3T24A

Crystal structure of pseudomonas aeruginosa opdq
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
396
structure length
377
Chain Sequence
QSEFIKDSKASIELRNFYFNRDFRQEGASQSKAEEWAQGFLLRYESGYTEGTIGFGVDAIGLLGVKLDSQDDYGEAGITAKLRASKSTLKIGTLTPKLPVIMPNDSRLLPQTFQGGALNSMEIDGLTLDAGRLKKVNQRDSSDNEDMTITGGGKRQIVVRSGLTSDKFDFAGGSYKWTDNLSTSYHYGKLDNFYKQHYLGLVHTLPIADKQSLKSDIRWARSTDDGSSNVDNKALNAMFTYSLGYHAFGVGYQKMSGDTGFAYINGADPYLVNFIQIGDFANKDEKSWQARYDYNFAGVGIPGLTFMTRYVKGDNIDLLTTSGEGKEWERDMDIAYVFQSGPLKNLGVKWRNATMRTNYTNDYDENRLIVSYTLPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords porin
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
total genus 100
structure length 377
sequence length 396
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t24A01
1GFPA 3K19A 3SY7A 2Y0LA 1OPFA 4KRAA 3O0EA 3UPGA 1GFNA 3SZDA 1E54A 1GFQA 4FT6A 2ODJA 3SY9A 4C69X 3JTYA 2PORA 3WI5A 2OMFA 2QTKA 3NSGA 3WI4A 4FSOA 5PRNA 4LSEA 4FOZA 5DL7A 2J1NA 4RJWA 3VY8X 3SYBA 3HW9A 2Y2XA 1BH3A 3PRNA 4GCSA 4AUIA 3POQA 1HXXA 2XG6A 3EMNX 4BUMX 2XE1A 3T24A 4KR8A 3VZTX 4FRTA 2J4UP 1HXUA 4D5UA 6PRNA 3POXA 3SZVA 4GCQA 2PRNA 2XE3A 3FYXA 5DL6A 2O4VA 5FVNA 5DL5A 2Y0KA 4JFBA 3VZUX 2FGRA 1PHOA 4LSIA 4RJXA 4FMSA 3UU2A 4LSFA 2Y0HA 5DL8A 2XE5A 4LSHA 3T0SA 3VZWX 3A2SX 1GFMA 1HXTA 3PORA 4FSPA 2ZLDA 1BT9A 4D65A 1H6S1 1MPFA 4FRXA 7PRNA 5JDPA 1OSMA 3POUA 2XE2A 3VY9X 4GCPA 2FGQX 3HWBA 4D64A 2ZFGA 8PRNA 1GFOA 2K4TA 3T20A 3SYSA 1PRNA 4KR4A
chains in the Genus database with same CATH superfamily
2YPVA 3DWNA 1P4TA 4RLCA 2X9KA 2LFUA 3NJTA 4FESA 3AA7B 1GFPA 3K19A 3SY7A 4U9CA 2Y0LA 2XTRA 4N75A 3BS0A 2MNHA 1OPFA 4KRAA 5EE2A 4O3XB 3O0EA 3UPGA 4K3CA 1GFNA 3KVDD 4PR7A 3TZGA 3SZDA 1E54A 1GFQA 2YNKA 3G7GA 3LK3B 5AFUL 5GTIO 4FT6A 2ODJA 3DWOX 3SY9A 4C69X 3JTYA 4O4UA 3PQSA 2PORA 3WI5A 5IYUA 2OMFA 3AA6A 4AKMA 2QTKA 3NSGA 3WI4A 5G3AA 3PGRA 4FSOA 5PRNA 4LSEA 4FOZA 5DL7A 2J1NA 1G90A 4RJWA 4AFKA 3VY8X 4C4VA 1IZNA 2R4LA 4PUXA 3AAEB 3SYBA 4O3ZA 3HW9A 1THQA 3AAAB 3AA0B 4GHBA 2R4PA 1BH3A 2Y2XA 2R8AA 3PRNA 4GCSA 4AUIA 3V8UA 2KZ7B 3DA3A 2AXTO 3POQA 4O49A 3BRYA 2R4NA 4IL6O 1HXXA 2JMMA 2XG6A 3EMNX 2W80C 3LK42 4G76A 4BUMX 2XE1A 2X27X 2XTQA 3T24A 4KR8A 2W81C 3VZTX 4AYID 4AKRB 3DZMA 4Z3TA 1Q9FA 2KXPA 2R89A 4FRTA 2J4UP 2GE4A 4PJ0O 5H2FO 1HXUA 2F1TA 4D5UA 6PRNA 2F1VA 4O3WA 4FQEA 4K3BA 2F1CX 3AA1A 5KAFO 4E1TA 3POXA 3SZVA 3UAQA 3KZIO 2M06A 4GCQA 2PRNA 3DA4A 3HOLA 4FZLA 2XE3A 1ZHWA 3FYXA 5B5EO 4KR4A 2O4VA 1ZHXA 3LK41 4N58A 5DL6A 2R88A 1QJ9A 3AAAA 2N2MA 4O4XA 1QJPA 3C5OA 4AYNA 5FVNA 4C00A 5GV0A 3A0BO 3AA7A 5GTHO 5DL5A 1ORMA 2KC0A 2Y0KA 4AYDC 4JFBA 2MHLA 4AYEC 3PQUA 4AZLA 4B61A 4JCHA 3VZUX 3AA6B 1T1LA 2FGRA 1PHOA 2JQYA 3LK3A 4LSIA 3PF1A 4FZMA 5D5DA 2XMXA 4RJXA 2M07A 2K0LA 3GP6A 4FMSA 3UU2A 3WU2O 2WJQA 4LSFA 2WJRA 4QQ1A 2Y0HA 4C4VB 5DL8A 1IZNB 2XE5A 4LSHA 3T0SA 3VZWX 5ADXL 4N59A 2KDYA 3A2SX 3VE2A 5T5FA 1GFMA 2WVPA 3LK2A 4CTDA 1HXTA 4UB6O 1MM4A 1ZHTA 3VE1A 2IWWA 3QRAA 4UB8O 3AAEA 3PORA 4AYMC 4G75A 4FZNA 5TISO 4FSPA 3AA0A 5ADXK 2ZLDA 1BT9A 4RL9A 4D65A 2N2LA 2KZ7A 1H6S1 1MPFA 4N74A 2KXPB 4F4BA 1MM5A 3BRZA 4FRXA 4XNLA 7PRNA 5JDPA 3QRCA 1Q9GA 1S5LO 1OSMA 3T20A 1T16A 1YS5A 3POUA 2XE2A 4O3YA 5G39A 5KAIO 3VY9X 4GCPA 3JCUO 2ERVA 2R4OA 5AFUK 2FGQX 3HWBA 5E79O 3AA1B 4AKRA 3LK2B 4XNKA 1QJ8A 4D64A 2ZFGA 8PRNA 1ZHYA 2Y7SA 1GFOA 5G26A 5G38A 5B66O 2K4TA 4FUVA 1ZHZA 2LHFA 3PGUA 4E1SA 3SYSA 3HOEA 1PRNA 4GF4A 3A0HO 4RLBA 3PGSA 2IWVA 3RBHA 1BXWA
chains in the Genus database with same CATH topology
2YPVA 1P4TA 4RLCA 2LFUA 4FESA 3AA7B 1GFPA 3K19A 3SY7A 4U9CA 2Y0LA 2XTRA 2MNHA 1OPFA 4KRAA 5EE2A 4O3XB 3O0EA 3UPGA 1GFNA 3KVDD 3TZGA 3SZDA 1E54A 1GFQA 2YNKA 3G7GA 3LK3B 5AFUL 4FT6A 2ODJA 3SY9A 4C69X 3JTYA 4O4UA 3PQSA 2PORA 3WI5A 5IYUA 2OMFA 3AA6A 4AKMA 2QTKA 3NSGA 3WI4A 4FSOA 5PRNA 4LSEA 4FOZA 5DL7A 2J1NA 1G90A 4RJWA 4AFKA 3VY8X 1IZNA 4PUXA 3AAEB 3SYBA 4O3ZA 3HW9A 1THQA 3AA0B 4GHBA 2Y2XA 1BH3A 3PRNA 4GCSA 4AUIA 3V8UA 2KZ7B 3DA3A 3POQA 4O49A 1HXXA 2JMMA 2XG6A 3EMNX 2W80C 3LK42 4G76A 4BUMX 2XE1A 2X27X 2XTQA 3T24A 4KR8A 2W81C 3VZTX 4AYID 4AKRB 4Z3TA 1Q9FA 2KXPA 4FRTA 2J4UP 2GE4A 1HXUA 2F1TA 4D5UA 6PRNA 2F1VA 4O3WA 3AA1A 4E1TA 3POXA 3SZVA 3UAQA 2M06A 4GCQA 2PRNA 3DA4A 3HOLA 4FZLA 2XE3A 1ZHWA 3FYXA 5DL6A 2O4VA 1ZHXA 3LK41 4N58A 1QJ9A 3AAAA 2N2MA 4O4XA 1QJPA 3C5OA 4AYNA 5FVNA 5GV0A 3AA7A 5DL5A 1ORMA 2KC0A 2Y0KA 4AYDC 4JFBA 2MHLA 4AYEC 3PQUA 4AZLA 4B61A 4JCHA 3VZUX 3AA6B 2FGRA 1PHOA 3LK3A 4LSIA 4FZMA 5D5DA 2XMXA 4RJXA 2M07A 2K0LA 3GP6A 4FMSA 3UU2A 4LSFA 4QQ1A 2Y0HA 5DL8A 1IZNB 2XE5A 4LSHA 3T0SA 3VZWX 5ADXL 4N59A 2KDYA 3A2SX 3VE2A 5T5FA 1GFMA 3LK2A 1HXTA 1MM4A 1ZHTA 3VE1A 3QRAA 3AAEA 3PORA 4AYMC 4G75A 4FZNA 4FSPA 3AA0A 5ADXK 2ZLDA 1BT9A 4RL9A 4D65A 2N2LA 2KZ7A 1H6S1 1MPFA 2KXPB 4F4BA 1MM5A 4FRXA 4XNLA 7PRNA 5JDPA 3QRCA 1Q9GA 1OSMA 1YS5A 4O3YA 3POUA 2XE2A 3VY9X 4GCPA 2ERVA 5AFUK 2FGQX 3HWBA 4AKRA 3AA1B 3LK2B 4XNKA 1QJ8A 4D64A 2ZFGA 8PRNA 1ZHYA 2Y7SA 1GFOA 5G26A 2K4TA 4FUVA 1ZHZA 2LHFA 3T20A 4E1SA 3SYSA 3HOEA 1PRNA 4GF4A 4KR4A 4RLBA 3AAAB 3RBHA 1BXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFP A;  3K19 A;  3SY7 A;  2Y0L A;  1OPF A;  4KRA A;  3O0E A;  3UPG A;  1GFN A;  3SZD A;  1E54 A;  1GFQ A;  4FT6 A;  2ODJ A;  3SY9 A;  4C69 X;  3JTY A;  2POR A;  3WI5 A;  2OMF A;  2QTK A;  3NSG A;  3WI4 A;  4FSO A;  5PRN A;  4LSE A;  4FOZ A;  5DL7 A;  2J1N A;  4RJW A;  3VY8 X;  3SYB A;  3HW9 A;  2Y2X A;  1BH3 A;  3PRN A;  4GCS A;  4AUI A;  3POQ A;  1HXX A;  2XG6 A;  3EMN X;  4BUM X;  2XE1 A;  3T24 A;  4KR8 A;  3VZT X;  4FRT A;  2J4U P;  1HXU A;  4D5U A;  6PRN A;  3POX A;  3SZV A;  4GCQ A;  2PRN A;  2XE3 A;  3FYX A;  5DL6 A;  2O4V A;  5FVN A;  5DL5 A;  2Y0K A;  4JFB A;  3VZU X;  2FGR A;  1PHO A;  4LSI A;  4RJX A;  4FMS A;  3UU2 A;  4LSF A;  2Y0H A;  5DL8 A;  2XE5 A;  4LSH A;  3T0S A;  3VZW X;  3A2S X;  1GFM A;  1HXT A;  3POR A;  4FSP A;  2ZLD A;  1BT9 A;  4D65 A;  1H6S 1;  1MPF A;  4FRX A;  7PRN A;  5JDP A;  1OSM A;  3POU A;  2XE2 A;  3VY9 X;  4GCP A;  2FGQ X;  3HWB A;  4D64 A;  2ZFG A;  8PRN A;  1GFO A;  2K4T A;  3T20 A;  3SYS A;  1PRN A;  4KR4 A; 
#chains in the Genus database with same CATH topology
 2YPV A;  3DWN A;  1P4T A;  4RLC A;  2X9K A;  2LFU A;  3NJT A;  4FES A;  3AA7 B;  1GFP A;  3K19 A;  3SY7 A;  4U9C A;  2Y0L A;  2XTR A;  4N75 A;  3BS0 A;  2MNH A;  1OPF A;  4KRA A;  5EE2 A;  4O3X B;  3O0E A;  3UPG A;  4K3C A;  1GFN A;  3KVD D;  4PR7 A;  3TZG A;  3SZD A;  1E54 A;  1GFQ A;  2YNK A;  3G7G A;  3LK3 B;  5AFU L;  5GTI O;  4FT6 A;  2ODJ A;  3DWO X;  3SY9 A;  4C69 X;  3JTY A;  4O4U A;  3PQS A;  2POR A;  3WI5 A;  5IYU A;  2OMF A;  3AA6 A;  4AKM A;  2QTK A;  3NSG A;  3WI4 A;  5G3A A;  3PGR A;  4FSO A;  5PRN A;  4LSE A;  4FOZ A;  5DL7 A;  2J1N A;  1G90 A;  4RJW A;  4AFK A;  3VY8 X;  4C4V A;  1IZN A;  2R4L A;  4PUX A;  3AAE B;  3SYB A;  4O3Z A;  3HW9 A;  1THQ A;  3AAA B;  3AA0 B;  4GHB A;  2R4P A;  1BH3 A;  2Y2X A;  2R8A A;  3PRN A;  4GCS A;  4AUI A;  3V8U A;  2KZ7 B;  3DA3 A;  2AXT O;  3POQ A;  4O49 A;  3BRY A;  2R4N A;  4IL6 O;  1HXX A;  2JMM A;  2XG6 A;  3EMN X;  2W80 C;  3LK4 2;  4G76 A;  4BUM X;  2XE1 A;  2X27 X;  2XTQ A;  3T24 A;  4KR8 A;  2W81 C;  3VZT X;  4AYI D;  4AKR B;  3DZM A;  4Z3T A;  1Q9F A;  2KXP A;  2R89 A;  4FRT A;  2J4U P;  2GE4 A;  4PJ0 O;  5H2F O;  1HXU A;  2F1T A;  4D5U A;  6PRN A;  2F1V A;  4O3W A;  4FQE A;  4K3B A;  2F1C X;  3AA1 A;  5KAF O;  4E1T A;  3POX A;  3SZV A;  3UAQ A;  3KZI O;  2M06 A;  4GCQ A;  2PRN A;  3DA4 A;  3HOL A;  4FZL A;  2XE3 A;  1ZHW A;  3FYX A;  5B5E O;  4KR4 A;  2O4V A;  1ZHX A;  3LK4 1;  4N58 A;  5DL6 A;  2R88 A;  1QJ9 A;  3AAA A;  2N2M A;  4O4X A;  1QJP A;  3C5O A;  4AYN A;  5FVN A;  4C00 A;  5GV0 A;  3A0B O;  3AA7 A;  5GTH O;  5DL5 A;  1ORM A;  2KC0 A;  2Y0K A;  4AYD C;  4JFB A;  2MHL A;  4AYE C;  3PQU A;  4AZL A;  4B61 A;  4JCH A;  3VZU X;  3AA6 B;  1T1L A;  2FGR A;  1PHO A;  2JQY A;  3LK3 A;  4LSI A;  3PF1 A;  4FZM A;  5D5D A;  2XMX A;  4RJX A;  2M07 A;  2K0L A;  3GP6 A;  4FMS A;  3UU2 A;  3WU2 O;  2WJQ A;  4LSF A;  2WJR A;  4QQ1 A;  2Y0H A;  4C4V B;  5DL8 A;  1IZN B;  2XE5 A;  4LSH A;  3T0S A;  3VZW X;  5ADX L;  4N59 A;  2KDY A;  3A2S X;  3VE2 A;  5T5F A;  1GFM A;  2WVP A;  3LK2 A;  4CTD A;  1HXT A;  4UB6 O;  1MM4 A;  1ZHT A;  3VE1 A;  2IWW A;  3QRA A;  4UB8 O;  3AAE A;  3POR A;  4AYM C;  4G75 A;  4FZN A;  5TIS O;  4FSP A;  3AA0 A;  5ADX K;  2ZLD A;  1BT9 A;  4RL9 A;  4D65 A;  2N2L A;  2KZ7 A;  1H6S 1;  1MPF A;  4N74 A;  2KXP B;  4F4B A;  1MM5 A;  3BRZ A;  4FRX A;  4XNL A;  7PRN A;  5JDP A;  3QRC A;  1Q9G A;  1S5L O;  1OSM A;  3T20 A;  1T16 A;  1YS5 A;  3POU A;  2XE2 A;  4O3Y A;  5G39 A;  5KAI O;  3VY9 X;  4GCP A;  3JCU O;  2ERV A;  2R4O A;  5AFU K;  2FGQ X;  3HWB A;  5E79 O;  3AA1 B;  4AKR A;  3LK2 B;  4XNK A;  1QJ8 A;  4D64 A;  2ZFG A;  8PRN A;  1ZHY A;  2Y7S A;  1GFO A;  5G26 A;  5G38 A;  5B66 O;  2K4T A;  4FUV A;  1ZHZ A;  2LHF A;  3PGU A;  4E1S A;  3SYS A;  3HOE A;  1PRN A;  4GF4 A;  3A0H O;  4RLB A;  3PGS A;  2IWV A;  3RBH A;  1BXW A; 
#chains in the Genus database with same CATH homology
 2YPV A;  1P4T A;  4RLC A;  2LFU A;  4FES A;  3AA7 B;  1GFP A;  3K19 A;  3SY7 A;  4U9C A;  2Y0L A;  2XTR A;  2MNH A;  1OPF A;  4KRA A;  5EE2 A;  4O3X B;  3O0E A;  3UPG A;  1GFN A;  3KVD D;  3TZG A;  3SZD A;  1E54 A;  1GFQ A;  2YNK A;  3G7G A;  3LK3 B;  5AFU L;  4FT6 A;  2ODJ A;  3SY9 A;  4C69 X;  3JTY A;  4O4U A;  3PQS A;  2POR A;  3WI5 A;  5IYU A;  2OMF A;  3AA6 A;  4AKM A;  2QTK A;  3NSG A;  3WI4 A;  4FSO A;  5PRN A;  4LSE A;  4FOZ A;  5DL7 A;  2J1N A;  1G90 A;  4RJW A;  4AFK A;  3VY8 X;  1IZN A;  4PUX A;  3AAE B;  3SYB A;  4O3Z A;  3HW9 A;  1THQ A;  3AA0 B;  4GHB A;  2Y2X A;  1BH3 A;  3PRN A;  4GCS A;  4AUI A;  3V8U A;  2KZ7 B;  3DA3 A;  3POQ A;  4O49 A;  1HXX A;  2JMM A;  2XG6 A;  3EMN X;  2W80 C;  3LK4 2;  4G76 A;  4BUM X;  2XE1 A;  2X27 X;  2XTQ A;  3T24 A;  4KR8 A;  2W81 C;  3VZT X;  4AYI D;  4AKR B;  4Z3T A;  1Q9F A;  2KXP A;  4FRT A;  2J4U P;  2GE4 A;  1HXU A;  2F1T A;  4D5U A;  6PRN A;  2F1V A;  4O3W A;  3AA1 A;  4E1T A;  3POX A;  3SZV A;  3UAQ A;  2M06 A;  4GCQ A;  2PRN A;  3DA4 A;  3HOL A;  4FZL A;  2XE3 A;  1ZHW A;  3FYX A;  5DL6 A;  2O4V A;  1ZHX A;  3LK4 1;  4N58 A;  1QJ9 A;  3AAA A;  2N2M A;  4O4X A;  1QJP A;  3C5O A;  4AYN A;  5FVN A;  5GV0 A;  3AA7 A;  5DL5 A;  1ORM A;  2KC0 A;  2Y0K A;  4AYD C;  4JFB A;  2MHL A;  4AYE C;  3PQU A;  4AZL A;  4B61 A;  4JCH A;  3VZU X;  3AA6 B;  2FGR A;  1PHO A;  3LK3 A;  4LSI A;  4FZM A;  5D5D A;  2XMX A;  4RJX A;  2M07 A;  2K0L A;  3GP6 A;  4FMS A;  3UU2 A;  4LSF A;  4QQ1 A;  2Y0H A;  5DL8 A;  1IZN B;  2XE5 A;  4LSH A;  3T0S A;  3VZW X;  5ADX L;  4N59 A;  2KDY A;  3A2S X;  3VE2 A;  5T5F A;  1GFM A;  3LK2 A;  1HXT A;  1MM4 A;  1ZHT A;  3VE1 A;  3QRA A;  3AAE A;  3POR A;  4AYM C;  4G75 A;  4FZN A;  4FSP A;  3AA0 A;  5ADX K;  2ZLD A;  1BT9 A;  4RL9 A;  4D65 A;  2N2L A;  2KZ7 A;  1H6S 1;  1MPF A;  2KXP B;  4F4B A;  1MM5 A;  4FRX A;  4XNL A;  7PRN A;  5JDP A;  3QRC A;  1Q9G A;  1OSM A;  1YS5 A;  4O3Y A;  3POU A;  2XE2 A;  3VY9 X;  4GCP A;  2ERV A;  5AFU K;  2FGQ X;  3HWB A;  4AKR A;  3AA1 B;  3LK2 B;  4XNK A;  1QJ8 A;  4D64 A;  2ZFG A;  8PRN A;  1ZHY A;  2Y7S A;  1GFO A;  5G26 A;  2K4T A;  4FUV A;  1ZHZ A;  2LHF A;  3T20 A;  4E1S A;  3SYS A;  3HOE A;  1PRN A;  4GF4 A;  4KR4 A;  4RLB A;  3AAA B;  3RBH A;  1BXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...