4GCPA

Crystal structure of e. coli ompf porin in complex with ampicillin
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
333
structure length
333
Chain Sequence
GNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein F
publication title The Binding of Antibiotics in OmpF Porin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein/antibiotic
total genus 99
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00267 Porin_1 Gram-negative porin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 4gcpA00
4FRXA 5DL6A 4GCPA 2Y0KA 1GFPA 3POXA 3POUA 2ODJA 1MPFA 6PRNA 3PORA 1HXTA 4RJXA 4AUIA 4C69X 1PHOA 3UPGA 3HW9A 3SZVA 2Y0HA 2K4TA 8PRNA 3A2SX 2PORA 3SY7A 4LSFA 1BT9A 5DL7A 5PRNA 3T20A 3VZTX 4FT6A 2FGQX 2Y2XA 5DL5A 3SZDA 2PRNA 1GFOA 3O0EA 1HXXA 4KR4A 5JDPA 2J4UP 2XG6A 1GFNA 3VY8X 2XE5A 5DL8A 3VZUX 3UU2A 4FSPA 2OMFA 3SY9A 2J1NA 4LSEA 4FMSA 1BH3A 4KRAA 2Y0LA 4LSIA 3SYSA 1OPFA 4JFBA 4GCQA 3VZWX 3K19A 3WI4A 3VY9X 4RJWA 1PRNA 1E54A 4FRTA 4D5UA 4D65A 2ZFGA 2XE2A 5FVNA 1GFMA 2QTKA 1H6S1 1GFQA 3EMNX 3WI5A 2FGRA 4FSOA 7PRNA 3PRNA 4D64A 3T24A 4GCSA 3T0SA 4LSHA 2O4VA 2ZLDA 3NSGA 3FYXA 2XE3A 4KR8A 4BUMX 3HWBA 1HXUA 2XE1A 4FOZA 3POQA 1OSMA 3JTYA 3SYBA
chains in the Genus database with same CATH superfamily
2GE4A 4FRXA 4FZNA 5DL6A 3KZIO 4GCPA 2X9KA 2Y0KA 1GFPA 3POXA 1Q9FA 5G3AA 5E79O 1T16A 4AFKA 3POUA 1IZNA 2F1CX 2ODJA 2R88A 2W81C 5AFUK 1S5LO 4XNKA 1MPFA 3RBHA 4Z3TA 3LK2B 2JQYA 6PRNA 2F1VA 4AYEC 4FESA 3PORA 4O3XB 3PGUA 1HXTA 2IWVA 4G75A 2ERVA 1T1LA 3AA0A 5H2FO 4RJXA 3NJTA 3HOLA 5KAFO 3UAQA 2MHLA 4FQEA 4AUIA 4AKRA 4C69X 4CTDA 3AA7A 3PQUA 1PHOA 4PUXA 2R4OA 3UPGA 3HW9A 4O3YA 3SZVA 2AXTO 2XTRA 2LFUA 2K4TA 2Y0HA 5G26A 2M06A 4RLCA 3PF1A 4FUVA 3BRZA 5EE2A 2JMMA 5G39A 4E1SA 4E1TA 8PRNA 2N2MA 2R4PA 3A2SX 3AA1A 2PORA 1BXWA 2R4NA 3DA4A 3DWNA 3DWOX 5G38A 2IWWA 3SY7A 3LK3A 4LSFA 1BT9A 4RL9A 4GHBA 2XMXA 5DL7A 5PRNA 1Q9GA 3PGRA 4AYID 4O3WA 4IL6O 4K3BA 5ADXL 2Y7SA 4AYDC 3VZTX 3T20A 4FT6A 2FGQX 4C4VA 2Y2XA 3AA6B 3A0HO 3HOEA 2R4LA 4UB8O 1MM4A 2R8AA 4U9CA 4GF4A 4FZLA 3AAAA 4FZMA 3BS0A 5DL5A 3WU2O 3SZDA 2PRNA 4K3CA 3TZGA 4G76A 1GFOA 3O0EA 2KXPB 1HXXA 5KAIO 5AFUL 3LK41 3KVDD 4KR4A 5JDPA 2R89A 1ZHZA 2J4UP 1P4TA 1QJPA 2XG6A 1GFNA 1ZHWA 2WJQA 3C5OA 4O49A 3VY8X 2N2LA 2XE5A 5T5FA 2KZ7A 3QRAA 5DL8A 3VE1A 3VZUX 1ZHXA 3QRCA 4FSPA 4N75A 3UU2A 1G90A 2OMFA 1IZNB 4F4BA 1ORMA 4JCHA 3DZMA 5B5EO 3SY9A 1MM5A 2J1NA 4FMSA 4LSEA 1BH3A 1THQA 4KRAA 3AAAB 4O3ZA 5B66O 2Y0LA 4LSIA 2K0LA 2YPVA 5GTHO 2KC0A 2YNKA 5TISO 4O4UA 2F1TA 1OPFA 2XTQA 3AA0B 4JFBA 4N74A 4GCQA 4QQ1A 4XNLA 5D5DA 5GTIO 3VE2A 3LK2A 3VZWX 4AKRB 2KDYA 2M07A 1QJ9A 2X27X 3AA7B 3K19A 2WJRA 3WI4A 4PR7A 3VY9X 3AAEA 4RJWA 3LK42 4AZLA 1PRNA 1E54A 3AA1B 4RLBA 4FRTA 4AYNA 4C4VB 4D5UA 3BRYA 4D65A 4PJ0O 2ZFGA 3DA3A 2XE2A 5FVNA 1GFMA 3LK3B 4C00A 3GP6A 2QTKA 1H6S1 1GFQA 1QJ8A 3EMNX 3G7GA 3WI5A 2FGRA 4AKMA 4B61A 4FSOA 7PRNA 3PRNA 4D64A 2MNHA 3T24A 4GCSA 3T0SA 5IYUA 4LSHA 2O4VA 4N58A 4AYMC 2W80C 1ZHTA 2ZLDA 3NSGA 3FYXA 2XE3A 4KR8A 4BUMX 1ZHYA 3AA6A 3AAEB 2WVPA 1YS5A 3V8UA 3HWBA 4N59A 3PGSA 5GV0A 2LHFA 3A0BO 1HXUA 2KZ7B 3SYSA 2KXPA 4UB6O 2XE1A 4FOZA 5ADXK 4O4XA 3POQA 3JCUO 1OSMA 3JTYA 3PQSA 3SYBA
chains in the Genus database with same CATH topology
2GE4A 4FRXA 4FZNA 5DL6A 4GCPA 2Y0KA 1GFPA 3POXA 1Q9FA 5AFUK 4AFKA 3POUA 1IZNA 2W81C 2ODJA 4XNKA 1MPFA 3RBHA 4Z3TA 3LK2B 6PRNA 2F1VA 4AYEC 4FESA 3PORA 4O3XB 1HXTA 4G75A 2ERVA 3AA0A 4RJXA 3UAQA 3HOLA 2MHLA 4AUIA 4AKRA 4C69X 3AA7A 3PQUA 1PHOA 4PUXA 3UPGA 3HW9A 4O3YA 3SZVA 2XTRA 2Y0HA 2LFUA 2K4TA 4AYID 5G26A 2M06A 4RLCA 4FUVA 4E1TA 5EE2A 2JMMA 4E1SA 8PRNA 2N2MA 3A2SX 3AA1A 2PORA 1BXWA 3DA4A 3SY7A 3LK3A 4LSFA 1BT9A 4RL9A 4GHBA 2XMXA 5DL7A 5PRNA 1Q9GA 5ADXL 1G90A 4O3WA 2Y7SA 4AYDC 3VZTX 3T20A 4FT6A 2FGQX 2Y2XA 3AA6B 3HOEA 1MM4A 4U9CA 4GF4A 4FZLA 3AAAA 4FZMA 5DL5A 3SZDA 2PRNA 3TZGA 4G76A 1GFOA 3O0EA 2KXPB 1HXXA 5AFUL 3LK41 3KVDD 4KR4A 5JDPA 2J4UP 1ZHZA 1P4TA 1QJPA 2XG6A 1GFNA 1ZHWA 3C5OA 4O49A 3VY8X 2N2LA 2XE5A 5T5FA 2KZ7A 3QRAA 5DL8A 3VE1A 3VZUX 1ZHXA 3QRCA 4FSPA 3UU2A 2OMFA 1IZNB 4F4BA 1ORMA 4JCHA 3SY9A 1MM5A 2J1NA 4FMSA 4LSEA 1BH3A 1THQA 4KRAA 3AAAB 4O3ZA 2Y0LA 4LSIA 2K0LA 2YPVA 2KC0A 2YNKA 3SYSA 4O4UA 2F1TA 1OPFA 2XTQA 3AA0B 4JFBA 4QQ1A 4GCQA 4XNLA 5D5DA 3VE2A 3LK2A 3VZWX 4AKRB 2KDYA 2M07A 1QJ9A 2X27X 3AA7B 3K19A 3WI4A 3VY9X 3AAEA 4RJWA 3LK42 4AZLA 1PRNA 1E54A 3AA1B 4RLBA 4FRTA 4AYNA 4D5UA 4D65A 2ZFGA 3DA3A 2XE2A 5FVNA 1GFMA 3LK3B 3GP6A 2QTKA 1H6S1 1GFQA 1QJ8A 3EMNX 3G7GA 3WI5A 2FGRA 4AKMA 4B61A 4FSOA 7PRNA 3PRNA 4D64A 2MNHA 3T24A 4GCSA 3T0SA 5IYUA 4LSHA 2O4VA 4N58A 4AYMC 2W80C 1ZHTA 2ZLDA 3NSGA 3FYXA 2XE3A 4KR8A 4BUMX 1ZHYA 3AA6A 3AAEB 3V8UA 1YS5A 3HWBA 4N59A 5GV0A 2LHFA 1HXUA 2KZ7B 2KXPA 2XE1A 4FOZA 5ADXK 4O4XA 3POQA 1OSMA 3JTYA 3PQSA 3SYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRX A;  5DL6 A;  4GCP A;  2Y0K A;  1GFP A;  3POX A;  3POU A;  2ODJ A;  1MPF A;  6PRN A;  3POR A;  1HXT A;  4RJX A;  4AUI A;  4C69 X;  1PHO A;  3UPG A;  3HW9 A;  3SZV A;  2Y0H A;  2K4T A;  8PRN A;  3A2S X;  2POR A;  3SY7 A;  4LSF A;  1BT9 A;  5DL7 A;  5PRN A;  3T20 A;  3VZT X;  4FT6 A;  2FGQ X;  2Y2X A;  5DL5 A;  3SZD A;  2PRN A;  1GFO A;  3O0E A;  1HXX A;  4KR4 A;  5JDP A;  2J4U P;  2XG6 A;  1GFN A;  3VY8 X;  2XE5 A;  5DL8 A;  3VZU X;  3UU2 A;  4FSP A;  2OMF A;  3SY9 A;  2J1N A;  4LSE A;  4FMS A;  1BH3 A;  4KRA A;  2Y0L A;  4LSI A;  3SYS A;  1OPF A;  4JFB A;  4GCQ A;  3VZW X;  3K19 A;  3WI4 A;  3VY9 X;  4RJW A;  1PRN A;  1E54 A;  4FRT A;  4D5U A;  4D65 A;  2ZFG A;  2XE2 A;  5FVN A;  1GFM A;  2QTK A;  1H6S 1;  1GFQ A;  3EMN X;  3WI5 A;  2FGR A;  4FSO A;  7PRN A;  3PRN A;  4D64 A;  3T24 A;  4GCS A;  3T0S A;  4LSH A;  2O4V A;  2ZLD A;  3NSG A;  3FYX A;  2XE3 A;  4KR8 A;  4BUM X;  3HWB A;  1HXU A;  2XE1 A;  4FOZ A;  3POQ A;  1OSM A;  3JTY A;  3SYB A; 
#chains in the Genus database with same CATH topology
 2GE4 A;  4FRX A;  4FZN A;  5DL6 A;  3KZI O;  4GCP A;  2X9K A;  2Y0K A;  1GFP A;  3POX A;  1Q9F A;  5G3A A;  5E79 O;  1T16 A;  4AFK A;  3POU A;  1IZN A;  2F1C X;  2ODJ A;  2R88 A;  2W81 C;  5AFU K;  1S5L O;  4XNK A;  1MPF A;  3RBH A;  4Z3T A;  3LK2 B;  2JQY A;  6PRN A;  2F1V A;  4AYE C;  4FES A;  3POR A;  4O3X B;  3PGU A;  1HXT A;  2IWV A;  4G75 A;  2ERV A;  1T1L A;  3AA0 A;  5H2F O;  4RJX A;  3NJT A;  3HOL A;  5KAF O;  3UAQ A;  2MHL A;  4FQE A;  4AUI A;  4AKR A;  4C69 X;  4CTD A;  3AA7 A;  3PQU A;  1PHO A;  4PUX A;  2R4O A;  3UPG A;  3HW9 A;  4O3Y A;  3SZV A;  2AXT O;  2XTR A;  2LFU A;  2K4T A;  2Y0H A;  5G26 A;  2M06 A;  4RLC A;  3PF1 A;  4FUV A;  3BRZ A;  5EE2 A;  2JMM A;  5G39 A;  4E1S A;  4E1T A;  8PRN A;  2N2M A;  2R4P A;  3A2S X;  3AA1 A;  2POR A;  1BXW A;  2R4N A;  3DA4 A;  3DWN A;  3DWO X;  5G38 A;  2IWW A;  3SY7 A;  3LK3 A;  4LSF A;  1BT9 A;  4RL9 A;  4GHB A;  2XMX A;  5DL7 A;  5PRN A;  1Q9G A;  3PGR A;  4AYI D;  4O3W A;  4IL6 O;  4K3B A;  5ADX L;  2Y7S A;  4AYD C;  3VZT X;  3T20 A;  4FT6 A;  2FGQ X;  4C4V A;  2Y2X A;  3AA6 B;  3A0H O;  3HOE A;  2R4L A;  4UB8 O;  1MM4 A;  2R8A A;  4U9C A;  4GF4 A;  4FZL A;  3AAA A;  4FZM A;  3BS0 A;  5DL5 A;  3WU2 O;  3SZD A;  2PRN A;  4K3C A;  3TZG A;  4G76 A;  1GFO A;  3O0E A;  2KXP B;  1HXX A;  5KAI O;  5AFU L;  3LK4 1;  3KVD D;  4KR4 A;  5JDP A;  2R89 A;  1ZHZ A;  2J4U P;  1P4T A;  1QJP A;  2XG6 A;  1GFN A;  1ZHW A;  2WJQ A;  3C5O A;  4O49 A;  3VY8 X;  2N2L A;  2XE5 A;  5T5F A;  2KZ7 A;  3QRA A;  5DL8 A;  3VE1 A;  3VZU X;  1ZHX A;  3QRC A;  4FSP A;  4N75 A;  3UU2 A;  1G90 A;  2OMF A;  1IZN B;  4F4B A;  1ORM A;  4JCH A;  3DZM A;  5B5E O;  3SY9 A;  1MM5 A;  2J1N A;  4FMS A;  4LSE A;  1BH3 A;  1THQ A;  4KRA A;  3AAA B;  4O3Z A;  5B66 O;  2Y0L A;  4LSI A;  2K0L A;  2YPV A;  5GTH O;  2KC0 A;  2YNK A;  5TIS O;  4O4U A;  2F1T A;  1OPF A;  2XTQ A;  3AA0 B;  4JFB A;  4N74 A;  4GCQ A;  4QQ1 A;  4XNL A;  5D5D A;  5GTI O;  3VE2 A;  3LK2 A;  3VZW X;  4AKR B;  2KDY A;  2M07 A;  1QJ9 A;  2X27 X;  3AA7 B;  3K19 A;  2WJR A;  3WI4 A;  4PR7 A;  3VY9 X;  3AAE A;  4RJW A;  3LK4 2;  4AZL A;  1PRN A;  1E54 A;  3AA1 B;  4RLB A;  4FRT A;  4AYN A;  4C4V B;  4D5U A;  3BRY A;  4D65 A;  4PJ0 O;  2ZFG A;  3DA3 A;  2XE2 A;  5FVN A;  1GFM A;  3LK3 B;  4C00 A;  3GP6 A;  2QTK A;  1H6S 1;  1GFQ A;  1QJ8 A;  3EMN X;  3G7G A;  3WI5 A;  2FGR A;  4AKM A;  4B61 A;  4FSO A;  7PRN A;  3PRN A;  4D64 A;  2MNH A;  3T24 A;  4GCS A;  3T0S A;  5IYU A;  4LSH A;  2O4V A;  4N58 A;  4AYM C;  2W80 C;  1ZHT A;  2ZLD A;  3NSG A;  3FYX A;  2XE3 A;  4KR8 A;  4BUM X;  1ZHY A;  3AA6 A;  3AAE B;  2WVP A;  1YS5 A;  3V8U A;  3HWB A;  4N59 A;  3PGS A;  5GV0 A;  2LHF A;  3A0B O;  1HXU A;  2KZ7 B;  3SYS A;  2KXP A;  4UB6 O;  2XE1 A;  4FOZ A;  5ADX K;  4O4X A;  3POQ A;  3JCU O;  1OSM A;  3JTY A;  3PQS A;  3SYB A; 
#chains in the Genus database with same CATH homology
 2GE4 A;  4FRX A;  4FZN A;  5DL6 A;  4GCP A;  2Y0K A;  1GFP A;  3POX A;  1Q9F A;  5AFU K;  4AFK A;  3POU A;  1IZN A;  2W81 C;  2ODJ A;  4XNK A;  1MPF A;  3RBH A;  4Z3T A;  3LK2 B;  6PRN A;  2F1V A;  4AYE C;  4FES A;  3POR A;  4O3X B;  1HXT A;  4G75 A;  2ERV A;  3AA0 A;  4RJX A;  3UAQ A;  3HOL A;  2MHL A;  4AUI A;  4AKR A;  4C69 X;  3AA7 A;  3PQU A;  1PHO A;  4PUX A;  3UPG A;  3HW9 A;  4O3Y A;  3SZV A;  2XTR A;  2Y0H A;  2LFU A;  2K4T A;  4AYI D;  5G26 A;  2M06 A;  4RLC A;  4FUV A;  4E1T A;  5EE2 A;  2JMM A;  4E1S A;  8PRN A;  2N2M A;  3A2S X;  3AA1 A;  2POR A;  1BXW A;  3DA4 A;  3SY7 A;  3LK3 A;  4LSF A;  1BT9 A;  4RL9 A;  4GHB A;  2XMX A;  5DL7 A;  5PRN A;  1Q9G A;  5ADX L;  1G90 A;  4O3W A;  2Y7S A;  4AYD C;  3VZT X;  3T20 A;  4FT6 A;  2FGQ X;  2Y2X A;  3AA6 B;  3HOE A;  1MM4 A;  4U9C A;  4GF4 A;  4FZL A;  3AAA A;  4FZM A;  5DL5 A;  3SZD A;  2PRN A;  3TZG A;  4G76 A;  1GFO A;  3O0E A;  2KXP B;  1HXX A;  5AFU L;  3LK4 1;  3KVD D;  4KR4 A;  5JDP A;  2J4U P;  1ZHZ A;  1P4T A;  1QJP A;  2XG6 A;  1GFN A;  1ZHW A;  3C5O A;  4O49 A;  3VY8 X;  2N2L A;  2XE5 A;  5T5F A;  2KZ7 A;  3QRA A;  5DL8 A;  3VE1 A;  3VZU X;  1ZHX A;  3QRC A;  4FSP A;  3UU2 A;  2OMF A;  1IZN B;  4F4B A;  1ORM A;  4JCH A;  3SY9 A;  1MM5 A;  2J1N A;  4FMS A;  4LSE A;  1BH3 A;  1THQ A;  4KRA A;  3AAA B;  4O3Z A;  2Y0L A;  4LSI A;  2K0L A;  2YPV A;  2KC0 A;  2YNK A;  3SYS A;  4O4U A;  2F1T A;  1OPF A;  2XTQ A;  3AA0 B;  4JFB A;  4QQ1 A;  4GCQ A;  4XNL A;  5D5D A;  3VE2 A;  3LK2 A;  3VZW X;  4AKR B;  2KDY A;  2M07 A;  1QJ9 A;  2X27 X;  3AA7 B;  3K19 A;  3WI4 A;  3VY9 X;  3AAE A;  4RJW A;  3LK4 2;  4AZL A;  1PRN A;  1E54 A;  3AA1 B;  4RLB A;  4FRT A;  4AYN A;  4D5U A;  4D65 A;  2ZFG A;  3DA3 A;  2XE2 A;  5FVN A;  1GFM A;  3LK3 B;  3GP6 A;  2QTK A;  1H6S 1;  1GFQ A;  1QJ8 A;  3EMN X;  3G7G A;  3WI5 A;  2FGR A;  4AKM A;  4B61 A;  4FSO A;  7PRN A;  3PRN A;  4D64 A;  2MNH A;  3T24 A;  4GCS A;  3T0S A;  5IYU A;  4LSH A;  2O4V A;  4N58 A;  4AYM C;  2W80 C;  1ZHT A;  2ZLD A;  3NSG A;  3FYX A;  2XE3 A;  4KR8 A;  4BUM X;  1ZHY A;  3AA6 A;  3AAE B;  3V8U A;  1YS5 A;  3HWB A;  4N59 A;  5GV0 A;  2LHF A;  1HXU A;  2KZ7 B;  2KXP A;  2XE1 A;  4FOZ A;  5ADX K;  4O4X A;  3POQ A;  1OSM A;  3JTY A;  3PQS A;  3SYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...