2QTKA

Crystal structure of the outer membrane protein opdk from pseudomonas aeruginosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
387
structure length
371
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFKSLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNNSELLPLHAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Probable porin
publication title Crystal Structure of the Outer Membrane Protein OpdK from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 97
structure length 371
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2qtkA01
3NSGA 1GFNA 2J4UP 3VY9X 3FYXA 7PRNA 2FGRA 4RJWA 3SZVA 4GCQA 4D64A 3PORA 2ODJA 3SYBA 4LSIA 3SYSA 2Y2XA 3UPGA 3VZUX 2OMFA 3PRNA 4KR8A 3VZWX 4GCPA 4D65A 4LSEA 1E54A 3T0SA 4FSOA 1H6S1 3T24A 2K4TA 1HXTA 3SY9A 3VY8X 2O4VA 1BH3A 2XG6A 5JDPA 4GCSA 5DL8A 1OSMA 2FGQX 8PRNA 1GFOA 4BUMX 4FOZA 4FSPA 3SZDA 5FVNA 2ZFGA 3POXA 1HXUA 3POQA 1PHOA 3HW9A 4FRTA 4FT6A 3K19A 2XE1A 4FRXA 1GFQA 2Y0LA 1GFMA 1HXXA 5DL5A 2XE3A 4LSFA 6PRNA 1MPFA 2ZLDA 4AUIA 2PRNA 3WI4A 2J1NA 3HWBA 2PORA 4KR4A 2Y0HA 4D5UA 4KRAA 3VZTX 5PRNA 2QTKA 1BT9A 3O0EA 4FMSA 5DL7A 2Y0KA 1GFPA 3EMNX 3T20A 3UU2A 1OPFA 3A2SX 5DL6A 1PRNA 3SY7A 4C69X 3WI5A 4LSHA 4RJXA 3POUA 3JTYA 2XE2A 4JFBA 2XE5A
chains in the Genus database with same CATH superfamily
2R4OA 3GP6A 3NSGA 4N74A 1GFNA 1ZHWA 2J4UP 4C00A 3PGUA 2MNHA 3AAAB 5G39A 5AFUL 3HOEA 3AAAA 3AA7B 2R4PA 4C4VB 3RBHA 3BRYA 2Y7SA 4GF4A 3AA7A 1P4TA 3FYXA 3VY9X 4C4VA 7PRNA 2FGRA 4FESA 3NJTA 4RJWA 1MM5A 3DA4A 3LK3A 5G26A 1QJ9A 2IWVA 3BRZA 4GCQA 3SZVA 4AKMA 4XNKA 3PORA 1ZHYA 2ODJA 4D64A 1Q9GA 3SYBA 4AZLA 3AA6B 2K0LA 2WJRA 2M06A 4LSIA 2JMMA 3SYSA 2F1CX 3AA6A 4K3CA 4O3YA 3LK2B 3VE1A 2Y2XA 4N59A 4FUVA 2KXPB 3UPGA 3AAEB 3LK2A 2OMFA 3VZUX 4UB8O 3AAEA 2XTRA 3G7GA 3PRNA 4KR8A 3UAQA 4GCPA 3VZWX 4D65A 4LSEA 4IL6O 2WVPA 2M07A 4QQ1A 4O3XB 1E54A 3T0SA 4FZNA 2W81C 4E1TA 4FSOA 1H6S1 1QJPA 3T24A 4FZMA 4O3WA 5GV0A 3BS0A 3AA1B 4AYDC 1ZHTA 3VE2A 3AA1A 2K4TA 1S5LO 1T1LA 2YNKA 2AXTO 3LK3B 4G76A 5TISO 2YPVA 4K3BA 4RLBA 1YS5A 1MM4A 1HXTA 3SY9A 2O4VA 1BH3A 3VY8X 2XG6A 4AYNA 3V8UA 4O49A 4AFKA 2IWWA 5JDPA 4GCSA 2KZ7A 1OSMA 1IZNA 2FGQX 4RLCA 1T16A 3QRCA 1GFOA 5DL8A 2ERVA 4FOZA 4BUMX 8PRNA 4UB6O 4FSPA 3KZIO 3PF1A 1ORMA 3SZDA 3HOLA 2R4LA 5FVNA 2N2LA 5ADXK 4G75A 2ZFGA 4AYID 4O4XA 4XNLA 2LHFA 3POXA 1HXUA 2MHLA 1PHOA 3HW9A 3POQA 4FRTA 4FT6A 3TZGA 3K19A 2XE1A 4FRXA 2N2MA 1GFQA 2R88A 1GFMA 1HXXA 2Y0LA 4CTDA 4RL9A 3DZMA 4FZLA 2KC0A 2F1VA 3QRAA 5DL5A 5GTIO 5T5FA 2XE3A 5KAFO 4AKRA 4LSFA 3PGSA 5AFUK 4FQEA 3DWOX 5GTHO 6PRNA 5D5DA 1MPFA 4AYMC 4F4BA 2ZLDA 3AA0A 2GE4A 4Z3TA 4AUIA 2PRNA 4PR7A 2KZ7B 1IZNB 3WU2O 2X27X 3DWNA 3PGRA 3WI4A 4E1SA 5ADXL 2KDYA 4GHBA 2J1NA 1THQA 2R8AA 3HWBA 3C5OA 5IYUA 2PORA 4KR4A 5EE2A 2Y0HA 3LK42 1Q9FA 1ZHXA 4O3ZA 4KRAA 4PJ0O 3VZTX 4D5UA 5PRNA 5H2FO 3LK41 4PUXA 2QTKA 1QJ8A 2F1TA 1BT9A 5E79O 5B66O 4B61A 4AKRB 3KVDD 4AYEC 3O0EA 3PQUA 3PQSA 4FMSA 5DL7A 2JQYA 3A0BO 2Y0KA 2R89A 1GFPA 3EMNX 3T20A 4N75A 3AA0B 5G3AA 5B5EO 3UU2A 1OPFA 3A2SX 2W80C 4O4UA 4U9CA 5G38A 5DL6A 2WJQA 1PRNA 2X9KA 3A0HO 1BXWA 2R4NA 1ZHZA 4N58A 3SY7A 4C69X 3WI5A 2LFUA 2KXPA 1G90A 3DA3A 4JCHA 4LSHA 4RJXA 2XTQA 3JCUO 3POUA 3JTYA 2XE2A 5KAIO 4JFBA 2XE5A 2XMXA
chains in the Genus database with same CATH topology
3GP6A 3NSGA 1GFNA 1ZHWA 2J4UP 5AFUL 2MNHA 3AAAB 3HOEA 3AAAA 3AA7B 3RBHA 3VY9X 2Y7SA 4GF4A 3AA7A 1P4TA 3FYXA 7PRNA 2FGRA 4FESA 5G26A 4RJWA 1MM5A 3DA4A 3LK3A 3SZVA 1QJ9A 4GCQA 4AKMA 4D64A 4XNKA 3PORA 1ZHYA 2ODJA 1Q9GA 3SYBA 4AZLA 3AA6B 2K0LA 2M06A 4LSIA 2JMMA 3SYSA 3AA6A 4O3YA 3LK2B 3VE1A 2Y2XA 4N59A 4FUVA 2KXPB 3UPGA 3AAEB 3LK2A 2OMFA 3VZUX 3AAEA 2XTRA 3G7GA 3PRNA 4KR8A 3UAQA 4GCPA 3VZWX 4D65A 4LSEA 4QQ1A 2M07A 4O3XB 1E54A 3T0SA 4FZNA 2W81C 4E1TA 4FSOA 1H6S1 1QJPA 3T24A 4FZMA 4O3WA 5GV0A 3AA1B 4AYDC 1ZHTA 3VE2A 3AA1A 2K4TA 2YNKA 3LK3B 4G76A 2YPVA 4RLBA 1YS5A 1MM4A 1HXTA 3SY9A 2O4VA 1BH3A 3VY8X 2XG6A 4AYNA 3V8UA 4O49A 4AFKA 5JDPA 4GCSA 2KZ7A 1OSMA 1IZNA 2FGQX 4RLCA 3QRCA 5DL8A 1GFOA 4BUMX 2ERVA 4FOZA 8PRNA 4FSPA 1ORMA 3SZDA 3HOLA 5FVNA 5ADXK 2N2LA 4G75A 2ZFGA 4AYID 4O4XA 4XNLA 2LHFA 3POXA 1HXUA 2MHLA 1PHOA 3HW9A 3POQA 4FRTA 4FT6A 3TZGA 3K19A 2XE1A 4FRXA 2N2MA 1GFQA 2Y0LA 1GFMA 1HXXA 4RL9A 4FZLA 5DL5A 2KC0A 2F1VA 3QRAA 5T5FA 4AKRA 2XE3A 4LSFA 5AFUK 6PRNA 5D5DA 1MPFA 4AYMC 4F4BA 2ZLDA 3AA0A 2GE4A 4Z3TA 4AUIA 2PRNA 2KZ7B 1IZNB 2X27X 3WI4A 4E1SA 5ADXL 2KDYA 4GHBA 2J1NA 1THQA 3HWBA 3C5OA 5IYUA 2PORA 4KR4A 5EE2A 2Y0HA 3LK42 1Q9FA 1ZHXA 4O3ZA 4KRAA 4D5UA 3VZTX 5PRNA 3LK41 4PUXA 2QTKA 1QJ8A 2F1TA 1BT9A 4B61A 4AKRB 3KVDD 4AYEC 3O0EA 3PQUA 3PQSA 4FMSA 5DL7A 2Y0KA 1GFPA 3EMNX 3T20A 3AA0B 3UU2A 1OPFA 3A2SX 2W80C 4O4UA 4U9CA 5DL6A 1PRNA 1BXWA 1ZHZA 4N58A 3SY7A 4C69X 3WI5A 2LFUA 2KXPA 1G90A 3DA3A 4JCHA 4LSHA 4RJXA 2XTQA 3POUA 3JTYA 2XE2A 4JFBA 2XE5A 2XMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSG A;  1GFN A;  2J4U P;  3VY9 X;  3FYX A;  7PRN A;  2FGR A;  4RJW A;  3SZV A;  4GCQ A;  4D64 A;  3POR A;  2ODJ A;  3SYB A;  4LSI A;  3SYS A;  2Y2X A;  3UPG A;  3VZU X;  2OMF A;  3PRN A;  4KR8 A;  3VZW X;  4GCP A;  4D65 A;  4LSE A;  1E54 A;  3T0S A;  4FSO A;  1H6S 1;  3T24 A;  2K4T A;  1HXT A;  3SY9 A;  3VY8 X;  2O4V A;  1BH3 A;  2XG6 A;  5JDP A;  4GCS A;  5DL8 A;  1OSM A;  2FGQ X;  8PRN A;  1GFO A;  4BUM X;  4FOZ A;  4FSP A;  3SZD A;  5FVN A;  2ZFG A;  3POX A;  1HXU A;  3POQ A;  1PHO A;  3HW9 A;  4FRT A;  4FT6 A;  3K19 A;  2XE1 A;  4FRX A;  1GFQ A;  2Y0L A;  1GFM A;  1HXX A;  5DL5 A;  2XE3 A;  4LSF A;  6PRN A;  1MPF A;  2ZLD A;  4AUI A;  2PRN A;  3WI4 A;  2J1N A;  3HWB A;  2POR A;  4KR4 A;  2Y0H A;  4D5U A;  4KRA A;  3VZT X;  5PRN A;  2QTK A;  1BT9 A;  3O0E A;  4FMS A;  5DL7 A;  2Y0K A;  1GFP A;  3EMN X;  3T20 A;  3UU2 A;  1OPF A;  3A2S X;  5DL6 A;  1PRN A;  3SY7 A;  4C69 X;  3WI5 A;  4LSH A;  4RJX A;  3POU A;  3JTY A;  2XE2 A;  4JFB A;  2XE5 A; 
#chains in the Genus database with same CATH topology
 2R4O A;  3GP6 A;  3NSG A;  4N74 A;  1GFN A;  1ZHW A;  2J4U P;  4C00 A;  3PGU A;  2MNH A;  3AAA B;  5G39 A;  5AFU L;  3HOE A;  3AAA A;  3AA7 B;  2R4P A;  4C4V B;  3RBH A;  3BRY A;  2Y7S A;  4GF4 A;  3AA7 A;  1P4T A;  3FYX A;  3VY9 X;  4C4V A;  7PRN A;  2FGR A;  4FES A;  3NJT A;  4RJW A;  1MM5 A;  3DA4 A;  3LK3 A;  5G26 A;  1QJ9 A;  2IWV A;  3BRZ A;  4GCQ A;  3SZV A;  4AKM A;  4XNK A;  3POR A;  1ZHY A;  2ODJ A;  4D64 A;  1Q9G A;  3SYB A;  4AZL A;  3AA6 B;  2K0L A;  2WJR A;  2M06 A;  4LSI A;  2JMM A;  3SYS A;  2F1C X;  3AA6 A;  4K3C A;  4O3Y A;  3LK2 B;  3VE1 A;  2Y2X A;  4N59 A;  4FUV A;  2KXP B;  3UPG A;  3AAE B;  3LK2 A;  2OMF A;  3VZU X;  4UB8 O;  3AAE A;  2XTR A;  3G7G A;  3PRN A;  4KR8 A;  3UAQ A;  4GCP A;  3VZW X;  4D65 A;  4LSE A;  4IL6 O;  2WVP A;  2M07 A;  4QQ1 A;  4O3X B;  1E54 A;  3T0S A;  4FZN A;  2W81 C;  4E1T A;  4FSO A;  1H6S 1;  1QJP A;  3T24 A;  4FZM A;  4O3W A;  5GV0 A;  3BS0 A;  3AA1 B;  4AYD C;  1ZHT A;  3VE2 A;  3AA1 A;  2K4T A;  1S5L O;  1T1L A;  2YNK A;  2AXT O;  3LK3 B;  4G76 A;  5TIS O;  2YPV A;  4K3B A;  4RLB A;  1YS5 A;  1MM4 A;  1HXT A;  3SY9 A;  2O4V A;  1BH3 A;  3VY8 X;  2XG6 A;  4AYN A;  3V8U A;  4O49 A;  4AFK A;  2IWW A;  5JDP A;  4GCS A;  2KZ7 A;  1OSM A;  1IZN A;  2FGQ X;  4RLC A;  1T16 A;  3QRC A;  1GFO A;  5DL8 A;  2ERV A;  4FOZ A;  4BUM X;  8PRN A;  4UB6 O;  4FSP A;  3KZI O;  3PF1 A;  1ORM A;  3SZD A;  3HOL A;  2R4L A;  5FVN A;  2N2L A;  5ADX K;  4G75 A;  2ZFG A;  4AYI D;  4O4X A;  4XNL A;  2LHF A;  3POX A;  1HXU A;  2MHL A;  1PHO A;  3HW9 A;  3POQ A;  4FRT A;  4FT6 A;  3TZG A;  3K19 A;  2XE1 A;  4FRX A;  2N2M A;  1GFQ A;  2R88 A;  1GFM A;  1HXX A;  2Y0L A;  4CTD A;  4RL9 A;  3DZM A;  4FZL A;  2KC0 A;  2F1V A;  3QRA A;  5DL5 A;  5GTI O;  5T5F A;  2XE3 A;  5KAF O;  4AKR A;  4LSF A;  3PGS A;  5AFU K;  4FQE A;  3DWO X;  5GTH O;  6PRN A;  5D5D A;  1MPF A;  4AYM C;  4F4B A;  2ZLD A;  3AA0 A;  2GE4 A;  4Z3T A;  4AUI A;  2PRN A;  4PR7 A;  2KZ7 B;  1IZN B;  3WU2 O;  2X27 X;  3DWN A;  3PGR A;  3WI4 A;  4E1S A;  5ADX L;  2KDY A;  4GHB A;  2J1N A;  1THQ A;  2R8A A;  3HWB A;  3C5O A;  5IYU A;  2POR A;  4KR4 A;  5EE2 A;  2Y0H A;  3LK4 2;  1Q9F A;  1ZHX A;  4O3Z A;  4KRA A;  4PJ0 O;  3VZT X;  4D5U A;  5PRN A;  5H2F O;  3LK4 1;  4PUX A;  2QTK A;  1QJ8 A;  2F1T A;  1BT9 A;  5E79 O;  5B66 O;  4B61 A;  4AKR B;  3KVD D;  4AYE C;  3O0E A;  3PQU A;  3PQS A;  4FMS A;  5DL7 A;  2JQY A;  3A0B O;  2Y0K A;  2R89 A;  1GFP A;  3EMN X;  3T20 A;  4N75 A;  3AA0 B;  5G3A A;  5B5E O;  3UU2 A;  1OPF A;  3A2S X;  2W80 C;  4O4U A;  4U9C A;  5G38 A;  5DL6 A;  2WJQ A;  1PRN A;  2X9K A;  3A0H O;  1BXW A;  2R4N A;  1ZHZ A;  4N58 A;  3SY7 A;  4C69 X;  3WI5 A;  2LFU A;  2KXP A;  1G90 A;  3DA3 A;  4JCH A;  4LSH A;  4RJX A;  2XTQ A;  3JCU O;  3POU A;  3JTY A;  2XE2 A;  5KAI O;  4JFB A;  2XE5 A;  2XMX A; 
#chains in the Genus database with same CATH homology
 3GP6 A;  3NSG A;  1GFN A;  1ZHW A;  2J4U P;  5AFU L;  2MNH A;  3AAA B;  3HOE A;  3AAA A;  3AA7 B;  3RBH A;  3VY9 X;  2Y7S A;  4GF4 A;  3AA7 A;  1P4T A;  3FYX A;  7PRN A;  2FGR A;  4FES A;  5G26 A;  4RJW A;  1MM5 A;  3DA4 A;  3LK3 A;  3SZV A;  1QJ9 A;  4GCQ A;  4AKM A;  4D64 A;  4XNK A;  3POR A;  1ZHY A;  2ODJ A;  1Q9G A;  3SYB A;  4AZL A;  3AA6 B;  2K0L A;  2M06 A;  4LSI A;  2JMM A;  3SYS A;  3AA6 A;  4O3Y A;  3LK2 B;  3VE1 A;  2Y2X A;  4N59 A;  4FUV A;  2KXP B;  3UPG A;  3AAE B;  3LK2 A;  2OMF A;  3VZU X;  3AAE A;  2XTR A;  3G7G A;  3PRN A;  4KR8 A;  3UAQ A;  4GCP A;  3VZW X;  4D65 A;  4LSE A;  4QQ1 A;  2M07 A;  4O3X B;  1E54 A;  3T0S A;  4FZN A;  2W81 C;  4E1T A;  4FSO A;  1H6S 1;  1QJP A;  3T24 A;  4FZM A;  4O3W A;  5GV0 A;  3AA1 B;  4AYD C;  1ZHT A;  3VE2 A;  3AA1 A;  2K4T A;  2YNK A;  3LK3 B;  4G76 A;  2YPV A;  4RLB A;  1YS5 A;  1MM4 A;  1HXT A;  3SY9 A;  2O4V A;  1BH3 A;  3VY8 X;  2XG6 A;  4AYN A;  3V8U A;  4O49 A;  4AFK A;  5JDP A;  4GCS A;  2KZ7 A;  1OSM A;  1IZN A;  2FGQ X;  4RLC A;  3QRC A;  5DL8 A;  1GFO A;  4BUM X;  2ERV A;  4FOZ A;  8PRN A;  4FSP A;  1ORM A;  3SZD A;  3HOL A;  5FVN A;  5ADX K;  2N2L A;  4G75 A;  2ZFG A;  4AYI D;  4O4X A;  4XNL A;  2LHF A;  3POX A;  1HXU A;  2MHL A;  1PHO A;  3HW9 A;  3POQ A;  4FRT A;  4FT6 A;  3TZG A;  3K19 A;  2XE1 A;  4FRX A;  2N2M A;  1GFQ A;  2Y0L A;  1GFM A;  1HXX A;  4RL9 A;  4FZL A;  5DL5 A;  2KC0 A;  2F1V A;  3QRA A;  5T5F A;  4AKR A;  2XE3 A;  4LSF A;  5AFU K;  6PRN A;  5D5D A;  1MPF A;  4AYM C;  4F4B A;  2ZLD A;  3AA0 A;  2GE4 A;  4Z3T A;  4AUI A;  2PRN A;  2KZ7 B;  1IZN B;  2X27 X;  3WI4 A;  4E1S A;  5ADX L;  2KDY A;  4GHB A;  2J1N A;  1THQ A;  3HWB A;  3C5O A;  5IYU A;  2POR A;  4KR4 A;  5EE2 A;  2Y0H A;  3LK4 2;  1Q9F A;  1ZHX A;  4O3Z A;  4KRA A;  4D5U A;  3VZT X;  5PRN A;  3LK4 1;  4PUX A;  2QTK A;  1QJ8 A;  2F1T A;  1BT9 A;  4B61 A;  4AKR B;  3KVD D;  4AYE C;  3O0E A;  3PQU A;  3PQS A;  4FMS A;  5DL7 A;  2Y0K A;  1GFP A;  3EMN X;  3T20 A;  3AA0 B;  3UU2 A;  1OPF A;  3A2S X;  2W80 C;  4O4U A;  4U9C A;  5DL6 A;  1PRN A;  1BXW A;  1ZHZ A;  4N58 A;  3SY7 A;  4C69 X;  3WI5 A;  2LFU A;  2KXP A;  1G90 A;  3DA3 A;  4JCH A;  4LSH A;  4RJX A;  2XTQ A;  3POU A;  3JTY A;  2XE2 A;  4JFB A;  2XE5 A;  2XMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...