4GCPA

Crystal structure of e. coli ompf porin in complex with ampicillin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/antibiotic
molecule keywords Outer membrane protein F
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
total genus 99
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcpA00
2QTKA 1PHOA 3O0EA 4KRAA 1MPFA 2ZLDA 4GCPA 4FMSA 1GFPA 2XE2A 4GCQA 3T0SA 4BUMX 2XE5A 1OSMA 2J1NA 4C69X 4RJWA 7PRNA 2ODJA 4AUIA 3SY7A 4D5UA 5JDPA 2FGQX 4FSPA 3WI4A 4FOZA 3FYXA 3NSGA 6PRNA 3POQA 4FRTA 2XE3A 4FRXA 8PRNA 4LSIA 3EMNX 4LSEA 2XG6A 1H6S1 4JFBA 3VY8X 3WI5A 2J4UP 3T24A 4KR4A 3VZWX 2Y0LA 3UU2A 2FGRA 3PRNA 3SY9A 1GFMA 5FVNA 1BT9A 2ZFGA 3K19A 3JTYA 2XE1A 3VY9X 2OMFA 3POUA 4LSFA 3VZUX 2PORA 2K4TA 1PRNA 1HXUA 1GFNA 1HXXA 4D65A 3POXA 5PRNA 3PORA 3SYSA 2Y2XA 4RJXA 2Y0HA 3VZTX 1GFQA 1OPFA 2Y0KA 2O4VA 3SZVA 3UPGA 2PRNA 5DL5A 4FSOA 4GCSA 3HW9A 3HWBA 1HXTA 3T20A 4D64A 3A2SX 1E54A 3SZDA 4FT6A 5DL8A 1GFOA 4KR8A 5DL6A 1BH3A 4LSHA 5DL7A 3SYBA
chains in the Genus database with same CATH superfamily
1ZHWA 4PJ0O 2M06A 4N74A 2QTKA 2GE4A 3C5OA 4E1TA 4FZLA 2LFUA 4C4VA 2WJQA 4N59A 5E79O 1MM5A 1PHOA 3AA7A 1BH3A 3O0EA 4KRAA 1MPFA 1ORMA 2ZLDA 4GCPA 4FMSA 4N75A 5GTIO 1GFPA 3QRAA 2XE2A 2XMXA 4E1SA 4QQ1A 3GP6A 1MM4A 5D5DA 4PR7A 5AFUK 2X27X 3HOLA 1S5LO 2W80C 4GCQA 4CTDA 4RLBA 4XNKA 3T0SA 4C4VB 3PF1A 4AYNA 3AAAA 4IL6O 2LHFA 4N58A 4BUMX 3AA0A 2XE5A 1OSMA 2J1NA 3HOEA 4RJWA 4FZNA 4AYDC 4C00A 4C69X 7PRNA 4JCHA 2ODJA 2IWWA 4AUIA 3SY7A 4D5UA 4O4XA 5B66O 1Q9FA 5JDPA 1ZHZA 3RBHA 2N2LA 2FGQX 4FSPA 3WI4A 4AKRB 4FOZA 3G7GA 1IZNA 3FYXA 3NSGA 4GF4A 4AYEC 3AAAB 1THQA 3POQA 4FRTA 2KXPB 2XE3A 4FRXA 4LSIA 2JQYA 5KAFO 4AFKA 8PRNA 4FUVA 3AA0B 5IYUA 3EMNX 2R4PA 4LSEA 4O3XB 4FQEA 2F1CX 4FZMA 5G3AA 2XG6A 4G76A 3LK41 2WJRA 1H6S1 2R88A 2R8AA 3KVDD 4JFBA 4AYMC 3PGSA 2W81C 3VY8X 1QJ9A 3TZGA 3WI5A 2ERVA 3VE2A 1IZNB 2J4UP 3T24A 4AKRA 3DWOX 4KR4A 3WU2O 4B61A 1T16A 3VZWX 2MHLA 2KXPA 2Y0LA 4AYID 4O3YA 4O3WA 3UU2A 2FGRA 4AKMA 2JMMA 2R4LA 4UB8O 2R4NA 3PRNA 3SY9A 1GFMA 1QJ8A 3PGRA 1ZHYA 3LK2A 3UAQA 4U9CA 2KC0A 5FVNA 4FESA 1BT9A 2Y7SA 2ZFGA 3PQUA 2R89A 4XNLA 1Q9GA 2KZ7A 2M07A 3JTYA 3K19A 2XE1A 5H2FO 2K0LA 3VY9X 2OMFA 3DA3A 5ADXK 2X9KA 3A0HO 3DA4A 3POUA 2PORA 4GHBA 4LSFA 4O4UA 3VZUX 1G90A 4O49A 2K4TA 4F4BA 3LK2B 5KAIO 5GV0A 2N2MA 3VE1A 3V8UA 4K3CA 5AFUL 1PRNA 2KZ7B 2XTRA 1ZHXA 1HXUA 3NJTA 1GFNA 1BXWA 2YPVA 3A0BO 4K3BA 3AA1A 4O3ZA 2R4OA 5T5FA 3DWNA 1HXXA 2KDYA 4D65A 4UB6O 3POXA 5PRNA 2WVPA 3DZMA 3PORA 3SYSA 2F1VA 1YS5A 2Y2XA 3LK42 4G75A 3PQSA 4RJXA 2MNHA 1P4TA 2XTQA 2Y0HA 3BRYA 3VZTX 1GFQA 1OPFA 3QRCA 3LK3A 2Y0KA 3PGUA 2O4VA 5B5EO 4RLCA 3SZVA 3AA1B 3UPGA 2YNKA 5G38A 2PRNA 5DL5A 4FSOA 4GCSA 3AA6A 5G26A 3HW9A 5GTHO 3JCUO 3BS0A 3HWBA 1HXTA 5ADXL 3AAEA 2F1TA 5TISO 4RL9A 5G39A 6PRNA 3LK3B 3BRZA 3T20A 2AXTO 4D64A 3AA7B 3A2SX 1E54A 3KZIO 3SZDA 5EE2A 4Z3TA 3AA6B 4FT6A 3AAEB 1GFOA 4KR8A 5DL8A 5DL6A 4PUXA 1T1LA 4AZLA 2IWVA 1QJPA 4LSHA 1ZHTA 5DL7A 3SYBA
chains in the Genus database with same CATH topology
1ZHWA 2M06A 2QTKA 2GE4A 3C5OA 4E1TA 4FZLA 2LFUA 4N59A 1MM5A 1PHOA 3AA7A 1BH3A 3O0EA 4KRAA 1MPFA 1ORMA 2ZLDA 4GCPA 4FMSA 1GFPA 3QRAA 2XE2A 2XMXA 4E1SA 4QQ1A 3GP6A 1MM4A 5D5DA 5AFUK 2X27X 3HOLA 2W80C 4GCQA 4RLBA 4XNKA 3T0SA 4AYNA 3AAAA 2LHFA 4N58A 4BUMX 3AA0A 2XE5A 1OSMA 2J1NA 3HOEA 4RJWA 4FZNA 4AYDC 4C69X 7PRNA 4JCHA 2ODJA 4AUIA 3SY7A 4D5UA 4O4XA 1Q9FA 5JDPA 1ZHZA 3RBHA 2N2LA 2FGQX 4FSPA 3WI4A 4AKRB 4FOZA 3G7GA 1IZNA 3FYXA 3NSGA 4GF4A 4AYEC 3AAAB 1THQA 3POQA 4FRTA 2KXPB 2XE3A 4FRXA 4LSIA 6PRNA 4AFKA 8PRNA 5IYUA 4FUVA 3AA0B 3EMNX 4LSEA 4O3XB 4FZMA 2XG6A 4G76A 3LK41 1H6S1 4JFBA 3KVDD 4AYMC 2W81C 3VY8X 1QJ9A 3TZGA 3WI5A 2ERVA 3VE2A 1IZNB 2J4UP 3T24A 4AKRA 4KR4A 4B61A 3VZWX 2MHLA 2KXPA 2Y0LA 4AYID 4O3YA 4O3WA 3UU2A 2FGRA 4AKMA 2JMMA 3PRNA 3SY9A 1GFMA 1QJ8A 1ZHYA 3LK2A 3UAQA 4U9CA 2KC0A 5FVNA 4FESA 1BT9A 2Y7SA 2ZFGA 3PQUA 4XNLA 1Q9GA 2KZ7A 2M07A 3JTYA 3K19A 2XE1A 2K0LA 3VY9X 2OMFA 3DA3A 5ADXK 3POUA 3DA4A 4GHBA 2PORA 4LSFA 3VZUX 4O4UA 1G90A 4O49A 2K4TA 4F4BA 3LK2B 5GV0A 2N2MA 3VE1A 3V8UA 5AFUL 1PRNA 2KZ7B 2XTRA 1ZHXA 1HXUA 1GFNA 1BXWA 2YPVA 3AA1A 4O3ZA 5T5FA 1HXXA 2KDYA 4D65A 3POXA 5PRNA 3PORA 3SYSA 2F1VA 1YS5A 2Y2XA 3LK42 4G75A 3PQSA 4RJXA 2MNHA 1P4TA 2XTQA 2Y0HA 3VZTX 1GFQA 1OPFA 3QRCA 3LK3A 2Y0KA 2O4VA 4RLCA 3SZVA 3AA1B 3UPGA 2YNKA 2PRNA 5DL5A 4FSOA 4GCSA 3AA6A 5G26A 3HW9A 3HWBA 1HXTA 5ADXL 3AAEA 2F1TA 4RL9A 3LK3B 3T20A 4D64A 3AA7B 3A2SX 1E54A 3SZDA 5EE2A 4Z3TA 3AA6B 4FT6A 3AAEB 1GFOA 4KR8A 5DL8A 5DL6A 4PUXA 4AZLA 1QJPA 4LSHA 1ZHTA 5DL7A 3SYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTK A;  1PHO A;  3O0E A;  4KRA A;  1MPF A;  2ZLD A;  4GCP A;  4FMS A;  1GFP A;  2XE2 A;  4GCQ A;  3T0S A;  4BUM X;  2XE5 A;  1OSM A;  2J1N A;  4C69 X;  4RJW A;  7PRN A;  2ODJ A;  4AUI A;  3SY7 A;  4D5U A;  5JDP A;  2FGQ X;  4FSP A;  3WI4 A;  4FOZ A;  3FYX A;  3NSG A;  6PRN A;  3POQ A;  4FRT A;  2XE3 A;  4FRX A;  8PRN A;  4LSI A;  3EMN X;  4LSE A;  2XG6 A;  1H6S 1;  4JFB A;  3VY8 X;  3WI5 A;  2J4U P;  3T24 A;  4KR4 A;  3VZW X;  2Y0L A;  3UU2 A;  2FGR A;  3PRN A;  3SY9 A;  1GFM A;  5FVN A;  1BT9 A;  2ZFG A;  3K19 A;  3JTY A;  2XE1 A;  3VY9 X;  2OMF A;  3POU A;  4LSF A;  3VZU X;  2POR A;  2K4T A;  1PRN A;  1HXU A;  1GFN A;  1HXX A;  4D65 A;  3POX A;  5PRN A;  3POR A;  3SYS A;  2Y2X A;  4RJX A;  2Y0H A;  3VZT X;  1GFQ A;  1OPF A;  2Y0K A;  2O4V A;  3SZV A;  3UPG A;  2PRN A;  5DL5 A;  4FSO A;  4GCS A;  3HW9 A;  3HWB A;  1HXT A;  3T20 A;  4D64 A;  3A2S X;  1E54 A;  3SZD A;  4FT6 A;  5DL8 A;  1GFO A;  4KR8 A;  5DL6 A;  1BH3 A;  4LSH A;  5DL7 A;  3SYB A; 
#chains in the Genus database with same CATH topology
 1ZHW A;  4PJ0 O;  2M06 A;  4N74 A;  2QTK A;  2GE4 A;  3C5O A;  4E1T A;  4FZL A;  2LFU A;  4C4V A;  2WJQ A;  4N59 A;  5E79 O;  1MM5 A;  1PHO A;  3AA7 A;  1BH3 A;  3O0E A;  4KRA A;  1MPF A;  1ORM A;  2ZLD A;  4GCP A;  4FMS A;  4N75 A;  5GTI O;  1GFP A;  3QRA A;  2XE2 A;  2XMX A;  4E1S A;  4QQ1 A;  3GP6 A;  1MM4 A;  5D5D A;  4PR7 A;  5AFU K;  2X27 X;  3HOL A;  1S5L O;  2W80 C;  4GCQ A;  4CTD A;  4RLB A;  4XNK A;  3T0S A;  4C4V B;  3PF1 A;  4AYN A;  3AAA A;  4IL6 O;  2LHF A;  4N58 A;  4BUM X;  3AA0 A;  2XE5 A;  1OSM A;  2J1N A;  3HOE A;  4RJW A;  4FZN A;  4AYD C;  4C00 A;  4C69 X;  7PRN A;  4JCH A;  2ODJ A;  2IWW A;  4AUI A;  3SY7 A;  4D5U A;  4O4X A;  5B66 O;  1Q9F A;  5JDP A;  1ZHZ A;  3RBH A;  2N2L A;  2FGQ X;  4FSP A;  3WI4 A;  4AKR B;  4FOZ A;  3G7G A;  1IZN A;  3FYX A;  3NSG A;  4GF4 A;  4AYE C;  3AAA B;  1THQ A;  3POQ A;  4FRT A;  2KXP B;  2XE3 A;  4FRX A;  4LSI A;  2JQY A;  5KAF O;  4AFK A;  8PRN A;  4FUV A;  3AA0 B;  5IYU A;  3EMN X;  2R4P A;  4LSE A;  4O3X B;  4FQE A;  2F1C X;  4FZM A;  5G3A A;  2XG6 A;  4G76 A;  3LK4 1;  2WJR A;  1H6S 1;  2R88 A;  2R8A A;  3KVD D;  4JFB A;  4AYM C;  3PGS A;  2W81 C;  3VY8 X;  1QJ9 A;  3TZG A;  3WI5 A;  2ERV A;  3VE2 A;  1IZN B;  2J4U P;  3T24 A;  4AKR A;  3DWO X;  4KR4 A;  3WU2 O;  4B61 A;  1T16 A;  3VZW X;  2MHL A;  2KXP A;  2Y0L A;  4AYI D;  4O3Y A;  4O3W A;  3UU2 A;  2FGR A;  4AKM A;  2JMM A;  2R4L A;  4UB8 O;  2R4N A;  3PRN A;  3SY9 A;  1GFM A;  1QJ8 A;  3PGR A;  1ZHY A;  3LK2 A;  3UAQ A;  4U9C A;  2KC0 A;  5FVN A;  4FES A;  1BT9 A;  2Y7S A;  2ZFG A;  3PQU A;  2R89 A;  4XNL A;  1Q9G A;  2KZ7 A;  2M07 A;  3JTY A;  3K19 A;  2XE1 A;  5H2F O;  2K0L A;  3VY9 X;  2OMF A;  3DA3 A;  5ADX K;  2X9K A;  3A0H O;  3DA4 A;  3POU A;  2POR A;  4GHB A;  4LSF A;  4O4U A;  3VZU X;  1G90 A;  4O49 A;  2K4T A;  4F4B A;  3LK2 B;  5KAI O;  5GV0 A;  2N2M A;  3VE1 A;  3V8U A;  4K3C A;  5AFU L;  1PRN A;  2KZ7 B;  2XTR A;  1ZHX A;  1HXU A;  3NJT A;  1GFN A;  1BXW A;  2YPV A;  3A0B O;  4K3B A;  3AA1 A;  4O3Z A;  2R4O A;  5T5F A;  3DWN A;  1HXX A;  2KDY A;  4D65 A;  4UB6 O;  3POX A;  5PRN A;  2WVP A;  3DZM A;  3POR A;  3SYS A;  2F1V A;  1YS5 A;  2Y2X A;  3LK4 2;  4G75 A;  3PQS A;  4RJX A;  2MNH A;  1P4T A;  2XTQ A;  2Y0H A;  3BRY A;  3VZT X;  1GFQ A;  1OPF A;  3QRC A;  3LK3 A;  2Y0K A;  3PGU A;  2O4V A;  5B5E O;  4RLC A;  3SZV A;  3AA1 B;  3UPG A;  2YNK A;  5G38 A;  2PRN A;  5DL5 A;  4FSO A;  4GCS A;  3AA6 A;  5G26 A;  3HW9 A;  5GTH O;  3JCU O;  3BS0 A;  3HWB A;  1HXT A;  5ADX L;  3AAE A;  2F1T A;  5TIS O;  4RL9 A;  5G39 A;  6PRN A;  3LK3 B;  3BRZ A;  3T20 A;  2AXT O;  4D64 A;  3AA7 B;  3A2S X;  1E54 A;  3KZI O;  3SZD A;  5EE2 A;  4Z3T A;  3AA6 B;  4FT6 A;  3AAE B;  1GFO A;  4KR8 A;  5DL8 A;  5DL6 A;  4PUX A;  1T1L A;  4AZL A;  2IWV A;  1QJP A;  4LSH A;  1ZHT A;  5DL7 A;  3SYB A; 
#chains in the Genus database with same CATH homology
 1ZHW A;  2M06 A;  2QTK A;  2GE4 A;  3C5O A;  4E1T A;  4FZL A;  2LFU A;  4N59 A;  1MM5 A;  1PHO A;  3AA7 A;  1BH3 A;  3O0E A;  4KRA A;  1MPF A;  1ORM A;  2ZLD A;  4GCP A;  4FMS A;  1GFP A;  3QRA A;  2XE2 A;  2XMX A;  4E1S A;  4QQ1 A;  3GP6 A;  1MM4 A;  5D5D A;  5AFU K;  2X27 X;  3HOL A;  2W80 C;  4GCQ A;  4RLB A;  4XNK A;  3T0S A;  4AYN A;  3AAA A;  2LHF A;  4N58 A;  4BUM X;  3AA0 A;  2XE5 A;  1OSM A;  2J1N A;  3HOE A;  4RJW A;  4FZN A;  4AYD C;  4C69 X;  7PRN A;  4JCH A;  2ODJ A;  4AUI A;  3SY7 A;  4D5U A;  4O4X A;  1Q9F A;  5JDP A;  1ZHZ A;  3RBH A;  2N2L A;  2FGQ X;  4FSP A;  3WI4 A;  4AKR B;  4FOZ A;  3G7G A;  1IZN A;  3FYX A;  3NSG A;  4GF4 A;  4AYE C;  3AAA B;  1THQ A;  3POQ A;  4FRT A;  2KXP B;  2XE3 A;  4FRX A;  4LSI A;  6PRN A;  4AFK A;  8PRN A;  5IYU A;  4FUV A;  3AA0 B;  3EMN X;  4LSE A;  4O3X B;  4FZM A;  2XG6 A;  4G76 A;  3LK4 1;  1H6S 1;  4JFB A;  3KVD D;  4AYM C;  2W81 C;  3VY8 X;  1QJ9 A;  3TZG A;  3WI5 A;  2ERV A;  3VE2 A;  1IZN B;  2J4U P;  3T24 A;  4AKR A;  4KR4 A;  4B61 A;  3VZW X;  2MHL A;  2KXP A;  2Y0L A;  4AYI D;  4O3Y A;  4O3W A;  3UU2 A;  2FGR A;  4AKM A;  2JMM A;  3PRN A;  3SY9 A;  1GFM A;  1QJ8 A;  1ZHY A;  3LK2 A;  3UAQ A;  4U9C A;  2KC0 A;  5FVN A;  4FES A;  1BT9 A;  2Y7S A;  2ZFG A;  3PQU A;  4XNL A;  1Q9G A;  2KZ7 A;  2M07 A;  3JTY A;  3K19 A;  2XE1 A;  2K0L A;  3VY9 X;  2OMF A;  3DA3 A;  5ADX K;  3POU A;  3DA4 A;  4GHB A;  2POR A;  4LSF A;  3VZU X;  4O4U A;  1G90 A;  4O49 A;  2K4T A;  4F4B A;  3LK2 B;  5GV0 A;  2N2M A;  3VE1 A;  3V8U A;  5AFU L;  1PRN A;  2KZ7 B;  2XTR A;  1ZHX A;  1HXU A;  1GFN A;  1BXW A;  2YPV A;  3AA1 A;  4O3Z A;  5T5F A;  1HXX A;  2KDY A;  4D65 A;  3POX A;  5PRN A;  3POR A;  3SYS A;  2F1V A;  1YS5 A;  2Y2X A;  3LK4 2;  4G75 A;  3PQS A;  4RJX A;  2MNH A;  1P4T A;  2XTQ A;  2Y0H A;  3VZT X;  1GFQ A;  1OPF A;  3QRC A;  3LK3 A;  2Y0K A;  2O4V A;  4RLC A;  3SZV A;  3AA1 B;  3UPG A;  2YNK A;  2PRN A;  5DL5 A;  4FSO A;  4GCS A;  3AA6 A;  5G26 A;  3HW9 A;  3HWB A;  1HXT A;  5ADX L;  3AAE A;  2F1T A;  4RL9 A;  3LK3 B;  3T20 A;  4D64 A;  3AA7 B;  3A2S X;  1E54 A;  3SZD A;  5EE2 A;  4Z3T A;  3AA6 B;  4FT6 A;  3AAE B;  1GFO A;  4KR8 A;  5DL8 A;  5DL6 A;  4PUX A;  4AZL A;  1QJP A;  4LSH A;  1ZHT A;  5DL7 A;  3SYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...