3T24A

Crystal structure of pseudomonas aeruginosa opdq
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
396
structure length
377
Chain Sequence
QSEFIKDSKASIELRNFYFNRDFRQEGASQSKAEEWAQGFLLRYESGYTEGTIGFGVDAIGLLGVKLDSQDDYGEAGITAKLRASKSTLKIGTLTPKLPVIMPNDSRLLPQTFQGGALNSMEIDGLTLDAGRLKKVNQRDSSDNEDMTITGGGKRQIVVRSGLTSDKFDFAGGSYKWTDNLSTSYHYGKLDNFYKQHYLGLVHTLPIADKQSLKSDIRWARSTDDGSSNVDNKALNAMFTYSLGYHAFGVGYQKMSGDTGFAYINGADPYLVNFIQIGDFANKDEKSWQARYDYNFAGVGIPGLTFMTRYVKGDNIDLLTTSGEGKEWERDMDIAYVFQSGPLKNLGVKWRNATMRTNYTNDYDENRLIVSYTLPLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Membrane protein
molecule keywords porin
total genus 100
structure length 377
sequence length 396
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03573 OprD outer membrane porin, OprD family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 3t24A01
4D64A 3NSGA 4FSPA 3SZDA 2Y0LA 2Y0HA 3K19A 4KR4A 5PRNA 4LSEA 2ZLDA 4AUIA 3POUA 3PRNA 1MPFA 1H6S1 8PRNA 2PORA 2XE2A 2OMFA 1GFNA 3JTYA 2J1NA 4FT6A 1HXUA 3SY7A 3HWBA 3SZVA 4BUMX 3VZUX 4D5UA 2K4TA 5DL6A 5DL7A 1BH3A 5JDPA 2ZFGA 3SY9A 4LSFA 3UU2A 1BT9A 2Y2XA 1HXXA 4RJWA 7PRNA 3VY8X 3HW9A 3SYBA 2XE3A 5DL5A 3UPGA 5DL8A 3VZTX 4KRAA 4D65A 3T0SA 1GFQA 1GFMA 3WI5A 6PRNA 2QTKA 3SYSA 2XE5A 2XG6A 3T20A 4KR8A 4FSOA 3VY9X 1OPFA 1GFPA 2FGQX 4GCSA 4JFBA 3PORA 4RJXA 3POQA 2ODJA 2FGRA 4FMSA 1PRNA 3WI4A 4GCPA 1GFOA 2Y0KA 3FYXA 4LSHA 3VZWX 3O0EA 1OSMA 3A2SX 4GCQA 2XE1A 4FRXA 3EMNX 4LSIA 4C69X 2PRNA 5FVNA 2O4VA 2J4UP 1E54A 3POXA 4FOZA 4FRTA 1HXTA 3T24A 1PHOA
chains in the Genus database with same CATH superfamily
5AFUL 4RLCA 5E79O 2LFUA 4C00A 2JMMA 4N59A 4D64A 3NSGA 4IL6O 4AKRB 3AAEA 1QJ8A 2N2MA 3PF1A 4UB6O 4AYMC 4FSPA 4FZMA 3SZDA 2Y0LA 2Y0HA 4O4UA 3DA3A 3DA4A 2WJQA 3K19A 4N74A 4KR4A 5PRNA 4LSEA 3PGSA 2ZLDA 4AUIA 3POUA 3PRNA 1MPFA 1H6S1 2XMXA 1ZHTA 2KZ7B 8PRNA 2PORA 2W80C 2XE2A 4O49A 2LHFA 2OMFA 3DWOX 1GFNA 3DZMA 4O3ZA 5GTIO 2KXPA 3JTYA 4U9CA 2F1CX 1HXTA 5EE2A 5H2FO 2J1NA 4FT6A 4E1TA 2X27X 1IZNA 1HXUA 5G26A 3AAAA 1MM4A 3PQSA 3SY7A 3TZGA 1S5LO 5GTHO 3HWBA 3LK2A 3NJTA 1QJ9A 4AZLA 3SZVA 4BUMX 4O4XA 1G90A 3VZUX 3WU2O 5GV0A 3HOLA 4D5UA 2K4TA 3AA0A 2M06A 2IWVA 4PJ0O 4GHBA 5DL6A 2X9KA 1BH3A 5DL7A 2GE4A 5JDPA 2ZFGA 3SY9A 4QQ1A 2N2LA 4LSFA 3UU2A 1BT9A 2Y2XA 4FQEA 5ADXK 1HXXA 3AA0B 3VE1A 4RJWA 2KXPB 7PRNA 3AA6B 2W81C 2F1TA 2R88A 4CTDA 4K3BA 3VY8X 3AA6A 4AKMA 3HW9A 2KZ7A 4E1SA 4GF4A 3SYBA 3LK2B 2XE3A 3AA1B 5DL5A 3UPGA 5DL8A 3VZTX 2MHLA 3PGRA 4KRAA 4D65A 3QRCA 3T0SA 1GFQA 4AFKA 4B61A 4FZNA 5B66O 1GFMA 2XTQA 3WI5A 2IWWA 3HOEA 3KZIO 4N75A 2QTKA 5TISO 4AYEC 6PRNA 2R4OA 1ZHYA 4G75A 2M07A 3SYSA 4RLBA 2ERVA 2JQYA 2XE5A 2KC0A 4RL9A 2XG6A 5KAIO 4AYNA 5ADXL 5B5EO 2XTRA 2R4NA 3T20A 2R4PA 4KR8A 4FSOA 3C5OA 3VY9X 1ORMA 4AYDC 1IZNB 1OPFA 2F1VA 3AA1A 1GFPA 2K0LA 5T5FA 3BS0A 2FGQX 4F4BA 3BRZA 1THQA 3AAEB 4AYID 5IYUA 4GCSA 5D5DA 4JFBA 3LK42 2YPVA 3LK3A 3QRAA 3RBHA 3PORA 3VE2A 4PR7A 4RJXA 3LK41 5G38A 2Y7SA 4O3WA 5G3AA 3T24A 3UAQA 3V8UA 1ZHWA 2KDYA 2R4LA 3JCUO 3POQA 2ODJA 4JCHA 3GP6A 2FGRA 3DWNA 4FMSA 4AKRA 4PUXA 3KVDD 1Q9FA 1PRNA 4K3CA 4Z3TA 4XNKA 4O3XB 3WI4A 1MM5A 2WJRA 4GCPA 1GFOA 3AA7A 4XNLA 5AFUK 2Y0KA 3FYXA 4FZLA 4LSHA 3VZWX 2R89A 3O0EA 1OSMA 3A2SX 4GCQA 5KAFO 1QJPA 2AXTO 4FUVA 4G76A 1P4TA 2XE1A 3LK3B 2MNHA 4FRXA 3EMNX 4LSIA 4C69X 2PRNA 3A0BO 5FVNA 1BXWA 1Q9GA 3G7GA 2O4VA 2WVPA 1E54A 4N58A 3POXA 4UB8O 4C4VB 2J4UP 5G39A 2YNKA 1T1LA 1ZHXA 1YS5A 3A0HO 3AAAB 4FOZA 1T16A 4FRTA 3AA7B 3PGUA 2R8AA 3BRYA 4O3YA 1ZHZA 4FESA 3PQUA 1PHOA 4C4VA
chains in the Genus database with same CATH topology
5AFUL 4RLCA 2LFUA 2JMMA 4N59A 4D64A 3NSGA 4AKRB 3AAEA 1QJ8A 2N2MA 4AYMC 4FSPA 4FZMA 3SZDA 2Y0LA 2Y0HA 4O4UA 3DA3A 3DA4A 3K19A 4KR4A 5PRNA 4LSEA 2ZLDA 4AUIA 3POUA 3PRNA 1MPFA 1H6S1 2XMXA 1ZHTA 2KZ7B 8PRNA 2PORA 2W80C 2XE2A 4O49A 2LHFA 2OMFA 1GFNA 4O3ZA 2KXPA 3JTYA 4U9CA 1HXTA 5EE2A 2J1NA 4FT6A 4E1TA 2X27X 1IZNA 1HXUA 5G26A 3AAAA 1MM4A 3PQSA 3SY7A 3TZGA 3HWBA 3LK2A 4AZLA 1QJ9A 3SZVA 4BUMX 4O4XA 1G90A 3VZUX 5GV0A 3HOLA 4D5UA 2K4TA 3AA0A 2M06A 4GHBA 5DL6A 1BH3A 5DL7A 2GE4A 5JDPA 2ZFGA 3SY9A 4QQ1A 2N2LA 4LSFA 3UU2A 1BT9A 2Y2XA 5ADXK 1HXXA 3AA0B 3VE1A 4RJWA 2KXPB 7PRNA 3AA6B 2W81C 2F1TA 3VY8X 3AA6A 4AKMA 3HW9A 2KZ7A 4E1SA 4GF4A 3SYBA 3LK2B 2XE3A 3AA1B 5DL5A 3UPGA 5DL8A 3VZTX 2MHLA 4KRAA 4D65A 3QRCA 3T0SA 1GFQA 4AFKA 4B61A 4FZNA 1GFMA 2XTQA 3WI5A 3HOEA 6PRNA 2QTKA 4AYEC 4G75A 1ZHYA 2M07A 3SYSA 4RLBA 2ERVA 2XE5A 4RL9A 2KC0A 4AYNA 2XG6A 5ADXL 2XTRA 3T20A 4KR8A 4AYDC 4FSOA 3C5OA 3VY9X 1ORMA 1IZNB 1OPFA 2F1VA 3AA1A 1GFPA 2K0LA 5T5FA 2FGQX 4F4BA 1THQA 3AAEB 4AYID 5IYUA 4GCSA 5D5DA 4JFBA 3LK42 2YPVA 3LK3A 3QRAA 3RBHA 3PORA 3VE2A 4RJXA 3LK41 3V8UA 2Y7SA 4O3WA 3T24A 3UAQA 1ZHWA 2KDYA 3POQA 2ODJA 4JCHA 3GP6A 2FGRA 4FMSA 4AKRA 4PUXA 3KVDD 1Q9FA 1PRNA 4Z3TA 4XNKA 4O3XB 3WI4A 1MM5A 4GCPA 1GFOA 3AA7A 4XNLA 5AFUK 2Y0KA 3FYXA 4FZLA 4LSHA 3VZWX 3O0EA 1OSMA 3A2SX 4GCQA 1QJPA 4FUVA 4G76A 1P4TA 2XE1A 3LK3B 2MNHA 4FRXA 3EMNX 4LSIA 4C69X 2PRNA 5FVNA 1BXWA 1Q9GA 3G7GA 2O4VA 4N58A 1E54A 2J4UP 3POXA 2YNKA 1ZHXA 1YS5A 3AAAB 4FOZA 4FRTA 3AA7B 4O3YA 1ZHZA 4FESA 3PQUA 1PHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D64 A;  3NSG A;  4FSP A;  3SZD A;  2Y0L A;  2Y0H A;  3K19 A;  4KR4 A;  5PRN A;  4LSE A;  2ZLD A;  4AUI A;  3POU A;  3PRN A;  1MPF A;  1H6S 1;  8PRN A;  2POR A;  2XE2 A;  2OMF A;  1GFN A;  3JTY A;  2J1N A;  4FT6 A;  1HXU A;  3SY7 A;  3HWB A;  3SZV A;  4BUM X;  3VZU X;  4D5U A;  2K4T A;  5DL6 A;  5DL7 A;  1BH3 A;  5JDP A;  2ZFG A;  3SY9 A;  4LSF A;  3UU2 A;  1BT9 A;  2Y2X A;  1HXX A;  4RJW A;  7PRN A;  3VY8 X;  3HW9 A;  3SYB A;  2XE3 A;  5DL5 A;  3UPG A;  5DL8 A;  3VZT X;  4KRA A;  4D65 A;  3T0S A;  1GFQ A;  1GFM A;  3WI5 A;  6PRN A;  2QTK A;  3SYS A;  2XE5 A;  2XG6 A;  3T20 A;  4KR8 A;  4FSO A;  3VY9 X;  1OPF A;  1GFP A;  2FGQ X;  4GCS A;  4JFB A;  3POR A;  4RJX A;  3POQ A;  2ODJ A;  2FGR A;  4FMS A;  1PRN A;  3WI4 A;  4GCP A;  1GFO A;  2Y0K A;  3FYX A;  4LSH A;  3VZW X;  3O0E A;  1OSM A;  3A2S X;  4GCQ A;  2XE1 A;  4FRX A;  3EMN X;  4LSI A;  4C69 X;  2PRN A;  5FVN A;  2O4V A;  2J4U P;  1E54 A;  3POX A;  4FOZ A;  4FRT A;  1HXT A;  3T24 A;  1PHO A; 
#chains in the Genus database with same CATH topology
 5AFU L;  4RLC A;  5E79 O;  2LFU A;  4C00 A;  2JMM A;  4N59 A;  4D64 A;  3NSG A;  4IL6 O;  4AKR B;  3AAE A;  1QJ8 A;  2N2M A;  3PF1 A;  4UB6 O;  4AYM C;  4FSP A;  4FZM A;  3SZD A;  2Y0L A;  2Y0H A;  4O4U A;  3DA3 A;  3DA4 A;  2WJQ A;  3K19 A;  4N74 A;  4KR4 A;  5PRN A;  4LSE A;  3PGS A;  2ZLD A;  4AUI A;  3POU A;  3PRN A;  1MPF A;  1H6S 1;  2XMX A;  1ZHT A;  2KZ7 B;  8PRN A;  2POR A;  2W80 C;  2XE2 A;  4O49 A;  2LHF A;  2OMF A;  3DWO X;  1GFN A;  3DZM A;  4O3Z A;  5GTI O;  2KXP A;  3JTY A;  4U9C A;  2F1C X;  1HXT A;  5EE2 A;  5H2F O;  2J1N A;  4FT6 A;  4E1T A;  2X27 X;  1IZN A;  1HXU A;  5G26 A;  3AAA A;  1MM4 A;  3PQS A;  3SY7 A;  3TZG A;  1S5L O;  5GTH O;  3HWB A;  3LK2 A;  3NJT A;  1QJ9 A;  4AZL A;  3SZV A;  4BUM X;  4O4X A;  1G90 A;  3VZU X;  3WU2 O;  5GV0 A;  3HOL A;  4D5U A;  2K4T A;  3AA0 A;  2M06 A;  2IWV A;  4PJ0 O;  4GHB A;  5DL6 A;  2X9K A;  1BH3 A;  5DL7 A;  2GE4 A;  5JDP A;  2ZFG A;  3SY9 A;  4QQ1 A;  2N2L A;  4LSF A;  3UU2 A;  1BT9 A;  2Y2X A;  4FQE A;  5ADX K;  1HXX A;  3AA0 B;  3VE1 A;  4RJW A;  2KXP B;  7PRN A;  3AA6 B;  2W81 C;  2F1T A;  2R88 A;  4CTD A;  4K3B A;  3VY8 X;  3AA6 A;  4AKM A;  3HW9 A;  2KZ7 A;  4E1S A;  4GF4 A;  3SYB A;  3LK2 B;  2XE3 A;  3AA1 B;  5DL5 A;  3UPG A;  5DL8 A;  3VZT X;  2MHL A;  3PGR A;  4KRA A;  4D65 A;  3QRC A;  3T0S A;  1GFQ A;  4AFK A;  4B61 A;  4FZN A;  5B66 O;  1GFM A;  2XTQ A;  3WI5 A;  2IWW A;  3HOE A;  3KZI O;  4N75 A;  2QTK A;  5TIS O;  4AYE C;  6PRN A;  2R4O A;  1ZHY A;  4G75 A;  2M07 A;  3SYS A;  4RLB A;  2ERV A;  2JQY A;  2XE5 A;  2KC0 A;  4RL9 A;  2XG6 A;  5KAI O;  4AYN A;  5ADX L;  5B5E O;  2XTR A;  2R4N A;  3T20 A;  2R4P A;  4KR8 A;  4FSO A;  3C5O A;  3VY9 X;  1ORM A;  4AYD C;  1IZN B;  1OPF A;  2F1V A;  3AA1 A;  1GFP A;  2K0L A;  5T5F A;  3BS0 A;  2FGQ X;  4F4B A;  3BRZ A;  1THQ A;  3AAE B;  4AYI D;  5IYU A;  4GCS A;  5D5D A;  4JFB A;  3LK4 2;  2YPV A;  3LK3 A;  3QRA A;  3RBH A;  3POR A;  3VE2 A;  4PR7 A;  4RJX A;  3LK4 1;  5G38 A;  2Y7S A;  4O3W A;  5G3A A;  3T24 A;  3UAQ A;  3V8U A;  1ZHW A;  2KDY A;  2R4L A;  3JCU O;  3POQ A;  2ODJ A;  4JCH A;  3GP6 A;  2FGR A;  3DWN A;  4FMS A;  4AKR A;  4PUX A;  3KVD D;  1Q9F A;  1PRN A;  4K3C A;  4Z3T A;  4XNK A;  4O3X B;  3WI4 A;  1MM5 A;  2WJR A;  4GCP A;  1GFO A;  3AA7 A;  4XNL A;  5AFU K;  2Y0K A;  3FYX A;  4FZL A;  4LSH A;  3VZW X;  2R89 A;  3O0E A;  1OSM A;  3A2S X;  4GCQ A;  5KAF O;  1QJP A;  2AXT O;  4FUV A;  4G76 A;  1P4T A;  2XE1 A;  3LK3 B;  2MNH A;  4FRX A;  3EMN X;  4LSI A;  4C69 X;  2PRN A;  3A0B O;  5FVN A;  1BXW A;  1Q9G A;  3G7G A;  2O4V A;  2WVP A;  1E54 A;  4N58 A;  3POX A;  4UB8 O;  4C4V B;  2J4U P;  5G39 A;  2YNK A;  1T1L A;  1ZHX A;  1YS5 A;  3A0H O;  3AAA B;  4FOZ A;  1T16 A;  4FRT A;  3AA7 B;  3PGU A;  2R8A A;  3BRY A;  4O3Y A;  1ZHZ A;  4FES A;  3PQU A;  1PHO A;  4C4V A; 
#chains in the Genus database with same CATH homology
 5AFU L;  4RLC A;  2LFU A;  2JMM A;  4N59 A;  4D64 A;  3NSG A;  4AKR B;  3AAE A;  1QJ8 A;  2N2M A;  4AYM C;  4FSP A;  4FZM A;  3SZD A;  2Y0L A;  2Y0H A;  4O4U A;  3DA3 A;  3DA4 A;  3K19 A;  4KR4 A;  5PRN A;  4LSE A;  2ZLD A;  4AUI A;  3POU A;  3PRN A;  1MPF A;  1H6S 1;  2XMX A;  1ZHT A;  2KZ7 B;  8PRN A;  2POR A;  2W80 C;  2XE2 A;  4O49 A;  2LHF A;  2OMF A;  1GFN A;  4O3Z A;  2KXP A;  3JTY A;  4U9C A;  1HXT A;  5EE2 A;  2J1N A;  4FT6 A;  4E1T A;  2X27 X;  1IZN A;  1HXU A;  5G26 A;  3AAA A;  1MM4 A;  3PQS A;  3SY7 A;  3TZG A;  3HWB A;  3LK2 A;  4AZL A;  1QJ9 A;  3SZV A;  4BUM X;  4O4X A;  1G90 A;  3VZU X;  5GV0 A;  3HOL A;  4D5U A;  2K4T A;  3AA0 A;  2M06 A;  4GHB A;  5DL6 A;  1BH3 A;  5DL7 A;  2GE4 A;  5JDP A;  2ZFG A;  3SY9 A;  4QQ1 A;  2N2L A;  4LSF A;  3UU2 A;  1BT9 A;  2Y2X A;  5ADX K;  1HXX A;  3AA0 B;  3VE1 A;  4RJW A;  2KXP B;  7PRN A;  3AA6 B;  2W81 C;  2F1T A;  3VY8 X;  3AA6 A;  4AKM A;  3HW9 A;  2KZ7 A;  4E1S A;  4GF4 A;  3SYB A;  3LK2 B;  2XE3 A;  3AA1 B;  5DL5 A;  3UPG A;  5DL8 A;  3VZT X;  2MHL A;  4KRA A;  4D65 A;  3QRC A;  3T0S A;  1GFQ A;  4AFK A;  4B61 A;  4FZN A;  1GFM A;  2XTQ A;  3WI5 A;  3HOE A;  6PRN A;  2QTK A;  4AYE C;  4G75 A;  1ZHY A;  2M07 A;  3SYS A;  4RLB A;  2ERV A;  2XE5 A;  4RL9 A;  2KC0 A;  4AYN A;  2XG6 A;  5ADX L;  2XTR A;  3T20 A;  4KR8 A;  4AYD C;  4FSO A;  3C5O A;  3VY9 X;  1ORM A;  1IZN B;  1OPF A;  2F1V A;  3AA1 A;  1GFP A;  2K0L A;  5T5F A;  2FGQ X;  4F4B A;  1THQ A;  3AAE B;  4AYI D;  5IYU A;  4GCS A;  5D5D A;  4JFB A;  3LK4 2;  2YPV A;  3LK3 A;  3QRA A;  3RBH A;  3POR A;  3VE2 A;  4RJX A;  3LK4 1;  3V8U A;  2Y7S A;  4O3W A;  3T24 A;  3UAQ A;  1ZHW A;  2KDY A;  3POQ A;  2ODJ A;  4JCH A;  3GP6 A;  2FGR A;  4FMS A;  4AKR A;  4PUX A;  3KVD D;  1Q9F A;  1PRN A;  4Z3T A;  4XNK A;  4O3X B;  3WI4 A;  1MM5 A;  4GCP A;  1GFO A;  3AA7 A;  4XNL A;  5AFU K;  2Y0K A;  3FYX A;  4FZL A;  4LSH A;  3VZW X;  3O0E A;  1OSM A;  3A2S X;  4GCQ A;  1QJP A;  4FUV A;  4G76 A;  1P4T A;  2XE1 A;  3LK3 B;  2MNH A;  4FRX A;  3EMN X;  4LSI A;  4C69 X;  2PRN A;  5FVN A;  1BXW A;  1Q9G A;  3G7G A;  2O4V A;  4N58 A;  1E54 A;  2J4U P;  3POX A;  2YNK A;  1ZHX A;  1YS5 A;  3AAA B;  4FOZ A;  4FRT A;  3AA7 B;  4O3Y A;  1ZHZ A;  4FES A;  3PQU A;  1PHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...