2OMFA

Ompf porin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
340
structure length
340
Chain Sequence
AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX PORIN OUTER MEMBRANE PROTEIN F
publication title The Refined Structure of Ompf Porin from E.Coli at 2.4 Angstroms Resolution
rcsb
molecule tags Integral membrane protein porin
total genus 105
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 1995-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 2omfA00
1GFQA 3UU2A 3PORA 4LSEA 3POUA 3POQA 1BH3A 3VZWX 3SY7A 1GFOA 4KR4A 2Y2XA 1GFNA 4AUIA 4KR8A 3T24A 3VZUX 2ZFGA 3O0EA 4GCSA 8PRNA 2XE5A 3JTYA 4FOZA 2Y0LA 4RJWA 2Y0KA 2OMFA 5DL7A 2J1NA 5JDPA 3WI5A 1E54A 4FSOA 4GCQA 5DL6A 1H6S1 3K19A 4FT6A 4LSIA 1HXUA 2FGRA 5DL5A 4D5UA 3SYBA 1PRNA 3HWBA 3UPGA 1BT9A 1HXXA 3SYSA 3POXA 4LSHA 2O4VA 4D65A 1HXTA 3HW9A 3SZVA 1PHOA 2XG6A 3A2SX 7PRNA 4D64A 2FGQX 4BUMX 2ODJA 5DL8A 3FYXA 4FRTA 3SZDA 3VY8X 4FRXA 2PORA 2XE3A 3T0SA 4FSPA 3WI4A 3T20A 4C69X 1GFMA 4KRAA 4RJXA 6PRNA 3VZTX 4FMSA 4GCPA 4JFBA 1OPFA 1MPFA 3SY9A 2QTKA 5PRNA 3VY9X 3EMNX 2XE1A 3PRNA 3NSGA 2XE2A 2Y0HA 2ZLDA 1GFPA 2J4UP 2K4TA 1OSMA 4LSFA 2PRNA 5FVNA
chains in the Genus database with same CATH superfamily
4CTDA 1GFQA 4O4UA 2KC0A 3UU2A 3PORA 4FESA 4LSEA 3POUA 3POQA 4AYEC 1BH3A 3TZGA 4AYDC 4C00A 3VZWX 4F4BA 3SY7A 2W81C 1GFOA 4KR4A 4AYID 3C5OA 2WVPA 2Y2XA 3HOLA 1GFNA 2YPVA 5EE2A 4K3BA 4AUIA 4AKMA 1T1LA 5ADXK 2WJRA 2R88A 2F1TA 1P4TA 2R4OA 4FZLA 4KR8A 3T24A 3VZUX 2ZFGA 3O0EA 4FQEA 4GCSA 4N74A 5B66O 5IYUA 3BS0A 8PRNA 4N75A 1QJ8A 2XE5A 3JTYA 4FOZA 4PUXA 5G3AA 2Y0LA 3LK42 4RJWA 1ZHXA 2OMFA 2LHFA 2IWVA 2Y0KA 4PR7A 4RLCA 5DL7A 3BRZA 2J1NA 2MHLA 5B5EO 2M07A 5JDPA 3WI5A 1ZHWA 1QJPA 4AKRB 3GP6A 2JQYA 4AKRA 4O49A 2X27X 4O3XB 4E1TA 1E54A 4FSOA 4O3YA 3DA3A 4GCQA 5DL6A 1H6S1 3K19A 3LK2B 3RBHA 5GV0A 5ADXL 5TISO 3LK2A 4FT6A 4N59A 4RL9A 4GF4A 4LSIA 3PQUA 3UAQA 4AZLA 2K0LA 4XNKA 3VE2A 2XMXA 4FZNA 4RLBA 1BXWA 1HXUA 2Y7SA 2FGRA 4O3ZA 4O3WA 5DL5A 5D5DA 4FUVA 3VE1A 3WU2O 3BRYA 3G7GA 1ZHZA 4D5UA 3AA6B 2KDYA 5T5FA 5AFUL 2R89A 3SYBA 1ZHTA 2KZ7B 1PRNA 2N2LA 2X9KA 3DWOX 3HWBA 3KZIO 4FZMA 3UPGA 1MM4A 2MNHA 5E79O 1BT9A 1HXXA 4UB6O 4AYMC 3DZMA 4B61A 4JCHA 2N2MA 3JCUO 3SYSA 4AYNA 3A0BO 3POXA 5KAIO 3PGSA 4LSHA 2O4VA 4PJ0O 3AAEB 3QRAA 1S5LO 2XTQA 4D65A 3AAEA 1HXTA 3DA4A 3HW9A 1IZNB 2R4LA 4E1SA 1Q9GA 3SZVA 3LK41 1PHOA 2XG6A 3A2SX 3AA7B 1G90A 3NJTA 3PF1A 7PRNA 4D64A 5KAFO 3AAAB 2FGQX 4U9CA 2F1CX 2ODJA 4BUMX 3AAAA 5DL8A 2IWWA 2KXPB 3FYXA 4FRTA 3SZDA 3VY8X 2KXPA 4UB8O 1THQA 4FRXA 4N58A 3PGRA 4O4XA 1QJ9A 1T16A 2PORA 1ORMA 2XE3A 3T0SA 4GHBA 4FSPA 3WI4A 3AA6A 5G39A 3LK3B 3T20A 2KZ7A 4C69X 1GFMA 3LK3A 5GTHO 4KRAA 4RJXA 2R8AA 6PRNA 2YNKA 3DWNA 3PQSA 2GE4A 3VZTX 4C4VB 4FMSA 4GCPA 4JFBA 1OPFA 4C4VA 4IL6O 2R4PA 2R4NA 4XNLA 1MPFA 3SY9A 5G26A 4AFKA 2AXTO 2ERVA 1Q9FA 2LFUA 2QTKA 3QRCA 5G38A 5PRNA 2WJQA 3V8UA 2M06A 1IZNA 3AA0B 3VY9X 3EMNX 2XE1A 3PGUA 3PRNA 3AA0A 3AA7A 1YS5A 4G76A 4K3CA 1MM5A 3NSGA 2XE2A 2F1VA 2Y0HA 5H2FO 2ZLDA 1GFPA 2JMMA 2XTRA 3KVDD 4G75A 2K4TA 2J4UP 2W80C 3AA1B 1OSMA 1ZHYA 5GTIO 4LSFA 4QQ1A 5AFUK 3AA1A 3HOEA 2PRNA 5FVNA 3A0HO 4Z3TA
chains in the Genus database with same CATH topology
1GFQA 4O4UA 2KC0A 3UU2A 3PORA 4FESA 4LSEA 3POUA 3POQA 4AYEC 1BH3A 3TZGA 4AYDC 3VZWX 4F4BA 3SY7A 2W81C 1GFOA 4KR4A 4AYID 3C5OA 2Y2XA 3HOLA 5EE2A 1GFNA 2YPVA 4AUIA 4AKMA 5ADXK 2F1TA 1P4TA 4FZLA 4KR8A 3T24A 3VZUX 2ZFGA 3O0EA 4GCSA 5IYUA 8PRNA 1QJ8A 2XE5A 3JTYA 4FOZA 4PUXA 2Y0LA 3LK42 4RJWA 1ZHXA 2LHFA 2OMFA 2Y0KA 4RLCA 5DL7A 2J1NA 2MHLA 2M07A 5JDPA 3WI5A 1ZHWA 1QJPA 4AKRB 3GP6A 4AKRA 4O49A 2X27X 4O3XB 4E1TA 1E54A 4FSOA 4O3YA 3DA3A 4GCQA 5DL6A 1H6S1 3K19A 3LK2B 3RBHA 5GV0A 5ADXL 3LK2A 4FT6A 4N59A 4RL9A 4GF4A 4LSIA 3PQUA 3UAQA 4AZLA 2K0LA 4XNKA 3VE2A 2XMXA 4FZNA 4RLBA 1BXWA 1HXUA 2Y7SA 2FGRA 4O3ZA 4O3WA 5DL5A 5D5DA 4FUVA 3VE1A 3G7GA 1ZHZA 4D5UA 3AA6B 2KDYA 5T5FA 5AFUL 3SYBA 1ZHTA 2KZ7B 1PRNA 2N2LA 3HWBA 4FZMA 3UPGA 1MM4A 2MNHA 1BT9A 1HXXA 4AYMC 4B61A 4JCHA 2N2MA 3SYSA 4AYNA 3POXA 4LSHA 2O4VA 3AAEB 3QRAA 2XTQA 4D65A 3AAEA 1HXTA 3DA4A 3HW9A 1IZNB 4E1SA 1Q9GA 3SZVA 3LK41 1PHOA 2XG6A 3A2SX 3AA7B 1G90A 7PRNA 4D64A 3AAAB 2FGQX 4U9CA 4BUMX 2ODJA 3AAAA 5DL8A 2KXPB 3FYXA 4FRTA 3SZDA 3VY8X 2KXPA 1THQA 4FRXA 4N58A 4O4XA 1QJ9A 2PORA 1ORMA 2XE3A 3T0SA 4GHBA 4FSPA 3WI4A 3AA6A 3LK3B 3T20A 2KZ7A 4C69X 1GFMA 3LK3A 4KRAA 4RJXA 6PRNA 2YNKA 3PQSA 2GE4A 3VZTX 4FMSA 4GCPA 4JFBA 1OPFA 4XNLA 1MPFA 3SY9A 5G26A 4AFKA 2ERVA 1Q9FA 2LFUA 2QTKA 3QRCA 5PRNA 3V8UA 2M06A 1IZNA 3AA0B 3VY9X 3EMNX 2XE1A 3PRNA 3AA0A 3AA7A 1YS5A 4G76A 1MM5A 3NSGA 2XE2A 2F1VA 2Y0HA 2ZLDA 1GFPA 2JMMA 2XTRA 4G75A 2J4UP 2K4TA 2W80C 3AA1B 1OSMA 1ZHYA 5AFUK 4LSFA 4QQ1A 3AA1A 3HOEA 2PRNA 5FVNA 3KVDD 4Z3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFQ A;  3UU2 A;  3POR A;  4LSE A;  3POU A;  3POQ A;  1BH3 A;  3VZW X;  3SY7 A;  1GFO A;  4KR4 A;  2Y2X A;  1GFN A;  4AUI A;  4KR8 A;  3T24 A;  3VZU X;  2ZFG A;  3O0E A;  4GCS A;  8PRN A;  2XE5 A;  3JTY A;  4FOZ A;  2Y0L A;  4RJW A;  2Y0K A;  2OMF A;  5DL7 A;  2J1N A;  5JDP A;  3WI5 A;  1E54 A;  4FSO A;  4GCQ A;  5DL6 A;  1H6S 1;  3K19 A;  4FT6 A;  4LSI A;  1HXU A;  2FGR A;  5DL5 A;  4D5U A;  3SYB A;  1PRN A;  3HWB A;  3UPG A;  1BT9 A;  1HXX A;  3SYS A;  3POX A;  4LSH A;  2O4V A;  4D65 A;  1HXT A;  3HW9 A;  3SZV A;  1PHO A;  2XG6 A;  3A2S X;  7PRN A;  4D64 A;  2FGQ X;  4BUM X;  2ODJ A;  5DL8 A;  3FYX A;  4FRT A;  3SZD A;  3VY8 X;  4FRX A;  2POR A;  2XE3 A;  3T0S A;  4FSP A;  3WI4 A;  3T20 A;  4C69 X;  1GFM A;  4KRA A;  4RJX A;  6PRN A;  3VZT X;  4FMS A;  4GCP A;  4JFB A;  1OPF A;  1MPF A;  3SY9 A;  2QTK A;  5PRN A;  3VY9 X;  3EMN X;  2XE1 A;  3PRN A;  3NSG A;  2XE2 A;  2Y0H A;  2ZLD A;  1GFP A;  2J4U P;  2K4T A;  1OSM A;  4LSF A;  2PRN A;  5FVN A; 
#chains in the Genus database with same CATH topology
 4CTD A;  1GFQ A;  4O4U A;  2KC0 A;  3UU2 A;  3POR A;  4FES A;  4LSE A;  3POU A;  3POQ A;  4AYE C;  1BH3 A;  3TZG A;  4AYD C;  4C00 A;  3VZW X;  4F4B A;  3SY7 A;  2W81 C;  1GFO A;  4KR4 A;  4AYI D;  3C5O A;  2WVP A;  2Y2X A;  3HOL A;  1GFN A;  2YPV A;  5EE2 A;  4K3B A;  4AUI A;  4AKM A;  1T1L A;  5ADX K;  2WJR A;  2R88 A;  2F1T A;  1P4T A;  2R4O A;  4FZL A;  4KR8 A;  3T24 A;  3VZU X;  2ZFG A;  3O0E A;  4FQE A;  4GCS A;  4N74 A;  5B66 O;  5IYU A;  3BS0 A;  8PRN A;  4N75 A;  1QJ8 A;  2XE5 A;  3JTY A;  4FOZ A;  4PUX A;  5G3A A;  2Y0L A;  3LK4 2;  4RJW A;  1ZHX A;  2OMF A;  2LHF A;  2IWV A;  2Y0K A;  4PR7 A;  4RLC A;  5DL7 A;  3BRZ A;  2J1N A;  2MHL A;  5B5E O;  2M07 A;  5JDP A;  3WI5 A;  1ZHW A;  1QJP A;  4AKR B;  3GP6 A;  2JQY A;  4AKR A;  4O49 A;  2X27 X;  4O3X B;  4E1T A;  1E54 A;  4FSO A;  4O3Y A;  3DA3 A;  4GCQ A;  5DL6 A;  1H6S 1;  3K19 A;  3LK2 B;  3RBH A;  5GV0 A;  5ADX L;  5TIS O;  3LK2 A;  4FT6 A;  4N59 A;  4RL9 A;  4GF4 A;  4LSI A;  3PQU A;  3UAQ A;  4AZL A;  2K0L A;  4XNK A;  3VE2 A;  2XMX A;  4FZN A;  4RLB A;  1BXW A;  1HXU A;  2Y7S A;  2FGR A;  4O3Z A;  4O3W A;  5DL5 A;  5D5D A;  4FUV A;  3VE1 A;  3WU2 O;  3BRY A;  3G7G A;  1ZHZ A;  4D5U A;  3AA6 B;  2KDY A;  5T5F A;  5AFU L;  2R89 A;  3SYB A;  1ZHT A;  2KZ7 B;  1PRN A;  2N2L A;  2X9K A;  3DWO X;  3HWB A;  3KZI O;  4FZM A;  3UPG A;  1MM4 A;  2MNH A;  5E79 O;  1BT9 A;  1HXX A;  4UB6 O;  4AYM C;  3DZM A;  4B61 A;  4JCH A;  2N2M A;  3JCU O;  3SYS A;  4AYN A;  3A0B O;  3POX A;  5KAI O;  3PGS A;  4LSH A;  2O4V A;  4PJ0 O;  3AAE B;  3QRA A;  1S5L O;  2XTQ A;  4D65 A;  3AAE A;  1HXT A;  3DA4 A;  3HW9 A;  1IZN B;  2R4L A;  4E1S A;  1Q9G A;  3SZV A;  3LK4 1;  1PHO A;  2XG6 A;  3A2S X;  3AA7 B;  1G90 A;  3NJT A;  3PF1 A;  7PRN A;  4D64 A;  5KAF O;  3AAA B;  2FGQ X;  4U9C A;  2F1C X;  2ODJ A;  4BUM X;  3AAA A;  5DL8 A;  2IWW A;  2KXP B;  3FYX A;  4FRT A;  3SZD A;  3VY8 X;  2KXP A;  4UB8 O;  1THQ A;  4FRX A;  4N58 A;  3PGR A;  4O4X A;  1QJ9 A;  1T16 A;  2POR A;  1ORM A;  2XE3 A;  3T0S A;  4GHB A;  4FSP A;  3WI4 A;  3AA6 A;  5G39 A;  3LK3 B;  3T20 A;  2KZ7 A;  4C69 X;  1GFM A;  3LK3 A;  5GTH O;  4KRA A;  4RJX A;  2R8A A;  6PRN A;  2YNK A;  3DWN A;  3PQS A;  2GE4 A;  3VZT X;  4C4V B;  4FMS A;  4GCP A;  4JFB A;  1OPF A;  4C4V A;  4IL6 O;  2R4P A;  2R4N A;  4XNL A;  1MPF A;  3SY9 A;  5G26 A;  4AFK A;  2AXT O;  2ERV A;  1Q9F A;  2LFU A;  2QTK A;  3QRC A;  5G38 A;  5PRN A;  2WJQ A;  3V8U A;  2M06 A;  1IZN A;  3AA0 B;  3VY9 X;  3EMN X;  2XE1 A;  3PGU A;  3PRN A;  3AA0 A;  3AA7 A;  1YS5 A;  4G76 A;  4K3C A;  1MM5 A;  3NSG A;  2XE2 A;  2F1V A;  2Y0H A;  5H2F O;  2ZLD A;  1GFP A;  2JMM A;  2XTR A;  3KVD D;  4G75 A;  2K4T A;  2J4U P;  2W80 C;  3AA1 B;  1OSM A;  1ZHY A;  5GTI O;  4LSF A;  4QQ1 A;  5AFU K;  3AA1 A;  3HOE A;  2PRN A;  5FVN A;  3A0H O;  4Z3T A; 
#chains in the Genus database with same CATH homology
 1GFQ A;  4O4U A;  2KC0 A;  3UU2 A;  3POR A;  4FES A;  4LSE A;  3POU A;  3POQ A;  4AYE C;  1BH3 A;  3TZG A;  4AYD C;  3VZW X;  4F4B A;  3SY7 A;  2W81 C;  1GFO A;  4KR4 A;  4AYI D;  3C5O A;  2Y2X A;  3HOL A;  5EE2 A;  1GFN A;  2YPV A;  4AUI A;  4AKM A;  5ADX K;  2F1T A;  1P4T A;  4FZL A;  4KR8 A;  3T24 A;  3VZU X;  2ZFG A;  3O0E A;  4GCS A;  5IYU A;  8PRN A;  1QJ8 A;  2XE5 A;  3JTY A;  4FOZ A;  4PUX A;  2Y0L A;  3LK4 2;  4RJW A;  1ZHX A;  2LHF A;  2OMF A;  2Y0K A;  4RLC A;  5DL7 A;  2J1N A;  2MHL A;  2M07 A;  5JDP A;  3WI5 A;  1ZHW A;  1QJP A;  4AKR B;  3GP6 A;  4AKR A;  4O49 A;  2X27 X;  4O3X B;  4E1T A;  1E54 A;  4FSO A;  4O3Y A;  3DA3 A;  4GCQ A;  5DL6 A;  1H6S 1;  3K19 A;  3LK2 B;  3RBH A;  5GV0 A;  5ADX L;  3LK2 A;  4FT6 A;  4N59 A;  4RL9 A;  4GF4 A;  4LSI A;  3PQU A;  3UAQ A;  4AZL A;  2K0L A;  4XNK A;  3VE2 A;  2XMX A;  4FZN A;  4RLB A;  1BXW A;  1HXU A;  2Y7S A;  2FGR A;  4O3Z A;  4O3W A;  5DL5 A;  5D5D A;  4FUV A;  3VE1 A;  3G7G A;  1ZHZ A;  4D5U A;  3AA6 B;  2KDY A;  5T5F A;  5AFU L;  3SYB A;  1ZHT A;  2KZ7 B;  1PRN A;  2N2L A;  3HWB A;  4FZM A;  3UPG A;  1MM4 A;  2MNH A;  1BT9 A;  1HXX A;  4AYM C;  4B61 A;  4JCH A;  2N2M A;  3SYS A;  4AYN A;  3POX A;  4LSH A;  2O4V A;  3AAE B;  3QRA A;  2XTQ A;  4D65 A;  3AAE A;  1HXT A;  3DA4 A;  3HW9 A;  1IZN B;  4E1S A;  1Q9G A;  3SZV A;  3LK4 1;  1PHO A;  2XG6 A;  3A2S X;  3AA7 B;  1G90 A;  7PRN A;  4D64 A;  3AAA B;  2FGQ X;  4U9C A;  4BUM X;  2ODJ A;  3AAA A;  5DL8 A;  2KXP B;  3FYX A;  4FRT A;  3SZD A;  3VY8 X;  2KXP A;  1THQ A;  4FRX A;  4N58 A;  4O4X A;  1QJ9 A;  2POR A;  1ORM A;  2XE3 A;  3T0S A;  4GHB A;  4FSP A;  3WI4 A;  3AA6 A;  3LK3 B;  3T20 A;  2KZ7 A;  4C69 X;  1GFM A;  3LK3 A;  4KRA A;  4RJX A;  6PRN A;  2YNK A;  3PQS A;  2GE4 A;  3VZT X;  4FMS A;  4GCP A;  4JFB A;  1OPF A;  4XNL A;  1MPF A;  3SY9 A;  5G26 A;  4AFK A;  2ERV A;  1Q9F A;  2LFU A;  2QTK A;  3QRC A;  5PRN A;  3V8U A;  2M06 A;  1IZN A;  3AA0 B;  3VY9 X;  3EMN X;  2XE1 A;  3PRN A;  3AA0 A;  3AA7 A;  1YS5 A;  4G76 A;  1MM5 A;  3NSG A;  2XE2 A;  2F1V A;  2Y0H A;  2ZLD A;  1GFP A;  2JMM A;  2XTR A;  4G75 A;  2J4U P;  2K4T A;  2W80 C;  3AA1 B;  1OSM A;  1ZHY A;  5AFU K;  4LSF A;  4QQ1 A;  3AA1 A;  3HOE A;  2PRN A;  5FVN A;  3KVD D;  4Z3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...