2QTKA

Crystal structure of the outer membrane protein opdk from pseudomonas aeruginosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
387
structure length
371
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFKSLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNNSELLPLHAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Outer Membrane Protein OpdK from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Probable porin
total genus 97
structure length 371
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2qtkA01
1GFPA 2Y0HA 5DL7A 4LSHA 1H6S1 2XE2A 4GCPA 1HXTA 3JTYA 3EMNX 4LSIA 1HXUA 1MPFA 4C69X 1GFQA 4BUMX 2O4VA 2XE5A 2K4TA 4KR4A 3T20A 4FSOA 2J1NA 5PRNA 1BH3A 4FOZA 1GFNA 1OSMA 1E54A 2ZLDA 4LSFA 3HWBA 3PORA 3UPGA 4AUIA 2QTKA 3T24A 4FRTA 6PRNA 4FRXA 1PHOA 1GFMA 2FGRA 3VZTX 3WI4A 5FVNA 4FMSA 2OMFA 4GCSA 2XE1A 3VY8X 4KR8A 2Y0LA 4D65A 2Y2XA 3NSGA 2ODJA 3O0EA 3SYSA 3VY9X 2PRNA 3PRNA 3UU2A 3POXA 4RJWA 1HXXA 3SZDA 4FT6A 1GFOA 5DL5A 3POUA 3A2SX 5DL8A 3HW9A 2XG6A 1PRNA 2FGQX 3FYXA 4GCQA 5JDPA 4D5UA 4RJXA 4D64A 3K19A 3T0SA 3VZUX 4FSPA 1OPFA 4JFBA 7PRNA 3POQA 3SY7A 3SYBA 3SY9A 3WI5A 2XE3A 5DL6A 2Y0KA 4KRAA 1BT9A 2J4UP 2PORA 4LSEA 2ZFGA 3VZWX 8PRNA 3SZVA
chains in the Genus database with same CATH superfamily
5E79O 1GFPA 2WVPA 2Y0HA 3AA0B 5G3AA 4RLCA 2KZ7A 5DL7A 5G26A 4LSHA 4CTDA 2MNHA 4AKMA 4GCPA 4PUXA 1H6S1 2X9KA 2XE2A 3PQUA 2YNKA 1P4TA 3C5OA 1HXTA 1Q9FA 2XTRA 4FZNA 4FZLA 1MM5A 1T1LA 5IYUA 3WU2O 2M07A 2F1CX 4XNLA 3HOLA 5AFUL 3JTYA 3EMNX 1IZNB 5B66O 3G7GA 4LSIA 5G38A 2Y7SA 4K3BA 3BRZA 5B5EO 1HXUA 1MPFA 2R4NA 3LK41 4U9CA 1ZHYA 5H2FO 4C69X 1GFQA 5D5DA 4BUMX 2O4VA 2XE5A 2W80C 3AAEA 2K4TA 1S5LO 4KR4A 3T20A 3LK2A 4FSOA 5KAIO 2J1NA 4PR7A 4K3CA 1BH3A 5PRNA 4AYNA 4IL6O 5AFUK 4FOZA 3AA6B 2W81C 3LK42 2XMXA 2KXPB 3AAEB 5GV0A 1BXWA 1GFNA 1OSMA 3DA4A 1ZHZA 5TISO 4QQ1A 4GHBA 1E54A 2K0LA 5G39A 4UB6O 4E1SA 4C4VB 3LK3B 2ZLDA 4LSFA 3HWBA 4O4XA 3PORA 4O3WA 4C4VA 5GTHO 3VE1A 1QJPA 2KXPA 3TZGA 3UPGA 4G76A 4AZLA 4AUIA 2QTKA 3T24A 4FRTA 1QJ9A 3AA0A 3GP6A 5ADXL 1T16A 2N2MA 4O49A 3BRYA 5EE2A 6PRNA 7PRNA 2LHFA 4FRXA 1PHOA 1GFMA 2FGRA 4FQEA 1ZHXA 4UB8O 4FUVA 3LK2B 3VZTX 3WI4A 5FVNA 4FMSA 2OMFA 1G90A 3PGSA 4GCSA 2XE1A 2ERVA 3VY8X 4KR8A 2AXTO 2Y0LA 4JCHA 2Y2XA 2JQYA 3LK3A 4D65A 3NSGA 4N74A 4O3XB 3DWNA 2ODJA 2LFUA 3O0EA 3SYSA 3VY9X 4O4UA 2YPVA 2PRNA 3RBHA 4AYEC 3AA7B 2R4PA 3PRNA 4G75A 3DZMA 3UU2A 2X27X 2IWVA 2MHLA 2R88A 2XTQA 4O3ZA 3VE2A 3POXA 4AYID 4RJWA 3AA6A 4RL9A 1HXXA 3PF1A 3AA1B 4AKRA 3SZDA 2F1TA 4FT6A 4N75A 3AAAB 4PJ0O 4N58A 4RLBA 1GFOA 3A0BO 5DL5A 3KZIO 3POUA 4B61A 4FESA 3UAQA 3A2SX 2M06A 3A0HO 5DL8A 5GTIO 3HW9A 5T5FA 2XG6A 2F1VA 2GE4A 3AAAA 3JCUO 3BS0A 3PGUA 1IZNA 4FZMA 4JFBA 4C00A 3QRCA 4Z3TA 1PRNA 2FGQX 3NJTA 3FYXA 4GCQA 4AYMC 5JDPA 4D5UA 3DWOX 4RJXA 4D64A 2R89A 4XNKA 4AFKA 1THQA 3K19A 3T0SA 3VZUX 4FSPA 1YS5A 1ZHTA 1OPFA 2R8AA 2N2LA 2R4LA 2R4OA 2KZ7B 3AA7A 3DA3A 3KVDD 1Q9GA 3PGRA 3POQA 4O3YA 4GF4A 3SY7A 3SYBA 3SY9A 1MM4A 3V8UA 2IWWA 3WI5A 2XE3A 5DL6A 4AYDC 2Y0KA 5ADXK 2KC0A 1ORMA 4KRAA 1BT9A 2J4UP 1QJ8A 2PORA 2WJQA 4LSEA 4N59A 4F4BA 2KDYA 2ZFGA 3PQSA 3VZWX 2JMMA 4E1TA 2WJRA 1ZHWA 4AKRB 3HOEA 3AA1A 5KAFO 8PRNA 3SZVA 3QRAA
chains in the Genus database with same CATH topology
1GFPA 2Y0HA 3AA0B 4RLCA 2KZ7A 5DL7A 5G26A 4LSHA 2MNHA 4AKMA 4PUXA 1H6S1 2XE2A 4GCPA 3PQUA 2YNKA 1P4TA 3C5OA 1HXTA 1Q9FA 2XTRA 4FZNA 4FZLA 1MM5A 5IYUA 2M07A 4XNLA 3HOLA 5AFUL 3JTYA 3EMNX 1IZNB 3G7GA 4LSIA 2Y7SA 1HXUA 1MPFA 3LK41 4U9CA 1ZHYA 4C69X 1GFQA 5D5DA 4BUMX 2O4VA 2XE5A 2W80C 3AAEA 2K4TA 4KR4A 3T20A 3LK2A 4FSOA 2J1NA 5PRNA 1BH3A 4AYNA 5AFUK 4FOZA 3AA6B 2W81C 3LK42 2XMXA 2KXPB 3AAEB 5GV0A 1BXWA 1GFNA 1OSMA 3DA4A 1ZHZA 4QQ1A 4GHBA 1E54A 2K0LA 4E1SA 3LK3B 2ZLDA 4LSFA 3HWBA 4O4XA 3PORA 4O3WA 3VE1A 1QJPA 2KXPA 3TZGA 3UPGA 4G76A 4AZLA 4AUIA 2QTKA 3T24A 4FRTA 1QJ9A 3AA0A 3GP6A 5ADXL 2N2MA 4O49A 5EE2A 6PRNA 2LHFA 4FRXA 1PHOA 1GFMA 2FGRA 1ZHXA 4FUVA 3LK2B 3VZTX 3WI4A 5FVNA 4FMSA 2OMFA 1G90A 4GCSA 2XE1A 2ERVA 3VY8X 4KR8A 2Y0LA 4JCHA 2Y2XA 4D65A 3LK3A 3NSGA 4O3XB 2ODJA 2LFUA 3O0EA 3SYSA 3VY9X 4O4UA 2YPVA 2PRNA 3RBHA 4AYEC 3AA7B 3PRNA 4G75A 3UU2A 2X27X 2MHLA 2XTQA 4O3ZA 4AYID 3VE2A 3POXA 4RJWA 3AA6A 4RL9A 1HXXA 3AA1B 4AKRA 3SZDA 2F1TA 4FT6A 3AAAB 4RLBA 4N58A 1GFOA 5DL5A 4B61A 3POUA 4FESA 3UAQA 3A2SX 2M06A 5DL8A 3HW9A 5T5FA 2XG6A 2F1VA 2GE4A 3AAAA 4FZMA 1IZNA 3QRCA 4Z3TA 1PRNA 2FGQX 3FYXA 4GCQA 4AYMC 5JDPA 4D5UA 4RJXA 4D64A 4XNKA 4AFKA 1THQA 3K19A 3T0SA 3VZUX 4FSPA 1YS5A 1ZHTA 1OPFA 3AA7A 2N2LA 3DA3A 3KVDD 2KZ7B 3POQA 4JFBA 4O3YA 1Q9GA 3SY7A 3SYBA 7PRNA 4GF4A 3SY9A 1MM4A 3V8UA 3WI5A 2XE3A 5DL6A 4AYDC 2Y0KA 5ADXK 2KC0A 1ORMA 4KRAA 1BT9A 2J4UP 1QJ8A 2PORA 4LSEA 4N59A 4F4BA 2KDYA 2ZFGA 3PQSA 3VZWX 2JMMA 4E1TA 1ZHWA 4AKRB 3HOEA 3AA1A 8PRNA 3SZVA 3QRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFP A;  2Y0H A;  5DL7 A;  4LSH A;  1H6S 1;  2XE2 A;  4GCP A;  1HXT A;  3JTY A;  3EMN X;  4LSI A;  1HXU A;  1MPF A;  4C69 X;  1GFQ A;  4BUM X;  2O4V A;  2XE5 A;  2K4T A;  4KR4 A;  3T20 A;  4FSO A;  2J1N A;  5PRN A;  1BH3 A;  4FOZ A;  1GFN A;  1OSM A;  1E54 A;  2ZLD A;  4LSF A;  3HWB A;  3POR A;  3UPG A;  4AUI A;  2QTK A;  3T24 A;  4FRT A;  6PRN A;  4FRX A;  1PHO A;  1GFM A;  2FGR A;  3VZT X;  3WI4 A;  5FVN A;  4FMS A;  2OMF A;  4GCS A;  2XE1 A;  3VY8 X;  4KR8 A;  2Y0L A;  4D65 A;  2Y2X A;  3NSG A;  2ODJ A;  3O0E A;  3SYS A;  3VY9 X;  2PRN A;  3PRN A;  3UU2 A;  3POX A;  4RJW A;  1HXX A;  3SZD A;  4FT6 A;  1GFO A;  5DL5 A;  3POU A;  3A2S X;  5DL8 A;  3HW9 A;  2XG6 A;  1PRN A;  2FGQ X;  3FYX A;  4GCQ A;  5JDP A;  4D5U A;  4RJX A;  4D64 A;  3K19 A;  3T0S A;  3VZU X;  4FSP A;  1OPF A;  4JFB A;  7PRN A;  3POQ A;  3SY7 A;  3SYB A;  3SY9 A;  3WI5 A;  2XE3 A;  5DL6 A;  2Y0K A;  4KRA A;  1BT9 A;  2J4U P;  2POR A;  4LSE A;  2ZFG A;  3VZW X;  8PRN A;  3SZV A; 
#chains in the Genus database with same CATH topology
 5E79 O;  1GFP A;  2WVP A;  2Y0H A;  3AA0 B;  5G3A A;  4RLC A;  2KZ7 A;  5DL7 A;  5G26 A;  4LSH A;  4CTD A;  2MNH A;  4AKM A;  4GCP A;  4PUX A;  1H6S 1;  2X9K A;  2XE2 A;  3PQU A;  2YNK A;  1P4T A;  3C5O A;  1HXT A;  1Q9F A;  2XTR A;  4FZN A;  4FZL A;  1MM5 A;  1T1L A;  5IYU A;  3WU2 O;  2M07 A;  2F1C X;  4XNL A;  3HOL A;  5AFU L;  3JTY A;  3EMN X;  1IZN B;  5B66 O;  3G7G A;  4LSI A;  5G38 A;  2Y7S A;  4K3B A;  3BRZ A;  5B5E O;  1HXU A;  1MPF A;  2R4N A;  3LK4 1;  4U9C A;  1ZHY A;  5H2F O;  4C69 X;  1GFQ A;  5D5D A;  4BUM X;  2O4V A;  2XE5 A;  2W80 C;  3AAE A;  2K4T A;  1S5L O;  4KR4 A;  3T20 A;  3LK2 A;  4FSO A;  5KAI O;  2J1N A;  4PR7 A;  4K3C A;  1BH3 A;  5PRN A;  4AYN A;  4IL6 O;  5AFU K;  4FOZ A;  3AA6 B;  2W81 C;  3LK4 2;  2XMX A;  2KXP B;  3AAE B;  5GV0 A;  1BXW A;  1GFN A;  1OSM A;  3DA4 A;  1ZHZ A;  5TIS O;  4QQ1 A;  4GHB A;  1E54 A;  2K0L A;  5G39 A;  4UB6 O;  4E1S A;  4C4V B;  3LK3 B;  2ZLD A;  4LSF A;  3HWB A;  4O4X A;  3POR A;  4O3W A;  4C4V A;  5GTH O;  3VE1 A;  1QJP A;  2KXP A;  3TZG A;  3UPG A;  4G76 A;  4AZL A;  4AUI A;  2QTK A;  3T24 A;  4FRT A;  1QJ9 A;  3AA0 A;  3GP6 A;  5ADX L;  1T16 A;  2N2M A;  4O49 A;  3BRY A;  5EE2 A;  6PRN A;  7PRN A;  2LHF A;  4FRX A;  1PHO A;  1GFM A;  2FGR A;  4FQE A;  1ZHX A;  4UB8 O;  4FUV A;  3LK2 B;  3VZT X;  3WI4 A;  5FVN A;  4FMS A;  2OMF A;  1G90 A;  3PGS A;  4GCS A;  2XE1 A;  2ERV A;  3VY8 X;  4KR8 A;  2AXT O;  2Y0L A;  4JCH A;  2Y2X A;  2JQY A;  3LK3 A;  4D65 A;  3NSG A;  4N74 A;  4O3X B;  3DWN A;  2ODJ A;  2LFU A;  3O0E A;  3SYS A;  3VY9 X;  4O4U A;  2YPV A;  2PRN A;  3RBH A;  4AYE C;  3AA7 B;  2R4P A;  3PRN A;  4G75 A;  3DZM A;  3UU2 A;  2X27 X;  2IWV A;  2MHL A;  2R88 A;  2XTQ A;  4O3Z A;  3VE2 A;  3POX A;  4AYI D;  4RJW A;  3AA6 A;  4RL9 A;  1HXX A;  3PF1 A;  3AA1 B;  4AKR A;  3SZD A;  2F1T A;  4FT6 A;  4N75 A;  3AAA B;  4PJ0 O;  4N58 A;  4RLB A;  1GFO A;  3A0B O;  5DL5 A;  3KZI O;  3POU A;  4B61 A;  4FES A;  3UAQ A;  3A2S X;  2M06 A;  3A0H O;  5DL8 A;  5GTI O;  3HW9 A;  5T5F A;  2XG6 A;  2F1V A;  2GE4 A;  3AAA A;  3JCU O;  3BS0 A;  3PGU A;  1IZN A;  4FZM A;  4JFB A;  4C00 A;  3QRC A;  4Z3T A;  1PRN A;  2FGQ X;  3NJT A;  3FYX A;  4GCQ A;  4AYM C;  5JDP A;  4D5U A;  3DWO X;  4RJX A;  4D64 A;  2R89 A;  4XNK A;  4AFK A;  1THQ A;  3K19 A;  3T0S A;  3VZU X;  4FSP A;  1YS5 A;  1ZHT A;  1OPF A;  2R8A A;  2N2L A;  2R4L A;  2R4O A;  2KZ7 B;  3AA7 A;  3DA3 A;  3KVD D;  1Q9G A;  3PGR A;  3POQ A;  4O3Y A;  4GF4 A;  3SY7 A;  3SYB A;  3SY9 A;  1MM4 A;  3V8U A;  2IWW A;  3WI5 A;  2XE3 A;  5DL6 A;  4AYD C;  2Y0K A;  5ADX K;  2KC0 A;  1ORM A;  4KRA A;  1BT9 A;  2J4U P;  1QJ8 A;  2POR A;  2WJQ A;  4LSE A;  4N59 A;  4F4B A;  2KDY A;  2ZFG A;  3PQS A;  3VZW X;  2JMM A;  4E1T A;  2WJR A;  1ZHW A;  4AKR B;  3HOE A;  3AA1 A;  5KAF O;  8PRN A;  3SZV A;  3QRA A; 
#chains in the Genus database with same CATH homology
 1GFP A;  2Y0H A;  3AA0 B;  4RLC A;  2KZ7 A;  5DL7 A;  5G26 A;  4LSH A;  2MNH A;  4AKM A;  4PUX A;  1H6S 1;  2XE2 A;  4GCP A;  3PQU A;  2YNK A;  1P4T A;  3C5O A;  1HXT A;  1Q9F A;  2XTR A;  4FZN A;  4FZL A;  1MM5 A;  5IYU A;  2M07 A;  4XNL A;  3HOL A;  5AFU L;  3JTY A;  3EMN X;  1IZN B;  3G7G A;  4LSI A;  2Y7S A;  1HXU A;  1MPF A;  3LK4 1;  4U9C A;  1ZHY A;  4C69 X;  1GFQ A;  5D5D A;  4BUM X;  2O4V A;  2XE5 A;  2W80 C;  3AAE A;  2K4T A;  4KR4 A;  3T20 A;  3LK2 A;  4FSO A;  2J1N A;  5PRN A;  1BH3 A;  4AYN A;  5AFU K;  4FOZ A;  3AA6 B;  2W81 C;  3LK4 2;  2XMX A;  2KXP B;  3AAE B;  5GV0 A;  1BXW A;  1GFN A;  1OSM A;  3DA4 A;  1ZHZ A;  4QQ1 A;  4GHB A;  1E54 A;  2K0L A;  4E1S A;  3LK3 B;  2ZLD A;  4LSF A;  3HWB A;  4O4X A;  3POR A;  4O3W A;  3VE1 A;  1QJP A;  2KXP A;  3TZG A;  3UPG A;  4G76 A;  4AZL A;  4AUI A;  2QTK A;  3T24 A;  4FRT A;  1QJ9 A;  3AA0 A;  3GP6 A;  5ADX L;  2N2M A;  4O49 A;  5EE2 A;  6PRN A;  2LHF A;  4FRX A;  1PHO A;  1GFM A;  2FGR A;  1ZHX A;  4FUV A;  3LK2 B;  3VZT X;  3WI4 A;  5FVN A;  4FMS A;  2OMF A;  1G90 A;  4GCS A;  2XE1 A;  2ERV A;  3VY8 X;  4KR8 A;  2Y0L A;  4JCH A;  2Y2X A;  4D65 A;  3LK3 A;  3NSG A;  4O3X B;  2ODJ A;  2LFU A;  3O0E A;  3SYS A;  3VY9 X;  4O4U A;  2YPV A;  2PRN A;  3RBH A;  4AYE C;  3AA7 B;  3PRN A;  4G75 A;  3UU2 A;  2X27 X;  2MHL A;  2XTQ A;  4O3Z A;  4AYI D;  3VE2 A;  3POX A;  4RJW A;  3AA6 A;  4RL9 A;  1HXX A;  3AA1 B;  4AKR A;  3SZD A;  2F1T A;  4FT6 A;  3AAA B;  4RLB A;  4N58 A;  1GFO A;  5DL5 A;  4B61 A;  3POU A;  4FES A;  3UAQ A;  3A2S X;  2M06 A;  5DL8 A;  3HW9 A;  5T5F A;  2XG6 A;  2F1V A;  2GE4 A;  3AAA A;  4FZM A;  1IZN A;  3QRC A;  4Z3T A;  1PRN A;  2FGQ X;  3FYX A;  4GCQ A;  4AYM C;  5JDP A;  4D5U A;  4RJX A;  4D64 A;  4XNK A;  4AFK A;  1THQ A;  3K19 A;  3T0S A;  3VZU X;  4FSP A;  1YS5 A;  1ZHT A;  1OPF A;  3AA7 A;  2N2L A;  3DA3 A;  3KVD D;  2KZ7 B;  3POQ A;  4JFB A;  4O3Y A;  1Q9G A;  3SY7 A;  3SYB A;  7PRN A;  4GF4 A;  3SY9 A;  1MM4 A;  3V8U A;  3WI5 A;  2XE3 A;  5DL6 A;  4AYD C;  2Y0K A;  5ADX K;  2KC0 A;  1ORM A;  4KRA A;  1BT9 A;  2J4U P;  1QJ8 A;  2POR A;  4LSE A;  4N59 A;  4F4B A;  2KDY A;  2ZFG A;  3PQS A;  3VZW X;  2JMM A;  4E1T A;  1ZHW A;  4AKR B;  3HOE A;  3AA1 A;  8PRN A;  3SZV A;  3QRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...