4GCPA

Crystal structure of e. coli ompf porin in complex with ampicillin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
molecule keywords Outer membrane protein F
total genus 99
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcpA00
2PORA 1BT9A 3SY9A 3PRNA 1PRNA 2K4TA 4LSIA 4FRXA 3O0EA 3VY9X 3SY7A 4KRAA 5DL7A 3SYSA 4AUIA 2ZFGA 2XE5A 3HWBA 3WI5A 4LSEA 1OSMA 4JFBA 3PORA 4KR4A 3JTYA 3T24A 3VZWX 3SZDA 4RJXA 1H6S1 4D5UA 1GFPA 1HXTA 1GFOA 2O4VA 2FGQX 4BUMX 1GFMA 5PRNA 3UU2A 5DL6A 6PRNA 2Y0KA 5DL8A 7PRNA 2PRNA 2XG6A 2FGRA 3SZVA 3T20A 3K19A 1HXXA 2Y0HA 3POXA 1OPFA 3EMNX 1E54A 3VZUX 3POUA 3FYXA 4GCSA 3A2SX 2QTKA 4GCPA 5FVNA 4D64A 3NSGA 3T0SA 1BH3A 4D65A 8PRNA 1HXUA 2ZLDA 2ODJA 2XE3A 3POQA 3VY8X 5JDPA 3WI4A 2XE2A 4FT6A 2XE1A 2J1NA 2Y0LA 3VZTX 4FOZA 4LSFA 1MPFA 2Y2XA 4FSOA 4C69X 4RJWA 2J4UP 3UPGA 5DL5A 4FSPA 1PHOA 4KR8A 1GFNA 3SYBA 1GFQA 3HW9A 4FMSA 4FRTA 2OMFA 4LSHA 4GCQA
chains in the Genus database with same CATH superfamily
3AAEB 2PORA 2XTQA 1BT9A 3SY9A 5ADXK 3PF1A 5KAIO 3PRNA 1PRNA 3PGRA 2K4TA 4FZLA 4FRXA 2R89A 3AA7B 4LSIA 2R4OA 1QJPA 2KZ7A 3O0EA 4RLCA 2W81C 2M07A 5E79O 4O4UA 2M06A 3VY9X 2JQYA 1THQA 3SY7A 2N2LA 3HOEA 4KRAA 5DL7A 3SYSA 4AUIA 2ZFGA 1ORMA 4F4BA 1P4TA 2XE5A 3DA3A 3HWBA 4FQEA 2R8AA 4FZNA 2XTRA 4E1TA 3WI5A 4AYDC 3BRZA 4LSEA 5H2FO 1OSMA 4O3ZA 3BRYA 4JFBA 2AXTO 3PGSA 3PORA 4U9CA 4KR4A 4AYMC 3VE1A 2IWWA 5AFUK 3JTYA 3T24A 5IYUA 3KZIO 3VZWX 1ZHYA 5KAFO 1ZHTA 2KC0A 2WJRA 3SZDA 4G75A 1QJ8A 2R4PA 1IZNA 3LK3A 1H6S1 3BS0A 4RJXA 2WJQA 4AKMA 3DWOX 3LK3B 4D5UA 1GFPA 3LK2A 3NJTA 3V8UA 1HXTA 1MM5A 1GFOA 2O4VA 2FGQX 5T5FA 4BUMX 2LHFA 4CTDA 1GFMA 3LK42 4AYID 4AYNA 5PRNA 3UU2A 4K3BA 2X9KA 2KDYA 2X27X 5DL6A 6PRNA 3AA0A 3PQSA 2Y0KA 3VE2A 4C4VA 3A0BO 5ADXL 5DL8A 2MNHA 4C4VB 7PRNA 2Y7SA 4XNLA 2PRNA 2KZ7B 2XG6A 1Q9GA 3AAAB 2K0LA 5GTHO 4JCHA 4C00A 2FGRA 5G26A 1S5LO 4GHBA 3GP6A 5EE2A 3SZVA 4AFKA 4QQ1A 4AKRB 4N74A 4O3XB 1Q9FA 2R4NA 3WU2O 4AYEC 4FESA 4E1SA 3T20A 2LFUA 2R4LA 1HXXA 3DZMA 3K19A 3AA0B 4FZMA 4AKRA 3QRAA 3AAEA 3AA7A 3AAAA 3DA4A 1MM4A 4O49A 2F1VA 2Y0HA 3POXA 4UB8O 4XNKA 1OPFA 3EMNX 4O4XA 4O3YA 1E54A 1G90A 5AFUL 3VZUX 1BXWA 3POUA 3FYXA 4GCSA 4N58A 4K3CA 3TZGA 2MHLA 2XMXA 3A2SX 5GTIO 3RBHA 2QTKA 2IWVA 2R88A 5B5EO 4GCPA 5FVNA 4O3WA 4D64A 3NSGA 4PJ0O 5D5DA 3T0SA 1BH3A 2JMMA 3AA1A 4D65A 8PRNA 1HXUA 4GF4A 2ZLDA 2ODJA 2XE3A 3PGUA 3POQA 3VY8X 4FUVA 4Z3TA 5TISO 5JDPA 5G38A 3WI4A 2XE2A 1T16A 3LK2B 1YS5A 1ZHZA 5G39A 4IL6O 4FT6A 4RLBA 2XE1A 1IZNB 3A0HO 3QRCA 4AZLA 3C5OA 3DWNA 2J1NA 2Y0LA 3PQUA 3LK41 3KVDD 4N75A 4RL9A 2F1TA 3VZTX 5B66O 2W80C 4FOZA 4LSFA 3AA1B 1MPFA 2N2MA 2Y2XA 4FSOA 1T1LA 3AA6B 2ERVA 4C69X 4RJWA 2J4UP 1QJ9A 3AA6A 4FSPA 5DL5A 3UPGA 2F1CX 4N59A 1PHOA 1ZHXA 4KR8A 1GFNA 4UB6O 3SYBA 4PR7A 1GFQA 5GV0A 4B61A 3HW9A 4FMSA 2WVPA 4FRTA 3HOLA 3UAQA 2OMFA 4PUXA 2YPVA 2GE4A 5G3AA 3JCUO 1ZHWA 2KXPA 4LSHA 4GCQA 4G76A 2KXPB 3G7GA 2YNKA
chains in the Genus database with same CATH topology
3AAEB 2PORA 2XTQA 1BT9A 3SY9A 5ADXK 3PRNA 1PRNA 2K4TA 4FZLA 4FRXA 3AA7B 4LSIA 1QJPA 2KZ7A 3O0EA 4RLCA 2W81C 2M07A 3VY9X 4O4UA 2M06A 1THQA 3SY7A 2N2LA 3HOEA 4KRAA 5DL7A 3SYSA 4AUIA 2ZFGA 1ORMA 4F4BA 1P4TA 2XE5A 3DA3A 3HWBA 4FZNA 4E1TA 2XTRA 3WI5A 4AYDC 4LSEA 1OSMA 4O3ZA 4JFBA 3PORA 4U9CA 4KR4A 4AYMC 3VE1A 5AFUK 3JTYA 3T24A 5IYUA 3VZWX 1ZHYA 1ZHTA 2KC0A 3SZDA 4G75A 1QJ8A 3LK3A 1IZNA 4RJXA 1H6S1 4AKMA 3LK3B 4D5UA 1GFPA 3LK2A 3V8UA 1HXTA 1MM5A 1GFOA 2O4VA 2FGQX 5T5FA 4BUMX 2LHFA 1GFMA 3LK42 4AYID 4AYNA 5PRNA 3UU2A 5DL6A 6PRNA 2KDYA 2X27X 3AA0A 3PQSA 2Y0KA 3VE2A 5ADXL 5DL8A 2MNHA 7PRNA 2Y7SA 4XNLA 2PRNA 2KZ7B 2XG6A 1Q9GA 3AAAB 2K0LA 4JCHA 2FGRA 5G26A 4GHBA 4AFKA 3GP6A 5EE2A 3SZVA 4QQ1A 4AKRB 4O3XB 1Q9FA 4AYEC 4E1SA 4FESA 3T20A 2LFUA 1HXXA 3K19A 4FZMA 4AKRA 3AA0B 3QRAA 3AAEA 3AA7A 3AAAA 3DA4A 1MM4A 4O49A 2F1VA 2Y0HA 3POXA 4XNKA 1OPFA 3EMNX 4O4XA 4O3YA 1E54A 1G90A 5AFUL 3VZUX 1BXWA 3POUA 3FYXA 4GCSA 4N58A 3TZGA 2MHLA 2XMXA 3A2SX 3RBHA 2QTKA 4GCPA 5FVNA 4O3WA 4D64A 3NSGA 5D5DA 3T0SA 1BH3A 2JMMA 3AA1A 4D65A 8PRNA 1HXUA 4GF4A 2ZLDA 2ODJA 2XE3A 3POQA 3VY8X 4Z3TA 4FUVA 5JDPA 3WI4A 2XE2A 3LK2B 1YS5A 1ZHZA 4FT6A 4RLBA 2XE1A 1IZNB 3QRCA 4AZLA 3C5OA 2J1NA 2Y0LA 3PQUA 3LK41 3KVDD 4RL9A 3VZTX 2F1TA 2W80C 4FOZA 4LSFA 3AA1B 1MPFA 2N2MA 2Y2XA 4FSOA 3AA6B 2ERVA 4C69X 4RJWA 2J4UP 1QJ9A 3AA6A 4FSPA 5DL5A 3UPGA 4N59A 1PHOA 1ZHXA 4KR8A 1GFNA 3SYBA 1GFQA 5GV0A 4B61A 3HW9A 4FMSA 4FRTA 3HOLA 3UAQA 2OMFA 4PUXA 2YPVA 2GE4A 1ZHWA 2KXPA 4LSHA 4GCQA 4G76A 2KXPB 3G7GA 2YNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2POR A;  1BT9 A;  3SY9 A;  3PRN A;  1PRN A;  2K4T A;  4LSI A;  4FRX A;  3O0E A;  3VY9 X;  3SY7 A;  4KRA A;  5DL7 A;  3SYS A;  4AUI A;  2ZFG A;  2XE5 A;  3HWB A;  3WI5 A;  4LSE A;  1OSM A;  4JFB A;  3POR A;  4KR4 A;  3JTY A;  3T24 A;  3VZW X;  3SZD A;  4RJX A;  1H6S 1;  4D5U A;  1GFP A;  1HXT A;  1GFO A;  2O4V A;  2FGQ X;  4BUM X;  1GFM A;  5PRN A;  3UU2 A;  5DL6 A;  6PRN A;  2Y0K A;  5DL8 A;  7PRN A;  2PRN A;  2XG6 A;  2FGR A;  3SZV A;  3T20 A;  3K19 A;  1HXX A;  2Y0H A;  3POX A;  1OPF A;  3EMN X;  1E54 A;  3VZU X;  3POU A;  3FYX A;  4GCS A;  3A2S X;  2QTK A;  4GCP A;  5FVN A;  4D64 A;  3NSG A;  3T0S A;  1BH3 A;  4D65 A;  8PRN A;  1HXU A;  2ZLD A;  2ODJ A;  2XE3 A;  3POQ A;  3VY8 X;  5JDP A;  3WI4 A;  2XE2 A;  4FT6 A;  2XE1 A;  2J1N A;  2Y0L A;  3VZT X;  4FOZ A;  4LSF A;  1MPF A;  2Y2X A;  4FSO A;  4C69 X;  4RJW A;  2J4U P;  3UPG A;  5DL5 A;  4FSP A;  1PHO A;  4KR8 A;  1GFN A;  3SYB A;  1GFQ A;  3HW9 A;  4FMS A;  4FRT A;  2OMF A;  4LSH A;  4GCQ A; 
#chains in the Genus database with same CATH topology
 3AAE B;  2POR A;  2XTQ A;  1BT9 A;  3SY9 A;  5ADX K;  3PF1 A;  5KAI O;  3PRN A;  1PRN A;  3PGR A;  2K4T A;  4FZL A;  4FRX A;  2R89 A;  3AA7 B;  4LSI A;  2R4O A;  1QJP A;  2KZ7 A;  3O0E A;  4RLC A;  2W81 C;  2M07 A;  5E79 O;  4O4U A;  2M06 A;  3VY9 X;  2JQY A;  1THQ A;  3SY7 A;  2N2L A;  3HOE A;  4KRA A;  5DL7 A;  3SYS A;  4AUI A;  2ZFG A;  1ORM A;  4F4B A;  1P4T A;  2XE5 A;  3DA3 A;  3HWB A;  4FQE A;  2R8A A;  4FZN A;  2XTR A;  4E1T A;  3WI5 A;  4AYD C;  3BRZ A;  4LSE A;  5H2F O;  1OSM A;  4O3Z A;  3BRY A;  4JFB A;  2AXT O;  3PGS A;  3POR A;  4U9C A;  4KR4 A;  4AYM C;  3VE1 A;  2IWW A;  5AFU K;  3JTY A;  3T24 A;  5IYU A;  3KZI O;  3VZW X;  1ZHY A;  5KAF O;  1ZHT A;  2KC0 A;  2WJR A;  3SZD A;  4G75 A;  1QJ8 A;  2R4P A;  1IZN A;  3LK3 A;  1H6S 1;  3BS0 A;  4RJX A;  2WJQ A;  4AKM A;  3DWO X;  3LK3 B;  4D5U A;  1GFP A;  3LK2 A;  3NJT A;  3V8U A;  1HXT A;  1MM5 A;  1GFO A;  2O4V A;  2FGQ X;  5T5F A;  4BUM X;  2LHF A;  4CTD A;  1GFM A;  3LK4 2;  4AYI D;  4AYN A;  5PRN A;  3UU2 A;  4K3B A;  2X9K A;  2KDY A;  2X27 X;  5DL6 A;  6PRN A;  3AA0 A;  3PQS A;  2Y0K A;  3VE2 A;  4C4V A;  3A0B O;  5ADX L;  5DL8 A;  2MNH A;  4C4V B;  7PRN A;  2Y7S A;  4XNL A;  2PRN A;  2KZ7 B;  2XG6 A;  1Q9G A;  3AAA B;  2K0L A;  5GTH O;  4JCH A;  4C00 A;  2FGR A;  5G26 A;  1S5L O;  4GHB A;  3GP6 A;  5EE2 A;  3SZV A;  4AFK A;  4QQ1 A;  4AKR B;  4N74 A;  4O3X B;  1Q9F A;  2R4N A;  3WU2 O;  4AYE C;  4FES A;  4E1S A;  3T20 A;  2LFU A;  2R4L A;  1HXX A;  3DZM A;  3K19 A;  3AA0 B;  4FZM A;  4AKR A;  3QRA A;  3AAE A;  3AA7 A;  3AAA A;  3DA4 A;  1MM4 A;  4O49 A;  2F1V A;  2Y0H A;  3POX A;  4UB8 O;  4XNK A;  1OPF A;  3EMN X;  4O4X A;  4O3Y A;  1E54 A;  1G90 A;  5AFU L;  3VZU X;  1BXW A;  3POU A;  3FYX A;  4GCS A;  4N58 A;  4K3C A;  3TZG A;  2MHL A;  2XMX A;  3A2S X;  5GTI O;  3RBH A;  2QTK A;  2IWV A;  2R88 A;  5B5E O;  4GCP A;  5FVN A;  4O3W A;  4D64 A;  3NSG A;  4PJ0 O;  5D5D A;  3T0S A;  1BH3 A;  2JMM A;  3AA1 A;  4D65 A;  8PRN A;  1HXU A;  4GF4 A;  2ZLD A;  2ODJ A;  2XE3 A;  3PGU A;  3POQ A;  3VY8 X;  4FUV A;  4Z3T A;  5TIS O;  5JDP A;  5G38 A;  3WI4 A;  2XE2 A;  1T16 A;  3LK2 B;  1YS5 A;  1ZHZ A;  5G39 A;  4IL6 O;  4FT6 A;  4RLB A;  2XE1 A;  1IZN B;  3A0H O;  3QRC A;  4AZL A;  3C5O A;  3DWN A;  2J1N A;  2Y0L A;  3PQU A;  3LK4 1;  3KVD D;  4N75 A;  4RL9 A;  2F1T A;  3VZT X;  5B66 O;  2W80 C;  4FOZ A;  4LSF A;  3AA1 B;  1MPF A;  2N2M A;  2Y2X A;  4FSO A;  1T1L A;  3AA6 B;  2ERV A;  4C69 X;  4RJW A;  2J4U P;  1QJ9 A;  3AA6 A;  4FSP A;  5DL5 A;  3UPG A;  2F1C X;  4N59 A;  1PHO A;  1ZHX A;  4KR8 A;  1GFN A;  4UB6 O;  3SYB A;  4PR7 A;  1GFQ A;  5GV0 A;  4B61 A;  3HW9 A;  4FMS A;  2WVP A;  4FRT A;  3HOL A;  3UAQ A;  2OMF A;  4PUX A;  2YPV A;  2GE4 A;  5G3A A;  3JCU O;  1ZHW A;  2KXP A;  4LSH A;  4GCQ A;  4G76 A;  2KXP B;  3G7G A;  2YNK A; 
#chains in the Genus database with same CATH homology
 3AAE B;  2POR A;  2XTQ A;  1BT9 A;  3SY9 A;  5ADX K;  3PRN A;  1PRN A;  2K4T A;  4FZL A;  4FRX A;  3AA7 B;  4LSI A;  1QJP A;  2KZ7 A;  3O0E A;  4RLC A;  2W81 C;  2M07 A;  3VY9 X;  4O4U A;  2M06 A;  1THQ A;  3SY7 A;  2N2L A;  3HOE A;  4KRA A;  5DL7 A;  3SYS A;  4AUI A;  2ZFG A;  1ORM A;  4F4B A;  1P4T A;  2XE5 A;  3DA3 A;  3HWB A;  4FZN A;  4E1T A;  2XTR A;  3WI5 A;  4AYD C;  4LSE A;  1OSM A;  4O3Z A;  4JFB A;  3POR A;  4U9C A;  4KR4 A;  4AYM C;  3VE1 A;  5AFU K;  3JTY A;  3T24 A;  5IYU A;  3VZW X;  1ZHY A;  1ZHT A;  2KC0 A;  3SZD A;  4G75 A;  1QJ8 A;  3LK3 A;  1IZN A;  4RJX A;  1H6S 1;  4AKM A;  3LK3 B;  4D5U A;  1GFP A;  3LK2 A;  3V8U A;  1HXT A;  1MM5 A;  1GFO A;  2O4V A;  2FGQ X;  5T5F A;  4BUM X;  2LHF A;  1GFM A;  3LK4 2;  4AYI D;  4AYN A;  5PRN A;  3UU2 A;  5DL6 A;  6PRN A;  2KDY A;  2X27 X;  3AA0 A;  3PQS A;  2Y0K A;  3VE2 A;  5ADX L;  5DL8 A;  2MNH A;  7PRN A;  2Y7S A;  4XNL A;  2PRN A;  2KZ7 B;  2XG6 A;  1Q9G A;  3AAA B;  2K0L A;  4JCH A;  2FGR A;  5G26 A;  4GHB A;  4AFK A;  3GP6 A;  5EE2 A;  3SZV A;  4QQ1 A;  4AKR B;  4O3X B;  1Q9F A;  4AYE C;  4E1S A;  4FES A;  3T20 A;  2LFU A;  1HXX A;  3K19 A;  4FZM A;  4AKR A;  3AA0 B;  3QRA A;  3AAE A;  3AA7 A;  3AAA A;  3DA4 A;  1MM4 A;  4O49 A;  2F1V A;  2Y0H A;  3POX A;  4XNK A;  1OPF A;  3EMN X;  4O4X A;  4O3Y A;  1E54 A;  1G90 A;  5AFU L;  3VZU X;  1BXW A;  3POU A;  3FYX A;  4GCS A;  4N58 A;  3TZG A;  2MHL A;  2XMX A;  3A2S X;  3RBH A;  2QTK A;  4GCP A;  5FVN A;  4O3W A;  4D64 A;  3NSG A;  5D5D A;  3T0S A;  1BH3 A;  2JMM A;  3AA1 A;  4D65 A;  8PRN A;  1HXU A;  4GF4 A;  2ZLD A;  2ODJ A;  2XE3 A;  3POQ A;  3VY8 X;  4Z3T A;  4FUV A;  5JDP A;  3WI4 A;  2XE2 A;  3LK2 B;  1YS5 A;  1ZHZ A;  4FT6 A;  4RLB A;  2XE1 A;  1IZN B;  3QRC A;  4AZL A;  3C5O A;  2J1N A;  2Y0L A;  3PQU A;  3LK4 1;  3KVD D;  4RL9 A;  3VZT X;  2F1T A;  2W80 C;  4FOZ A;  4LSF A;  3AA1 B;  1MPF A;  2N2M A;  2Y2X A;  4FSO A;  3AA6 B;  2ERV A;  4C69 X;  4RJW A;  2J4U P;  1QJ9 A;  3AA6 A;  4FSP A;  5DL5 A;  3UPG A;  4N59 A;  1PHO A;  1ZHX A;  4KR8 A;  1GFN A;  3SYB A;  1GFQ A;  5GV0 A;  4B61 A;  3HW9 A;  4FMS A;  4FRT A;  3HOL A;  3UAQ A;  2OMF A;  4PUX A;  2YPV A;  2GE4 A;  1ZHW A;  2KXP A;  4LSH A;  4GCQ A;  4G76 A;  2KXP B;  3G7G A;  2YNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...