4AYNA

Structure of the c-terminal barrel of neisseria meningitidis fhbp variant 2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'GGEHTAFNQLPSGKAEYHGKAFSSDDPNGRLHYSIDFTKKQGYGRIEHLKTPEQNVELASAELKADEKSHAVILGDTRYGSEEKGTYHLALFGDRAQEIAGSATVKIREKVHEIGIAGKQLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACTOR H-BINDING PROTEIN
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Neisseria meningitidis mc58
molecule tags Immune system
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08794 Lipoprot_C Lipoprotein GNA1870 C terminal like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.90 Mainly Beta Beta Barrel Porin Porin 4aynA00
4O3ZA 3HOLA 5EE2A 4U9CA 4AYDC 3UAQA 4AYID 4O4XA 4QQ1A 2KDYA 2KC0A 3V8UA 4Z3TA 3VE2A 4AYEC 2Y7SA 4O3YA 4O3XB 2YPVA 2W80C 4O4UA 3VE1A 2W81C 5T5FA 4O49A 2LFUA 4O3WA 4AYNA 3HOEA 3PQSA 1YS5A 4AYMC 3PQUA 3KVDD
chains in the Genus database with same CATH superfamily
4G76A 4IL6O 2ZFGA 3VY9X 8PRNA 2KXPA 1T16A 2PORA 2XTQA 4JFBA 3AAAA 3HW9A 3SZDA 3PGUA 1MPFA 5D5DA 4CTDA 1T1LA 2AXTO 4FRTA 4D64A 1S5LO 5TISO 2R88A 2IWVA 2K4TA 3VZUX 2F1VA 2XE2A 2M07A 2KXPB 1G90A 5E79O 3T24A 3WI5A 3LK41 2YPVA 3EMNX 2FGQX 3LK2A 3NSGA 3SY9A 4JCHA 4C69X 4PR7A 4E1SA 1Q9FA 1ZHTA 3SYBA 2N2LA 2Y2XA 4RL9A 3UU2A 3AAEA 1HXUA 3VZTX 5FVNA 2K0LA 3HOEA 3PQSA 5DL6A 4RLBA 4AYMC 1PHOA 1HXXA 3NJTA 3POXA 4GF4A 5G38A 2R4OA 2R4NA 4LSIA 5GV0A 3PGSA 2X9KA 2ZLDA 2FGRA 4FSOA 1MM5A 4FUVA 4GCPA 2KZ7A 1QJ8A 2R8AA 5G26A 1OPFA 2O4VA 3POQA 1GFOA 4FSPA 4C4VA 5GTHO 3AA7B 3HWBA 4AYID 1ZHWA 2Y0HA 2GE4A 1QJ9A 3O0EA 3K19A 4FESA 4AKMA 3V8UA 4B61A 4Z3TA 2IWWA 1IZNA 2F1CX 3G7GA 3JTYA 4FQEA 3BRZA 5G39A 1ORMA 4LSEA 2Y0LA 2WJQA 2W80C 3AAAB 3DA4A 2W81C 2OMFA 4XNKA 3A0BO 1BXWA 2XMXA 3SYSA 3UPGA 2XTRA 3POUA 4FZNA 3SZVA 3A2SX 3PORA 4FMSA 4GCQA 3AA1A 3DWNA 4GCSA 4N59A 4N74A 5DL5A 5G3AA 4AKRA 4N75A 4RJXA 3LK3A 3KVDD 2XE5A 5AFUK 3RBHA 3T20A 4E1TA 4KR8A 4UB8O 1PRNA 3FYXA 3LK2B 5GTIO 1GFNA 1QJPA 7PRNA 5EE2A 1ZHZA 3PGRA 2QTKA 3AA0A 3DWOX 3GP6A 3JCUO 3AAEB 3WI4A 2MHLA 4AYDC 4KR4A 4F4BA 4O4XA 4GHBA 3LK3B 4QQ1A 1GFQA 3KZIO 2KDYA 2J4UP 2KC0A 2R4PA 3SY7A 2XE3A 1OSMA 5AFUL 4AYEC 1ZHXA 1BT9A 2LHFA 4PUXA 4D65A 4O3YA 4O3XB 3VY8X 3VZWX 5IYUA 3A0HO 2ERVA 2KZ7B 2WJRA 3PF1A 4O4UA 5T5FA 5KAFO 4FZLA 4LSHA 3T0SA 3VE1A 4K3BA 1GFMA 4C4VB 4C00A 4N58A 1ZHYA 4FRXA 4AYNA 4D5UA 5H2FO 2F1TA 1P4TA 5B5EO 4FZMA 1YS5A 1IZNB 3PQUA 1MM4A 2YNKA 2N2MA 4O3ZA 2MNHA 3AA6A 3LK42 1H6S1 5DL8A 3HOLA 4KRAA 3C5OA 4K3CA 4FOZA 3BRYA 1THQA 2JMMA 2M06A 2XG6A 5PRNA 5ADXK 3UAQA 3BS0A 3AA1B 4AKRB 2Y0KA 2J1NA 4AUIA 3AA6B 3DA3A 3VE2A 3PRNA 5DL7A 2R89A 2Y7SA 4AFKA 2ODJA 4G75A 2JQYA 4XNLA 1E54A 1GFPA 1HXTA 4PJ0O 4BUMX 4UB6O 1Q9GA 3AA0B 3QRAA 5B66O 4O49A 2LFUA 4RLCA 5JDPA 1BH3A 5ADXL 3DZMA 4O3WA 5KAIO 4AZLA 4RJWA 3AA7A 3QRCA 6PRNA 2X27X 4FT6A 2R4LA 3WU2O 2PRNA 4U9CA 3TZGA 2XE1A 2WVPA 4LSFA
chains in the Genus database with same CATH topology
4G76A 2ZFGA 3VY9X 8PRNA 2KXPA 2PORA 4JFBA 2XTQA 3AAAA 3HW9A 3SZDA 5D5DA 1MPFA 4FRTA 4D64A 2K4TA 3VZUX 2F1VA 2XE2A 2M07A 2KXPB 1G90A 3T24A 3WI5A 3LK41 2YPVA 3EMNX 2FGQX 3LK2A 3NSGA 3SY9A 4JCHA 4C69X 4E1SA 1Q9FA 1ZHTA 3SYBA 2N2LA 2Y2XA 4RL9A 3UU2A 3AAEA 1HXUA 3VZTX 5FVNA 2K0LA 3HOEA 3PQSA 5DL6A 4RLBA 4AYMC 1PHOA 1HXXA 3POXA 4GF4A 5GV0A 3T20A 4LSIA 4FSOA 2ZLDA 2FGRA 1MM5A 4FUVA 4GCPA 2KZ7A 1QJ8A 5G26A 1OPFA 2O4VA 3POQA 1GFOA 4FSPA 3AA7B 3HWBA 4AYID 1ZHWA 2Y0HA 2GE4A 1QJ9A 3O0EA 3K19A 4FESA 4AKMA 3V8UA 4B61A 4Z3TA 1IZNA 3JTYA 3G7GA 1ORMA 4LSEA 2Y0LA 3DA4A 2W80C 3AAAB 2W81C 2OMFA 4XNKA 1BXWA 2XMXA 3SYSA 3UPGA 2XTRA 3POUA 4FZNA 3SZVA 3A2SX 3PORA 4FMSA 4GCQA 3AA1A 4GCSA 4N59A 5DL5A 4AKRA 5AFUK 7PRNA 4RJXA 3LK3A 3KVDD 2XE5A 3RBHA 4E1TA 4KR8A 1PRNA 3FYXA 3LK2B 1GFNA 1QJPA 5EE2A 1ZHZA 2QTKA 3AA0A 3GP6A 4F4BA 4AYDC 3AAEB 3WI4A 2MHLA 4KR4A 4O4XA 4GHBA 3LK3B 4QQ1A 1GFQA 2J4UP 2KDYA 2KC0A 3SY7A 2XE3A 1OSMA 5AFUL 4AYEC 1ZHXA 1BT9A 2LHFA 4PUXA 4D65A 4O3YA 4O3XB 3VY8X 3VZWX 5IYUA 2ERVA 2KZ7B 4O4UA 3VE1A 5T5FA 3T0SA 4FZLA 4LSHA 1GFMA 4N58A 1ZHYA 4FRXA 4AYNA 4D5UA 2F1TA 1P4TA 4FZMA 1YS5A 1IZNB 3PQUA 1MM4A 2YNKA 2N2MA 4O3ZA 2MNHA 3AA6A 3LK42 1H6S1 5DL8A 3HOLA 4KRAA 3C5OA 4FOZA 1THQA 2JMMA 2M06A 2XG6A 5PRNA 5ADXK 3UAQA 3AA1B 4AKRB 2Y0KA 2J1NA 4AUIA 3AA6B 3DA3A 3VE2A 3PRNA 5DL7A 2Y7SA 4AFKA 2ODJA 4G75A 4XNLA 1E54A 1GFPA 1HXTA 4BUMX 1Q9GA 3AA0B 3QRAA 4O49A 2LFUA 4RLCA 5JDPA 1BH3A 5ADXL 4O3WA 4AZLA 4RJWA 3AA7A 3QRCA 6PRNA 2X27X 4FT6A 2PRNA 4U9CA 3TZGA 2XE1A 4LSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3Z A;  3HOL A;  5EE2 A;  4U9C A;  4AYD C;  3UAQ A;  4AYI D;  4O4X A;  4QQ1 A;  2KDY A;  2KC0 A;  3V8U A;  4Z3T A;  3VE2 A;  4AYE C;  2Y7S A;  4O3Y A;  4O3X B;  2YPV A;  2W80 C;  4O4U A;  3VE1 A;  2W81 C;  5T5F A;  4O49 A;  2LFU A;  4O3W A;  4AYN A;  3HOE A;  3PQS A;  1YS5 A;  4AYM C;  3PQU A;  3KVD D; 
#chains in the Genus database with same CATH topology
 4G76 A;  4IL6 O;  2ZFG A;  3VY9 X;  8PRN A;  2KXP A;  1T16 A;  2POR A;  2XTQ A;  4JFB A;  3AAA A;  3HW9 A;  3SZD A;  3PGU A;  1MPF A;  5D5D A;  4CTD A;  1T1L A;  2AXT O;  4FRT A;  4D64 A;  1S5L O;  5TIS O;  2R88 A;  2IWV A;  2K4T A;  3VZU X;  2F1V A;  2XE2 A;  2M07 A;  2KXP B;  1G90 A;  5E79 O;  3T24 A;  3WI5 A;  3LK4 1;  2YPV A;  3EMN X;  2FGQ X;  3LK2 A;  3NSG A;  3SY9 A;  4JCH A;  4C69 X;  4PR7 A;  4E1S A;  1Q9F A;  1ZHT A;  3SYB A;  2N2L A;  2Y2X A;  4RL9 A;  3UU2 A;  3AAE A;  1HXU A;  3VZT X;  5FVN A;  2K0L A;  3HOE A;  3PQS A;  5DL6 A;  4RLB A;  4AYM C;  1PHO A;  1HXX A;  3NJT A;  3POX A;  4GF4 A;  5G38 A;  2R4O A;  2R4N A;  4LSI A;  5GV0 A;  3PGS A;  2X9K A;  2ZLD A;  2FGR A;  4FSO A;  1MM5 A;  4FUV A;  4GCP A;  2KZ7 A;  1QJ8 A;  2R8A A;  5G26 A;  1OPF A;  2O4V A;  3POQ A;  1GFO A;  4FSP A;  4C4V A;  5GTH O;  3AA7 B;  3HWB A;  4AYI D;  1ZHW A;  2Y0H A;  2GE4 A;  1QJ9 A;  3O0E A;  3K19 A;  4FES A;  4AKM A;  3V8U A;  4B61 A;  4Z3T A;  2IWW A;  1IZN A;  2F1C X;  3G7G A;  3JTY A;  4FQE A;  3BRZ A;  5G39 A;  1ORM A;  4LSE A;  2Y0L A;  2WJQ A;  2W80 C;  3AAA B;  3DA4 A;  2W81 C;  2OMF A;  4XNK A;  3A0B O;  1BXW A;  2XMX A;  3SYS A;  3UPG A;  2XTR A;  3POU A;  4FZN A;  3SZV A;  3A2S X;  3POR A;  4FMS A;  4GCQ A;  3AA1 A;  3DWN A;  4GCS A;  4N59 A;  4N74 A;  5DL5 A;  5G3A A;  4AKR A;  4N75 A;  4RJX A;  3LK3 A;  3KVD D;  2XE5 A;  5AFU K;  3RBH A;  3T20 A;  4E1T A;  4KR8 A;  4UB8 O;  1PRN A;  3FYX A;  3LK2 B;  5GTI O;  1GFN A;  1QJP A;  7PRN A;  5EE2 A;  1ZHZ A;  3PGR A;  2QTK A;  3AA0 A;  3DWO X;  3GP6 A;  3JCU O;  3AAE B;  3WI4 A;  2MHL A;  4AYD C;  4KR4 A;  4F4B A;  4O4X A;  4GHB A;  3LK3 B;  4QQ1 A;  1GFQ A;  3KZI O;  2KDY A;  2J4U P;  2KC0 A;  2R4P A;  3SY7 A;  2XE3 A;  1OSM A;  5AFU L;  4AYE C;  1ZHX A;  1BT9 A;  2LHF A;  4PUX A;  4D65 A;  4O3Y A;  4O3X B;  3VY8 X;  3VZW X;  5IYU A;  3A0H O;  2ERV A;  2KZ7 B;  2WJR A;  3PF1 A;  4O4U A;  5T5F A;  5KAF O;  4FZL A;  4LSH A;  3T0S A;  3VE1 A;  4K3B A;  1GFM A;  4C4V B;  4C00 A;  4N58 A;  1ZHY A;  4FRX A;  4AYN A;  4D5U A;  5H2F O;  2F1T A;  1P4T A;  5B5E O;  4FZM A;  1YS5 A;  1IZN B;  3PQU A;  1MM4 A;  2YNK A;  2N2M A;  4O3Z A;  2MNH A;  3AA6 A;  3LK4 2;  1H6S 1;  5DL8 A;  3HOL A;  4KRA A;  3C5O A;  4K3C A;  4FOZ A;  3BRY A;  1THQ A;  2JMM A;  2M06 A;  2XG6 A;  5PRN A;  5ADX K;  3UAQ A;  3BS0 A;  3AA1 B;  4AKR B;  2Y0K A;  2J1N A;  4AUI A;  3AA6 B;  3DA3 A;  3VE2 A;  3PRN A;  5DL7 A;  2R89 A;  2Y7S A;  4AFK A;  2ODJ A;  4G75 A;  2JQY A;  4XNL A;  1E54 A;  1GFP A;  1HXT A;  4PJ0 O;  4BUM X;  4UB6 O;  1Q9G A;  3AA0 B;  3QRA A;  5B66 O;  4O49 A;  2LFU A;  4RLC A;  5JDP A;  1BH3 A;  5ADX L;  3DZM A;  4O3W A;  5KAI O;  4AZL A;  4RJW A;  3AA7 A;  3QRC A;  6PRN A;  2X27 X;  4FT6 A;  2R4L A;  3WU2 O;  2PRN A;  4U9C A;  3TZG A;  2XE1 A;  2WVP A;  4LSF A; 
#chains in the Genus database with same CATH homology
 4G76 A;  2ZFG A;  3VY9 X;  8PRN A;  2KXP A;  2POR A;  4JFB A;  2XTQ A;  3AAA A;  3HW9 A;  3SZD A;  5D5D A;  1MPF A;  4FRT A;  4D64 A;  2K4T A;  3VZU X;  2F1V A;  2XE2 A;  2M07 A;  2KXP B;  1G90 A;  3T24 A;  3WI5 A;  3LK4 1;  2YPV A;  3EMN X;  2FGQ X;  3LK2 A;  3NSG A;  3SY9 A;  4JCH A;  4C69 X;  4E1S A;  1Q9F A;  1ZHT A;  3SYB A;  2N2L A;  2Y2X A;  4RL9 A;  3UU2 A;  3AAE A;  1HXU A;  3VZT X;  5FVN A;  2K0L A;  3HOE A;  3PQS A;  5DL6 A;  4RLB A;  4AYM C;  1PHO A;  1HXX A;  3POX A;  4GF4 A;  5GV0 A;  3T20 A;  4LSI A;  4FSO A;  2ZLD A;  2FGR A;  1MM5 A;  4FUV A;  4GCP A;  2KZ7 A;  1QJ8 A;  5G26 A;  1OPF A;  2O4V A;  3POQ A;  1GFO A;  4FSP A;  3AA7 B;  3HWB A;  4AYI D;  1ZHW A;  2Y0H A;  2GE4 A;  1QJ9 A;  3O0E A;  3K19 A;  4FES A;  4AKM A;  3V8U A;  4B61 A;  4Z3T A;  1IZN A;  3JTY A;  3G7G A;  1ORM A;  4LSE A;  2Y0L A;  3DA4 A;  2W80 C;  3AAA B;  2W81 C;  2OMF A;  4XNK A;  1BXW A;  2XMX A;  3SYS A;  3UPG A;  2XTR A;  3POU A;  4FZN A;  3SZV A;  3A2S X;  3POR A;  4FMS A;  4GCQ A;  3AA1 A;  4GCS A;  4N59 A;  5DL5 A;  4AKR A;  5AFU K;  7PRN A;  4RJX A;  3LK3 A;  3KVD D;  2XE5 A;  3RBH A;  4E1T A;  4KR8 A;  1PRN A;  3FYX A;  3LK2 B;  1GFN A;  1QJP A;  5EE2 A;  1ZHZ A;  2QTK A;  3AA0 A;  3GP6 A;  4F4B A;  4AYD C;  3AAE B;  3WI4 A;  2MHL A;  4KR4 A;  4O4X A;  4GHB A;  3LK3 B;  4QQ1 A;  1GFQ A;  2J4U P;  2KDY A;  2KC0 A;  3SY7 A;  2XE3 A;  1OSM A;  5AFU L;  4AYE C;  1ZHX A;  1BT9 A;  2LHF A;  4PUX A;  4D65 A;  4O3Y A;  4O3X B;  3VY8 X;  3VZW X;  5IYU A;  2ERV A;  2KZ7 B;  4O4U A;  3VE1 A;  5T5F A;  3T0S A;  4FZL A;  4LSH A;  1GFM A;  4N58 A;  1ZHY A;  4FRX A;  4AYN A;  4D5U A;  2F1T A;  1P4T A;  4FZM A;  1YS5 A;  1IZN B;  3PQU A;  1MM4 A;  2YNK A;  2N2M A;  4O3Z A;  2MNH A;  3AA6 A;  3LK4 2;  1H6S 1;  5DL8 A;  3HOL A;  4KRA A;  3C5O A;  4FOZ A;  1THQ A;  2JMM A;  2M06 A;  2XG6 A;  5PRN A;  5ADX K;  3UAQ A;  3AA1 B;  4AKR B;  2Y0K A;  2J1N A;  4AUI A;  3AA6 B;  3DA3 A;  3VE2 A;  3PRN A;  5DL7 A;  2Y7S A;  4AFK A;  2ODJ A;  4G75 A;  4XNL A;  1E54 A;  1GFP A;  1HXT A;  4BUM X;  1Q9G A;  3AA0 B;  3QRA A;  4O49 A;  2LFU A;  4RLC A;  5JDP A;  1BH3 A;  5ADX L;  4O3W A;  4AZL A;  4RJW A;  3AA7 A;  3QRC A;  6PRN A;  2X27 X;  4FT6 A;  2PRN A;  4U9C A;  3TZG A;  2XE1 A;  4LSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...