2QTKA

Crystal structure of the outer membrane protein opdk from pseudomonas aeruginosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
387
structure length
371
Chain Sequence
b'GFLEDAKTDLVLRNYYFNRDFKSLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNNSELLPLHAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable porin
publication title Crystal Structure of the Outer Membrane Protein OpdK from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 97
structure length 371
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2qtkA01
5PRNA 4C69X 4GCPA 4KR4A 4D65A 3VY8X 3T20A 1E54A 1GFPA 4BUMX 2ZFGA 2XG6A 4LSEA 3PORA 3SYBA 1H6S1 4FSOA 1GFMA 5DL8A 5FVNA 4GCSA 4RJXA 2J1NA 3SZVA 4FSPA 2ODJA 2FGRA 4KRAA 1HXXA 2Y0LA 2FGQX 2Y0HA 3NSGA 2ZLDA 5DL5A 4LSIA 2O4VA 3WI5A 2J4UP 1OSMA 2QTKA 2XE3A 4FMSA 3POQA 3PRNA 4KR8A 3SY7A 6PRNA 2OMFA 1BT9A 4FOZA 3VZUX 3K19A 2PORA 3SYSA 4LSHA 5DL6A 8PRNA 3T0SA 3O0EA 3JTYA 5JDPA 3UU2A 4FRTA 3VY9X 1OPFA 3VZWX 3WI4A 3T24A 2Y2XA 3EMNX 4RJWA 4D64A 3HW9A 2K4TA 4GCQA 1PHOA 5DL7A 1HXTA 2Y0KA 4JFBA 3SY9A 3A2SX 3HWBA 1PRNA 1GFOA 2XE5A 4D5UA 4FT6A 3SZDA 7PRNA 2XE2A 4FRXA 1BH3A 2XE1A 1GFQA 1GFNA 3POXA 3POUA 3VZTX 3UPGA 4LSFA 1HXUA 3FYXA 4AUIA 1MPFA 2PRNA
chains in the Genus database with same CATH superfamily
5PRNA 4PJ0O 2KC0A 4FZMA 3BS0A 2M06A 4FZLA 4GCPA 4KR4A 3HOEA 4UB8O 4C69X 3VY8X 4D65A 3T20A 1E54A 1GFPA 4BUMX 1ZHYA 2ERVA 1IZNA 3AAAB 3QRAA 5D5DA 3KZIO 2ZFGA 4PR7A 4FZNA 4G75A 3PGRA 2XG6A 4IL6O 4LSEA 1QJ9A 3PORA 3AA1A 3SYBA 5G38A 3VE1A 2KDYA 4XNKA 1H6S1 5TISO 3LK2A 4FSOA 1GFMA 5DL8A 5B66O 3GP6A 5EE2A 4AKRA 5FVNA 1ORMA 3AA0A 4PUXA 3UAQA 4AYID 3BRYA 1P4TA 4GCSA 4RJXA 2J1NA 5G26A 5H2FO 3SZVA 3AAEB 4FSPA 4XNLA 3PF1A 2WJQA 4K3CA 2JMMA 2F1CX 2FGRA 2ODJA 4KRAA 2IWWA 3QRCA 3V8UA 1HXXA 2Y0LA 2F1VA 5AFUK 2FGQX 2Y0HA 1YS5A 2W80C 2ZLDA 3DWOX 3NSGA 2XTQA 3AA7A 4UB6O 4AYMC 2JQYA 2KXPA 3KVDD 4F4BA 3PGSA 4LSIA 2IWVA 3DA3A 4O3YA 1Q9GA 2O4VA 4AYNA 4AZLA 4K3BA 5DL5A 3WI5A 4GHBA 2R8AA 1OSMA 2QTKA 4G76A 4AFKA 2XE3A 1Q9FA 5ADXK 2J4UP 1ZHWA 2MNHA 4FMSA 3LK42 3POQA 1IZNB 3LK3A 3PRNA 4JCHA 4KR8A 4C4VA 3SY7A 5AFUL 3PQSA 6PRNA 2OMFA 2AXTO 1BT9A 4FQEA 4FOZA 4GF4A 3K19A 4RLCA 2PORA 3VZUX 4O4XA 5IYUA 5GTIO 3AA1B 3SYSA 4LSHA 4RL9A 5DL6A 2LFUA 4E1TA 5ADXL 3LK2B 3WU2O 8PRNA 3T0SA 3A0HO 3O0EA 1T16A 5E79O 3JTYA 4AKRB 4N75A 3AA0B 3UU2A 5JDPA 2R88A 3RBHA 4FRTA 1MM5A 4O3ZA 3VY9X 4O49A 1OPFA 3VZWX 2KZ7A 2W81C 2X27X 3PQUA 3T24A 3WI4A 1MM4A 2Y2XA 3EMNX 4RJWA 3DA4A 4D64A 3HW9A 4E1SA 5B5EO 4RLBA 3AA6A 3DZMA 2F1TA 2K4TA 4FUVA 5KAFO 4GCQA 1PHOA 3AA7B 4B61A 5DL7A 1BXWA 2WVPA 1THQA 2KXPB 4FESA 3C5OA 4AYEC 2R4LA 2XTRA 3LK41 1S5LO 3TZGA 3AAAA 1HXTA 1QJPA 1T1LA 1ZHXA 2R89A 2Y0KA 2Y7SA 2R4NA 2N2MA 3G7GA 2YNKA 4JFBA 5GTHO 3SY9A 1G90A 4AYDC 3A2SX 4Z3TA 2N2LA 1ZHTA 2YPVA 1PRNA 1GFOA 3HWBA 4N59A 2LHFA 2XE5A 3LK3B 4U9CA 4C00A 4C4VB 3HOLA 1ZHZA 4D5UA 4FT6A 2X9KA 3SZDA 5KAIO 5T5FA 3VE2A 7PRNA 2XE2A 1QJ8A 4FRXA 4O3WA 1BH3A 2XE1A 1GFQA 1GFNA 4O4UA 3POXA 3A0BO 3AAEA 4N58A 5G3AA 2R4OA 3POUA 3PGUA 2K0LA 3BRZA 4N74A 2MHLA 5G39A 4QQ1A 2GE4A 2XMXA 3VZTX 2R4PA 2KZ7B 3UPGA 4CTDA 4O3XB 3NJTA 4LSFA 1HXUA 3FYXA 3JCUO 1MPFA 4AUIA 4AKMA 5GV0A 3AA6B 2WJRA 2M07A 2PRNA 3DWNA
chains in the Genus database with same CATH topology
5PRNA 2KC0A 4FZMA 4FZLA 2M06A 4GCPA 4KR4A 4C69X 3HOEA 4D65A 3VY8X 3T20A 1E54A 1GFPA 4BUMX 1ZHYA 2ERVA 1IZNA 3AAAB 3QRAA 2ZFGA 4FZNA 4G75A 2XG6A 4LSEA 1QJ9A 3PORA 3AA1A 3SYBA 3VE1A 2KDYA 4XNKA 1H6S1 3LK2A 4FSOA 1GFMA 5DL8A 3GP6A 5EE2A 4AKRA 5FVNA 1ORMA 3AA0A 4PUXA 3UAQA 4AYID 1P4TA 4GCSA 4RJXA 2J1NA 5G26A 3SZVA 3AAEB 4FSPA 4XNLA 2JMMA 2ODJA 2FGRA 4KRAA 3QRCA 3V8UA 1HXXA 2Y0LA 2F1VA 5AFUK 2FGQX 2Y0HA 1YS5A 2W80C 2ZLDA 3NSGA 5DL5A 2XTQA 3AA7A 4E1SA 4AYMC 2KXPA 3KVDD 4F4BA 4LSIA 3DA3A 4O3YA 1Q9GA 2O4VA 4AYNA 4AZLA 3WI5A 4GHBA 4G76A 1OSMA 2QTKA 2J4UP 4AFKA 2XE3A 1Q9FA 5ADXK 1ZHWA 2MNHA 4FMSA 3LK42 3POQA 1IZNB 3LK3A 3PRNA 4JCHA 4KR8A 3SY7A 5AFUL 3PQSA 6PRNA 2OMFA 1BT9A 4FOZA 4GF4A 3K19A 4RLCA 2PORA 3VZUX 4O4XA 5IYUA 3AA1B 3SYSA 4LSHA 4RL9A 5DL6A 2LFUA 4E1TA 5ADXL 3LK2B 8PRNA 3T0SA 3O0EA 3JTYA 4AKRB 5JDPA 3AA0B 3UU2A 3RBHA 4FRTA 1MM5A 4O3ZA 3VY9X 4O49A 1OPFA 3VZWX 2KZ7A 2W81C 2X27X 3PQUA 3T24A 3WI4A 1MM4A 2Y2XA 3EMNX 4RJWA 3DA4A 4D64A 3HW9A 1G90A 4RLBA 3AA6A 2F1TA 2K4TA 4FUVA 4GCQA 1PHOA 3AA7B 4B61A 5DL7A 1BXWA 1THQA 2KXPB 4FESA 3C5OA 4AYEC 2XTRA 3LK41 3TZGA 3AAAA 1HXTA 1QJPA 1ZHXA 2Y0KA 2Y7SA 5D5DA 3G7GA 2N2MA 2YNKA 4JFBA 3SY9A 4AYDC 3A2SX 4Z3TA 2N2LA 1ZHTA 3HWBA 1PRNA 1GFOA 4N59A 4U9CA 2LHFA 2XE5A 3LK3B 3HOLA 1ZHZA 4D5UA 4FT6A 3SZDA 5T5FA 3VE2A 7PRNA 2XE2A 1QJ8A 4FRXA 4O3WA 1BH3A 2XE1A 1GFQA 1GFNA 4O4UA 3POXA 3AAEA 4N58A 3POUA 2K0LA 2MHLA 4QQ1A 2GE4A 2XMXA 3VZTX 2KZ7B 3UPGA 4O3XB 5GV0A 4LSFA 1HXUA 3FYXA 4AUIA 1MPFA 4AKMA 3AA6B 2YPVA 2M07A 2PRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5PRN A;  4C69 X;  4GCP A;  4KR4 A;  4D65 A;  3VY8 X;  3T20 A;  1E54 A;  1GFP A;  4BUM X;  2ZFG A;  2XG6 A;  4LSE A;  3POR A;  3SYB A;  1H6S 1;  4FSO A;  1GFM A;  5DL8 A;  5FVN A;  4GCS A;  4RJX A;  2J1N A;  3SZV A;  4FSP A;  2ODJ A;  2FGR A;  4KRA A;  1HXX A;  2Y0L A;  2FGQ X;  2Y0H A;  3NSG A;  2ZLD A;  5DL5 A;  4LSI A;  2O4V A;  3WI5 A;  2J4U P;  1OSM A;  2QTK A;  2XE3 A;  4FMS A;  3POQ A;  3PRN A;  4KR8 A;  3SY7 A;  6PRN A;  2OMF A;  1BT9 A;  4FOZ A;  3VZU X;  3K19 A;  2POR A;  3SYS A;  4LSH A;  5DL6 A;  8PRN A;  3T0S A;  3O0E A;  3JTY A;  5JDP A;  3UU2 A;  4FRT A;  3VY9 X;  1OPF A;  3VZW X;  3WI4 A;  3T24 A;  2Y2X A;  3EMN X;  4RJW A;  4D64 A;  3HW9 A;  2K4T A;  4GCQ A;  1PHO A;  5DL7 A;  1HXT A;  2Y0K A;  4JFB A;  3SY9 A;  3A2S X;  3HWB A;  1PRN A;  1GFO A;  2XE5 A;  4D5U A;  4FT6 A;  3SZD A;  7PRN A;  2XE2 A;  4FRX A;  1BH3 A;  2XE1 A;  1GFQ A;  1GFN A;  3POX A;  3POU A;  3VZT X;  3UPG A;  4LSF A;  1HXU A;  3FYX A;  4AUI A;  1MPF A;  2PRN A; 
#chains in the Genus database with same CATH topology
 5PRN A;  4PJ0 O;  2KC0 A;  4FZM A;  3BS0 A;  2M06 A;  4FZL A;  4GCP A;  4KR4 A;  3HOE A;  4UB8 O;  4C69 X;  3VY8 X;  4D65 A;  3T20 A;  1E54 A;  1GFP A;  4BUM X;  1ZHY A;  2ERV A;  1IZN A;  3AAA B;  3QRA A;  5D5D A;  3KZI O;  2ZFG A;  4PR7 A;  4FZN A;  4G75 A;  3PGR A;  2XG6 A;  4IL6 O;  4LSE A;  1QJ9 A;  3POR A;  3AA1 A;  3SYB A;  5G38 A;  3VE1 A;  2KDY A;  4XNK A;  1H6S 1;  5TIS O;  3LK2 A;  4FSO A;  1GFM A;  5DL8 A;  5B66 O;  3GP6 A;  5EE2 A;  4AKR A;  5FVN A;  1ORM A;  3AA0 A;  4PUX A;  3UAQ A;  4AYI D;  3BRY A;  1P4T A;  4GCS A;  4RJX A;  2J1N A;  5G26 A;  5H2F O;  3SZV A;  3AAE B;  4FSP A;  4XNL A;  3PF1 A;  2WJQ A;  4K3C A;  2JMM A;  2F1C X;  2FGR A;  2ODJ A;  4KRA A;  2IWW A;  3QRC A;  3V8U A;  1HXX A;  2Y0L A;  2F1V A;  5AFU K;  2FGQ X;  2Y0H A;  1YS5 A;  2W80 C;  2ZLD A;  3DWO X;  3NSG A;  2XTQ A;  3AA7 A;  4UB6 O;  4AYM C;  2JQY A;  2KXP A;  3KVD D;  4F4B A;  3PGS A;  4LSI A;  2IWV A;  3DA3 A;  4O3Y A;  1Q9G A;  2O4V A;  4AYN A;  4AZL A;  4K3B A;  5DL5 A;  3WI5 A;  4GHB A;  2R8A A;  1OSM A;  2QTK A;  4G76 A;  4AFK A;  2XE3 A;  1Q9F A;  5ADX K;  2J4U P;  1ZHW A;  2MNH A;  4FMS A;  3LK4 2;  3POQ A;  1IZN B;  3LK3 A;  3PRN A;  4JCH A;  4KR8 A;  4C4V A;  3SY7 A;  5AFU L;  3PQS A;  6PRN A;  2OMF A;  2AXT O;  1BT9 A;  4FQE A;  4FOZ A;  4GF4 A;  3K19 A;  4RLC A;  2POR A;  3VZU X;  4O4X A;  5IYU A;  5GTI O;  3AA1 B;  3SYS A;  4LSH A;  4RL9 A;  5DL6 A;  2LFU A;  4E1T A;  5ADX L;  3LK2 B;  3WU2 O;  8PRN A;  3T0S A;  3A0H O;  3O0E A;  1T16 A;  5E79 O;  3JTY A;  4AKR B;  4N75 A;  3AA0 B;  3UU2 A;  5JDP A;  2R88 A;  3RBH A;  4FRT A;  1MM5 A;  4O3Z A;  3VY9 X;  4O49 A;  1OPF A;  3VZW X;  2KZ7 A;  2W81 C;  2X27 X;  3PQU A;  3T24 A;  3WI4 A;  1MM4 A;  2Y2X A;  3EMN X;  4RJW A;  3DA4 A;  4D64 A;  3HW9 A;  4E1S A;  5B5E O;  4RLB A;  3AA6 A;  3DZM A;  2F1T A;  2K4T A;  4FUV A;  5KAF O;  4GCQ A;  1PHO A;  3AA7 B;  4B61 A;  5DL7 A;  1BXW A;  2WVP A;  1THQ A;  2KXP B;  4FES A;  3C5O A;  4AYE C;  2R4L A;  2XTR A;  3LK4 1;  1S5L O;  3TZG A;  3AAA A;  1HXT A;  1QJP A;  1T1L A;  1ZHX A;  2R89 A;  2Y0K A;  2Y7S A;  2R4N A;  2N2M A;  3G7G A;  2YNK A;  4JFB A;  5GTH O;  3SY9 A;  1G90 A;  4AYD C;  3A2S X;  4Z3T A;  2N2L A;  1ZHT A;  2YPV A;  1PRN A;  1GFO A;  3HWB A;  4N59 A;  2LHF A;  2XE5 A;  3LK3 B;  4U9C A;  4C00 A;  4C4V B;  3HOL A;  1ZHZ A;  4D5U A;  4FT6 A;  2X9K A;  3SZD A;  5KAI O;  5T5F A;  3VE2 A;  7PRN A;  2XE2 A;  1QJ8 A;  4FRX A;  4O3W A;  1BH3 A;  2XE1 A;  1GFQ A;  1GFN A;  4O4U A;  3POX A;  3A0B O;  3AAE A;  4N58 A;  5G3A A;  2R4O A;  3POU A;  3PGU A;  2K0L A;  3BRZ A;  4N74 A;  2MHL A;  5G39 A;  4QQ1 A;  2GE4 A;  2XMX A;  3VZT X;  2R4P A;  2KZ7 B;  3UPG A;  4CTD A;  4O3X B;  3NJT A;  4LSF A;  1HXU A;  3FYX A;  3JCU O;  1MPF A;  4AUI A;  4AKM A;  5GV0 A;  3AA6 B;  2WJR A;  2M07 A;  2PRN A;  3DWN A; 
#chains in the Genus database with same CATH homology
 5PRN A;  2KC0 A;  4FZM A;  4FZL A;  2M06 A;  4GCP A;  4KR4 A;  4C69 X;  3HOE A;  4D65 A;  3VY8 X;  3T20 A;  1E54 A;  1GFP A;  4BUM X;  1ZHY A;  2ERV A;  1IZN A;  3AAA B;  3QRA A;  2ZFG A;  4FZN A;  4G75 A;  2XG6 A;  4LSE A;  1QJ9 A;  3POR A;  3AA1 A;  3SYB A;  3VE1 A;  2KDY A;  4XNK A;  1H6S 1;  3LK2 A;  4FSO A;  1GFM A;  5DL8 A;  3GP6 A;  5EE2 A;  4AKR A;  5FVN A;  1ORM A;  3AA0 A;  4PUX A;  3UAQ A;  4AYI D;  1P4T A;  4GCS A;  4RJX A;  2J1N A;  5G26 A;  3SZV A;  3AAE B;  4FSP A;  4XNL A;  2JMM A;  2ODJ A;  2FGR A;  4KRA A;  3QRC A;  3V8U A;  1HXX A;  2Y0L A;  2F1V A;  5AFU K;  2FGQ X;  2Y0H A;  1YS5 A;  2W80 C;  2ZLD A;  3NSG A;  5DL5 A;  2XTQ A;  3AA7 A;  4E1S A;  4AYM C;  2KXP A;  3KVD D;  4F4B A;  4LSI A;  3DA3 A;  4O3Y A;  1Q9G A;  2O4V A;  4AYN A;  4AZL A;  3WI5 A;  4GHB A;  4G76 A;  1OSM A;  2QTK A;  2J4U P;  4AFK A;  2XE3 A;  1Q9F A;  5ADX K;  1ZHW A;  2MNH A;  4FMS A;  3LK4 2;  3POQ A;  1IZN B;  3LK3 A;  3PRN A;  4JCH A;  4KR8 A;  3SY7 A;  5AFU L;  3PQS A;  6PRN A;  2OMF A;  1BT9 A;  4FOZ A;  4GF4 A;  3K19 A;  4RLC A;  2POR A;  3VZU X;  4O4X A;  5IYU A;  3AA1 B;  3SYS A;  4LSH A;  4RL9 A;  5DL6 A;  2LFU A;  4E1T A;  5ADX L;  3LK2 B;  8PRN A;  3T0S A;  3O0E A;  3JTY A;  4AKR B;  5JDP A;  3AA0 B;  3UU2 A;  3RBH A;  4FRT A;  1MM5 A;  4O3Z A;  3VY9 X;  4O49 A;  1OPF A;  3VZW X;  2KZ7 A;  2W81 C;  2X27 X;  3PQU A;  3T24 A;  3WI4 A;  1MM4 A;  2Y2X A;  3EMN X;  4RJW A;  3DA4 A;  4D64 A;  3HW9 A;  1G90 A;  4RLB A;  3AA6 A;  2F1T A;  2K4T A;  4FUV A;  4GCQ A;  1PHO A;  3AA7 B;  4B61 A;  5DL7 A;  1BXW A;  1THQ A;  2KXP B;  4FES A;  3C5O A;  4AYE C;  2XTR A;  3LK4 1;  3TZG A;  3AAA A;  1HXT A;  1QJP A;  1ZHX A;  2Y0K A;  2Y7S A;  5D5D A;  3G7G A;  2N2M A;  2YNK A;  4JFB A;  3SY9 A;  4AYD C;  3A2S X;  4Z3T A;  2N2L A;  1ZHT A;  3HWB A;  1PRN A;  1GFO A;  4N59 A;  4U9C A;  2LHF A;  2XE5 A;  3LK3 B;  3HOL A;  1ZHZ A;  4D5U A;  4FT6 A;  3SZD A;  5T5F A;  3VE2 A;  7PRN A;  2XE2 A;  1QJ8 A;  4FRX A;  4O3W A;  1BH3 A;  2XE1 A;  1GFQ A;  1GFN A;  4O4U A;  3POX A;  3AAE A;  4N58 A;  3POU A;  2K0L A;  2MHL A;  4QQ1 A;  2GE4 A;  2XMX A;  3VZT X;  2KZ7 B;  3UPG A;  4O3X B;  5GV0 A;  4LSF A;  1HXU A;  3FYX A;  4AUI A;  1MPF A;  4AKM A;  3AA6 B;  2YPV A;  2M07 A;  2PRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...