3LK3B

Crystal structure of capz bound to the cpi and csi uncapping motifs from carmil
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
249
structure length
249
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F-actin-capping protein subunit alpha-1
molecule tags Protein binding
source organism Gallus gallus
publication title Structural characterization of a capping protein interaction motif defines a family of actin filament regulators
doi rcsb
total genus 80
structure length 249
sequence length 249
ec nomenclature
pdb deposition date 2010-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3lk3B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 3lk3B02
4AKRB 5ADXL 4AKRA 3AA1A 3LK42 5AFUL 3AA1B 3AA0A 3LK3A 3LK2A 3AA6A 3AAAA 3AAEB 3AA7A 2KXPB 5AFUK 1IZNB 2KZ7B 1IZNA 2KXPA 3AA7B 3AAEA 3AAAB 3AA6B 5ADXK 3LK2B 3LK3B 3LK41 2KZ7A 3AA0B
chains in the Genus database with same CATH superfamily
2KNDA 4DR3T 2PG8A 5KMGP 4FOZA 1W09A 4X20E 3FYXA 2IIUA 5M4YA 4O4XA 4TNWA 2F1VA 3UQ7A 4QKNA 4OYKA 1MIVA 5TAOA 3A7MA 3NWIA 1GFPA 3PGRA 5HXCA 3I9YA 3PUVF 5IHYA 2CHOA 4KUMB 4H9PC 2DCFA 1MMDA 5LXTE 3O1HA 1GFNA 4HEAA 2LM9A 4L0RA 3EAMA 5ABFA 2YPVA 4HWFA 3Q5DA 5FNVE 5JREA 3AVRA 5DQWA 5FVLA 3P50A 5HEUA 3F2EA 3Q5XA 3KV5A 2Y2XA 4YFSA 4UB8O 2YOEA 3C64A 2WU2A 5ADXL 1S94A 5ABFB 5AQHB 4PW8A 5CA1E 2JIWA 4IIJE 4PNIA 3K3QC 3N9QA 3QOFA 1ZHTA 2CLYC 3KVDD 3FXEB 5LHGB 1N36T 5LG3A 1XDPA 3FZHB 4HFDA 2CBIA 4LFBT 3UFGA 3A0HO 1KEYA 3CMLA 1E2AA 2VQFT 4FI5A 4AQFC 4CI1B 1MIWA 5E79O 5HCMA 2Y6XA 3JAFA 5FY0A 2C5KT 3WAKA 1XWMA 5JDGA 5JTGA 2Q9QD 4ILAA 5FVKA 3LK3B 2FJBA 5JDMA 3JAEA 2XQ7A 2XTQA 2MBGA 3L3PA 5CB4E 3V5UA 5AQQB 4AKIA 2LJLA 5LGNB 4DUZT 2WP9A 4AFKA 3HL6A 5LA6E 3UU2A 3TLVA 3AVSA 5E0OA 3O0EA 2C0SA 4DV2T 2XE3A 5KDMC 2BG9C 3HR0A 4YSYA 3MKDA 5G38A 3AAIA 4ADZA 1ZHWA 2NR4A 3LJCA 1OWAA 3HOLA 3K3OA 2XM2A 2R6GF 3NSGA 2FBWA 4A5XA 4AZLA 3PDYA 3AE5A 2WY2A 3QNUA 4IDOA 2V6YB 5EE2A 4DO0A 3RKOA 4AYID 4JI1T 2M07A 4L9IA 3T0SA 5CJ5A 2LRLA 2YEVC 4ZI3D 4IHJE 5LG4A 5G39A 4H9NC 2WDRA 3LK41 1YW0A 2NW8A 3PUZF 5GONE 4COFA 2HHHT 1CHUA 2W80C 3ZN0B 1J5WA 4PR7A 1ZOYA 2E2AA 3CX7B 4G63A 4RJXA 2X9XA 3AA6A 5LJMA 4GOUA 4TV9E 5FXWA 2N2NA 2MAWA 4K3CA 2WWVA 4X65T 3G06A 3RC3A 4YXDA 5LHHB 3TLWA 1HFAA 1ZV4X 3UUMA 3I9WA 2R4NA 2N9DA 3UULA 2NWBA 4U74A 2VASA 2UU9T 4UVAB 2BG9B 3RYHE 5LBMA 1HF8A 4JI6T 2WQYA 2FGRA 1GFOA 2XG6A 2FJAA 3HKCE 4DUYT 1QJ9A 5L2LA 4AQGA 3VR8A 4CN1A 4KR4A 4QQ1A 3IA3A 3T24A 4BJNA 2BKNA 2XE1A 2RPAA 3UUNA 1UCUA 2UUAT 2CWOA 3PUYF 2ZM2A 4CXWA 5L4HA 4ZZBA 4N58A 2VKOA 2KDYA 3P4QA 1QSDA 2K5BB 5ADXK 4JFBA 2E5LT 2AXDS 3AE3A 1OEDE 3V8UA 2NTYA 3QB5K 5JDPA 4EV6A 4QXCB 2N2LA 2HPLA 4Z91A 2X51A 1CUNA 4QXHB 1J1JA 3N9LA 3SYSA 3RIAA 2VKJA 5LBQB 4TUYE 3ZEFB 5AQJB 5KX5E 1KFYA 1E54A 4E7SA 3O9XA 3UT5E 5L3DB 2E9XD 5F5WA 5HYAA 1ZP0A 4BUMX 3VZTX 4GIWA 3QRAA 1DU2A 2CXLA 4IE7A 3ZT5A 2XAJB 4B3MT 4AXPA 8PRNA 2WCAA 3DA4A 3S4UA 4JCHA 2QA7A 1WR6A 3OBVE 3T8OA 3KV6A 2J1DG 2CXFA 3RLFF 2CMRA 4UV9B 5AQVB 3AAAA 1D0YA 4LFAT 1G8XA 2LKGA 2KT9A 2CA5A 1D1CA 4G75A 1U4QA 2ERVA 4KR8A 2XQAA 2J4GA 4O4IE 3B13A 3PUGA 4B61A 1MIYA 2P9BA 4HGAA 2R4PA 4FZMA 4NUUA 3HI2A 4MLKA 3L8RA 2LKHA 2WDVA 3VKGA 2VVSA 3P4WA 4TWHA 2K3WA 5C8YE 5ABEA 4IE5A 3PGUA 5EK4A 2K24A 4HFCA 3A2SX 5LYJE 2H7OA 3RGLA 3O1IA 2IMLA 3I0QA 1OXZA 1UUSA 5J0ZA 2BBHA 4AKRB 5AQTB 2WB5A 1WRDA 1HNZT 2HN2A 5AQMB 3AA1B 3AA0A 2XPKA 4YTMA 2C5IT 3ZMSB 1OEDB 3ZC1A 3JCUO 3FBLA 3RX6A 1X9BA 4DIDB 4HFIA 2JQ9A 2AE9A 1LVKA 4TWDA 3TLTA 2LM2A 2CWYA 5JH7E 2JPFA 2E9XC 3IBPA 3KVBA 3PU3A 5GV0A 1HX1B 5AQOB 2LOPA 4HN9A 5L47A 2R8AA 3FZLB 4BAYB 4B3TT 4IL6O 4PFPA 7PRNA 3F31A 2XTRA 5KAFO 1HX8A 1XZYA 3ZMTB 3ZCIA 3R6NA 4A98A 2XUEA 3ANWA 4PFOA 4XNKA 4LF8T 4PJMA 4WW0A 1JNZA 4PJ0O 4U3CA 5JDQA 4O2BE 4KHZF 3M65A 3SOLA 2N2MA 1ORMA 4UEMA 4GYRA 3U78A 2VURA 3LDQB 3AEGA 5HXEA 3EABA 3ZMZB 2CHNA 2QTKA 2FUPA 3AE6A 2OLTA 3NRXA 4UF0A 2JMMA 5A1LA 1ZHYA 1LVFA 4FRTA 2YU2A 3PORA 1L0VA 3B5MA 2C5JA 3PJAJ 4LF9T 2CM0A 5HWYA 3KINB 3CPZA 3JC6C 4PK6A 4JI5T 1T16A 2VL8A 2V8SV 3MA9A 4IGUA 4V1Av 4GCPA 5FVNA 1YQ4A 1PRNA 5DL5A 5G26A 4HWDA 1WFDA 3B57A 4Z90A 3J7Yq 4YLHA 2XASB 4IDZA 2LHRA 5GTHO 4JI3T 4IDNA 3N9PA 1H6S1 3WAJA 1NAFA 4GCSA 3PQSA 3MACA 2G0UA 3AE2A 2OV9A 4HTEA 2D0TA 1G90A 5L3GB 3ZT6A 4DBQA 3TZGA 4HE8A 1Y64B 3HKBE 2WZIA 4FQEA 3LBXA 4E1TA 3PQUA 3DTOA 2WZHA 4CXXA 3ONXA 1MMAA 1HXXA 4MFRA 2BVMA 2LSKA 3UUBA 4K3BA 2FJDA 2WWUA 2L3LA 2L9QA 4U33A 2BBJA 5ABHA 2Y7SA 4DV6T 2VVNA 2R4OA 3P4PA 1GFMA 2X0LB 2LHFA 3E0ZA 1HS7A 2K4TA 1G73A 3RPUA 1SE7A 3VY9X 1BR2A 4WYVA 4PJNA 3FZMB 1JNRA 2EHOB 3UU8A 4YT0A 3T20A 3QK6A 1N34T 2X0YA 4DNDA 2Y0HA 4AYDC 4DV0T 4O3XB 3GN5A 3K19A 3RHWA 4FSOA 2WS3A 1MNDA 3FZFB 2XZEA 2DWGA 3J9X1 1IZNA 5FY1A 4G2AA 4ILBA 3DA3A 3ZYKA 4GHBA 5G3AA 4LSIA 3PUXF 5AFUL 4DV5T 4JYAT 2LOSA 2IW5B 2EHOD 1MNEA 2X9WA 5AQGB 4UELA 4RLBA 2SPCA 2UUCT 1YKEB 4I43B 2LSJA 4IE6A 1XNQT 4UV8B 2PBIA 3ZSSA 2J4UP 1W0AA 3L39A 4LSHA 1X79A 5BMVE 3KFWX 2D2SA 2WM9A 3LK3A 2LE8A 1VCSA 3C5OA 4BJMA 2KZ7B 2QGSA 4QH1A 2ZFGA 2UXXB 3H37A 1KNZA 3RI5A 1IJ6A 4CXYA 3DWNA 4GF4A 2W81C 2XQYA 3K8PC 3R84B 5KXJA 4XAXB 4IE0A 2V5CA 2XJ7A 4O2AE 4LMJA 2A3DA 4YHJA 2XE2A 1HR0T 5AFUK 1QJ8A 4PJJA 4G76A 4JI0T 4H9SE 2O4VA 4RJWA 3PE0A 3DZMA 5T5FA 5AQFB 4E7ZA 3GP6A 2NP9A 1UGOA 4GK0E 4KI0F 2M6BA 2IHR1 4B3ST 3BK9A 2B1EA 2CBJA 1M7KA 4QXBB 1BXWA 4U9CA 4H9OC 1OSMA 3AA6B 5LMNT 3I1AA 5TISO 2WVPA 2WBLA 3BQKA 3LK42 5JRCA 2UUBT 2VKDA 2VQET 1QUUA 2W62A 2BZBA 3SZDA 4RLCA 4LF5T 3RRCA 4F6RC 3CQXC 4O3ZA 3VU7H 2QYWA 3KV9A 3RIFA 3JCFA 3VR9A 4CI2B 3WI4A 2CXDA 3N2OA 2ZM8A 3VE2A 4AISA 2V6YA 1T7SA 5AQIB 2R89A 3IF8B 3A8YC 3HW9A 2I6HA 2X67A 1KNRA 4KMCA 4IREA 4CQIA 4TX5A 1FMVA 5L3BB 4FJOA 3FXDB 3RIUC 5AQKB 2YN6A 2JMHA 5D5DA 5FY7A 4EEBA 1I94T 3H3MA 5CA0E 4X62T 3K1SA 4AIUA 1LRZA 4DMWA 4ZXLA 4GKJT 2KWIB 1YQ3A 2JQQA 4KBMB 3FBZA 2LSYA 4QX7B 3VHLA 2XSAA 3LG7A 1T8BA 1YD8G 4ZS2A 4ZOLE 4UXNB 2XTLA 3SYBA 2MNHA 4ZHQE 3VY8X 5LGTB 3KZIO 1MM4A 5HCJA 2IC9A 2DHRA 4OK0A 4ZI2D 4L5GA 3EDVA 5BR8T 1Y01A 4UVBB 2E9XB 3AE1A 4O4LE 5LCYA 4UB6O 2Q9QB 4IDPA 2V7MA 3MK7C 5LP6E 3UPGA 2ODUA 2BDEA 3I0OA 2R4LA 2XAQB 1E7PA 2HPJA 4RL9A 2F4VT 3MJXA 2BKPA 3P4RA 2YNKA 4QH5A 4X64T 2V7KA 3HOEA 4K0UA 2DLRA 1PHOA 1HNWT 2KINB 4C4VB 5FXXA 2D5UA 3A0BO 2LSIA 4NPPA 3OYZA 5DL6A 4I0UA 4QWNB 3UU3A 2KZ7A 3ZJ2A 4LF7T 3RYFE 5LB7B 1IBKT 2XQ5A 3N9MA 2OA5A 3T1YT 4AQFA 3IEEA 2PRNA 5FXZA 3RIUA 2ES0A 3P8CD 5AQNB 3K3NA 2X9YA 4IL4A 4X5TA 2LFUA 5LGUB 2X66A 5F8PA 4KP3C 5HXSA 5C3JA 2DL1A 3SWHA 3ZN1B 4YHHT 4D65A 3PUSA 1HCIA 2BVLA 4PK5A 5FYMA 5JR9B 2H3RA 3EI0A 3AA7A 3RKGA 4P0BA 3CIRA 3D0TA 2B76A 4AKLA 2LHNA 3HA4A 4C4VA 3ZLIA 3OKQA 3ZJ1A 1E1HB 4DR2T 1LKXA 2CEAA 3AXJB 2NOXA 1VCTA 1XDOA 2Y0KA 1SHZC 4YSZA 1XMQT 5LJNA 2XAFB 2W0GA 3UUXB 3F57A 1T1LA 4XBFB 2I59A 4A56A 2IUBA 2XQ8A 4U72A 2IDOB 1MMGA 1IBMT 3UQ4A 4WBNE 2LLYA 2Q9QA 3RC8A 5FXVA 4C00A 2LEHA 2XHEB 4GYSA 2CRBA 4DV7T 4ZI7E 1FJGT 3AAEA 3V5SA 2BS3A 4HWCA 4KX6A 4P09A 3PUQA 2WMNA 4YJ3E 1R8IA 5L3FB 3BQIA 3FB2A 5J1GA 4I50E 4D5UA 3VE1A 3SY9A 1Q9FA 1IAPA 3X1DA 1N33T 4PAGA 2Q9QC 2YDRA 3AE4A 2BG9E 5FP3A 4FUVA 2FJEA 3C4ZA 2WJQA 1OEDC 1NWMX 2K48A 1NENA 2NTXA 5JDLA 3PRNA 3PUAA 1H7CA 3ZT7A 4LFCT 4U7YA 3AE9A 4TNVA 4B6XA 5L4EA 4E1SA 2Z6EA 1YXRA 3KBTA 4EYUA 4AYEC 4F8HA 4GK5E 1D1AA 3AAEB 2OMFA 4QH4A 5GTIO 3ONLC 4PK4A 3N2GE 3Q5WA 4HWIB 4OYJA 3SFEA 1QJPA 2CCQA 4HFVA 2W2UA 4LF6T 4EYYR 3CX8B 4DBRA 3DP7A 3VRAA 1BT9A 2A9UA 2ACXA 3SS1A 3LSVA 2RP4A 5KAIO 2PORA 4GCQA 2YINA 2MOZA 3POUA 3N9NA 4Z8XA 2HN1A 2X68A 5HEGA 2J62A 3FHNA 5JDFA 4ANJA 2NW9A 2ACZA 5FL0A 4MALA 4JI2T 4N59A 4I55E 3SFDA 3ZCJA 2H88A 1D0ZA 2I0MA 1I6ZA 3RQWA 4TWFA 4WNKA 3UU6A 2M67A 4ZI3C 4FZNA 3HWBA 1UURA 2E5VA 1US7B 1BR4A 3BS0A 4O3WA 3GMIA 2YKSA 4JEUB 2E9XA 2H7VC 4XZCA 2LSGA 3RH3A 2A72A 4HFEA 3H3AA 4K0KT 3E22E 3AEEA 2KXPA 1OEDA 3OJAA 4ISSA 2V6XA 1B7TA 5EK2A 3AA0B 3BRZA 4X1IE 2BS4A 4H63H 3WI3A 4N78D 3ETVA 2R88A 3JTYA 4KRAA 4AI6A 5LMUT 3NVOA 5J2TE 3LK2B 2IWVA 4M1PA 2V5DA 2W63A 4ZI2C 2K9AA 3Q9DA 4AUIA 3UU4A 3ESLA 1J5ET 1UX4A 4QX8B 4TV8E 5LNKA 2BS2A 3EUHA 1Z8UA 3ZSTA 2VB6A 4MHCA 1IJ5A 4CI3B 3MXZA 3POQA 4JI7T 3GN5B 3NKZA 3RRWA 4DVDA 1Q9GA 4CTDA 1GFQA 1WR0A 5DABA 5JR9C 3NZPA 3Q5EA 4IT4A 3CQCB 5EZYE 4C91A 4NUVA 4DV3T 2M06A 5CFBA 3SZVA 3VZWX 3JC6D 4O4JE 4FZLA 3T1HT 3W15B 2JRKA 2JQKA 3PJAA 2WDQA 3PV0F 4ISTA 2NW7A 4EGWA 2KLQA 1KNPA 5AQRB 4PJLA 5HAXA 1NEKA 4X1YE 3ZYLA 2D0UA 1U5PA 2PTFA 5AQLB 4MBQA 2XAHB 5H2FO 2BKOA 3C98B 1N32T 2XQ6A 5JQGE 4P1NA 3ZC0A 1XMOT 2X0HA 3ZMUB 3C4XA 4UR9A 3NRYA 4DV4T 2XM1A 4XNLA 2XMXA 5LOVE 4I4TE 2QRXA 1EZ3A 4LSEA 2XQ3A 3BRYA 3HKDE 4YTPA 5HXHA 3ZMVB 1V9DA 6PRNA 4FESA 3PU8A 5IYUA 4DR4T 2W4XA 2GK9A 1M62A 3G7GA 2J1NA 1SUMB 2WSSV 2QVAA 4FMSA 3CQGB 4EOZB 3LK2A 3PGSA 3PTRB 3KV4A 3BQLA 1S35A 4HFHA 4PUXA 3KVAA 2V7LA 2ODJA 2Y48B 5JRCB 2W00A 3RQUA 2ZM0A 4NXNT 4HKAA 5HEHA 2ZLDA 3DJBA 2JQHA 2K0LA 3ONJA 2N1GA 4YTNA 4ZEYA 5HWXA 4HWHA 3NJTA 4NIQA 5HEOA 4Q25A 2ZLYA 3HKEE 4CN6A 3RYCE 5CGMA 5ETWA 3U3IA 3SY7A 4JLEA 2IAKA 2UXDT 4DMVA 4EXTA 1KK7A 4LSFA 3VRBA 1OPFA 2CLYB 1FIOA 3GWHA 5HXRA 2WJRA 5DQVA 1P4TA 2XY8B 4CZZB 2DNXA 2DWKA 4N75A 5C2TA 4TN7B 4YJ2E 3OPCA 1D0XA 3EHZA 3EDUA 4N74A 3TKLB 3AEDA 4AKGA 3NZQA 3EMNX 3ZPOA 3UTKA 4JEHB 2V26A 3OVUA 5DJQC 1MMNA 4JV5T 2XE5A 4JI4T 2GE4A 5IUXA 5AQUB 4TZ4C 2XAGB 5LHIB 1T72A 3FZKB 3AEAA 2MHLA 4YY3T 1VRBA 4X1KE 4A97A 3N2KE 3PUWF 1WLXA 4LMLA 3UAQA 3WI5A 2CPTA 1UK5A 3CKDA 2WMOA 4C90A 3NBXX 4EB6E 1BH3A 3A5XA 1WYCA 2UXNB 5F3JA 2J47A 4DV1T 3KDSE 2MTQA 2DI4A 2A2FX 4U2YA 1D1BA 4ASKA 4ZS3A 2RA1A 3IHRA 4JBWF 2VK9A 4HFBA 2LT3A 1WCRA 1YKHB 5FL1A 4DR5T 4B3RT 4O3YA 3KBUA 5EK3A 4OHFA 2KWHA 3ZKRA 2EHOA 4F4BA 4ERRA 3OYXA 2AXTO 3QC9A 5IYZE 2UXBT 4EIWA 3CWZB 2W61A 4OFZA 2PFVA 2JJ9A 5DL7A 3O4XE 4AQYT 2JQYA 4C69X 3C50A 4CN4A 5B5EO 4AYMC 3OTOT 2KXPB 3N5LA 3P4SA 4ILCA 4UIGA 5PRNA 1ZHZA 2Y8DA 5HEJA 2Y0LA 2F1CX 4IDQA 4UF0B 2VL0A 4ILUA 1S5LO 2YDQA 2ZMAA 4ZZCA 4O4UA 1AJ3A 4J2CA 1FMWA 2KMFA 3LBXB 3C51A 3Q2MA 2JMKA 3UU5A 3UFEA 1W0BA 3L09A 3LFMA 4H9QC 3RYIE 2V7JA 4H63V 1VOMA 5J2UE 3PF1A 2YU1A 4UVCB 2ZM6T 3AXJA 3DWOX 3QB5A 1HXTA 1ZEEA 3GA8A 1WYBA 2MYSA 2UXCT 3SRZA 1BR0A 4LF4T 3AB3B 3C4WA 1BR1A 2HH7A 3MZKB 3EVYA 4KHPT 2YDSA 1HTJF 4AYNA 3AE8A 2WAUA 4EEDA 4AKMA 3QRCA 4P0AA 2IWWA 4IL9A 5AQPB 3JADA 4WBOA 5FMNA 2X9HA 1GQEA 2FGQX 4X66T 4DR1T 4QHOA 4OX9T 3TLSA 2MPKA 4BA9A 3E08A 2KC0A 3POXA 5JVDE 2VKHA 2KSRA 1MPFA 2BG9A 1T98A 4DR7T 4FSPA 4EZHA 3ABVA 5IWAT 2X9KA 4LMKA 3AA1A 5FKYA 1XNRT 2V7IA 3AE7A 4O49A 3AEFA 1IZNB 5ABGA 1ZHCA 1THQA 1MM5A 1ZKEA 4H9RC 2E8IA 2W67A 3ANWB 2XQ9A 2L8KA 3RF1A 4NXMT 3TLUA 2V1DB 4IE4A 5JDNA 4U31A 2IC6A 3RBHA 4JUYA 3CVRA 5H6QB 2XSBA 2XQ4A 4U2ZA 2M6IA 5L3EB 3P7IA 3PURA 5H6RB 2PJQA 1KF6A 5JDHA 1Z0PA 4JI8T 4U7IA 3CK6A 1FEWA 4YSXA 4FRXA 3ZYMA 4Z3TA 4WZXA 3CX6B 2H89A 3O1JA 4O4HE 1HG2A 2EHOC 4AKHA 4FT6A 3AECA 5AQSB 4AKRA 1W9RA 5B66O 5L3CB 4DR6T 1SA0E 3QUJA 3VKHA 1O3XA 4O8SA 1HG5A 3WU2O 2WU5A 2W66A 2ODVA 1HXUA 3VZUX 3ETUA 1UX5A 1IBLT 1YS5A 4EAHA 1ZHXA 2D9DA 2X27X 5DL8A 4D64A 1QLBA 2YK0A 1HNXT 4EZ4A 4GKKT 3N9OA 2VWAA 3AA7B 5JR9A 3AAAB 2F1TA 3AEBA 3M3ZB 2LRKA 2CE7A
chains in the Genus database with same CATH topology
2KNDA 4FOZA 2PG8A 5KMGP 2YNKA 3G7GA 4X20E 3FYXA 2V7KA 5M4YA 2XUEA 3ANWA 4PFOA 2WSSV 2J1NA 2F1VA 3HOEA 4O4XA 4K0UA 4FMSA 2DLRA 4QKNA 1PHOA 4OYKA 1MIVA 5TAOA 4XNKA 3CQGB 4EOZB 3LK2A 4PJMA 3PTRB 2KINB 3KV4A 3BQLA 1GFPA 1S35A 4PUXA 3KVAA 4WW0A 3I9YA 5HXCA 5FXXA 2D5UA 2V7LA 2LSIA 5IHYA 4KUMB 2ODJA 4H9PC 3OYZA 5JDQA 5DL6A 4O2BE 4QWNB 2Y48B 3M65A 3SOLA 2KZ7A 2N2MA 3ZJ2A 5JRCB 2W00A 4GYRA 4UEMA 3RYFE 2DCFA 1ORMA 2ZM0A 1MMDA 3U78A 4HKAA 5LXTE 2ZLDA 3O1HA 1GFNA 4HEAA 3DJBA 5HXEA 3ZMZB 2LM9A 2K0LA 3N9MA 4L0RA 2OA5A 2QTKA 2YPVA 2N1GA 5FNVE 5JREA 4AQFA 3IEEA 3AVRA 5DQWA 2PRNA 5FXZA 5HWXA 3NRXA 4UF0A 1ZHYA 2ES0A 3P8CD 1LVFA 5A1LA 2JMMA 3F2EA 4FRTA 2YU2A 2ZLYA 2X9YA 3HKEE 3K3NA 3Q5XA 3KV5A 2Y2XA 3PORA 4YFSA 2C5JA 2LFUA 5LGUB 2X66A 3C64A 3RYCE 2CM0A 5F8PA 4KP3C 5HXSA 5ADXL 1S94A 5HWYA 3SWHA 5ETWA 3U3IA 3KINB 4PW8A 3CPZA 3ZN1B 5CA1E 3SY7A 3JC6C 4PK6A 4D65A 4JLEA 2IAKA 3PUSA 4DMVA 4EXTA 2VL8A 1HCIA 1KK7A 2BVLA 3MA9A 4IGUA 4PK5A 4V1Av 5FYMA 4IIJE 1OPFA 4GCPA 5JR9B 2H3RA 1PRNA 5FVNA 3AA7A 5DL5A 5G26A 2CLYB 1FIOA 4PNIA 3B57A 4P0BA 3GWHA 5HXRA 3J7Yq 4YLHA 3K3QC 3N9QA 5DQVA 1ZHTA 2CLYC 3D0TA 3KVDD 3FXEB 5LHGB 1P4TA 4CZZB 4AKLA 2DNXA 2DWKA 2LHNA 3HA4A 4TN7B 4YJ2E 2XASB 4IDZA 3ZLIA 2LHRA 3OKQA 1D0XA 3ZJ1A 1E1HB 3EDUA 3N9PA 3CMLA 1LKXA 2CEAA 4FI5A 4AQFC 4CI1B 2NOXA 1H6S1 1MIWA 3WAJA 1NAFA 1SHZC 2Y6XA 5FY0A 2Y0KA 3PQSA 3MACA 4GCSA 2C5KT 4LSFA 2G0UA 3TKLB 2XAFB 5LJNA 2W0GA 3UUXB 3F57A 3WAKA 5JDGA 4XBFB 4AKGA 3NZQA 3EMNX 4HTEA 3ZPOA 2D0TA 2I59A 2Q9QD 1G90A 3UTKA 4JEHB 2V26A 5L3GB 4A56A 4DBQA 4U72A 3LK3B 3TZGA 5DJQC 4HE8A 1Y64B 3HKBE 1MMNA 2XE5A 5JDMA 1MMGA 3LBXA 4WBNE 4E1TA 3PQUA 3DTOA 2Q9QA 3RC8A 2GE4A 5FXVA 4CXXA 2XTQA 4TZ4C 2XAGB 3ONXA 2LEHA 5LHIB 1MMAA 2MBGA 3L3PA 5CB4E 4MFRA 2BVMA 2LSKA 2XHEB 1HXXA 2MHLA 4GYSA 1VRBA 3V5UA 2WWUA 4X1KE 2L3LA 4AKIA 2L9QA 2LJLA 2Y7SA 5LGNB 3N2KE 4ZI7E 1WLXA 4AFKA 3AAEA 3HL6A 3V5SA 3UAQA 3WI5A 1GFMA 4P09A 5LA6E 3UU2A 2X0LB 3PUQA 2WMNA 3CKDA 3AVSA 4YJ3E 5E0OA 3O0EA 2WMOA 4C90A 2LHFA 2C0SA 5L3FB 3NBXX 3E0ZA 4EB6E 5KDMC 2XE3A 1HS7A 3BQIA 3FB2A 5J1GA 2K4TA 1G73A 3RPUA 3HR0A 4I50E 1BH3A 3VY9X 3A5XA 4D5UA 1BR2A 1WYCA 3VE1A 3MKDA 4PJNA 3SY9A 3AAIA 1Q9FA 1IAPA 4ADZA 1ZHWA 2UXNB 3LJCA 5F3JA 1OWAA 2EHOB 3KDSE 3HOLA 2MTQA 3K3OA 2DI4A 3NSGA 2A2FX 1D1BA 4ASKA 4AZLA 4PAGA 2Q9QC 4ZS3A 3PDYA 2RA1A 3IHRA 3T20A 3QK6A 5FP3A 2VK9A 4FUVA 5EE2A 3C4ZA 4DO0A 2LT3A 4DNDA 3RKOA 1NWMX 2K48A 2Y0HA 2NTXA 4AYDC 4AYID 2M07A 4L9IA 1YKHB 5JDLA 3GN5A 4O3XB 3T0SA 3K19A 3PRNA 4FSOA 2YEVC 1MNDA 3PUAA 4ZI3D 4O3YA 4IHJE 2DWGA 1H7CA 3KBUA 3J9X1 5LG4A 1IZNA 5EK3A 4OHFA 2KWHA 5FY1A 2EHOA 4H9NC 4G2AA 4F4BA 4ERRA 1YW0A 3LK41 3OYXA 4B6XA 2NW8A 3QC9A 3DA3A 5IYZE 5GONE 3CWZB 3ZYKA 4EIWA 4GHBA 4E1SA 2W61A 4OFZA 2PFVA 2JJ9A 2W80C 2Z6EA 3KBTA 3ZN0B 4LSIA 4EYUA 5DL7A 5AFUL 3O4XE 4AYEC 3CX7B 4G63A 2LOSA 2IW5B 4RJXA 4GK5E 4C69X 3C50A 2EHOD 2X9XA 1D1AA 4AYMC 3AA6A 3AAEB 2OMFA 1MNEA 2KXPB 3N5LA 2X9WA 4UIGA 4UELA 5PRNA 1ZHZA 4PK4A 3N2GE 3Q5WA 4RLBA 2SPCA 2Y8DA 1YKEB 5LJMA 2Y0LA 4GOUA 4OYJA 4TV9E 2N2NA 4I43B 5FXWA 1QJPA 2LSJA 4IE6A 2CCQA 4UF0B 4UV8B 4ILUA 2ZMAA 3RC3A 4O4UA 4HFVA 5LHHB 2PBIA 1HFAA 2J4UP 1AJ3A 1ZV4X 4LSHA 4J2CA 1X79A 3UUMA 1FMWA 3I9WA 4EYYR 3CX8B 2N9DA 2KMFA 3LBXB 5BMVE 3UULA 3C51A 3KFWX 2JMKA 2D2SA 3DP7A 2WM9A 3Q2MA 4DBRA 3UFEA 3LK3A 2NWBA 2LE8A 1BT9A 4U74A 2ACXA 2VASA 3C5OA 4UVAB 3SS1A 4BJMA 2RP4A 3L09A 2KZ7B 3LFMA 2QGSA 3RYHE 2ZFGA 2UXXB 4H9QC 2PORA 5LBMA 1HF8A 2FGRA 3RYIE 2V7JA 3H37A 1KNZA 1GFOA 4H63V 2XG6A 4GCQA 3HKCE 1VOMA 1IJ6A 5J2UE 1QJ9A 5L2LA 2YINA 4AQGA 2YU1A 4UVCB 2MOZA 3POUA 4KR4A 3N9NA 4QQ1A 4Z8XA 4CXYA 2X68A 3T24A 4BJNA 1HXTA 3FHNA 2XE1A 2W81C 1ZEEA 3UUNA 2XQYA 1UCUA 3K8PC 2CWOA 5JDFA 4ANJA 3GA8A 2NW9A 3R84B 2ZM2A 4XAXB 4IE0A 4N59A 4MALA 4CXWA 4I55E 1WYBA 2MYSA 4O2AE 3ZCJA 3SRZA 1D0ZA 1BR0A 4N58A 3AB3B 3C4WA 1BR1A 2A3DA 2VKOA 4YHJA 2XE2A 2HH7A 3MZKB 1QJ8A 3EVYA 1QSDA 4PJJA 2KDYA 4G76A 4WNKA 4H9SE 1HTJF 2O4VA 4AYNA 2K5BB 2M67A 4JFBA 5ADXK 4ZI3C 4RJWA 4FZNA 3PE0A 3HWBA 5T5FA 4E7ZA 2WAUA 4AKMA 1US7B 1BR4A 3GP6A 2NP9A 4P0AA 3QRCA 3V8UA 4GK0E 4O3WA 2NTYA 3GMIA 4WBOA 5FMNA 2X9HA 5JDPA 4JEUB 2E9XA 3BK9A 2H7VC 2FGQX 4XZCA 2B1EA 4QXCB 2LSGA 4QHOA 3RH3A 2A72A 4BA9A 2N2LA 4QXBB 1BXWA 3H3AA 2HPLA 3E08A 4H9OC 3E22E 2KC0A 1OSMA 2KXPA 5JVDE 3POXA 2VKHA 2X51A 1CUNA 3AA6B 3I1AA 4QXHB 1MPFA 3N9LA 1T98A 4FSPA 3OJAA 4ISSA 3SYSA 2VKJA 5LBQB 4EZHA 1B7TA 5EK2A 4TUYE 3AA0B 2WBLA 3BQKA 3AA1A 3ZEFB 4X1IE 3WI3A 3LK42 4H63H 5KX5E 5JRCA 4N78D 2VKDA 3ETVA 1E54A 1QUUA 2V7IA 2W62A 4E7SA 2BZBA 3SZDA 4O49A 4RLCA 3JTYA 3O9XA 1IZNB 4KRAA 3UT5E 4AI6A 1ZHCA 5L3DB 3RRCA 4F6RC 1THQA 3CQXC 5J2TE 1MM5A 2E9XD 3LK2B 4O3ZA 2CE7A 3VU7H 3KV9A 1ZKEA 4M1PA 4H9RC 5HYAA 4CI2B 3WI4A 2E8IA 2W63A 3VZTX 4ZI2C 3ANWB 4GIWA 3QRAA 4BUMX 2CXDA 2CXLA 4IE7A 2L8KA 3N2OA 2ZM8A 2K9AA 3VE2A 3Q9DA 2XAJB 4AXPA 5AFUK 8PRNA 3DA4A 2V1DB 4IE4A 3S4UA 4AUIA 4JCHA 2QA7A 1WR6A 3ESLA 3IF8B 3OBVE 3T8OA 3HW9A 3KV6A 2J1DG 2CXFA 1UX4A 2X67A 2CMRA 4QX8B 4UV9B 5JDNA 3AAAA 1D0YA 2IC6A 3RBHA 4KMCA 4TV8E 1G8XA 5LNKA 4CQIA 2KT9A 3EUHA 4TX5A 1FMVA 2CA5A 5L3BB 1D1CA 4FJOA 3FXDB 2VB6A 4JUYA 4MHCA 1IJ5A 3CVRA 5H6QB 4G75A 1U4QA 4CI3B 2ERVA 3MXZA 4KR8A 3POQA 4O4IE 5L3EB 3P7IA 3GN5B 2JMHA 5D5DA 3B13A 5FY7A 3PURA 3PUGA 5H6RB 1MIYA 2P9BA 4HGAA 4B61A 4FZMA 3RRWA 2PJQA 4DVDA 1Q9GA 5JDHA 4NUUA 3HI2A 1Z0PA 4MLKA 1GFQA 5CA0E 5DABA 3NZPA 1LRZA 5JR9C 4DMWA 3VKGA 1FEWA 5C8YE 4IE5A 5EK4A 2K24A 3A2SX 3CQCB 2H7OA 5LYJE 2KWIB 3ZYMA 4FRXA 4Z3TA 5EZYE 4U9CA 2JQQA 4C91A 3O1IA 3CX6B 4KBMB 4NUVA 3FBZA 3I0QA 2LSYA 3O1JA 4O4HE 2M06A 1HG2A 2EHOC 4QX7B 1OXZA 3VHLA 3SZVA 4AKHA 3VZWX 4FT6A 3JC6D 4O4JE 3LG7A 4AKRB 4FZLA 4AKRA 1WRDA 1YD8G 3W15B 4ZS2A 2JRKA 5L3CB 3AA1B 4ISTA 1SA0E 2NW7A 4GF4A 3QUJA 2KLQA 4ZOLE 4UXNB 3VKHA 3AA0A 2XTLA 1O3XA 4PJLA 4O8SA 5HAXA 2MNHA 4ZHQE 3SYBA 1HG5A 5LGTB 3VY8X 4X1YE 3ZYLA 2C5IT 3ZMSB 3ZC1A 3FBLA 1MM4A 3RX6A 2D0UA 1U5PA 2ODVA 2IC9A 4MBQA 2XAHB 1HXUA 2DHRA 3VZUX 4OK0A 4ZI2D 3C98B 3ETUA 1LVKA 4L5GA 3EDVA 5JQGE 1UX5A 2CWYA 5JH7E 2JPFA 2E9XC 3IBPA 3KVBA 4UVBB 1YS5A 3PU3A 3ZC0A 2E9XB 5GV0A 4EAHA 1ZHXA 2LOPA 3ZMUB 4O4LE 5LCYA 3C4XA 4HN9A 2X27X 3NRYA 5DL8A 4D64A 2YK0A 2Q9QB 4XNLA 2V7MA 2XMXA 3MK7C 5LP6E 4EZ4A 3UPGA 5LOVE 4BAYB 4I4TE 3N9OA 4PFPA 1EZ3A 3F31A 2VWAA 2ODUA 2XTRA 4LSEA 3AA7B 7PRNA 5JR9A 3HKDE 3AAAB 2BDEA 3I0OA 2F1TA 2XAQB 1HX8A 2HPJA 5HXHA 4RL9A 3ZMTB 3ZMVB 1V9DA 3R6NA 3ZCIA 6PRNA 4FESA 3PU8A 5IYUA 2GK9A 3MJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AKR B;  5ADX L;  4AKR A;  3AA1 A;  3LK4 2;  5AFU L;  3AA1 B;  3AA0 A;  3LK3 A;  3LK2 A;  3AA6 A;  3AAA A;  3AAE B;  3AA7 A;  2KXP B;  5AFU K;  1IZN B;  2KZ7 B;  1IZN A;  2KXP A;  3AA7 B;  3AAE A;  3AAA B;  3AA6 B;  5ADX K;  3LK2 B;  3LK3 B;  3LK4 1;  2KZ7 A;  3AA0 B; 
#chains in the Genus database with same CATH topology
 2KND A;  4DR3 T;  2PG8 A;  5KMG P;  4FOZ A;  1W09 A;  4X20 E;  3FYX A;  2IIU A;  5M4Y A;  4O4X A;  4TNW A;  2F1V A;  3UQ7 A;  4QKN A;  4OYK A;  1MIV A;  5TAO A;  3A7M A;  3NWI A;  1GFP A;  3PGR A;  5HXC A;  3I9Y A;  3PUV F;  5IHY A;  2CHO A;  4KUM B;  4H9P C;  2DCF A;  1MMD A;  5LXT E;  3O1H A;  1GFN A;  4HEA A;  2LM9 A;  4L0R A;  3EAM A;  5ABF A;  2YPV A;  4HWF A;  3Q5D A;  5FNV E;  5JRE A;  3AVR A;  5DQW A;  5FVL A;  3P50 A;  5HEU A;  3F2E A;  3Q5X A;  3KV5 A;  2Y2X A;  4YFS A;  4UB8 O;  2YOE A;  3C64 A;  2WU2 A;  5ADX L;  1S94 A;  5ABF B;  5AQH B;  4PW8 A;  5CA1 E;  2JIW A;  4IIJ E;  4PNI A;  3K3Q C;  3N9Q A;  3QOF A;  1ZHT A;  2CLY C;  3KVD D;  3FXE B;  5LHG B;  1N36 T;  5LG3 A;  1XDP A;  3FZH B;  4HFD A;  2CBI A;  4LFB T;  3UFG A;  3A0H O;  1KEY A;  3CML A;  1E2A A;  2VQF T;  4FI5 A;  4AQF C;  4CI1 B;  1MIW A;  5E79 O;  5HCM A;  2Y6X A;  3JAF A;  5FY0 A;  2C5K T;  3WAK A;  1XWM A;  5JDG A;  5JTG A;  2Q9Q D;  4ILA A;  5FVK A;  3LK3 B;  2FJB A;  5JDM A;  3JAE A;  2XQ7 A;  2XTQ A;  2MBG A;  3L3P A;  5CB4 E;  3V5U A;  5AQQ B;  4AKI A;  2LJL A;  5LGN B;  4DUZ T;  2WP9 A;  4AFK A;  3HL6 A;  5LA6 E;  3UU2 A;  3TLV A;  3AVS A;  5E0O A;  3O0E A;  2C0S A;  4DV2 T;  2XE3 A;  5KDM C;  2BG9 C;  3HR0 A;  4YSY A;  3MKD A;  5G38 A;  3AAI A;  4ADZ A;  1ZHW A;  2NR4 A;  3LJC A;  1OWA A;  3HOL A;  3K3O A;  2XM2 A;  2R6G F;  3NSG A;  2FBW A;  4A5X A;  4AZL A;  3PDY A;  3AE5 A;  2WY2 A;  3QNU A;  4IDO A;  2V6Y B;  5EE2 A;  4DO0 A;  3RKO A;  4AYI D;  4JI1 T;  2M07 A;  4L9I A;  3T0S A;  5CJ5 A;  2LRL A;  2YEV C;  4ZI3 D;  4IHJ E;  5LG4 A;  5G39 A;  4H9N C;  2WDR A;  3LK4 1;  1YW0 A;  2NW8 A;  3PUZ F;  5GON E;  4COF A;  2HHH T;  1CHU A;  2W80 C;  3ZN0 B;  1J5W A;  4PR7 A;  1ZOY A;  2E2A A;  3CX7 B;  4G63 A;  4RJX A;  2X9X A;  3AA6 A;  5LJM A;  4GOU A;  4TV9 E;  5FXW A;  2N2N A;  2MAW A;  4K3C A;  2WWV A;  4X65 T;  3G06 A;  3RC3 A;  4YXD A;  5LHH B;  3TLW A;  1HFA A;  1ZV4 X;  3UUM A;  3I9W A;  2R4N A;  2N9D A;  3UUL A;  2NWB A;  4U74 A;  2VAS A;  2UU9 T;  4UVA B;  2BG9 B;  3RYH E;  5LBM A;  1HF8 A;  4JI6 T;  2WQY A;  2FGR A;  1GFO A;  2XG6 A;  2FJA A;  3HKC E;  4DUY T;  1QJ9 A;  5L2L A;  4AQG A;  3VR8 A;  4CN1 A;  4KR4 A;  4QQ1 A;  3IA3 A;  3T24 A;  4BJN A;  2BKN A;  2XE1 A;  2RPA A;  3UUN A;  1UCU A;  2UUA T;  2CWO A;  3PUY F;  2ZM2 A;  4CXW A;  5L4H A;  4ZZB A;  4N58 A;  2VKO A;  2KDY A;  3P4Q A;  1QSD A;  2K5B B;  5ADX K;  4JFB A;  2E5L T;  2AXD S;  3AE3 A;  1OED E;  3V8U A;  2NTY A;  3QB5 K;  5JDP A;  4EV6 A;  4QXC B;  2N2L A;  2HPL A;  4Z91 A;  2X51 A;  1CUN A;  4QXH B;  1J1J A;  3N9L A;  3SYS A;  3RIA A;  2VKJ A;  5LBQ B;  4TUY E;  3ZEF B;  5AQJ B;  5KX5 E;  1KFY A;  1E54 A;  4E7S A;  3O9X A;  3UT5 E;  5L3D B;  2E9X D;  5F5W A;  5HYA A;  1ZP0 A;  4BUM X;  3VZT X;  4GIW A;  3QRA A;  1DU2 A;  2CXL A;  4IE7 A;  3ZT5 A;  2XAJ B;  4B3M T;  4AXP A;  8PRN A;  2WCA A;  3DA4 A;  3S4U A;  4JCH A;  2QA7 A;  1WR6 A;  3OBV E;  3T8O A;  3KV6 A;  2J1D G;  2CXF A;  3RLF F;  2CMR A;  4UV9 B;  5AQV B;  3AAA A;  1D0Y A;  4LFA T;  1G8X A;  2LKG A;  2KT9 A;  2CA5 A;  1D1C A;  4G75 A;  1U4Q A;  2ERV A;  4KR8 A;  2XQA A;  2J4G A;  4O4I E;  3B13 A;  3PUG A;  4B61 A;  1MIY A;  2P9B A;  4HGA A;  2R4P A;  4FZM A;  4NUU A;  3HI2 A;  4MLK A;  3L8R A;  2LKH A;  2WDV A;  3VKG A;  2VVS A;  3P4W A;  4TWH A;  2K3W A;  5C8Y E;  5ABE A;  4IE5 A;  3PGU A;  5EK4 A;  2K24 A;  4HFC A;  3A2S X;  5LYJ E;  2H7O A;  3RGL A;  3O1I A;  2IML A;  3I0Q A;  1OXZ A;  1UUS A;  5J0Z A;  2BBH A;  4AKR B;  5AQT B;  2WB5 A;  1WRD A;  1HNZ T;  2HN2 A;  5AQM B;  3AA1 B;  3AA0 A;  2XPK A;  4YTM A;  2C5I T;  3ZMS B;  1OED B;  3ZC1 A;  3JCU O;  3FBL A;  3RX6 A;  1X9B A;  4DID B;  4HFI A;  2JQ9 A;  2AE9 A;  1LVK A;  4TWD A;  3TLT A;  2LM2 A;  2CWY A;  5JH7 E;  2JPF A;  2E9X C;  3IBP A;  3KVB A;  3PU3 A;  5GV0 A;  1HX1 B;  5AQO B;  2LOP A;  4HN9 A;  5L47 A;  2R8A A;  3FZL B;  4BAY B;  4B3T T;  4IL6 O;  4PFP A;  7PRN A;  3F31 A;  2XTR A;  5KAF O;  1HX8 A;  1XZY A;  3ZMT B;  3ZCI A;  3R6N A;  4A98 A;  2XUE A;  3ANW A;  4PFO A;  4XNK A;  4LF8 T;  4PJM A;  4WW0 A;  1JNZ A;  4PJ0 O;  4U3C A;  5JDQ A;  4O2B E;  4KHZ F;  3M65 A;  3SOL A;  2N2M A;  1ORM A;  4UEM A;  4GYR A;  3U78 A;  2VUR A;  3LDQ B;  3AEG A;  5HXE A;  3EAB A;  3ZMZ B;  2CHN A;  2QTK A;  2FUP A;  3AE6 A;  2OLT A;  3NRX A;  4UF0 A;  2JMM A;  5A1L A;  1ZHY A;  1LVF A;  4FRT A;  2YU2 A;  3POR A;  1L0V A;  3B5M A;  2C5J A;  3PJA J;  4LF9 T;  2CM0 A;  5HWY A;  3KIN B;  3CPZ A;  3JC6 C;  4PK6 A;  4JI5 T;  1T16 A;  2VL8 A;  2V8S V;  3MA9 A;  4IGU A;  4V1A v;  4GCP A;  5FVN A;  1YQ4 A;  1PRN A;  5DL5 A;  5G26 A;  4HWD A;  1WFD A;  3B57 A;  4Z90 A;  3J7Y q;  4YLH A;  2XAS B;  4IDZ A;  2LHR A;  5GTH O;  4JI3 T;  4IDN A;  3N9P A;  1H6S 1;  3WAJ A;  1NAF A;  4GCS A;  3PQS A;  3MAC A;  2G0U A;  3AE2 A;  2OV9 A;  4HTE A;  2D0T A;  1G90 A;  5L3G B;  3ZT6 A;  4DBQ A;  3TZG A;  4HE8 A;  1Y64 B;  3HKB E;  2WZI A;  4FQE A;  3LBX A;  4E1T A;  3PQU A;  3DTO A;  2WZH A;  4CXX A;  3ONX A;  1MMA A;  1HXX A;  4MFR A;  2BVM A;  2LSK A;  3UUB A;  4K3B A;  2FJD A;  2WWU A;  2L3L A;  2L9Q A;  4U33 A;  2BBJ A;  5ABH A;  2Y7S A;  4DV6 T;  2VVN A;  2R4O A;  3P4P A;  1GFM A;  2X0L B;  2LHF A;  3E0Z A;  1HS7 A;  2K4T A;  1G73 A;  3RPU A;  1SE7 A;  3VY9 X;  1BR2 A;  4WYV A;  4PJN A;  3FZM B;  1JNR A;  2EHO B;  3UU8 A;  4YT0 A;  3T20 A;  3QK6 A;  1N34 T;  2X0Y A;  4DND A;  2Y0H A;  4AYD C;  4DV0 T;  4O3X B;  3GN5 A;  3K19 A;  3RHW A;  4FSO A;  2WS3 A;  1MND A;  3FZF B;  2XZE A;  2DWG A;  3J9X 1;  1IZN A;  5FY1 A;  4G2A A;  4ILB A;  3DA3 A;  3ZYK A;  4GHB A;  5G3A A;  4LSI A;  3PUX F;  5AFU L;  4DV5 T;  4JYA T;  2LOS A;  2IW5 B;  2EHO D;  1MNE A;  2X9W A;  5AQG B;  4UEL A;  4RLB A;  2SPC A;  2UUC T;  1YKE B;  4I43 B;  2LSJ A;  4IE6 A;  1XNQ T;  4UV8 B;  2PBI A;  3ZSS A;  2J4U P;  1W0A A;  3L39 A;  4LSH A;  1X79 A;  5BMV E;  3KFW X;  2D2S A;  2WM9 A;  3LK3 A;  2LE8 A;  1VCS A;  3C5O A;  4BJM A;  2KZ7 B;  2QGS A;  4QH1 A;  2ZFG A;  2UXX B;  3H37 A;  1KNZ A;  3RI5 A;  1IJ6 A;  4CXY A;  3DWN A;  4GF4 A;  2W81 C;  2XQY A;  3K8P C;  3R84 B;  5KXJ A;  4XAX B;  4IE0 A;  2V5C A;  2XJ7 A;  4O2A E;  4LMJ A;  2A3D A;  4YHJ A;  2XE2 A;  1HR0 T;  5AFU K;  1QJ8 A;  4PJJ A;  4G76 A;  4JI0 T;  4H9S E;  2O4V A;  4RJW A;  3PE0 A;  3DZM A;  5T5F A;  5AQF B;  4E7Z A;  3GP6 A;  2NP9 A;  1UGO A;  4GK0 E;  4KI0 F;  2M6B A;  2IHR 1;  4B3S T;  3BK9 A;  2B1E A;  2CBJ A;  1M7K A;  4QXB B;  1BXW A;  4U9C A;  4H9O C;  1OSM A;  3AA6 B;  5LMN T;  3I1A A;  5TIS O;  2WVP A;  2WBL A;  3BQK A;  3LK4 2;  5JRC A;  2UUB T;  2VKD A;  2VQE T;  1QUU A;  2W62 A;  2BZB A;  3SZD A;  4RLC A;  4LF5 T;  3RRC A;  4F6R C;  3CQX C;  4O3Z A;  3VU7 H;  2QYW A;  3KV9 A;  3RIF A;  3JCF A;  3VR9 A;  4CI2 B;  3WI4 A;  2CXD A;  3N2O A;  2ZM8 A;  3VE2 A;  4AIS A;  2V6Y A;  1T7S A;  5AQI B;  2R89 A;  3IF8 B;  3A8Y C;  3HW9 A;  2I6H A;  2X67 A;  1KNR A;  4KMC A;  4IRE A;  4CQI A;  4TX5 A;  1FMV A;  5L3B B;  4FJO A;  3FXD B;  3RIU C;  5AQK B;  2YN6 A;  2JMH A;  5D5D A;  5FY7 A;  4EEB A;  1I94 T;  3H3M A;  5CA0 E;  4X62 T;  3K1S A;  4AIU A;  1LRZ A;  4DMW A;  4ZXL A;  4GKJ T;  2KWI B;  1YQ3 A;  2JQQ A;  4KBM B;  3FBZ A;  2LSY A;  4QX7 B;  3VHL A;  2XSA A;  3LG7 A;  1T8B A;  1YD8 G;  4ZS2 A;  4ZOL E;  4UXN B;  2XTL A;  3SYB A;  2MNH A;  4ZHQ E;  3VY8 X;  5LGT B;  3KZI O;  1MM4 A;  5HCJ A;  2IC9 A;  2DHR A;  4OK0 A;  4ZI2 D;  4L5G A;  3EDV A;  5BR8 T;  1Y01 A;  4UVB B;  2E9X B;  3AE1 A;  4O4L E;  5LCY A;  4UB6 O;  2Q9Q B;  4IDP A;  2V7M A;  3MK7 C;  5LP6 E;  3UPG A;  2ODU A;  2BDE A;  3I0O A;  2R4L A;  2XAQ B;  1E7P A;  2HPJ A;  4RL9 A;  2F4V T;  3MJX A;  2BKP A;  3P4R A;  2YNK A;  4QH5 A;  4X64 T;  2V7K A;  3HOE A;  4K0U A;  2DLR A;  1PHO A;  1HNW T;  2KIN B;  4C4V B;  5FXX A;  2D5U A;  3A0B O;  2LSI A;  4NPP A;  3OYZ A;  5DL6 A;  4I0U A;  4QWN B;  3UU3 A;  2KZ7 A;  3ZJ2 A;  4LF7 T;  3RYF E;  5LB7 B;  1IBK T;  2XQ5 A;  3N9M A;  2OA5 A;  3T1Y T;  4AQF A;  3IEE A;  2PRN A;  5FXZ A;  3RIU A;  2ES0 A;  3P8C D;  5AQN B;  3K3N A;  2X9Y A;  4IL4 A;  4X5T A;  2LFU A;  5LGU B;  2X66 A;  5F8P A;  4KP3 C;  5HXS A;  5C3J A;  2DL1 A;  3SWH A;  3ZN1 B;  4YHH T;  4D65 A;  3PUS A;  1HCI A;  2BVL A;  4PK5 A;  5FYM A;  5JR9 B;  2H3R A;  3EI0 A;  3AA7 A;  3RKG A;  4P0B A;  3CIR A;  3D0T A;  2B76 A;  4AKL A;  2LHN A;  3HA4 A;  4C4V A;  3ZLI A;  3OKQ A;  3ZJ1 A;  1E1H B;  4DR2 T;  1LKX A;  2CEA A;  3AXJ B;  2NOX A;  1VCT A;  1XDO A;  2Y0K A;  1SHZ C;  4YSZ A;  1XMQ T;  5LJN A;  2XAF B;  2W0G A;  3UUX B;  3F57 A;  1T1L A;  4XBF B;  2I59 A;  4A56 A;  2IUB A;  2XQ8 A;  4U72 A;  2IDO B;  1MMG A;  1IBM T;  3UQ4 A;  4WBN E;  2LLY A;  2Q9Q A;  3RC8 A;  5FXV A;  4C00 A;  2LEH A;  2XHE B;  4GYS A;  2CRB A;  4DV7 T;  4ZI7 E;  1FJG T;  3AAE A;  3V5S A;  2BS3 A;  4HWC A;  4KX6 A;  4P09 A;  3PUQ A;  2WMN A;  4YJ3 E;  1R8I A;  5L3F B;  3BQI A;  3FB2 A;  5J1G A;  4I50 E;  4D5U A;  3VE1 A;  3SY9 A;  1Q9F A;  1IAP A;  3X1D A;  1N33 T;  4PAG A;  2Q9Q C;  2YDR A;  3AE4 A;  2BG9 E;  5FP3 A;  4FUV A;  2FJE A;  3C4Z A;  2WJQ A;  1OED C;  1NWM X;  2K48 A;  1NEN A;  2NTX A;  5JDL A;  3PRN A;  3PUA A;  1H7C A;  3ZT7 A;  4LFC T;  4U7Y A;  3AE9 A;  4TNV A;  4B6X A;  5L4E A;  4E1S A;  2Z6E A;  1YXR A;  3KBT A;  4EYU A;  4AYE C;  4F8H A;  4GK5 E;  1D1A A;  3AAE B;  2OMF A;  4QH4 A;  5GTI O;  3ONL C;  4PK4 A;  3N2G E;  3Q5W A;  4HWI B;  4OYJ A;  3SFE A;  1QJP A;  2CCQ A;  4HFV A;  2W2U A;  4LF6 T;  4EYY R;  3CX8 B;  4DBR A;  3DP7 A;  3VRA A;  1BT9 A;  2A9U A;  2ACX A;  3SS1 A;  3LSV A;  2RP4 A;  5KAI O;  2POR A;  4GCQ A;  2YIN A;  2MOZ A;  3POU A;  3N9N A;  4Z8X A;  2HN1 A;  2X68 A;  5HEG A;  2J62 A;  3FHN A;  5JDF A;  4ANJ A;  2NW9 A;  2ACZ A;  5FL0 A;  4MAL A;  4JI2 T;  4N59 A;  4I55 E;  3SFD A;  3ZCJ A;  2H88 A;  1D0Z A;  2I0M A;  1I6Z A;  3RQW A;  4TWF A;  4WNK A;  3UU6 A;  2M67 A;  4ZI3 C;  4FZN A;  3HWB A;  1UUR A;  2E5V A;  1US7 B;  1BR4 A;  3BS0 A;  4O3W A;  3GMI A;  2YKS A;  4JEU B;  2E9X A;  2H7V C;  4XZC A;  2LSG A;  3RH3 A;  2A72 A;  4HFE A;  3H3A A;  4K0K T;  3E22 E;  3AEE A;  2KXP A;  1OED A;  3OJA A;  4ISS A;  2V6X A;  1B7T A;  5EK2 A;  3AA0 B;  3BRZ A;  4X1I E;  2BS4 A;  4H63 H;  3WI3 A;  4N78 D;  3ETV A;  2R88 A;  3JTY A;  4KRA A;  4AI6 A;  5LMU T;  3NVO A;  5J2T E;  3LK2 B;  2IWV A;  4M1P A;  2V5D A;  2W63 A;  4ZI2 C;  2K9A A;  3Q9D A;  4AUI A;  3UU4 A;  3ESL A;  1J5E T;  1UX4 A;  4QX8 B;  4TV8 E;  5LNK A;  2BS2 A;  3EUH A;  1Z8U A;  3ZST A;  2VB6 A;  4MHC A;  1IJ5 A;  4CI3 B;  3MXZ A;  3POQ A;  4JI7 T;  3GN5 B;  3NKZ A;  3RRW A;  4DVD A;  1Q9G A;  4CTD A;  1GFQ A;  1WR0 A;  5DAB A;  5JR9 C;  3NZP A;  3Q5E A;  4IT4 A;  3CQC B;  5EZY E;  4C91 A;  4NUV A;  4DV3 T;  2M06 A;  5CFB A;  3SZV A;  3VZW X;  3JC6 D;  4O4J E;  4FZL A;  3T1H T;  3W15 B;  2JRK A;  2JQK A;  3PJA A;  2WDQ A;  3PV0 F;  4IST A;  2NW7 A;  4EGW A;  2KLQ A;  1KNP A;  5AQR B;  4PJL A;  5HAX A;  1NEK A;  4X1Y E;  3ZYL A;  2D0U A;  1U5P A;  2PTF A;  5AQL B;  4MBQ A;  2XAH B;  5H2F O;  2BKO A;  3C98 B;  1N32 T;  2XQ6 A;  5JQG E;  4P1N A;  3ZC0 A;  1XMO T;  2X0H A;  3ZMU B;  3C4X A;  4UR9 A;  3NRY A;  4DV4 T;  2XM1 A;  4XNL A;  2XMX A;  5LOV E;  4I4T E;  2QRX A;  1EZ3 A;  4LSE A;  2XQ3 A;  3BRY A;  3HKD E;  4YTP A;  5HXH A;  3ZMV B;  1V9D A;  6PRN A;  4FES A;  3PU8 A;  5IYU A;  4DR4 T;  2W4X A;  2GK9 A;  1M62 A;  3G7G A;  2J1N A;  1SUM B;  2WSS V;  2QVA A;  4FMS A;  3CQG B;  4EOZ B;  3LK2 A;  3PGS A;  3PTR B;  3KV4 A;  3BQL A;  1S35 A;  4HFH A;  4PUX A;  3KVA A;  2V7L A;  2ODJ A;  2Y48 B;  5JRC B;  2W00 A;  3RQU A;  2ZM0 A;  4NXN T;  4HKA A;  5HEH A;  2ZLD A;  3DJB A;  2JQH A;  2K0L A;  3ONJ A;  2N1G A;  4YTN A;  4ZEY A;  5HWX A;  4HWH A;  3NJT A;  4NIQ A;  5HEO A;  4Q25 A;  2ZLY A;  3HKE E;  4CN6 A;  3RYC E;  5CGM A;  5ETW A;  3U3I A;  3SY7 A;  4JLE A;  2IAK A;  2UXD T;  4DMV A;  4EXT A;  1KK7 A;  4LSF A;  3VRB A;  1OPF A;  2CLY B;  1FIO A;  3GWH A;  5HXR A;  2WJR A;  5DQV A;  1P4T A;  2XY8 B;  4CZZ B;  2DNX A;  2DWK A;  4N75 A;  5C2T A;  4TN7 B;  4YJ2 E;  3OPC A;  1D0X A;  3EHZ A;  3EDU A;  4N74 A;  3TKL B;  3AED A;  4AKG A;  3NZQ A;  3EMN X;  3ZPO A;  3UTK A;  4JEH B;  2V26 A;  3OVU A;  5DJQ C;  1MMN A;  4JV5 T;  2XE5 A;  4JI4 T;  2GE4 A;  5IUX A;  5AQU B;  4TZ4 C;  2XAG B;  5LHI B;  1T72 A;  3FZK B;  3AEA A;  2MHL A;  4YY3 T;  1VRB A;  4X1K E;  4A97 A;  3N2K E;  3PUW F;  1WLX A;  4LML A;  3UAQ A;  3WI5 A;  2CPT A;  1UK5 A;  3CKD A;  2WMO A;  4C90 A;  3NBX X;  4EB6 E;  1BH3 A;  3A5X A;  1WYC A;  2UXN B;  5F3J A;  2J47 A;  4DV1 T;  3KDS E;  2MTQ A;  2DI4 A;  2A2F X;  4U2Y A;  1D1B A;  4ASK A;  4ZS3 A;  2RA1 A;  3IHR A;  4JBW F;  2VK9 A;  4HFB A;  2LT3 A;  1WCR A;  1YKH B;  5FL1 A;  4DR5 T;  4B3R T;  4O3Y A;  3KBU A;  5EK3 A;  4OHF A;  2KWH A;  3ZKR A;  2EHO A;  4F4B A;  4ERR A;  3OYX A;  2AXT O;  3QC9 A;  5IYZ E;  2UXB T;  4EIW A;  3CWZ B;  2W61 A;  4OFZ A;  2PFV A;  2JJ9 A;  5DL7 A;  3O4X E;  4AQY T;  2JQY A;  4C69 X;  3C50 A;  4CN4 A;  5B5E O;  4AYM C;  3OTO T;  2KXP B;  3N5L A;  3P4S A;  4ILC A;  4UIG A;  5PRN A;  1ZHZ A;  2Y8D A;  5HEJ A;  2Y0L A;  2F1C X;  4IDQ A;  4UF0 B;  2VL0 A;  4ILU A;  1S5L O;  2YDQ A;  2ZMA A;  4ZZC A;  4O4U A;  1AJ3 A;  4J2C A;  1FMW A;  2KMF A;  3LBX B;  3C51 A;  3Q2M A;  2JMK A;  3UU5 A;  3UFE A;  1W0B A;  3L09 A;  3LFM A;  4H9Q C;  3RYI E;  2V7J A;  4H63 V;  1VOM A;  5J2U E;  3PF1 A;  2YU1 A;  4UVC B;  2ZM6 T;  3AXJ A;  3DWO X;  3QB5 A;  1HXT A;  1ZEE A;  3GA8 A;  1WYB A;  2MYS A;  2UXC T;  3SRZ A;  1BR0 A;  4LF4 T;  3AB3 B;  3C4W A;  1BR1 A;  2HH7 A;  3MZK B;  3EVY A;  4KHP T;  2YDS A;  1HTJ F;  4AYN A;  3AE8 A;  2WAU A;  4EED A;  4AKM A;  3QRC A;  4P0A A;  2IWW A;  4IL9 A;  5AQP B;  3JAD A;  4WBO A;  5FMN A;  2X9H A;  1GQE A;  2FGQ X;  4X66 T;  4DR1 T;  4QHO A;  4OX9 T;  3TLS A;  2MPK A;  4BA9 A;  3E08 A;  2KC0 A;  3POX A;  5JVD E;  2VKH A;  2KSR A;  1MPF A;  2BG9 A;  1T98 A;  4DR7 T;  4FSP A;  4EZH A;  3ABV A;  5IWA T;  2X9K A;  4LMK A;  3AA1 A;  5FKY A;  1XNR T;  2V7I A;  3AE7 A;  4O49 A;  3AEF A;  1IZN B;  5ABG A;  1ZHC A;  1THQ A;  1MM5 A;  1ZKE A;  4H9R C;  2E8I A;  2W67 A;  3ANW B;  2XQ9 A;  2L8K A;  3RF1 A;  4NXM T;  3TLU A;  2V1D B;  4IE4 A;  5JDN A;  4U31 A;  2IC6 A;  3RBH A;  4JUY A;  3CVR A;  5H6Q B;  2XSB A;  2XQ4 A;  4U2Z A;  2M6I A;  5L3E B;  3P7I A;  3PUR A;  5H6R B;  2PJQ A;  1KF6 A;  5JDH A;  1Z0P A;  4JI8 T;  4U7I A;  3CK6 A;  1FEW A;  4YSX A;  4FRX A;  3ZYM A;  4Z3T A;  4WZX A;  3CX6 B;  2H89 A;  3O1J A;  4O4H E;  1HG2 A;  2EHO C;  4AKH A;  4FT6 A;  3AEC A;  5AQS B;  4AKR A;  1W9R A;  5B66 O;  5L3C B;  4DR6 T;  1SA0 E;  3QUJ A;  3VKH A;  1O3X A;  4O8S A;  1HG5 A;  3WU2 O;  2WU5 A;  2W66 A;  2ODV A;  1HXU A;  3VZU X;  3ETU A;  1UX5 A;  1IBL T;  1YS5 A;  4EAH A;  1ZHX A;  2D9D A;  2X27 X;  5DL8 A;  4D64 A;  1QLB A;  2YK0 A;  1HNX T;  4EZ4 A;  4GKK T;  3N9O A;  2VWA A;  3AA7 B;  5JR9 A;  3AAA B;  2F1T A;  3AEB A;  3M3Z B;  2LRK A;  2CE7 A; 
#chains in the Genus database with same CATH homology
 2KND A;  4FOZ A;  2PG8 A;  5KMG P;  2YNK A;  3G7G A;  4X20 E;  3FYX A;  2V7K A;  5M4Y A;  2XUE A;  3ANW A;  4PFO A;  2WSS V;  2J1N A;  2F1V A;  3HOE A;  4O4X A;  4K0U A;  4FMS A;  2DLR A;  4QKN A;  1PHO A;  4OYK A;  1MIV A;  5TAO A;  4XNK A;  3CQG B;  4EOZ B;  3LK2 A;  4PJM A;  3PTR B;  2KIN B;  3KV4 A;  3BQL A;  1GFP A;  1S35 A;  4PUX A;  3KVA A;  4WW0 A;  3I9Y A;  5HXC A;  5FXX A;  2D5U A;  2V7L A;  2LSI A;  5IHY A;  4KUM B;  2ODJ A;  4H9P C;  3OYZ A;  5JDQ A;  5DL6 A;  4O2B E;  4QWN B;  2Y48 B;  3M65 A;  3SOL A;  2KZ7 A;  2N2M A;  3ZJ2 A;  5JRC B;  2W00 A;  4GYR A;  4UEM A;  3RYF E;  2DCF A;  1ORM A;  2ZM0 A;  1MMD A;  3U78 A;  4HKA A;  5LXT E;  2ZLD A;  3O1H A;  1GFN A;  4HEA A;  3DJB A;  5HXE A;  3ZMZ B;  2LM9 A;  2K0L A;  3N9M A;  4L0R A;  2OA5 A;  2QTK A;  2YPV A;  2N1G A;  5FNV E;  5JRE A;  4AQF A;  3IEE A;  3AVR A;  5DQW A;  2PRN A;  5FXZ A;  5HWX A;  3NRX A;  4UF0 A;  1ZHY A;  2ES0 A;  3P8C D;  1LVF A;  5A1L A;  2JMM A;  3F2E A;  4FRT A;  2YU2 A;  2ZLY A;  2X9Y A;  3HKE E;  3K3N A;  3Q5X A;  3KV5 A;  2Y2X A;  3POR A;  4YFS A;  2C5J A;  2LFU A;  5LGU B;  2X66 A;  3C64 A;  3RYC E;  2CM0 A;  5F8P A;  4KP3 C;  5HXS A;  5ADX L;  1S94 A;  5HWY A;  3SWH A;  5ETW A;  3U3I A;  3KIN B;  4PW8 A;  3CPZ A;  3ZN1 B;  5CA1 E;  3SY7 A;  3JC6 C;  4PK6 A;  4D65 A;  4JLE A;  2IAK A;  3PUS A;  4DMV A;  4EXT A;  2VL8 A;  1HCI A;  1KK7 A;  2BVL A;  3MA9 A;  4IGU A;  4PK5 A;  4V1A v;  5FYM A;  4IIJ E;  1OPF A;  4GCP A;  5JR9 B;  2H3R A;  1PRN A;  5FVN A;  3AA7 A;  5DL5 A;  5G26 A;  2CLY B;  1FIO A;  4PNI A;  3B57 A;  4P0B A;  3GWH A;  5HXR A;  3J7Y q;  4YLH A;  3K3Q C;  3N9Q A;  5DQV A;  1ZHT A;  2CLY C;  3D0T A;  3KVD D;  3FXE B;  5LHG B;  1P4T A;  4CZZ B;  4AKL A;  2DNX A;  2DWK A;  2LHN A;  3HA4 A;  4TN7 B;  4YJ2 E;  2XAS B;  4IDZ A;  3ZLI A;  2LHR A;  3OKQ A;  1D0X A;  3ZJ1 A;  1E1H B;  3EDU A;  3N9P A;  3CML A;  1LKX A;  2CEA A;  4FI5 A;  4AQF C;  4CI1 B;  2NOX A;  1H6S 1;  1MIW A;  3WAJ A;  1NAF A;  1SHZ C;  2Y6X A;  5FY0 A;  2Y0K A;  3PQS A;  3MAC A;  4GCS A;  2C5K T;  4LSF A;  2G0U A;  3TKL B;  2XAF B;  5LJN A;  2W0G A;  3UUX B;  3F57 A;  3WAK A;  5JDG A;  4XBF B;  4AKG A;  3NZQ A;  3EMN X;  4HTE A;  3ZPO A;  2D0T A;  2I59 A;  2Q9Q D;  1G90 A;  3UTK A;  4JEH B;  2V26 A;  5L3G B;  4A56 A;  4DBQ A;  4U72 A;  3LK3 B;  3TZG A;  5DJQ C;  4HE8 A;  1Y64 B;  3HKB E;  1MMN A;  2XE5 A;  5JDM A;  1MMG A;  3LBX A;  4WBN E;  4E1T A;  3PQU A;  3DTO A;  2Q9Q A;  3RC8 A;  2GE4 A;  5FXV A;  4CXX A;  2XTQ A;  4TZ4 C;  2XAG B;  3ONX A;  2LEH A;  5LHI B;  1MMA A;  2MBG A;  3L3P A;  5CB4 E;  4MFR A;  2BVM A;  2LSK A;  2XHE B;  1HXX A;  2MHL A;  4GYS A;  1VRB A;  3V5U A;  2WWU A;  4X1K E;  2L3L A;  4AKI A;  2L9Q A;  2LJL A;  2Y7S A;  5LGN B;  3N2K E;  4ZI7 E;  1WLX A;  4AFK A;  3AAE A;  3HL6 A;  3V5S A;  3UAQ A;  3WI5 A;  1GFM A;  4P09 A;  5LA6 E;  3UU2 A;  2X0L B;  3PUQ A;  2WMN A;  3CKD A;  3AVS A;  4YJ3 E;  5E0O A;  3O0E A;  2WMO A;  4C90 A;  2LHF A;  2C0S A;  5L3F B;  3NBX X;  3E0Z A;  4EB6 E;  5KDM C;  2XE3 A;  1HS7 A;  3BQI A;  3FB2 A;  5J1G A;  2K4T A;  1G73 A;  3RPU A;  3HR0 A;  4I50 E;  1BH3 A;  3VY9 X;  3A5X A;  4D5U A;  1BR2 A;  1WYC A;  3VE1 A;  3MKD A;  4PJN A;  3SY9 A;  3AAI A;  1Q9F A;  1IAP A;  4ADZ A;  1ZHW A;  2UXN B;  3LJC A;  5F3J A;  1OWA A;  2EHO B;  3KDS E;  3HOL A;  2MTQ A;  3K3O A;  2DI4 A;  3NSG A;  2A2F X;  1D1B A;  4ASK A;  4AZL A;  4PAG A;  2Q9Q C;  4ZS3 A;  3PDY A;  2RA1 A;  3IHR A;  3T20 A;  3QK6 A;  5FP3 A;  2VK9 A;  4FUV A;  5EE2 A;  3C4Z A;  4DO0 A;  2LT3 A;  4DND A;  3RKO A;  1NWM X;  2K48 A;  2Y0H A;  2NTX A;  4AYD C;  4AYI D;  2M07 A;  4L9I A;  1YKH B;  5JDL A;  3GN5 A;  4O3X B;  3T0S A;  3K19 A;  3PRN A;  4FSO A;  2YEV C;  1MND A;  3PUA A;  4ZI3 D;  4O3Y A;  4IHJ E;  2DWG A;  1H7C A;  3KBU A;  3J9X 1;  5LG4 A;  1IZN A;  5EK3 A;  4OHF A;  2KWH A;  5FY1 A;  2EHO A;  4H9N C;  4G2A A;  4F4B A;  4ERR A;  1YW0 A;  3LK4 1;  3OYX A;  4B6X A;  2NW8 A;  3QC9 A;  3DA3 A;  5IYZ E;  5GON E;  3CWZ B;  3ZYK A;  4EIW A;  4GHB A;  4E1S A;  2W61 A;  4OFZ A;  2PFV A;  2JJ9 A;  2W80 C;  2Z6E A;  3KBT A;  3ZN0 B;  4LSI A;  4EYU A;  5DL7 A;  5AFU L;  3O4X E;  4AYE C;  3CX7 B;  4G63 A;  2LOS A;  2IW5 B;  4RJX A;  4GK5 E;  4C69 X;  3C50 A;  2EHO D;  2X9X A;  1D1A A;  4AYM C;  3AA6 A;  3AAE B;  2OMF A;  1MNE A;  2KXP B;  3N5L A;  2X9W A;  4UIG A;  4UEL A;  5PRN A;  1ZHZ A;  4PK4 A;  3N2G E;  3Q5W A;  4RLB A;  2SPC A;  2Y8D A;  1YKE B;  5LJM A;  2Y0L A;  4GOU A;  4OYJ A;  4TV9 E;  2N2N A;  4I43 B;  5FXW A;  1QJP A;  2LSJ A;  4IE6 A;  2CCQ A;  4UF0 B;  4UV8 B;  4ILU A;  2ZMA A;  3RC3 A;  4O4U A;  4HFV A;  5LHH B;  2PBI A;  1HFA A;  2J4U P;  1AJ3 A;  1ZV4 X;  4LSH A;  4J2C A;  1X79 A;  3UUM A;  1FMW A;  3I9W A;  4EYY R;  3CX8 B;  2N9D A;  2KMF A;  3LBX B;  5BMV E;  3UUL A;  3C51 A;  3KFW X;  2JMK A;  2D2S A;  3DP7 A;  2WM9 A;  3Q2M A;  4DBR A;  3UFE A;  3LK3 A;  2NWB A;  2LE8 A;  1BT9 A;  4U74 A;  2ACX A;  2VAS A;  3C5O A;  4UVA B;  3SS1 A;  4BJM A;  2RP4 A;  3L09 A;  2KZ7 B;  3LFM A;  2QGS A;  3RYH E;  2ZFG A;  2UXX B;  4H9Q C;  2POR A;  5LBM A;  1HF8 A;  2FGR A;  3RYI E;  2V7J A;  3H37 A;  1KNZ A;  1GFO A;  4H63 V;  2XG6 A;  4GCQ A;  3HKC E;  1VOM A;  1IJ6 A;  5J2U E;  1QJ9 A;  5L2L A;  2YIN A;  4AQG A;  2YU1 A;  4UVC B;  2MOZ A;  3POU A;  4KR4 A;  3N9N A;  4QQ1 A;  4Z8X A;  4CXY A;  2X68 A;  3T24 A;  4BJN A;  1HXT A;  3FHN A;  2XE1 A;  2W81 C;  1ZEE A;  3UUN A;  2XQY A;  1UCU A;  3K8P C;  2CWO A;  5JDF A;  4ANJ A;  3GA8 A;  2NW9 A;  3R84 B;  2ZM2 A;  4XAX B;  4IE0 A;  4N59 A;  4MAL A;  4CXW A;  4I55 E;  1WYB A;  2MYS A;  4O2A E;  3ZCJ A;  3SRZ A;  1D0Z A;  1BR0 A;  4N58 A;  3AB3 B;  3C4W A;  1BR1 A;  2A3D A;  2VKO A;  4YHJ A;  2XE2 A;  2HH7 A;  3MZK B;  1QJ8 A;  3EVY A;  1QSD A;  4PJJ A;  2KDY A;  4G76 A;  4WNK A;  4H9S E;  1HTJ F;  2O4V A;  4AYN A;  2K5B B;  2M67 A;  4JFB A;  5ADX K;  4ZI3 C;  4RJW A;  4FZN A;  3PE0 A;  3HWB A;  5T5F A;  4E7Z A;  2WAU A;  4AKM A;  1US7 B;  1BR4 A;  3GP6 A;  2NP9 A;  4P0A A;  3QRC A;  3V8U A;  4GK0 E;  4O3W A;  2NTY A;  3GMI A;  4WBO A;  5FMN A;  2X9H A;  5JDP A;  4JEU B;  2E9X A;  3BK9 A;  2H7V C;  2FGQ X;  4XZC A;  2B1E A;  4QXC B;  2LSG A;  4QHO A;  3RH3 A;  2A72 A;  4BA9 A;  2N2L A;  4QXB B;  1BXW A;  3H3A A;  2HPL A;  3E08 A;  4H9O C;  3E22 E;  2KC0 A;  1OSM A;  2KXP A;  5JVD E;  3POX A;  2VKH A;  2X51 A;  1CUN A;  3AA6 B;  3I1A A;  4QXH B;  1MPF A;  3N9L A;  1T98 A;  4FSP A;  3OJA A;  4ISS A;  3SYS A;  2VKJ A;  5LBQ B;  4EZH A;  1B7T A;  5EK2 A;  4TUY E;  3AA0 B;  2WBL A;  3BQK A;  3AA1 A;  3ZEF B;  4X1I E;  3WI3 A;  3LK4 2;  4H63 H;  5KX5 E;  5JRC A;  4N78 D;  2VKD A;  3ETV A;  1E54 A;  1QUU A;  2V7I A;  2W62 A;  4E7S A;  2BZB A;  3SZD A;  4O49 A;  4RLC A;  3JTY A;  3O9X A;  1IZN B;  4KRA A;  3UT5 E;  4AI6 A;  1ZHC A;  5L3D B;  3RRC A;  4F6R C;  1THQ A;  3CQX C;  5J2T E;  1MM5 A;  2E9X D;  3LK2 B;  4O3Z A;  2CE7 A;  3VU7 H;  3KV9 A;  1ZKE A;  4M1P A;  4H9R C;  5HYA A;  4CI2 B;  3WI4 A;  2E8I A;  2W63 A;  3VZT X;  4ZI2 C;  3ANW B;  4GIW A;  3QRA A;  4BUM X;  2CXD A;  2CXL A;  4IE7 A;  2L8K A;  3N2O A;  2ZM8 A;  2K9A A;  3VE2 A;  3Q9D A;  2XAJ B;  4AXP A;  5AFU K;  8PRN A;  3DA4 A;  2V1D B;  4IE4 A;  3S4U A;  4AUI A;  4JCH A;  2QA7 A;  1WR6 A;  3ESL A;  3IF8 B;  3OBV E;  3T8O A;  3HW9 A;  3KV6 A;  2J1D G;  2CXF A;  1UX4 A;  2X67 A;  2CMR A;  4QX8 B;  4UV9 B;  5JDN A;  3AAA A;  1D0Y A;  2IC6 A;  3RBH A;  4KMC A;  4TV8 E;  1G8X A;  5LNK A;  4CQI A;  2KT9 A;  3EUH A;  4TX5 A;  1FMV A;  2CA5 A;  5L3B B;  1D1C A;  4FJO A;  3FXD B;  2VB6 A;  4JUY A;  4MHC A;  1IJ5 A;  3CVR A;  5H6Q B;  4G75 A;  1U4Q A;  4CI3 B;  2ERV A;  3MXZ A;  4KR8 A;  3POQ A;  4O4I E;  5L3E B;  3P7I A;  3GN5 B;  2JMH A;  5D5D A;  3B13 A;  5FY7 A;  3PUR A;  3PUG A;  5H6R B;  1MIY A;  2P9B A;  4HGA A;  4B61 A;  4FZM A;  3RRW A;  2PJQ A;  4DVD A;  1Q9G A;  5JDH A;  4NUU A;  3HI2 A;  1Z0P A;  4MLK A;  1GFQ A;  5CA0 E;  5DAB A;  3NZP A;  1LRZ A;  5JR9 C;  4DMW A;  3VKG A;  1FEW A;  5C8Y E;  4IE5 A;  5EK4 A;  2K24 A;  3A2S X;  3CQC B;  2H7O A;  5LYJ E;  2KWI B;  3ZYM A;  4FRX A;  4Z3T A;  5EZY E;  4U9C A;  2JQQ A;  4C91 A;  3O1I A;  3CX6 B;  4KBM B;  4NUV A;  3FBZ A;  3I0Q A;  2LSY A;  3O1J A;  4O4H E;  2M06 A;  1HG2 A;  2EHO C;  4QX7 B;  1OXZ A;  3VHL A;  3SZV A;  4AKH A;  3VZW X;  4FT6 A;  3JC6 D;  4O4J E;  3LG7 A;  4AKR B;  4FZL A;  4AKR A;  1WRD A;  1YD8 G;  3W15 B;  4ZS2 A;  2JRK A;  5L3C B;  3AA1 B;  4IST A;  1SA0 E;  2NW7 A;  4GF4 A;  3QUJ A;  2KLQ A;  4ZOL E;  4UXN B;  3VKH A;  3AA0 A;  2XTL A;  1O3X A;  4PJL A;  4O8S A;  5HAX A;  2MNH A;  4ZHQ E;  3SYB A;  1HG5 A;  5LGT B;  3VY8 X;  4X1Y E;  3ZYL A;  2C5I T;  3ZMS B;  3ZC1 A;  3FBL A;  1MM4 A;  3RX6 A;  2D0U A;  1U5P A;  2ODV A;  2IC9 A;  4MBQ A;  2XAH B;  1HXU A;  2DHR A;  3VZU X;  4OK0 A;  4ZI2 D;  3C98 B;  3ETU A;  1LVK A;  4L5G A;  3EDV A;  5JQG E;  1UX5 A;  2CWY A;  5JH7 E;  2JPF A;  2E9X C;  3IBP A;  3KVB A;  4UVB B;  1YS5 A;  3PU3 A;  3ZC0 A;  2E9X B;  5GV0 A;  4EAH A;  1ZHX A;  2LOP A;  3ZMU B;  4O4L E;  5LCY A;  3C4X A;  4HN9 A;  2X27 X;  3NRY A;  5DL8 A;  4D64 A;  2YK0 A;  2Q9Q B;  4XNL A;  2V7M A;  2XMX A;  3MK7 C;  5LP6 E;  4EZ4 A;  3UPG A;  5LOV E;  4BAY B;  4I4T E;  3N9O A;  4PFP A;  1EZ3 A;  3F31 A;  2VWA A;  2ODU A;  2XTR A;  4LSE A;  3AA7 B;  7PRN A;  5JR9 A;  3HKD E;  3AAA B;  2BDE A;  3I0O A;  2F1T A;  2XAQ B;  1HX8 A;  2HPJ A;  5HXH A;  4RL9 A;  3ZMT B;  3ZMV B;  1V9D A;  3R6N A;  3ZCI A;  6PRN A;  4FES A;  3PU8 A;  5IYU A;  2GK9 A;  3MJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...