2QTKA

Crystal structure of the outer membrane protein opdk from pseudomonas aeruginosa
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
387
structure length
371
Chain Sequence
GFLEDAKTDLVLRNYYFNRDFKSLVDEWAQGFILKFSSGYTPGTVGVGLDAIGLFGVKLNNSELLPLHAADNYGRVGVAAKLRVSASELKIGEMLPDIPLLRYDDGRLLPQTFRGFAVVSRELPGLALQAGRFDAVSLRNSADMQDLSAWSAPTQKSDGFNYAGAEYRFNRERTQLGLWHGQLEDVYRQSYANLLHKQRVGDWTLGANLGLFVDRDDGAARAGEIDSHTVYGLFSAGIGLHTFYLGLQKVGGDSGWQSVYGSSGRSMGNDMFNGNFTNADERSWQVRYDYDFVGLGWPGLIGMVRYGHGSNATTKAGSGGKEWERDVELGYTVQSGPLARLNVRLNHASNRRSFNSDFDQTRLVVSYPLSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable porin
publication title Crystal Structure of the Outer Membrane Protein OpdK from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 97
structure length 371
sequence length 387
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2qtkA01
3PORA 4BUMX 2Y0LA 2J1NA 1HXTA 2ZLDA 3HW9A 4FMSA 2ODJA 1HXXA 3T0SA 2Y0HA 1HXUA 3K19A 4GCQA 4D64A 1GFQA 4LSFA 4JFBA 4AUIA 1GFMA 3T24A 2O4VA 3POQA 3WI5A 5PRNA 4KR4A 1PHOA 3O0EA 2ZFGA 8PRNA 2Y0KA 1H6S1 5DL7A 3UPGA 3SYBA 3JTYA 4FSOA 2FGQX 4LSHA 2XG6A 4LSIA 3SY7A 3EMNX 1OPFA 3SYSA 3A2SX 3SZVA 2PORA 5DL5A 3VY9X 2XE2A 4GCPA 4FOZA 4FRTA 4LSEA 3PRNA 1E54A 4FRXA 4GCSA 4KR8A 3POXA 2J4UP 3SZDA 1BT9A 2XE3A 3POUA 1GFNA 4FSPA 2Y2XA 5JDPA 3NSGA 2OMFA 2PRNA 3WI4A 1GFPA 4RJWA 5FVNA 4D65A 5DL6A 5DL8A 4FT6A 2K4TA 3UU2A 2XE5A 2XE1A 3VZUX 1MPFA 2QTKA 3VY8X 3VZWX 6PRNA 4C69X 3FYXA 4KRAA 4RJXA 1GFOA 3HWBA 7PRNA 1OSMA 1PRNA 3T20A 3VZTX 1BH3A 4D5UA 2FGRA 3SY9A
chains in the Genus database with same CATH superfamily
3RBHA 2WJQA 3DA4A 3PORA 4RLBA 4BUMX 2Y0LA 2J1NA 1HXTA 1P4TA 1ZHZA 3LK2A 2ZLDA 2X27X 3PF1A 4GF4A 3HW9A 4N75A 2F1VA 4U9CA 3DWOX 2M07A 1HXXA 2ODJA 4FMSA 3HOLA 5KAIO 4FZMA 2Y0HA 2WVPA 1HXUA 3K19A 4FQEA 2MNHA 4GCQA 5GTHO 2AXTO 2XTRA 1GFQA 4LSFA 2IWVA 4JFBA 5GTIO 5TISO 4O4XA 1GFMA 4AUIA 3T24A 2O4VA 2ERVA 5E79O 2X9KA 3DA3A 4IL6O 3POQA 4PUXA 2R4PA 3WI5A 2Y7SA 5PRNA 3LK41 4F4BA 1MM5A 1PHOA 4KR4A 5G38A 3O0EA 2ZFGA 2KC0A 4FZNA 4JCHA 2GE4A 8PRNA 2Y0KA 1H6S1 4XNLA 5DL7A 3SY9A 3UPGA 3SYBA 2R4LA 5AFUL 3AA0B 3JTYA 1ORMA 3PGRA 4FSOA 3NJTA 2FGQX 2YNKA 2W81C 4LSHA 4AYID 5B66O 2XG6A 4LSIA 3SY7A 3EMNX 1OPFA 4RL9A 4UB8O 2N2MA 3SYSA 3T0SA 3BRYA 3BRZA 2F1TA 3A2SX 5EE2A 4AFKA 2JMMA 3LK42 3SZVA 4B61A 2PORA 5AFUK 3KVDD 5DL5A 1ZHYA 3VY9X 3AA1B 2XE2A 4GCPA 2R8AA 2KZ7B 3JCUO 3AA0A 2WJRA 1BXWA 4FOZA 4O3WA 5IYUA 3AAAB 3AAEB 5D5DA 1ZHTA 4CTDA 4FRTA 4K3BA 3UAQA 4PR7A 4XNKA 4Z3TA 4UB6O 3AA6A 2XTQA 1IZNB 4G75A 4LSEA 4AYMC 1QJ9A 3PRNA 4PJ0O 1E54A 4G76A 4C4VB 4N59A 3AA1A 2M06A 1S5LO 2R4NA 2KZ7A 4FRXA 2LHFA 1MM4A 3C5OA 4GCSA 4KR8A 5G39A 5KAFO 4N58A 3AAAA 3AAEA 3POXA 2R4OA 5G26A 1ZHXA 4GHBA 4AYEC 2KDYA 2JQYA 2R88A 2J4UP 3A0BO 3PQUA 3A0HO 3SZDA 2N2LA 4D64A 5ADXL 1IZNA 3AA6B 3PGSA 1BT9A 1QJPA 3HOEA 2XE3A 3POUA 4C4VA 3QRAA 4O49A 1GFNA 4K3CA 5T5FA 5B5EO 1G90A 4O4UA 4FSPA 2Y2XA 5JDPA 1T16A 3DZMA 3NSGA 1THQA 4N74A 2OMFA 3KZIO 2PRNA 3V8UA 5ADXK 2KXPB 3WU2O 3WI4A 3LK3B 1GFPA 4RJWA 4C00A 1Q9FA 3PGUA 3BS0A 4O3YA 3DWNA 3AA7A 1ZHWA 5FVNA 2W80C 4AKRB 4E1SA 4D65A 1YS5A 2LFUA 2R89A 5DL6A 5H2FO 3VE1A 3GP6A 3TZGA 5DL8A 4FT6A 3VE2A 5G3AA 2K4TA 4E1TA 3G7GA 3PQSA 2XE5A 2XE1A 3QRCA 3UU2A 4O3XB 3VZUX 4AYDC 1MPFA 2KXPA 3LK3A 2QTKA 4QQ1A 4O3ZA 3VY8X 2XMXA 4RLCA 5GV0A 3VZWX 6PRNA 3AA7B 4FESA 4C69X 4AKRA 4AYNA 3FYXA 4KRAA 4RJXA 1GFOA 3HWBA 7PRNA 2F1CX 1OSMA 3LK2B 4AKMA 1QJ8A 1PRNA 4AZLA 3T20A 1T1LA 2K0LA 1Q9GA 2YPVA 1BH3A 3VZTX 2MHLA 2FGRA 4D5UA 4FUVA 2IWWA 4FZLA
chains in the Genus database with same CATH topology
3RBHA 3DA4A 3PORA 4RLBA 4BUMX 2Y0LA 2J1NA 1HXTA 1P4TA 1ZHZA 3LK2A 2ZLDA 2X27X 4GF4A 3HW9A 2F1VA 4U9CA 4FMSA 2M07A 1HXXA 2ODJA 3T0SA 3HOLA 4FZMA 2Y0HA 1HXUA 3K19A 4GCQA 2MNHA 2XTRA 4D64A 1GFQA 4LSFA 4JFBA 4AUIA 4O4XA 1GFMA 3T24A 2O4VA 2ERVA 3DA3A 4PUXA 3POQA 3WI5A 2Y7SA 5PRNA 3LK41 4F4BA 1MM5A 1PHOA 4KR4A 3O0EA 2ZFGA 2KC0A 4FZNA 4JCHA 2GE4A 8PRNA 2Y0KA 1H6S1 4XNLA 5DL7A 3SY9A 3UPGA 3SYBA 5AFUL 3AA0B 3JTYA 1ORMA 4FSOA 2FGQX 2YNKA 2W81C 4LSHA 4AYID 2XG6A 4LSIA 3SY7A 3EMNX 1OPFA 4RL9A 2N2MA 3SYSA 2F1TA 3A2SX 5EE2A 4AFKA 2JMMA 3LK42 3SZVA 4B61A 2PORA 5AFUK 3KVDD 5DL5A 1ZHYA 3VY9X 3AA1B 2XE2A 4GCPA 2KZ7B 3AA0A 4FOZA 1BXWA 4O3WA 5IYUA 3AAAB 3AAEB 5D5DA 1ZHTA 4FRTA 3UAQA 4XNKA 4Z3TA 3AA6A 2XTQA 1IZNB 4G75A 4LSEA 4AYMC 1QJ9A 3PRNA 1E54A 4G76A 4N59A 3AA1A 2M06A 4FRXA 2KZ7A 2LHFA 1MM4A 3C5OA 4GCSA 4KR8A 4N58A 3AAAA 3AAEA 3POXA 5G26A 1ZHXA 4GHBA 4AYEC 2KDYA 2J4UP 3PQUA 3SZDA 2N2LA 5ADXL 1IZNA 3AA6B 1BT9A 1QJPA 3HOEA 2XE3A 3POUA 3QRAA 4O49A 1GFNA 5T5FA 1G90A 4O4UA 4FSPA 2Y2XA 5JDPA 3NSGA 1THQA 2OMFA 3V8UA 2PRNA 5ADXK 2KXPB 3WI4A 3LK3B 1GFPA 4RJWA 1Q9FA 4O3YA 3AA7A 1ZHWA 5FVNA 2W80C 4AKRB 4E1SA 4D65A 1YS5A 2LFUA 5DL6A 3VE1A 3GP6A 3TZGA 5DL8A 4FT6A 3VE2A 4E1TA 2K4TA 3G7GA 3PQSA 2XE5A 2XE1A 3QRCA 3UU2A 4O3XB 3VZUX 4AYDC 1MPFA 2KXPA 3LK3A 2QTKA 4QQ1A 4O3ZA 3VY8X 2XMXA 4RLCA 5GV0A 3VZWX 6PRNA 3AA7B 4FESA 4C69X 4AKRA 4AYNA 3FYXA 4KRAA 4RJXA 1GFOA 3HWBA 7PRNA 1OSMA 3LK2B 4AKMA 1QJ8A 1PRNA 4AZLA 3T20A 2K0LA 1Q9GA 2YPVA 1BH3A 3VZTX 2MHLA 2FGRA 4D5UA 4FUVA 4FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POR A;  4BUM X;  2Y0L A;  2J1N A;  1HXT A;  2ZLD A;  3HW9 A;  4FMS A;  2ODJ A;  1HXX A;  3T0S A;  2Y0H A;  1HXU A;  3K19 A;  4GCQ A;  4D64 A;  1GFQ A;  4LSF A;  4JFB A;  4AUI A;  1GFM A;  3T24 A;  2O4V A;  3POQ A;  3WI5 A;  5PRN A;  4KR4 A;  1PHO A;  3O0E A;  2ZFG A;  8PRN A;  2Y0K A;  1H6S 1;  5DL7 A;  3UPG A;  3SYB A;  3JTY A;  4FSO A;  2FGQ X;  4LSH A;  2XG6 A;  4LSI A;  3SY7 A;  3EMN X;  1OPF A;  3SYS A;  3A2S X;  3SZV A;  2POR A;  5DL5 A;  3VY9 X;  2XE2 A;  4GCP A;  4FOZ A;  4FRT A;  4LSE A;  3PRN A;  1E54 A;  4FRX A;  4GCS A;  4KR8 A;  3POX A;  2J4U P;  3SZD A;  1BT9 A;  2XE3 A;  3POU A;  1GFN A;  4FSP A;  2Y2X A;  5JDP A;  3NSG A;  2OMF A;  2PRN A;  3WI4 A;  1GFP A;  4RJW A;  5FVN A;  4D65 A;  5DL6 A;  5DL8 A;  4FT6 A;  2K4T A;  3UU2 A;  2XE5 A;  2XE1 A;  3VZU X;  1MPF A;  2QTK A;  3VY8 X;  3VZW X;  6PRN A;  4C69 X;  3FYX A;  4KRA A;  4RJX A;  1GFO A;  3HWB A;  7PRN A;  1OSM A;  1PRN A;  3T20 A;  3VZT X;  1BH3 A;  4D5U A;  2FGR A;  3SY9 A; 
#chains in the Genus database with same CATH topology
 3RBH A;  2WJQ A;  3DA4 A;  3POR A;  4RLB A;  4BUM X;  2Y0L A;  2J1N A;  1HXT A;  1P4T A;  1ZHZ A;  3LK2 A;  2ZLD A;  2X27 X;  3PF1 A;  4GF4 A;  3HW9 A;  4N75 A;  2F1V A;  4U9C A;  3DWO X;  2M07 A;  1HXX A;  2ODJ A;  4FMS A;  3HOL A;  5KAI O;  4FZM A;  2Y0H A;  2WVP A;  1HXU A;  3K19 A;  4FQE A;  2MNH A;  4GCQ A;  5GTH O;  2AXT O;  2XTR A;  1GFQ A;  4LSF A;  2IWV A;  4JFB A;  5GTI O;  5TIS O;  4O4X A;  1GFM A;  4AUI A;  3T24 A;  2O4V A;  2ERV A;  5E79 O;  2X9K A;  3DA3 A;  4IL6 O;  3POQ A;  4PUX A;  2R4P A;  3WI5 A;  2Y7S A;  5PRN A;  3LK4 1;  4F4B A;  1MM5 A;  1PHO A;  4KR4 A;  5G38 A;  3O0E A;  2ZFG A;  2KC0 A;  4FZN A;  4JCH A;  2GE4 A;  8PRN A;  2Y0K A;  1H6S 1;  4XNL A;  5DL7 A;  3SY9 A;  3UPG A;  3SYB A;  2R4L A;  5AFU L;  3AA0 B;  3JTY A;  1ORM A;  3PGR A;  4FSO A;  3NJT A;  2FGQ X;  2YNK A;  2W81 C;  4LSH A;  4AYI D;  5B66 O;  2XG6 A;  4LSI A;  3SY7 A;  3EMN X;  1OPF A;  4RL9 A;  4UB8 O;  2N2M A;  3SYS A;  3T0S A;  3BRY A;  3BRZ A;  2F1T A;  3A2S X;  5EE2 A;  4AFK A;  2JMM A;  3LK4 2;  3SZV A;  4B61 A;  2POR A;  5AFU K;  3KVD D;  5DL5 A;  1ZHY A;  3VY9 X;  3AA1 B;  2XE2 A;  4GCP A;  2R8A A;  2KZ7 B;  3JCU O;  3AA0 A;  2WJR A;  1BXW A;  4FOZ A;  4O3W A;  5IYU A;  3AAA B;  3AAE B;  5D5D A;  1ZHT A;  4CTD A;  4FRT A;  4K3B A;  3UAQ A;  4PR7 A;  4XNK A;  4Z3T A;  4UB6 O;  3AA6 A;  2XTQ A;  1IZN B;  4G75 A;  4LSE A;  4AYM C;  1QJ9 A;  3PRN A;  4PJ0 O;  1E54 A;  4G76 A;  4C4V B;  4N59 A;  3AA1 A;  2M06 A;  1S5L O;  2R4N A;  2KZ7 A;  4FRX A;  2LHF A;  1MM4 A;  3C5O A;  4GCS A;  4KR8 A;  5G39 A;  5KAF O;  4N58 A;  3AAA A;  3AAE A;  3POX A;  2R4O A;  5G26 A;  1ZHX A;  4GHB A;  4AYE C;  2KDY A;  2JQY A;  2R88 A;  2J4U P;  3A0B O;  3PQU A;  3A0H O;  3SZD A;  2N2L A;  4D64 A;  5ADX L;  1IZN A;  3AA6 B;  3PGS A;  1BT9 A;  1QJP A;  3HOE A;  2XE3 A;  3POU A;  4C4V A;  3QRA A;  4O49 A;  1GFN A;  4K3C A;  5T5F A;  5B5E O;  1G90 A;  4O4U A;  4FSP A;  2Y2X A;  5JDP A;  1T16 A;  3DZM A;  3NSG A;  1THQ A;  4N74 A;  2OMF A;  3KZI O;  2PRN A;  3V8U A;  5ADX K;  2KXP B;  3WU2 O;  3WI4 A;  3LK3 B;  1GFP A;  4RJW A;  4C00 A;  1Q9F A;  3PGU A;  3BS0 A;  4O3Y A;  3DWN A;  3AA7 A;  1ZHW A;  5FVN A;  2W80 C;  4AKR B;  4E1S A;  4D65 A;  1YS5 A;  2LFU A;  2R89 A;  5DL6 A;  5H2F O;  3VE1 A;  3GP6 A;  3TZG A;  5DL8 A;  4FT6 A;  3VE2 A;  5G3A A;  2K4T A;  4E1T A;  3G7G A;  3PQS A;  2XE5 A;  2XE1 A;  3QRC A;  3UU2 A;  4O3X B;  3VZU X;  4AYD C;  1MPF A;  2KXP A;  3LK3 A;  2QTK A;  4QQ1 A;  4O3Z A;  3VY8 X;  2XMX A;  4RLC A;  5GV0 A;  3VZW X;  6PRN A;  3AA7 B;  4FES A;  4C69 X;  4AKR A;  4AYN A;  3FYX A;  4KRA A;  4RJX A;  1GFO A;  3HWB A;  7PRN A;  2F1C X;  1OSM A;  3LK2 B;  4AKM A;  1QJ8 A;  1PRN A;  4AZL A;  3T20 A;  1T1L A;  2K0L A;  1Q9G A;  2YPV A;  1BH3 A;  3VZT X;  2MHL A;  2FGR A;  4D5U A;  4FUV A;  2IWW A;  4FZL A; 
#chains in the Genus database with same CATH homology
 3RBH A;  3DA4 A;  3POR A;  4RLB A;  4BUM X;  2Y0L A;  2J1N A;  1HXT A;  1P4T A;  1ZHZ A;  3LK2 A;  2ZLD A;  2X27 X;  4GF4 A;  3HW9 A;  2F1V A;  4U9C A;  4FMS A;  2M07 A;  1HXX A;  2ODJ A;  3T0S A;  3HOL A;  4FZM A;  2Y0H A;  1HXU A;  3K19 A;  4GCQ A;  2MNH A;  2XTR A;  4D64 A;  1GFQ A;  4LSF A;  4JFB A;  4AUI A;  4O4X A;  1GFM A;  3T24 A;  2O4V A;  2ERV A;  3DA3 A;  4PUX A;  3POQ A;  3WI5 A;  2Y7S A;  5PRN A;  3LK4 1;  4F4B A;  1MM5 A;  1PHO A;  4KR4 A;  3O0E A;  2ZFG A;  2KC0 A;  4FZN A;  4JCH A;  2GE4 A;  8PRN A;  2Y0K A;  1H6S 1;  4XNL A;  5DL7 A;  3SY9 A;  3UPG A;  3SYB A;  5AFU L;  3AA0 B;  3JTY A;  1ORM A;  4FSO A;  2FGQ X;  2YNK A;  2W81 C;  4LSH A;  4AYI D;  2XG6 A;  4LSI A;  3SY7 A;  3EMN X;  1OPF A;  4RL9 A;  2N2M A;  3SYS A;  2F1T A;  3A2S X;  5EE2 A;  4AFK A;  2JMM A;  3LK4 2;  3SZV A;  4B61 A;  2POR A;  5AFU K;  3KVD D;  5DL5 A;  1ZHY A;  3VY9 X;  3AA1 B;  2XE2 A;  4GCP A;  2KZ7 B;  3AA0 A;  4FOZ A;  1BXW A;  4O3W A;  5IYU A;  3AAA B;  3AAE B;  5D5D A;  1ZHT A;  4FRT A;  3UAQ A;  4XNK A;  4Z3T A;  3AA6 A;  2XTQ A;  1IZN B;  4G75 A;  4LSE A;  4AYM C;  1QJ9 A;  3PRN A;  1E54 A;  4G76 A;  4N59 A;  3AA1 A;  2M06 A;  4FRX A;  2KZ7 A;  2LHF A;  1MM4 A;  3C5O A;  4GCS A;  4KR8 A;  4N58 A;  3AAA A;  3AAE A;  3POX A;  5G26 A;  1ZHX A;  4GHB A;  4AYE C;  2KDY A;  2J4U P;  3PQU A;  3SZD A;  2N2L A;  5ADX L;  1IZN A;  3AA6 B;  1BT9 A;  1QJP A;  3HOE A;  2XE3 A;  3POU A;  3QRA A;  4O49 A;  1GFN A;  5T5F A;  1G90 A;  4O4U A;  4FSP A;  2Y2X A;  5JDP A;  3NSG A;  1THQ A;  2OMF A;  3V8U A;  2PRN A;  5ADX K;  2KXP B;  3WI4 A;  3LK3 B;  1GFP A;  4RJW A;  1Q9F A;  4O3Y A;  3AA7 A;  1ZHW A;  5FVN A;  2W80 C;  4AKR B;  4E1S A;  4D65 A;  1YS5 A;  2LFU A;  5DL6 A;  3VE1 A;  3GP6 A;  3TZG A;  5DL8 A;  4FT6 A;  3VE2 A;  4E1T A;  2K4T A;  3G7G A;  3PQS A;  2XE5 A;  2XE1 A;  3QRC A;  3UU2 A;  4O3X B;  3VZU X;  4AYD C;  1MPF A;  2KXP A;  3LK3 A;  2QTK A;  4QQ1 A;  4O3Z A;  3VY8 X;  2XMX A;  4RLC A;  5GV0 A;  3VZW X;  6PRN A;  3AA7 B;  4FES A;  4C69 X;  4AKR A;  4AYN A;  3FYX A;  4KRA A;  4RJX A;  1GFO A;  3HWB A;  7PRN A;  1OSM A;  3LK2 B;  4AKM A;  1QJ8 A;  1PRN A;  4AZL A;  3T20 A;  2K0L A;  1Q9G A;  2YPV A;  1BH3 A;  3VZT X;  2MHL A;  2FGR A;  4D5U A;  4FUV A;  4FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...