5B66 O;  5G39 A;  3PGR A;  3ZT6 A;  5KXJ A;  1QJ8 A;  5LJM A;  2V1D B;  4ZI3 D;  1OED B;  2R4L A;  2JPF A;  4GK0 E;  4GCQ A;  4UV8 B;  1GFP A;  3KZI O;  5KAI O;  3AEA A;  4AQF A;  2JIW A;  2ZLY A;  5TAO A;  2BKP A;  2CPT A;  5JVD E;  2C5I T;  1HG5 A;  3PE0 A;  4KUM B;  3QB5 A;  3T8O A;  2MPK A;  3E0Z A;  5LGT B;  2FJD A;  2FGQ X;  1MNE A;  3LK2 B;  1UUR A;  4ZOL E;  3RX6 A;  4FSP A;  5AQU B;  3VE2 A;  4EIW A;  4O2A E;  2LKH A;  5AQM B;  1VOM A;  4I55 E;  5JQG E;  5JR9 A;  5DQW A;  2VKJ A;  4GYR A;  4OHF A;  1KNZ A;  3HKD E;  2ERV A;  3AAE A;  4O3Y A;  3LDQ B;  2CWY A;  4Z91 A;  3FXE B;  2V6Y B;  3C64 A;  4LMK A;  4OYJ A;  1W09 A;  4PAG A;  4LF8 T;  4HWC A;  5AQL B;  4HWH A;  5LNK A;  5FP3 A;  5JDG A;  2QA7 A;  2ZM2 A;  3EVY A;  3OVU A;  4DV5 T;  1OED A;  1BH3 A;  4BUM X;  3AAA B;  1IZN B;  2K9A A;  2A9U A;  5HAX A;  4LSF A;  1N32 T;  3LFM A;  3JCF A;  4O3X B;  2WJQ A;  2Q9Q B;  5LMU T;  2XAS B;  5AQT B;  1FIO A;  2LSI A;  3AE1 A;  4G2A A;  3AVS A;  3HOL A;  3LK2 A;  3JAF A;  4A98 A;  5JRC B;  4P0A A;  2KXP B;  3CX8 B;  5LXT E;  3QUJ A;  4HFB A;  2LM9 A;  5KAF O;  3N9N A;  4HWI B;  2POR A;  5HEO A;  3RKG A;  4PR7 A;  1Y01 A;  3K3N A;  3I1A A;  2VKO A;  2F4V T;  3ONJ A;  4YFS A;  5GON E;  5CB4 E;  3WAK A;  2V6Y A;  4F4B A;  2WQY A;  3UUL A;  5J2T E;  4JYA T;  1THQ A;  2DCF A;  4DR2 T;  1JNZ A;  2DWK A;  3NRY A;  2M07 A;  4D5U A;  4G76 A;  5LGN B;  4IDN A;  3I9Y A;  3AAA A;  1IZN A;  4P0B A;  4QKN A;  2EHO D;  3NBX X;  6PRN A;  3E22 E;  4JI6 T;  2V5C A;  2IDO B;  4I0U A;  3ZYM A;  1HF8 A;  4CI2 B;  5FY7 A;  5LGU B;  3DTO A;  4TN7 B;  1YXR A;  2Q9Q A;  3N9P A;  1YKH B;  3AVR A;  5L3D B;  2L9Q A;  5F5W A;  2DHR A;  1UUS A;  2W0G A;  5JRC A;  4U33 A;  3UTK A;  2KXP A;  5JDM A;  5FYM A;  2E8I A;  3IBP A;  5G38 A;  2UUB T;  4RLC A;  4DV6 T;  1E1H B;  3DA4 A;  2VWA A;  5CA1 E;  1U5P A;  4XAX B;  3O9X A;  4BJM A;  1X79 A;  4UVA B;  3RH3 A;  3PDY A;  2X0Y A;  3R84 B;  3RQU A;  2H89 A;  3VKG A;  3LK4 1;  5FXW A;  3OPC A;  4HFD A;  1WYC A;  4ILU A;  4C69 X;  1IAP A;  3ETU A;  4ZI7 E;  2UXC T;  4C90 A;  2C0S A;  1UGO A;  2D0U A;  2F1T A;  1YQ4 A;  4U74 A;  4HFI A;  4JUY A;  1OED E;  3C50 A;  5BR8 T;  3A2S X;  3B5M A;  4EYU A;  2SPC A;  2B1E A;  3A5X A;  5J2U E;  2CCQ A;  4YXD A;  4KHP T;  4HN9 A;  3AE7 A;  5AQJ B;  3ZYL A;  3EDV A;  2X9W A;  1YS5 A;  5AQI B;  2LRL A;  3K3O A;  3WU2 O;  3P50 A;  5AQR B;  5L3C B;  1H6S 1;  4E1S A;  1MPF A;  4HE8 A;  5AQV B;  1ZKE A;  2J1D G;  3TLW A;  5IWA T;  3NJT A;  1VCS A;  1XDO A;  2DI4 A;  5L2L A;  3OYX A;  5DAB A;  3B13 A;  1ZEE A;  3AXJ B;  1ZP0 A;  3ZLI A;  3O1J A;  4GYS A;  4XNL A;  3VZT X;  3FB2 A;  4DID B;  4OYK A;  1HXU A;  2J1N A;  3KV9 A;  3T1Y T;  2E5L T;  2Z6E A;  4BJN A;  5F8P A;  2LFU A;  4YSX A;  1LRZ A;  4DMW A;  4ZI2 D;  3RYF E;  2VQF T;  5HXR A;  4MFR A;  1Q9G A;  5LOV E;  4AKR B;  3DWO X;  2K4T A;  2V5D A;  4B6X A;  4I43 B;  3ANW B;  2E9X C;  3ZC1 A;  2VL8 A;  4H63 V;  3JC6 D;  2MBG A;  3PUW F;  2Y0K A;  3HL6 A;  4MBQ A;  4LML A;  4PK6 A;  4B61 A;  2D0T A;  5LP6 E;  3CVR A;  3RI5 A;  3ZPO A;  1ZV4 X;  4LFB T;  5JDH A;  2QVA A;  3POQ A;  4EEB A;  3AXJ A;  4IL6 O;  4N58 A;  2ZM6 T;  2Q9Q D;  3NVO A;  2FUP A;  3PU8 A;  1D0Z A;  4UB8 O;  4DUZ T;  4UVB B;  1ZOY A;  2A72 A;  4AIS A;  2J4G A;  2M6B A;  4HTE A;  3VR8 A;  4E7Z A;  4FZN A;  1YQ3 A;  4YHJ A;  2VKD A;  4CZZ B;  3S4U A;  3BS0 A;  2VB6 A;  4M1P A;  3EDU A;  3BQL A;  4PK5 A;  1Q9F A;  3I9W A;  5L3G B;  3T0S A;  5CJ5 A;  1W9R A;  4ILC A;  2V6X A;  1HS7 A;  4AI6 A;  4AKR A;  3EUH A;  2Y0H A;  4KR4 A;  2HN2 A;  3ANW A;  3L09 A;  4EZH A;  3A0B O;  5BMV E;  3RIU A;  3T24 A;  3F31 A;  5D5D A;  3DJB A;  2W62 A;  3RGL A;  5E79 O;  1R8I A;  2CEA A;  5LJN A;  5DL7 A;  3RF1 A;  4AKM A;  3SFD A;  2JMH A;  2OLT A;  4NXM T;  3DZM A;  4CI1 B;  4HKA A;  2KIN B;  3LBX B;  4FT6 A;  4FZM A;  3HKE E;  2CM0 A;  2VK9 A;  3MZK B;  4DV3 T;  4ASK A;  1D1A A;  2LHF A;  2YDS A;  4IDP A;  3EAM A;  3PUA A;  3LK3 B;  1HNX T;  3N9L A;  2NW7 A;  2XAQ B;  3WI4 A;  2L8K A;  4U3C A;  4C00 A;  2D9D A;  3RHW A;  2BVL A;  5LYJ E;  5G26 A;  2R4O A;  2BVM A;  2UUA T;  5PRN A;  3AEE A;  3ZMZ B;  2G0U A;  1U4Q A;  2M06 A;  1MMA A;  3J9X 1;  4RJX A;  3HOE A;  4FES A;  2GE4 A;  3LG7 A;  1S35 A;  3PU3 A;  1GQE A;  2WZI A;  5H2F O;  5ABF B;  4U7I A;  4N59 A;  1N34 T;  1BR1 A;  3RKO A;  4K3C A;  2FJB A;  5EK3 A;  3T1H T;  3TZG A;  3BRY A;  3ABV A;  2I59 A;  2WZH A;  2XMX A;  2Y48 B;  2LJL A;  3KIN B;  1KFY A;  2CBJ A;  3H3M A;  4X1I E;  2LSJ A;  3PUX F;  4ZS2 A;  1HX1 B;  2WVP A;  4MLK A;  4FQE A;  3AA6 A;  3T20 A;  5JH7 E;  2LRK A;  3ZCJ A;  3UUX B;  3VY9 X;  1ZHY A;  3QOF A;  4DR1 T;  4YTP A;  2XPK A;  4L0R A;  3AEB A;  4RJW A;  2ACZ A;  2EHO A;  2DL1 A;  4UEM A;  3PUS A; 
#chains in the Genus database with same CATH homology
 5LHI B;  4KRA A;  3D0T A;  4C91 A;  1ZHX A;  2LSI A;  4G2A A;  5ADX L;  2O4V A;  5AFU L;  3AVS A;  3HOL A;  3LK2 A;  4PFO A;  5JRC B;  4P0A A;  5HYA A;  4HFV A;  2KXP B;  1YW0 A;  3CX7 B;  3CX8 B;  3KVA A;  4U72 A;  5LXT E;  1GFO A;  2GE4 A;  3QUJ A;  4UVC B;  3O4X E;  3CQG B;  2LM9 A;  1BT9 A;  3N9N A;  2XUE A;  1UCU A;  2W00 A;  3ZJ2 A;  4AYM C;  2L3L A;  2KWI B;  2Y2X A;  2POR A;  4O4I E;  3M65 A;  2KWH A;  2W61 A;  2C5J A;  3K3N A;  3I1A A;  5L3E B;  2VKO A;  1ZHT A;  4YFS A;  3POR A;  2XQY A;  5GON E;  3MXZ A;  3P8C D;  2YPV A;  3VZU X;  5CB4 E;  2ZFG A;  4X20 E;  3IEE A;  4ZI2 C;  1EZ3 A;  3KVB A;  3WAK A;  4QWN B;  1Z0P A;  5IYU A;  4UIG A;  3MJX A;  4TZ4 C;  2X66 A;  4F4B A;  3KFW X;  4RL9 A;  3UUL A;  4GF4 A;  3NZQ A;  4GOU A;  1NWM X;  1QJ9 A;  5J2T E;  3QRA A;  4CQI A;  2XTQ A;  5E0O A;  2X9Y A;  4XBF B;  1PRN A;  1THQ A;  3RBH A;  2KMF A;  2DCF A;  3ZMS B;  4O3Z A;  2MHL A;  2DWK A;  3NRY A;  3SRZ A;  2M07 A;  3ESL A;  4D5U A;  3ONX A;  2CXL A;  1AJ3 A;  3BQK A;  4G76 A;  3Q5W A;  5LGN B;  4H9P C;  2CXF A;  3RRC A;  3I9Y A;  3JC6 C;  3AAA A;  1IZN A;  2LEH A;  3VY8 X;  2UXX B;  4P0B A;  2KZ7 A;  4QKN A;  2CA5 A;  2EHO D;  3NBX X;  5H6R B;  4CI3 B;  4EYY R;  4Z3T A;  4CXX A;  6PRN A;  3E22 E;  4IGU A;  2YIN A;  5HWX A;  5T5F A;  2C5K T;  4H9Q C;  4GCS A;  5ADX K;  5A1L A;  3N5L A;  4UF0 B;  3ZYM A;  3MK7 C;  1HF8 A;  1IJ6 A;  2PBI A;  4AYD C;  4CI2 B;  3CML A;  2W80 C;  4E7S A;  2W63 A;  4PUX A;  5FY7 A;  4KR8 A;  5LGU B;  1MM4 A;  3DTO A;  4TN7 B;  2Q9Q A;  3RYI E;  2LHR A;  3HW9 A;  4O4H E;  3N2K E;  1YKH B;  3AVR A;  3N9P A;  4IIJ E;  4J2C A;  4AYI D;  5LHG B;  4AFK A;  2XAJ B;  1GFQ A;  3SYS A;  2YNK A;  5L3D B;  4GCP A;  2OA5 A;  4MAL A;  2L9Q A;  2DHR A;  2D2S A;  2W0G A;  3FYX A;  5JRC A;  4O4U A;  3UTK A;  3AB3 B;  3Q5X A;  2KXP A;  1BXW A;  5JDM A;  4AUI A;  5FYM A;  2E8I A;  3HWB A;  3WAJ A;  3IBP A;  4ISS A;  3ZN1 B;  1G73 A;  2Q9Q C;  1H7C A;  2H7V C;  3AA1 B;  1E54 A;  4V1A v;  4RLC A;  3O1I A;  2IAK A;  3SYB A;  4PNI A;  4PW8 A;  1E1H B;  3SS1 A;  3DA4 A;  2BDE A;  2VWA A;  2BZB A;  4UV9 B;  5CA1 E;  1BR0 A;  2CWO A;  1U5P A;  3PUG A;  3CPZ A;  1VRB A;  4O8S A;  3VU7 H;  1PHO A;  4XAX B;  3O9X A;  1YD8 G;  2ACX A;  3ZYK A;  1BR4 A;  3KV4 A;  2XE1 A;  3N9O A;  4BJM A;  3LK3 A;  1X79 A;  2JMK A;  2YU1 A;  5KX5 E;  4OK0 A;  4UVA B;  3RH3 A;  2XAH B;  3SY9 A;  3N2G E;  3O1H A;  3PDY A;  4FJO A;  2NTY A;  3WI3 A;  3R84 B;  3HI2 A;  2Y6X A;  2ES0 A;  2K5B B;  4QHO A;  3FBZ A;  5HXC A;  3UFE A;  3VKG A;  2H3R A;  3LK4 1;  3SZV A;  3RC8 A;  3UT5 E;  4G63 A;  5FXW A;  3C51 A;  1D1B A;  3H37 A;  4MHC A;  4CXW A;  1G8X A;  3FXD B;  4I4T E;  2WWU A;  4EXT A;  2WMO A;  3LBX A;  4GK5 E;  3ZJ1 A;  5DL6 A;  2WMN A;  2Y8D A;  2GK9 A;  2XHE B;  1WYC A;  3KBT A;  4UEL A;  4ILU A;  2X68 A;  4O2B E;  4C69 X;  1IAP A;  3ETU A;  2IW5 B;  4ZI7 E;  3PTR B;  2ZM0 A;  3IHR A;  4C90 A;  2C0S A;  4U9C A;  3POU A;  2D0U A;  3HA4 A;  5FXV A;  2F1T A;  2J4U P;  3AA0 B;  4U74 A;  2NTX A;  3CWZ B;  4QXC B;  5C8Y E;  2HPJ A;  3CKD A;  5KMG P;  4PJL A;  4JUY A;  4UXN B;  4AKH A;  3WI5 A;  3C50 A;  4LSE A;  2ZM8 A;  4YJ3 E;  1ZHW A;  3GA8 A;  2D5U A;  2E9X B;  2PFV A;  3OKQ A;  5FXZ A;  2MYS A;  5HWY A;  3A2S X;  2NW8 A;  4EZ4 A;  4FI5 A;  3J7Y q;  2CE7 A;  2JRK A;  4EYU A;  2SPC A;  2B1E A;  2ODV A;  3KDS E;  3A5X A;  4P09 A;  5J2U E;  2CCQ A;  4FRT A;  4L5G A;  4X1Y E;  3SOL A;  4HN9 A;  1MIY A;  3ZYL A;  3EDV A;  2X9W A;  3C4X A;  1YS5 A;  1HCI A;  3F57 A;  4PJJ A;  5F3J A;  1OSM A;  1ORM A;  4A56 A;  3GMI A;  5GV0 A;  5HXE A;  3K3O A;  5FVN A;  3AA1 A;  4O3W A;  1D0Y A;  3NZP A;  1WRD A;  5L3C B;  4X1K E;  4AXP A;  1H6S 1;  4H9R C;  4E1S A;  1MPF A;  4HE8 A;  3V8U A;  3E08 A;  5M4Y A;  3ZEF B;  4AYE C;  1ZKE A;  4FUV A;  2J1D G;  3SWH A;  2ZLD A;  1MIW A;  3POX A;  2WAU A;  3UAQ A;  2DWG A;  3C98 B;  3RRW A;  4IE5 A;  2H7O A;  2CXD A;  2DI4 A;  5L2L A;  3OYX A;  2ODU A;  1MMG A;  5DAB A;  3RC3 A;  1HXX A;  3SZD A;  3B13 A;  3CX6 B;  4FZL A;  4EAH A;  3MA9 A;  1G90 A;  3N9Q A;  4PJN A;  1ZEE A;  4K0U A;  5DQV A;  3ZMU B;  2XE3 A;  4FOZ A;  2XG6 A;  5L3F B;  4JCH A;  2MOZ A;  2MNH A;  3ZLI A;  1UX4 A;  5IHY A;  3O1J A;  5EK2 A;  4GYS A;  4E1T A;  2CLY B;  4XNL A;  2W81 C;  3VZT X;  3FB2 A;  5ETW A;  2JQQ A;  3V5S A;  4OYK A;  2VKH A;  2V7J A;  1HXU A;  2J1N A;  3KV9 A;  1OPF A;  2Z6E A;  4BJN A;  5AFU K;  2V7I A;  3OJA A;  4IE0 A;  4JEU B;  5F8P A;  2LFU A;  1V9D A;  3AAI A;  3IF8 B;  3Q2M A;  5JDP A;  1LRZ A;  2XTL A;  4TUY E;  4DMW A;  2Y0L A;  3O0E A;  2V26 A;  4ZI2 D;  2M67 A;  1ZHC A;  3AA6 B;  2MTQ A;  3UUM A;  3HKC E;  3RYF E;  3BQI A;  3K8P C;  3AA7 B;  2NW9 A;  2E9X A;  3I0O A;  3QC9 A;  5HXR A;  4BAY B;  3NSG A;  5JDN A;  4MFR A;  1Q9G A;  5JDQ A;  1ZHZ A;  5FXX A;  2Y7S A;  3ZN0 B;  5LCY A;  4HEA A;  1HG2 A;  2EHO B;  5LOV E;  2V7K A;  4DMV A;  1FMV A;  2UXN B;  3C4W A;  4QX8 B;  4HGA A;  4AKR B;  1LVF A;  4DBQ A;  3PUR A;  3HKB E;  2K4T A;  1D1C A;  4H9O C;  4B6X A;  5IYZ E;  4I43 B;  3EMN X;  3ANW B;  2E9X C;  2XTR A;  3ZC1 A;  2LOP A;  2VL8 A;  3H3A A;  4H63 V;  3JC6 D;  1YKE B;  4TV9 E;  2MBG A;  1US7 B;  1NAF A;  4AZL A;  3ETV A;  8PRN A;  2OMF A;  2Y0K A;  1GFN A;  4AKG A;  2DNX A;  5EZY E;  4IE7 A;  5CA0 E;  2QTK A;  1LKX A;  3HL6 A;  2XE5 A;  4MBQ A;  4PK6 A;  4B61 A;  4FMS A;  2K48 A;  2D0T A;  5LP6 E;  1B7T A;  3CVR A;  2PRN A;  3KBU A;  1ZV4 X;  3RYH E;  3ZPO A;  2IC6 A;  2IC9 A;  2N9D A;  2V7L A;  3K3Q C;  3OYZ A;  2JMM A;  2N2N A;  2NP9 A;  5JDH A;  3G7G A;  3POQ A;  3GN5 B;  2VAS A;  2X0L B;  5KDM C;  2X9H A;  4IE6 A;  3ZMT B;  1MMN A;  4L9I A;  4OFZ A;  4JEH B;  4H63 H;  4GIW A;  2X67 A;  4N58 A;  5L3B B;  4O4J E;  4ZS3 A;  1MMD A;  2XAG B;  4CXY A;  5JDF A;  4EOZ B;  5EE2 A;  3R6N A;  2Q9Q D;  4PJM A;  4FRX A;  2WSS V;  1D0X A;  1T98 A;  3JTY A;  4O4X A;  4RLB A;  4QQ1 A;  2RA1 A;  1D0Z A;  3PU8 A;  4IST A;  4XZC A;  2E9X D;  2CMR A;  4UF0 A;  4UVB B;  1QUU A;  3CQX C;  2A72 A;  1P4T A;  1QJP A;  2KT9 A;  4WW0 A;  1HXT A;  4ERR A;  3PRN A;  1IJ5 A;  4HTE A;  2CLY C;  3VHL A;  2RP4 A;  4E7Z A;  4FZN A;  3V5U A;  2KLQ A;  1OWA A;  1MND A;  4YHJ A;  1O3X A;  1MIV A;  2VKD A;  5JRE A;  5HXH A;  4CZZ B;  2P9B A;  3S4U A;  5LBM A;  3C5O A;  2VB6 A;  1UX5 A;  3U78 A;  3VZW X;  5H6Q B;  2XAF B;  3SY7 A;  4M1P A;  3EDU A;  4ZI3 C;  1LVK A;  3AA7 A;  3BQL A;  1BR2 A;  1WYB A;  5J1G A;  4AKI A;  4PK5 A;  1Q9F A;  3I9W A;  2N1G A;  3FBL A;  5L3G B;  3T0S A;  4BA9 A;  4QX7 B;  4YLH A;  2ZMA A;  3PQS A;  4KMC A;  2KC0 A;  2LSK A;  3QRC A;  4IE4 A;  1HS7 A;  1HFA A;  4AI6 A;  4AKR A;  3EUH A;  2Y0H A;  3UU2 A;  4WBO A;  4KR4 A;  4KBM B;  4F6R C;  3ANW A;  3KV6 A;  3L09 A;  4EZH A;  2K0L A;  5JR9 B;  5DL8 A;  4D65 A;  5BMV E;  2HH7 A;  3T24 A;  3NRX A;  3F31 A;  3PUQ A;  2EHO C;  3FHN A;  4FSO A;  5D5D A;  4AKL A;  5LHH B;  3DJB A;  1OXZ A;  3AAE B;  4NUU A;  4O4L E;  1HX8 A;  3Q9D A;  1MM5 A;  2W62 A;  3W15 B;  2X27 X;  2N2M A;  2ODJ A;  4H9S E;  3VE1 A;  1SHZ C;  4NUV A;  3GWH A;  2CEA A;  5FY1 A;  4TX5 A;  1WLX A;  3LJC A;  5LJN A;  5DL7 A;  1WR6 A;  1QJ8 A;  3GN5 A;  4AKM A;  2A2F X;  3LK4 2;  5LJM A;  4PK4 A;  2V1D B;  2JMH A;  4ZI3 D;  5LG4 A;  7PRN A;  2YK0 A;  4D64 A;  3N9M A;  2JPF A;  3ZC0 A;  4WNK A;  4GK0 E;  3UPG A;  4CI1 B;  4HKA A;  4ANJ A;  3MAC A;  4EB6 E;  4XNK A;  2KIN B;  3DP7 A;  4GCQ A;  4UV8 B;  1GFP A;  2N2L A;  3LBX B;  4DND A;  3B57 A;  4FT6 A;  1Y64 B;  4DBR A;  3AA0 A;  4AQF A;  2QGS A;  2ZLY A;  5TAO A;  1KK7 A;  3HKE E;  4FZM A;  4Z8X A;  2HPL A;  2CM0 A;  2LSG A;  2VK9 A;  3HR0 A;  3I0Q A;  3MZK B;  1D1A A;  5JVD E;  4ASK A;  2LHF A;  2C5I T;  1HG5 A;  5FY0 A;  1FEW A;  3OBV E;  3PE0 A;  4GHB A;  3PUA A;  4KUM B;  2WM9 A;  2YU2 A;  3LK3 B;  3N9L A;  3T8O A;  2KDY A;  2NW7 A;  3E0Z A;  4AQF C;  5LGT B;  2XAQ B;  2F1V A;  3WI4 A;  3C4Z A;  2L8K A;  2FGQ X;  1MNE A;  4PFP A;  3LK2 B;  2BVL A;  4ZOL E;  3ZCI A;  5LYJ E;  3PQU A;  3RX6 A;  5G26 A;  4FSP A;  4QXB B;  2BVM A;  2LE8 A;  2PJQ A;  3N2O A;  5FNV E;  5PRN A;  2FGR A;  3ZMZ B;  2G0U A;  1CUN A;  2DLR A;  3VE2 A;  4EIW A;  3MKD A;  3UUN A;  4O2A E;  5LBQ B;  1U4Q A;  2WBL A;  2M06 A;  3F2E A;  1MMA A;  3J9X 1;  4RJX A;  4ZHQ E;  3HOE A;  1VOM A;  4I55 E;  4FES A;  4LSI A;  5JQG E;  1SA0 E;  5JR9 A;  3LG7 A;  4DO0 A;  4ADZ A;  5JDL A;  5DQW A;  2V7M A;  2VKJ A;  5EK4 A;  3TKL B;  4LSH A;  1S35 A;  3KV5 A;  3PU3 A;  2LT3 A;  4GYR A;  4IHJ E;  2A3D A;  4OHF A;  4QXH B;  4KP3 C;  1KNZ A;  1GFM A;  4G75 A;  3HKD E;  2ERV A;  3AAE A;  3K19 A;  4O3Y A;  2JJ9 A;  3ZMV B;  4H9N C;  5FMN A;  2CWY A;  1QSD A;  3FXE B;  1FMW A;  2KND A;  4I50 E;  5DJQ C;  3KVD D;  3C64 A;  4N59 A;  4OYJ A;  1BR1 A;  2XE2 A;  3RKO A;  4AYN A;  4O49 A;  2YEV C;  3QK6 A;  4PAG A;  4JFB A;  3RYC E;  4YJ2 E;  5EK3 A;  1S94 A;  5JR9 C;  3BK9 A;  2X51 A;  4JLE A;  5LNK A;  3TZG A;  2NWB A;  5FP3 A;  5JDG A;  2QA7 A;  4IDZ A;  2LSY A;  2ZM2 A;  2I59 A;  3EVY A;  2XMX A;  4N78 D;  3DA3 A;  1BH3 A;  2Y48 B;  2LJL A;  4TV8 E;  3GP6 A;  3KIN B;  5LA6 E;  4WBN E;  4BUM X;  3AAA B;  1IZN B;  2K9A A;  3RPU A;  2KZ7 B;  4X1I E;  2LSJ A;  3L3P A;  5HAX A;  4AQG A;  4ZS2 A;  4LSF A;  3P7I A;  4MLK A;  3LFM A;  3AA6 A;  3T20 A;  2X9X A;  5JH7 E;  3ZCJ A;  3UUX B;  1HTJ F;  2K24 A;  4DVD A;  3VY9 X;  1ZHY A;  3VKH A;  3U3I A;  3CQC B;  2LHN A;  2LOS A;  4L0R A;  4O3X B;  4RJW A;  2Q9Q B;  2XAS B;  1FIO A;  2EHO A;  2PG8 A;  4UEM A;  5HXS A;  2NOX A;  5DL5 A;  3PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...