4AYNA

Structure of the c-terminal barrel of neisseria meningitidis fhbp variant 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
GGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACTOR H-BINDING PROTEIN
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aynA00
4QQ1A 3VE1A 4Z3TA 4AYDC 4O3YA 4O3XB 4O3WA 3HOLA 2KDYA 2YPVA 3V8UA 5T5FA 2W80C 3KVDD 4AYMC 3VE2A 3UAQA 3HOEA 4U9CA 3PQUA 4AYID 4O4UA 4O49A 1YS5A 3PQSA 5EE2A 4O4XA 4AYEC 4AYNA 2LFUA 2W81C 2KC0A 2Y7SA 4O3ZA
chains in the Genus database with same CATH superfamily
4KRAA 3HW9A 4D5UA 2PORA 2XE1A 3WU2O 2ERVA 4AKMA 3LK2B 4E1SA 1ZHZA 4UB8O 1Q9GA 4C00A 2K0LA 1HXXA 5KAIO 5B5EO 1GFNA 4UB6O 5B66O 4LSEA 3LK3B 4RLCA 2R88A 3C5OA 4GHBA 3G7GA 3JCUO 3VE2A 4LSHA 3AAEA 5TISO 3UAQA 5H2FO 3T20A 1GFMA 3WI5A 3DWOX 4FOZA 3HOEA 4U9CA 5AFUK 2XE5A 3EMNX 2FGQX 2XMXA 8PRNA 4FUVA 3LK2A 2N2MA 1IZNB 2LHFA 3LK42 3O0EA 4G76A 5EE2A 1ZHWA 3LK41 3PF1A 4FRTA 1HXUA 2X9KA 3DA4A 4G75A 4GF4A 5DL8A 4AYNA 4GCPA 3LK3A 2KZ7A 1QJ8A 5DL5A 2Y0HA 3VZTX 3AAEB 1MM5A 2IWVA 2XG6A 3AAAA 3K19A 5DL7A 2QTKA 6PRNA 3POQA 4AZLA 4FRXA 2MNHA 1T16A 4RL9A 4AYDC 4K3BA 4PJ0O 4IL6O 4KR4A 2F1TA 4B61A 5DL6A 1IZNA 2AXTO 2JQYA 2OMFA 3WI4A 5IYUA 3HOLA 2KDYA 2R4OA 1ZHYA 2W80C 4LSFA 3UU2A 2KZ7B 3KVDD 2ZLDA 1E54A 3AA0A 3HWBA 4FZNA 4XNLA 4C4VA 2J4UP 3UPGA 4PR7A 3AAAB 3QRAA 3PQUA 4XNKA 5PRNA 4AYID 2JMMA 3AA6B 1GFPA 2M07A 5GTIO 4AUIA 1BT9A 5D5DA 1QJPA 3TZGA 2ZFGA 2F1VA 4KR8A 1HXTA 5KAFO 1PRNA 2J1NA 2YNKA 2KC0A 2FGRA 1THQA 3AA0B 4C4VB 3QRCA 4JFBA 3VZUX 4RLBA 4RJWA 3NSGA 1PHOA 5GV0A 4AFKA 1OPFA 3POXA 1ZHTA 3VZWX 5G3AA 3AA6A 1P4TA 3DWNA 3NJTA 1MM4A 3PGUA 3POUA 4FZMA 4O3WA 4JCHA 4LSIA 3A0HO 4GCQA 2MHLA 2YPVA 4FZLA 5FVNA 5G26A 5T5FA 3AA7A 3V8UA 2X27X 3DA3A 3SZDA 1Q9FA 2WJRA 4PUXA 2Y0KA 4N59A 1S5LO 1MPFA 2R89A 4D65A 2R4NA 4FT6A 3T24A 1ORMA 3BRYA 4GCSA 2XTRA 4O4UA 4O49A 2Y2XA 3PQSA 3SYSA 3RBHA 4AYEC 2XE3A 4FQEA 1QJ9A 4AKRA 2F1CX 1BXWA 3A2SX 2O4VA 2WJQA 3GP6A 4N75A 3AA1A 3AA7B 3BS0A 3T0SA 2GE4A 2W81C 4FESA 2Y7SA 4O3ZA 3SZVA 5G39A 5GTHO 2ODJA 2XE2A 4QQ1A 1T1LA 3VE1A 5AFUL 4C69X 4FSOA 3VY8X 1H6S1 3FYXA 4Z3TA 5G38A 2XTQA 2R4PA 4O3YA 4O3XB 1GFQA 3PRNA 4AKRB 4D64A 7PRNA 1G90A 3VY9X 5ADXL 3JTYA 4E1TA 1GFOA 4N58A 3AA1B 2KXPB 3PGSA 2K4TA 1BH3A 3PORA 4FMSA 4CTDA 4AYMC 3SYBA 4N74A 2R8AA 5E79O 2Y0LA 2WVPA 5JDPA 1ZHXA 1OSMA 1YS5A 3BRZA 2M06A 3SY9A 4F4BA 4RJXA 3KZIO 2R4LA 4O4XA 4BUMX 5ADXK 3A0BO 2N2LA 3SY7A 2LFUA 4FSPA 4K3CA 3DZMA 3PGRA 2IWWA 2PRNA 2KXPA
chains in the Genus database with same CATH topology
4KRAA 3HW9A 4D5UA 2PORA 2XE1A 2ERVA 4AKMA 3LK2B 4E1SA 1ZHZA 1Q9GA 2K0LA 1HXXA 1GFNA 4LSEA 3LK3B 4RLCA 3C5OA 4GHBA 3G7GA 3VE2A 4LSHA 3AAEA 3UAQA 3T20A 1GFMA 3WI5A 4FOZA 3HOEA 4U9CA 5AFUK 2XE5A 3EMNX 2FGQX 2XMXA 8PRNA 4FUVA 3LK2A 2N2MA 1IZNB 2LHFA 3LK42 3O0EA 4G76A 5EE2A 1ZHWA 3LK41 4FRTA 4G75A 1HXUA 3DA4A 4GF4A 4AYNA 5DL8A 4GCPA 3LK3A 2KZ7A 1QJ8A 5DL5A 2Y0HA 3VZTX 3AAEB 1MM5A 2XG6A 3AAAA 3K19A 5DL7A 2QTKA 6PRNA 3POQA 4AZLA 4FRXA 2MNHA 4RL9A 4AYDC 4KR4A 2F1TA 4B61A 5DL6A 1IZNA 2OMFA 3WI4A 5IYUA 3HOLA 2KDYA 1ZHYA 2W80C 4LSFA 3UU2A 2KZ7B 3KVDD 2ZLDA 1E54A 3AA0A 3HWBA 4FZNA 4XNLA 2J4UP 3UPGA 3AAAB 3QRAA 3PQUA 4XNKA 5PRNA 4AYID 2JMMA 3AA6B 1GFPA 2M07A 4AUIA 1BT9A 5D5DA 1QJPA 3TZGA 2ZFGA 2F1VA 4KR8A 1HXTA 1PRNA 2J1NA 2YNKA 2KC0A 2FGRA 1THQA 3AA0B 3QRCA 4JFBA 3VZUX 4RLBA 4RJWA 3NSGA 1PHOA 5GV0A 4AFKA 1OPFA 3POXA 1ZHTA 3VZWX 3AA6A 1P4TA 3POUA 1MM4A 4FZMA 5FVNA 4O3WA 4JCHA 4LSIA 5G26A 4GCQA 2MHLA 2YPVA 4FZLA 5T5FA 3V8UA 3AA7A 2X27X 3DA3A 3SZDA 1Q9FA 4PUXA 2Y0KA 4N59A 1MPFA 4D65A 3T24A 4FT6A 1ORMA 4GCSA 2XTRA 4O4UA 4O49A 2Y2XA 3PQSA 3SYSA 3RBHA 4AYEC 2XE3A 4AKRA 1QJ9A 1BXWA 3A2SX 2O4VA 3GP6A 3T0SA 3AA1A 3AA7B 2GE4A 2W81C 4FESA 2Y7SA 4O3ZA 3SZVA 2ODJA 2XE2A 4QQ1A 3VE1A 5AFUL 4C69X 4FSOA 3VY8X 1H6S1 3FYXA 4Z3TA 2XTQA 4O3YA 4O3XB 1GFQA 3PRNA 4AKRB 4D64A 7PRNA 1G90A 3VY9X 5ADXL 3JTYA 4E1TA 1GFOA 4N58A 3AA1B 2KXPB 3PORA 2K4TA 1BH3A 4FMSA 4AYMC 3SYBA 2Y0LA 5JDPA 1ZHXA 1OSMA 1YS5A 3SY9A 2M06A 4F4BA 4RJXA 4O4XA 4BUMX 5ADXK 2N2LA 3SY7A 2LFUA 4FSPA 2PRNA 2KXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQ1 A;  3VE1 A;  4Z3T A;  4AYD C;  4O3Y A;  4O3X B;  4O3W A;  3HOL A;  2KDY A;  2YPV A;  3V8U A;  5T5F A;  2W80 C;  3KVD D;  4AYM C;  3VE2 A;  3UAQ A;  3HOE A;  4U9C A;  3PQU A;  4AYI D;  4O4U A;  4O49 A;  1YS5 A;  3PQS A;  5EE2 A;  4O4X A;  4AYE C;  4AYN A;  2LFU A;  2W81 C;  2KC0 A;  2Y7S A;  4O3Z A; 
#chains in the Genus database with same CATH topology
 4KRA A;  3HW9 A;  4D5U A;  2POR A;  2XE1 A;  3WU2 O;  2ERV A;  4AKM A;  3LK2 B;  4E1S A;  1ZHZ A;  4UB8 O;  1Q9G A;  4C00 A;  2K0L A;  1HXX A;  5KAI O;  5B5E O;  1GFN A;  4UB6 O;  5B66 O;  4LSE A;  3LK3 B;  4RLC A;  2R88 A;  3C5O A;  4GHB A;  3G7G A;  3JCU O;  3VE2 A;  4LSH A;  3AAE A;  5TIS O;  3UAQ A;  5H2F O;  3T20 A;  1GFM A;  3WI5 A;  3DWO X;  4FOZ A;  3HOE A;  4U9C A;  5AFU K;  2XE5 A;  3EMN X;  2FGQ X;  2XMX A;  8PRN A;  4FUV A;  3LK2 A;  2N2M A;  1IZN B;  2LHF A;  3LK4 2;  3O0E A;  4G76 A;  5EE2 A;  1ZHW A;  3LK4 1;  3PF1 A;  4FRT A;  1HXU A;  2X9K A;  3DA4 A;  4G75 A;  4GF4 A;  5DL8 A;  4AYN A;  4GCP A;  3LK3 A;  2KZ7 A;  1QJ8 A;  5DL5 A;  2Y0H A;  3VZT X;  3AAE B;  1MM5 A;  2IWV A;  2XG6 A;  3AAA A;  3K19 A;  5DL7 A;  2QTK A;  6PRN A;  3POQ A;  4AZL A;  4FRX A;  2MNH A;  1T16 A;  4RL9 A;  4AYD C;  4K3B A;  4PJ0 O;  4IL6 O;  4KR4 A;  2F1T A;  4B61 A;  5DL6 A;  1IZN A;  2AXT O;  2JQY A;  2OMF A;  3WI4 A;  5IYU A;  3HOL A;  2KDY A;  2R4O A;  1ZHY A;  2W80 C;  4LSF A;  3UU2 A;  2KZ7 B;  3KVD D;  2ZLD A;  1E54 A;  3AA0 A;  3HWB A;  4FZN A;  4XNL A;  4C4V A;  2J4U P;  3UPG A;  4PR7 A;  3AAA B;  3QRA A;  3PQU A;  4XNK A;  5PRN A;  4AYI D;  2JMM A;  3AA6 B;  1GFP A;  2M07 A;  5GTI O;  4AUI A;  1BT9 A;  5D5D A;  1QJP A;  3TZG A;  2ZFG A;  2F1V A;  4KR8 A;  1HXT A;  5KAF O;  1PRN A;  2J1N A;  2YNK A;  2KC0 A;  2FGR A;  1THQ A;  3AA0 B;  4C4V B;  3QRC A;  4JFB A;  3VZU X;  4RLB A;  4RJW A;  3NSG A;  1PHO A;  5GV0 A;  4AFK A;  1OPF A;  3POX A;  1ZHT A;  3VZW X;  5G3A A;  3AA6 A;  1P4T A;  3DWN A;  3NJT A;  1MM4 A;  3PGU A;  3POU A;  4FZM A;  4O3W A;  4JCH A;  4LSI A;  3A0H O;  4GCQ A;  2MHL A;  2YPV A;  4FZL A;  5FVN A;  5G26 A;  5T5F A;  3AA7 A;  3V8U A;  2X27 X;  3DA3 A;  3SZD A;  1Q9F A;  2WJR A;  4PUX A;  2Y0K A;  4N59 A;  1S5L O;  1MPF A;  2R89 A;  4D65 A;  2R4N A;  4FT6 A;  3T24 A;  1ORM A;  3BRY A;  4GCS A;  2XTR A;  4O4U A;  4O49 A;  2Y2X A;  3PQS A;  3SYS A;  3RBH A;  4AYE C;  2XE3 A;  4FQE A;  1QJ9 A;  4AKR A;  2F1C X;  1BXW A;  3A2S X;  2O4V A;  2WJQ A;  3GP6 A;  4N75 A;  3AA1 A;  3AA7 B;  3BS0 A;  3T0S A;  2GE4 A;  2W81 C;  4FES A;  2Y7S A;  4O3Z A;  3SZV A;  5G39 A;  5GTH O;  2ODJ A;  2XE2 A;  4QQ1 A;  1T1L A;  3VE1 A;  5AFU L;  4C69 X;  4FSO A;  3VY8 X;  1H6S 1;  3FYX A;  4Z3T A;  5G38 A;  2XTQ A;  2R4P A;  4O3Y A;  4O3X B;  1GFQ A;  3PRN A;  4AKR B;  4D64 A;  7PRN A;  1G90 A;  3VY9 X;  5ADX L;  3JTY A;  4E1T A;  1GFO A;  4N58 A;  3AA1 B;  2KXP B;  3PGS A;  2K4T A;  1BH3 A;  3POR A;  4FMS A;  4CTD A;  4AYM C;  3SYB A;  4N74 A;  2R8A A;  5E79 O;  2Y0L A;  2WVP A;  5JDP A;  1ZHX A;  1OSM A;  1YS5 A;  3BRZ A;  2M06 A;  3SY9 A;  4F4B A;  4RJX A;  3KZI O;  2R4L A;  4O4X A;  4BUM X;  5ADX K;  3A0B O;  2N2L A;  3SY7 A;  2LFU A;  4FSP A;  4K3C A;  3DZM A;  3PGR A;  2IWW A;  2PRN A;  2KXP A; 
#chains in the Genus database with same CATH homology
 4KRA A;  3HW9 A;  4D5U A;  2POR A;  2XE1 A;  2ERV A;  4AKM A;  3LK2 B;  4E1S A;  1ZHZ A;  1Q9G A;  2K0L A;  1HXX A;  1GFN A;  4LSE A;  3LK3 B;  4RLC A;  3C5O A;  4GHB A;  3G7G A;  3VE2 A;  4LSH A;  3AAE A;  3UAQ A;  3T20 A;  1GFM A;  3WI5 A;  4FOZ A;  3HOE A;  4U9C A;  5AFU K;  2XE5 A;  3EMN X;  2FGQ X;  2XMX A;  8PRN A;  4FUV A;  3LK2 A;  2N2M A;  1IZN B;  2LHF A;  3LK4 2;  3O0E A;  4G76 A;  5EE2 A;  1ZHW A;  3LK4 1;  4FRT A;  4G75 A;  1HXU A;  3DA4 A;  4GF4 A;  4AYN A;  5DL8 A;  4GCP A;  3LK3 A;  2KZ7 A;  1QJ8 A;  5DL5 A;  2Y0H A;  3VZT X;  3AAE B;  1MM5 A;  2XG6 A;  3AAA A;  3K19 A;  5DL7 A;  2QTK A;  6PRN A;  3POQ A;  4AZL A;  4FRX A;  2MNH A;  4RL9 A;  4AYD C;  4KR4 A;  2F1T A;  4B61 A;  5DL6 A;  1IZN A;  2OMF A;  3WI4 A;  5IYU A;  3HOL A;  2KDY A;  1ZHY A;  2W80 C;  4LSF A;  3UU2 A;  2KZ7 B;  3KVD D;  2ZLD A;  1E54 A;  3AA0 A;  3HWB A;  4FZN A;  4XNL A;  2J4U P;  3UPG A;  3AAA B;  3QRA A;  3PQU A;  4XNK A;  5PRN A;  4AYI D;  2JMM A;  3AA6 B;  1GFP A;  2M07 A;  4AUI A;  1BT9 A;  5D5D A;  1QJP A;  3TZG A;  2ZFG A;  2F1V A;  4KR8 A;  1HXT A;  1PRN A;  2J1N A;  2YNK A;  2KC0 A;  2FGR A;  1THQ A;  3AA0 B;  3QRC A;  4JFB A;  3VZU X;  4RLB A;  4RJW A;  3NSG A;  1PHO A;  5GV0 A;  4AFK A;  1OPF A;  3POX A;  1ZHT A;  3VZW X;  3AA6 A;  1P4T A;  3POU A;  1MM4 A;  4FZM A;  5FVN A;  4O3W A;  4JCH A;  4LSI A;  5G26 A;  4GCQ A;  2MHL A;  2YPV A;  4FZL A;  5T5F A;  3V8U A;  3AA7 A;  2X27 X;  3DA3 A;  3SZD A;  1Q9F A;  4PUX A;  2Y0K A;  4N59 A;  1MPF A;  4D65 A;  3T24 A;  4FT6 A;  1ORM A;  4GCS A;  2XTR A;  4O4U A;  4O49 A;  2Y2X A;  3PQS A;  3SYS A;  3RBH A;  4AYE C;  2XE3 A;  4AKR A;  1QJ9 A;  1BXW A;  3A2S X;  2O4V A;  3GP6 A;  3T0S A;  3AA1 A;  3AA7 B;  2GE4 A;  2W81 C;  4FES A;  2Y7S A;  4O3Z A;  3SZV A;  2ODJ A;  2XE2 A;  4QQ1 A;  3VE1 A;  5AFU L;  4C69 X;  4FSO A;  3VY8 X;  1H6S 1;  3FYX A;  4Z3T A;  2XTQ A;  4O3Y A;  4O3X B;  1GFQ A;  3PRN A;  4AKR B;  4D64 A;  7PRN A;  1G90 A;  3VY9 X;  5ADX L;  3JTY A;  4E1T A;  1GFO A;  4N58 A;  3AA1 B;  2KXP B;  3POR A;  2K4T A;  1BH3 A;  4FMS A;  4AYM C;  3SYB A;  2Y0L A;  5JDP A;  1ZHX A;  1OSM A;  1YS5 A;  3SY9 A;  2M06 A;  4F4B A;  4RJX A;  4O4X A;  4BUM X;  5ADX K;  2N2L A;  3SY7 A;  2LFU A;  4FSP A;  2PRN A;  2KXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...