2QTKA

Crystal structure of the outer membrane protein opdk from pseudomonas aeruginosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
387
structure length
371
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFKSLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNNSELLPLHAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Outer Membrane Protein OpdK from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords Probable porin
total genus 97
structure length 371
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2qtkA01
3VY9X 2XE1A 2XE2A 3FYXA 5DL7A 4AUIA 3SY7A 2Y0HA 3HW9A 4LSEA 1HXXA 1BH3A 2K4TA 3T20A 2ZFGA 4GCPA 2XG6A 2FGQX 3O0EA 3VZUX 8PRNA 3POUA 5DL8A 4LSFA 2Y0KA 3NSGA 2O4VA 4BUMX 1GFOA 3SYSA 4FRTA 4FT6A 2ZLDA 4FSPA 3JTYA 5DL6A 4FOZA 1BT9A 1GFNA 4FMSA 3WI4A 3T0SA 4RJXA 1PRNA 3K19A 1HXTA 2PRNA 1HXUA 3SZDA 4D65A 4RJWA 3SZVA 4KR8A 1GFMA 3A2SX 4LSIA 3PORA 4C69X 4FRXA 3VZWX 4D64A 2QTKA 2ODJA 3EMNX 3SY9A 6PRNA 5DL5A 3POQA 4LSHA 2PORA 5FVNA 2Y2XA 1PHOA 3UU2A 2J4UP 2FGRA 4KRAA 3UPGA 3T24A 1E54A 2Y0LA 2OMFA 3PRNA 3SYBA 4GCSA 2J1NA 3HWBA 4FSOA 3VZTX 1GFPA 1OSMA 2XE5A 5PRNA 1H6S1 3POXA 2XE3A 3VY8X 7PRNA 3WI5A 4GCQA 1OPFA 4KR4A 4JFBA 1GFQA 1MPFA 4D5UA 5JDPA
chains in the Genus database with same CATH superfamily
1ORMA 2JMMA 1MM4A 4PJ0O 4AZLA 3VY9X 3BRYA 2JQYA 2XE1A 2XE2A 2MNHA 4IL6O 4G75A 3FYXA 5DL7A 3KVDD 4AUIA 4O3XB 5E79O 3SY7A 3KZIO 2KXPA 2Y0HA 2KC0A 1MM5A 3HW9A 2WJRA 3GP6A 3PGSA 1IZNB 3AAAB 4GF4A 4LSEA 4XNKA 5TISO 3RBHA 1HXXA 3A0BO 1BH3A 1T1LA 4PUXA 2K4TA 2R4PA 2ZFGA 4F4BA 4AYMC 2F1CX 4E1SA 3T20A 4GCPA 5ADXK 5KAFO 2XG6A 3AAAA 2FGQX 3O0EA 3VZUX 2W81C 4AYID 4Z3TA 8PRNA 3POUA 5G26A 5H2FO 3DWNA 1ZHZA 1IZNA 1T16A 3DZMA 5DL8A 2KXPB 4LSFA 2M06A 2Y0KA 3NSGA 3AA0B 1Q9GA 2O4VA 4BUMX 1THQA 1GFOA 4FRTA 3SYSA 4FT6A 1P4TA 3JCUO 4D5UA 4JCHA 5ADXL 2ZLDA 2R4NA 3LK2B 4FSPA 4N75A 3JTYA 5DL6A 3UAQA 4FOZA 1BT9A 1ZHXA 2YPVA 1GFNA 4FMSA 3WI4A 3TZGA 3LK2A 2WJQA 3LK3B 1ZHTA 4AYDC 3T0SA 4RJXA 1PRNA 1QJ8A 3K19A 1HXTA 2MHLA 2PRNA 4FZLA 3PGRA 1HXUA 3SZDA 3WU2O 4D65A 4CTDA 2AXTO 4FUVA 2KZ7B 2R89A 4RJWA 3SZVA 4KR8A 1Q9FA 1GFMA 3A2SX 4UB8O 4N58A 4LSIA 2IWVA 3PORA 3VE1A 4N74A 4O49A 4AYNA 5B5EO 4RL9A 3AA6B 4C69X 3AA1A 4FRXA 3VZWX 4C00A 4D64A 4E1TA 2M07A 3PQSA 2QTKA 2ODJA 2XTQA 3EMNX 4K3BA 3SY9A 6PRNA 4C4VB 1S5LO 3AA0A 4QQ1A 3VE2A 5DL5A 5AFUL 2R88A 1BXWA 3POQA 4U9CA 3AAEB 2R4OA 2IWWA 4C4VA 3G7GA 5G39A 2LHFA 2N2LA 4UB6O 4LSHA 2PORA 3AA1B 5FVNA 2K0LA 2ERVA 5AFUK 3HOLA 3QRCA 2Y2XA 1PHOA 3UU2A 2J4UP 4O3WA 1G90A 2FGRA 2W80C 4KRAA 3LK42 4N59A 2KZ7A 4O4XA 5KAIO 4B61A 4AKRB 3UPGA 2XTRA 1E54A 1YS5A 3T24A 3BRZA 2Y0LA 2OMFA 3BS0A 3PGUA 3PRNA 3SYBA 4AYEC 2XMXA 2J1NA 2YNKA 4GCSA 5GTIO 5G38A 3QRAA 3A0HO 3AAEA 3HWBA 4FSOA 4O3YA 4GHBA 2GE4A 3C5OA 5G3AA 3AA7A 3VZTX 2N2MA 3DA3A 3AA6A 3PF1A 3NJTA 1GFPA 3LK41 5T5FA 1OSMA 4PR7A 4FESA 2XE5A 4O4UA 1QJ9A 5PRNA 4AKRA 2X9KA 1H6S1 3DWOX 4FZNA 4AFKA 3POXA 3V8UA 2XE3A 3VY8X 2WVPA 7PRNA 3WI5A 1ZHYA 1ZHWA 4RLBA 4GCQA 2F1VA 1OPFA 3PQUA 5GV0A 4AKMA 3DA4A 2KDYA 4JFBA 4KR4A 2F1TA 4O3ZA 1QJPA 2R8AA 4XNLA 5B66O 4K3CA 1GFQA 2R4LA 1MPFA 4RLCA 2X27X 3HOEA 4G76A 5GTHO 4FZMA 5IYUA 2LFUA 2Y7SA 3AA7B 5D5DA 3LK3A 5JDPA 5EE2A 4FQEA
chains in the Genus database with same CATH topology
1ORMA 2JMMA 1MM4A 4AZLA 3VY9X 2XE1A 2XE2A 2MNHA 4G75A 3FYXA 5DL7A 3KVDD 4AUIA 4O3XB 3SY7A 2KXPA 2Y0HA 2KC0A 1MM5A 3HW9A 3GP6A 3RBHA 4LSEA 1IZNB 3AAAB 4GF4A 4XNKA 4AYMC 1HXXA 4PUXA 1BH3A 4F4BA 2K4TA 3T20A 2ZFGA 4E1SA 4GCPA 5ADXK 2XG6A 3AAAA 2FGQX 3O0EA 3VZUX 2W81C 4AYID 4Z3TA 8PRNA 3POUA 5G26A 1ZHZA 1IZNA 5DL8A 2KXPB 4LSFA 2M06A 2Y0KA 3NSGA 3AA0B 1Q9GA 2O4VA 4BUMX 1THQA 1GFOA 4FRTA 3SYSA 4FT6A 1P4TA 4D5UA 5ADXL 4JCHA 2ZLDA 3LK2B 4FSPA 3JTYA 5DL6A 3UAQA 4FOZA 1BT9A 1ZHXA 2YPVA 1GFNA 4FMSA 3WI4A 3TZGA 3LK2A 3LK3B 1ZHTA 4AYDC 3T0SA 4RJXA 1PRNA 1QJ8A 3K19A 1HXTA 2MHLA 2PRNA 4FZLA 1HXUA 3SZDA 4D65A 4FUVA 4RJWA 2KZ7B 3SZVA 4KR8A 1Q9FA 1GFMA 3A2SX 4N58A 4LSIA 4AYNA 3PORA 3VE1A 4O49A 4RL9A 3AA6B 4C69X 3AA1A 4FRXA 3VZWX 4D64A 4E1TA 2M07A 3PQSA 2XTQA 2QTKA 2ODJA 3EMNX 3SY9A 6PRNA 3AA0A 4QQ1A 3VE2A 5DL5A 5AFUL 3POQA 1BXWA 4U9CA 3AAEB 3G7GA 2LHFA 2N2LA 4LSHA 2PORA 3AA1B 5FVNA 2K0LA 2ERVA 5AFUK 3HOLA 3QRCA 2Y2XA 1PHOA 3UU2A 2J4UP 4O3WA 1G90A 2FGRA 2W80C 4KRAA 3LK42 4N59A 2KZ7A 4O4XA 4B61A 4AKRB 3UPGA 2XTRA 1E54A 1YS5A 3T24A 2Y0LA 2OMFA 3PRNA 3SYBA 4AYEC 2XMXA 2YNKA 2J1NA 4GCSA 3QRAA 3AAEA 3HWBA 4FSOA 4O3YA 4GHBA 2GE4A 3C5OA 3VZTX 3AA7A 2N2MA 3DA3A 3AA6A 1GFPA 3LK41 5T5FA 1OSMA 4FESA 2XE5A 4O4UA 1QJ9A 5PRNA 4AKRA 1H6S1 4FZNA 4AFKA 3POXA 3V8UA 2XE3A 3VY8X 7PRNA 3WI5A 1ZHYA 1ZHWA 4RLBA 4GCQA 2F1VA 1OPFA 3PQUA 5GV0A 4AKMA 3DA4A 2KDYA 4JFBA 4KR4A 2F1TA 4O3ZA 1QJPA 4XNLA 1GFQA 1MPFA 4RLCA 2X27X 3HOEA 4G76A 4FZMA 5IYUA 2LFUA 2Y7SA 3AA7B 5D5DA 3LK3A 5JDPA 5EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VY9 X;  2XE1 A;  2XE2 A;  3FYX A;  5DL7 A;  4AUI A;  3SY7 A;  2Y0H A;  3HW9 A;  4LSE A;  1HXX A;  1BH3 A;  2K4T A;  3T20 A;  2ZFG A;  4GCP A;  2XG6 A;  2FGQ X;  3O0E A;  3VZU X;  8PRN A;  3POU A;  5DL8 A;  4LSF A;  2Y0K A;  3NSG A;  2O4V A;  4BUM X;  1GFO A;  3SYS A;  4FRT A;  4FT6 A;  2ZLD A;  4FSP A;  3JTY A;  5DL6 A;  4FOZ A;  1BT9 A;  1GFN A;  4FMS A;  3WI4 A;  3T0S A;  4RJX A;  1PRN A;  3K19 A;  1HXT A;  2PRN A;  1HXU A;  3SZD A;  4D65 A;  4RJW A;  3SZV A;  4KR8 A;  1GFM A;  3A2S X;  4LSI A;  3POR A;  4C69 X;  4FRX A;  3VZW X;  4D64 A;  2QTK A;  2ODJ A;  3EMN X;  3SY9 A;  6PRN A;  5DL5 A;  3POQ A;  4LSH A;  2POR A;  5FVN A;  2Y2X A;  1PHO A;  3UU2 A;  2J4U P;  2FGR A;  4KRA A;  3UPG A;  3T24 A;  1E54 A;  2Y0L A;  2OMF A;  3PRN A;  3SYB A;  4GCS A;  2J1N A;  3HWB A;  4FSO A;  3VZT X;  1GFP A;  1OSM A;  2XE5 A;  5PRN A;  1H6S 1;  3POX A;  2XE3 A;  3VY8 X;  7PRN A;  3WI5 A;  4GCQ A;  1OPF A;  4KR4 A;  4JFB A;  1GFQ A;  1MPF A;  4D5U A;  5JDP A; 
#chains in the Genus database with same CATH topology
 1ORM A;  2JMM A;  1MM4 A;  4PJ0 O;  4AZL A;  3VY9 X;  3BRY A;  2JQY A;  2XE1 A;  2XE2 A;  2MNH A;  4IL6 O;  4G75 A;  3FYX A;  5DL7 A;  3KVD D;  4AUI A;  4O3X B;  5E79 O;  3SY7 A;  3KZI O;  2KXP A;  2Y0H A;  2KC0 A;  1MM5 A;  3HW9 A;  2WJR A;  3GP6 A;  3PGS A;  1IZN B;  3AAA B;  4GF4 A;  4LSE A;  4XNK A;  5TIS O;  3RBH A;  1HXX A;  3A0B O;  1BH3 A;  1T1L A;  4PUX A;  2K4T A;  2R4P A;  2ZFG A;  4F4B A;  4AYM C;  2F1C X;  4E1S A;  3T20 A;  4GCP A;  5ADX K;  5KAF O;  2XG6 A;  3AAA A;  2FGQ X;  3O0E A;  3VZU X;  2W81 C;  4AYI D;  4Z3T A;  8PRN A;  3POU A;  5G26 A;  5H2F O;  3DWN A;  1ZHZ A;  1IZN A;  1T16 A;  3DZM A;  5DL8 A;  2KXP B;  4LSF A;  2M06 A;  2Y0K A;  3NSG A;  3AA0 B;  1Q9G A;  2O4V A;  4BUM X;  1THQ A;  1GFO A;  4FRT A;  3SYS A;  4FT6 A;  1P4T A;  3JCU O;  4D5U A;  4JCH A;  5ADX L;  2ZLD A;  2R4N A;  3LK2 B;  4FSP A;  4N75 A;  3JTY A;  5DL6 A;  3UAQ A;  4FOZ A;  1BT9 A;  1ZHX A;  2YPV A;  1GFN A;  4FMS A;  3WI4 A;  3TZG A;  3LK2 A;  2WJQ A;  3LK3 B;  1ZHT A;  4AYD C;  3T0S A;  4RJX A;  1PRN A;  1QJ8 A;  3K19 A;  1HXT A;  2MHL A;  2PRN A;  4FZL A;  3PGR A;  1HXU A;  3SZD A;  3WU2 O;  4D65 A;  4CTD A;  2AXT O;  4FUV A;  2KZ7 B;  2R89 A;  4RJW A;  3SZV A;  4KR8 A;  1Q9F A;  1GFM A;  3A2S X;  4UB8 O;  4N58 A;  4LSI A;  2IWV A;  3POR A;  3VE1 A;  4N74 A;  4O49 A;  4AYN A;  5B5E O;  4RL9 A;  3AA6 B;  4C69 X;  3AA1 A;  4FRX A;  3VZW X;  4C00 A;  4D64 A;  4E1T A;  2M07 A;  3PQS A;  2QTK A;  2ODJ A;  2XTQ A;  3EMN X;  4K3B A;  3SY9 A;  6PRN A;  4C4V B;  1S5L O;  3AA0 A;  4QQ1 A;  3VE2 A;  5DL5 A;  5AFU L;  2R88 A;  1BXW A;  3POQ A;  4U9C A;  3AAE B;  2R4O A;  2IWW A;  4C4V A;  3G7G A;  5G39 A;  2LHF A;  2N2L A;  4UB6 O;  4LSH A;  2POR A;  3AA1 B;  5FVN A;  2K0L A;  2ERV A;  5AFU K;  3HOL A;  3QRC A;  2Y2X A;  1PHO A;  3UU2 A;  2J4U P;  4O3W A;  1G90 A;  2FGR A;  2W80 C;  4KRA A;  3LK4 2;  4N59 A;  2KZ7 A;  4O4X A;  5KAI O;  4B61 A;  4AKR B;  3UPG A;  2XTR A;  1E54 A;  1YS5 A;  3T24 A;  3BRZ A;  2Y0L A;  2OMF A;  3BS0 A;  3PGU A;  3PRN A;  3SYB A;  4AYE C;  2XMX A;  2J1N A;  2YNK A;  4GCS A;  5GTI O;  5G38 A;  3QRA A;  3A0H O;  3AAE A;  3HWB A;  4FSO A;  4O3Y A;  4GHB A;  2GE4 A;  3C5O A;  5G3A A;  3AA7 A;  3VZT X;  2N2M A;  3DA3 A;  3AA6 A;  3PF1 A;  3NJT A;  1GFP A;  3LK4 1;  5T5F A;  1OSM A;  4PR7 A;  4FES A;  2XE5 A;  4O4U A;  1QJ9 A;  5PRN A;  4AKR A;  2X9K A;  1H6S 1;  3DWO X;  4FZN A;  4AFK A;  3POX A;  3V8U A;  2XE3 A;  3VY8 X;  2WVP A;  7PRN A;  3WI5 A;  1ZHY A;  1ZHW A;  4RLB A;  4GCQ A;  2F1V A;  1OPF A;  3PQU A;  5GV0 A;  4AKM A;  3DA4 A;  2KDY A;  4JFB A;  4KR4 A;  2F1T A;  4O3Z A;  1QJP A;  2R8A A;  4XNL A;  5B66 O;  4K3C A;  1GFQ A;  2R4L A;  1MPF A;  4RLC A;  2X27 X;  3HOE A;  4G76 A;  5GTH O;  4FZM A;  5IYU A;  2LFU A;  2Y7S A;  3AA7 B;  5D5D A;  3LK3 A;  5JDP A;  5EE2 A;  4FQE A; 
#chains in the Genus database with same CATH homology
 1ORM A;  2JMM A;  1MM4 A;  4AZL A;  3VY9 X;  2XE1 A;  2XE2 A;  2MNH A;  4G75 A;  3FYX A;  5DL7 A;  3KVD D;  4AUI A;  4O3X B;  3SY7 A;  2KXP A;  2Y0H A;  2KC0 A;  1MM5 A;  3HW9 A;  3GP6 A;  3RBH A;  4LSE A;  1IZN B;  3AAA B;  4GF4 A;  4XNK A;  4AYM C;  1HXX A;  4PUX A;  1BH3 A;  4F4B A;  2K4T A;  3T20 A;  2ZFG A;  4E1S A;  4GCP A;  5ADX K;  2XG6 A;  3AAA A;  2FGQ X;  3O0E A;  3VZU X;  2W81 C;  4AYI D;  4Z3T A;  8PRN A;  3POU A;  5G26 A;  1ZHZ A;  1IZN A;  5DL8 A;  2KXP B;  4LSF A;  2M06 A;  2Y0K A;  3NSG A;  3AA0 B;  1Q9G A;  2O4V A;  4BUM X;  1THQ A;  1GFO A;  4FRT A;  3SYS A;  4FT6 A;  1P4T A;  4D5U A;  5ADX L;  4JCH A;  2ZLD A;  3LK2 B;  4FSP A;  3JTY A;  5DL6 A;  3UAQ A;  4FOZ A;  1BT9 A;  1ZHX A;  2YPV A;  1GFN A;  4FMS A;  3WI4 A;  3TZG A;  3LK2 A;  3LK3 B;  1ZHT A;  4AYD C;  3T0S A;  4RJX A;  1PRN A;  1QJ8 A;  3K19 A;  1HXT A;  2MHL A;  2PRN A;  4FZL A;  1HXU A;  3SZD A;  4D65 A;  4FUV A;  4RJW A;  2KZ7 B;  3SZV A;  4KR8 A;  1Q9F A;  1GFM A;  3A2S X;  4N58 A;  4LSI A;  4AYN A;  3POR A;  3VE1 A;  4O49 A;  4RL9 A;  3AA6 B;  4C69 X;  3AA1 A;  4FRX A;  3VZW X;  4D64 A;  4E1T A;  2M07 A;  3PQS A;  2XTQ A;  2QTK A;  2ODJ A;  3EMN X;  3SY9 A;  6PRN A;  3AA0 A;  4QQ1 A;  3VE2 A;  5DL5 A;  5AFU L;  3POQ A;  1BXW A;  4U9C A;  3AAE B;  3G7G A;  2LHF A;  2N2L A;  4LSH A;  2POR A;  3AA1 B;  5FVN A;  2K0L A;  2ERV A;  5AFU K;  3HOL A;  3QRC A;  2Y2X A;  1PHO A;  3UU2 A;  2J4U P;  4O3W A;  1G90 A;  2FGR A;  2W80 C;  4KRA A;  3LK4 2;  4N59 A;  2KZ7 A;  4O4X A;  4B61 A;  4AKR B;  3UPG A;  2XTR A;  1E54 A;  1YS5 A;  3T24 A;  2Y0L A;  2OMF A;  3PRN A;  3SYB A;  4AYE C;  2XMX A;  2YNK A;  2J1N A;  4GCS A;  3QRA A;  3AAE A;  3HWB A;  4FSO A;  4O3Y A;  4GHB A;  2GE4 A;  3C5O A;  3VZT X;  3AA7 A;  2N2M A;  3DA3 A;  3AA6 A;  1GFP A;  3LK4 1;  5T5F A;  1OSM A;  4FES A;  2XE5 A;  4O4U A;  1QJ9 A;  5PRN A;  4AKR A;  1H6S 1;  4FZN A;  4AFK A;  3POX A;  3V8U A;  2XE3 A;  3VY8 X;  7PRN A;  3WI5 A;  1ZHY A;  1ZHW A;  4RLB A;  4GCQ A;  2F1V A;  1OPF A;  3PQU A;  5GV0 A;  4AKM A;  3DA4 A;  2KDY A;  4JFB A;  4KR4 A;  2F1T A;  4O3Z A;  1QJP A;  4XNL A;  1GFQ A;  1MPF A;  4RLC A;  2X27 X;  3HOE A;  4G76 A;  4FZM A;  5IYU A;  2LFU A;  2Y7S A;  3AA7 B;  5D5D A;  3LK3 A;  5JDP A;  5EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...