2OMFA

Ompf porin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Refined Structure of Ompf Porin from E.Coli at 2.4 Angstroms Resolution
rcsb
molecule tags Integral membrane protein porin
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2omfA00
3FYXA 2XE5A 1GFNA 1GFMA 3VZTX 3VZUX 4LSHA 2O4VA 4GCPA 4LSFA 4FT6A 4RJWA 1PRNA 4KRAA 2ZLDA 3PRNA 3T0SA 5DL5A 4LSIA 2QTKA 3SYBA 1HXUA 4BUMX 3WI4A 6PRNA 3EMNX 1GFPA 3POQA 5JDPA 3T24A 2J1NA 8PRNA 4D64A 1MPFA 4FMSA 3SZDA 4JFBA 5DL6A 4FOZA 5DL8A 1E54A 3K19A 2FGRA 2XE1A 1GFQA 2K4TA 3VY9X 2ZFGA 3HW9A 3SY9A 3UU2A 4D65A 2ODJA 3SYSA 1PHOA 3NSGA 2XG6A 5DL7A 3A2SX 3SZVA 4D5UA 5PRNA 2PORA 1OPFA 2OMFA 3T20A 4FSOA 3PORA 1HXXA 2XE3A 4KR4A 1GFOA 2XE2A 3POUA 7PRNA 2Y0KA 4LSEA 4FSPA 2Y0LA 3JTYA 4GCSA 2PRNA 5FVNA 4FRXA 3UPGA 3HWBA 1BT9A 3WI5A 3VZWX 1HXTA 2FGQX 1BH3A 4GCQA 3SY7A 2Y2XA 2J4UP 1H6S1 3O0EA 3POXA 4FRTA 4KR8A 3VY8X 4RJXA 4AUIA 4C69X 1OSMA 2Y0HA
chains in the Genus database with same CATH superfamily
2WJQA 2GE4A 2AXTO 3FYXA 2XE5A 1GFNA 1GFMA 3VZTX 3VZUX 2LHFA 2R88A 4LSHA 5B5EO 5AFUL 4N58A 2MHLA 3AA7B 4GHBA 2O4VA 3AAAB 5G38A 4GCPA 2R4PA 1YS5A 2N2LA 4FZLA 2R4NA 4LSFA 3LK3A 4FT6A 1QJ8A 4RJWA 4KRAA 3UAQA 2ZLDA 1ZHYA 3PRNA 3G7GA 5G26A 5DL5A 5T5FA 4LSIA 4XNLA 3T0SA 4C4VA 2QTKA 3SYBA 4PR7A 3AA1A 1HXUA 2F1VA 2XTQA 4BUMX 3DA4A 1IZNB 2YPVA 3LK42 3WI4A 3EMNX 6PRNA 1GFPA 3POQA 2YNKA 3JCUO 3T24A 5JDPA 4AKRA 1QJ9A 2J1NA 4Z3TA 8PRNA 5GTIO 4F4BA 4D64A 1MPFA 3PGUA 2W80C 4N59A 2X27X 4FMSA 3SZDA 1G90A 4JFBA 5DL6A 2LFUA 4O3YA 2IWVA 4FOZA 1E54A 5DL8A 4N75A 3K19A 4FUVA 1MM5A 2FGRA 3HOLA 2XE1A 1GFQA 2KZ7A 4JCHA 4C4VB 2K4TA 3LK2B 1T16A 3AA0B 5TISO 1S5LO 3VY9X 2R4LA 2ZFGA 2MNHA 2WVPA 3HW9A 3AAEA 3SY9A 4AYID 5D5DA 3UU2A 4RL9A 4D65A 4AYEC 3QRAA 3PF1A 3KVDD 2KXPA 3BS0A 4AYDC 2ODJA 3SYSA 3TZGA 3AA6A 3QRCA 1PHOA 3RBHA 3NSGA 2XG6A 4E1TA 5DL7A 1MM4A 4B61A 3A2SX 4K3BA 3SZVA 3DWOX 1ZHWA 4O49A 5PRNA 3WU2O 4O4XA 4D5UA 5AFUK 1QJPA 2F1TA 1OPFA 2PORA 2OMFA 3HOEA 3BRYA 3DA3A 1T1LA 3KZIO 4XNKA 2K0LA 4AYMC 3T20A 4FSOA 3NJTA 4PUXA 3VE2A 2XMXA 3C5OA 3AAEB 2M06A 2F1CX 5GTHO 4O3ZA 3PORA 4N74A 3V8UA 4AZLA 1HXXA 3PQUA 2XE3A 4G76A 5H2FO 3PQSA 2R8AA 4K3CA 4KR4A 3A0HO 4QQ1A 4UB6O 4CTDA 5B66O 1GFOA 3AA7A 2XE2A 5G3AA 1ORMA 2ERVA 3AAAA 3POUA 4FESA 7PRNA 2Y0KA 4LSEA 4AKRB 1P4TA 2JQYA 4FSPA 2Y0LA 3JTYA 3LK3B 4GCSA 2PRNA 4GF4A 2XTRA 4RLBA 2Y0HA 5FVNA 3GP6A 4AKMA 5ADXK 2JMMA 4FRXA 4UB8O 5KAIO 2X9KA 3VE1A 4FZNA 3UPGA 1ZHTA 4AFKA 1ZHXA 3HWBA 5IYUA 1BT9A 3WI5A 4IL6O 5GV0A 4E1SA 2KZ7B 2N2MA 4PJ0O 3LK2A 4O3XB 3VZWX 1HXTA 2FGQX 5E79O 1BH3A 2WJRA 4GCQA 4U9CA 3SY7A 2KC0A 2Y7SA 2Y2XA 1BXWA 4G75A 1ZHZA 4C00A 2IWWA 1THQA 5KAFO 2J4UP 1H6S1 2KXPB 2KDYA 3BRZA 3O0EA 3POXA 4FRTA 4KR8A 4O4UA 5ADXL 4AYNA 3PGSA 5G39A 4FZMA 3VY8X 3LK41 4RJXA 3AA0A 4AUIA 1Q9FA 4C69X 3DWNA 1OSMA 3A0BO 4O3WA 2R89A 3DZMA 2W81C 5EE2A 4FQEA 2M07A 3PGRA 4RLCA 2R4OA 1Q9GA 3AA1B 1PRNA 3AA6B 1IZNA
chains in the Genus database with same CATH topology
2GE4A 3FYXA 2XE5A 1GFNA 1GFMA 3VZTX 3VZUX 2LHFA 4LSHA 5AFUL 4N58A 2MHLA 3AA7B 4GHBA 2O4VA 3AAAB 4GCPA 1YS5A 2N2LA 4FZLA 4LSFA 3LK3A 4FT6A 1QJ8A 4RJWA 1PRNA 4KRAA 3UAQA 2ZLDA 1ZHYA 3PRNA 3G7GA 5G26A 5DL5A 5T5FA 4LSIA 4XNLA 3T0SA 2QTKA 3SYBA 3AA1A 1HXUA 2F1VA 2XTQA 4BUMX 3DA4A 1IZNB 2YPVA 3LK42 3WI4A 3EMNX 6PRNA 1GFPA 3POQA 2YNKA 3T24A 5JDPA 4AKRA 1QJ9A 2J1NA 4Z3TA 8PRNA 4F4BA 4D64A 1MPFA 2W80C 4N59A 2X27X 4FMSA 3SZDA 1G90A 4JFBA 5DL6A 2LFUA 4O3YA 4FOZA 5DL8A 1E54A 3K19A 4FUVA 1MM5A 2FGRA 3HOLA 2XE1A 1GFQA 2KZ7A 4JCHA 2K4TA 3LK2B 3VY9X 3AA0B 2ZFGA 2MNHA 3HW9A 3AAEA 3SY9A 4AYID 5D5DA 3UU2A 4RL9A 4D65A 4AYEC 3QRAA 3KVDD 2KXPA 4AYDC 2ODJA 3SYSA 3TZGA 3AA6A 3QRCA 1PHOA 3RBHA 3NSGA 2XG6A 4E1TA 5DL7A 1MM4A 3A2SX 3SZVA 4D5UA 1ZHWA 4O49A 5PRNA 4O4XA 5AFUK 1QJPA 2F1TA 1OPFA 2PORA 2OMFA 3HOEA 3DA3A 4XNKA 4AYMC 4B61A 2K0LA 3T20A 4FSOA 4PUXA 3VE2A 2XMXA 3C5OA 3AAEB 2M06A 4O3ZA 3PORA 3V8UA 4AZLA 1HXXA 3PQUA 2XE3A 4G76A 3PQSA 4KR4A 4QQ1A 1GFOA 3AA7A 2XE2A 1ORMA 2ERVA 3AAAA 3POUA 4FESA 7PRNA 2Y0KA 4LSEA 4AKRB 1P4TA 4FSPA 2Y0LA 3JTYA 3LK3B 4GCSA 2PRNA 4GF4A 2XTRA 4RLBA 5FVNA 4AKMA 3GP6A 5ADXK 2JMMA 4FRXA 3VE1A 4FZNA 3UPGA 1ZHTA 4AFKA 1ZHXA 3HWBA 5IYUA 1BT9A 3WI5A 5GV0A 4E1SA 2KZ7B 2N2MA 3LK2A 4O3XB 3VZWX 1HXTA 2FGQX 1BH3A 4GCQA 4U9CA 3SY7A 2KC0A 2Y7SA 2Y2XA 1BXWA 4G75A 1ZHZA 1THQA 2J4UP 1H6S1 2KXPB 2KDYA 3O0EA 3POXA 4FRTA 4KR8A 4O4UA 5ADXL 4AYNA 4FZMA 3VY8X 3LK41 4RJXA 3AA0A 4AUIA 1Q9FA 4C69X 1OSMA 4O3WA 2W81C 5EE2A 2M07A 4RLCA 1Q9GA 3AA1B 2Y0HA 3AA6B 1IZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FYX A;  2XE5 A;  1GFN A;  1GFM A;  3VZT X;  3VZU X;  4LSH A;  2O4V A;  4GCP A;  4LSF A;  4FT6 A;  4RJW A;  1PRN A;  4KRA A;  2ZLD A;  3PRN A;  3T0S A;  5DL5 A;  4LSI A;  2QTK A;  3SYB A;  1HXU A;  4BUM X;  3WI4 A;  6PRN A;  3EMN X;  1GFP A;  3POQ A;  5JDP A;  3T24 A;  2J1N A;  8PRN A;  4D64 A;  1MPF A;  4FMS A;  3SZD A;  4JFB A;  5DL6 A;  4FOZ A;  5DL8 A;  1E54 A;  3K19 A;  2FGR A;  2XE1 A;  1GFQ A;  2K4T A;  3VY9 X;  2ZFG A;  3HW9 A;  3SY9 A;  3UU2 A;  4D65 A;  2ODJ A;  3SYS A;  1PHO A;  3NSG A;  2XG6 A;  5DL7 A;  3A2S X;  3SZV A;  4D5U A;  5PRN A;  2POR A;  1OPF A;  2OMF A;  3T20 A;  4FSO A;  3POR A;  1HXX A;  2XE3 A;  4KR4 A;  1GFO A;  2XE2 A;  3POU A;  7PRN A;  2Y0K A;  4LSE A;  4FSP A;  2Y0L A;  3JTY A;  4GCS A;  2PRN A;  5FVN A;  4FRX A;  3UPG A;  3HWB A;  1BT9 A;  3WI5 A;  3VZW X;  1HXT A;  2FGQ X;  1BH3 A;  4GCQ A;  3SY7 A;  2Y2X A;  2J4U P;  1H6S 1;  3O0E A;  3POX A;  4FRT A;  4KR8 A;  3VY8 X;  4RJX A;  4AUI A;  4C69 X;  1OSM A;  2Y0H A; 
#chains in the Genus database with same CATH topology
 2WJQ A;  2GE4 A;  2AXT O;  3FYX A;  2XE5 A;  1GFN A;  1GFM A;  3VZT X;  3VZU X;  2LHF A;  2R88 A;  4LSH A;  5B5E O;  5AFU L;  4N58 A;  2MHL A;  3AA7 B;  4GHB A;  2O4V A;  3AAA B;  5G38 A;  4GCP A;  2R4P A;  1YS5 A;  2N2L A;  4FZL A;  2R4N A;  4LSF A;  3LK3 A;  4FT6 A;  1QJ8 A;  4RJW A;  4KRA A;  3UAQ A;  2ZLD A;  1ZHY A;  3PRN A;  3G7G A;  5G26 A;  5DL5 A;  5T5F A;  4LSI A;  4XNL A;  3T0S A;  4C4V A;  2QTK A;  3SYB A;  4PR7 A;  3AA1 A;  1HXU A;  2F1V A;  2XTQ A;  4BUM X;  3DA4 A;  1IZN B;  2YPV A;  3LK4 2;  3WI4 A;  3EMN X;  6PRN A;  1GFP A;  3POQ A;  2YNK A;  3JCU O;  3T24 A;  5JDP A;  4AKR A;  1QJ9 A;  2J1N A;  4Z3T A;  8PRN A;  5GTI O;  4F4B A;  4D64 A;  1MPF A;  3PGU A;  2W80 C;  4N59 A;  2X27 X;  4FMS A;  3SZD A;  1G90 A;  4JFB A;  5DL6 A;  2LFU A;  4O3Y A;  2IWV A;  4FOZ A;  1E54 A;  5DL8 A;  4N75 A;  3K19 A;  4FUV A;  1MM5 A;  2FGR A;  3HOL A;  2XE1 A;  1GFQ A;  2KZ7 A;  4JCH A;  4C4V B;  2K4T A;  3LK2 B;  1T16 A;  3AA0 B;  5TIS O;  1S5L O;  3VY9 X;  2R4L A;  2ZFG A;  2MNH A;  2WVP A;  3HW9 A;  3AAE A;  3SY9 A;  4AYI D;  5D5D A;  3UU2 A;  4RL9 A;  4D65 A;  4AYE C;  3QRA A;  3PF1 A;  3KVD D;  2KXP A;  3BS0 A;  4AYD C;  2ODJ A;  3SYS A;  3TZG A;  3AA6 A;  3QRC A;  1PHO A;  3RBH A;  3NSG A;  2XG6 A;  4E1T A;  5DL7 A;  1MM4 A;  4B61 A;  3A2S X;  4K3B A;  3SZV A;  3DWO X;  1ZHW A;  4O49 A;  5PRN A;  3WU2 O;  4O4X A;  4D5U A;  5AFU K;  1QJP A;  2F1T A;  1OPF A;  2POR A;  2OMF A;  3HOE A;  3BRY A;  3DA3 A;  1T1L A;  3KZI O;  4XNK A;  2K0L A;  4AYM C;  3T20 A;  4FSO A;  3NJT A;  4PUX A;  3VE2 A;  2XMX A;  3C5O A;  3AAE B;  2M06 A;  2F1C X;  5GTH O;  4O3Z A;  3POR A;  4N74 A;  3V8U A;  4AZL A;  1HXX A;  3PQU A;  2XE3 A;  4G76 A;  5H2F O;  3PQS A;  2R8A A;  4K3C A;  4KR4 A;  3A0H O;  4QQ1 A;  4UB6 O;  4CTD A;  5B66 O;  1GFO A;  3AA7 A;  2XE2 A;  5G3A A;  1ORM A;  2ERV A;  3AAA A;  3POU A;  4FES A;  7PRN A;  2Y0K A;  4LSE A;  4AKR B;  1P4T A;  2JQY A;  4FSP A;  2Y0L A;  3JTY A;  3LK3 B;  4GCS A;  2PRN A;  4GF4 A;  2XTR A;  4RLB A;  2Y0H A;  5FVN A;  3GP6 A;  4AKM A;  5ADX K;  2JMM A;  4FRX A;  4UB8 O;  5KAI O;  2X9K A;  3VE1 A;  4FZN A;  3UPG A;  1ZHT A;  4AFK A;  1ZHX A;  3HWB A;  5IYU A;  1BT9 A;  3WI5 A;  4IL6 O;  5GV0 A;  4E1S A;  2KZ7 B;  2N2M A;  4PJ0 O;  3LK2 A;  4O3X B;  3VZW X;  1HXT A;  2FGQ X;  5E79 O;  1BH3 A;  2WJR A;  4GCQ A;  4U9C A;  3SY7 A;  2KC0 A;  2Y7S A;  2Y2X A;  1BXW A;  4G75 A;  1ZHZ A;  4C00 A;  2IWW A;  1THQ A;  5KAF O;  2J4U P;  1H6S 1;  2KXP B;  2KDY A;  3BRZ A;  3O0E A;  3POX A;  4FRT A;  4KR8 A;  4O4U A;  5ADX L;  4AYN A;  3PGS A;  5G39 A;  4FZM A;  3VY8 X;  3LK4 1;  4RJX A;  3AA0 A;  4AUI A;  1Q9F A;  4C69 X;  3DWN A;  1OSM A;  3A0B O;  4O3W A;  2R89 A;  3DZM A;  2W81 C;  5EE2 A;  4FQE A;  2M07 A;  3PGR A;  4RLC A;  2R4O A;  1Q9G A;  3AA1 B;  1PRN A;  3AA6 B;  1IZN A; 
#chains in the Genus database with same CATH homology
 2GE4 A;  3FYX A;  2XE5 A;  1GFN A;  1GFM A;  3VZT X;  3VZU X;  2LHF A;  4LSH A;  5AFU L;  4N58 A;  2MHL A;  3AA7 B;  4GHB A;  2O4V A;  3AAA B;  4GCP A;  1YS5 A;  2N2L A;  4FZL A;  4LSF A;  3LK3 A;  4FT6 A;  1QJ8 A;  4RJW A;  1PRN A;  4KRA A;  3UAQ A;  2ZLD A;  1ZHY A;  3PRN A;  3G7G A;  5G26 A;  5DL5 A;  5T5F A;  4LSI A;  4XNL A;  3T0S A;  2QTK A;  3SYB A;  3AA1 A;  1HXU A;  2F1V A;  2XTQ A;  4BUM X;  3DA4 A;  1IZN B;  2YPV A;  3LK4 2;  3WI4 A;  3EMN X;  6PRN A;  1GFP A;  3POQ A;  2YNK A;  3T24 A;  5JDP A;  4AKR A;  1QJ9 A;  2J1N A;  4Z3T A;  8PRN A;  4F4B A;  4D64 A;  1MPF A;  2W80 C;  4N59 A;  2X27 X;  4FMS A;  3SZD A;  1G90 A;  4JFB A;  5DL6 A;  2LFU A;  4O3Y A;  4FOZ A;  5DL8 A;  1E54 A;  3K19 A;  4FUV A;  1MM5 A;  2FGR A;  3HOL A;  2XE1 A;  1GFQ A;  2KZ7 A;  4JCH A;  2K4T A;  3LK2 B;  3VY9 X;  3AA0 B;  2ZFG A;  2MNH A;  3HW9 A;  3AAE A;  3SY9 A;  4AYI D;  5D5D A;  3UU2 A;  4RL9 A;  4D65 A;  4AYE C;  3QRA A;  3KVD D;  2KXP A;  4AYD C;  2ODJ A;  3SYS A;  3TZG A;  3AA6 A;  3QRC A;  1PHO A;  3RBH A;  3NSG A;  2XG6 A;  4E1T A;  5DL7 A;  1MM4 A;  3A2S X;  3SZV A;  4D5U A;  1ZHW A;  4O49 A;  5PRN A;  4O4X A;  5AFU K;  1QJP A;  2F1T A;  1OPF A;  2POR A;  2OMF A;  3HOE A;  3DA3 A;  4XNK A;  4AYM C;  4B61 A;  2K0L A;  3T20 A;  4FSO A;  4PUX A;  3VE2 A;  2XMX A;  3C5O A;  3AAE B;  2M06 A;  4O3Z A;  3POR A;  3V8U A;  4AZL A;  1HXX A;  3PQU A;  2XE3 A;  4G76 A;  3PQS A;  4KR4 A;  4QQ1 A;  1GFO A;  3AA7 A;  2XE2 A;  1ORM A;  2ERV A;  3AAA A;  3POU A;  4FES A;  7PRN A;  2Y0K A;  4LSE A;  4AKR B;  1P4T A;  4FSP A;  2Y0L A;  3JTY A;  3LK3 B;  4GCS A;  2PRN A;  4GF4 A;  2XTR A;  4RLB A;  5FVN A;  4AKM A;  3GP6 A;  5ADX K;  2JMM A;  4FRX A;  3VE1 A;  4FZN A;  3UPG A;  1ZHT A;  4AFK A;  1ZHX A;  3HWB A;  5IYU A;  1BT9 A;  3WI5 A;  5GV0 A;  4E1S A;  2KZ7 B;  2N2M A;  3LK2 A;  4O3X B;  3VZW X;  1HXT A;  2FGQ X;  1BH3 A;  4GCQ A;  4U9C A;  3SY7 A;  2KC0 A;  2Y7S A;  2Y2X A;  1BXW A;  4G75 A;  1ZHZ A;  1THQ A;  2J4U P;  1H6S 1;  2KXP B;  2KDY A;  3O0E A;  3POX A;  4FRT A;  4KR8 A;  4O4U A;  5ADX L;  4AYN A;  4FZM A;  3VY8 X;  3LK4 1;  4RJX A;  3AA0 A;  4AUI A;  1Q9F A;  4C69 X;  1OSM A;  4O3W A;  2W81 C;  5EE2 A;  2M07 A;  4RLC A;  1Q9G A;  3AA1 B;  2Y0H A;  3AA6 B;  1IZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...