2OMFA

Ompf porin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Integral membrane protein porin
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title The Refined Structure of Ompf Porin from E.Coli at 2.4 Angstroms Resolution
rcsb
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2omfA00
4GCQA 3VZWX 2O4VA 3WI4A 3O0EA 3SYBA 1GFPA 3VZUX 1HXTA 5DL8A 3POXA 3VY8X 5FVNA 2PRNA 3A2SX 1OSMA 1OPFA 3JTYA 4FT6A 5DL6A 1HXUA 2Y0KA 2PORA 2J4UP 4FOZA 3T0SA 2OMFA 1E54A 3POQA 3K19A 7PRNA 4LSHA 2FGRA 4KRAA 2XE3A 3POUA 2J1NA 3PORA 4RJXA 4GCSA 3VZTX 3T24A 1H6S1 4D5UA 2XG6A 4C69X 2ZFGA 3NSGA 2XE2A 4GCPA 3PRNA 4RJWA 3SZVA 3SZDA 1MPFA 1GFQA 5DL5A 3T20A 3SY9A 2QTKA 3UPGA 2XE1A 4FRTA 1BH3A 4FMSA 4LSIA 4D65A 4LSEA 3FYXA 2K4TA 5PRNA 1HXXA 5JDPA 2Y2XA 6PRNA 3SYSA 2FGQX 4BUMX 3WI5A 1BT9A 2Y0HA 2ODJA 3VY9X 4KR8A 1GFMA 4FSOA 4FRXA 4JFBA 3HW9A 1PRNA 8PRNA 4FSPA 1GFNA 2Y0LA 1PHOA 3EMNX 4AUIA 2ZLDA 4LSFA 2XE5A 5DL7A 3HWBA 1GFOA 4D64A 3SY7A 4KR4A 3UU2A
chains in the Genus database with same CATH superfamily
1ZHZA 2F1TA 3BRYA 4N59A 4GCQA 3HOEA 3AA6A 4PUXA 5D5DA 5GV0A 4C00A 3LK41 3TZGA 1ZHTA 2O4VA 3VZWX 4AYID 5G38A 5T5FA 4O3ZA 3WI4A 2M06A 1THQA 3BRZA 3O0EA 3SYBA 4Z3TA 1GFPA 4XNLA 3VZUX 4XNKA 3AA0A 2AXTO 3QRAA 3GP6A 3LK42 4O3YA 1HXTA 5DL8A 1ZHYA 1MM4A 3POXA 2W81C 1T1LA 4RLCA 5FVNA 3VY8X 3LK2B 5AFUL 2PRNA 3A2SX 5KAIO 4FZMA 1IZNB 4FUVA 4RLBA 3LK2A 1OSMA 4G76A 4O3WA 1OPFA 3JTYA 4QQ1A 2K0LA 4FT6A 1IZNA 5DL6A 4AYMC 1HXUA 2LHFA 2Y0KA 3AA6B 2KXPB 2F1CX 2PORA 2M07A 2J4UP 1MM5A 3A0HO 4FOZA 3T0SA 2KXPA 1YS5A 2OMFA 2R88A 3A0BO 1E54A 3POQA 5EE2A 3PGRA 3K19A 4E1TA 7PRNA 2XMXA 3AA0B 4LSHA 3QRCA 4AYNA 2FGRA 1QJPA 1S5LO 4IL6O 4KRAA 4AYDC 2XE3A 3KZIO 3POUA 5H2FO 2XTQA 2J1NA 3PORA 4RJXA 4GCSA 3VZTX 5IYUA 2X27X 3T24A 2F1VA 2R4OA 1H6S1 2JMMA 4N75A 4AZLA 4D5UA 3BS0A 2XG6A 3RBHA 4C69X 4FQEA 2R4NA 2KC0A 3PGUA 2ZFGA 3NSGA 4FZNA 2XE2A 4K3CA 4GCPA 3PRNA 4RJWA 3WU2O 3AAEB 2X9KA 3UAQA 3G7GA 3PF1A 3SZVA 3SZDA 3V8UA 4C4VB 1MPFA 1GFQA 2YNKA 2R4LA 3AAEA 5DL5A 5PRNA 3DWNA 3VE2A 4AFKA 4C4VA 3T20A 3SY9A 5G26A 2N2MA 5G3AA 4U9CA 2QTKA 3UPGA 2XE1A 4FRTA 1BXWA 2KZ7A 5ADXK 2WJQA 1BH3A 4FMSA 4O4XA 4K3BA 5GTHO 2N2LA 4LSIA 4D65A 3PQSA 2LFUA 2W80C 4PJ0O 4AKMA 4LSEA 4B61A 3FYXA 2K4TA 1ORMA 1HXXA 1Q9GA 2XTRA 4JCHA 3DA3A 1P4TA 2Y2XA 5E79O 5JDPA 3DWOX 6PRNA 3SYSA 2FGQX 2KDYA 4BUMX 3WI5A 5TISO 1BT9A 4GF4A 2JQYA 2Y0HA 2Y7SA 2YPVA 4F4BA 2ODJA 3VY9X 5KAFO 4KR8A 2IWWA 4N58A 1GFMA 3JCUO 2MHLA 3DA4A 4FSOA 2MNHA 4AKRB 4FRXA 2R8AA 4JFBA 3HOLA 4UB8O 4AKRA 3HW9A 3LK3B 3PQUA 4N74A 4O3XB 2R4PA 5GTIO 1PRNA 1Q9FA 2KZ7B 1T16A 1ZHWA 5AFUK 3LK3A 4RL9A 2WJRA 8PRNA 4FSPA 2R89A 4CTDA 5G39A 3AA1B 4FZLA 4O49A 1GFNA 3C5OA 2ERVA 2Y0LA 4KR4A 2IWVA 1PHOA 3AA7B 3EMNX 3KVDD 3AA1A 4G75A 4AUIA 5B66O 4O4UA 4E1SA 1QJ8A 2ZLDA 3AAAB 3AA7A 4AYEC 4LSFA 3DZMA 2GE4A 2WVPA 3NJTA 4GHBA 3PGSA 4UB6O 2XE5A 5DL7A 5ADXL 3AAAA 3HWBA 4PR7A 1GFOA 3VE1A 1G90A 4FESA 4D64A 3SY7A 1ZHXA 5B5EO 1QJ9A 3UU2A
chains in the Genus database with same CATH topology
1ZHZA 2F1TA 4N59A 4GCQA 3HOEA 3AA6A 4PUXA 5D5DA 5GV0A 3LK41 3TZGA 1ZHTA 2O4VA 3VZWX 4AYID 5T5FA 3WI4A 4O3ZA 2M06A 1THQA 3O0EA 3SYBA 4Z3TA 1GFPA 4XNLA 3VZUX 4XNKA 3AA0A 3QRAA 3GP6A 3LK42 4O3YA 1HXTA 5DL8A 1ZHYA 1MM4A 3POXA 2W81C 4RLCA 5FVNA 3VY8X 3LK2B 5AFUL 2PRNA 3A2SX 4FZMA 1IZNB 4FUVA 4RLBA 3LK2A 1OSMA 4G76A 4O3WA 1OPFA 3JTYA 4QQ1A 2K0LA 4FT6A 1IZNA 5DL6A 4AYMC 1HXUA 2LHFA 2Y0KA 3AA6B 2KXPB 2PORA 2M07A 2J4UP 1MM5A 4FOZA 3T0SA 2KXPA 1YS5A 2OMFA 1E54A 3POQA 5EE2A 3K19A 4E1TA 7PRNA 2XMXA 3AA0B 4LSHA 3QRCA 4AYNA 2FGRA 1QJPA 4KRAA 4AYDC 2XE3A 3POUA 2XTQA 2J1NA 3PORA 4RJXA 4GCSA 3VZTX 5IYUA 2X27X 3T24A 2F1VA 1H6S1 2JMMA 4AZLA 4D5UA 2XG6A 3RBHA 4C69X 2KC0A 2ZFGA 3NSGA 4FZNA 2XE2A 4GCPA 3PRNA 4RJWA 3AAEB 3UAQA 3G7GA 3SZVA 3SZDA 3V8UA 1MPFA 1GFQA 2YNKA 3AAEA 5DL5A 3VE2A 4AFKA 3T20A 3SY9A 5G26A 2N2MA 4U9CA 2QTKA 3UPGA 2XE1A 4FRTA 1BXWA 2KZ7A 5ADXK 1BH3A 4FMSA 4O4XA 2N2LA 4LSIA 4D65A 3PQSA 2LFUA 2W80C 4B61A 4AKMA 4LSEA 3FYXA 2K4TA 1ORMA 1HXXA 1Q9GA 2XTRA 4JCHA 3DA3A 1P4TA 2Y2XA 5PRNA 5JDPA 6PRNA 3SYSA 2FGQX 2KDYA 4BUMX 3WI5A 1BT9A 4GF4A 2YPVA 2Y0HA 2Y7SA 4F4BA 2ODJA 3VY9X 4KR8A 4N58A 1GFMA 4FSOA 2MHLA 3DA4A 2MNHA 4AKRB 4FRXA 4JFBA 3HOLA 4AKRA 3HW9A 3LK3B 3PQUA 4O3XB 1PRNA 1Q9FA 2KZ7B 1ZHWA 5AFUK 3LK3A 4RL9A 8PRNA 4FSPA 3AA1B 4FZLA 4O49A 1GFNA 3C5OA 2ERVA 2Y0LA 4KR4A 4G75A 1PHOA 3AA7B 3EMNX 3KVDD 3AA1A 4AUIA 4O4UA 4E1SA 1QJ8A 2ZLDA 3AAAB 3AA7A 4AYEC 4LSFA 2GE4A 4GHBA 2XE5A 5DL7A 5ADXL 3AAAA 3HWBA 3VE1A 1GFOA 1G90A 4FESA 4D64A 3SY7A 1ZHXA 1QJ9A 3UU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCQ A;  3VZW X;  2O4V A;  3WI4 A;  3O0E A;  3SYB A;  1GFP A;  3VZU X;  1HXT A;  5DL8 A;  3POX A;  3VY8 X;  5FVN A;  2PRN A;  3A2S X;  1OSM A;  1OPF A;  3JTY A;  4FT6 A;  5DL6 A;  1HXU A;  2Y0K A;  2POR A;  2J4U P;  4FOZ A;  3T0S A;  2OMF A;  1E54 A;  3POQ A;  3K19 A;  7PRN A;  4LSH A;  2FGR A;  4KRA A;  2XE3 A;  3POU A;  2J1N A;  3POR A;  4RJX A;  4GCS A;  3VZT X;  3T24 A;  1H6S 1;  4D5U A;  2XG6 A;  4C69 X;  2ZFG A;  3NSG A;  2XE2 A;  4GCP A;  3PRN A;  4RJW A;  3SZV A;  3SZD A;  1MPF A;  1GFQ A;  5DL5 A;  3T20 A;  3SY9 A;  2QTK A;  3UPG A;  2XE1 A;  4FRT A;  1BH3 A;  4FMS A;  4LSI A;  4D65 A;  4LSE A;  3FYX A;  2K4T A;  5PRN A;  1HXX A;  5JDP A;  2Y2X A;  6PRN A;  3SYS A;  2FGQ X;  4BUM X;  3WI5 A;  1BT9 A;  2Y0H A;  2ODJ A;  3VY9 X;  4KR8 A;  1GFM A;  4FSO A;  4FRX A;  4JFB A;  3HW9 A;  1PRN A;  8PRN A;  4FSP A;  1GFN A;  2Y0L A;  1PHO A;  3EMN X;  4AUI A;  2ZLD A;  4LSF A;  2XE5 A;  5DL7 A;  3HWB A;  1GFO A;  4D64 A;  3SY7 A;  4KR4 A;  3UU2 A; 
#chains in the Genus database with same CATH topology
 1ZHZ A;  2F1T A;  3BRY A;  4N59 A;  4GCQ A;  3HOE A;  3AA6 A;  4PUX A;  5D5D A;  5GV0 A;  4C00 A;  3LK4 1;  3TZG A;  1ZHT A;  2O4V A;  3VZW X;  4AYI D;  5G38 A;  5T5F A;  4O3Z A;  3WI4 A;  2M06 A;  1THQ A;  3BRZ A;  3O0E A;  3SYB A;  4Z3T A;  1GFP A;  4XNL A;  3VZU X;  4XNK A;  3AA0 A;  2AXT O;  3QRA A;  3GP6 A;  3LK4 2;  4O3Y A;  1HXT A;  5DL8 A;  1ZHY A;  1MM4 A;  3POX A;  2W81 C;  1T1L A;  4RLC A;  5FVN A;  3VY8 X;  3LK2 B;  5AFU L;  2PRN A;  3A2S X;  5KAI O;  4FZM A;  1IZN B;  4FUV A;  4RLB A;  3LK2 A;  1OSM A;  4G76 A;  4O3W A;  1OPF A;  3JTY A;  4QQ1 A;  2K0L A;  4FT6 A;  1IZN A;  5DL6 A;  4AYM C;  1HXU A;  2LHF A;  2Y0K A;  3AA6 B;  2KXP B;  2F1C X;  2POR A;  2M07 A;  2J4U P;  1MM5 A;  3A0H O;  4FOZ A;  3T0S A;  2KXP A;  1YS5 A;  2OMF A;  2R88 A;  3A0B O;  1E54 A;  3POQ A;  5EE2 A;  3PGR A;  3K19 A;  4E1T A;  7PRN A;  2XMX A;  3AA0 B;  4LSH A;  3QRC A;  4AYN A;  2FGR A;  1QJP A;  1S5L O;  4IL6 O;  4KRA A;  4AYD C;  2XE3 A;  3KZI O;  3POU A;  5H2F O;  2XTQ A;  2J1N A;  3POR A;  4RJX A;  4GCS A;  3VZT X;  5IYU A;  2X27 X;  3T24 A;  2F1V A;  2R4O A;  1H6S 1;  2JMM A;  4N75 A;  4AZL A;  4D5U A;  3BS0 A;  2XG6 A;  3RBH A;  4C69 X;  4FQE A;  2R4N A;  2KC0 A;  3PGU A;  2ZFG A;  3NSG A;  4FZN A;  2XE2 A;  4K3C A;  4GCP A;  3PRN A;  4RJW A;  3WU2 O;  3AAE B;  2X9K A;  3UAQ A;  3G7G A;  3PF1 A;  3SZV A;  3SZD A;  3V8U A;  4C4V B;  1MPF A;  1GFQ A;  2YNK A;  2R4L A;  3AAE A;  5DL5 A;  5PRN A;  3DWN A;  3VE2 A;  4AFK A;  4C4V A;  3T20 A;  3SY9 A;  5G26 A;  2N2M A;  5G3A A;  4U9C A;  2QTK A;  3UPG A;  2XE1 A;  4FRT A;  1BXW A;  2KZ7 A;  5ADX K;  2WJQ A;  1BH3 A;  4FMS A;  4O4X A;  4K3B A;  5GTH O;  2N2L A;  4LSI A;  4D65 A;  3PQS A;  2LFU A;  2W80 C;  4PJ0 O;  4AKM A;  4LSE A;  4B61 A;  3FYX A;  2K4T A;  1ORM A;  1HXX A;  1Q9G A;  2XTR A;  4JCH A;  3DA3 A;  1P4T A;  2Y2X A;  5E79 O;  5JDP A;  3DWO X;  6PRN A;  3SYS A;  2FGQ X;  2KDY A;  4BUM X;  3WI5 A;  5TIS O;  1BT9 A;  4GF4 A;  2JQY A;  2Y0H A;  2Y7S A;  2YPV A;  4F4B A;  2ODJ A;  3VY9 X;  5KAF O;  4KR8 A;  2IWW A;  4N58 A;  1GFM A;  3JCU O;  2MHL A;  3DA4 A;  4FSO A;  2MNH A;  4AKR B;  4FRX A;  2R8A A;  4JFB A;  3HOL A;  4UB8 O;  4AKR A;  3HW9 A;  3LK3 B;  3PQU A;  4N74 A;  4O3X B;  2R4P A;  5GTI O;  1PRN A;  1Q9F A;  2KZ7 B;  1T16 A;  1ZHW A;  5AFU K;  3LK3 A;  4RL9 A;  2WJR A;  8PRN A;  4FSP A;  2R89 A;  4CTD A;  5G39 A;  3AA1 B;  4FZL A;  4O49 A;  1GFN A;  3C5O A;  2ERV A;  2Y0L A;  4KR4 A;  2IWV A;  1PHO A;  3AA7 B;  3EMN X;  3KVD D;  3AA1 A;  4G75 A;  4AUI A;  5B66 O;  4O4U A;  4E1S A;  1QJ8 A;  2ZLD A;  3AAA B;  3AA7 A;  4AYE C;  4LSF A;  3DZM A;  2GE4 A;  2WVP A;  3NJT A;  4GHB A;  3PGS A;  4UB6 O;  2XE5 A;  5DL7 A;  5ADX L;  3AAA A;  3HWB A;  4PR7 A;  1GFO A;  3VE1 A;  1G90 A;  4FES A;  4D64 A;  3SY7 A;  1ZHX A;  5B5E O;  1QJ9 A;  3UU2 A; 
#chains in the Genus database with same CATH homology
 1ZHZ A;  2F1T A;  4N59 A;  4GCQ A;  3HOE A;  3AA6 A;  4PUX A;  5D5D A;  5GV0 A;  3LK4 1;  3TZG A;  1ZHT A;  2O4V A;  3VZW X;  4AYI D;  5T5F A;  3WI4 A;  4O3Z A;  2M06 A;  1THQ A;  3O0E A;  3SYB A;  4Z3T A;  1GFP A;  4XNL A;  3VZU X;  4XNK A;  3AA0 A;  3QRA A;  3GP6 A;  3LK4 2;  4O3Y A;  1HXT A;  5DL8 A;  1ZHY A;  1MM4 A;  3POX A;  2W81 C;  4RLC A;  5FVN A;  3VY8 X;  3LK2 B;  5AFU L;  2PRN A;  3A2S X;  4FZM A;  1IZN B;  4FUV A;  4RLB A;  3LK2 A;  1OSM A;  4G76 A;  4O3W A;  1OPF A;  3JTY A;  4QQ1 A;  2K0L A;  4FT6 A;  1IZN A;  5DL6 A;  4AYM C;  1HXU A;  2LHF A;  2Y0K A;  3AA6 B;  2KXP B;  2POR A;  2M07 A;  2J4U P;  1MM5 A;  4FOZ A;  3T0S A;  2KXP A;  1YS5 A;  2OMF A;  1E54 A;  3POQ A;  5EE2 A;  3K19 A;  4E1T A;  7PRN A;  2XMX A;  3AA0 B;  4LSH A;  3QRC A;  4AYN A;  2FGR A;  1QJP A;  4KRA A;  4AYD C;  2XE3 A;  3POU A;  2XTQ A;  2J1N A;  3POR A;  4RJX A;  4GCS A;  3VZT X;  5IYU A;  2X27 X;  3T24 A;  2F1V A;  1H6S 1;  2JMM A;  4AZL A;  4D5U A;  2XG6 A;  3RBH A;  4C69 X;  2KC0 A;  2ZFG A;  3NSG A;  4FZN A;  2XE2 A;  4GCP A;  3PRN A;  4RJW A;  3AAE B;  3UAQ A;  3G7G A;  3SZV A;  3SZD A;  3V8U A;  1MPF A;  1GFQ A;  2YNK A;  3AAE A;  5DL5 A;  3VE2 A;  4AFK A;  3T20 A;  3SY9 A;  5G26 A;  2N2M A;  4U9C A;  2QTK A;  3UPG A;  2XE1 A;  4FRT A;  1BXW A;  2KZ7 A;  5ADX K;  1BH3 A;  4FMS A;  4O4X A;  2N2L A;  4LSI A;  4D65 A;  3PQS A;  2LFU A;  2W80 C;  4B61 A;  4AKM A;  4LSE A;  3FYX A;  2K4T A;  1ORM A;  1HXX A;  1Q9G A;  2XTR A;  4JCH A;  3DA3 A;  1P4T A;  2Y2X A;  5PRN A;  5JDP A;  6PRN A;  3SYS A;  2FGQ X;  2KDY A;  4BUM X;  3WI5 A;  1BT9 A;  4GF4 A;  2YPV A;  2Y0H A;  2Y7S A;  4F4B A;  2ODJ A;  3VY9 X;  4KR8 A;  4N58 A;  1GFM A;  4FSO A;  2MHL A;  3DA4 A;  2MNH A;  4AKR B;  4FRX A;  4JFB A;  3HOL A;  4AKR A;  3HW9 A;  3LK3 B;  3PQU A;  4O3X B;  1PRN A;  1Q9F A;  2KZ7 B;  1ZHW A;  5AFU K;  3LK3 A;  4RL9 A;  8PRN A;  4FSP A;  3AA1 B;  4FZL A;  4O49 A;  1GFN A;  3C5O A;  2ERV A;  2Y0L A;  4KR4 A;  4G75 A;  1PHO A;  3AA7 B;  3EMN X;  3KVD D;  3AA1 A;  4AUI A;  4O4U A;  4E1S A;  1QJ8 A;  2ZLD A;  3AAA B;  3AA7 A;  4AYE C;  4LSF A;  2GE4 A;  4GHB A;  2XE5 A;  5DL7 A;  5ADX L;  3AAA A;  3HWB A;  3VE1 A;  1GFO A;  1G90 A;  4FES A;  4D64 A;  3SY7 A;  1ZHX A;  1QJ9 A;  3UU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...