3T24A

Crystal structure of pseudomonas aeruginosa opdq
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
396
structure length
377
Chain Sequence
b'QSEFIKDSKASIELRNFYFNRDFRQEGASQSKAEEWAQGFLLRYESGYTEGTIGFGVDAIGLLGVKLDSQDDYGEAGITAKLRASKSTLKIGTLTPKLPVIMPNDSRLLPQTFQGGALNSMEIDGLTLDAGRLKKVNQRDSSDNEDMTITGGGKRQIVVRSGLTSDKFDFAGGSYKWTDNLSTSYHYGKLDNFYKQHYLGLVHTLPIADKQSLKSDIRWARSTDDGSSNVDNKALNAMFTYSLGYHAFGVGYQKMSGDTGFAYINGADPYLVNFIQIGDFANKDEKSWQARYDYNFAGVGIPGLTFMTRYVKGDNIDLLTTSGEGKEWERDMDIAYVFQSGPLKNLGVKWRNATMRTNYTNDYDENRLIVSYTLPLW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porin
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 100
structure length 377
sequence length 396
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t24A01
1GFOA 3VZUX 3PRNA 2XG6A 1OSMA 2ZFGA 3UU2A 4LSFA 3PORA 3SY9A 4GCSA 1GFNA 3POXA 4LSEA 5PRNA 3EMNX 3SYSA 7PRNA 2J1NA 4GCPA 3A2SX 1E54A 4KRAA 1BT9A 2ODJA 8PRNA 3K19A 1HXTA 4D5UA 2PRNA 4KR4A 4FRXA 3POQA 4FMSA 4AUIA 2XE1A 1GFQA 3NSGA 1BH3A 4FOZA 3SZDA 3WI4A 4RJXA 4FT6A 3T24A 5DL5A 2XE5A 1GFMA 1H6S1 1MPFA 1PHOA 2OMFA 2QTKA 2ZLDA 3SYBA 2K4TA 1PRNA 2Y2XA 1HXUA 2PORA 2FGRA 3WI5A 1HXXA 2XE3A 3FYXA 3VZTX 1GFPA 5DL8A 3O0EA 3VY8X 4D64A 4C69X 2Y0LA 2J4UP 3SZVA 4FRTA 5FVNA 4D65A 3VY9X 4LSHA 3UPGA 3T0SA 4RJWA 2O4VA 3VZWX 2FGQX 4FSPA 4JFBA 3HWBA 4BUMX 1OPFA 2XE2A 3HW9A 3SY7A 3JTYA 6PRNA 5JDPA 4KR8A 5DL6A 5DL7A 3POUA 2Y0KA 4LSIA 2Y0HA 4FSOA 4GCQA 3T20A
chains in the Genus database with same CATH superfamily
3LK42 2KC0A 3PF1A 1GFOA 4N74A 3VZUX 3PRNA 2XG6A 3SZDA 1OSMA 1MM5A 1IZNA 2ZFGA 3UU2A 3VE2A 3AA7A 4LSFA 3PORA 3SY9A 5D5DA 3BS0A 2R88A 4GCSA 5IYUA 5EE2A 4QQ1A 1GFNA 3POXA 2JMMA 3DWOX 4LSEA 5PRNA 3EMNX 3SYSA 7PRNA 2IWWA 2J1NA 4GCPA 4O3ZA 4AFKA 2R89A 2M07A 1E54A 3A2SX 3HOLA 4CTDA 3QRAA 2GE4A 1ZHWA 4KRAA 4AYNA 3KZIO 1BT9A 3GP6A 4JCHA 4XNKA 2XMXA 5KAIO 5B66O 2ODJA 8PRNA 3AAEB 4N75A 5ADXL 5ADXK 3K19A 2R4LA 2KDYA 3BRYA 2R4PA 3PGRA 3PQUA 4O3WA 4Z3TA 3PGUA 4AKMA 2X27X 2ERVA 4IL6O 4UB8O 3NJTA 5TISO 4AYMC 4E1SA 4N58A 3PGSA 1HXTA 4D5UA 2F1CX 2PRNA 4KR4A 1BXWA 4FRXA 4E1TA 2W80C 3LK2B 4O4UA 3POQA 4FMSA 4U9CA 2XE1A 4AKRB 4AUIA 2K0LA 1GFQA 3PQSA 4GF4A 3AA6B 5H2FO 3WI4A 1QJ8A 5G3AA 3NSGA 1BH3A 4FOZA 4XNLA 2KXPA 3DA3A 2X9KA 4FZLA 3AA1B 3AA0A 4FT6A 4RJXA 3RBHA 4C4VA 3T24A 3DA4A 4GHBA 1QJPA 2R4OA 3G7GA 2W81C 3A0BO 4PJ0O 5DL5A 2XE5A 4O49A 4RL9A 2LFUA 3LK3B 1G90A 1T1LA 2M06A 1YS5A 2R4NA 1GFMA 1H6S1 3AAAB 3AAEA 3HOEA 1MPFA 1Q9FA 2YNKA 1T16A 3BRZA 4K3CA 4FZMA 5B5EO 1PHOA 1THQA 1QJ9A 2OMFA 3AA7B 2QTKA 5GTHO 2WVPA 3A0HO 4F4BA 4FQEA 2ZLDA 4UB6O 5KAFO 2WJQA 3SYBA 2K4TA 4G76A 3LK2A 3VE1A 1MM4A 5G26A 1PRNA 2Y2XA 5G39A 1HXUA 2PORA 2FGRA 4N59A 1HXXA 5E79O 3WI5A 3DWNA 2XE3A 3FYXA 3VZTX 1GFPA 1ZHZA 4O3XB 5DL8A 3O0EA 3VY8X 4PR7A 4D64A 4C69X 5GV0A 2XTRA 1ZHXA 2N2LA 4O4XA 2Y0LA 2WJRA 1S5LO 2J4UP 3SZVA 3LK41 3C5OA 4FRTA 5FVNA 5GTIO 5T5FA 4O3YA 4D65A 3VY9X 4LSHA 3UPGA 3T0SA 4RJWA 2R8AA 2N2MA 2O4VA 2MNHA 2KZ7B 4FESA 3VZWX 2FGQX 4FSPA 2AXTO 4PUXA 2F1VA 4FUVA 5G38A 4K3BA 4JFBA 3V8UA 3HWBA 2XTQA 4AYDC 4BUMX 1OPFA 2JQYA 2XE2A 1P4TA 3HW9A 4AZLA 1IZNB 1Q9GA 4AKRA 2LHFA 3SY7A 3JTYA 4C00A 3AA6A 3QRCA 6PRNA 3WU2O 5JDPA 4KR8A 4FZNA 3UAQA 1ZHYA 5DL6A 4AYEC 3AA1A 5DL7A 2IWVA 2KXPB 3DZMA 4B61A 2MHLA 3AA0B 4C4VB 5AFUL 5AFUK 3KVDD 3JCUO 3POUA 3LK3A 2Y0KA 2F1TA 4RLBA 4AYID 3AAAA 4LSIA 2Y7SA 2Y0HA 3TZGA 1ORMA 1ZHTA 4FSOA 4GCQA 4G75A 2YPVA 2KZ7A 3T20A 4RLCA
chains in the Genus database with same CATH topology
3LK42 2KC0A 1GFOA 3VZUX 3PRNA 2XG6A 3SZDA 1OSMA 1MM5A 1IZNA 2ZFGA 3UU2A 3VE2A 3AA7A 4LSFA 3PORA 3SY9A 5D5DA 4GCSA 5IYUA 5EE2A 4QQ1A 1GFNA 3POXA 2JMMA 4LSEA 5PRNA 3EMNX 3SYSA 7PRNA 2J1NA 4GCPA 4O3ZA 4AFKA 2M07A 1E54A 3A2SX 3HOLA 3QRAA 2GE4A 1ZHWA 4KRAA 4AYNA 4JCHA 1BT9A 3GP6A 4XNKA 2XMXA 2ODJA 8PRNA 3AAEB 5ADXL 5ADXK 3K19A 2KDYA 3PQUA 4O3WA 4Z3TA 4AKMA 2X27X 2ERVA 4AYMC 4E1SA 4N58A 1HXTA 4D5UA 2PRNA 4KR4A 1BXWA 4FRXA 4E1TA 2W80C 3LK2B 4O4UA 3POQA 4FMSA 4U9CA 2XE1A 4AKRB 4AUIA 2K0LA 1GFQA 3PQSA 4GF4A 3AA6B 3WI4A 1QJ8A 3NSGA 1BH3A 4FOZA 4XNLA 2KXPA 3DA3A 4FZLA 4RJXA 3AA1B 3AA0A 4FT6A 3RBHA 3T24A 3DA4A 4GHBA 1QJPA 3G7GA 5DL5A 2W81C 2XE5A 4O49A 4RL9A 2LFUA 3LK3B 1G90A 2M06A 1YS5A 3AAAB 1GFMA 1H6S1 3AAEA 3HOEA 1MPFA 1Q9FA 2YNKA 4FZMA 1PHOA 1THQA 1QJ9A 2OMFA 3AA7B 2QTKA 4F4BA 2ZLDA 3SYBA 3VE1A 2K4TA 4G76A 3LK2A 1MM4A 5G26A 1PRNA 2Y2XA 1HXUA 2PORA 2FGRA 4N59A 1HXXA 3WI5A 2XE3A 3FYXA 3VZTX 1GFPA 1ZHZA 4O3XB 5DL8A 3O0EA 3VY8X 4D64A 5GV0A 4C69X 2XTRA 1ZHXA 2N2LA 4O4XA 2Y0LA 2J4UP 3SZVA 3LK41 3C5OA 4FRTA 5FVNA 4D65A 5T5FA 4O3YA 3VY9X 4LSHA 3UPGA 3T0SA 4RJWA 2N2MA 2O4VA 2MNHA 2KZ7B 4FESA 3VZWX 2FGQX 4FSPA 4PUXA 2F1VA 4FUVA 4AYDC 3V8UA 4JFBA 3HWBA 2XTQA 4BUMX 1OPFA 2XE2A 1P4TA 3HW9A 4AZLA 1IZNB 1Q9GA 4AKRA 2LHFA 3SY7A 3JTYA 3AA6A 3QRCA 6PRNA 5JDPA 4KR8A 4FZNA 3UAQA 1ZHYA 5DL6A 4AYEC 3AA1A 5DL7A 2KXPB 4B61A 2MHLA 3AA0B 5AFUL 5AFUK 3KVDD 3POUA 3LK3A 2Y0KA 2F1TA 4RLBA 4AYID 3AAAA 4LSIA 2Y7SA 2Y0HA 3TZGA 1ORMA 1ZHTA 4FSOA 4GCQA 4G75A 2YPVA 2KZ7A 3T20A 4RLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFO A;  3VZU X;  3PRN A;  2XG6 A;  1OSM A;  2ZFG A;  3UU2 A;  4LSF A;  3POR A;  3SY9 A;  4GCS A;  1GFN A;  3POX A;  4LSE A;  5PRN A;  3EMN X;  3SYS A;  7PRN A;  2J1N A;  4GCP A;  3A2S X;  1E54 A;  4KRA A;  1BT9 A;  2ODJ A;  8PRN A;  3K19 A;  1HXT A;  4D5U A;  2PRN A;  4KR4 A;  4FRX A;  3POQ A;  4FMS A;  4AUI A;  2XE1 A;  1GFQ A;  3NSG A;  1BH3 A;  4FOZ A;  3SZD A;  3WI4 A;  4RJX A;  4FT6 A;  3T24 A;  5DL5 A;  2XE5 A;  1GFM A;  1H6S 1;  1MPF A;  1PHO A;  2OMF A;  2QTK A;  2ZLD A;  3SYB A;  2K4T A;  1PRN A;  2Y2X A;  1HXU A;  2POR A;  2FGR A;  3WI5 A;  1HXX A;  2XE3 A;  3FYX A;  3VZT X;  1GFP A;  5DL8 A;  3O0E A;  3VY8 X;  4D64 A;  4C69 X;  2Y0L A;  2J4U P;  3SZV A;  4FRT A;  5FVN A;  4D65 A;  3VY9 X;  4LSH A;  3UPG A;  3T0S A;  4RJW A;  2O4V A;  3VZW X;  2FGQ X;  4FSP A;  4JFB A;  3HWB A;  4BUM X;  1OPF A;  2XE2 A;  3HW9 A;  3SY7 A;  3JTY A;  6PRN A;  5JDP A;  4KR8 A;  5DL6 A;  5DL7 A;  3POU A;  2Y0K A;  4LSI A;  2Y0H A;  4FSO A;  4GCQ A;  3T20 A; 
#chains in the Genus database with same CATH topology
 3LK4 2;  2KC0 A;  3PF1 A;  1GFO A;  4N74 A;  3VZU X;  3PRN A;  2XG6 A;  3SZD A;  1OSM A;  1MM5 A;  1IZN A;  2ZFG A;  3UU2 A;  3VE2 A;  3AA7 A;  4LSF A;  3POR A;  3SY9 A;  5D5D A;  3BS0 A;  2R88 A;  4GCS A;  5IYU A;  5EE2 A;  4QQ1 A;  1GFN A;  3POX A;  2JMM A;  3DWO X;  4LSE A;  5PRN A;  3EMN X;  3SYS A;  7PRN A;  2IWW A;  2J1N A;  4GCP A;  4O3Z A;  4AFK A;  2R89 A;  2M07 A;  1E54 A;  3A2S X;  3HOL A;  4CTD A;  3QRA A;  2GE4 A;  1ZHW A;  4KRA A;  4AYN A;  3KZI O;  1BT9 A;  3GP6 A;  4JCH A;  4XNK A;  2XMX A;  5KAI O;  5B66 O;  2ODJ A;  8PRN A;  3AAE B;  4N75 A;  5ADX L;  5ADX K;  3K19 A;  2R4L A;  2KDY A;  3BRY A;  2R4P A;  3PGR A;  3PQU A;  4O3W A;  4Z3T A;  3PGU A;  4AKM A;  2X27 X;  2ERV A;  4IL6 O;  4UB8 O;  3NJT A;  5TIS O;  4AYM C;  4E1S A;  4N58 A;  3PGS A;  1HXT A;  4D5U A;  2F1C X;  2PRN A;  4KR4 A;  1BXW A;  4FRX A;  4E1T A;  2W80 C;  3LK2 B;  4O4U A;  3POQ A;  4FMS A;  4U9C A;  2XE1 A;  4AKR B;  4AUI A;  2K0L A;  1GFQ A;  3PQS A;  4GF4 A;  3AA6 B;  5H2F O;  3WI4 A;  1QJ8 A;  5G3A A;  3NSG A;  1BH3 A;  4FOZ A;  4XNL A;  2KXP A;  3DA3 A;  2X9K A;  4FZL A;  3AA1 B;  3AA0 A;  4FT6 A;  4RJX A;  3RBH A;  4C4V A;  3T24 A;  3DA4 A;  4GHB A;  1QJP A;  2R4O A;  3G7G A;  2W81 C;  3A0B O;  4PJ0 O;  5DL5 A;  2XE5 A;  4O49 A;  4RL9 A;  2LFU A;  3LK3 B;  1G90 A;  1T1L A;  2M06 A;  1YS5 A;  2R4N A;  1GFM A;  1H6S 1;  3AAA B;  3AAE A;  3HOE A;  1MPF A;  1Q9F A;  2YNK A;  1T16 A;  3BRZ A;  4K3C A;  4FZM A;  5B5E O;  1PHO A;  1THQ A;  1QJ9 A;  2OMF A;  3AA7 B;  2QTK A;  5GTH O;  2WVP A;  3A0H O;  4F4B A;  4FQE A;  2ZLD A;  4UB6 O;  5KAF O;  2WJQ A;  3SYB A;  2K4T A;  4G76 A;  3LK2 A;  3VE1 A;  1MM4 A;  5G26 A;  1PRN A;  2Y2X A;  5G39 A;  1HXU A;  2POR A;  2FGR A;  4N59 A;  1HXX A;  5E79 O;  3WI5 A;  3DWN A;  2XE3 A;  3FYX A;  3VZT X;  1GFP A;  1ZHZ A;  4O3X B;  5DL8 A;  3O0E A;  3VY8 X;  4PR7 A;  4D64 A;  4C69 X;  5GV0 A;  2XTR A;  1ZHX A;  2N2L A;  4O4X A;  2Y0L A;  2WJR A;  1S5L O;  2J4U P;  3SZV A;  3LK4 1;  3C5O A;  4FRT A;  5FVN A;  5GTI O;  5T5F A;  4O3Y A;  4D65 A;  3VY9 X;  4LSH A;  3UPG A;  3T0S A;  4RJW A;  2R8A A;  2N2M A;  2O4V A;  2MNH A;  2KZ7 B;  4FES A;  3VZW X;  2FGQ X;  4FSP A;  2AXT O;  4PUX A;  2F1V A;  4FUV A;  5G38 A;  4K3B A;  4JFB A;  3V8U A;  3HWB A;  2XTQ A;  4AYD C;  4BUM X;  1OPF A;  2JQY A;  2XE2 A;  1P4T A;  3HW9 A;  4AZL A;  1IZN B;  1Q9G A;  4AKR A;  2LHF A;  3SY7 A;  3JTY A;  4C00 A;  3AA6 A;  3QRC A;  6PRN A;  3WU2 O;  5JDP A;  4KR8 A;  4FZN A;  3UAQ A;  1ZHY A;  5DL6 A;  4AYE C;  3AA1 A;  5DL7 A;  2IWV A;  2KXP B;  3DZM A;  4B61 A;  2MHL A;  3AA0 B;  4C4V B;  5AFU L;  5AFU K;  3KVD D;  3JCU O;  3POU A;  3LK3 A;  2Y0K A;  2F1T A;  4RLB A;  4AYI D;  3AAA A;  4LSI A;  2Y7S A;  2Y0H A;  3TZG A;  1ORM A;  1ZHT A;  4FSO A;  4GCQ A;  4G75 A;  2YPV A;  2KZ7 A;  3T20 A;  4RLC A; 
#chains in the Genus database with same CATH homology
 3LK4 2;  2KC0 A;  1GFO A;  3VZU X;  3PRN A;  2XG6 A;  3SZD A;  1OSM A;  1MM5 A;  1IZN A;  2ZFG A;  3UU2 A;  3VE2 A;  3AA7 A;  4LSF A;  3POR A;  3SY9 A;  5D5D A;  4GCS A;  5IYU A;  5EE2 A;  4QQ1 A;  1GFN A;  3POX A;  2JMM A;  4LSE A;  5PRN A;  3EMN X;  3SYS A;  7PRN A;  2J1N A;  4GCP A;  4O3Z A;  4AFK A;  2M07 A;  1E54 A;  3A2S X;  3HOL A;  3QRA A;  2GE4 A;  1ZHW A;  4KRA A;  4AYN A;  4JCH A;  1BT9 A;  3GP6 A;  4XNK A;  2XMX A;  2ODJ A;  8PRN A;  3AAE B;  5ADX L;  5ADX K;  3K19 A;  2KDY A;  3PQU A;  4O3W A;  4Z3T A;  4AKM A;  2X27 X;  2ERV A;  4AYM C;  4E1S A;  4N58 A;  1HXT A;  4D5U A;  2PRN A;  4KR4 A;  1BXW A;  4FRX A;  4E1T A;  2W80 C;  3LK2 B;  4O4U A;  3POQ A;  4FMS A;  4U9C A;  2XE1 A;  4AKR B;  4AUI A;  2K0L A;  1GFQ A;  3PQS A;  4GF4 A;  3AA6 B;  3WI4 A;  1QJ8 A;  3NSG A;  1BH3 A;  4FOZ A;  4XNL A;  2KXP A;  3DA3 A;  4FZL A;  4RJX A;  3AA1 B;  3AA0 A;  4FT6 A;  3RBH A;  3T24 A;  3DA4 A;  4GHB A;  1QJP A;  3G7G A;  5DL5 A;  2W81 C;  2XE5 A;  4O49 A;  4RL9 A;  2LFU A;  3LK3 B;  1G90 A;  2M06 A;  1YS5 A;  3AAA B;  1GFM A;  1H6S 1;  3AAE A;  3HOE A;  1MPF A;  1Q9F A;  2YNK A;  4FZM A;  1PHO A;  1THQ A;  1QJ9 A;  2OMF A;  3AA7 B;  2QTK A;  4F4B A;  2ZLD A;  3SYB A;  3VE1 A;  2K4T A;  4G76 A;  3LK2 A;  1MM4 A;  5G26 A;  1PRN A;  2Y2X A;  1HXU A;  2POR A;  2FGR A;  4N59 A;  1HXX A;  3WI5 A;  2XE3 A;  3FYX A;  3VZT X;  1GFP A;  1ZHZ A;  4O3X B;  5DL8 A;  3O0E A;  3VY8 X;  4D64 A;  5GV0 A;  4C69 X;  2XTR A;  1ZHX A;  2N2L A;  4O4X A;  2Y0L A;  2J4U P;  3SZV A;  3LK4 1;  3C5O A;  4FRT A;  5FVN A;  4D65 A;  5T5F A;  4O3Y A;  3VY9 X;  4LSH A;  3UPG A;  3T0S A;  4RJW A;  2N2M A;  2O4V A;  2MNH A;  2KZ7 B;  4FES A;  3VZW X;  2FGQ X;  4FSP A;  4PUX A;  2F1V A;  4FUV A;  4AYD C;  3V8U A;  4JFB A;  3HWB A;  2XTQ A;  4BUM X;  1OPF A;  2XE2 A;  1P4T A;  3HW9 A;  4AZL A;  1IZN B;  1Q9G A;  4AKR A;  2LHF A;  3SY7 A;  3JTY A;  3AA6 A;  3QRC A;  6PRN A;  5JDP A;  4KR8 A;  4FZN A;  3UAQ A;  1ZHY A;  5DL6 A;  4AYE C;  3AA1 A;  5DL7 A;  2KXP B;  4B61 A;  2MHL A;  3AA0 B;  5AFU L;  5AFU K;  3KVD D;  3POU A;  3LK3 A;  2Y0K A;  2F1T A;  4RLB A;  4AYI D;  3AAA A;  4LSI A;  2Y7S A;  2Y0H A;  3TZG A;  1ORM A;  1ZHT A;  4FSO A;  4GCQ A;  4G75 A;  2YPV A;  2KZ7 A;  3T20 A;  4RLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...