3T24A

Crystal structure of pseudomonas aeruginosa opdq
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
396
structure length
377
Chain Sequence
QSEFIKDSKASIELRNFYFNRDFRQEGASQSKAEEWAQGFLLRYESGYTEGTIGFGVDAIGLLGVKLDSQDDYGEAGITAKLRASKSTLKIGTLTPKLPVIMPNDSRLLPQTFQGGALNSMEIDGLTLDAGRLKKVNQRDSSDNEDMTITGGGKRQIVVRSGLTSDKFDFAGGSYKWTDNLSTSYHYGKLDNFYKQHYLGLVHTLPIADKQSLKSDIRWARSTDDGSSNVDNKALNAMFTYSLGYHAFGVGYQKMSGDTGFAYINGADPYLVNFIQIGDFANKDEKSWQARYDYNFAGVGIPGLTFMTRYVKGDNIDLLTTSGEGKEWERDMDIAYVFQSGPLKNLGVKWRNATMRTNYTNDYDENRLIVSYTLPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords porin
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 100
structure length 377
sequence length 396
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t24A01
3PORA 4D64A 8PRNA 3A2SX 2K4TA 1GFNA 2Y0KA 1GFOA 2PORA 5DL5A 3PRNA 1GFQA 2ZLDA 1HXXA 4GCPA 3WI4A 1MPFA 4FMSA 5DL7A 5FVNA 2OMFA 3POXA 1PRNA 3VY8X 3SY9A 3VY9X 4FSOA 1H6S1 4GCQA 2FGQX 3T24A 1GFPA 4LSIA 2J4UP 1BT9A 2Y2XA 4FOZA 1E54A 3VZWX 3FYXA 3SYSA 3SZVA 3HWBA 2O4VA 3SZDA 3UU2A 2J1NA 2XE3A 4GCSA 3HW9A 4FT6A 2ZFGA 4AUIA 1HXTA 1OSMA 3JTYA 4RJWA 4D5UA 3SY7A 4KR4A 1BH3A 1GFMA 3VZUX 2XE1A 4KR8A 2Y0HA 2FGRA 2XG6A 7PRNA 6PRNA 4D65A 5DL6A 2XE5A 1OPFA 3T0SA 1HXUA 4LSFA 4C69X 2ODJA 3VZTX 2Y0LA 3EMNX 4KRAA 5PRNA 5DL8A 3WI5A 4RJXA 3UPGA 4LSHA 3T20A 2PRNA 2XE2A 1PHOA 3POUA 4FSPA 4FRTA 4FRXA 3O0EA 4LSEA 4BUMX 2QTKA 3POQA 3K19A 3NSGA 4JFBA 3SYBA 5JDPA
chains in the Genus database with same CATH superfamily
2N2MA 3PORA 4AYDC 2MNHA 3AA6B 4D64A 7PRNA 1G90A 2MHLA 1ORMA 3AAAB 8PRNA 3G7GA 3QRCA 4D65A 4O4XA 3KZIO 3A2SX 5AFUL 2K4TA 1GFNA 5GTIO 2WJQA 2Y0KA 4B61A 2GE4A 2LHFA 3DWNA 5D5DA 2R88A 4AFKA 1GFOA 2KDYA 2PORA 4FUVA 4O49A 5DL5A 3PQSA 3PRNA 1MM4A 3AA1B 4E1TA 2M06A 5GTHO 5IYUA 1ZHZA 2KZ7B 1GFQA 2AXTO 3QRAA 2Y7SA 2ZLDA 1HXXA 2N2LA 4F4BA 4GCPA 3KVDD 1IZNB 1Q9FA 2JQYA 3WI4A 1MPFA 4FMSA 3WU2O 5B66O 5DL7A 4K3CA 2WVPA 3LK42 5FVNA 4AYMC 2OMFA 2R4LA 5KAIO 4C00A 1QJPA 4UB8O 1QJ9A 1PRNA 1P4TA 2R89A 3LK2A 3POXA 4N74A 2KXPB 3JCUO 4UB6O 5KAFO 3LK3A 4E1SA 4FZMA 4C4VA 4G75A 2LFUA 3SY9A 3VY8X 4PJ0O 3VY9X 4FSOA 1H6S1 4GCQA 4G76A 5B5EO 4XNKA 3UAQA 4CTDA 5G39A 4AKMA 5GV0A 2R8AA 4GHBA 5G3AA 3AA7A 2F1VA 3PF1A 4FZNA 4AYID 2FGQX 2R4NA 3DWOX 4C4VB 3T24A 5JDPA 1GFPA 1S5LO 4FZLA 4LSIA 2J4UP 1THQA 1BT9A 2Y2XA 4FOZA 1E54A 2YPVA 3VZWX 3PGSA 3FYXA 3V8UA 3SYSA 3SZVA 5T5FA 3AAEA 3AA0A 1Q9GA 3HOLA 3HWBA 2O4VA 3A0BO 5G38A 3SZDA 3UU2A 4JCHA 2J1NA 1QJ8A 2XE3A 4GCSA 4RLCA 3HW9A 3BRZA 2ZFGA 4FT6A 5TISO 4AUIA 1HXTA 2ERVA 1OSMA 3BRYA 1YS5A 3JTYA 4RJWA 4N58A 4D5UA 3SY7A 3LK41 4KR4A 5EE2A 1BH3A 2XTQA 1T1LA 3BS0A 3LK2B 3LK3B 4PUXA 4QQ1A 4AYEC 2F1TA 1GFMA 4C69X 2R4OA 3VZUX 3AA6A 2XE1A 4IL6O 4AKRA 3AAAA 4KR8A 3VE2A 2Y0HA 3RBHA 3TZGA 2IWWA 2FGRA 2XG6A 3A0HO 3DA4A 3AA7B 3GP6A 4FQEA 4O3XB 4XNLA 2YNKA 3PGUA 4N59A 4N75A 4O3YA 2XTRA 5DL6A 4O3ZA 4RLBA 1ZHXA 1BXWA 2W81C 2X27X 4RL9A 2XE5A 4AKRB 1OPFA 2WJRA 3T0SA 1HXUA 4AYNA 1ZHYA 5G26A 4LSFA 2IWVA 4GF4A 4O4UA 4U9CA 2ODJA 3AA1A 2W80C 2Y0LA 3EMNX 4KRAA 3VZTX 2R4PA 3AAEB 4Z3TA 3AA0B 2K0LA 2KZ7A 2M07A 5DL8A 5PRNA 3WI5A 4RJXA 3UPGA 1ZHTA 3VE1A 2X9KA 4LSHA 1IZNA 5ADXK 3T20A 5E79O 2PRNA 2XE2A 1MM5A 1PHOA 2JMMA 3POUA 3PQUA 4FSPA 1T16A 3DA3A 4O3WA 2KC0A 4PR7A 5ADXL 2KXPA 3HOEA 4FRTA 3DZMA 4FRXA 3NJTA 3O0EA 5H2FO 4LSEA 4BUMX 4FESA 3PGRA 2QTKA 3POQA 6PRNA 2XMXA 3K19A 3NSGA 2F1CX 4JFBA 4K3BA 3SYBA 1ZHWA 5AFUK 4AZLA 3C5OA
chains in the Genus database with same CATH topology
2N2MA 3PORA 4AYDC 2MNHA 3AA6B 4D64A 7PRNA 1G90A 2MHLA 1ORMA 3AAAB 8PRNA 3G7GA 3QRCA 4O4XA 3A2SX 5AFUL 2K4TA 1GFNA 2Y0KA 4B61A 2GE4A 2LHFA 5D5DA 4AFKA 1GFOA 2KDYA 2PORA 4FUVA 4O49A 5DL5A 3PQSA 3PRNA 1MM4A 3AA1B 4E1TA 2M06A 5IYUA 1ZHZA 2KZ7B 1GFQA 3QRAA 2Y7SA 2ZLDA 1HXXA 2N2LA 4F4BA 4GCPA 3KVDD 1IZNB 1Q9FA 3WI4A 1MPFA 4FMSA 5DL7A 3LK42 5FVNA 4AYMC 2OMFA 1QJPA 1QJ9A 1PRNA 1P4TA 3POXA 3LK2A 2KXPB 3LK3A 4E1SA 4FZMA 4G75A 2LFUA 3SY9A 3VY8X 3VY9X 4FSOA 1H6S1 4GCQA 4G76A 4XNKA 3UAQA 4AKMA 5GV0A 4GHBA 3AA7A 2F1VA 4FZNA 4AYID 2FGQX 3T24A 5JDPA 1GFPA 4FZLA 4LSIA 2J4UP 1THQA 1BT9A 2Y2XA 4FOZA 1E54A 2YPVA 3VZWX 3FYXA 3V8UA 3SYSA 3SZVA 5T5FA 3AAEA 3AA0A 1Q9GA 3HOLA 3HWBA 2O4VA 3SZDA 3UU2A 4JCHA 2J1NA 1QJ8A 2XE3A 4GCSA 4RLCA 3HW9A 4FT6A 2ZFGA 4AUIA 1HXTA 2ERVA 1OSMA 1YS5A 3JTYA 4RJWA 4N58A 4D5UA 3SY7A 3LK41 4KR4A 5EE2A 1BH3A 2XTQA 3LK2B 3LK3B 4PUXA 4QQ1A 4AYEC 2F1TA 1GFMA 3VZUX 3AA6A 2XE1A 4AKRA 3AAAA 4KR8A 3VE2A 2Y0HA 3RBHA 3TZGA 2FGRA 2XG6A 3DA4A 3GP6A 3AA7B 4O3XB 4XNLA 4D65A 6PRNA 2YNKA 4N59A 4O3YA 5DL6A 2XTRA 4O3ZA 4RLBA 1ZHXA 1BXWA 2W81C 2X27X 4RL9A 2XE5A 4AKRB 1OPFA 3T0SA 1HXUA 4AYNA 1ZHYA 5G26A 4LSFA 4GF4A 4O4UA 4U9CA 4C69X 2ODJA 3AA1A 2W80C 2Y0LA 3EMNX 4KRAA 3VZTX 4Z3TA 3AAEB 3AA0B 2K0LA 2KZ7A 2M07A 5DL8A 5PRNA 3WI5A 4RJXA 3UPGA 1ZHTA 3VE1A 4LSHA 1IZNA 5ADXK 3T20A 2PRNA 2XE2A 1MM5A 1PHOA 2JMMA 3POUA 3PQUA 4FSPA 4O3WA 3DA3A 2KC0A 5ADXL 2KXPA 3HOEA 4FRTA 4FRXA 3O0EA 4LSEA 4BUMX 4FESA 2QTKA 3POQA 2XMXA 3K19A 3NSGA 4JFBA 3SYBA 1ZHWA 5AFUK 4AZLA 3C5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3POR A;  4D64 A;  8PRN A;  3A2S X;  2K4T A;  1GFN A;  2Y0K A;  1GFO A;  2POR A;  5DL5 A;  3PRN A;  1GFQ A;  2ZLD A;  1HXX A;  4GCP A;  3WI4 A;  1MPF A;  4FMS A;  5DL7 A;  5FVN A;  2OMF A;  3POX A;  1PRN A;  3VY8 X;  3SY9 A;  3VY9 X;  4FSO A;  1H6S 1;  4GCQ A;  2FGQ X;  3T24 A;  1GFP A;  4LSI A;  2J4U P;  1BT9 A;  2Y2X A;  4FOZ A;  1E54 A;  3VZW X;  3FYX A;  3SYS A;  3SZV A;  3HWB A;  2O4V A;  3SZD A;  3UU2 A;  2J1N A;  2XE3 A;  4GCS A;  3HW9 A;  4FT6 A;  2ZFG A;  4AUI A;  1HXT A;  1OSM A;  3JTY A;  4RJW A;  4D5U A;  3SY7 A;  4KR4 A;  1BH3 A;  1GFM A;  3VZU X;  2XE1 A;  4KR8 A;  2Y0H A;  2FGR A;  2XG6 A;  7PRN A;  6PRN A;  4D65 A;  5DL6 A;  2XE5 A;  1OPF A;  3T0S A;  1HXU A;  4LSF A;  4C69 X;  2ODJ A;  3VZT X;  2Y0L A;  3EMN X;  4KRA A;  5PRN A;  5DL8 A;  3WI5 A;  4RJX A;  3UPG A;  4LSH A;  3T20 A;  2PRN A;  2XE2 A;  1PHO A;  3POU A;  4FSP A;  4FRT A;  4FRX A;  3O0E A;  4LSE A;  4BUM X;  2QTK A;  3POQ A;  3K19 A;  3NSG A;  4JFB A;  3SYB A;  5JDP A; 
#chains in the Genus database with same CATH topology
 2N2M A;  3POR A;  4AYD C;  2MNH A;  3AA6 B;  4D64 A;  7PRN A;  1G90 A;  2MHL A;  1ORM A;  3AAA B;  8PRN A;  3G7G A;  3QRC A;  4D65 A;  4O4X A;  3KZI O;  3A2S X;  5AFU L;  2K4T A;  1GFN A;  5GTI O;  2WJQ A;  2Y0K A;  4B61 A;  2GE4 A;  2LHF A;  3DWN A;  5D5D A;  2R88 A;  4AFK A;  1GFO A;  2KDY A;  2POR A;  4FUV A;  4O49 A;  5DL5 A;  3PQS A;  3PRN A;  1MM4 A;  3AA1 B;  4E1T A;  2M06 A;  5GTH O;  5IYU A;  1ZHZ A;  2KZ7 B;  1GFQ A;  2AXT O;  3QRA A;  2Y7S A;  2ZLD A;  1HXX A;  2N2L A;  4F4B A;  4GCP A;  3KVD D;  1IZN B;  1Q9F A;  2JQY A;  3WI4 A;  1MPF A;  4FMS A;  3WU2 O;  5B66 O;  5DL7 A;  4K3C A;  2WVP A;  3LK4 2;  5FVN A;  4AYM C;  2OMF A;  2R4L A;  5KAI O;  4C00 A;  1QJP A;  4UB8 O;  1QJ9 A;  1PRN A;  1P4T A;  2R89 A;  3LK2 A;  3POX A;  4N74 A;  2KXP B;  3JCU O;  4UB6 O;  5KAF O;  3LK3 A;  4E1S A;  4FZM A;  4C4V A;  4G75 A;  2LFU A;  3SY9 A;  3VY8 X;  4PJ0 O;  3VY9 X;  4FSO A;  1H6S 1;  4GCQ A;  4G76 A;  5B5E O;  4XNK A;  3UAQ A;  4CTD A;  5G39 A;  4AKM A;  5GV0 A;  2R8A A;  4GHB A;  5G3A A;  3AA7 A;  2F1V A;  3PF1 A;  4FZN A;  4AYI D;  2FGQ X;  2R4N A;  3DWO X;  4C4V B;  3T24 A;  5JDP A;  1GFP A;  1S5L O;  4FZL A;  4LSI A;  2J4U P;  1THQ A;  1BT9 A;  2Y2X A;  4FOZ A;  1E54 A;  2YPV A;  3VZW X;  3PGS A;  3FYX A;  3V8U A;  3SYS A;  3SZV A;  5T5F A;  3AAE A;  3AA0 A;  1Q9G A;  3HOL A;  3HWB A;  2O4V A;  3A0B O;  5G38 A;  3SZD A;  3UU2 A;  4JCH A;  2J1N A;  1QJ8 A;  2XE3 A;  4GCS A;  4RLC A;  3HW9 A;  3BRZ A;  2ZFG A;  4FT6 A;  5TIS O;  4AUI A;  1HXT A;  2ERV A;  1OSM A;  3BRY A;  1YS5 A;  3JTY A;  4RJW A;  4N58 A;  4D5U A;  3SY7 A;  3LK4 1;  4KR4 A;  5EE2 A;  1BH3 A;  2XTQ A;  1T1L A;  3BS0 A;  3LK2 B;  3LK3 B;  4PUX A;  4QQ1 A;  4AYE C;  2F1T A;  1GFM A;  4C69 X;  2R4O A;  3VZU X;  3AA6 A;  2XE1 A;  4IL6 O;  4AKR A;  3AAA A;  4KR8 A;  3VE2 A;  2Y0H A;  3RBH A;  3TZG A;  2IWW A;  2FGR A;  2XG6 A;  3A0H O;  3DA4 A;  3AA7 B;  3GP6 A;  4FQE A;  4O3X B;  4XNL A;  2YNK A;  3PGU A;  4N59 A;  4N75 A;  4O3Y A;  2XTR A;  5DL6 A;  4O3Z A;  4RLB A;  1ZHX A;  1BXW A;  2W81 C;  2X27 X;  4RL9 A;  2XE5 A;  4AKR B;  1OPF A;  2WJR A;  3T0S A;  1HXU A;  4AYN A;  1ZHY A;  5G26 A;  4LSF A;  2IWV A;  4GF4 A;  4O4U A;  4U9C A;  2ODJ A;  3AA1 A;  2W80 C;  2Y0L A;  3EMN X;  4KRA A;  3VZT X;  2R4P A;  3AAE B;  4Z3T A;  3AA0 B;  2K0L A;  2KZ7 A;  2M07 A;  5DL8 A;  5PRN A;  3WI5 A;  4RJX A;  3UPG A;  1ZHT A;  3VE1 A;  2X9K A;  4LSH A;  1IZN A;  5ADX K;  3T20 A;  5E79 O;  2PRN A;  2XE2 A;  1MM5 A;  1PHO A;  2JMM A;  3POU A;  3PQU A;  4FSP A;  1T16 A;  3DA3 A;  4O3W A;  2KC0 A;  4PR7 A;  5ADX L;  2KXP A;  3HOE A;  4FRT A;  3DZM A;  4FRX A;  3NJT A;  3O0E A;  5H2F O;  4LSE A;  4BUM X;  4FES A;  3PGR A;  2QTK A;  3POQ A;  6PRN A;  2XMX A;  3K19 A;  3NSG A;  2F1C X;  4JFB A;  4K3B A;  3SYB A;  1ZHW A;  5AFU K;  4AZL A;  3C5O A; 
#chains in the Genus database with same CATH homology
 2N2M A;  3POR A;  4AYD C;  2MNH A;  3AA6 B;  4D64 A;  7PRN A;  1G90 A;  2MHL A;  1ORM A;  3AAA B;  8PRN A;  3G7G A;  3QRC A;  4O4X A;  3A2S X;  5AFU L;  2K4T A;  1GFN A;  2Y0K A;  4B61 A;  2GE4 A;  2LHF A;  5D5D A;  4AFK A;  1GFO A;  2KDY A;  2POR A;  4FUV A;  4O49 A;  5DL5 A;  3PQS A;  3PRN A;  1MM4 A;  3AA1 B;  4E1T A;  2M06 A;  5IYU A;  1ZHZ A;  2KZ7 B;  1GFQ A;  3QRA A;  2Y7S A;  2ZLD A;  1HXX A;  2N2L A;  4F4B A;  4GCP A;  3KVD D;  1IZN B;  1Q9F A;  3WI4 A;  1MPF A;  4FMS A;  5DL7 A;  3LK4 2;  5FVN A;  4AYM C;  2OMF A;  1QJP A;  1QJ9 A;  1PRN A;  1P4T A;  3POX A;  3LK2 A;  2KXP B;  3LK3 A;  4E1S A;  4FZM A;  4G75 A;  2LFU A;  3SY9 A;  3VY8 X;  3VY9 X;  4FSO A;  1H6S 1;  4GCQ A;  4G76 A;  4XNK A;  3UAQ A;  4AKM A;  5GV0 A;  4GHB A;  3AA7 A;  2F1V A;  4FZN A;  4AYI D;  2FGQ X;  3T24 A;  5JDP A;  1GFP A;  4FZL A;  4LSI A;  2J4U P;  1THQ A;  1BT9 A;  2Y2X A;  4FOZ A;  1E54 A;  2YPV A;  3VZW X;  3FYX A;  3V8U A;  3SYS A;  3SZV A;  5T5F A;  3AAE A;  3AA0 A;  1Q9G A;  3HOL A;  3HWB A;  2O4V A;  3SZD A;  3UU2 A;  4JCH A;  2J1N A;  1QJ8 A;  2XE3 A;  4GCS A;  4RLC A;  3HW9 A;  4FT6 A;  2ZFG A;  4AUI A;  1HXT A;  2ERV A;  1OSM A;  1YS5 A;  3JTY A;  4RJW A;  4N58 A;  4D5U A;  3SY7 A;  3LK4 1;  4KR4 A;  5EE2 A;  1BH3 A;  2XTQ A;  3LK2 B;  3LK3 B;  4PUX A;  4QQ1 A;  4AYE C;  2F1T A;  1GFM A;  3VZU X;  3AA6 A;  2XE1 A;  4AKR A;  3AAA A;  4KR8 A;  3VE2 A;  2Y0H A;  3RBH A;  3TZG A;  2FGR A;  2XG6 A;  3DA4 A;  3GP6 A;  3AA7 B;  4O3X B;  4XNL A;  4D65 A;  6PRN A;  2YNK A;  4N59 A;  4O3Y A;  5DL6 A;  2XTR A;  4O3Z A;  4RLB A;  1ZHX A;  1BXW A;  2W81 C;  2X27 X;  4RL9 A;  2XE5 A;  4AKR B;  1OPF A;  3T0S A;  1HXU A;  4AYN A;  1ZHY A;  5G26 A;  4LSF A;  4GF4 A;  4O4U A;  4U9C A;  4C69 X;  2ODJ A;  3AA1 A;  2W80 C;  2Y0L A;  3EMN X;  4KRA A;  3VZT X;  4Z3T A;  3AAE B;  3AA0 B;  2K0L A;  2KZ7 A;  2M07 A;  5DL8 A;  5PRN A;  3WI5 A;  4RJX A;  3UPG A;  1ZHT A;  3VE1 A;  4LSH A;  1IZN A;  5ADX K;  3T20 A;  2PRN A;  2XE2 A;  1MM5 A;  1PHO A;  2JMM A;  3POU A;  3PQU A;  4FSP A;  4O3W A;  3DA3 A;  2KC0 A;  5ADX L;  2KXP A;  3HOE A;  4FRT A;  4FRX A;  3O0E A;  4LSE A;  4BUM X;  4FES A;  2QTK A;  3POQ A;  2XMX A;  3K19 A;  3NSG A;  4JFB A;  3SYB A;  1ZHW A;  5AFU K;  4AZL A;  3C5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...