2OMFA

Ompf porin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
b'AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title The Refined Structure of Ompf Porin from E.Coli at 2.4 Angstroms Resolution
rcsb
molecule tags Integral membrane protein porin
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2omfA00
2J1NA 3O0EA 4D65A 5FVNA 2FGQX 3WI5A 3PORA 2ZLDA 3SY9A 1HXTA 5PRNA 3A2SX 4FOZA 1HXUA 5DL7A 4FSOA 3SZVA 3SZDA 2QTKA 4FT6A 3UU2A 4FSPA 4RJWA 2O4VA 1HXXA 4AUIA 2XE2A 4LSIA 4KR8A 3SYBA 2Y0KA 4D5UA 2XE3A 1GFMA 4KRAA 3T20A 3FYXA 3POUA 2XE5A 3HWBA 2ODJA 2ZFGA 3VZWX 3POQA 2XE1A 3EMNX 4BUMX 4KR4A 3VY8X 2Y0LA 5DL8A 3HW9A 1PHOA 2Y0HA 4LSEA 1OSMA 2Y2XA 1GFQA 1GFOA 2FGRA 1BH3A 3PRNA 3SY7A 2J4UP 1MPFA 1E54A 3T24A 4LSFA 4LSHA 6PRNA 1PRNA 3VY9X 3VZUX 3K19A 3NSGA 4C69X 4RJXA 4FMSA 4GCPA 1GFNA 3VZTX 7PRNA 4GCSA 8PRNA 2K4TA 2PORA 5JDPA 4D64A 1OPFA 4GCQA 3T0SA 2OMFA 3POXA 4FRXA 1BT9A 3JTYA 5DL5A 3WI4A 1GFPA 4FRTA 1H6S1 3SYSA 2PRNA 4JFBA 5DL6A 2XG6A 3UPGA
chains in the Genus database with same CATH superfamily
5H2FO 3DZMA 3BRZA 2J1NA 3O0EA 4Z3TA 3PGRA 4D65A 4JCHA 2FGQX 5FVNA 3JCUO 3WI5A 3BRYA 2ZLDA 3NJTA 3PORA 4AKRB 3SY9A 1HXTA 4N58A 3AA7B 3A2SX 5PRNA 3HOEA 1IZNB 2YNKA 4FOZA 4K3BA 1HXUA 3AA6B 4O49A 5G39A 5DL7A 4FSOA 3SZVA 1Q9FA 1ZHYA 5KAIO 5TISO 3SZDA 1IZNA 2QTKA 3GP6A 4FT6A 5B66O 4IL6O 4FSPA 3UU2A 4AYEC 4RJWA 2O4VA 1HXXA 3LK3A 4N59A 1ZHTA 3QRAA 4AUIA 4UB6O 3KVDD 4AKRA 2XE2A 4LSIA 3LK2A 4KR8A 2Y0KA 3SYBA 1P4TA 4D5UA 2KXPA 2XE3A 1GFMA 4AYMC 4QQ1A 2KZ7A 4B61A 4F4BA 4AYDC 3PGUA 4KRAA 3FYXA 3T20A 3POUA 2JQYA 3DA3A 3HOLA 2IWVA 3LK41 3PQUA 1T1LA 3QRCA 2N2MA 4CTDA 2K0LA 2M06A 2XE5A 3DWNA 3LK42 5B5EO 5EE2A 3HWBA 4U9CA 3VE2A 2ODJA 1ORMA 4FQEA 2ZFGA 4FUVA 4FZNA 1S5LO 4O3WA 3VZWX 5G3AA 3POQA 3C5OA 5E79O 2XE1A 3EMNX 2R4LA 3LK3B 5IYUA 4BUMX 4KR4A 4PJ0O 2WJRA 2Y0LA 2LHFA 5DL8A 3HW9A 3KZIO 1PHOA 2W80C 2Y0HA 3LK2B 4O4XA 4PUXA 5D5DA 5T5FA 5AFUK 2KXPB 3A0HO 1MM4A 4LSEA 1OSMA 2KZ7B 2R4PA 2Y2XA 4G76A 5G26A 3G7GA 1GFQA 2MNHA 1ZHWA 4O3YA 4O3ZA 2F1CX 2M07A 3UAQA 5ADXL 1GFOA 2FGRA 2XTRA 1BH3A 3PF1A 4UB8O 3PRNA 4G75A 3SY7A 2J4UP 2R4NA 2R8AA 1QJPA 1ZHZA 2R88A 4FZMA 5KAFO 3WU2O 2AXTO 1MPFA 3AAAB 3RBHA 3AA0B 4E1TA 1E54A 3AA1A 3V8UA 3TZGA 4RLCA 2GE4A 3AAAA 3T24A 2LFUA 2N2LA 2X27X 3AA0A 4LSFA 4O3XB 2W81C 2R4OA 3AAEA 3DWOX 4LSHA 4AKMA 4AYID 4GF4A 6PRNA 1THQA 1PRNA 5GTIO 3VY9X 4C00A 3VY8X 3VZUX 3K19A 3NSGA 4XNKA 2MHLA 4C69X 4RJXA 4FMSA 4AFKA 4O4UA 2WVPA 4GCPA 1GFNA 4FZLA 4K3CA 2WJQA 1BXWA 4RLBA 3VZTX 4C4VA 4N74A 4AZLA 7PRNA 4GCSA 2R89A 4FESA 3DA4A 4AYNA 8PRNA 2K4TA 4E1SA 3AA1B 2PORA 4N75A 5ADXK 2IWWA 1ZHXA 2YPVA 3PQSA 1T16A 5JDPA 4D64A 2Y7SA 1QJ8A 2F1TA 1OPFA 4GCQA 3AAEB 3AA7A 2ERVA 3T0SA 2KDYA 1G90A 5GTHO 1Q9GA 2OMFA 1YS5A 2XTQA 3AA6A 3POXA 4FRXA 1BT9A 1MM5A 4PR7A 3JTYA 3PGSA 1QJ9A 2KC0A 2JMMA 4RL9A 1GFPA 5DL5A 5G38A 3VE1A 2F1VA 4FRTA 3WI4A 1H6S1 4C4VB 3SYSA 2PRNA 3A0BO 4JFBA 5AFUL 3BS0A 4XNLA 4GHBA 2X9KA 5DL6A 5GV0A 2XMXA 2XG6A 3UPGA
chains in the Genus database with same CATH topology
2J1NA 3O0EA 4Z3TA 4D65A 4JCHA 2FGQX 5FVNA 3WI5A 3PORA 2ZLDA 3SY9A 1HXTA 4N58A 3AA7B 3A2SX 5PRNA 3HOEA 1IZNB 2YNKA 4FOZA 1HXUA 3AA6B 4O49A 5DL7A 4FSOA 3SZVA 1Q9FA 1ZHYA 3SZDA 1IZNA 2QTKA 3GP6A 4FT6A 3UU2A 4FSPA 4AYEC 4RJWA 2O4VA 1HXXA 3LK3A 4N59A 1ZHTA 3QRAA 4AUIA 4AKRA 3KVDD 2XE2A 4LSIA 3LK2A 4KR8A 2Y0KA 3SYBA 1P4TA 4D5UA 2XE3A 2KXPA 1GFMA 4AYMC 4QQ1A 2KZ7A 4B61A 4F4BA 4AYDC 4KRAA 3T20A 3FYXA 3POUA 3DA3A 3HOLA 3LK41 3PQUA 3QRCA 2N2MA 2K0LA 2M06A 2XE5A 3LK42 5EE2A 3HWBA 4U9CA 3VE2A 2ODJA 1ORMA 4FUVA 2ZFGA 4FZNA 4O3WA 3VZWX 3POQA 3C5OA 2XE1A 3EMNX 3LK3B 5IYUA 4BUMX 4KR4A 3VY8X 5AFUL 2Y0LA 2LHFA 5DL8A 3HW9A 4AKRB 1PHOA 2W80C 2Y0HA 3LK2B 4O4XA 4PUXA 5D5DA 5T5FA 5AFUK 2KXPB 4LSEA 1MM4A 1OSMA 2KZ7B 2Y2XA 4G76A 5G26A 3G7GA 1GFQA 2MNHA 1ZHWA 4O3YA 4O3ZA 2M07A 3UAQA 5ADXL 1GFOA 2FGRA 2XTRA 1BH3A 3PRNA 4G75A 3SY7A 2J4UP 1QJPA 1ZHZA 4FZMA 1MPFA 3AAAB 3RBHA 3AA0B 4E1TA 1E54A 3AA1A 3V8UA 4RLCA 2GE4A 3AAAA 3T24A 2LFUA 2N2LA 2X27X 3AA0A 4LSFA 4O3XB 2W81C 3AAEA 4AKMA 4LSHA 4AYID 4GF4A 6PRNA 1THQA 1PRNA 3VY9X 3VZUX 3K19A 3NSGA 4XNKA 2MHLA 4C69X 4RJXA 4FMSA 4AFKA 4O4UA 4GCPA 1GFNA 4FZLA 4RLBA 1BXWA 3VZTX 4AZLA 7PRNA 4GCSA 4FESA 3DA4A 4AYNA 8PRNA 2K4TA 4E1SA 3AA1B 2PORA 5ADXK 1ZHXA 2YPVA 3PQSA 5JDPA 4D64A 2Y7SA 1QJ8A 2F1TA 1OPFA 4GCQA 3AAEB 3AA7A 2ERVA 3T0SA 2KDYA 1G90A 1Q9GA 2OMFA 1YS5A 2XTQA 3AA6A 3POXA 4FRXA 1BT9A 1MM5A 3JTYA 5DL5A 1QJ9A 2KC0A 2JMMA 4RL9A 1GFPA 3VE1A 3WI4A 2F1VA 4FRTA 1H6S1 3SYSA 2PRNA 4JFBA 5GV0A 4XNLA 5DL6A 4GHBA 3TZGA 2XMXA 2XG6A 3UPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1N A;  3O0E A;  4D65 A;  5FVN A;  2FGQ X;  3WI5 A;  3POR A;  2ZLD A;  3SY9 A;  1HXT A;  5PRN A;  3A2S X;  4FOZ A;  1HXU A;  5DL7 A;  4FSO A;  3SZV A;  3SZD A;  2QTK A;  4FT6 A;  3UU2 A;  4FSP A;  4RJW A;  2O4V A;  1HXX A;  4AUI A;  2XE2 A;  4LSI A;  4KR8 A;  3SYB A;  2Y0K A;  4D5U A;  2XE3 A;  1GFM A;  4KRA A;  3T20 A;  3FYX A;  3POU A;  2XE5 A;  3HWB A;  2ODJ A;  2ZFG A;  3VZW X;  3POQ A;  2XE1 A;  3EMN X;  4BUM X;  4KR4 A;  3VY8 X;  2Y0L A;  5DL8 A;  3HW9 A;  1PHO A;  2Y0H A;  4LSE A;  1OSM A;  2Y2X A;  1GFQ A;  1GFO A;  2FGR A;  1BH3 A;  3PRN A;  3SY7 A;  2J4U P;  1MPF A;  1E54 A;  3T24 A;  4LSF A;  4LSH A;  6PRN A;  1PRN A;  3VY9 X;  3VZU X;  3K19 A;  3NSG A;  4C69 X;  4RJX A;  4FMS A;  4GCP A;  1GFN A;  3VZT X;  7PRN A;  4GCS A;  8PRN A;  2K4T A;  2POR A;  5JDP A;  4D64 A;  1OPF A;  4GCQ A;  3T0S A;  2OMF A;  3POX A;  4FRX A;  1BT9 A;  3JTY A;  5DL5 A;  3WI4 A;  1GFP A;  4FRT A;  1H6S 1;  3SYS A;  2PRN A;  4JFB A;  5DL6 A;  2XG6 A;  3UPG A; 
#chains in the Genus database with same CATH topology
 5H2F O;  3DZM A;  3BRZ A;  2J1N A;  3O0E A;  4Z3T A;  3PGR A;  4D65 A;  4JCH A;  2FGQ X;  5FVN A;  3JCU O;  3WI5 A;  3BRY A;  2ZLD A;  3NJT A;  3POR A;  4AKR B;  3SY9 A;  1HXT A;  4N58 A;  3AA7 B;  3A2S X;  5PRN A;  3HOE A;  1IZN B;  2YNK A;  4FOZ A;  4K3B A;  1HXU A;  3AA6 B;  4O49 A;  5G39 A;  5DL7 A;  4FSO A;  3SZV A;  1Q9F A;  1ZHY A;  5KAI O;  5TIS O;  3SZD A;  1IZN A;  2QTK A;  3GP6 A;  4FT6 A;  5B66 O;  4IL6 O;  4FSP A;  3UU2 A;  4AYE C;  4RJW A;  2O4V A;  1HXX A;  3LK3 A;  4N59 A;  1ZHT A;  3QRA A;  4AUI A;  4UB6 O;  3KVD D;  4AKR A;  2XE2 A;  4LSI A;  3LK2 A;  4KR8 A;  2Y0K A;  3SYB A;  1P4T A;  4D5U A;  2KXP A;  2XE3 A;  1GFM A;  4AYM C;  4QQ1 A;  2KZ7 A;  4B61 A;  4F4B A;  4AYD C;  3PGU A;  4KRA A;  3FYX A;  3T20 A;  3POU A;  2JQY A;  3DA3 A;  3HOL A;  2IWV A;  3LK4 1;  3PQU A;  1T1L A;  3QRC A;  2N2M A;  4CTD A;  2K0L A;  2M06 A;  2XE5 A;  3DWN A;  3LK4 2;  5B5E O;  5EE2 A;  3HWB A;  4U9C A;  3VE2 A;  2ODJ A;  1ORM A;  4FQE A;  2ZFG A;  4FUV A;  4FZN A;  1S5L O;  4O3W A;  3VZW X;  5G3A A;  3POQ A;  3C5O A;  5E79 O;  2XE1 A;  3EMN X;  2R4L A;  3LK3 B;  5IYU A;  4BUM X;  4KR4 A;  4PJ0 O;  2WJR A;  2Y0L A;  2LHF A;  5DL8 A;  3HW9 A;  3KZI O;  1PHO A;  2W80 C;  2Y0H A;  3LK2 B;  4O4X A;  4PUX A;  5D5D A;  5T5F A;  5AFU K;  2KXP B;  3A0H O;  1MM4 A;  4LSE A;  1OSM A;  2KZ7 B;  2R4P A;  2Y2X A;  4G76 A;  5G26 A;  3G7G A;  1GFQ A;  2MNH A;  1ZHW A;  4O3Y A;  4O3Z A;  2F1C X;  2M07 A;  3UAQ A;  5ADX L;  1GFO A;  2FGR A;  2XTR A;  1BH3 A;  3PF1 A;  4UB8 O;  3PRN A;  4G75 A;  3SY7 A;  2J4U P;  2R4N A;  2R8A A;  1QJP A;  1ZHZ A;  2R88 A;  4FZM A;  5KAF O;  3WU2 O;  2AXT O;  1MPF A;  3AAA B;  3RBH A;  3AA0 B;  4E1T A;  1E54 A;  3AA1 A;  3V8U A;  3TZG A;  4RLC A;  2GE4 A;  3AAA A;  3T24 A;  2LFU A;  2N2L A;  2X27 X;  3AA0 A;  4LSF A;  4O3X B;  2W81 C;  2R4O A;  3AAE A;  3DWO X;  4LSH A;  4AKM A;  4AYI D;  4GF4 A;  6PRN A;  1THQ A;  1PRN A;  5GTI O;  3VY9 X;  4C00 A;  3VY8 X;  3VZU X;  3K19 A;  3NSG A;  4XNK A;  2MHL A;  4C69 X;  4RJX A;  4FMS A;  4AFK A;  4O4U A;  2WVP A;  4GCP A;  1GFN A;  4FZL A;  4K3C A;  2WJQ A;  1BXW A;  4RLB A;  3VZT X;  4C4V A;  4N74 A;  4AZL A;  7PRN A;  4GCS A;  2R89 A;  4FES A;  3DA4 A;  4AYN A;  8PRN A;  2K4T A;  4E1S A;  3AA1 B;  2POR A;  4N75 A;  5ADX K;  2IWW A;  1ZHX A;  2YPV A;  3PQS A;  1T16 A;  5JDP A;  4D64 A;  2Y7S A;  1QJ8 A;  2F1T A;  1OPF A;  4GCQ A;  3AAE B;  3AA7 A;  2ERV A;  3T0S A;  2KDY A;  1G90 A;  5GTH O;  1Q9G A;  2OMF A;  1YS5 A;  2XTQ A;  3AA6 A;  3POX A;  4FRX A;  1BT9 A;  1MM5 A;  4PR7 A;  3JTY A;  3PGS A;  1QJ9 A;  2KC0 A;  2JMM A;  4RL9 A;  1GFP A;  5DL5 A;  5G38 A;  3VE1 A;  2F1V A;  4FRT A;  3WI4 A;  1H6S 1;  4C4V B;  3SYS A;  2PRN A;  3A0B O;  4JFB A;  5AFU L;  3BS0 A;  4XNL A;  4GHB A;  2X9K A;  5DL6 A;  5GV0 A;  2XMX A;  2XG6 A;  3UPG A; 
#chains in the Genus database with same CATH homology
 2J1N A;  3O0E A;  4Z3T A;  4D65 A;  4JCH A;  2FGQ X;  5FVN A;  3WI5 A;  3POR A;  2ZLD A;  3SY9 A;  1HXT A;  4N58 A;  3AA7 B;  3A2S X;  5PRN A;  3HOE A;  1IZN B;  2YNK A;  4FOZ A;  1HXU A;  3AA6 B;  4O49 A;  5DL7 A;  4FSO A;  3SZV A;  1Q9F A;  1ZHY A;  3SZD A;  1IZN A;  2QTK A;  3GP6 A;  4FT6 A;  3UU2 A;  4FSP A;  4AYE C;  4RJW A;  2O4V A;  1HXX A;  3LK3 A;  4N59 A;  1ZHT A;  3QRA A;  4AUI A;  4AKR A;  3KVD D;  2XE2 A;  4LSI A;  3LK2 A;  4KR8 A;  2Y0K A;  3SYB A;  1P4T A;  4D5U A;  2XE3 A;  2KXP A;  1GFM A;  4AYM C;  4QQ1 A;  2KZ7 A;  4B61 A;  4F4B A;  4AYD C;  4KRA A;  3T20 A;  3FYX A;  3POU A;  3DA3 A;  3HOL A;  3LK4 1;  3PQU A;  3QRC A;  2N2M A;  2K0L A;  2M06 A;  2XE5 A;  3LK4 2;  5EE2 A;  3HWB A;  4U9C A;  3VE2 A;  2ODJ A;  1ORM A;  4FUV A;  2ZFG A;  4FZN A;  4O3W A;  3VZW X;  3POQ A;  3C5O A;  2XE1 A;  3EMN X;  3LK3 B;  5IYU A;  4BUM X;  4KR4 A;  3VY8 X;  5AFU L;  2Y0L A;  2LHF A;  5DL8 A;  3HW9 A;  4AKR B;  1PHO A;  2W80 C;  2Y0H A;  3LK2 B;  4O4X A;  4PUX A;  5D5D A;  5T5F A;  5AFU K;  2KXP B;  4LSE A;  1MM4 A;  1OSM A;  2KZ7 B;  2Y2X A;  4G76 A;  5G26 A;  3G7G A;  1GFQ A;  2MNH A;  1ZHW A;  4O3Y A;  4O3Z A;  2M07 A;  3UAQ A;  5ADX L;  1GFO A;  2FGR A;  2XTR A;  1BH3 A;  3PRN A;  4G75 A;  3SY7 A;  2J4U P;  1QJP A;  1ZHZ A;  4FZM A;  1MPF A;  3AAA B;  3RBH A;  3AA0 B;  4E1T A;  1E54 A;  3AA1 A;  3V8U A;  4RLC A;  2GE4 A;  3AAA A;  3T24 A;  2LFU A;  2N2L A;  2X27 X;  3AA0 A;  4LSF A;  4O3X B;  2W81 C;  3AAE A;  4AKM A;  4LSH A;  4AYI D;  4GF4 A;  6PRN A;  1THQ A;  1PRN A;  3VY9 X;  3VZU X;  3K19 A;  3NSG A;  4XNK A;  2MHL A;  4C69 X;  4RJX A;  4FMS A;  4AFK A;  4O4U A;  4GCP A;  1GFN A;  4FZL A;  4RLB A;  1BXW A;  3VZT X;  4AZL A;  7PRN A;  4GCS A;  4FES A;  3DA4 A;  4AYN A;  8PRN A;  2K4T A;  4E1S A;  3AA1 B;  2POR A;  5ADX K;  1ZHX A;  2YPV A;  3PQS A;  5JDP A;  4D64 A;  2Y7S A;  1QJ8 A;  2F1T A;  1OPF A;  4GCQ A;  3AAE B;  3AA7 A;  2ERV A;  3T0S A;  2KDY A;  1G90 A;  1Q9G A;  2OMF A;  1YS5 A;  2XTQ A;  3AA6 A;  3POX A;  4FRX A;  1BT9 A;  1MM5 A;  3JTY A;  5DL5 A;  1QJ9 A;  2KC0 A;  2JMM A;  4RL9 A;  1GFP A;  3VE1 A;  3WI4 A;  2F1V A;  4FRT A;  1H6S 1;  3SYS A;  2PRN A;  4JFB A;  5GV0 A;  4XNL A;  5DL6 A;  4GHB A;  3TZG A;  2XMX A;  2XG6 A;  3UPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...