4AYNA

Structure of the c-terminal barrel of neisseria meningitidis fhbp variant 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
GGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords FACTOR H-BINDING PROTEIN
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aynA00
1YS5A 3VE2A 4AYID 3HOLA 3PQUA 3V8UA 4O3WA 2KC0A 3UAQA 5T5FA 2LFUA 4O3XB 2YPVA 4U9CA 4O49A 4O4XA 4AYEC 4O4UA 3HOEA 3PQSA 4AYDC 2W80C 4QQ1A 3KVDD 2KDYA 2Y7SA 4O3YA 4AYMC 5EE2A 4AYNA 4O3ZA 2W81C 4Z3TA 3VE1A
chains in the Genus database with same CATH superfamily
3VE2A 4AYID 2XTQA 4FQEA 2KC0A 3QRCA 3UAQA 4E1TA 3AA6B 1MPFA 5KAIO 3G7GA 2IWVA 4U9CA 4O49A 1OSMA 2J4UP 4FZMA 3EMNX 2Y0HA 3AA1B 3LK3B 1IZNA 3VZTX 3VZUX 1QJ9A 4D64A 5PRNA 3SYSA 3KVDD 4RLBA 3NSGA 3LK2A 3DA3A 4FSPA 5E79O 2OMFA 3DWNA 3PRNA 4E1SA 3SY7A 1OPFA 3A0BO 2QTKA 1ZHXA 1HXUA 2MHLA 1QJ8A 2R88A 2XE3A 3PF1A 4G76A 5EE2A 4AYNA 2GE4A 2FGRA 5IYUA 4CTDA 2K4TA 4AKRB 1GFMA 5ADXL 4FUVA 4N59A 1MM4A 3JCUO 2XMXA 3BS0A 3T20A 5G3AA 4RJWA 4N74A 3POXA 4O3WA 2WJQA 3AAEA 5DL7A 4AZLA 2JMMA 1ZHTA 3C5OA 4O3XB 5G26A 5T5FA 3T0SA 2X27X 4LSEA 2O4VA 4FZNA 5JDPA 1S5LO 2YPVA 3BRZA 3AA7B 4C4VA 3AAAB 2R89A 3AA1A 1BT9A 3POUA 3AA0B 2KZ7A 3HOEA 3NJTA 4PUXA 4AYDC 4N75A 3DZMA 2W80C 2XE2A 1H6S1 2PORA 5GTIO 5KAFO 4UB6O 3JTYA 1PRNA 2J1NA 2LHFA 2MNHA 3VY8X 2FGQX 3GP6A 4XNLA 1THQA 2JQYA 2ZFGA 2KXPA 1HXTA 4GF4A 1QJPA 2N2LA 3RBHA 3TZGA 4AYMC 2IWWA 4FRTA 2R4OA 1GFQA 7PRNA 3SY9A 3LK42 4Z3TA 5DL6A 4BUMX 2X9KA 3POQA 4K3CA 4RJXA 3WI4A 1YS5A 4C00A 3HOLA 3PQUA 3V8UA 4RLCA 3PGUA 2F1TA 4GCQA 4RL9A 3AA6A 3T24A 2R4LA 4C69X 5AFUK 4KRAA 4B61A 3WU2O 2F1CX 4O4XA 2F1VA 4FMSA 4FSOA 4D65A 5GV0A 2R4NA 3PORA 3UU2A 3LK3A 1IZNB 2XG6A 3PQSA 4UB8O 5DL5A 4AFKA 4F4BA 5GTHO 1Q9GA 1T16A 5TISO 3QRAA 1BXWA 2YNKA 4KR4A 3LK2B 1ZHYA 4JFBA 1ORMA 5D5DA 2Y7SA 4O3YA 2Y2XA 3PGSA 5G39A 3BRYA 1BH3A 2ERVA 3PGRA 4IL6O 4KR8A 4XNKA 2W81C 4AKRA 1GFNA 4GHBA 2M06A 2M07A 3WI5A 2PRNA 5B66O 4LSFA 4LSIA 4LSHA 5DL8A 5G38A 2K0LA 2R4PA 4D5UA 3VE1A 3VY9X 1HXXA 6PRNA 1ZHZA 4JCHA 3DWOX 1G90A 3O0EA 5H2FO 4GCSA 3AAEB 3SZVA 3A0HO 2LFUA 4FT6A 3SZDA 2ZLDA 1E54A 5B5EO 1P4TA 1T1LA 3DA4A 3AA7A 2XE1A 3FYXA 1PHOA 3AAAA 3LK41 3KZIO 4FESA 4AYEC 3AA0A 4O4UA 3SYBA 4AUIA 1MM5A 2KZ7B 3A2SX 3HW9A 2Y0KA 3VZWX 4C4VB 5ADXK 4QQ1A 2XE5A 4FOZA 5FVNA 4FRXA 4G75A 4AKMA 2KDYA 5AFUL 2N2MA 2WVPA 3K19A 2KXPB 1ZHWA 2Y0LA 4PR7A 4O3ZA 2ODJA 4N58A 4GCPA 3UPGA 1GFPA 2AXTO 2WJRA 4FZLA 1Q9FA 3HWBA 4K3BA 8PRNA 2XTRA 1GFOA 4PJ0O 2R8AA
chains in the Genus database with same CATH topology
3VE2A 4AYID 2XTQA 2KC0A 3QRCA 3UAQA 4E1TA 3AA6B 1MPFA 3G7GA 4U9CA 4O49A 1OSMA 2J4UP 4FZMA 3EMNX 2Y0HA 3AA1B 3LK3B 1IZNA 3VZTX 3VZUX 1QJ9A 4D64A 5PRNA 3SYSA 3KVDD 4RLBA 3NSGA 3LK2A 3DA3A 4FSPA 4E1SA 2OMFA 3PRNA 3SY7A 1OPFA 2QTKA 1ZHXA 1HXUA 2MHLA 1QJ8A 2XE3A 4G76A 5EE2A 4AYNA 2GE4A 2FGRA 5IYUA 2K4TA 4AKRB 1GFMA 5ADXL 4FUVA 4N59A 1MM4A 2XMXA 3T20A 4RJWA 3POXA 4O3WA 5DL7A 3AAEA 4AZLA 2JMMA 1ZHTA 3C5OA 4O3XB 5G26A 5T5FA 3T0SA 2X27X 4LSEA 2O4VA 4FZNA 5JDPA 2YPVA 3AA7B 3AAAB 3AA1A 1BT9A 3POUA 3AA0B 2KZ7A 3HOEA 4PUXA 4AYDC 2W80C 2XE2A 1H6S1 2PORA 3JTYA 1PRNA 2J1NA 2MNHA 2LHFA 3VY8X 2FGQX 3GP6A 4XNLA 1THQA 2ZFGA 4GF4A 2KXPA 1HXTA 3TZGA 1QJPA 2N2LA 3RBHA 4AYMC 4FRTA 1GFQA 7PRNA 3SY9A 3LK42 4Z3TA 5DL6A 4BUMX 3POQA 3WI4A 4RJXA 1YS5A 3HOLA 3PQUA 3V8UA 4RLCA 2F1TA 4GCQA 3AA6A 3T24A 4C69X 5AFUK 4KRAA 4B61A 4O4XA 2F1VA 4FMSA 4FSOA 4D65A 3PORA 3UU2A 3LK3A 1IZNB 2XG6A 3PQSA 5DL5A 4AFKA 4F4BA 1Q9GA 3QRAA 1BXWA 2YNKA 4KR4A 3LK2B 1ZHYA 4JFBA 1ORMA 5D5DA 2Y7SA 4O3YA 2Y2XA 1BH3A 2ERVA 4KR8A 4XNKA 2W81C 4AKRA 1GFNA 4GHBA 2M06A 2M07A 3WI5A 2PRNA 4LSFA 4LSIA 4LSHA 5DL8A 4D5UA 2K0LA 3VE1A 3VY9X 1HXXA 6PRNA 1ZHZA 4JCHA 1G90A 3O0EA 4GCSA 3AAEB 3SZVA 2LFUA 4FT6A 3SZDA 2ZLDA 1E54A 1P4TA 3DA4A 3AA7A 2XE1A 3FYXA 1PHOA 3AAAA 3LK41 4FESA 4AYEC 3AA0A 4O4UA 3SYBA 4AUIA 1MM5A 2KZ7B 3A2SX 3HW9A 2Y0KA 3VZWX 5ADXK 4QQ1A 2XE5A 4FOZA 5FVNA 4FRXA 4G75A 4AKMA 2KDYA 5AFUL 2N2MA 3K19A 2KXPB 1ZHWA 2Y0LA 4O3ZA 2ODJA 4N58A 4GCPA 3UPGA 1GFPA 4FZLA 1Q9FA 3HWBA 8PRNA 2XTRA 1GFOA 4RL9A 5GV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YS5 A;  3VE2 A;  4AYI D;  3HOL A;  3PQU A;  3V8U A;  4O3W A;  2KC0 A;  3UAQ A;  5T5F A;  2LFU A;  4O3X B;  2YPV A;  4U9C A;  4O49 A;  4O4X A;  4AYE C;  4O4U A;  3HOE A;  3PQS A;  4AYD C;  2W80 C;  4QQ1 A;  3KVD D;  2KDY A;  2Y7S A;  4O3Y A;  4AYM C;  5EE2 A;  4AYN A;  4O3Z A;  2W81 C;  4Z3T A;  3VE1 A; 
#chains in the Genus database with same CATH topology
 3VE2 A;  4AYI D;  2XTQ A;  4FQE A;  2KC0 A;  3QRC A;  3UAQ A;  4E1T A;  3AA6 B;  1MPF A;  5KAI O;  3G7G A;  2IWV A;  4U9C A;  4O49 A;  1OSM A;  2J4U P;  4FZM A;  3EMN X;  2Y0H A;  3AA1 B;  3LK3 B;  1IZN A;  3VZT X;  3VZU X;  1QJ9 A;  4D64 A;  5PRN A;  3SYS A;  3KVD D;  4RLB A;  3NSG A;  3LK2 A;  3DA3 A;  4FSP A;  5E79 O;  2OMF A;  3DWN A;  3PRN A;  4E1S A;  3SY7 A;  1OPF A;  3A0B O;  2QTK A;  1ZHX A;  1HXU A;  2MHL A;  1QJ8 A;  2R88 A;  2XE3 A;  3PF1 A;  4G76 A;  5EE2 A;  4AYN A;  2GE4 A;  2FGR A;  5IYU A;  4CTD A;  2K4T A;  4AKR B;  1GFM A;  5ADX L;  4FUV A;  4N59 A;  1MM4 A;  3JCU O;  2XMX A;  3BS0 A;  3T20 A;  5G3A A;  4RJW A;  4N74 A;  3POX A;  4O3W A;  2WJQ A;  3AAE A;  5DL7 A;  4AZL A;  2JMM A;  1ZHT A;  3C5O A;  4O3X B;  5G26 A;  5T5F A;  3T0S A;  2X27 X;  4LSE A;  2O4V A;  4FZN A;  5JDP A;  1S5L O;  2YPV A;  3BRZ A;  3AA7 B;  4C4V A;  3AAA B;  2R89 A;  3AA1 A;  1BT9 A;  3POU A;  3AA0 B;  2KZ7 A;  3HOE A;  3NJT A;  4PUX A;  4AYD C;  4N75 A;  3DZM A;  2W80 C;  2XE2 A;  1H6S 1;  2POR A;  5GTI O;  5KAF O;  4UB6 O;  3JTY A;  1PRN A;  2J1N A;  2LHF A;  2MNH A;  3VY8 X;  2FGQ X;  3GP6 A;  4XNL A;  1THQ A;  2JQY A;  2ZFG A;  2KXP A;  1HXT A;  4GF4 A;  1QJP A;  2N2L A;  3RBH A;  3TZG A;  4AYM C;  2IWW A;  4FRT A;  2R4O A;  1GFQ A;  7PRN A;  3SY9 A;  3LK4 2;  4Z3T A;  5DL6 A;  4BUM X;  2X9K A;  3POQ A;  4K3C A;  4RJX A;  3WI4 A;  1YS5 A;  4C00 A;  3HOL A;  3PQU A;  3V8U A;  4RLC A;  3PGU A;  2F1T A;  4GCQ A;  4RL9 A;  3AA6 A;  3T24 A;  2R4L A;  4C69 X;  5AFU K;  4KRA A;  4B61 A;  3WU2 O;  2F1C X;  4O4X A;  2F1V A;  4FMS A;  4FSO A;  4D65 A;  5GV0 A;  2R4N A;  3POR A;  3UU2 A;  3LK3 A;  1IZN B;  2XG6 A;  3PQS A;  4UB8 O;  5DL5 A;  4AFK A;  4F4B A;  5GTH O;  1Q9G A;  1T16 A;  5TIS O;  3QRA A;  1BXW A;  2YNK A;  4KR4 A;  3LK2 B;  1ZHY A;  4JFB A;  1ORM A;  5D5D A;  2Y7S A;  4O3Y A;  2Y2X A;  3PGS A;  5G39 A;  3BRY A;  1BH3 A;  2ERV A;  3PGR A;  4IL6 O;  4KR8 A;  4XNK A;  2W81 C;  4AKR A;  1GFN A;  4GHB A;  2M06 A;  2M07 A;  3WI5 A;  2PRN A;  5B66 O;  4LSF A;  4LSI A;  4LSH A;  5DL8 A;  5G38 A;  2K0L A;  2R4P A;  4D5U A;  3VE1 A;  3VY9 X;  1HXX A;  6PRN A;  1ZHZ A;  4JCH A;  3DWO X;  1G90 A;  3O0E A;  5H2F O;  4GCS A;  3AAE B;  3SZV A;  3A0H O;  2LFU A;  4FT6 A;  3SZD A;  2ZLD A;  1E54 A;  5B5E O;  1P4T A;  1T1L A;  3DA4 A;  3AA7 A;  2XE1 A;  3FYX A;  1PHO A;  3AAA A;  3LK4 1;  3KZI O;  4FES A;  4AYE C;  3AA0 A;  4O4U A;  3SYB A;  4AUI A;  1MM5 A;  2KZ7 B;  3A2S X;  3HW9 A;  2Y0K A;  3VZW X;  4C4V B;  5ADX K;  4QQ1 A;  2XE5 A;  4FOZ A;  5FVN A;  4FRX A;  4G75 A;  4AKM A;  2KDY A;  5AFU L;  2N2M A;  2WVP A;  3K19 A;  2KXP B;  1ZHW A;  2Y0L A;  4PR7 A;  4O3Z A;  2ODJ A;  4N58 A;  4GCP A;  3UPG A;  1GFP A;  2AXT O;  2WJR A;  4FZL A;  1Q9F A;  3HWB A;  4K3B A;  8PRN A;  2XTR A;  1GFO A;  4PJ0 O;  2R8A A; 
#chains in the Genus database with same CATH homology
 3VE2 A;  4AYI D;  2XTQ A;  2KC0 A;  3QRC A;  3UAQ A;  4E1T A;  3AA6 B;  1MPF A;  3G7G A;  4U9C A;  4O49 A;  1OSM A;  2J4U P;  4FZM A;  3EMN X;  2Y0H A;  3AA1 B;  3LK3 B;  1IZN A;  3VZT X;  3VZU X;  1QJ9 A;  4D64 A;  5PRN A;  3SYS A;  3KVD D;  4RLB A;  3NSG A;  3LK2 A;  3DA3 A;  4FSP A;  4E1S A;  2OMF A;  3PRN A;  3SY7 A;  1OPF A;  2QTK A;  1ZHX A;  1HXU A;  2MHL A;  1QJ8 A;  2XE3 A;  4G76 A;  5EE2 A;  4AYN A;  2GE4 A;  2FGR A;  5IYU A;  2K4T A;  4AKR B;  1GFM A;  5ADX L;  4FUV A;  4N59 A;  1MM4 A;  2XMX A;  3T20 A;  4RJW A;  3POX A;  4O3W A;  5DL7 A;  3AAE A;  4AZL A;  2JMM A;  1ZHT A;  3C5O A;  4O3X B;  5G26 A;  5T5F A;  3T0S A;  2X27 X;  4LSE A;  2O4V A;  4FZN A;  5JDP A;  2YPV A;  3AA7 B;  3AAA B;  3AA1 A;  1BT9 A;  3POU A;  3AA0 B;  2KZ7 A;  3HOE A;  4PUX A;  4AYD C;  2W80 C;  2XE2 A;  1H6S 1;  2POR A;  3JTY A;  1PRN A;  2J1N A;  2MNH A;  2LHF A;  3VY8 X;  2FGQ X;  3GP6 A;  4XNL A;  1THQ A;  2ZFG A;  4GF4 A;  2KXP A;  1HXT A;  3TZG A;  1QJP A;  2N2L A;  3RBH A;  4AYM C;  4FRT A;  1GFQ A;  7PRN A;  3SY9 A;  3LK4 2;  4Z3T A;  5DL6 A;  4BUM X;  3POQ A;  3WI4 A;  4RJX A;  1YS5 A;  3HOL A;  3PQU A;  3V8U A;  4RLC A;  2F1T A;  4GCQ A;  3AA6 A;  3T24 A;  4C69 X;  5AFU K;  4KRA A;  4B61 A;  4O4X A;  2F1V A;  4FMS A;  4FSO A;  4D65 A;  3POR A;  3UU2 A;  3LK3 A;  1IZN B;  2XG6 A;  3PQS A;  5DL5 A;  4AFK A;  4F4B A;  1Q9G A;  3QRA A;  1BXW A;  2YNK A;  4KR4 A;  3LK2 B;  1ZHY A;  4JFB A;  1ORM A;  5D5D A;  2Y7S A;  4O3Y A;  2Y2X A;  1BH3 A;  2ERV A;  4KR8 A;  4XNK A;  2W81 C;  4AKR A;  1GFN A;  4GHB A;  2M06 A;  2M07 A;  3WI5 A;  2PRN A;  4LSF A;  4LSI A;  4LSH A;  5DL8 A;  4D5U A;  2K0L A;  3VE1 A;  3VY9 X;  1HXX A;  6PRN A;  1ZHZ A;  4JCH A;  1G90 A;  3O0E A;  4GCS A;  3AAE B;  3SZV A;  2LFU A;  4FT6 A;  3SZD A;  2ZLD A;  1E54 A;  1P4T A;  3DA4 A;  3AA7 A;  2XE1 A;  3FYX A;  1PHO A;  3AAA A;  3LK4 1;  4FES A;  4AYE C;  3AA0 A;  4O4U A;  3SYB A;  4AUI A;  1MM5 A;  2KZ7 B;  3A2S X;  3HW9 A;  2Y0K A;  3VZW X;  5ADX K;  4QQ1 A;  2XE5 A;  4FOZ A;  5FVN A;  4FRX A;  4G75 A;  4AKM A;  2KDY A;  5AFU L;  2N2M A;  3K19 A;  2KXP B;  1ZHW A;  2Y0L A;  4O3Z A;  2ODJ A;  4N58 A;  4GCP A;  3UPG A;  1GFP A;  4FZL A;  1Q9F A;  3HWB A;  8PRN A;  2XTR A;  1GFO A;  4RL9 A;  5GV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...